1A7DA

Chloromet myohemerythrin from themiste zostericola
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
118
structure length
118
Chain Sequence
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDFLEKIGGLSAPVDAKNVDYCKEWLVNHIKGTDFKYKGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen transport
molecule keywords MYOHEMERYTHRIN
publication title Structures of wild-type chloromet and L103N hydroxomet Themiste zostericola myohemerythrins at 1.8 A resolution.
pubmed doi rcsb
source organism Themiste zostericola
total genus 45
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1a7dA00
1HMOA 2AWYA 3WHNA 2HMQA 4XPXA 3WAQA 2AWCA 2MHRA 2HMZA 3AGUA 1I4ZA 4XQ1A 1A7DA 4XPYA 3AGTA 1HMDA 2AVKA 4XPWA 1I4YA 1A7EA
chains in the Genus database with same CATH superfamily
1ZHXA 1CGNA 1Z5ZA 2EINC 3LNRA 3RW0A 4A2NB 4FAPB 1J8YF 1BZ4A 1CGOA 1H6GA 2JD3A 4N4WA 1T6UA 4RBNA 3U5SA 3ZTZA 4E0IA 1HW2A 2QY9A 5E2QA 5COGA 4BEJA 2HMQA 1T9KA 2VCBA 4R32A 1KU2A 3TQOA 2KYHA 1RJ9B 3EGDB 3EQLF 4MVOA 4YL3A 1LI7A 4DRJB 4MVRA 2B0JA 4Q5SF 4QI0A 5F5FA 2YLDA 3SXKA 1PD0A 3FHDA 3UGOA 1MNEA 2XXAB 4O6NA 4G7HF 2XLOA 3H2VA 3JZ0A 3KYJA 2C03A 1QSPA 3U3FA 2IBFA 4B6IA 4HFKB 4GEHA 4IARA 4K1OA 1ZU4A 5DS5A 1FMVA 3X2QC 1BBHA 4JKVA 3U9JA 1KNYA 2P7VA 1WOLA 3I5PA 1ZVZA 1TFKB 2KQ9A 3NKEA 2P1AA 1RXQA 4X0RA 2AWYA 2LD6A 5AC4A 2VH3A 3NMIA 4JTAB 2XLWA 3RFYA 4OIPF 3A9CA 4C7OA 1RJ9A 2KK1A 4HFFB 4JRZA 3V5ZA 4CS7A 4ER9A 5KYXB 1E85A 4JC7A 1H9GA 1HE9A 3AGUA 2H7VC 1G5ZA 5JP7A 3T6GB 5HV9A 5COFA 1CGME 1NBBA 2F22A 4DJ9A 2WVNA 2Y39A 2ZPAA 4KC9A 2ZXRA 1Z7Qc 4XEVA 4YT8A 1BR4A 1SF8A 2IXNA 3ZWIA 4Z9HA 1Q0FA 3ECSA 3JRTA 4OIRF 1WASA 2YQYA 1OQCA 1YAUO 1QQ3A 2L81A 2EPNA 1K40A 2EILC 4NTAA 4O6MA 3HJCA 3R7CA 4DRHB 4U5GA 5JT4A 4XEKA 2OEVA 3MYIA 3VAYA 2OCCC 2YLGA 2NSFA 1WGWA 1SR2A 1OXKA 5A6JA 3S0XA 2Q9BA 3LESA 1T6IA 1YLMA 4DXWA 2YEVA 4EBKA 2GFHA 4EBBA 5EK0A 3J06A 3EHNA 4DRIB 2R7UA 3IPMO 3L34A 5GPGB 3DKAA 2KW3C 3DJUB 2KSFA 3CAXA 1B68A 1TWCA 2W9YA 1TKNA 3SYNA 2YL3A 3B0UX 1C17M 1CPRA 2YWAA 1E2XA 3LS0A 1YVIA 4NTBA 2QE9A 2X0CA 4CDYA 2XLHA 1LS1A 1ORJA 2IOQA 2PP4A 3K1IA 4K7BA 2ZXWC 3SP1A 5L0GA 2DYRC 2HKVA 2W4MA 2QUPA 2HUJA 4LERA 4JZAA 4PR9A 3VYWA 3GODA 4YWQA 1LE4A 3GM3A 2IYLD 3IQ6A 4I1OB 3NKDA 1ZHTA 1SZIA 2IXOA 2Y3BA 2IXMA 1YDIA 2A6HF 2BL2A 4WGYA 2Y3GA 4JURI 2NG1A 2A68F 1JR8A 2YL7A 3ZC4A 4C3BA 4IJJA 4Q7CA 4KNWA 2J9BA 4MNDA 3U3BA 1XZQA 3S29A 3UMIA 2D4UA 3EPVA 5D92A 3MFNA 3NG1A 1R5ID 2EPMX 1F1MA 3Q7LA 4JCHA 4Z9IA 1Y6DA 3JSZA 2L6HA 4ONSA 2LSEA 2R7TA 3JT1A 1HY5A 3ZQVA 5BUOA 5JVEA 2GDCA 3ABKC 4PFOA 3AG2C 4AE4B 2GWWA 3FVYA 5D91A 3V5YA 3W2VA 2I8BA 5KYWB 4IWBA 1O87A 1Q0KA 3OA1A 1D1CA 256BA 3DAGA 1NU9C 2A0BA 1RKCA 5F28E 3ZQYA 1BR2A 5CI9A 3WHNA 2NUPB 1OW6A 4J7TA 4LDRA 3US6A 4DBQA 3EG9B 1V55C 2MHRA 3GANA 1Q0MA 5B1AC 1M2VB 1JMWA 1L3PA 1Q0GA 3WG7C 1FNTc 3M1CB 2CW0F 2HSQA 3B9QA 1V54C 4G7ZF 1OCZC 3M4CA 3UR3C 3ZIBA 3U2LA 3ITFA 2R7XA 4CBEA 5JRAA 3EHMA 1IZMA 2ZXPA 3IEEA 3O39A 4JEAA 3VF0A 4BJTA 4AL1A 1H9TA 1NZEA 2CNWD 4OIOF 1KTMA 2M64A 3TOLA 2KC3A 1VYIA 3JTLO 3T6JA 5CIVA 1MMNA 3JSEO 2LP4A 4F4BA 1M6TA 2A1DD 5DLJA 1LS4A 2LK4A 3CEXA 3HNJA 2J9WA 3NMJA 2V3CC 1D1AA 4PJMA 2CNWA 4BEMJ 2GA0A 3F47A 4WABA 1ZHYA 1YZCA 3CSKA 5B3SC 1VK5A 3CQZA 3FOPA 1M56C 2VB6A 3V7OA 3X1OA 2XSEA 1ZYRF 4IGGA 2W4BA 2L6FA 3ABMC 2M4EA 4MTFA 4O7GA 3LEVA 4Q4ZF 3DD7A 1TWAA 3N24A 4XEFA 2XS8A 4YT5A 5CI8A 5JUAA 4XQ1A 3GEIA 2WVOA 4J32B 5BQIA 3GORA 2I15A 3SXMA 2QLAA 2HSBA 2UUIA 1YA7O 3FOOA 1EI7A 1HE1A 2XLEA 4CDVA 4C3DA 5AC5A 1SMYF 2LIGA 4MW3A 2R7SA 3K1IC 2MWQA 2J45A 2RD9A 2EIJC 2R7QA 2KNHA 3GWLA 3EH1A 3C8GB 4JIOA 3K66A 2HS5A 5TJ5E 4PK4A 2J8WA 4MVMA 2JX0A 1FMWA 1QZXA 4N06A 1QVXA 2EPKX 4NQFA 5K0IA 3PHF2 1AUEA 2PF4E 2ASRA 4MTGA 3EGDA 3GWNA 1JPNA 1GQAA 1OCRC 1D0XA 1LPEA 2NUTB 3FAJA 1Z63A 1WTYA 4CJGA 3BEHA 4CSAC 3ATPA 5JLIA 3HTKC 2XXAA 3NYLA 2XM4A 4LDKA 4D4XA 4NY3A 3QVYA 2OKUA 1ORYA 3ASNC 4GQHA 5B1BC 1BDJB 3AQCA 3NYMA 2YKZA 2VASA 3RH3A 1E84A 2XLMA 2G3VA 1TWHA 1I4YA 3I4UA 4DVZA 4QI2A 3B29A 4LDQA 4XWJA 3A11A 4J7YA 1L7CA 3C8GA 4EKWA 1ZHZA 3K1HA 5KYNA 4MS2A 2WB7A 3TJ6A 3RVYA 3SZRA 2R7VA 1EA8A 3U2MA 1FFHA 2X51A 4JJFA 4O79A 3ZDLA 1JOGA 4BJ5A 1Z3IX 3WODF 1GS9A 1QLEC 2JPUA 2R02A 3DAFA 4IRUA 3T6BA 5FCLA 5KYXA 1Q0DA 2OEXA 4EIYA 1K04A 3GM2A 1QPUA 2IXPA 5KYYB 3E70C 4IAQA 4I3MA 2J9UA 3PMRA 4JW1A 1PD1A 4CDAA 2HJMA 1Z6AA 2WZLA 4U5EE 3RQFA 5L3QA 3DWWA 3C7JA 4MVSA 3RIPA 1WATA 4MVQA 3K7DA 1K05A 4KI2A 1ZZPA 4FX5A 2Y69C 5DQTA 1ZW3A 3M4BA 3Q7GA 5COMA 4CJOA 1R4TA 4K0DA 4BPMA 3G4ZA 4IAOA 3RF3A 4LACB 2P6VA 2E87A 4PACA 2YVKA 3AJMA 4C3EA 4EUKB 3AG4C 1YYJA 3MYFA 3TD7A 4OD5A 3DMDA 3WAQA 1ST6A 3MX3A 5KYYA 2UUHA 2R9RB 3CZ6A 4U5BE 3HNKA 1FAPB 1NU7D 1VLSA 5A6AA 3EGXB 4RDAA 4U5FE 4ULWA 4CSAA 1DOWA 2D5RB 1LI5A 4W8PA 3DE8A 3I5QA 3T4RA 3C8ZA 4E7ZA 4XPYA 2HFIA 1BR1A 1OKKA 1A0BA 2J9VA 3S84A 3QZCA 3O6XA 2OJQA 3NRHA 2G3KA 3EJNA 2EIKC 1OXBA 3IHUA 3FMSA 4PFPA 4JEBA 2KGOA 2NPUA 3C63A 3RYLA 4JTDB 3B0VC 3KYIA 4JJGA 5F5HA 4E7SA 3V5XA 1NSGB 4H54A 5DQZA 4CS9A 1AEPA 3TK0A 1IW7F 3KKBA 4LLEA 3K33A 2DB4A 4J30B 3NMKA 5JS5A 3S90A 3S28A 2OU6A 2HJ3A 2YHSA 3GEHA 2OJED 5KYUB 3B0PA 1NFNA 3EGXA 1H7IA 2FGYA 3IQ5A 1TQGA 2W45A 3C18A 3ZTMA 1D0YA 3G4XA 3T9OA 1T6QA 4E0HA 3N2ZB 3LAYA 5L0IA 1UG7A 3Q6MA 1C03A 2CDQA 3RVZA 2G62A 3EZIA 2WVQA 1UFBA 1OCOC 2EPLX 2YL1A 4XPWA 2YRFA 3H65A 3QVZA 5DS6A 4AE4A 3DXJF 1M57C 3W8IA 4W8KA 3ZVRA 4EBJA 5KYWA 2PBEA 2Q9AA 2BE5F 2R03A 3UMKA 2Z15A 1I5NA 4U5DE 4P9TA 3B71A 2CCYA 4HE8D 2NUPA 4I1MA 4JE9A 2Q9CA 5E33A 4NTFA 1C02A 3EG9A 4N6CA 4MW8A 5KYUA 4BJ5C 2HMZA 4BJ1A 4DOZA 1M2VA 1YYXA 1T5OA 1VOMA 3LLKA 3VRCA 1N1CA 2P0NA 4KBLA 2VCCA 4WGZA 5DVWA 4QDLA 2MYSA 1PV3A 1A7DA 1WN0A 1S05A 3RQEA 1Y4CA 3DI5A 1G4US 2V26A 1GM5A 4PJLA 2AU5A 3QW1A 4D4NA 4YT2A 5FZTA 2A0UA 3MLGA 4U5HA 1VMAA 3L8IA 2YZSA 3Q6NA 2PNOA 2VC9A 3ZG1A 2L7AA 2PFDA 2XL8A 1FTSA 2RSEB 4AL0A 4C7OB 4XPXA 1EQ1A 1U89A 1XZPA 2XLVA 1OW8A 3KPHA 4P9FA 4DBRA 2YL0A 1AVOB 4G0HA 2WZFA 3LS1A 4MQ9F 1JAFA 1JPJA 2P61A 1G4WR 1YA9A 4JCZA 2QNLA 3KL4A 1O3UA 2HV7A 4BG0A 1VLTA 3PCVA 3AG3C 2OQMA 1VB5A 1E83A 5L0CA 3JYHA 1M2OA 3S9OA 1LVKA 1OCCC 3C8GD 1ZHWA 4ZLDA 2R05A 2J7PD 3DE9A 3C62A 2LFDA 1LKXA 3N0TA 3HKKA 3SXYA 2XLDA 1MMGA 3L1MA 3AOUA 2OG2A 1T01A 5A6KA 4MVUA 3UNGC 3NYJA 2J7PA 4CS9C 4G78A 2ETSA 1A7VA 1ZU5A 3W8HA 4WJ0A 5AGFA 3W2WA 3DM9B 3E9VA 5HSWA 3U8VA 1DOVA 2HV6A 2AWCA 4BJ6C 2PX0A 3BRJA 4E18A 2XM0A 2XRHA 1I4ZA 2A6EF 3ASOC 5A6BD 3L8JA 5E3CA 2NUTA 3U9MA 4E17A 2WL8A 2Q7RA 4YJWA 5L3VA 1MMAA 5B3IA 2L6GA 3DZAA 4AX2A 1RCPA 1LIHA 4NC3A 4U5CE 2KJGA 1SYQA 4I44A 3M79A 5L0HA 3QTHA 5A6BA 3L0IA 4OINF 1YJGA 1FFTC 3HNIA 3ABLC 4YL1A 2C04A 4CS8C 1D1BA 3QW0A 2YLIA 3O55A 2B0HA 2FAPB 2Y3DA 4MTOA 3IQCA 1LE2A 2A69F 5T3WA 1U6HA 3G50A 3K6BA 1JRAA 1MMDA 1PCXA 5T1DB 1ZW2A 2DYSC 4JVSA 4NCQA 1MNDA 1A41A 2J0XA 1RKEB 3LEOA 4U9EA 4YL0A 4XLPF 2TMVP 2DI3A 4FWVA 4AK9A 4OD4A 4PJJA 1E86A 4JTCB 5BQGA 2HZ8A 2Q4FA 3TULA 1OKKD 3JRMO 3EH2A 2LQGA 3LJBA 4MVZA 2FFHA 1V74B 3IQTA 3LLIA 3SEOA 3NDBB 1U0BB 2VCAA 1W2WA 1TWGA 4XTKA 1G8XA 1OR3A 2CYDA 2R7WA 3AGTA 4U9DA 4P6IC 1VTMP 2AVKA 4YK5A 2CGEA 3RQGA 2NSGA 4DVYP 3OWTA 2Q3TA 4FESA 4CX9A 3PDMP 2ICWG 1GGQA 2Q00A 4YT4A 3LNMB 1A7EA 2L9JA 1Z23A 3EFOB 4ULVA 3U0CA 4M63A 4EWCA 3SNHA 1HMOA 4XLNF 1YZAA 2WZGA 3JYYA 1CPQA 1XWJA 4RD9A 3JCUQ 1EKYA 1RKEA 3H2UA 1MQVA 3POVA 4EHPA 3TOMA 5L0JA 2J46A 5T3TA 3ZSUA 3KMIA 1QKRA 1OW7A 3FDQA 2BC5A 3RKOF 4BJ6A 3R2PA 3LUTB 4PJNA 5JSLA 2LCHA 1NLXA 2AP3A 1ORSC 1V4AA 3W4YA 4G7OF 3TJ5A 3FXHA 1LM3B 2Y3HA 3KH2A 1HMDA 2R7OA 3SXZA 1VYKA 1TFOB 2OOCA 4UDVA 4H4KC 2DGJA 4CIHA 3EFOA 5L0DA 1HW1A 2J0WA 1OR2A 4N6HA 4CIPA 1RMVA 3UMHA 3HNLA 4CS8A 3HLZA 3OEOA 2O9XA 3EZHA 2ZD9A 2GAQA 3GEEA 3MBGA 5DS4A 5A69A 3VM6A 2H7BA 1NG1A 5EGYA 2R7RA 3UGPA 3M15A 3AQBA 3DJNB 1D0ZA 4LLCA 1NFOA 2R25A 2ZXOA 4A4AA 1APCA 3AG1C 1TR2A 4HEAJ 4KNVA 4ANJA 5E3AA 4ZLCA 2LFFA 2H7OA 3S27A 4OIQF 4YN0B 2XL6A 2XS1A 4L6RA 1FR0A 2QTVA 3O10A 1O5HA 2PX3A 5BQHA 3GM1A 3F46A 4IB4A 5EHHA 3FAPB 5IY5C 4Z9JA 1WWPA 1J8MF 5L0FA 4GYTA 2EIMC 1YARO 2IM8A 2XL4A 1S7ZA 4O6YA 3U8PA 2EPOA 3DM5A 3QMKA 2H8AA
chains in the Genus database with same CATH topology
1HMOA 2AWYA 3WHNA 2HMQA 4XPXA 3WAQA 2AWCA 2MHRA 2HMZA 3AGUA 1I4ZA 4XQ1A 1A7DA 4XPYA 3AGTA 1HMDA 2AVKA 4XPWA 1I4YA 1A7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HMO A;  2AWY A;  3WHN A;  2HMQ A;  4XPX A;  3WAQ A;  2AWC A;  2MHR A;  2HMZ A;  3AGU A;  1I4Z A;  4XQ1 A;  1A7D A;  4XPY A;  3AGT A;  1HMD A;  2AVK A;  4XPW A;  1I4Y A;  1A7E A; 
#chains in the Genus database with same CATH topology
 1ZHX A;  1CGN A;  1Z5Z A;  2EIN C;  3LNR A;  3RW0 A;  4A2N B;  4FAP B;  1J8Y F;  1BZ4 A;  1CGO A;  1H6G A;  2JD3 A;  4N4W A;  1T6U A;  4RBN A;  3U5S A;  3ZTZ A;  4E0I A;  1HW2 A;  2QY9 A;  5E2Q A;  5COG A;  4BEJ A;  2HMQ A;  1T9K A;  2VCB A;  4R32 A;  1KU2 A;  3TQO A;  2KYH A;  1RJ9 B;  3EGD B;  3EQL F;  4MVO A;  4YL3 A;  1LI7 A;  4DRJ B;  4MVR A;  2B0J A;  4Q5S F;  4QI0 A;  5F5F A;  2YLD A;  3SXK A;  1PD0 A;  3FHD A;  3UGO A;  1MNE A;  2XXA B;  4O6N A;  4G7H F;  2XLO A;  3H2V A;  3JZ0 A;  3KYJ A;  2C03 A;  1QSP A;  3U3F A;  2IBF A;  4B6I A;  4HFK B;  4GEH A;  4IAR A;  4K1O A;  1ZU4 A;  5DS5 A;  1FMV A;  3X2Q C;  1BBH A;  4JKV A;  3U9J A;  1KNY A;  2P7V A;  1WOL A;  3I5P A;  1ZVZ A;  1TFK B;  2KQ9 A;  3NKE A;  2P1A A;  1RXQ A;  4X0R A;  2AWY A;  2LD6 A;  5AC4 A;  2VH3 A;  3NMI A;  4JTA B;  2XLW A;  3RFY A;  4OIP F;  3A9C A;  4C7O A;  1RJ9 A;  2KK1 A;  4HFF B;  4JRZ A;  3V5Z A;  4CS7 A;  4ER9 A;  5KYX B;  1E85 A;  4JC7 A;  1H9G A;  1HE9 A;  3AGU A;  2H7V C;  1G5Z A;  5JP7 A;  3T6G B;  5HV9 A;  5COF A;  1CGM E;  1NBB A;  2F22 A;  4DJ9 A;  2WVN A;  2Y39 A;  2ZPA A;  4KC9 A;  2ZXR A;  1Z7Q c;  4XEV A;  4YT8 A;  1BR4 A;  1SF8 A;  2IXN A;  3ZWI A;  4Z9H A;  1Q0F A;  3ECS A;  3JRT A;  4OIR F;  1WAS A;  2YQY A;  1OQC A;  1YAU O;  1QQ3 A;  2L81 A;  2EPN A;  1K40 A;  2EIL C;  4NTA A;  4O6M A;  3HJC A;  3R7C A;  4DRH B;  4U5G A;  5JT4 A;  4XEK A;  2OEV A;  3MYI A;  3VAY A;  2OCC C;  2YLG A;  2NSF A;  1WGW A;  1SR2 A;  1OXK A;  5A6J A;  3S0X A;  2Q9B A;  3LES A;  1T6I A;  1YLM A;  4DXW A;  2YEV A;  4EBK A;  2GFH A;  4EBB A;  5EK0 A;  3J06 A;  3EHN A;  4DRI B;  2R7U A;  3IPM O;  3L34 A;  5GPG B;  3DKA A;  2KW3 C;  3DJU B;  2KSF A;  3CAX A;  1B68 A;  1TWC A;  2W9Y A;  1TKN A;  3SYN A;  2YL3 A;  3B0U X;  1C17 M;  1CPR A;  2YWA A;  1E2X A;  3LS0 A;  1YVI A;  4NTB A;  2QE9 A;  2X0C A;  4CDY A;  2XLH A;  1LS1 A;  1ORJ A;  2IOQ A;  2PP4 A;  3K1I A;  4K7B A;  2ZXW C;  3SP1 A;  5L0G A;  2DYR C;  2HKV A;  2W4M A;  2QUP A;  2HUJ A;  4LER A;  4JZA A;  4PR9 A;  3VYW A;  3GOD A;  4YWQ A;  1LE4 A;  3GM3 A;  2IYL D;  3IQ6 A;  4I1O B;  3NKD A;  1ZHT A;  1SZI A;  2IXO A;  2Y3B A;  2IXM A;  1YDI A;  2A6H F;  2BL2 A;  4WGY A;  2Y3G A;  4JUR I;  2NG1 A;  2A68 F;  1JR8 A;  2YL7 A;  3ZC4 A;  4C3B A;  4IJJ A;  4Q7C A;  4KNW A;  2J9B A;  4MND A;  3U3B A;  1XZQ A;  3S29 A;  3UMI A;  2D4U A;  3EPV A;  5D92 A;  3MFN A;  3NG1 A;  1R5I D;  2EPM X;  1F1M A;  3Q7L A;  4JCH A;  4Z9I A;  1Y6D A;  3JSZ A;  2L6H A;  4ONS A;  2LSE A;  2R7T A;  3JT1 A;  1HY5 A;  3ZQV A;  5BUO A;  5JVE A;  2GDC A;  3ABK C;  4PFO A;  3AG2 C;  4AE4 B;  2GWW A;  3FVY A;  5D91 A;  3V5Y A;  3W2V A;  2I8B A;  5KYW B;  4IWB A;  1O87 A;  1Q0K A;  3OA1 A;  1D1C A;  256B A;  3DAG A;  1NU9 C;  2A0B A;  1RKC A;  5F28 E;  3ZQY A;  1BR2 A;  5CI9 A;  3WHN A;  2NUP B;  1OW6 A;  4J7T A;  4LDR A;  3US6 A;  4DBQ A;  3EG9 B;  1V55 C;  2MHR A;  3GAN A;  1Q0M A;  5B1A C;  1M2V B;  1JMW A;  1L3P A;  1Q0G A;  3WG7 C;  1FNT c;  3M1C B;  2CW0 F;  2HSQ A;  3B9Q A;  1V54 C;  4G7Z F;  1OCZ C;  3M4C A;  3UR3 C;  3ZIB A;  3U2L A;  3ITF A;  2R7X A;  4CBE A;  5JRA A;  3EHM A;  1IZM A;  2ZXP A;  3IEE A;  3O39 A;  4JEA A;  3VF0 A;  4BJT A;  4AL1 A;  1H9T A;  1NZE A;  2CNW D;  4OIO F;  1KTM A;  2M64 A;  3TOL A;  2KC3 A;  1VYI A;  3JTL O;  3T6J A;  5CIV A;  1MMN A;  3JSE O;  2LP4 A;  4F4B A;  1M6T A;  2A1D D;  5DLJ A;  1LS4 A;  2LK4 A;  3CEX A;  3HNJ A;  2J9W A;  3NMJ A;  2V3C C;  1D1A A;  4PJM A;  2CNW A;  4BEM J;  2GA0 A;  3F47 A;  4WAB A;  1ZHY A;  1YZC A;  3CSK A;  5B3S C;  1VK5 A;  3CQZ A;  3FOP A;  1M56 C;  2VB6 A;  3V7O A;  3X1O A;  2XSE A;  1ZYR F;  4IGG A;  2W4B A;  2L6F A;  3ABM C;  2M4E A;  4MTF A;  4O7G A;  3LEV A;  4Q4Z F;  3DD7 A;  1TWA A;  3N24 A;  4XEF A;  2XS8 A;  4YT5 A;  5CI8 A;  5JUA A;  4XQ1 A;  3GEI A;  2WVO A;  4J32 B;  5BQI A;  3GOR A;  2I15 A;  3SXM A;  2QLA A;  2HSB A;  2UUI A;  1YA7 O;  3FOO A;  1EI7 A;  1HE1 A;  2XLE A;  4CDV A;  4C3D A;  5AC5 A;  1SMY F;  2LIG A;  4MW3 A;  2R7S A;  3K1I C;  2MWQ A;  2J45 A;  2RD9 A;  2EIJ C;  2R7Q A;  2KNH A;  3GWL A;  3EH1 A;  3C8G B;  4JIO A;  3K66 A;  2HS5 A;  5TJ5 E;  4PK4 A;  2J8W A;  4MVM A;  2JX0 A;  1FMW A;  1QZX A;  4N06 A;  1QVX A;  2EPK X;  4NQF A;  5K0I A;  3PHF 2;  1AUE A;  2PF4 E;  2ASR A;  4MTG A;  3EGD A;  3GWN A;  1JPN A;  1GQA A;  1OCR C;  1D0X A;  1LPE A;  2NUT B;  3FAJ A;  1Z63 A;  1WTY A;  4CJG A;  3BEH A;  4CSA C;  3ATP A;  5JLI A;  3HTK C;  2XXA A;  3NYL A;  2XM4 A;  4LDK A;  4D4X A;  4NY3 A;  3QVY A;  2OKU A;  1ORY A;  3ASN C;  4GQH A;  5B1B C;  1BDJ B;  3AQC A;  3NYM A;  2YKZ A;  2VAS A;  3RH3 A;  1E84 A;  2XLM A;  2G3V A;  1TWH A;  1I4Y A;  3I4U A;  4DVZ A;  4QI2 A;  3B29 A;  4LDQ A;  4XWJ A;  3A11 A;  4J7Y A;  1L7C A;  3C8G A;  4EKW A;  1ZHZ A;  3K1H A;  5KYN A;  4MS2 A;  2WB7 A;  3TJ6 A;  3RVY A;  3SZR A;  2R7V A;  1EA8 A;  3U2M A;  1FFH A;  2X51 A;  4JJF A;  4O79 A;  3ZDL A;  1JOG A;  4BJ5 A;  1Z3I X;  3WOD F;  1GS9 A;  1QLE C;  2JPU A;  2R02 A;  3DAF A;  4IRU A;  3T6B A;  5FCL A;  5KYX A;  1Q0D A;  2OEX A;  4EIY A;  1K04 A;  3GM2 A;  1QPU A;  2IXP A;  5KYY B;  3E70 C;  4IAQ A;  4I3M A;  2J9U A;  3PMR A;  4JW1 A;  1PD1 A;  4CDA A;  2HJM A;  1Z6A A;  2WZL A;  4U5E E;  3RQF A;  5L3Q A;  3DWW A;  3C7J A;  4MVS A;  3RIP A;  1WAT A;  4MVQ A;  3K7D A;  1K05 A;  4KI2 A;  1ZZP A;  4FX5 A;  2Y69 C;  5DQT A;  1ZW3 A;  3M4B A;  3Q7G A;  5COM A;  4CJO A;  1R4T A;  4K0D A;  4BPM A;  3G4Z A;  4IAO A;  3RF3 A;  4LAC B;  2P6V A;  2E87 A;  4PAC A;  2YVK A;  3AJM A;  4C3E A;  4EUK B;  3AG4 C;  1YYJ A;  3MYF A;  3TD7 A;  4OD5 A;  3DMD A;  3WAQ A;  1ST6 A;  3MX3 A;  5KYY A;  2UUH A;  2R9R B;  3CZ6 A;  4U5B E;  3HNK A;  1FAP B;  1NU7 D;  1VLS A;  5A6A A;  3EGX B;  4RDA A;  4U5F E;  4ULW A;  4CSA A;  1DOW A;  2D5R B;  1LI5 A;  4W8P A;  3DE8 A;  3I5Q A;  3T4R A;  3C8Z A;  4E7Z A;  4XPY A;  2HFI A;  1BR1 A;  1OKK A;  1A0B A;  2J9V A;  3S84 A;  3QZC A;  3O6X A;  2OJQ A;  3NRH A;  2G3K A;  3EJN A;  2EIK C;  1OXB A;  3IHU A;  3FMS A;  4PFP A;  4JEB A;  2KGO A;  2NPU A;  3C63 A;  3RYL A;  4JTD B;  3B0V C;  3KYI A;  4JJG A;  5F5H A;  4E7S A;  3V5X A;  1NSG B;  4H54 A;  5DQZ A;  4CS9 A;  1AEP A;  3TK0 A;  1IW7 F;  3KKB A;  4LLE A;  3K33 A;  2DB4 A;  4J30 B;  3NMK A;  5JS5 A;  3S90 A;  3S28 A;  2OU6 A;  2HJ3 A;  2YHS A;  3GEH A;  2OJE D;  5KYU B;  3B0P A;  1NFN A;  3EGX A;  1H7I A;  2FGY A;  3IQ5 A;  1TQG A;  2W45 A;  3C18 A;  3ZTM A;  1D0Y A;  3G4X A;  3T9O A;  1T6Q A;  4E0H A;  3N2Z B;  3LAY A;  5L0I A;  1UG7 A;  3Q6M A;  1C03 A;  2CDQ A;  3RVZ A;  2G62 A;  3EZI A;  2WVQ A;  1UFB A;  1OCO C;  2EPL X;  2YL1 A;  4XPW A;  2YRF A;  3H65 A;  3QVZ A;  5DS6 A;  4AE4 A;  3DXJ F;  1M57 C;  3W8I A;  4W8K A;  3ZVR A;  4EBJ A;  5KYW A;  2PBE A;  2Q9A A;  2BE5 F;  2R03 A;  3UMK A;  2Z15 A;  1I5N A;  4U5D E;  4P9T A;  3B71 A;  2CCY A;  4HE8 D;  2NUP A;  4I1M A;  4JE9 A;  2Q9C A;  5E33 A;  4NTF A;  1C02 A;  3EG9 A;  4N6C A;  4MW8 A;  5KYU A;  4BJ5 C;  2HMZ A;  4BJ1 A;  4DOZ A;  1M2V A;  1YYX A;  1T5O A;  1VOM A;  3LLK A;  3VRC A;  1N1C A;  2P0N A;  4KBL A;  2VCC A;  4WGZ A;  5DVW A;  4QDL A;  2MYS A;  1PV3 A;  1A7D A;  1WN0 A;  1S05 A;  3RQE A;  1Y4C A;  3DI5 A;  1G4U S;  2V26 A;  1GM5 A;  4PJL A;  2AU5 A;  3QW1 A;  4D4N A;  4YT2 A;  5FZT A;  2A0U A;  3MLG A;  4U5H A;  1VMA A;  3L8I A;  2YZS A;  3Q6N A;  2PNO A;  2VC9 A;  3ZG1 A;  2L7A A;  2PFD A;  2XL8 A;  1FTS A;  2RSE B;  4AL0 A;  4C7O B;  4XPX A;  1EQ1 A;  1U89 A;  1XZP A;  2XLV A;  1OW8 A;  3KPH A;  4P9F A;  4DBR A;  2YL0 A;  1AVO B;  4G0H A;  2WZF A;  3LS1 A;  4MQ9 F;  1JAF A;  1JPJ A;  2P61 A;  1G4W R;  1YA9 A;  4JCZ A;  2QNL A;  3KL4 A;  1O3U A;  2HV7 A;  4BG0 A;  1VLT A;  3PCV A;  3AG3 C;  2OQM A;  1VB5 A;  1E83 A;  5L0C A;  3JYH A;  1M2O A;  3S9O A;  1LVK A;  1OCC C;  3C8G D;  1ZHW A;  4ZLD A;  2R05 A;  2J7P D;  3DE9 A;  3C62 A;  2LFD A;  1LKX A;  3N0T A;  3HKK A;  3SXY A;  2XLD A;  1MMG A;  3L1M A;  3AOU A;  2OG2 A;  1T01 A;  5A6K A;  4MVU A;  3UNG C;  3NYJ A;  2J7P A;  4CS9 C;  4G78 A;  2ETS A;  1A7V A;  1ZU5 A;  3W8H A;  4WJ0 A;  5AGF A;  3W2W A;  3DM9 B;  3E9V A;  5HSW A;  3U8V A;  1DOV A;  2HV6 A;  2AWC A;  4BJ6 C;  2PX0 A;  3BRJ A;  4E18 A;  2XM0 A;  2XRH A;  1I4Z A;  2A6E F;  3ASO C;  5A6B D;  3L8J A;  5E3C A;  2NUT A;  3U9M A;  4E17 A;  2WL8 A;  2Q7R A;  4YJW A;  5L3V A;  1MMA A;  5B3I A;  2L6G A;  3DZA A;  4AX2 A;  1RCP A;  1LIH A;  4NC3 A;  4U5C E;  2KJG A;  1SYQ A;  4I44 A;  3M79 A;  5L0H A;  3QTH A;  5A6B A;  3L0I A;  4OIN F;  1YJG A;  1FFT C;  3HNI A;  3ABL C;  4YL1 A;  2C04 A;  4CS8 C;  1D1B A;  3QW0 A;  2YLI A;  3O55 A;  2B0H A;  2FAP B;  2Y3D A;  4MTO A;  3IQC A;  1LE2 A;  2A69 F;  5T3W A;  1U6H A;  3G50 A;  3K6B A;  1JRA A;  1MMD A;  1PCX A;  5T1D B;  1ZW2 A;  2DYS C;  4JVS A;  4NCQ A;  1MND A;  1A41 A;  2J0X A;  1RKE B;  3LEO A;  4U9E A;  4YL0 A;  4XLP F;  2TMV P;  2DI3 A;  4FWV A;  4AK9 A;  4OD4 A;  4PJJ A;  1E86 A;  4JTC B;  5BQG A;  2HZ8 A;  2Q4F A;  3TUL A;  1OKK D;  3JRM O;  3EH2 A;  2LQG A;  3LJB A;  4MVZ A;  2FFH A;  1V74 B;  3IQT A;  3LLI A;  3SEO A;  3NDB B;  1U0B B;  2VCA A;  1W2W A;  1TWG A;  4XTK A;  1G8X A;  1OR3 A;  2CYD A;  2R7W A;  3AGT A;  4U9D A;  4P6I C;  1VTM P;  2AVK A;  4YK5 A;  2CGE A;  3RQG A;  2NSG A;  4DVY P;  3OWT A;  2Q3T A;  4FES A;  4CX9 A;  3PDM P;  2ICW G;  1GGQ A;  2Q00 A;  4YT4 A;  3LNM B;  1A7E A;  2L9J A;  1Z23 A;  3EFO B;  4ULV A;  3U0C A;  4M63 A;  4EWC A;  3SNH A;  1HMO A;  4XLN F;  1YZA A;  2WZG A;  3JYY A;  1CPQ A;  1XWJ A;  4RD9 A;  3JCU Q;  1EKY A;  1RKE A;  3H2U A;  1MQV A;  3POV A;  4EHP A;  3TOM A;  5L0J A;  2J46 A;  5T3T A;  3ZSU A;  3KMI A;  1QKR A;  1OW7 A;  3FDQ A;  2BC5 A;  3RKO F;  4BJ6 A;  3R2P A;  3LUT B;  4PJN A;  5JSL A;  2LCH A;  1NLX A;  2AP3 A;  1ORS C;  1V4A A;  3W4Y A;  4G7O F;  3TJ5 A;  3FXH A;  1LM3 B;  2Y3H A;  3KH2 A;  1HMD A;  2R7O A;  3SXZ A;  1VYK A;  1TFO B;  2OOC A;  4UDV A;  4H4K C;  2DGJ A;  4CIH A;  3EFO A;  5L0D A;  1HW1 A;  2J0W A;  1OR2 A;  4N6H A;  4CIP A;  1RMV A;  3UMH A;  3HNL A;  4CS8 A;  3HLZ A;  3OEO A;  2O9X A;  3EZH A;  2ZD9 A;  2GAQ A;  3GEE A;  3MBG A;  5DS4 A;  5A69 A;  3VM6 A;  2H7B A;  1NG1 A;  5EGY A;  2R7R A;  3UGP A;  3M15 A;  3AQB A;  3DJN B;  1D0Z A;  4LLC A;  1NFO A;  2R25 A;  2ZXO A;  4A4A A;  1APC A;  3AG1 C;  1TR2 A;  4HEA J;  4KNV A;  4ANJ A;  5E3A A;  4ZLC A;  2LFF A;  2H7O A;  3S27 A;  4OIQ F;  4YN0 B;  2XL6 A;  2XS1 A;  4L6R A;  1FR0 A;  2QTV A;  3O10 A;  1O5H A;  2PX3 A;  5BQH A;  3GM1 A;  3F46 A;  4IB4 A;  5EHH A;  3FAP B;  5IY5 C;  4Z9J A;  1WWP A;  1J8M F;  5L0F A;  4GYT A;  2EIM C;  1YAR O;  2IM8 A;  2XL4 A;  1S7Z A;  4O6Y A;  3U8P A;  2EPO A;  3DM5 A;  3QMK A;  2H8A A; 
#chains in the Genus database with same CATH homology
 1HMO A;  2AWY A;  3WHN A;  2HMQ A;  4XPX A;  3WAQ A;  2AWC A;  2MHR A;  2HMZ A;  3AGU A;  1I4Z A;  4XQ1 A;  1A7D A;  4XPY A;  3AGT A;  1HMD A;  2AVK A;  4XPW A;  1I4Y A;  1A7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...