5COMA

Crystal structure of uncharacterized protein q187f5 from clostridium difficile 630
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
171
structure length
171
Chain Sequence
RVYENKEELKSEINKTFEKYIAEFDNIPESLKDKRIDEVDRTPAENLAYQVGWTTLVLKWEEDERNGLQVKTPSDEFKWNQLGELYQWFTDTYAYLSLQELKSKLNENINSIYVMIDSLSDEELFKPHMRKWADDATKTAVWEVYKFIHVNTVAPFKTFRNKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative conjugative transposon protein Tn1549-like, CTn5-Or
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Peptoclostridium difficile 630
molecule tags Unknown function
total genus 74
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5comA00
1RXQA 2OQMA 2RD9A 5CIVA 5COFA 3GORA 2NSFA 2OU6A 2HKVA 3QTHA 2F22A 3CEXA 4N6CA 5COMA 5COGA 2P1AA 3DKAA 2QNLA 3DI5A 2NSGA 2QE9A 2YQYA
chains in the Genus database with same CATH superfamily
2L7AA 2L6HA 2GAQA 5A6KA 4MTGA 3ZDLA 4AK9A 2OEXA 1H7IA 3IQTA 2YRFA 4EWCA 1Z3IX 4BPMA 4ULWA 1YJGA 2LD6A 1E84A 1O5HA 1M2VB 3EGDA 3WHNA 2HJ3A 2J9VA 3ECSA 1ST6A 2OU6A 5KYXB 4DRIB 3GWLA 1VYKA 3B0UX 4CDVA 1S7ZA 4HFFB 3TJ5A 2B0JA 2KGOA 2H7OA 1L7CA 3K6BA 4ULVA 1YZAA 2IXOA 1D0ZA 2NPUA 1TR2A 2WZGA 2PF4E 4O7GA 3S27A 3TOLA 1QSPA 3G50A 4DVYP 4U5FE 1NFOA 3CZ6A 1Y6DA 1G8XA 3IEEA 1GGQA 1G4WR 2IOQA 2KNHA 3RQGA 3NYLA 4AE4A 1OXKA 2DYSC 1RKEB 2WB7A 2YL0A 3DJNB 3TOMA 3U9MA 3W2WA 5T1DB 4CIHA 2JPUA 4ONSA 1VK5A 3RFYA 3VF0A 2JX0A 4BJ6A 5KYXA 1HW2A 4N4WA 2LFDA 2OKUA 2PBEA 1SMYF 1YLMA 4MW8A 4QDLA 4U9DA 4D4NA 4PK4A 3E70C 1F1MA 3C8ZA 2R9RB 3C63A 1NLXA 4I44A 2XLMA 4BG0A 1ORYA 3AGTA 2M4EA 2BE5F 1QVXA 4Z9HA 2WVQA 1CGOA 3ASOC 2A1DD 1NU9C 1Z5ZA 2A68F 4Q4ZF 3M4CA 1LM3B 1RCPA 2OG2A 3ABLC 1VYIA 3MLGA 2XLEA 3NKDA 3SZRA 2YEVA 2C04A 3FDQA 3DJUB 3AGUA 5B3IA 1IZMA 1YAUO 3DI5A 3DAFA 1LE4A 3V5ZA 1JAFA 1XZQA 2AWCA 2XS1A 2G3KA 2J0XA 4G78A 5T3TA 3RYLA 4NCQA 4O6YA 2R7XA 1PD0A 3VRCA 4LDRA 4CJOA 2VCCA 3KKBA 4H54A 3EZIA 4O6NA 2Z15A 1RXQA 4IGGA 2IM8A 4MNDA 2UUIA 2YWAA 4QI0A 4N06A 2IXPA 1KU2A 5EK0A 4BJ1A 1V74B 2G62A 2WZFA 4BJ5C 4OIRF 1ZW3A 1CPQA 1OXBA 1H9TA 1JOGA 5KYWB 4X0RA 4XPYA 5AGFA 4CBEA 4NTFA 2Y3GA 2ZXRA 4AX2A 2WVNA 3AQBA 5COMA 3EFOA 3FMSA 3SXKA 1HMOA 4EBJA 1E86A 1VLSA 2P1AA 4NC3A 4NY3A 4Q7CA 3GODA 4DJ9A 2R7RA 1TWHA 3GEHA 3Q7LA 5L0GA 1ZHTA 3GEIA 2YQYA 4JVSA 3RQEA 5F5HA 3S84A 3QW1A 1A7VA 1ZU4A 3LUTB 4BJ6C 3QMKA 4IWBA 4XEVA 3X2QC 2XLDA 1RJ9B 2VASA 3MYFA 4E7SA 4C3DA 2KJGA 2CNWA 3AJMA 1ZU5A 2WVOA 3LESA 3F46A 4XWJA 2W4BA 3ZQYA 5F28E 4EBBA 3JTLO 4NTBA 2UUHA 5BUOA 2Y3HA 1C02A 2PNOA 5A69A 3IQCA 2XXAB 3IPMO 1EKYA 4AL0A 2A69F 2LP4A 1YA9A 2X0CA 5A6AA 1Z23A 2F22A 2J46A 3FHDA 3HTKC 2EPLX 1LKXA 2R7OA 4FX5A 3U8PA 2MHRA 4MTOA 1UFBA 3SXZA 1JPNA 3V5YA 1VOMA 4U5EE 5COGA 2Q9BA 4MVMA 2OJED 2Y3BA 2R7QA 2A6EF 5A6BD 2OEVA 4F4BA 4PJMA 2HMZA 1OCCC 1Z7Qc 1D1AA 1OW6A 1BR2A 1H6GA 3ZWIA 1SYQA 1V55C 1WATA 1OQCA 4HFKB 4EBKA 4BJTA 4E7ZA 2XXAA 2PX0A 3Q7GA 4M63A 4U5DE 1LE2A 3ZSUA 4B6IA 2IYLD 2W45A 5E2QA 3V7OA 2HMQA 1BDJB 1MMGA 2P6VA 3JT1A 3K1HA 5KYNA 3LAYA 1G4US 2HS5A 2XSEA 4AL1A 4CSAC 2HZ8A 2CYDA 2R7UA 1R4TA 1YARO 3GM2A 3T6BA 3EGDB 3RQFA 1FAPB 1YA7O 1W2WA 4I1OB 1OCZC 2CDQA 3N2ZB 4C7OA 4MVSA 4Z9JA 3LS0A 2Q00A 4LDKA 2HSBA 4R32A 4W8PA 3VM6A 5K0IA 3LLKA 2JD3A 4K1OA 3AOUA 3C18A 3RH3A 5DLJA 1BZ4A 3L0IA 1MNDA 3KPHA 2OJQA 1LI5A 2Q4FA 3EPVA 1WGWA 3TQOA 1WWPA 3A9CA 3W2VA 3L34A 4YT4A 4YL0A 3VYWA 2HJMA 4LDQA 3ZVRA 1V54C 3EJNA 4HE8D 4J7TA 1B68A 4XPXA 5DVWA 4AE4B 5L0FA 1D0YA 1OW8A 2YL7A 2KW3C 2IXNA 4JEAA 5DQZA 1OCRC 5A6JA 4EHPA 3PHF2 4NTAA 4DXWA 2J9WA 4JJFA 3U0CA 1NU7D 4IAQA 3G4XA 5DS5A 1K05A 2HKVA 1SZIA 2AVKA 1YYXA 2FFHA 3HNIA 1YZCA 3O39A 4XTKA 4G7OF 3ZG1A 3FXHA 2DYRC 1HMDA 4OD5A 2V26A 4UDVA 1U89A 4K0DA 5B1BC 3O6XA 3HNLA 5L0JA 4JE9A 2R02A 1EI7A 1Q0DA 2XLOA 1NG1A 3KYJA 1I4ZA 1HW1A 1XWJA 2D5RB 3WODF 3RF3A 2P7VA 1BBHA 2LCHA 3FVYA 3PCVA 3ATPA 2A0UA 2Q3TA 2RD9A 3T9OA 4YL1A 1ORJA 2KK1A 4O79A 5EGYA 2W4MA 4OD4A 3C62A 4JW1A 5COFA 1OCOC 3EHMA 1NZEA 3K1IA 1ZHZA 5JVEA 1WN0A 3EGXA 4JURI 2IBFA 4PFOA 3PMRA 3HNKA 2W9YA 3SNHA 2AWYA 3ZQVA 2QLAA 3GM3A 3VAYA 3UGOA 1JRAA 1LS4A 2BL2A 1Q0GA 1T01A 3MBGA 3IQ6A 2NUTA 3NYMA 4D4XA 1TWAA 2NSGA 3NRHA 4JIOA 4EIYA 4RDAA 1FR0A 2DB4A 2YLGA 1VB5A 3EFOB 3TK0A 4YT5A 4E18A 2XLHA 3HKKA 2XLWA 1JMWA 4E17A 5EHHA 1SF8A 1T6QA 3AQCA 4KBLA 4YN0B 3RVYA 3RVZA 1T9KA 4JJGA 5KYYA 5CIVA 1CGME 3O10A 2GA0A 2AP3A 3U3FA 4DOZA 3R2PA 2M64A 5JSLA 5A6BA 3S0XA 2GWWA 2LIGA 2YLIA 3ABMC 5DS6A 1OR3A 5DS4A 4CSAA 2Q9CA 5AC4A 3RW0A 2RSEB 1K40A 2D4UA 1NSGB 1RKCA 2MWQA 3US6A 4EUKB 5L0DA 2OCCC 4U5HA 4JTDB 4I3MA 4KNVA 5T3WA 4ER9A 3LEVA 4CIPA 2QNLA 3S9OA 4DBRA 1G5ZA 1T5OA 2ZXWC 3N0TA 4MVOA 1FMVA 4DRJB 1PV3A 4RD9A 2L6GA 1QKRA 1ZVZA 4HEAJ 3I4UA 5DQTA 1UG7A 4PJNA 1ORSC 2YVKA 3F47A 3U8VA 2J9UA 3NMJA 5JT4A 2EPOA 2QTVA 1GS9A 3W8HA 3PDMP 2EINC 2GFHA 2OOCA 3B29A 3K1IC 3ABKC 2QY9A 2P61A 3H65A 2CW0F 3NMIA 2A6HF 4MQ9F 3DWWA 2HUJA 3V5XA 3QZCA 3K33A 2J0WA 5HSWA 4W8KA 3I5PA 4J32B 3UMKA 3QTHA 5L3QA 1D1CA 2R7TA 4OIOF 4WGYA 1HE1A 1LVKA 4LLEA 5D92A 2E87A 3AG1C 3DAGA 1ZW2A 4U5CE 5IY5C 3TJ6A 2XRHA 2ASRA 1WTYA 3AG4C 3C7JA 1U6HA 1VLTA 4PJJA 3RIPA 2HV6A 2NG1A 3EG9A 3M15A 5L3VA 4C7OB 3S28A 5CI9A 1YDIA 2EIKC 2XS8A 3U2MA 2WZLA 2Y69C 1C17M 2YKZA 3QVYA 5B1AC 3LLIA 2HFIA 2NUPA 2VC9A 4IJJA 3T6GB 4BEMJ 1AEPA 2XM0A 1T6IA 1EA8A 4YT2A 1HY5A 4JKVA 4DRHB 4OIQF 3HJCA 1MNEA 3UMIA 4FWVA 3LNRA 4OIPF 2L6FA 3OA1A 4N6HA 1FMWA 4J7YA 3ZTMA 3TD7A 2H7VC 2R7WA 3A11A 3KMIA 1O3UA 1QQ3A 3DMDA 1E2XA 1LI7A 1TKNA 2L9JA 1AUEA 2YLDA 1YYJA 3NG1A 3R7CA 1LS1A 4KI2A 4GQHA 1AVOB 3N24A 3SEOA 3CAXA 3MX3A 3W4YA 3EHNA 1MQVA 2PX3A 2CGEA 2R7VA 1HE9A 2XLVA 3JYHA 4A2NB 4E0HA 3O55A 3UMHA 4CS7A 1FNTc 3SXMA 2YL3A 3W8IA 3GWNA 4MVRA 3U2LA 4GEHA 1Q0KA 2KC3A 5E3AA 1A0BA 1SR2A 1D1BA 1WOLA 1PCXA 4PFPA 3DM9B 4IAOA 3ASNC 4LERA 3BEHA 2H8AA 2J45A 1L3PA 1DOVA 4U5BE 5JRAA 2IXMA 4YJWA 5BQGA 2R05A 2YZSA 1U0BB 2AU5A 3DM5A 2VCAA 4XEKA 3GORA 2EILC 2H7BA 3C8GA 1LIHA 3JCUQ 4MTFA 4XQ1A 4C3BA 4JCZA 1YVIA 2Q9AA 4BJ5A 3DE9A 2C03A 3L8IA 5HV9A 4GYTA 2X51A 3S29A 3EGXB 2ETSA 3DKAA 1A41A 4PR9A 4XPWA 3HNJA 3NKEA 1I4YA 3M79A 2NUTB 5FZTA 1QZXA 3HLZA 4YL3A 1Z63A 4CX9A 1ZYRF 2B0HA 2VCBA 4JCHA 3J06A 1MMDA 2LK4A 1QLEC 2OQMA 3EH2A 1VTMP 1ZZPA 3IHUA 3JSZA 4E0IA 4G7HF 3ZIBA 1S05A 1J8MF 3I5QA 1FFHA 3NYJA 4MVZA 2HV7A 3M1CB 4ZLCA 2VH3A 2XM4A 4WABA 3T4RA 5KYYB 1E85A 4ZLDA 3JRMO 4OINF 2ICWG 3QW0A 3IQ5A 1XZPA 1JR8A 1Y4CA 3H2UA 4J30B 3AG2C 4IARA 4MVUA 4JEBA 5E33A 2DGJA 1GQAA 3DZAA 3WG7C 2QE9A 2KSFA 5FCLA 3C8GD 3FAJA 1FFTC 1M2VA 3CQZA 4IRUA 1EQ1A 2R03A 5JP7A 1GM5A 3ZTZA 1M2OA 2LFFA 4EKWA 2MYSA 3L1MA 1M57C 1DOWA 3B0PA 4WGZA 2XL6A 3Q6NA 1C03A 2EPKX 3DE8A 1OKKA 2ZD9A 3L8JA 3LS1A 2XL4A 2HSQA 4MW3A 4NQFA 3WAQA 4P9TA 2P0NA 4CDAA 1I5NA 2G3VA 4YT8A 4C3EA 3S90A 1JPJA 4XLNF 2ZXPA 3E9VA 5AC5A 4WJ0A 3KH2A 3GEEA 4JTAB 4P6IC 5BQIA 2EPNA 1TQGA 3CEXA 3JRTA 5JS5A 1KNYA 3UGPA 4CS8C 4G0HA 4KNWA 3G4ZA 1VMAA 1RKEA 4XEFA 1A7DA 3UNGC 1TFOB 4L6RA 3LJBA 1FTSA 3OEOA 3JYYA 3T6JA 1TWGA 2PP4A 2EIJC 4ANJA 3H2VA 4JC7A 3EZHA 1M56C 3EG9B 2EPMX 5E3CA 4G7ZF 5JUAA 1TFKB 4JZAA 1T6UA 1IW7F 2I15A 2ZPAA 3B0VC 3NDBB 1BR4A 5L0IA 4JRZA 3SP1A 3MYIA 2NUPB 4Q5SF 4CS9A 4FESA 4BEJA 1BR1A 2Y3DA 3LEOA 3RKOF 4JTCB 2PFDA 4CJGA 2FGYA 2CCYA 3GANA 1CPRA 3MFNA 2FAPB 4O6MA 1J8YF 1N1CA 1V4AA 1OKKD 1LPEA 2VB6A 3DXJF 4LACB 3X1OA 4CDYA 2TMVP 1OW7A 5TJ5E 1TWCA 4RBNA 1R5ID 1ZHYA 2LQGA 3GM1A 5B3SC 4QI2A 3UR3C 1ZHXA 2KYHA 1WASA 4I1MA 2YL1A 2L81A 3FOPA 3U3BA 2J9BA 2V3CC 2R7SA 1ZHWA 1MMNA 2Q7RA 2BC5A 4IB4A 4A4AA 2EIMC 2XL8A 3KYIA 2O9XA 2A0BA 256BA 2NSFA 3FAPB 5KYWA 4PJLA 5CI8A 3DD7A 3U5SA 4XLPF 2J7PA 1Q0FA 1KTMA 3EQLF 1OR2A 1QPUA 2WL8A 4MS2A 4YK5A 3TULA 2J8WA 3C8GB 4MVQA 4PACA 3EH1A 5KYUB 4FAPB 4H4KC 1RJ9A 3U9JA 4Z9IA 1PD1A 4DBQA 1CGNA 2ZXOA 1APCA 2LSEA 4YWQA 3M4BA 1M6TA 3OWTA 5F5FA 2DI3A 5BQHA 3B71A 1H9GA 3FOOA 3SXYA 3POVA 4K7BA 1O87A 1Z6AA 3K7DA 3LNMB 3JSEO 4KC9A 2QUPA 3B9QA 3QVZA 2GDCA 4CS9C 3NMKA 3ZC4A 4LLCA 3ITFA 3JZ0A 2Y39A 1MMAA 1NBBA 5L0CA 3K66A 3AG3C 1RMVA 1D0XA 1NFNA 5KYUA 2CNWD 4DVZA 4N6CA 5D91A 1K04A 4U9EA 2KQ9A 1Q0MA 3KL4A 3BRJA 5L0HA 2I8BA 4U5GA 5JLIA 1A7EA 2R25A 3Q6MA 1E83A 2YHSA 4CS8A 3SYNA 3CSKA 4P9FA 2J7PD 5GPGB
chains in the Genus database with same CATH topology
1RXQA 2OQMA 2RD9A 5CIVA 5COFA 3GORA 2NSFA 2OU6A 2HKVA 3QTHA 2F22A 3CEXA 4N6CA 5COMA 5COGA 2P1AA 3DKAA 2QNLA 3DI5A 2NSGA 2QE9A 2YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  2OQM A;  2RD9 A;  5CIV A;  5COF A;  3GOR A;  2NSF A;  2OU6 A;  2HKV A;  3QTH A;  2F22 A;  3CEX A;  4N6C A;  5COM A;  5COG A;  2P1A A;  3DKA A;  2QNL A;  3DI5 A;  2NSG A;  2QE9 A;  2YQY A; 
#chains in the Genus database with same CATH topology
 2L7A A;  2L6H A;  2GAQ A;  5A6K A;  4MTG A;  3ZDL A;  4AK9 A;  2OEX A;  1H7I A;  3IQT A;  2YRF A;  4EWC A;  1Z3I X;  4BPM A;  4ULW A;  1YJG A;  2LD6 A;  1E84 A;  1O5H A;  1M2V B;  3EGD A;  3WHN A;  2HJ3 A;  2J9V A;  3ECS A;  1ST6 A;  2OU6 A;  5KYX B;  4DRI B;  3GWL A;  1VYK A;  3B0U X;  4CDV A;  1S7Z A;  4HFF B;  3TJ5 A;  2B0J A;  2KGO A;  2H7O A;  1L7C A;  3K6B A;  4ULV A;  1YZA A;  2IXO A;  1D0Z A;  2NPU A;  1TR2 A;  2WZG A;  2PF4 E;  4O7G A;  3S27 A;  3TOL A;  1QSP A;  3G50 A;  4DVY P;  4U5F E;  1NFO A;  3CZ6 A;  1Y6D A;  1G8X A;  3IEE A;  1GGQ A;  1G4W R;  2IOQ A;  2KNH A;  3RQG A;  3NYL A;  4AE4 A;  1OXK A;  2DYS C;  1RKE B;  2WB7 A;  2YL0 A;  3DJN B;  3TOM A;  3U9M A;  3W2W A;  5T1D B;  4CIH A;  2JPU A;  4ONS A;  1VK5 A;  3RFY A;  3VF0 A;  2JX0 A;  4BJ6 A;  5KYX A;  1HW2 A;  4N4W A;  2LFD A;  2OKU A;  2PBE A;  1SMY F;  1YLM A;  4MW8 A;  4QDL A;  4U9D A;  4D4N A;  4PK4 A;  3E70 C;  1F1M A;  3C8Z A;  2R9R B;  3C63 A;  1NLX A;  4I44 A;  2XLM A;  4BG0 A;  1ORY A;  3AGT A;  2M4E A;  2BE5 F;  1QVX A;  4Z9H A;  2WVQ A;  1CGO A;  3ASO C;  2A1D D;  1NU9 C;  1Z5Z A;  2A68 F;  4Q4Z F;  3M4C A;  1LM3 B;  1RCP A;  2OG2 A;  3ABL C;  1VYI A;  3MLG A;  2XLE A;  3NKD A;  3SZR A;  2YEV A;  2C04 A;  3FDQ A;  3DJU B;  3AGU A;  5B3I A;  1IZM A;  1YAU O;  3DI5 A;  3DAF A;  1LE4 A;  3V5Z A;  1JAF A;  1XZQ A;  2AWC A;  2XS1 A;  2G3K A;  2J0X A;  4G78 A;  5T3T A;  3RYL A;  4NCQ A;  4O6Y A;  2R7X A;  1PD0 A;  3VRC A;  4LDR A;  4CJO A;  2VCC A;  3KKB A;  4H54 A;  3EZI A;  4O6N A;  2Z15 A;  1RXQ A;  4IGG A;  2IM8 A;  4MND A;  2UUI A;  2YWA A;  4QI0 A;  4N06 A;  2IXP A;  1KU2 A;  5EK0 A;  4BJ1 A;  1V74 B;  2G62 A;  2WZF A;  4BJ5 C;  4OIR F;  1ZW3 A;  1CPQ A;  1OXB A;  1H9T A;  1JOG A;  5KYW B;  4X0R A;  4XPY A;  5AGF A;  4CBE A;  4NTF A;  2Y3G A;  2ZXR A;  4AX2 A;  2WVN A;  3AQB A;  5COM A;  3EFO A;  3FMS A;  3SXK A;  1HMO A;  4EBJ A;  1E86 A;  1VLS A;  2P1A A;  4NC3 A;  4NY3 A;  4Q7C A;  3GOD A;  4DJ9 A;  2R7R A;  1TWH A;  3GEH A;  3Q7L A;  5L0G A;  1ZHT A;  3GEI A;  2YQY A;  4JVS A;  3RQE A;  5F5H A;  3S84 A;  3QW1 A;  1A7V A;  1ZU4 A;  3LUT B;  4BJ6 C;  3QMK A;  4IWB A;  4XEV A;  3X2Q C;  2XLD A;  1RJ9 B;  2VAS A;  3MYF A;  4E7S A;  4C3D A;  2KJG A;  2CNW A;  3AJM A;  1ZU5 A;  2WVO A;  3LES A;  3F46 A;  4XWJ A;  2W4B A;  3ZQY A;  5F28 E;  4EBB A;  3JTL O;  4NTB A;  2UUH A;  5BUO A;  2Y3H A;  1C02 A;  2PNO A;  5A69 A;  3IQC A;  2XXA B;  3IPM O;  1EKY A;  4AL0 A;  2A69 F;  2LP4 A;  1YA9 A;  2X0C A;  5A6A A;  1Z23 A;  2F22 A;  2J46 A;  3FHD A;  3HTK C;  2EPL X;  1LKX A;  2R7O A;  4FX5 A;  3U8P A;  2MHR A;  4MTO A;  1UFB A;  3SXZ A;  1JPN A;  3V5Y A;  1VOM A;  4U5E E;  5COG A;  2Q9B A;  4MVM A;  2OJE D;  2Y3B A;  2R7Q A;  2A6E F;  5A6B D;  2OEV A;  4F4B A;  4PJM A;  2HMZ A;  1OCC C;  1Z7Q c;  1D1A A;  1OW6 A;  1BR2 A;  1H6G A;  3ZWI A;  1SYQ A;  1V55 C;  1WAT A;  1OQC A;  4HFK B;  4EBK A;  4BJT A;  4E7Z A;  2XXA A;  2PX0 A;  3Q7G A;  4M63 A;  4U5D E;  1LE2 A;  3ZSU A;  4B6I A;  2IYL D;  2W45 A;  5E2Q A;  3V7O A;  2HMQ A;  1BDJ B;  1MMG A;  2P6V A;  3JT1 A;  3K1H A;  5KYN A;  3LAY A;  1G4U S;  2HS5 A;  2XSE A;  4AL1 A;  4CSA C;  2HZ8 A;  2CYD A;  2R7U A;  1R4T A;  1YAR O;  3GM2 A;  3T6B A;  3EGD B;  3RQF A;  1FAP B;  1YA7 O;  1W2W A;  4I1O B;  1OCZ C;  2CDQ A;  3N2Z B;  4C7O A;  4MVS A;  4Z9J A;  3LS0 A;  2Q00 A;  4LDK A;  2HSB A;  4R32 A;  4W8P A;  3VM6 A;  5K0I A;  3LLK A;  2JD3 A;  4K1O A;  3AOU A;  3C18 A;  3RH3 A;  5DLJ A;  1BZ4 A;  3L0I A;  1MND A;  3KPH A;  2OJQ A;  1LI5 A;  2Q4F A;  3EPV A;  1WGW A;  3TQO A;  1WWP A;  3A9C A;  3W2V A;  3L34 A;  4YT4 A;  4YL0 A;  3VYW A;  2HJM A;  4LDQ A;  3ZVR A;  1V54 C;  3EJN A;  4HE8 D;  4J7T A;  1B68 A;  4XPX A;  5DVW A;  4AE4 B;  5L0F A;  1D0Y A;  1OW8 A;  2YL7 A;  2KW3 C;  2IXN A;  4JEA A;  5DQZ A;  1OCR C;  5A6J A;  4EHP A;  3PHF 2;  4NTA A;  4DXW A;  2J9W A;  4JJF A;  3U0C A;  1NU7 D;  4IAQ A;  3G4X A;  5DS5 A;  1K05 A;  2HKV A;  1SZI A;  2AVK A;  1YYX A;  2FFH A;  3HNI A;  1YZC A;  3O39 A;  4XTK A;  4G7O F;  3ZG1 A;  3FXH A;  2DYR C;  1HMD A;  4OD5 A;  2V26 A;  4UDV A;  1U89 A;  4K0D A;  5B1B C;  3O6X A;  3HNL A;  5L0J A;  4JE9 A;  2R02 A;  1EI7 A;  1Q0D A;  2XLO A;  1NG1 A;  3KYJ A;  1I4Z A;  1HW1 A;  1XWJ A;  2D5R B;  3WOD F;  3RF3 A;  2P7V A;  1BBH A;  2LCH A;  3FVY A;  3PCV A;  3ATP A;  2A0U A;  2Q3T A;  2RD9 A;  3T9O A;  4YL1 A;  1ORJ A;  2KK1 A;  4O79 A;  5EGY A;  2W4M A;  4OD4 A;  3C62 A;  4JW1 A;  5COF A;  1OCO C;  3EHM A;  1NZE A;  3K1I A;  1ZHZ A;  5JVE A;  1WN0 A;  3EGX A;  4JUR I;  2IBF A;  4PFO A;  3PMR A;  3HNK A;  2W9Y A;  3SNH A;  2AWY A;  3ZQV A;  2QLA A;  3GM3 A;  3VAY A;  3UGO A;  1JRA A;  1LS4 A;  2BL2 A;  1Q0G A;  1T01 A;  3MBG A;  3IQ6 A;  2NUT A;  3NYM A;  4D4X A;  1TWA A;  2NSG A;  3NRH A;  4JIO A;  4EIY A;  4RDA A;  1FR0 A;  2DB4 A;  2YLG A;  1VB5 A;  3EFO B;  3TK0 A;  4YT5 A;  4E18 A;  2XLH A;  3HKK A;  2XLW A;  1JMW A;  4E17 A;  5EHH A;  1SF8 A;  1T6Q A;  3AQC A;  4KBL A;  4YN0 B;  3RVY A;  3RVZ A;  1T9K A;  4JJG A;  5KYY A;  5CIV A;  1CGM E;  3O10 A;  2GA0 A;  2AP3 A;  3U3F A;  4DOZ A;  3R2P A;  2M64 A;  5JSL A;  5A6B A;  3S0X A;  2GWW A;  2LIG A;  2YLI A;  3ABM C;  5DS6 A;  1OR3 A;  5DS4 A;  4CSA A;  2Q9C A;  5AC4 A;  3RW0 A;  2RSE B;  1K40 A;  2D4U A;  1NSG B;  1RKC A;  2MWQ A;  3US6 A;  4EUK B;  5L0D A;  2OCC C;  4U5H A;  4JTD B;  4I3M A;  4KNV A;  5T3W A;  4ER9 A;  3LEV A;  4CIP A;  2QNL A;  3S9O A;  4DBR A;  1G5Z A;  1T5O A;  2ZXW C;  3N0T A;  4MVO A;  1FMV A;  4DRJ B;  1PV3 A;  4RD9 A;  2L6G A;  1QKR A;  1ZVZ A;  4HEA J;  3I4U A;  5DQT A;  1UG7 A;  4PJN A;  1ORS C;  2YVK A;  3F47 A;  3U8V A;  2J9U A;  3NMJ A;  5JT4 A;  2EPO A;  2QTV A;  1GS9 A;  3W8H A;  3PDM P;  2EIN C;  2GFH A;  2OOC A;  3B29 A;  3K1I C;  3ABK C;  2QY9 A;  2P61 A;  3H65 A;  2CW0 F;  3NMI A;  2A6H F;  4MQ9 F;  3DWW A;  2HUJ A;  3V5X A;  3QZC A;  3K33 A;  2J0W A;  5HSW A;  4W8K A;  3I5P A;  4J32 B;  3UMK A;  3QTH A;  5L3Q A;  1D1C A;  2R7T A;  4OIO F;  4WGY A;  1HE1 A;  1LVK A;  4LLE A;  5D92 A;  2E87 A;  3AG1 C;  3DAG A;  1ZW2 A;  4U5C E;  5IY5 C;  3TJ6 A;  2XRH A;  2ASR A;  1WTY A;  3AG4 C;  3C7J A;  1U6H A;  1VLT A;  4PJJ A;  3RIP A;  2HV6 A;  2NG1 A;  3EG9 A;  3M15 A;  5L3V A;  4C7O B;  3S28 A;  5CI9 A;  1YDI A;  2EIK C;  2XS8 A;  3U2M A;  2WZL A;  2Y69 C;  1C17 M;  2YKZ A;  3QVY A;  5B1A C;  3LLI A;  2HFI A;  2NUP A;  2VC9 A;  4IJJ A;  3T6G B;  4BEM J;  1AEP A;  2XM0 A;  1T6I A;  1EA8 A;  4YT2 A;  1HY5 A;  4JKV A;  4DRH B;  4OIQ F;  3HJC A;  1MNE A;  3UMI A;  4FWV A;  3LNR A;  4OIP F;  2L6F A;  3OA1 A;  4N6H A;  1FMW A;  4J7Y A;  3ZTM A;  3TD7 A;  2H7V C;  2R7W A;  3A11 A;  3KMI A;  1O3U A;  1QQ3 A;  3DMD A;  1E2X A;  1LI7 A;  1TKN A;  2L9J A;  1AUE A;  2YLD A;  1YYJ A;  3NG1 A;  3R7C A;  1LS1 A;  4KI2 A;  4GQH A;  1AVO B;  3N24 A;  3SEO A;  3CAX A;  3MX3 A;  3W4Y A;  3EHN A;  1MQV A;  2PX3 A;  2CGE A;  2R7V A;  1HE9 A;  2XLV A;  3JYH A;  4A2N B;  4E0H A;  3O55 A;  3UMH A;  4CS7 A;  1FNT c;  3SXM A;  2YL3 A;  3W8I A;  3GWN A;  4MVR A;  3U2L A;  4GEH A;  1Q0K A;  2KC3 A;  5E3A A;  1A0B A;  1SR2 A;  1D1B A;  1WOL A;  1PCX A;  4PFP A;  3DM9 B;  4IAO A;  3ASN C;  4LER A;  3BEH A;  2H8A A;  2J45 A;  1L3P A;  1DOV A;  4U5B E;  5JRA A;  2IXM A;  4YJW A;  5BQG A;  2R05 A;  2YZS A;  1U0B B;  2AU5 A;  3DM5 A;  2VCA A;  4XEK A;  3GOR A;  2EIL C;  2H7B A;  3C8G A;  1LIH A;  3JCU Q;  4MTF A;  4XQ1 A;  4C3B A;  4JCZ A;  1YVI A;  2Q9A A;  4BJ5 A;  3DE9 A;  2C03 A;  3L8I A;  5HV9 A;  4GYT A;  2X51 A;  3S29 A;  3EGX B;  2ETS A;  3DKA A;  1A41 A;  4PR9 A;  4XPW A;  3HNJ A;  3NKE A;  1I4Y A;  3M79 A;  2NUT B;  5FZT A;  1QZX A;  3HLZ A;  4YL3 A;  1Z63 A;  4CX9 A;  1ZYR F;  2B0H A;  2VCB A;  4JCH A;  3J06 A;  1MMD A;  2LK4 A;  1QLE C;  2OQM A;  3EH2 A;  1VTM P;  1ZZP A;  3IHU A;  3JSZ A;  4E0I A;  4G7H F;  3ZIB A;  1S05 A;  1J8M F;  3I5Q A;  1FFH A;  3NYJ A;  4MVZ A;  2HV7 A;  3M1C B;  4ZLC A;  2VH3 A;  2XM4 A;  4WAB A;  3T4R A;  5KYY B;  1E85 A;  4ZLD A;  3JRM O;  4OIN F;  2ICW G;  3QW0 A;  3IQ5 A;  1XZP A;  1JR8 A;  1Y4C A;  3H2U A;  4J30 B;  3AG2 C;  4IAR A;  4MVU A;  4JEB A;  5E33 A;  2DGJ A;  1GQA A;  3DZA A;  3WG7 C;  2QE9 A;  2KSF A;  5FCL A;  3C8G D;  3FAJ A;  1FFT C;  1M2V A;  3CQZ A;  4IRU A;  1EQ1 A;  2R03 A;  5JP7 A;  1GM5 A;  3ZTZ A;  1M2O A;  2LFF A;  4EKW A;  2MYS A;  3L1M A;  1M57 C;  1DOW A;  3B0P A;  4WGZ A;  2XL6 A;  3Q6N A;  1C03 A;  2EPK X;  3DE8 A;  1OKK A;  2ZD9 A;  3L8J A;  3LS1 A;  2XL4 A;  2HSQ A;  4MW3 A;  4NQF A;  3WAQ A;  4P9T A;  2P0N A;  4CDA A;  1I5N A;  2G3V A;  4YT8 A;  4C3E A;  3S90 A;  1JPJ A;  4XLN F;  2ZXP A;  3E9V A;  5AC5 A;  4WJ0 A;  3KH2 A;  3GEE A;  4JTA B;  4P6I C;  5BQI A;  2EPN A;  1TQG A;  3CEX A;  3JRT A;  5JS5 A;  1KNY A;  3UGP A;  4CS8 C;  4G0H A;  4KNW A;  3G4Z A;  1VMA A;  1RKE A;  4XEF A;  1A7D A;  3UNG C;  1TFO B;  4L6R A;  3LJB A;  1FTS A;  3OEO A;  3JYY A;  3T6J A;  1TWG A;  2PP4 A;  2EIJ C;  4ANJ A;  3H2V A;  4JC7 A;  3EZH A;  1M56 C;  3EG9 B;  2EPM X;  5E3C A;  4G7Z F;  5JUA A;  1TFK B;  4JZA A;  1T6U A;  1IW7 F;  2I15 A;  2ZPA A;  3B0V C;  3NDB B;  1BR4 A;  5L0I A;  4JRZ A;  3SP1 A;  3MYI A;  2NUP B;  4Q5S F;  4CS9 A;  4FES A;  4BEJ A;  1BR1 A;  2Y3D A;  3LEO A;  3RKO F;  4JTC B;  2PFD A;  4CJG A;  2FGY A;  2CCY A;  3GAN A;  1CPR A;  3MFN A;  2FAP B;  4O6M A;  1J8Y F;  1N1C A;  1V4A A;  1OKK D;  1LPE A;  2VB6 A;  3DXJ F;  4LAC B;  3X1O A;  4CDY A;  2TMV P;  1OW7 A;  5TJ5 E;  1TWC A;  4RBN A;  1R5I D;  1ZHY A;  2LQG A;  3GM1 A;  5B3S C;  4QI2 A;  3UR3 C;  1ZHX A;  2KYH A;  1WAS A;  4I1M A;  2YL1 A;  2L81 A;  3FOP A;  3U3B A;  2J9B A;  2V3C C;  2R7S A;  1ZHW A;  1MMN A;  2Q7R A;  2BC5 A;  4IB4 A;  4A4A A;  2EIM C;  2XL8 A;  3KYI A;  2O9X A;  2A0B A;  256B A;  2NSF A;  3FAP B;  5KYW A;  4PJL A;  5CI8 A;  3DD7 A;  3U5S A;  4XLP F;  2J7P A;  1Q0F A;  1KTM A;  3EQL F;  1OR2 A;  1QPU A;  2WL8 A;  4MS2 A;  4YK5 A;  3TUL A;  2J8W A;  3C8G B;  4MVQ A;  4PAC A;  3EH1 A;  5KYU B;  4FAP B;  4H4K C;  1RJ9 A;  3U9J A;  4Z9I A;  1PD1 A;  4DBQ A;  1CGN A;  2ZXO A;  1APC A;  2LSE A;  4YWQ A;  3M4B A;  1M6T A;  3OWT A;  5F5F A;  2DI3 A;  5BQH A;  3B71 A;  1H9G A;  3FOO A;  3SXY A;  3POV A;  4K7B A;  1O87 A;  1Z6A A;  3K7D A;  3LNM B;  3JSE O;  4KC9 A;  2QUP A;  3B9Q A;  3QVZ A;  2GDC A;  4CS9 C;  3NMK A;  3ZC4 A;  4LLC A;  3ITF A;  3JZ0 A;  2Y39 A;  1MMA A;  1NBB A;  5L0C A;  3K66 A;  3AG3 C;  1RMV A;  1D0X A;  1NFN A;  5KYU A;  2CNW D;  4DVZ A;  4N6C A;  5D91 A;  1K04 A;  4U9E A;  2KQ9 A;  1Q0M A;  3KL4 A;  3BRJ A;  5L0H A;  2I8B A;  4U5G A;  5JLI A;  1A7E A;  2R25 A;  3Q6M A;  1E83 A;  2YHS A;  4CS8 A;  3SYN A;  3CSK A;  4P9F A;  2J7P D;  5GPG B; 
#chains in the Genus database with same CATH homology
 1RXQ A;  2OQM A;  2RD9 A;  5CIV A;  5COF A;  3GOR A;  2NSF A;  2OU6 A;  2HKV A;  3QTH A;  2F22 A;  3CEX A;  4N6C A;  5COM A;  5COG A;  2P1A A;  3DKA A;  2QNL A;  3DI5 A;  2NSG A;  2QE9 A;  2YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...