5COMA

Crystal structure of uncharacterized protein q187f5 from clostridium difficile 630
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
171
structure length
171
Chain Sequence
RVYENKEELKSEINKTFEKYIAEFDNIPESLKDKRIDEVDRTPAENLAYQVGWTTLVLKWEEDERNGLQVKTPSDEFKWNQLGELYQWFTDTYAYLSLQELKSKLNENINSIYVMIDSLSDEELFKPHMRKWADDATKTAVWEVYKFIHVNTVAPFKTFRNKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative conjugative transposon protein Tn1549-like, CTn5-Or
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Peptoclostridium difficile 630
molecule tags Unknown function
total genus 74
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5comA00
5COMA 3QTHA 5COGA 2NSGA 3GORA 5COFA 2RD9A 2P1AA 3DKAA 5CIVA 1RXQA 2NSFA 3CEXA 2HKVA 2QE9A 2QNLA 3DI5A 2OU6A 4N6CA 2F22A 2YQYA 2OQMA
chains in the Genus database with same CATH superfamily
2RSEB 3AG2C 1V74B 1L7CA 3KPHA 3W4YA 3ATPA 1JOGA 2JPUA 1M2VA 3EHMA 4CS9C 3B0VC 1Z5ZA 3NYLA 2HV7A 3FOPA 3X1OA 1J8MF 2MWQA 3FMSA 1AEPA 4YK5A 2V26A 3GWLA 4MQ9F 1OKKA 4MVZA 4PJMA 1RJ9A 4B6IA 2L7AA 2QUPA 1SF8A 1XZQA 5EHHA 3NRHA 4EKWA 2EIJC 1ZHZA 3C62A 4XPYA 3UGOA 2W4MA 5CI9A 4L6RA 3C7JA 3GODA 3L0IA 4ULWA 2YL1A 1D1CA 2Q4FA 2KC3A 1E84A 2XL6A 3CZ6A 1SR2A 2P61A 4QI0A 1LKXA 1OKKD 2IXMA 2LK4A 4BG0A 1OCRC 3L1MA 4YT5A 2R7UA 4XEKA 4DBRA 3GEHA 4Z9HA 1K05A 2GDCA 3DZAA 4O6NA 4JTAB 5DQZA 5KYWA 1RCPA 2HFIA 1CGME 4JCHA 3RYLA 4KNWA 1RKEB 2RD9A 2Y3HA 3PMRA 2YVKA 3FOOA 5L0FA 2YLDA 1VTMP 1G4WR 1SYQA 1Q0KA 3S28A 3RQFA 3NKEA 4I1MA 2KYHA 3U5SA 2KQ9A 2QNLA 1HE9A 4CDYA 2YLGA 3N0TA 4KNVA 4C7OA 2EPKX 4RDAA 3RKOF 3EGXB 3I5PA 4N6HA 3SEOA 4MTOA 2YWAA 1A7DA 1QQ3A 2XLVA 2GA0A 3DI5A 1G4US 1M6TA 3HJCA 4JE9A 4JIOA 5B1AC 4NTFA 1V55C 2MHRA 2VCCA 2VCAA 3KYIA 3GANA 3NYMA 3ZG1A 4MVOA 1HW2A 1YYJA 1TWHA 1Q0GA 256BA 3NMIA 4DRIB 4JTDB 5HV9A 4OIOF 4ULVA 1OCOC 1ORSC 2P6VA 3ZWIA 1BDJB 3J06A 4J7TA 3EFOA 4LDRA 3DAFA 1N1CA 1T5OA 4K1OA 2R02A 1GGQA 3U8VA 5JVEA 3H2VA 3TJ6A 5IY5C 3W8HA 2QTVA 2ZXPA 3NDBB 4NQFA 5FZTA 4JURI 1ZHXA 5DS4A 1ZZPA 2KJGA 2LIGA 3QW0A 1GS9A 2IXPA 2Q00A 2YKZA 3M1CB 1MMNA 2NUPA 4CSAA 1ORYA 2W45A 2EIMC 3A9CA 2DYSC 1PV3A 1J8YF 2F22A 3DJNB 3NMJA 3OEOA 3US6A 4E7ZA 2CW0F 2LSEA 2XL8A 3K6BA 3L8IA 4DRHB 3AG4C 4A4AA 1I5NA 2P0NA 2FGYA 4FWVA 4FESA 4G7HF 3U2MA 2EINC 5A6AA 1RMVA 3JYYA 3AG1C 1M57C 1RKCA 1QPUA 3QVYA 4KBLA 4XTKA 5DLJA 3LEOA 3QZCA 1EKYA 1Q0DA 2VH3A 3ZTZA 2A0UA 4BJ5A 3DWWA 1OCZC 2VC9A 5KYYB 4CJGA 4GQHA 2J9VA 1OW6A 2OCCC 3LJBA 4JEAA 1H7IA 2WVOA 4G7OF 3ABMC 4X0RA 3SXYA 1FR0A 1UG7A 2PX3A 3LNRA 3O39A 2XSEA 1GM5A 1VYKA 1T9KA 4CS8C 2OU6A 1T01A 4H4KC 4ZLDA 1O87A 3JRMO 3R2PA 1WASA 4DJ9A 4O6YA 4EBBA 3WODF 4O7GA 3U0CA 1MMAA 4YT8A 4P9TA 3HKKA 3UMKA 5DS6A 3EH1A 3EGXA 3JSZA 3NG1A 4PK4A 1ZHTA 2XM4A 3T6BA 2EPMX 2R7TA 5DQTA 1OXKA 2P1AA 1FAPB 3ZSUA 2B0HA 3U3FA 3FAJA 3JYHA 4E0IA 2R7WA 2ZD9A 2NSFA 2VCBA 3CEXA 1ZU5A 3Q7GA 2YRFA 2VB6A 3RVYA 2GWWA 4XLPF 2YLIA 3B29A 2L81A 1H6GA 3T4RA 4U5HA 1TR2A 5DVWA 3DE8A 3BRJA 1HMOA 3AJMA 2J8WA 2G3VA 3T6JA 4XLNF 4HFFB 1LI5A 3Q7LA 2NPUA 4MTFA 4PJJA 2HS5A 5L0JA 1LPEA 2OEXA 5L0HA 1QVXA 3IPMO 3CSKA 2OOCA 4BJ1A 5K0IA 2IBFA 3TOMA 5B3SC 3H65A 4PACA 3UMHA 5BQHA 5L0GA 1ZHWA 1BR4A 1Y4CA 3UMIA 2XXAA 2M64A 2A69F 2HMQA 3MBGA 2PP4A 1PD0A 1WTYA 3MLGA 4HFKB 2QLAA 2XS8A 4N06A 3RIPA 3TJ5A 3VYWA 3S27A 3FDQA 2PBEA 3C8GA 2FAPB 2YEVA 4Z9IA 3GM3A 5T3WA 3DJUB 5JT4A 1A0BA 2J0WA 4WGZA 1E2XA 1LIHA 2LFDA 2NUTA 2EPOA 4BEMJ 4Q4ZF 3WHNA 3C8ZA 5JSLA 4XEFA 1OQCA 3SP1A 1LE4A 1T6IA 3ZC4A 2BL2A 2J9UA 3JZ0A 4CSAC 2VASA 4N4WA 3KH2A 4DBQA 4BEJA 4LERA 3TK0A 3V5ZA 3C8GD 2KNHA 3N2ZB 4P9FA 3AOUA 3NYJA 1BZ4A 2J46A 2Y3GA 5KYYA 5A6BA 2OQMA 2H7OA 4IRUA 1TWCA 1QLEC 1T6UA 1YA7O 1Z3IX 1ZW2A 3CAXA 1TFKB 3ASNC 5KYUA 4C3DA 3S84A 2HSQA 4NTAA 2NSGA 4NTBA 4OIQF 3ZQYA 2Y69C 3UR3C 1ZU4A 2P7VA 2Y39A 3E70C 3AG3C 4HE8D 3ZTMA 4PJLA 3U9JA 1O5HA 4BJ5C 1U6HA 3LLIA 1AVOB 1A7EA 4OD5A 4XWJA 1DOWA 5A6BD 1EI7A 1UFBA 1WN0A 2QE9A 2C03A 3C63A 2WZLA 1VMAA 1NLXA 3IQ6A 1CPQA 1DOVA 4I3MA 3RQGA 3SZRA 4AE4B 3JSEO 2GFHA 2LCHA 4AX2A 2IXOA 2XLHA 1NBBA 4W8PA 3PDMP 2YL0A 1G8XA 2Q9AA 3SXMA 4OINF 4EWCA 2PX0A 2LD6A 5A6KA 2L6GA 3DMDA 1K04A 3NMKA 3KYJA 4YL1A 2A1DD 5L0CA 2HV6A 3IEEA 2DYRC 3MFNA 4U5EE 4K7BA 1HE1A 5F5FA 3HNKA 3GORA 3HNLA 4OIRF 2L6FA 3HNJA 3FVYA 1NSGB 1V54C 3GM1A 1CPRA 3SYNA 5JRAA 4CDAA 4I44A 3G4ZA 4BJ6C 1S7ZA 4E7SA 4WABA 4PFOA 4FAPB 4JRZA 2ASRA 3E9VA 3LEVA 3M79A 2TMVP 1YA9A 4I1OB 4C3BA 3EPVA 4FX5A 2V3CC 4U5DE 3PCVA 1GQAA 1JR8A 3WAQA 1E83A 3FAPB 4LLEA 4DOZA 2EPNA 3CQZA 4MS2A 3S29A 4YT4A 4G7ZF 3X2QC 4IARA 2L6HA 2Q9CA 3B71A 3EGDB 3EZIA 2UUHA 3N24A 3O55A 3W2WA 2KW3C 3JCUQ 3QTHA 4E17A 1YZAA 4R32A 1U0BB 1KTMA 1BR2A 4CS9A 1XWJA 1JRAA 1M2OA 5F5HA 1IW7F 1OXBA 2OKUA 3POVA 2NG1A 3DKAA 1XZPA 4O6MA 1Q0MA 2J9WA 4KI2A 5EGYA 2J9BA 4CX9A 3VM6A 4IAQA 4JJFA 4A2NB 1H9GA 1YZCA 3U3BA 2A68F 3I4UA 4JZAA 2IM8A 5BUOA 5JUAA 2O9XA 1ZHYA 4NC3A 1RKEA 2BE5F 2B0JA 2LFFA 3DAGA 4WGYA 4N6CA 3KKBA 3OWTA 4J7YA 1E86A 5E2QA 4DXWA 4CIPA 1C03A 1OR3A 1RJ9B 1VOMA 4U9DA 2ZXWC 4ANJA 1D1AA 1WGWA 1Z7Qc 2XS1A 3G50A 4XPWA 1MQVA 1V4AA 3K33A 4XPXA 5E3CA 4PJNA 4MW8A 2Q7RA 3MYIA 1MNDA 1A41A 4F4BA 2IOQA 1Z23A 2Y3BA 2PNOA 4QI2A 2ZPAA 1YAUO 3L34A 1YYXA 2D4UA 3LNMB 3TULA 2D5RB 2E87A 5CI8A 1KU2A 1YVIA 4KC9A 5KYWB 4YN0B 2HJ3A 2R9RB 3U8PA 3DM9B 1QKRA 5T1DB 1D1BA 3M15A 3Q6NA 4JKVA 3UGPA 2OG2A 3MX3A 3DM5A 5L0DA 2R03A 3KMIA 4JW1A 4DVYP 2X51A 3W8IA 5D91A 4U5CE 4RBNA 3ITFA 5FCLA 2FFHA 4WJ0A 1CGNA 3IQCA 4MVRA 5COMA 2A6EF 3JRTA 3ZIBA 3RVZA 4H54A 3HNIA 3ABLC 4AK9A 4EHPA 2DI3A 2Y3DA 3AQCA 1JMWA 3KL4A 3U2LA 1SZIA 2LQGA 4JC7A 1B68A 1LE2A 5CIVA 2WZGA 4YT2A 1AUEA 2G62A 3EGDA 2GAQA 3B0PA 4IJJA 5AC5A 1ZW3A 2HMZA 3GEEA 4HEAJ 4YWQA 3L8JA 2J7PA 5TJ5E 2JD3A 2OJED 2ZXOA 2CYDA 4LACB 4MVMA 1WOLA 4J30B 2XLMA 3S90A 4MW3A 1ORJA 2R7RA 1LM3B 1YDIA 3EFOB 4MVQA 2WVNA 5F28E 5B3IA 1FTSA 1YJGA 3EH2A 5AGFA 1WATA 3K1IA 3LAYA 2XLOA 3HTKC 3GEIA 2J7PD 2C04A 3EHNA 1FFHA 2M4EA 4GEHA 5COGA 2EILC 2YL3A 2CNWD 5A6JA 4Q5SF 2NUPB 1JPJA 5D92A 4PFPA 2QY9A 4U5GA 2R7XA 1MNEA 5DS5A 3LUTB 4IAOA 2H7BA 2HKVA 2DGJA 4JVSA 3LLKA 5A69A 3NKDA 2JX0A 1ST6A 2R05A 1Z6AA 2KGOA 2WZFA 2YZSA 4G78A 5KYXB 3GWNA 1D0XA 3MYFA 4IGGA 3WG7C 4Q7CA 2IXNA 3VF0A 3JTLO 5E3AA 2R7OA 5E33A 4CJOA 4CS8A 1MMDA 1YARO 2ETSA 4IWBA 4J32B 4AL0A 1FFTC 1FMVA 5HSWA 4YJWA 4JTCB 3I5QA 3BEHA 1C17M 2EIKC 2J45A 1NG1A 3AGUA 1JPNA 4JJGA 3S9OA 4UDVA 3SXZA 4AL1A 1LVKA 2A6HF 2BC5A 4MVUA 3O6XA 3ECSA 4E18A 2HSBA 4DVZA 3S0XA 2HZ8A 3SNHA 2LP4A 1CGOA 4IB4A 3T9OA 4OD4A 2XM0A 4Z9JA 4CDVA 4W8KA 4XQ1A 2R7QA 5JP7A 2W9YA 3FXHA 1R5ID 1VYIA 2KSFA 3IQTA 5L3VA 5L0IA 2AP3A 2R7VA 2EPLX 2L9JA 4K0DA 1LS4A 4QDLA 1A7VA 4RD9A 3ASOC 5GPGB 4D4NA 4MNDA 1SMYF 4CBEA 4EBJA 1OW7A 4LLCA 1HW1A 1QSPA 3OA1A 1NZEA 1HMDA 2OEVA 4MTGA 4JEBA 5AC4A 4YL3A 4ONSA 1BBHA 1TKNA 3B9QA 2AVKA 1OW8A 3F46A 3K7DA 1NU7D 3RH3A 5JLIA 2HUJA 1LI7A 1I4ZA 3VAYA 1Z63A 3V5XA 4LDQA 3AGTA 3VRCA 3TD7A 3EG9B 3RQEA 4G0HA 1E85A 3H2UA 3TQOA 1EA8A 4P6IC 1OR2A 1K40A 1BR1A 3DE9A 3DXJF 1F1MA 1VK5A 2J0XA 2XL4A 3PHF2 1ZYRF 1FMWA 3QVZA 3M4CA 2XXAB 3LS0A 1Y6DA 3W2VA 3RF3A 3M4BA 1MMGA 1NU9C 3C18A 1M2VB 2H8AA 3SXKA 1TQGA 3F47A 1APCA 3EZHA 1HY5A 1T6QA 2IYLD 2W4BA 3C8GB 5BQGA 4EUKB 1KNYA 2MYSA 3JT1A 3K1HA 3K1IC 4U9EA 4OIPF 2CCYA 4BPMA 4ER9A 5T3TA 2NUTB 1R4TA 2A0BA 3QW1A 4D4XA 1TWAA 5KYXA 2WL8A 4AE4A 4EBKA 3K66A 1D0ZA 2AU5A 1NFOA 5COFA 3T6GB 3UNGC 4NCQA 2OJQA 2KK1A 4CIHA 1NFNA 2XLDA 4M63A 3V5YA 5JS5A 1H9TA 3ZQVA 1TWGA 2YHSA 2XRHA 2R25A 4ZLCA 4E0HA 2Q3TA 3EQLF 2ICWG 3LESA 5KYUB 2R7SA 1EQ1A 1W2WA 5EK0A 2YL7A 3G4XA 2Q9BA 5BQIA 4MVSA 2WVQA 2UUIA 4C3EA 4DRJB 1D0YA 3ZVRA 4XEVA 1WWPA 3RW0A 2AWCA 3ZDLA 3IHUA 2WB7A 4PR9A 1JAFA 3TOLA 1S05A 1PD1A 2DB4A 1VLSA 3O10A 3ABKC 1VB5A 4O79A 2G3KA 4C7OB 2ZXRA 3FHDA 1M56C 2XLWA 1Q0FA 4EIYA 1L3PA 1ZVZA 3A11A 1C02A 1RXQA 2HJMA 3IQ5A 4U5BE 4GYTA 3EJNA 3U9MA 2I15A 1PCXA 2XLEA 1YLMA 3R7CA 3QMKA 1LS1A 2AWYA 1VLTA 2CGEA 5B1BC 2X0CA 4BJ6A 4U5FE 3AQBA 3RFYA 2PFDA 1U89A 1O3UA 3GM2A 3HLZA 2H7VC 4LDKA 2CNWA 2PF4E 1TFOB 1IZMA 3EG9A 4JCZA 4CS7A 1QZXA 1I4YA 1OCCC 4NY3A 4YL0A 3V7OA 4BJTA 3B0UX 2Z15A 5KYNA 1FNTc 1G5ZA 3LS1A 3Q6MA 2YQYA 2I8BA 2CDQA 5L3QA 3DD7A
chains in the Genus database with same CATH topology
5COMA 3QTHA 5COGA 2NSGA 3GORA 5COFA 2RD9A 2P1AA 3DKAA 5CIVA 1RXQA 2NSFA 3CEXA 2HKVA 2QE9A 2QNLA 3DI5A 2OU6A 4N6CA 2F22A 2YQYA 2OQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COM A;  3QTH A;  5COG A;  2NSG A;  3GOR A;  5COF A;  2RD9 A;  2P1A A;  3DKA A;  5CIV A;  1RXQ A;  2NSF A;  3CEX A;  2HKV A;  2QE9 A;  2QNL A;  3DI5 A;  2OU6 A;  4N6C A;  2F22 A;  2YQY A;  2OQM A; 
#chains in the Genus database with same CATH topology
 2RSE B;  3AG2 C;  1V74 B;  1L7C A;  3KPH A;  3W4Y A;  3ATP A;  1JOG A;  2JPU A;  1M2V A;  3EHM A;  4CS9 C;  3B0V C;  1Z5Z A;  3NYL A;  2HV7 A;  3FOP A;  3X1O A;  1J8M F;  2MWQ A;  3FMS A;  1AEP A;  4YK5 A;  2V26 A;  3GWL A;  4MQ9 F;  1OKK A;  4MVZ A;  4PJM A;  1RJ9 A;  4B6I A;  2L7A A;  2QUP A;  1SF8 A;  1XZQ A;  5EHH A;  3NRH A;  4EKW A;  2EIJ C;  1ZHZ A;  3C62 A;  4XPY A;  3UGO A;  2W4M A;  5CI9 A;  4L6R A;  3C7J A;  3GOD A;  3L0I A;  4ULW A;  2YL1 A;  1D1C A;  2Q4F A;  2KC3 A;  1E84 A;  2XL6 A;  3CZ6 A;  1SR2 A;  2P61 A;  4QI0 A;  1LKX A;  1OKK D;  2IXM A;  2LK4 A;  4BG0 A;  1OCR C;  3L1M A;  4YT5 A;  2R7U A;  4XEK A;  4DBR A;  3GEH A;  4Z9H A;  1K05 A;  2GDC A;  3DZA A;  4O6N A;  4JTA B;  5DQZ A;  5KYW A;  1RCP A;  2HFI A;  1CGM E;  4JCH A;  3RYL A;  4KNW A;  1RKE B;  2RD9 A;  2Y3H A;  3PMR A;  2YVK A;  3FOO A;  5L0F A;  2YLD A;  1VTM P;  1G4W R;  1SYQ A;  1Q0K A;  3S28 A;  3RQF A;  3NKE A;  4I1M A;  2KYH A;  3U5S A;  2KQ9 A;  2QNL A;  1HE9 A;  4CDY A;  2YLG A;  3N0T A;  4KNV A;  4C7O A;  2EPK X;  4RDA A;  3RKO F;  3EGX B;  3I5P A;  4N6H A;  3SEO A;  4MTO A;  2YWA A;  1A7D A;  1QQ3 A;  2XLV A;  2GA0 A;  3DI5 A;  1G4U S;  1M6T A;  3HJC A;  4JE9 A;  4JIO A;  5B1A C;  4NTF A;  1V55 C;  2MHR A;  2VCC A;  2VCA A;  3KYI A;  3GAN A;  3NYM A;  3ZG1 A;  4MVO A;  1HW2 A;  1YYJ A;  1TWH A;  1Q0G A;  256B A;  3NMI A;  4DRI B;  4JTD B;  5HV9 A;  4OIO F;  4ULV A;  1OCO C;  1ORS C;  2P6V A;  3ZWI A;  1BDJ B;  3J06 A;  4J7T A;  3EFO A;  4LDR A;  3DAF A;  1N1C A;  1T5O A;  4K1O A;  2R02 A;  1GGQ A;  3U8V A;  5JVE A;  3H2V A;  3TJ6 A;  5IY5 C;  3W8H A;  2QTV A;  2ZXP A;  3NDB B;  4NQF A;  5FZT A;  4JUR I;  1ZHX A;  5DS4 A;  1ZZP A;  2KJG A;  2LIG A;  3QW0 A;  1GS9 A;  2IXP A;  2Q00 A;  2YKZ A;  3M1C B;  1MMN A;  2NUP A;  4CSA A;  1ORY A;  2W45 A;  2EIM C;  3A9C A;  2DYS C;  1PV3 A;  1J8Y F;  2F22 A;  3DJN B;  3NMJ A;  3OEO A;  3US6 A;  4E7Z A;  2CW0 F;  2LSE A;  2XL8 A;  3K6B A;  3L8I A;  4DRH B;  3AG4 C;  4A4A A;  1I5N A;  2P0N A;  2FGY A;  4FWV A;  4FES A;  4G7H F;  3U2M A;  2EIN C;  5A6A A;  1RMV A;  3JYY A;  3AG1 C;  1M57 C;  1RKC A;  1QPU A;  3QVY A;  4KBL A;  4XTK A;  5DLJ A;  3LEO A;  3QZC A;  1EKY A;  1Q0D A;  2VH3 A;  3ZTZ A;  2A0U A;  4BJ5 A;  3DWW A;  1OCZ C;  2VC9 A;  5KYY B;  4CJG A;  4GQH A;  2J9V A;  1OW6 A;  2OCC C;  3LJB A;  4JEA A;  1H7I A;  2WVO A;  4G7O F;  3ABM C;  4X0R A;  3SXY A;  1FR0 A;  1UG7 A;  2PX3 A;  3LNR A;  3O39 A;  2XSE A;  1GM5 A;  1VYK A;  1T9K A;  4CS8 C;  2OU6 A;  1T01 A;  4H4K C;  4ZLD A;  1O87 A;  3JRM O;  3R2P A;  1WAS A;  4DJ9 A;  4O6Y A;  4EBB A;  3WOD F;  4O7G A;  3U0C A;  1MMA A;  4YT8 A;  4P9T A;  3HKK A;  3UMK A;  5DS6 A;  3EH1 A;  3EGX A;  3JSZ A;  3NG1 A;  4PK4 A;  1ZHT A;  2XM4 A;  3T6B A;  2EPM X;  2R7T A;  5DQT A;  1OXK A;  2P1A A;  1FAP B;  3ZSU A;  2B0H A;  3U3F A;  3FAJ A;  3JYH A;  4E0I A;  2R7W A;  2ZD9 A;  2NSF A;  2VCB A;  3CEX A;  1ZU5 A;  3Q7G A;  2YRF A;  2VB6 A;  3RVY A;  2GWW A;  4XLP F;  2YLI A;  3B29 A;  2L81 A;  1H6G A;  3T4R A;  4U5H A;  1TR2 A;  5DVW A;  3DE8 A;  3BRJ A;  1HMO A;  3AJM A;  2J8W A;  2G3V A;  3T6J A;  4XLN F;  4HFF B;  1LI5 A;  3Q7L A;  2NPU A;  4MTF A;  4PJJ A;  2HS5 A;  5L0J A;  1LPE A;  2OEX A;  5L0H A;  1QVX A;  3IPM O;  3CSK A;  2OOC A;  4BJ1 A;  5K0I A;  2IBF A;  3TOM A;  5B3S C;  3H65 A;  4PAC A;  3UMH A;  5BQH A;  5L0G A;  1ZHW A;  1BR4 A;  1Y4C A;  3UMI A;  2XXA A;  2M64 A;  2A69 F;  2HMQ A;  3MBG A;  2PP4 A;  1PD0 A;  1WTY A;  3MLG A;  4HFK B;  2QLA A;  2XS8 A;  4N06 A;  3RIP A;  3TJ5 A;  3VYW A;  3S27 A;  3FDQ A;  2PBE A;  3C8G A;  2FAP B;  2YEV A;  4Z9I A;  3GM3 A;  5T3W A;  3DJU B;  5JT4 A;  1A0B A;  2J0W A;  4WGZ A;  1E2X A;  1LIH A;  2LFD A;  2NUT A;  2EPO A;  4BEM J;  4Q4Z F;  3WHN A;  3C8Z A;  5JSL A;  4XEF A;  1OQC A;  3SP1 A;  1LE4 A;  1T6I A;  3ZC4 A;  2BL2 A;  2J9U A;  3JZ0 A;  4CSA C;  2VAS A;  4N4W A;  3KH2 A;  4DBQ A;  4BEJ A;  4LER A;  3TK0 A;  3V5Z A;  3C8G D;  2KNH A;  3N2Z B;  4P9F A;  3AOU A;  3NYJ A;  1BZ4 A;  2J46 A;  2Y3G A;  5KYY A;  5A6B A;  2OQM A;  2H7O A;  4IRU A;  1TWC A;  1QLE C;  1T6U A;  1YA7 O;  1Z3I X;  1ZW2 A;  3CAX A;  1TFK B;  3ASN C;  5KYU A;  4C3D A;  3S84 A;  2HSQ A;  4NTA A;  2NSG A;  4NTB A;  4OIQ F;  3ZQY A;  2Y69 C;  3UR3 C;  1ZU4 A;  2P7V A;  2Y39 A;  3E70 C;  3AG3 C;  4HE8 D;  3ZTM A;  4PJL A;  3U9J A;  1O5H A;  4BJ5 C;  1U6H A;  3LLI A;  1AVO B;  1A7E A;  4OD5 A;  4XWJ A;  1DOW A;  5A6B D;  1EI7 A;  1UFB A;  1WN0 A;  2QE9 A;  2C03 A;  3C63 A;  2WZL A;  1VMA A;  1NLX A;  3IQ6 A;  1CPQ A;  1DOV A;  4I3M A;  3RQG A;  3SZR A;  4AE4 B;  3JSE O;  2GFH A;  2LCH A;  4AX2 A;  2IXO A;  2XLH A;  1NBB A;  4W8P A;  3PDM P;  2YL0 A;  1G8X A;  2Q9A A;  3SXM A;  4OIN F;  4EWC A;  2PX0 A;  2LD6 A;  5A6K A;  2L6G A;  3DMD A;  1K04 A;  3NMK A;  3KYJ A;  4YL1 A;  2A1D D;  5L0C A;  2HV6 A;  3IEE A;  2DYR C;  3MFN A;  4U5E E;  4K7B A;  1HE1 A;  5F5F A;  3HNK A;  3GOR A;  3HNL A;  4OIR F;  2L6F A;  3HNJ A;  3FVY A;  1NSG B;  1V54 C;  3GM1 A;  1CPR A;  3SYN A;  5JRA A;  4CDA A;  4I44 A;  3G4Z A;  4BJ6 C;  1S7Z A;  4E7S A;  4WAB A;  4PFO A;  4FAP B;  4JRZ A;  2ASR A;  3E9V A;  3LEV A;  3M79 A;  2TMV P;  1YA9 A;  4I1O B;  4C3B A;  3EPV A;  4FX5 A;  2V3C C;  4U5D E;  3PCV A;  1GQA A;  1JR8 A;  3WAQ A;  1E83 A;  3FAP B;  4LLE A;  4DOZ A;  2EPN A;  3CQZ A;  4MS2 A;  3S29 A;  4YT4 A;  4G7Z F;  3X2Q C;  4IAR A;  2L6H A;  2Q9C A;  3B71 A;  3EGD B;  3EZI A;  2UUH A;  3N24 A;  3O55 A;  3W2W A;  2KW3 C;  3JCU Q;  3QTH A;  4E17 A;  1YZA A;  4R32 A;  1U0B B;  1KTM A;  1BR2 A;  4CS9 A;  1XWJ A;  1JRA A;  1M2O A;  5F5H A;  1IW7 F;  1OXB A;  2OKU A;  3POV A;  2NG1 A;  3DKA A;  1XZP A;  4O6M A;  1Q0M A;  2J9W A;  4KI2 A;  5EGY A;  2J9B A;  4CX9 A;  3VM6 A;  4IAQ A;  4JJF A;  4A2N B;  1H9G A;  1YZC A;  3U3B A;  2A68 F;  3I4U A;  4JZA A;  2IM8 A;  5BUO A;  5JUA A;  2O9X A;  1ZHY A;  4NC3 A;  1RKE A;  2BE5 F;  2B0J A;  2LFF A;  3DAG A;  4WGY A;  4N6C A;  3KKB A;  3OWT A;  4J7Y A;  1E86 A;  5E2Q A;  4DXW A;  4CIP A;  1C03 A;  1OR3 A;  1RJ9 B;  1VOM A;  4U9D A;  2ZXW C;  4ANJ A;  1D1A A;  1WGW A;  1Z7Q c;  2XS1 A;  3G50 A;  4XPW A;  1MQV A;  1V4A A;  3K33 A;  4XPX A;  5E3C A;  4PJN A;  4MW8 A;  2Q7R A;  3MYI A;  1MND A;  1A41 A;  4F4B A;  2IOQ A;  1Z23 A;  2Y3B A;  2PNO A;  4QI2 A;  2ZPA A;  1YAU O;  3L34 A;  1YYX A;  2D4U A;  3LNM B;  3TUL A;  2D5R B;  2E87 A;  5CI8 A;  1KU2 A;  1YVI A;  4KC9 A;  5KYW B;  4YN0 B;  2HJ3 A;  2R9R B;  3U8P A;  3DM9 B;  1QKR A;  5T1D B;  1D1B A;  3M15 A;  3Q6N A;  4JKV A;  3UGP A;  2OG2 A;  3MX3 A;  3DM5 A;  5L0D A;  2R03 A;  3KMI A;  4JW1 A;  4DVY P;  2X51 A;  3W8I A;  5D91 A;  4U5C E;  4RBN A;  3ITF A;  5FCL A;  2FFH A;  4WJ0 A;  1CGN A;  3IQC A;  4MVR A;  5COM A;  2A6E F;  3JRT A;  3ZIB A;  3RVZ A;  4H54 A;  3HNI A;  3ABL C;  4AK9 A;  4EHP A;  2DI3 A;  2Y3D A;  3AQC A;  1JMW A;  3KL4 A;  3U2L A;  1SZI A;  2LQG A;  4JC7 A;  1B68 A;  1LE2 A;  5CIV A;  2WZG A;  4YT2 A;  1AUE A;  2G62 A;  3EGD A;  2GAQ A;  3B0P A;  4IJJ A;  5AC5 A;  1ZW3 A;  2HMZ A;  3GEE A;  4HEA J;  4YWQ A;  3L8J A;  2J7P A;  5TJ5 E;  2JD3 A;  2OJE D;  2ZXO A;  2CYD A;  4LAC B;  4MVM A;  1WOL A;  4J30 B;  2XLM A;  3S90 A;  4MW3 A;  1ORJ A;  2R7R A;  1LM3 B;  1YDI A;  3EFO B;  4MVQ A;  2WVN A;  5F28 E;  5B3I A;  1FTS A;  1YJG A;  3EH2 A;  5AGF A;  1WAT A;  3K1I A;  3LAY A;  2XLO A;  3HTK C;  3GEI A;  2J7P D;  2C04 A;  3EHN A;  1FFH A;  2M4E A;  4GEH A;  5COG A;  2EIL C;  2YL3 A;  2CNW D;  5A6J A;  4Q5S F;  2NUP B;  1JPJ A;  5D92 A;  4PFP A;  2QY9 A;  4U5G A;  2R7X A;  1MNE A;  5DS5 A;  3LUT B;  4IAO A;  2H7B A;  2HKV A;  2DGJ A;  4JVS A;  3LLK A;  5A69 A;  3NKD A;  2JX0 A;  1ST6 A;  2R05 A;  1Z6A A;  2KGO A;  2WZF A;  2YZS A;  4G78 A;  5KYX B;  3GWN A;  1D0X A;  3MYF A;  4IGG A;  3WG7 C;  4Q7C A;  2IXN A;  3VF0 A;  3JTL O;  5E3A A;  2R7O A;  5E33 A;  4CJO A;  4CS8 A;  1MMD A;  1YAR O;  2ETS A;  4IWB A;  4J32 B;  4AL0 A;  1FFT C;  1FMV A;  5HSW A;  4YJW A;  4JTC B;  3I5Q A;  3BEH A;  1C17 M;  2EIK C;  2J45 A;  1NG1 A;  3AGU A;  1JPN A;  4JJG A;  3S9O A;  4UDV A;  3SXZ A;  4AL1 A;  1LVK A;  2A6H F;  2BC5 A;  4MVU A;  3O6X A;  3ECS A;  4E18 A;  2HSB A;  4DVZ A;  3S0X A;  2HZ8 A;  3SNH A;  2LP4 A;  1CGO A;  4IB4 A;  3T9O A;  4OD4 A;  2XM0 A;  4Z9J A;  4CDV A;  4W8K A;  4XQ1 A;  2R7Q A;  5JP7 A;  2W9Y A;  3FXH A;  1R5I D;  1VYI A;  2KSF A;  3IQT A;  5L3V A;  5L0I A;  2AP3 A;  2R7V A;  2EPL X;  2L9J A;  4K0D A;  1LS4 A;  4QDL A;  1A7V A;  4RD9 A;  3ASO C;  5GPG B;  4D4N A;  4MND A;  1SMY F;  4CBE A;  4EBJ A;  1OW7 A;  4LLC A;  1HW1 A;  1QSP A;  3OA1 A;  1NZE A;  1HMD A;  2OEV A;  4MTG A;  4JEB A;  5AC4 A;  4YL3 A;  4ONS A;  1BBH A;  1TKN A;  3B9Q A;  2AVK A;  1OW8 A;  3F46 A;  3K7D A;  1NU7 D;  3RH3 A;  5JLI A;  2HUJ A;  1LI7 A;  1I4Z A;  3VAY A;  1Z63 A;  3V5X A;  4LDQ A;  3AGT A;  3VRC A;  3TD7 A;  3EG9 B;  3RQE A;  4G0H A;  1E85 A;  3H2U A;  3TQO A;  1EA8 A;  4P6I C;  1OR2 A;  1K40 A;  1BR1 A;  3DE9 A;  3DXJ F;  1F1M A;  1VK5 A;  2J0X A;  2XL4 A;  3PHF 2;  1ZYR F;  1FMW A;  3QVZ A;  3M4C A;  2XXA B;  3LS0 A;  1Y6D A;  3W2V A;  3RF3 A;  3M4B A;  1MMG A;  1NU9 C;  3C18 A;  1M2V B;  2H8A A;  3SXK A;  1TQG A;  3F47 A;  1APC A;  3EZH A;  1HY5 A;  1T6Q A;  2IYL D;  2W4B A;  3C8G B;  5BQG A;  4EUK B;  1KNY A;  2MYS A;  3JT1 A;  3K1H A;  3K1I C;  4U9E A;  4OIP F;  2CCY A;  4BPM A;  4ER9 A;  5T3T A;  2NUT B;  1R4T A;  2A0B A;  3QW1 A;  4D4X A;  1TWA A;  5KYX A;  2WL8 A;  4AE4 A;  4EBK A;  3K66 A;  1D0Z A;  2AU5 A;  1NFO A;  5COF A;  3T6G B;  3UNG C;  4NCQ A;  2OJQ A;  2KK1 A;  4CIH A;  1NFN A;  2XLD A;  4M63 A;  3V5Y A;  5JS5 A;  1H9T A;  3ZQV A;  1TWG A;  2YHS A;  2XRH A;  2R25 A;  4ZLC A;  4E0H A;  2Q3T A;  3EQL F;  2ICW G;  3LES A;  5KYU B;  2R7S A;  1EQ1 A;  1W2W A;  5EK0 A;  2YL7 A;  3G4X A;  2Q9B A;  5BQI A;  4MVS A;  2WVQ A;  2UUI A;  4C3E A;  4DRJ B;  1D0Y A;  3ZVR A;  4XEV A;  1WWP A;  3RW0 A;  2AWC A;  3ZDL A;  3IHU A;  2WB7 A;  4PR9 A;  1JAF A;  3TOL A;  1S05 A;  1PD1 A;  2DB4 A;  1VLS A;  3O10 A;  3ABK C;  1VB5 A;  4O79 A;  2G3K A;  4C7O B;  2ZXR A;  3FHD A;  1M56 C;  2XLW A;  1Q0F A;  4EIY A;  1L3P A;  1ZVZ A;  3A11 A;  1C02 A;  1RXQ A;  2HJM A;  3IQ5 A;  4U5B E;  4GYT A;  3EJN A;  3U9M A;  2I15 A;  1PCX A;  2XLE A;  1YLM A;  3R7C A;  3QMK A;  1LS1 A;  2AWY A;  1VLT A;  2CGE A;  5B1B C;  2X0C A;  4BJ6 A;  4U5F E;  3AQB A;  3RFY A;  2PFD A;  1U89 A;  1O3U A;  3GM2 A;  3HLZ A;  2H7V C;  4LDK A;  2CNW A;  2PF4 E;  1TFO B;  1IZM A;  3EG9 A;  4JCZ A;  4CS7 A;  1QZX A;  1I4Y A;  1OCC C;  4NY3 A;  4YL0 A;  3V7O A;  4BJT A;  3B0U X;  2Z15 A;  5KYN A;  1FNT c;  1G5Z A;  3LS1 A;  3Q6M A;  2YQY A;  2I8B A;  2CDQ A;  5L3Q A;  3DD7 A; 
#chains in the Genus database with same CATH homology
 5COM A;  3QTH A;  5COG A;  2NSG A;  3GOR A;  5COF A;  2RD9 A;  2P1A A;  3DKA A;  5CIV A;  1RXQ A;  2NSF A;  3CEX A;  2HKV A;  2QE9 A;  2QNL A;  3DI5 A;  2OU6 A;  4N6C A;  2F22 A;  2YQY A;  2OQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...