5COMA

Crystal structure of uncharacterized protein q187f5 from clostridium difficile 630
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
171
structure length
171
Chain Sequence
RVYENKEELKSEINKTFEKYIAEFDNIPESLKDKRIDEVDRTPAENLAYQVGWTTLVLKWEEDERNGLQVKTPSDEFKWNQLGELYQWFTDTYAYLSLQELKSKLNENINSIYVMIDSLSDEELFKPHMRKWADDATKTAVWEVYKFIHVNTVAPFKTFRNKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Peptoclostridium difficile 630
molecule tags Unknown function
molecule keywords Putative conjugative transposon protein Tn1549-like, CTn5-Or
total genus 74
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5comA00
3DKAA 2YQYA 5COMA 4N6CA 5COGA 2QNLA 1RXQA 2NSGA 2P1AA 3DI5A 2QE9A 2OQMA 3GORA 3CEXA 2RD9A 3QTHA 2HKVA 2OU6A 2NSFA 2F22A 5COFA 5CIVA
chains in the Genus database with same CATH superfamily
1QQ3A 3HNLA 5E33A 5IY5C 3VF0A 1JRAA 2PX3A 3H2VA 3LESA 5E3CA 1VYIA 4YT8A 5B3SC 3MLGA 1YJGA 4CDYA 1VK5A 1H7IA 4ZLDA 1YAUO 5FCLA 5T3WA 3RH3A 5L0GA 2B0HA 1T9KA 4W8KA 2J0XA 3T6BA 1O3UA 1TR2A 1VTMP 4CDVA 2LK4A 3MYIA 3B0UX 4ULWA 1SYQA 3DWWA 3RYLA 4CIHA 4H54A 5JP7A 2J0WA 4DBQA 2VB6A 1V54C 2Y3GA 4J32B 3ZWIA 5KYUA 1AEPA 2ZXRA 1TQGA 3HJCA 3AQCA 4MW8A 2IXPA 3B0VC 3ZG1A 1TWAA 3OA1A 4N6HA 3NYJA 3U9JA 1OKKA 4BJ5C 3UGPA 1LS1A 3K1IC 1HW2A 3VYWA 4CX9A 4CSAA 2OEXA 1C03A 1ZHXA 4LERA 2Q9AA 2EPNA 2XLEA 1VOMA 3JRTA 4JJGA 2Y3DA 2LD6A 1C02A 1H6GA 1MMAA 4N6CA 3L1MA 4JW1A 1E84A 2EIJC 2R03A 3UMIA 2LCHA 1OKKD 2GA0A 2Q9CA 3IQ6A 1YA7O 3KMIA 4U9DA 1Q0MA 1J8YF 2GAQA 1ZHYA 4U5EE 4YK5A 4ANJA 2FGYA 1YVIA 2EIMC 3CEXA 2VC9A 2KNHA 2PNOA 4U5HA 1LI5A 3FDQA 2NUPB 4KBLA 3BEHA 4K7BA 3LAYA 4OIQF 3U3FA 4IGGA 3N24A 3PDMP 2NUTB 3KYJA 5JS5A 3AQBA 1BR4A 2DYRC 4U5DE 4YT2A 2NSFA 4Q7CA 4U5BE 1T6IA 3B0PA 4IB4A 3Q7GA 5FZTA 4HEAJ 3ECSA 3IPMO 1HE1A 4MVMA 4JCHA 3C8GA 1KNYA 2ZXWC 4EUKB 2KYHA 2MHRA 3EG9B 4EWCA 4LDRA 1C17M 2GWWA 4G78A 4LLEA 3TJ6A 2JX0A 1ZW2A 4JIOA 3V7OA 3GM1A 3W8IA 3LS1A 1YYJA 2H7OA 4I44A 4JKVA 3X1OA 1WOLA 3UNGC 1PCXA 2AP3A 2EPKX 3JSZA 3W2WA 2DI3A 2QE9A 1BR1A 2Y3BA 3EZIA 4I1MA 4MVUA 1Q0DA 1OQCA 4OD4A 5GPGB 4DBRA 5KYWA 4P9TA 1WASA 5D91A 1GGQA 3C7JA 4NC3A 2C04A 3F47A 2XS1A 3RVZA 2ZD9A 4YT5A 3ASNC 4DRIB 3NYLA 3G4ZA 3FAPB 3N0TA 3QW0A 2F22A 4ONSA 1S05A 1F1MA 4XPYA 4XTKA 2R7WA 2HMQA 3C8GD 3C8GB 1E86A 4LDKA 4KC9A 3OWTA 1TFOB 4DVZA 1FMVA 1XZPA 2WZLA 4NTFA 2HJ3A 2HS5A 5CI8A 3U0CA 2YWAA 2JD3A 3TJ5A 1ZZPA 2QNLA 2WZGA 2QLAA 1Q0FA 3A9CA 1TWHA 3F46A 3GODA 3ITFA 4YL1A 2J7PA 2YHSA 2HJMA 5DS4A 2XRHA 1D1CA 1YDIA 2XSEA 5B3IA 2OG2A 3K66A 2Q00A 2QUPA 2VCCA 4PJLA 3VAYA 1PV3A 5DS6A 5JT4A 3A11A 2XLHA 1IZMA 1WN0A 1U6HA 2H8AA 3ZSUA 3TOMA 3JSEO 1EQ1A 2KK1A 3I5PA 3MYFA 4IWBA 3KKBA 1KTMA 2R02A 3GEEA 1DOVA 3IQTA 2VCAA 4OINF 4RD9A 2L6GA 3C62A 1QVXA 3RW0A 1AUEA 2OEVA 3L0IA 3G50A 2V3CC 1SR2A 1YA9A 4EBKA 2IOQA 3EFOB 3NMKA 4IJJA 4U5CE 4AE4B 5JVEA 1CGOA 4K0DA 2R9RB 5COGA 4ZLCA 4YJWA 2PF4E 4MQ9F 2EPLX 5BUOA 2YLGA 2Q7RA 2XL4A 4G7HF 1B68A 2KW3C 5HSWA 1JPNA 4OIPF 2UUIA 3UGOA 1TWCA 2A69F 1WTYA 2Z15A 3W8HA 4KI2A 3O10A 4EIYA 2PP4A 5L0DA 1OXKA 1QZXA 3U3BA 2R05A 3JT1A 2IXOA 3JZ0A 1Z3IX 3FHDA 3JYYA 3S27A 1U0BB 2KGOA 4XLNF 4G7ZF 1O5HA 4AX2A 5A6BD 2OCCC 2XXAB 3U8VA 3EFOA 1YLMA 1NLXA 1OXBA 1SZIA 2HV7A 4XEFA 3SZRA 2YL1A 3FMSA 5F5HA 3WHNA 1JR8A 2P61A 3AG4C 5COMA 3ABMC 1NBBA 3LJBA 2Y3HA 4HFFB 4PJJA 5AGFA 3R7CA 1BBHA 2J46A 4QDLA 4BEMJ 4FWVA 2VH3A 1VLSA 3SP1A 3Q7LA 3O6XA 4IRUA 1JMWA 1Z5ZA 2B0JA 2KQ9A 2IXMA 2P6VA 4QI2A 2YLDA 4GEHA 1GS9A 4CS8A 5KYXB 2A1DD 3AGTA 1JOGA 5L3QA 3EPVA 4Z9HA 5A6BA 2WZFA 3DE9A 1FMWA 4ER9A 1Z6AA 2G62A 2MYSA 3AJMA 3HTKC 1K05A 3K1HA 2XLMA 1NSGB 3K1IA 3VRCA 4C7OA 5COFA 1D1AA 1RKCA 4DRJB 1R4TA 3B29A 2CNWD 4P6IC 2X0CA 2BC5A 4CSAC 3HNIA 3EH2A 1NFNA 2L6HA 3C18A 1NU9C 1I4YA 3EHNA 1TKNA 2EILC 4HE8D 2WVOA 2ZXOA 3RKOF 2PX0A 1OR2A 3DM5A 3EJNA 1Y4CA 2J7PD 3AOUA 3LEVA 5EHHA 5TJ5E 5L0FA 3S0XA 4MVSA 3GM3A 2ICWG 4MS2A 1ZYRF 1WATA 2X51A 1Z63A 2XLVA 1H9GA 4OIRF 3ZTMA 1EKYA 3AG1C 4Q5SF 2QY9A 2EPMX 3K33A 1WGWA 1MQVA 2Q9BA 4FX5A 3V5ZA 3ABLC 3E70C 3RQGA 3EQLF 4U9EA 1QKRA 4JVSA 1RJ9A 2HKVA 1L3PA 5A69A 2WL8A 2H7BA 2R7OA 2R7QA 1BZ4A 2YVKA 2I8BA 4O79A 4U5GA 2UUHA 2A68F 2OJED 4D4XA 1E83A 4LACB 3IHUA 1V4AA 4YL3A 1VLTA 2E87A 3Q6NA 1JPJA 4O6NA 2OOCA 5K0IA 1APCA 1EI7A 1Q0GA 1T5OA 2J9VA 3JCUQ 4JTAB 4D4NA 2A0UA 1JAFA 1A41A 3DMDA 2XM0A 2XM4A 2VASA 3L8JA 1OW8A 2HFIA 2OQMA 3DAFA 3M4CA 4DRHB 1ZW3A 4YT4A 1RJ9B 1LM3B 2ZXPA 3CSKA 4XWJA 2ASRA 1EA8A 3H65A 4GQHA 5CI9A 1RKEB 5BQGA 5JSLA 5BQHA 1RMVA 3OEOA 5E2QA 1E2XA 3WG7C 2AWYA 5KYNA 1LE4A 3LS0A 4CS7A 3QVYA 2FAPB 4PR9A 3ZQVA 5AC5A 1A0BA 3FVYA 3M79A 4E0IA 5DQTA 4XEKA 1S7ZA 4FAPB 2L6FA 1D0YA 1T01A 4XPXA 3US6A 2YEVA 5JUAA 2OKUA 3SXZA 1FFHA 1M56C 2Y69C 3GWNA 2LFDA 2P7VA 3RQEA 1DOWA 2I15A 1M2OA 1ORSC 4YN0B 4CBEA 3RF3A 1RKEA 4Z9IA 1U89A 1V74B 4CS9C 3DI5A 1MMGA 3RQFA 5AC4A 4BJTA 3TD7A 5EGYA 4CS9A 3DJUB 3DJNB 2RD9A 2XL6A 5B1AC 2G3VA 3PMRA 2WVQA 4E7ZA 1XWJA 2J45A 4XLPF 3EGDB 3IQ5A 2MWQA 2YLIA 5L0IA 2EINC 3ASOC 2OU6A 3C63A 3TQOA 4C3DA 3DAGA 4R32A 1ORYA 5HV9A 2A6HF 2D5RB 2YL3A 4CIPA 1HMOA 2IXNA 3NMIA 5CIVA 2Q3TA 4J30B 3IQCA 3LEOA 1LPEA 4J7TA 5D92A 2OJQA 4XPWA 3X2QC 1G8XA 4JTCB 3ZC4A 2HSQA 2KC3A 4OIOF 3QZCA 3R2PA 1MNDA 5KYWB 3NMJA 3LLIA 2LQGA 2KSFA 5A6KA 1ZU5A 4QI0A 2JPUA 3SXMA 2TMVP 1LE2A 4I1OB 3FOOA 1VB5A 1YYXA 4MNDA 3KL4A 4A2NB 2XS8A 3I4UA 4JEAA 2BE5F 3JYHA 1LVKA 1BR2A 3QTHA 3WODF 4LLCA 4PK4A 3S9OA 3LNMB 3CZ6A 3HLZA 3I5QA 2ZPAA 1A7EA 1RCPA 2D4UA 4N4WA 3GEIA 1SF8A 4BG0A 5A6JA 1G4WR 1FAPB 4BJ6A 3M15A 2XLOA 4EKWA 1FR0A 3L34A 4XEVA 4MTOA 3Q6MA 3UR3C 4Z9JA 1T6QA 2WB7A 1XZQA 2IM8A 1HE9A 1Q0KA 1UG7A 3CQZA 2XXAA 1BDJB 3SNHA 3V5XA 4YWQA 2KJGA 1AVOB 4K1OA 3ZIBA 4C3EA 2DYSC 2R7RA 1RXQA 4PJMA 1G4US 2CNWA 2P1AA 1Z7Qc 4JJFA 3DE8A 3NDBB 1Y6DA 3EHMA 1D1BA 1D0XA 4E18A 1N1CA 1LKXA 2DGJA 1QLEC 2H7VC 3NKDA 2R25A 3QMKA 3NKEA 3W2VA 4O6YA 1TWGA 1GM5A 1J8MF 2YRFA 1OR3A 3AGUA 3KYIA 3VM6A 2PFDA 1I5NA 2W9YA 1NU7D 3U2LA 4F4BA 4L6RA 2R7TA 2WVNA 4AL0A 2R7XA 5L3VA 5KYXA 2G3KA 3UMHA 4G0HA 2NG1A 4AE4A 1M6TA 4Q4ZF 3DKAA 5L0HA 1HMDA 2CDQA 3LNRA 1O87A 2EPOA 3MBGA 1CPQA 3E9VA 1OCCC 4G7OF 4C7OB 1NFOA 3DXJF 4U5FE 1LI7A 4BPMA 3EG9A 2A0BA 1D0ZA 1GQAA 1ST6A 2EIKC 1ZHTA 2YKZA 5E3AA 5T1DB 2XLDA 3C8ZA 3GANA 4WABA 3TOLA 2XL8A 3K6BA 2J9BA 3NYMA 4M63A 4W8PA 4X0RA 3CAXA 2W4BA 4PJNA 3LLKA 3T4RA 1MNEA 3RVYA 4BEJA 1FNTc 2LFFA 4HFKB 2R7UA 4RDAA 1HY5A 2HZ8A 3DD7A 3ZQYA 3DZAA 4C3BA 2J9WA 2PBEA 4PFOA 1FTSA 2P0NA 1M57C 1ZVZA 4JTDB 4MVZA 5DVWA 3NG1A 4MVRA 3U8PA 2CYDA 3ZVRA 5A6AA 3BRJA 4CDAA 5JRAA 3S84A 2XLWA 3KPHA 4CJGA 2Q4FA 1K40A 1LS4A 1HW1A 3U2MA 4GYTA 2NUPA 1I4ZA 2O9XA 3JRMO 3SXYA 1QPUA 3B71A 3L8IA 4AK9A 5DS5A 4NTBA 4MTFA 2NUTA 2YZSA 4BJ6C 3M1CB 1SMYF 2HUJA 1OCOC 4JC7A 4YL0A 2A6EF 1OCRC 2IYLD 4I3MA 4MVQA 2V26A 4NTAA 3GM2A 2M64A 4IAOA 3O55A 4MVOA 4CJOA 2LIGA 3ATPA 1CGNA 2YL7A 2GFHA 2HMZA 5B1BC 4DOZA 3EH1A 3N2ZB 3O39A 4O6MA 2R7VA 4E7SA 3LUTB 4E0HA 5F5FA 3ZDLA 2YL0A 2CGEA 3PHF2 2C03A 2AU5A 4P9FA 4N06A 4UDVA 1A7VA 1L7CA 4JRZA 4KNVA 1IW7F 1A7DA 2L9JA 3WAQA 1VMAA 1OW7A 4H4KC 3ZTZA 5DQZA 4AL1A 1LIHA 4O7GA 5DLJA 3EGXB 5KYYB 3W4YA 3V5YA 3EZHA 1E85A 2BL2A 3IEEA 3NRHA 4FESA 3AG3C 5EK0A 3RIPA 4OD5A 3T6GB 4EBJA 1OW6A 3ABKC 4NCQA 4PFPA 1Z23A 1ZHZA 3S28A 3PCVA 1ZHWA 4CS8C 3GWLA 5L0CA 1OCZC 3TK0A 2AWCA 1WWPA 2IBFA 4E17A 3MX3A 5T3TA 1NG1A 5BQIA 3TULA 4JCZA 4JEBA 3FAJA 1M2VA 2Y39A 1R5ID 256BA 3HKKA 3K7DA 3U5SA 3EGXA 4DJ9A 1H9TA 3SXKA 3EGDA 1MMDA 4LDQA 1QSPA 4MW3A 1YZCA 4J7YA 1ORJA 2ETSA 4A4AA 2R7SA 5KYYA 1YARO 3HNKA 4JE9A 3DM9B 5F28E 4IAQA 1CGME 2LSEA 2DB4A 4ULVA 1UFBA 1PD1A 2J9UA 3T9OA 1VYKA 3B9QA 1K04A 1YZAA 3GORA 4PACA 4BJ5A 3POVA 5L0JA 1KU2A 3HNJA 2HSBA 1W2WA 2W4MA 4NQFA 1CPRA 4EHPA 4DXWA 2J8WA 2FFHA 1PD0A 2M4EA 3FOPA 3U9MA 1M2VB 2L81A 4RBNA 3AG2C 2VCBA 2CW0F 3SEOA 3QVZA 3KH2A 1NZEA 3H2UA 1T6UA 4MTGA 2YQYA 3QW1A 2LP4A 3GEHA 4KNWA 4JZAA 4EBBA 4DVYP 4XQ1A 1TFKB 2GDCA 1ZU4A 3M4BA 3UMKA 2NSGA 3T6JA 2AVKA 3JTLO 3S29A 4WGYA 2QTVA 4NY3A 4WGZA 3S90A 1MMNA 1G5ZA 1V55C 2L7AA 3FXHA 2RSEB 4BJ1A 2CCYA 2NPUA 3G4XA 4JURI 4WJ0A 2HV6A 4IARA 5KYUB 3SYNA 1FFTC 4B6IA 5JLIA 3J06A 3RFYA 2W45A 3MFNA
chains in the Genus database with same CATH topology
3DKAA 2YQYA 5COMA 4N6CA 5COGA 2QNLA 1RXQA 2NSGA 2P1AA 3DI5A 2QE9A 2OQMA 3GORA 3CEXA 2RD9A 3QTHA 2HKVA 2OU6A 2NSFA 2F22A 5COFA 5CIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKA A;  2YQY A;  5COM A;  4N6C A;  5COG A;  2QNL A;  1RXQ A;  2NSG A;  2P1A A;  3DI5 A;  2QE9 A;  2OQM A;  3GOR A;  3CEX A;  2RD9 A;  3QTH A;  2HKV A;  2OU6 A;  2NSF A;  2F22 A;  5COF A;  5CIV A; 
#chains in the Genus database with same CATH topology
 1QQ3 A;  3HNL A;  5E33 A;  5IY5 C;  3VF0 A;  1JRA A;  2PX3 A;  3H2V A;  3LES A;  5E3C A;  1VYI A;  4YT8 A;  5B3S C;  3MLG A;  1YJG A;  4CDY A;  1VK5 A;  1H7I A;  4ZLD A;  1YAU O;  5FCL A;  5T3W A;  3RH3 A;  5L0G A;  2B0H A;  1T9K A;  4W8K A;  2J0X A;  3T6B A;  1O3U A;  1TR2 A;  1VTM P;  4CDV A;  2LK4 A;  3MYI A;  3B0U X;  4ULW A;  1SYQ A;  3DWW A;  3RYL A;  4CIH A;  4H54 A;  5JP7 A;  2J0W A;  4DBQ A;  2VB6 A;  1V54 C;  2Y3G A;  4J32 B;  3ZWI A;  5KYU A;  1AEP A;  2ZXR A;  1TQG A;  3HJC A;  3AQC A;  4MW8 A;  2IXP A;  3B0V C;  3ZG1 A;  1TWA A;  3OA1 A;  4N6H A;  3NYJ A;  3U9J A;  1OKK A;  4BJ5 C;  3UGP A;  1LS1 A;  3K1I C;  1HW2 A;  3VYW A;  4CX9 A;  4CSA A;  2OEX A;  1C03 A;  1ZHX A;  4LER A;  2Q9A A;  2EPN A;  2XLE A;  1VOM A;  3JRT A;  4JJG A;  2Y3D A;  2LD6 A;  1C02 A;  1H6G A;  1MMA A;  4N6C A;  3L1M A;  4JW1 A;  1E84 A;  2EIJ C;  2R03 A;  3UMI A;  2LCH A;  1OKK D;  2GA0 A;  2Q9C A;  3IQ6 A;  1YA7 O;  3KMI A;  4U9D A;  1Q0M A;  1J8Y F;  2GAQ A;  1ZHY A;  4U5E E;  4YK5 A;  4ANJ A;  2FGY A;  1YVI A;  2EIM C;  3CEX A;  2VC9 A;  2KNH A;  2PNO A;  4U5H A;  1LI5 A;  3FDQ A;  2NUP B;  4KBL A;  3BEH A;  4K7B A;  3LAY A;  4OIQ F;  3U3F A;  4IGG A;  3N24 A;  3PDM P;  2NUT B;  3KYJ A;  5JS5 A;  3AQB A;  1BR4 A;  2DYR C;  4U5D E;  4YT2 A;  2NSF A;  4Q7C A;  4U5B E;  1T6I A;  3B0P A;  4IB4 A;  3Q7G A;  5FZT A;  4HEA J;  3ECS A;  3IPM O;  1HE1 A;  4MVM A;  4JCH A;  3C8G A;  1KNY A;  2ZXW C;  4EUK B;  2KYH A;  2MHR A;  3EG9 B;  4EWC A;  4LDR A;  1C17 M;  2GWW A;  4G78 A;  4LLE A;  3TJ6 A;  2JX0 A;  1ZW2 A;  4JIO A;  3V7O A;  3GM1 A;  3W8I A;  3LS1 A;  1YYJ A;  2H7O A;  4I44 A;  4JKV A;  3X1O A;  1WOL A;  3UNG C;  1PCX A;  2AP3 A;  2EPK X;  3JSZ A;  3W2W A;  2DI3 A;  2QE9 A;  1BR1 A;  2Y3B A;  3EZI A;  4I1M A;  4MVU A;  1Q0D A;  1OQC A;  4OD4 A;  5GPG B;  4DBR A;  5KYW A;  4P9T A;  1WAS A;  5D91 A;  1GGQ A;  3C7J A;  4NC3 A;  2C04 A;  3F47 A;  2XS1 A;  3RVZ A;  2ZD9 A;  4YT5 A;  3ASN C;  4DRI B;  3NYL A;  3G4Z A;  3FAP B;  3N0T A;  3QW0 A;  2F22 A;  4ONS A;  1S05 A;  1F1M A;  4XPY A;  4XTK A;  2R7W A;  2HMQ A;  3C8G D;  3C8G B;  1E86 A;  4LDK A;  4KC9 A;  3OWT A;  1TFO B;  4DVZ A;  1FMV A;  1XZP A;  2WZL A;  4NTF A;  2HJ3 A;  2HS5 A;  5CI8 A;  3U0C A;  2YWA A;  2JD3 A;  3TJ5 A;  1ZZP A;  2QNL A;  2WZG A;  2QLA A;  1Q0F A;  3A9C A;  1TWH A;  3F46 A;  3GOD A;  3ITF A;  4YL1 A;  2J7P A;  2YHS A;  2HJM A;  5DS4 A;  2XRH A;  1D1C A;  1YDI A;  2XSE A;  5B3I A;  2OG2 A;  3K66 A;  2Q00 A;  2QUP A;  2VCC A;  4PJL A;  3VAY A;  1PV3 A;  5DS6 A;  5JT4 A;  3A11 A;  2XLH A;  1IZM A;  1WN0 A;  1U6H A;  2H8A A;  3ZSU A;  3TOM A;  3JSE O;  1EQ1 A;  2KK1 A;  3I5P A;  3MYF A;  4IWB A;  3KKB A;  1KTM A;  2R02 A;  3GEE A;  1DOV A;  3IQT A;  2VCA A;  4OIN F;  4RD9 A;  2L6G A;  3C62 A;  1QVX A;  3RW0 A;  1AUE A;  2OEV A;  3L0I A;  3G50 A;  2V3C C;  1SR2 A;  1YA9 A;  4EBK A;  2IOQ A;  3EFO B;  3NMK A;  4IJJ A;  4U5C E;  4AE4 B;  5JVE A;  1CGO A;  4K0D A;  2R9R B;  5COG A;  4ZLC A;  4YJW A;  2PF4 E;  4MQ9 F;  2EPL X;  5BUO A;  2YLG A;  2Q7R A;  2XL4 A;  4G7H F;  1B68 A;  2KW3 C;  5HSW A;  1JPN A;  4OIP F;  2UUI A;  3UGO A;  1TWC A;  2A69 F;  1WTY A;  2Z15 A;  3W8H A;  4KI2 A;  3O10 A;  4EIY A;  2PP4 A;  5L0D A;  1OXK A;  1QZX A;  3U3B A;  2R05 A;  3JT1 A;  2IXO A;  3JZ0 A;  1Z3I X;  3FHD A;  3JYY A;  3S27 A;  1U0B B;  2KGO A;  4XLN F;  4G7Z F;  1O5H A;  4AX2 A;  5A6B D;  2OCC C;  2XXA B;  3U8V A;  3EFO A;  1YLM A;  1NLX A;  1OXB A;  1SZI A;  2HV7 A;  4XEF A;  3SZR A;  2YL1 A;  3FMS A;  5F5H A;  3WHN A;  1JR8 A;  2P61 A;  3AG4 C;  5COM A;  3ABM C;  1NBB A;  3LJB A;  2Y3H A;  4HFF B;  4PJJ A;  5AGF A;  3R7C A;  1BBH A;  2J46 A;  4QDL A;  4BEM J;  4FWV A;  2VH3 A;  1VLS A;  3SP1 A;  3Q7L A;  3O6X A;  4IRU A;  1JMW A;  1Z5Z A;  2B0J A;  2KQ9 A;  2IXM A;  2P6V A;  4QI2 A;  2YLD A;  4GEH A;  1GS9 A;  4CS8 A;  5KYX B;  2A1D D;  3AGT A;  1JOG A;  5L3Q A;  3EPV A;  4Z9H A;  5A6B A;  2WZF A;  3DE9 A;  1FMW A;  4ER9 A;  1Z6A A;  2G62 A;  2MYS A;  3AJM A;  3HTK C;  1K05 A;  3K1H A;  2XLM A;  1NSG B;  3K1I A;  3VRC A;  4C7O A;  5COF A;  1D1A A;  1RKC A;  4DRJ B;  1R4T A;  3B29 A;  2CNW D;  4P6I C;  2X0C A;  2BC5 A;  4CSA C;  3HNI A;  3EH2 A;  1NFN A;  2L6H A;  3C18 A;  1NU9 C;  1I4Y A;  3EHN A;  1TKN A;  2EIL C;  4HE8 D;  2WVO A;  2ZXO A;  3RKO F;  2PX0 A;  1OR2 A;  3DM5 A;  3EJN A;  1Y4C A;  2J7P D;  3AOU A;  3LEV A;  5EHH A;  5TJ5 E;  5L0F A;  3S0X A;  4MVS A;  3GM3 A;  2ICW G;  4MS2 A;  1ZYR F;  1WAT A;  2X51 A;  1Z63 A;  2XLV A;  1H9G A;  4OIR F;  3ZTM A;  1EKY A;  3AG1 C;  4Q5S F;  2QY9 A;  2EPM X;  3K33 A;  1WGW A;  1MQV A;  2Q9B A;  4FX5 A;  3V5Z A;  3ABL C;  3E70 C;  3RQG A;  3EQL F;  4U9E A;  1QKR A;  4JVS A;  1RJ9 A;  2HKV A;  1L3P A;  5A69 A;  2WL8 A;  2H7B A;  2R7O A;  2R7Q A;  1BZ4 A;  2YVK A;  2I8B A;  4O79 A;  4U5G A;  2UUH A;  2A68 F;  2OJE D;  4D4X A;  1E83 A;  4LAC B;  3IHU A;  1V4A A;  4YL3 A;  1VLT A;  2E87 A;  3Q6N A;  1JPJ A;  4O6N A;  2OOC A;  5K0I A;  1APC A;  1EI7 A;  1Q0G A;  1T5O A;  2J9V A;  3JCU Q;  4JTA B;  4D4N A;  2A0U A;  1JAF A;  1A41 A;  3DMD A;  2XM0 A;  2XM4 A;  2VAS A;  3L8J A;  1OW8 A;  2HFI A;  2OQM A;  3DAF A;  3M4C A;  4DRH B;  1ZW3 A;  4YT4 A;  1RJ9 B;  1LM3 B;  2ZXP A;  3CSK A;  4XWJ A;  2ASR A;  1EA8 A;  3H65 A;  4GQH A;  5CI9 A;  1RKE B;  5BQG A;  5JSL A;  5BQH A;  1RMV A;  3OEO A;  5E2Q A;  1E2X A;  3WG7 C;  2AWY A;  5KYN A;  1LE4 A;  3LS0 A;  4CS7 A;  3QVY A;  2FAP B;  4PR9 A;  3ZQV A;  5AC5 A;  1A0B A;  3FVY A;  3M79 A;  4E0I A;  5DQT A;  4XEK A;  1S7Z A;  4FAP B;  2L6F A;  1D0Y A;  1T01 A;  4XPX A;  3US6 A;  2YEV A;  5JUA A;  2OKU A;  3SXZ A;  1FFH A;  1M56 C;  2Y69 C;  3GWN A;  2LFD A;  2P7V A;  3RQE A;  1DOW A;  2I15 A;  1M2O A;  1ORS C;  4YN0 B;  4CBE A;  3RF3 A;  1RKE A;  4Z9I A;  1U89 A;  1V74 B;  4CS9 C;  3DI5 A;  1MMG A;  3RQF A;  5AC4 A;  4BJT A;  3TD7 A;  5EGY A;  4CS9 A;  3DJU B;  3DJN B;  2RD9 A;  2XL6 A;  5B1A C;  2G3V A;  3PMR A;  2WVQ A;  4E7Z A;  1XWJ A;  2J45 A;  4XLP F;  3EGD B;  3IQ5 A;  2MWQ A;  2YLI A;  5L0I A;  2EIN C;  3ASO C;  2OU6 A;  3C63 A;  3TQO A;  4C3D A;  3DAG A;  4R32 A;  1ORY A;  5HV9 A;  2A6H F;  2D5R B;  2YL3 A;  4CIP A;  1HMO A;  2IXN A;  3NMI A;  5CIV A;  2Q3T A;  4J30 B;  3IQC A;  3LEO A;  1LPE A;  4J7T A;  5D92 A;  2OJQ A;  4XPW A;  3X2Q C;  1G8X A;  4JTC B;  3ZC4 A;  2HSQ A;  2KC3 A;  4OIO F;  3QZC A;  3R2P A;  1MND A;  5KYW B;  3NMJ A;  3LLI A;  2LQG A;  2KSF A;  5A6K A;  1ZU5 A;  4QI0 A;  2JPU A;  3SXM A;  2TMV P;  1LE2 A;  4I1O B;  3FOO A;  1VB5 A;  1YYX A;  4MND A;  3KL4 A;  4A2N B;  2XS8 A;  3I4U A;  4JEA A;  2BE5 F;  3JYH A;  1LVK A;  1BR2 A;  3QTH A;  3WOD F;  4LLC A;  4PK4 A;  3S9O A;  3LNM B;  3CZ6 A;  3HLZ A;  3I5Q A;  2ZPA A;  1A7E A;  1RCP A;  2D4U A;  4N4W A;  3GEI A;  1SF8 A;  4BG0 A;  5A6J A;  1G4W R;  1FAP B;  4BJ6 A;  3M15 A;  2XLO A;  4EKW A;  1FR0 A;  3L34 A;  4XEV A;  4MTO A;  3Q6M A;  3UR3 C;  4Z9J A;  1T6Q A;  2WB7 A;  1XZQ A;  2IM8 A;  1HE9 A;  1Q0K A;  1UG7 A;  3CQZ A;  2XXA A;  1BDJ B;  3SNH A;  3V5X A;  4YWQ A;  2KJG A;  1AVO B;  4K1O A;  3ZIB A;  4C3E A;  2DYS C;  2R7R A;  1RXQ A;  4PJM A;  1G4U S;  2CNW A;  2P1A A;  1Z7Q c;  4JJF A;  3DE8 A;  3NDB B;  1Y6D A;  3EHM A;  1D1B A;  1D0X A;  4E18 A;  1N1C A;  1LKX A;  2DGJ A;  1QLE C;  2H7V C;  3NKD A;  2R25 A;  3QMK A;  3NKE A;  3W2V A;  4O6Y A;  1TWG A;  1GM5 A;  1J8M F;  2YRF A;  1OR3 A;  3AGU A;  3KYI A;  3VM6 A;  2PFD A;  1I5N A;  2W9Y A;  1NU7 D;  3U2L A;  4F4B A;  4L6R A;  2R7T A;  2WVN A;  4AL0 A;  2R7X A;  5L3V A;  5KYX A;  2G3K A;  3UMH A;  4G0H A;  2NG1 A;  4AE4 A;  1M6T A;  4Q4Z F;  3DKA A;  5L0H A;  1HMD A;  2CDQ A;  3LNR A;  1O87 A;  2EPO A;  3MBG A;  1CPQ A;  3E9V A;  1OCC C;  4G7O F;  4C7O B;  1NFO A;  3DXJ F;  4U5F E;  1LI7 A;  4BPM A;  3EG9 A;  2A0B A;  1D0Z A;  1GQA A;  1ST6 A;  2EIK C;  1ZHT A;  2YKZ A;  5E3A A;  5T1D B;  2XLD A;  3C8Z A;  3GAN A;  4WAB A;  3TOL A;  2XL8 A;  3K6B A;  2J9B A;  3NYM A;  4M63 A;  4W8P A;  4X0R A;  3CAX A;  2W4B A;  4PJN A;  3LLK A;  3T4R A;  1MNE A;  3RVY A;  4BEJ A;  1FNT c;  2LFF A;  4HFK B;  2R7U A;  4RDA A;  1HY5 A;  2HZ8 A;  3DD7 A;  3ZQY A;  3DZA A;  4C3B A;  2J9W A;  2PBE A;  4PFO A;  1FTS A;  2P0N A;  1M57 C;  1ZVZ A;  4JTD B;  4MVZ A;  5DVW A;  3NG1 A;  4MVR A;  3U8P A;  2CYD A;  3ZVR A;  5A6A A;  3BRJ A;  4CDA A;  5JRA A;  3S84 A;  2XLW A;  3KPH A;  4CJG A;  2Q4F A;  1K40 A;  1LS4 A;  1HW1 A;  3U2M A;  4GYT A;  2NUP A;  1I4Z A;  2O9X A;  3JRM O;  3SXY A;  1QPU A;  3B71 A;  3L8I A;  4AK9 A;  5DS5 A;  4NTB A;  4MTF A;  2NUT A;  2YZS A;  4BJ6 C;  3M1C B;  1SMY F;  2HUJ A;  1OCO C;  4JC7 A;  4YL0 A;  2A6E F;  1OCR C;  2IYL D;  4I3M A;  4MVQ A;  2V26 A;  4NTA A;  3GM2 A;  2M64 A;  4IAO A;  3O55 A;  4MVO A;  4CJO A;  2LIG A;  3ATP A;  1CGN A;  2YL7 A;  2GFH A;  2HMZ A;  5B1B C;  4DOZ A;  3EH1 A;  3N2Z B;  3O39 A;  4O6M A;  2R7V A;  4E7S A;  3LUT B;  4E0H A;  5F5F A;  3ZDL A;  2YL0 A;  2CGE A;  3PHF 2;  2C03 A;  2AU5 A;  4P9F A;  4N06 A;  4UDV A;  1A7V A;  1L7C A;  4JRZ A;  4KNV A;  1IW7 F;  1A7D A;  2L9J A;  3WAQ A;  1VMA A;  1OW7 A;  4H4K C;  3ZTZ A;  5DQZ A;  4AL1 A;  1LIH A;  4O7G A;  5DLJ A;  3EGX B;  5KYY B;  3W4Y A;  3V5Y A;  3EZH A;  1E85 A;  2BL2 A;  3IEE A;  3NRH A;  4FES A;  3AG3 C;  5EK0 A;  3RIP A;  4OD5 A;  3T6G B;  4EBJ A;  1OW6 A;  3ABK C;  4NCQ A;  4PFP A;  1Z23 A;  1ZHZ A;  3S28 A;  3PCV A;  1ZHW A;  4CS8 C;  3GWL A;  5L0C A;  1OCZ C;  3TK0 A;  2AWC A;  1WWP A;  2IBF A;  4E17 A;  3MX3 A;  5T3T A;  1NG1 A;  5BQI A;  3TUL A;  4JCZ A;  4JEB A;  3FAJ A;  1M2V A;  2Y39 A;  1R5I D;  256B A;  3HKK A;  3K7D A;  3U5S A;  3EGX A;  4DJ9 A;  1H9T A;  3SXK A;  3EGD A;  1MMD A;  4LDQ A;  1QSP A;  4MW3 A;  1YZC A;  4J7Y A;  1ORJ A;  2ETS A;  4A4A A;  2R7S A;  5KYY A;  1YAR O;  3HNK A;  4JE9 A;  3DM9 B;  5F28 E;  4IAQ A;  1CGM E;  2LSE A;  2DB4 A;  4ULV A;  1UFB A;  1PD1 A;  2J9U A;  3T9O A;  1VYK A;  3B9Q A;  1K04 A;  1YZA A;  3GOR A;  4PAC A;  4BJ5 A;  3POV A;  5L0J A;  1KU2 A;  3HNJ A;  2HSB A;  1W2W A;  2W4M A;  4NQF A;  1CPR A;  4EHP A;  4DXW A;  2J8W A;  2FFH A;  1PD0 A;  2M4E A;  3FOP A;  3U9M A;  1M2V B;  2L81 A;  4RBN A;  3AG2 C;  2VCB A;  2CW0 F;  3SEO A;  3QVZ A;  3KH2 A;  1NZE A;  3H2U A;  1T6U A;  4MTG A;  2YQY A;  3QW1 A;  2LP4 A;  3GEH A;  4KNW A;  4JZA A;  4EBB A;  4DVY P;  4XQ1 A;  1TFK B;  2GDC A;  1ZU4 A;  3M4B A;  3UMK A;  2NSG A;  3T6J A;  2AVK A;  3JTL O;  3S29 A;  4WGY A;  2QTV A;  4NY3 A;  4WGZ A;  3S90 A;  1MMN A;  1G5Z A;  1V55 C;  2L7A A;  3FXH A;  2RSE B;  4BJ1 A;  2CCY A;  2NPU A;  3G4X A;  4JUR I;  4WJ0 A;  2HV6 A;  4IAR A;  5KYU B;  3SYN A;  1FFT C;  4B6I A;  5JLI A;  3J06 A;  3RFY A;  2W45 A;  3MFN A; 
#chains in the Genus database with same CATH homology
 3DKA A;  2YQY A;  5COM A;  4N6C A;  5COG A;  2QNL A;  1RXQ A;  2NSG A;  2P1A A;  3DI5 A;  2QE9 A;  2OQM A;  3GOR A;  3CEX A;  2RD9 A;  3QTH A;  2HKV A;  2OU6 A;  2NSF A;  2F22 A;  5COF A;  5CIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...