1A7DA

Chloromet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
b'GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWLVNHIKGTDFKYKGKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYOHEMERYTHRIN
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
molecule tags Oxygen transport
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7dA00
4XPYA 1A7DA 4XQ1A 2AWYA 2HMQA 4XPWA 2AWCA 1HMOA 2MHRA 1I4ZA 3AGTA 3WHNA 1I4YA 2AVKA 3AGUA 3WAQA 2HMZA 1A7EA 1HMDA 4XPXA
chains in the Genus database with same CATH superfamily
3GM2A 2A1DD 4HEAJ 2AWYA 4MW3A 4LLCA 5E2QA 3A9CA 1YA9A 1LPEA 1EA8A 3EFOB 3I5PA 2J46A 1M57C 3IQCA 4CJOA 5IY5C 3AOUA 5DS5A 2W4BA 5L3QA 2BE5F 3PMRA 3GEEA 2GFHA 4JIOA 2YWAA 3IQ6A 2I15A 256BA 4U5BE 1K05A 1OCRC 1V55C 3LJBA 4PACA 5GPGB 2B0JA 4IJJA 2PX0A 1H6GA 2W45A 3H65A 4JCZA 2VCAA 4N06A 4DOZA 2A0UA 4CDYA 4NCQA 5KYWB 4DVZA 3ITFA 1MMAA 1TWCA 4BEMJ 4P9TA 4C7OA 1D1BA 3CAXA 3U3FA 2LFDA 3JT1A 1TQGA 3KMIA 3IEEA 3BRJA 1NZEA 4EHPA 4RBNA 2J45A 3GODA 2WVOA 3N24A 1H9TA 2EPNA 2P61A 2ZXRA 3RVYA 2Y3BA 3EG9B 2X0CA 2Q9BA 2XS8A 4XEFA 2Q3TA 4OINF 4OIPF 3DJUB 1NG1A 4KNVA 1E84A 1L7CA 3C8GB 1CPRA 3DI5A 4CS8A 4AL0A 3C63A 3C18A 4MTOA 5KYNA 1CGOA 3FDQA 4HFFB 4E7ZA 4DVYP 1S05A 5L0IA 1XZPA 3OA1A 3V5YA 5KYYB 1YYJA 3LLIA 4U5CE 3U2MA 3O55A 1ZHWA 2VCCA 1WASA 3T4RA 3EZIA 1M2VA 3RF3A 1VYKA 3SXYA 4Q4ZF 1T6QA 2Z15A 1C17M 4CJGA 1Y6DA 2H8AA 3EZHA 2QNLA 2ETSA 2Y3GA 1NLXA 1YLMA 2YEVA 3V5ZA 5DS6A 4AE4A 1LS4A 2EIMC 2EPMX 3ZWIA 4DJ9A 1JRAA 1ZHXA 1BR4A 1WOLA 3IQ5A 4NTAA 1VLSA 3B0UX 3Q6MA 3VYWA 2QUPA 3NMKA 3ZQVA 3HNLA 4JEBA 4OD5A 4BJ1A 4YL3A 1G5ZA 2NSFA 3O10A 1LE4A 3K33A 1ZU5A 5JLIA 2WZGA 5EK0A 3TOMA 3L8IA 4U9DA 4CX9A 3GEIA 3G50A 1T01A 2XRHA 3MYFA 2MYSA 3C8GD 3S0XA 3RFYA 3UR3C 3A11A 3EQLF 1QVXA 1Y4CA 4WABA 5B1BC 1OXBA 5E33A 2EPKX 5BQIA 4CS8C 2L6GA 1OW7A 4B6IA 2CNWA 4KI2A 5COFA 3T6JA 1O3UA 4LDKA 1K40A 1WATA 1WWPA 4P6IC 1JOGA 5COMA 4EKWA 2CW0F 5A69A 1SYQA 3B71A 3NMJA 3M1CB 2V3CC 4FESA 3RKOF 4JW1A 3GWLA 5T3WA 4DBQA 4KNWA 3CSKA 5AGFA 1QLEC 1U6HA 4JVSA 1QKRA 2CDQA 1MMGA 3ATPA 4K0DA 1GS9A 2YLGA 3G4ZA 4H54A 3EJNA 4M63A 3DE8A 4UDVA 3S90A 3S9OA 1ZHYA 2KGOA 5T1DB 3X2QC 3IQTA 4ONSA 3RW0A 2AP3A 2XLEA 3UMHA 4ANJA 4DBRA 4PJJA 3W4YA 3F46A 5TJ5E 2TMVP 3G4XA 3PDMP 3HJCA 3IHUA 1ZVZA 2LQGA 4XPYA 3J06A 2R7TA 2ZXOA 2KYHA 3KL4A 4ZLDA 1OXKA 4LDRA 4E17A 2KJGA 4IAOA 1Z6AA 2NPUA 2Y39A 3DMDA 3Q7LA 3TQOA 4D4XA 4DXWA 1EQ1A 1NSGB 2FGYA 1QQ3A 2L6FA 4U9EA 2Q9CA 3GANA 3T9OA 3EGDA 2D5RB 3K66A 5JS5A 1AUEA 2IXPA 1YAUO 3SXZA 3U9MA 5JVEA 4PJMA 4LACB 1LI5A 2PX3A 5CI9A 3SNHA 4YK5A 1LKXA 2R7UA 5L0CA 3ASOC 4YL0A 1Q0FA 3JTLO 1LI7A 4O7GA 2NUTB 4G78A 5K0IA 3S84A 1D0XA 4E18A 1HMDA 3ABLC 3RQGA 4YN0B 3EPVA 4DRJB 1XZQA 3JCUQ 4JZAA 2J7PA 5BQHA 4IWBA 1BR2A 3TJ6A 1TR2A 3ECSA 3M79A 2NUPA 3EFOA 1C03A 1CPQA 3FHDA 3JYYA 3UMKA 5L0DA 1TKNA 4YT4A 4JC7A 2EPLX 2G3KA 1QZXA 5F5FA 3UNGC 1ZW2A 4PFPA 2D4UA 2HSBA 3VF0A 4AX2A 2PFDA 1D1AA 3T6GB 4K1OA 2R7QA 4C3BA 2L9JA 4EBJA 3OEOA 3AQCA 4YWQA 4YT2A 1M6TA 3SXMA 1GM5A 3AG1C 3AG4C 4MVOA 3AGUA 2R7OA 4G7OF 2DYRC 2IXOA 1C02A 1A7EA 5BQGA 4JJGA 1ORYA 1ORJA 3KYIA 5KYWA 1TFKB 4WGZA 1Q0KA 3UGOA 3LS1A 2XXAA 4Z9HA 2PBEA 1OCCC 2OEXA 4CSAC 3JZ0A 3HNKA 1V74B 2W9YA 3ZG1A 3ABMC 2YHSA 4Q5SF 3L1MA 1ZHZA 5E3CA 3RYLA 1BR1A 4L6RA 4FWVA 3MLGA 1O5HA 2JX0A 1JMWA 4X0RA 3NKDA 2PF4E 1OW8A 2J7PD 3O39A 2C04A 2ZD9A 3JRMO 1S7ZA 3C8GA 3HNIA 3AJMA 4GYTA 1ORSC 4I1MA 1F1MA 2OG2A 5CI8A 1E2XA 4DRHB 1B68A 2RD9A 2UUIA 2XL8A 3DAGA 4N6CA 4O6MA 1V4AA 1G4WR 2LIGA 3C62A 3U2LA 1BBHA 4BEJA 2WZFA 5KYXA 4OIRF 2VC9A 1UG7A 3FMSA 1FMVA 3FVYA 3DM9B 4MW8A 3RIPA 2YQYA 4XPXA 2I8BA 2DB4A 5FCLA 3E70C 1RCPA 5B1AC 3ABKC 4XQ1A 3NG1A 4ULVA 3LNMB 2UUHA 3QW1A 4JRZA 1SZIA 4MQ9F 4D4NA 1FFHA 4JURI 3S28A 3GEHA 2J9UA 1VYIA 3FXHA 3HTKC 3EHNA 4XEKA 4EBBA 2X51A 3JRTA 4U5FE 1Z63A 2GA0A 5A6JA 2XL4A 5DLJA 1J8YF 3M15A 2L6HA 3HNJA 5F5HA 3QW0A 2OJQA 1Z3IX 2Y69C 1BZ4A 3LEOA 1SMYF 4J7TA 4WJ0A 4XEVA 1GQAA 3W8IA 3QVYA 3B0VC 1LS1A 2HUJA 4G7HF 5EHHA 3KKBA 1M2VB 4YJWA 5FZTA 1A0BA 5DQZA 1YVIA 1Z5ZA 4Z9JA 2WB7A 4CS7A 4CBEA 1J8MF 4U5HA 3TD7A 3I5QA 1O87A 4MVRA 4JCHA 3ZVRA 4IARA 4OD4A 3QVZA 3LNRA 1HW1A 2NSGA 2OEVA 4F4BA 4PJLA 4J32B 4K7BA 5AC4A 4JEAA 1FAPB 2LP4A 3C8ZA 3LESA 1FNTc 3TOLA 1Z23A 1OCOC 2L81A 4BJ6C 5JUAA 2YVKA 4NC3A 1M2OA 3RVZA 2DI3A 2IBFA 2IM8A 3CEXA 2XLMA 1FFTC 2R25A 1VOMA 1H7IA 4XLPF 3R7CA 3ZSUA 2G62A 4BJTA 1MNEA 1SR2A 2A6EF 1KU2A 4XLNF 3WODF 4RD9A 3QZCA 1G8XA 2R05A 2EINC 4U5DE 4EWCA 2W4MA 4AK9A 3Q7GA 3NMIA 1ST6A 2XLOA 2J9VA 3AG2C 3F47A 3DKAA 1OKKD 1VK5A 1PCXA 3SYNA 4E0HA 1NFOA 2H7OA 4QDLA 2R7XA 1OCZC 2QY9A 1D0ZA 4P9FA 1R4TA 1RJ9A 2YL3A 3H2VA 3TULA 2R02A 3K1IC 4W8PA 1Z7Qc 3RH3A 4FAPB 2HFIA 4C3EA 5A6KA 1E86A 1EKYA 1HE1A 2XSEA 2YL0A 4IRUA 2MWQA 4JE9A 4MVUA 4ULWA 5F28E 3UGPA 3N2ZB 2A6HF 2H7BA 2YLDA 2GAQA 4PJNA 2NG1A 4FX5A 2OOCA 2AWCA 2HZ8A 2OCCC 1PD0A 4AL1A 2J0WA 3SZRA 1YDIA 5KYUA 4QI0A 2PP4A 2XS1A 4C3DA 4CSAA 2M64A 4GEHA 4A4AA 1NFNA 2YL7A 4AE4B 4EIYA 2ZXWC 4E0IA 2RSEB 1Q0GA 3Q6NA 2WVNA 4BG0A 2KSFA 5D91A 4MVZA 3R2PA 1JPJA 2OKUA 4IB4A 2IOQA 2KC3A 1VB5A 3DD7A 3TJ5A 2QLAA 4BPMA 3X1OA 3L0IA 1RKCA 3EGXA 1DOVA 2PNOA 1PV3A 4CS9C 4GQHA 5BUOA 1WTYA 4CIPA 4YT8A 4YL1A 3OWTA 1CGNA 2HMQA 2M4EA 1WN0A 2L7AA 2R03A 3EGDB 3FAPB 4NTFA 3ZTZA 4OIQF 4JTCB 1TFOB 2P0NA 1AVOB 4BJ5C 2EILC 3VAYA 1LVKA 1HY5A 2KQ9A 2VASA 3H2UA 3RQFA 1LIHA 2OJED 2GDCA 2A68F 3BEHA 2EPOA 3VM6A 1YJGA 3AGTA 2YZSA 1AEPA 3M4BA 2C03A 1R5ID 3DWWA 2LK4A 4RDAA 3WHNA 1A41A 3NYLA 3W2VA 2XM0A 3KYJA 1FMWA 1RKEB 4EUKB 2YL1A 2CGEA 3MBGA 1Q0DA 3ZQYA 2WZLA 1MQVA 2BL2A 3DZAA 3EH1A 2FAPB 2IYLD 3MFNA 2KW3C 1EI7A 2LSEA 4HFKB 4MTFA 2XLVA 4DRIB 5DS4A 1IW7F 4OIOF 3KH2A 5AC5A 1OQCA 2LCHA 2XLWA 1JPNA 3GORA 1JAFA 4LLEA 3NRHA 2NUPB 1QSPA 3HLZA 1NU7D 1NU9C 4G0HA 5JSLA 1E85A 1U89A 3U9JA 5A6BA 3POVA 4CDVA 1WGWA 2IXNA 2WL8A 2MHRA 3ASNC 3EG9A 4NQFA 3U8PA 4CIHA 4I3MA 4NY3A 3B0PA 4R32A 2HV7A 1HW2A 3LAYA 2J9WA 3M4CA 4BJ6A 3QMKA 3ZIBA 2HSQA 4PK4A 4C7OB 1YZCA 3B9QA 2A0BA 1YYXA 3US6A 1K04A 2BC5A 2QE9A 3PHF2 4G7ZF 2OQMA 3SXKA 2XXAB 2XLHA 2HJMA 3LEVA 4KC9A 1Q0MA 3T6BA 1T6IA 2HMZA 5KYYA 2P1AA 1OR2A 4U5GA 3U8VA 2R7RA 3JSZA 3N0TA 4N4WA 3V7OA 2GWWA 4KBLA 3ZDLA 1CGME 2Q7RA 4QI2A 3SP1A 4N6HA 2YLIA 3EH2A 3V5XA 3S29A 1PD1A 3K1HA 1SF8A 1LE2A 3ZC4A 2ICWG 1I5NA 3AQBA 2VCBA 1ZHTA 2OU6A 2ZPAA 1N1CA 3K1IA 5KYXB 1NBBA 5L0GA 1OKKA 3CQZA 1KTMA 5A6BD 5DVWA 4JKVA 3DJNB 1H9GA 4EBKA 3FOPA 4Q7CA 4MS2A 1ZYRF 2YKZA 4XWJA 1MMDA 3DAFA 3NYMA 1D0YA 3GWNA 5E3AA 3DM5A 2JPUA 3WAQA 4MVQA 4LDQA 4MTGA 2YRFA 1A7DA 1ZZPA 4HE8D 1TWAA 3DE9A 3KPHA 2CCYA 4NTBA 3NYJA 2J9BA 1APCA 4Z9IA 2R7VA 1HE9A 3EHMA 3S27A 5JRAA 3I4UA 1JR8A 5L3VA 1T9KA 5L0FA 3RQEA 1A7VA 2WVQA 1D1CA 1IZMA 4JTDB 1U0BB 1VTMP 2HS5A 4O6YA 2Q4FA 4W8KA 4CS9A 5B3SC 4I44A 3O6XA 3L8JA 2V26A 1OW6A 1W2WA 2KNHA 1I4YA 2J8WA 2FFHA 1UFBA 2AU5A 2P7VA 4BJ5A 4ER9A 5HSWA 3E9VA 4MVMA 2F22A 4O6NA 5T3TA 1YZAA 2A69F 3TK0A 2R7SA 1ZW3A 1XWJA 3MX3A 4CDAA 1E83A 4I1OB 1TWGA 5EGYA 1VLTA 2Y3HA 5JP7A 2VB6A 2LD6A 3ZTMA 3NDBB 5D92A 1L3PA 3DXJF 3UMIA 4MNDA 5L0JA 2HJ3A 1RMVA 3C7JA 4IGGA 2R9RB 3L34A 2JD3A 3WG7C 3HKKA 2IXMA 1RXQA 1VMAA 4A2NB 5JT4A 5L0HA 3FAJA 3LLKA 3NKEA 1I4ZA 3AG3C 2XM4A 4O79A 4JTAB 5CIVA 1FTSA 2HKVA 5B3IA 3LS0A 1G4US 1T5OA 2J0XA 3K7DA 1M56C 2AVKA 1RJ9B 2XLDA 3U5SA 3W2WA 4E7SA 2Q9AA 3IPMO 1LM3B 3GM1A 2CYDA 5HV9A 1T6UA 2NUTA 1V54C 2ASRA 3JSEO 1TWHA 2H7VC 2KK1A 3B29A 1OR3A 3GM3A 3W8HA 2DGJA 1YA7O 1GGQA 1MNDA 4PR9A 4YT5A 2DYSC 5KYUB 2EIJC 4J30B 4PFOA 1BDJB 4XTKA 3CZ6A 4XPWA 2CNWD 2P6VA 3JYHA 2VH3A 4JJFA 1KNYA 1HMOA 3PCVA 3U3BA 4H4KC 2R7WA 3K6BA 2EIKC 2G3VA 2E87A 2Q00A 4ZLCA 1YARO 4MVSA 2O9XA 4J7YA 3MYIA 1FR0A 3U0CA 3EGXB 3QTHA 3VRCA 2QTVA 2XL6A 4IAQA 4LERA 2B0HA 3FOOA 2Y3DA 1RKEA 5A6AA 1DOWA 2HV6A 3SEOA 4U5EE 4WGYA 5DQTA 1MMNA 1QPUA 2LFFA 2ZXPA 1ZU4A 3LUTB 5COGA
chains in the Genus database with same CATH topology
4XPYA 1A7DA 4XQ1A 2AWYA 2HMQA 4XPWA 2AWCA 1HMOA 2MHRA 1I4ZA 3AGTA 3WHNA 1I4YA 2AVKA 3AGUA 3WAQA 2HMZA 1A7EA 1HMDA 4XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPY A;  1A7D A;  4XQ1 A;  2AWY A;  2HMQ A;  4XPW A;  2AWC A;  1HMO A;  2MHR A;  1I4Z A;  3AGT A;  3WHN A;  1I4Y A;  2AVK A;  3AGU A;  3WAQ A;  2HMZ A;  1A7E A;  1HMD A;  4XPX A; 
#chains in the Genus database with same CATH topology
 3GM2 A;  2A1D D;  4HEA J;  2AWY A;  4MW3 A;  4LLC A;  5E2Q A;  3A9C A;  1YA9 A;  1LPE A;  1EA8 A;  3EFO B;  3I5P A;  2J46 A;  1M57 C;  3IQC A;  4CJO A;  5IY5 C;  3AOU A;  5DS5 A;  2W4B A;  5L3Q A;  2BE5 F;  3PMR A;  3GEE A;  2GFH A;  4JIO A;  2YWA A;  3IQ6 A;  2I15 A;  256B A;  4U5B E;  1K05 A;  1OCR C;  1V55 C;  3LJB A;  4PAC A;  5GPG B;  2B0J A;  4IJJ A;  2PX0 A;  1H6G A;  2W45 A;  3H65 A;  4JCZ A;  2VCA A;  4N06 A;  4DOZ A;  2A0U A;  4CDY A;  4NCQ A;  5KYW B;  4DVZ A;  3ITF A;  1MMA A;  1TWC A;  4BEM J;  4P9T A;  4C7O A;  1D1B A;  3CAX A;  3U3F A;  2LFD A;  3JT1 A;  1TQG A;  3KMI A;  3IEE A;  3BRJ A;  1NZE A;  4EHP A;  4RBN A;  2J45 A;  3GOD A;  2WVO A;  3N24 A;  1H9T A;  2EPN A;  2P61 A;  2ZXR A;  3RVY A;  2Y3B A;  3EG9 B;  2X0C A;  2Q9B A;  2XS8 A;  4XEF A;  2Q3T A;  4OIN F;  4OIP F;  3DJU B;  1NG1 A;  4KNV A;  1E84 A;  1L7C A;  3C8G B;  1CPR A;  3DI5 A;  4CS8 A;  4AL0 A;  3C63 A;  3C18 A;  4MTO A;  5KYN A;  1CGO A;  3FDQ A;  4HFF B;  4E7Z A;  4DVY P;  1S05 A;  5L0I A;  1XZP A;  3OA1 A;  3V5Y A;  5KYY B;  1YYJ A;  3LLI A;  4U5C E;  3U2M A;  3O55 A;  1ZHW A;  2VCC A;  1WAS A;  3T4R A;  3EZI A;  1M2V A;  3RF3 A;  1VYK A;  3SXY A;  4Q4Z F;  1T6Q A;  2Z15 A;  1C17 M;  4CJG A;  1Y6D A;  2H8A A;  3EZH A;  2QNL A;  2ETS A;  2Y3G A;  1NLX A;  1YLM A;  2YEV A;  3V5Z A;  5DS6 A;  4AE4 A;  1LS4 A;  2EIM C;  2EPM X;  3ZWI A;  4DJ9 A;  1JRA A;  1ZHX A;  1BR4 A;  1WOL A;  3IQ5 A;  4NTA A;  1VLS A;  3B0U X;  3Q6M A;  3VYW A;  2QUP A;  3NMK A;  3ZQV A;  3HNL A;  4JEB A;  4OD5 A;  4BJ1 A;  4YL3 A;  1G5Z A;  2NSF A;  3O10 A;  1LE4 A;  3K33 A;  1ZU5 A;  5JLI A;  2WZG A;  5EK0 A;  3TOM A;  3L8I A;  4U9D A;  4CX9 A;  3GEI A;  3G50 A;  1T01 A;  2XRH A;  3MYF A;  2MYS A;  3C8G D;  3S0X A;  3RFY A;  3UR3 C;  3A11 A;  3EQL F;  1QVX A;  1Y4C A;  4WAB A;  5B1B C;  1OXB A;  5E33 A;  2EPK X;  5BQI A;  4CS8 C;  2L6G A;  1OW7 A;  4B6I A;  2CNW A;  4KI2 A;  5COF A;  3T6J A;  1O3U A;  4LDK A;  1K40 A;  1WAT A;  1WWP A;  4P6I C;  1JOG A;  5COM A;  4EKW A;  2CW0 F;  5A69 A;  1SYQ A;  3B71 A;  3NMJ A;  3M1C B;  2V3C C;  4FES A;  3RKO F;  4JW1 A;  3GWL A;  5T3W A;  4DBQ A;  4KNW A;  3CSK A;  5AGF A;  1QLE C;  1U6H A;  4JVS A;  1QKR A;  2CDQ A;  1MMG A;  3ATP A;  4K0D A;  1GS9 A;  2YLG A;  3G4Z A;  4H54 A;  3EJN A;  4M63 A;  3DE8 A;  4UDV A;  3S90 A;  3S9O A;  1ZHY A;  2KGO A;  5T1D B;  3X2Q C;  3IQT A;  4ONS A;  3RW0 A;  2AP3 A;  2XLE A;  3UMH A;  4ANJ A;  4DBR A;  4PJJ A;  3W4Y A;  3F46 A;  5TJ5 E;  2TMV P;  3G4X A;  3PDM P;  3HJC A;  3IHU A;  1ZVZ A;  2LQG A;  4XPY A;  3J06 A;  2R7T A;  2ZXO A;  2KYH A;  3KL4 A;  4ZLD A;  1OXK A;  4LDR A;  4E17 A;  2KJG A;  4IAO A;  1Z6A A;  2NPU A;  2Y39 A;  3DMD A;  3Q7L A;  3TQO A;  4D4X A;  4DXW A;  1EQ1 A;  1NSG B;  2FGY A;  1QQ3 A;  2L6F A;  4U9E A;  2Q9C A;  3GAN A;  3T9O A;  3EGD A;  2D5R B;  3K66 A;  5JS5 A;  1AUE A;  2IXP A;  1YAU O;  3SXZ A;  3U9M A;  5JVE A;  4PJM A;  4LAC B;  1LI5 A;  2PX3 A;  5CI9 A;  3SNH A;  4YK5 A;  1LKX A;  2R7U A;  5L0C A;  3ASO C;  4YL0 A;  1Q0F A;  3JTL O;  1LI7 A;  4O7G A;  2NUT B;  4G78 A;  5K0I A;  3S84 A;  1D0X A;  4E18 A;  1HMD A;  3ABL C;  3RQG A;  4YN0 B;  3EPV A;  4DRJ B;  1XZQ A;  3JCU Q;  4JZA A;  2J7P A;  5BQH A;  4IWB A;  1BR2 A;  3TJ6 A;  1TR2 A;  3ECS A;  3M79 A;  2NUP A;  3EFO A;  1C03 A;  1CPQ A;  3FHD A;  3JYY A;  3UMK A;  5L0D A;  1TKN A;  4YT4 A;  4JC7 A;  2EPL X;  2G3K A;  1QZX A;  5F5F A;  3UNG C;  1ZW2 A;  4PFP A;  2D4U A;  2HSB A;  3VF0 A;  4AX2 A;  2PFD A;  1D1A A;  3T6G B;  4K1O A;  2R7Q A;  4C3B A;  2L9J A;  4EBJ A;  3OEO A;  3AQC A;  4YWQ A;  4YT2 A;  1M6T A;  3SXM A;  1GM5 A;  3AG1 C;  3AG4 C;  4MVO A;  3AGU A;  2R7O A;  4G7O F;  2DYR C;  2IXO A;  1C02 A;  1A7E A;  5BQG A;  4JJG A;  1ORY A;  1ORJ A;  3KYI A;  5KYW A;  1TFK B;  4WGZ A;  1Q0K A;  3UGO A;  3LS1 A;  2XXA A;  4Z9H A;  2PBE A;  1OCC C;  2OEX A;  4CSA C;  3JZ0 A;  3HNK A;  1V74 B;  2W9Y A;  3ZG1 A;  3ABM C;  2YHS A;  4Q5S F;  3L1M A;  1ZHZ A;  5E3C A;  3RYL A;  1BR1 A;  4L6R A;  4FWV A;  3MLG A;  1O5H A;  2JX0 A;  1JMW A;  4X0R A;  3NKD A;  2PF4 E;  1OW8 A;  2J7P D;  3O39 A;  2C04 A;  2ZD9 A;  3JRM O;  1S7Z A;  3C8G A;  3HNI A;  3AJM A;  4GYT A;  1ORS C;  4I1M A;  1F1M A;  2OG2 A;  5CI8 A;  1E2X A;  4DRH B;  1B68 A;  2RD9 A;  2UUI A;  2XL8 A;  3DAG A;  4N6C A;  4O6M A;  1V4A A;  1G4W R;  2LIG A;  3C62 A;  3U2L A;  1BBH A;  4BEJ A;  2WZF A;  5KYX A;  4OIR F;  2VC9 A;  1UG7 A;  3FMS A;  1FMV A;  3FVY A;  3DM9 B;  4MW8 A;  3RIP A;  2YQY A;  4XPX A;  2I8B A;  2DB4 A;  5FCL A;  3E70 C;  1RCP A;  5B1A C;  3ABK C;  4XQ1 A;  3NG1 A;  4ULV A;  3LNM B;  2UUH A;  3QW1 A;  4JRZ A;  1SZI A;  4MQ9 F;  4D4N A;  1FFH A;  4JUR I;  3S28 A;  3GEH A;  2J9U A;  1VYI A;  3FXH A;  3HTK C;  3EHN A;  4XEK A;  4EBB A;  2X51 A;  3JRT A;  4U5F E;  1Z63 A;  2GA0 A;  5A6J A;  2XL4 A;  5DLJ A;  1J8Y F;  3M15 A;  2L6H A;  3HNJ A;  5F5H A;  3QW0 A;  2OJQ A;  1Z3I X;  2Y69 C;  1BZ4 A;  3LEO A;  1SMY F;  4J7T A;  4WJ0 A;  4XEV A;  1GQA A;  3W8I A;  3QVY A;  3B0V C;  1LS1 A;  2HUJ A;  4G7H F;  5EHH A;  3KKB A;  1M2V B;  4YJW A;  5FZT A;  1A0B A;  5DQZ A;  1YVI A;  1Z5Z A;  4Z9J A;  2WB7 A;  4CS7 A;  4CBE A;  1J8M F;  4U5H A;  3TD7 A;  3I5Q A;  1O87 A;  4MVR A;  4JCH A;  3ZVR A;  4IAR A;  4OD4 A;  3QVZ A;  3LNR A;  1HW1 A;  2NSG A;  2OEV A;  4F4B A;  4PJL A;  4J32 B;  4K7B A;  5AC4 A;  4JEA A;  1FAP B;  2LP4 A;  3C8Z A;  3LES A;  1FNT c;  3TOL A;  1Z23 A;  1OCO C;  2L81 A;  4BJ6 C;  5JUA A;  2YVK A;  4NC3 A;  1M2O A;  3RVZ A;  2DI3 A;  2IBF A;  2IM8 A;  3CEX A;  2XLM A;  1FFT C;  2R25 A;  1VOM A;  1H7I A;  4XLP F;  3R7C A;  3ZSU A;  2G62 A;  4BJT A;  1MNE A;  1SR2 A;  2A6E F;  1KU2 A;  4XLN F;  3WOD F;  4RD9 A;  3QZC A;  1G8X A;  2R05 A;  2EIN C;  4U5D E;  4EWC A;  2W4M A;  4AK9 A;  3Q7G A;  3NMI A;  1ST6 A;  2XLO A;  2J9V A;  3AG2 C;  3F47 A;  3DKA A;  1OKK D;  1VK5 A;  1PCX A;  3SYN A;  4E0H A;  1NFO A;  2H7O A;  4QDL A;  2R7X A;  1OCZ C;  2QY9 A;  1D0Z A;  4P9F A;  1R4T A;  1RJ9 A;  2YL3 A;  3H2V A;  3TUL A;  2R02 A;  3K1I C;  4W8P A;  1Z7Q c;  3RH3 A;  4FAP B;  2HFI A;  4C3E A;  5A6K A;  1E86 A;  1EKY A;  1HE1 A;  2XSE A;  2YL0 A;  4IRU A;  2MWQ A;  4JE9 A;  4MVU A;  4ULW A;  5F28 E;  3UGP A;  3N2Z B;  2A6H F;  2H7B A;  2YLD A;  2GAQ A;  4PJN A;  2NG1 A;  4FX5 A;  2OOC A;  2AWC A;  2HZ8 A;  2OCC C;  1PD0 A;  4AL1 A;  2J0W A;  3SZR A;  1YDI A;  5KYU A;  4QI0 A;  2PP4 A;  2XS1 A;  4C3D A;  4CSA A;  2M64 A;  4GEH A;  4A4A A;  1NFN A;  2YL7 A;  4AE4 B;  4EIY A;  2ZXW C;  4E0I A;  2RSE B;  1Q0G A;  3Q6N A;  2WVN A;  4BG0 A;  2KSF A;  5D91 A;  4MVZ A;  3R2P A;  1JPJ A;  2OKU A;  4IB4 A;  2IOQ A;  2KC3 A;  1VB5 A;  3DD7 A;  3TJ5 A;  2QLA A;  4BPM A;  3X1O A;  3L0I A;  1RKC A;  3EGX A;  1DOV A;  2PNO A;  1PV3 A;  4CS9 C;  4GQH A;  5BUO A;  1WTY A;  4CIP A;  4YT8 A;  4YL1 A;  3OWT A;  1CGN A;  2HMQ A;  2M4E A;  1WN0 A;  2L7A A;  2R03 A;  3EGD B;  3FAP B;  4NTF A;  3ZTZ A;  4OIQ F;  4JTC B;  1TFO B;  2P0N A;  1AVO B;  4BJ5 C;  2EIL C;  3VAY A;  1LVK A;  1HY5 A;  2KQ9 A;  2VAS A;  3H2U A;  3RQF A;  1LIH A;  2OJE D;  2GDC A;  2A68 F;  3BEH A;  2EPO A;  3VM6 A;  1YJG A;  3AGT A;  2YZS A;  1AEP A;  3M4B A;  2C03 A;  1R5I D;  3DWW A;  2LK4 A;  4RDA A;  3WHN A;  1A41 A;  3NYL A;  3W2V A;  2XM0 A;  3KYJ A;  1FMW A;  1RKE B;  4EUK B;  2YL1 A;  2CGE A;  3MBG A;  1Q0D A;  3ZQY A;  2WZL A;  1MQV A;  2BL2 A;  3DZA A;  3EH1 A;  2FAP B;  2IYL D;  3MFN A;  2KW3 C;  1EI7 A;  2LSE A;  4HFK B;  4MTF A;  2XLV A;  4DRI B;  5DS4 A;  1IW7 F;  4OIO F;  3KH2 A;  5AC5 A;  1OQC A;  2LCH A;  2XLW A;  1JPN A;  3GOR A;  1JAF A;  4LLE A;  3NRH A;  2NUP B;  1QSP A;  3HLZ A;  1NU7 D;  1NU9 C;  4G0H A;  5JSL A;  1E85 A;  1U89 A;  3U9J A;  5A6B A;  3POV A;  4CDV A;  1WGW A;  2IXN A;  2WL8 A;  2MHR A;  3ASN C;  3EG9 A;  4NQF A;  3U8P A;  4CIH A;  4I3M A;  4NY3 A;  3B0P A;  4R32 A;  2HV7 A;  1HW2 A;  3LAY A;  2J9W A;  3M4C A;  4BJ6 A;  3QMK A;  3ZIB A;  2HSQ A;  4PK4 A;  4C7O B;  1YZC A;  3B9Q A;  2A0B A;  1YYX A;  3US6 A;  1K04 A;  2BC5 A;  2QE9 A;  3PHF 2;  4G7Z F;  2OQM A;  3SXK A;  2XXA B;  2XLH A;  2HJM A;  3LEV A;  4KC9 A;  1Q0M A;  3T6B A;  1T6I A;  2HMZ A;  5KYY A;  2P1A A;  1OR2 A;  4U5G A;  3U8V A;  2R7R A;  3JSZ A;  3N0T A;  4N4W A;  3V7O A;  2GWW A;  4KBL A;  3ZDL A;  1CGM E;  2Q7R A;  4QI2 A;  3SP1 A;  4N6H A;  2YLI A;  3EH2 A;  3V5X A;  3S29 A;  1PD1 A;  3K1H A;  1SF8 A;  1LE2 A;  3ZC4 A;  2ICW G;  1I5N A;  3AQB A;  2VCB A;  1ZHT A;  2OU6 A;  2ZPA A;  1N1C A;  3K1I A;  5KYX B;  1NBB A;  5L0G A;  1OKK A;  3CQZ A;  1KTM A;  5A6B D;  5DVW A;  4JKV A;  3DJN B;  1H9G A;  4EBK A;  3FOP A;  4Q7C A;  4MS2 A;  1ZYR F;  2YKZ A;  4XWJ A;  1MMD A;  3DAF A;  3NYM A;  1D0Y A;  3GWN A;  5E3A A;  3DM5 A;  2JPU A;  3WAQ A;  4MVQ A;  4LDQ A;  4MTG A;  2YRF A;  1A7D A;  1ZZP A;  4HE8 D;  1TWA A;  3DE9 A;  3KPH A;  2CCY A;  4NTB A;  3NYJ A;  2J9B A;  1APC A;  4Z9I A;  2R7V A;  1HE9 A;  3EHM A;  3S27 A;  5JRA A;  3I4U A;  1JR8 A;  5L3V A;  1T9K A;  5L0F A;  3RQE A;  1A7V A;  2WVQ A;  1D1C A;  1IZM A;  4JTD B;  1U0B B;  1VTM P;  2HS5 A;  4O6Y A;  2Q4F A;  4W8K A;  4CS9 A;  5B3S C;  4I44 A;  3O6X A;  3L8J A;  2V26 A;  1OW6 A;  1W2W A;  2KNH A;  1I4Y A;  2J8W A;  2FFH A;  1UFB A;  2AU5 A;  2P7V A;  4BJ5 A;  4ER9 A;  5HSW A;  3E9V A;  4MVM A;  2F22 A;  4O6N A;  5T3T A;  1YZA A;  2A69 F;  3TK0 A;  2R7S A;  1ZW3 A;  1XWJ A;  3MX3 A;  4CDA A;  1E83 A;  4I1O B;  1TWG A;  5EGY A;  1VLT A;  2Y3H A;  5JP7 A;  2VB6 A;  2LD6 A;  3ZTM A;  3NDB B;  5D92 A;  1L3P A;  3DXJ F;  3UMI A;  4MND A;  5L0J A;  2HJ3 A;  1RMV A;  3C7J A;  4IGG A;  2R9R B;  3L34 A;  2JD3 A;  3WG7 C;  3HKK A;  2IXM A;  1RXQ A;  1VMA A;  4A2N B;  5JT4 A;  5L0H A;  3FAJ A;  3LLK A;  3NKE A;  1I4Z A;  3AG3 C;  2XM4 A;  4O79 A;  4JTA B;  5CIV A;  1FTS A;  2HKV A;  5B3I A;  3LS0 A;  1G4U S;  1T5O A;  2J0X A;  3K7D A;  1M56 C;  2AVK A;  1RJ9 B;  2XLD A;  3U5S A;  3W2W A;  4E7S A;  2Q9A A;  3IPM O;  1LM3 B;  3GM1 A;  2CYD A;  5HV9 A;  1T6U A;  2NUT A;  1V54 C;  2ASR A;  3JSE O;  1TWH A;  2H7V C;  2KK1 A;  3B29 A;  1OR3 A;  3GM3 A;  3W8H A;  2DGJ A;  1YA7 O;  1GGQ A;  1MND A;  4PR9 A;  4YT5 A;  2DYS C;  5KYU B;  2EIJ C;  4J30 B;  4PFO A;  1BDJ B;  4XTK A;  3CZ6 A;  4XPW A;  2CNW D;  2P6V A;  3JYH A;  2VH3 A;  4JJF A;  1KNY A;  1HMO A;  3PCV A;  3U3B A;  4H4K C;  2R7W A;  3K6B A;  2EIK C;  2G3V A;  2E87 A;  2Q00 A;  4ZLC A;  1YAR O;  4MVS A;  2O9X A;  4J7Y A;  3MYI A;  1FR0 A;  3U0C A;  3EGX B;  3QTH A;  3VRC A;  2QTV A;  2XL6 A;  4IAQ A;  4LER A;  2B0H A;  3FOO A;  2Y3D A;  1RKE A;  5A6A A;  1DOW A;  2HV6 A;  3SEO A;  4U5E E;  4WGY A;  5DQT A;  1MMN A;  1QPU A;  2LFF A;  2ZXP A;  1ZU4 A;  3LUT B;  5COG A; 
#chains in the Genus database with same CATH homology
 4XPY A;  1A7D A;  4XQ1 A;  2AWY A;  2HMQ A;  4XPW A;  2AWC A;  1HMO A;  2MHR A;  1I4Z A;  3AGT A;  3WHN A;  1I4Y A;  2AVK A;  3AGU A;  3WAQ A;  2HMZ A;  1A7E A;  1HMD A;  4XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...