5COMA

Crystal structure of uncharacterized protein q187f5 from clostridium difficile 630
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
171
structure length
171
Chain Sequence
b'RVYENKEELKSEINKTFEKYIAEFDNIPESLKDKRIDEVDRTPAENLAYQVGWTTLVLKWEEDERNGLQVKTPSDEFKWNQLGELYQWFTDTYAYLSLQELKSKLNENINSIYVMIDSLSDEELFKPHMRKWADDATKTAVWEVYKFIHVNTVAPFKTFRNKIRKWKKIVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative conjugative transposon protein Tn1549-like, CTn5-Or
molecule tags Unknown function
source organism Peptoclostridium difficile 630
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
total genus 74
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5comA00
3CEXA 2YQYA 5COMA 2NSGA 2NSFA 5COFA 2HKVA 5CIVA 4N6CA 3DI5A 1RXQA 2QNLA 2QE9A 3DKAA 2P1AA 2OQMA 5COGA 2RD9A 3GORA 2F22A 3QTHA 2OU6A
chains in the Genus database with same CATH superfamily
5A6KA 3EH1A 1B68A 2BE5F 2V26A 2ZXPA 5D91A 4AX2A 4ER9A 1IZMA 3DZAA 3OEOA 1ZHYA 1JRAA 1NFNA 1AEPA 5KYWB 1E85A 2QY9A 2ASRA 2E87A 2R7WA 4JURI 3S27A 1V4AA 3JRMO 3NYJA 4CJGA 3C8GA 5E3AA 3DAFA 4J30B 4AL1A 5A69A 3DMDA 1JAFA 2XXAA 1HW1A 4NTFA 2EPNA 3NKEA 5F28E 2KW3C 1W2WA 2R7XA 1S7ZA 2JPUA 2CYDA 3NYMA 3QZCA 4DRJB 4DOZA 4GEHA 4YT2A 2V3CC 5CI8A 4QI2A 2XM0A 1L3PA 1MNDA 3EH2A 3JYYA 1OW8A 1LE2A 2IXMA 2RD9A 2R03A 1HMOA 3DXJF 1BR1A 4JZAA 3RIPA 4C7OA 3EGDA 2KJGA 2Y3BA 2WL8A 3HNIA 3KYJA 3UMKA 5COMA 1JPNA 4K0DA 4JVSA 3ZQYA 1SZIA 2EIMC 2L6FA 3CZ6A 3DE8A 1TKNA 3KH2A 1VB5A 2OJQA 3K7DA 3UNGC 4U9DA 2XLHA 2R7OA 1C17M 3MLGA 5KYXB 3S84A 1HW2A 3AOUA 3GANA 3AGUA 2A6HF 2XXAB 3ZTZA 1T6UA 3RVYA 4CX9A 2QNLA 4IAOA 3C62A 4KI2A 1V54C 3IQ5A 3EQLF 2G3VA 5L0CA 3ASOC 5A6BD 1LS4A 3KYIA 3EPVA 2J46A 1NFOA 4JC7A 3FAJA 3K1IC 3QMKA 4JRZA 4M63A 4PJLA 3ZC4A 5KYWA 3FOPA 3HTKC 4HFFB 1FAPB 3RFYA 1VLSA 3G4XA 1FFTC 4MVQA 4BJ5A 2LFFA 1EI7A 5B3SC 2XM4A 1RJ9A 2W4MA 1FMWA 1RKEB 3KMIA 3NG1A 1OR2A 4I1OB 4O6YA 4U5HA 4J7YA 3AQCA 2BL2A 4BJ6C 1ORYA 4CS8A 4CSAA 2VCCA 2R7RA 3DM9B 4WJ0A 1VYKA 1ZHWA 3SXZA 5EHHA 3EG9A 4P9TA 1R4TA 3AQBA 5DS5A 1XZQA 4Z9HA 1T9KA 3M4CA 1ORJA 4HEAJ 3T6GB 3B0VC 3T6BA 3L8IA 2HMZA 2H7VC 4MTOA 2QE9A 3IQ6A 5T1DB 4XPXA 4IARA 3AJMA 3KKBA 1FFHA 4CS9C 2EPOA 3I5PA 3T4RA 4DXWA 4YL1A 5A6AA 5L0IA 1QPUA 1QVXA 3PHF2 2HV6A 3V5XA 2MYSA 4RDAA 3DE9A 4CIPA 2FFHA 4MW8A 4AE4A 3U3BA 1H9TA 1Y6DA 2OQMA 3K6BA 4JTAB 1YZCA 1NBBA 4YT4A 3QTHA 3ABMC 3LEVA 3S29A 4BG0A 5CI9A 1PD0A 2OG2A 1QZXA 5KYNA 2Q9AA 2OEXA 1ZHZA 2OJED 2R25A 1A41A 5DVWA 3DM5A 4YJWA 3LS1A 5DQZA 3L8JA 1YA9A 4GYTA 3JZ0A 4DBQA 2NUPA 3E70C 2IXNA 2D5RB 4IWBA 3MYFA 4JCHA 5D92A 2HJ3A 5A6JA 4JTDB 2IXPA 1TWAA 1ZU5A 3W4YA 1FTSA 4MNDA 3ZIBA 3LLKA 4CS7A 4E18A 2X0CA 4JEBA 1DOWA 5HSWA 4NCQA 3FAPB 2P0NA 1G8XA 3IPMO 2VB6A 4B6IA 2HUJA 2B0JA 3SZRA 2Q7RA 2L6HA 1BDJB 3HNLA 1LE4A 1K04A 1O5HA 4KC9A 1J8YF 1A0BA 2PBEA 2KGOA 5KYXA 1KNYA 2XLMA 3X1OA 1LPEA 2R7QA 1MQVA 2J8WA 1T01A 1O87A 2XL8A 1NU9C 3CQZA 3AGTA 5F5FA 2IXOA 1A7VA 1M6TA 4PFOA 5KYUB 2MWQA 3DJNB 3G50A 4ULWA 1E83A 2ZXOA 1NLXA 1O3UA 2GWWA 2HSBA 3CAXA 3IQTA 3MFNA 4FESA 4J32B 4JJGA 4JW1A 3U0CA 2D4UA 4N6CA 2PX3A 3ASNC 2AP3A 3B29A 3UMHA 3RQEA 4WGYA 4EBKA 1TR2A 4NC3A 2J9WA 5FCLA 1D0ZA 3ABKC 1GS9A 1TFOB 3NKDA 1M2VB 4P6IC 3ABLC 2RSEB 4XLPF 1Z3IX 3N0TA 4E0IA 3JT1A 4FWVA 4U5FE 4CS8C 4CSAC 3M15A 4JKVA 1A7EA 2NG1A 4XEKA 1RMVA 3LNMB 5JP7A 5B3IA 2MHRA 4U5CE 2PFDA 3EG9B 1EQ1A 5JSLA 1AVOB 4DVYP 2J7PD 2UUHA 2DI3A 3BRJA 4FX5A 3F47A 1OCZC 3ZSUA 1LVKA 1YVIA 5KYYB 1VTMP 1TWGA 4BEJA 1OXBA 3EGXB 2EPKX 2YZSA 2CDQA 4C3BA 3S0XA 5K0IA 3RQGA 2W9YA 2IM8A 3HKKA 2KYHA 1YARO 3FMSA 2YVKA 1YZAA 1RKEA 3UGOA 1OR3A 2UUIA 4EHPA 2KQ9A 3NRHA 2WZLA 1K40A 2LFDA 3HLZA 3U9MA 5E2QA 4GQHA 1HMDA 4MVRA 2PP4A 3U8VA 4ANJA 3PDMP 4CS9A 1M2OA 4MVUA 2XLEA 4E0HA 4EBBA 1CGME 4BJ1A 3H65A 4XLNF 1OQCA 2KC3A 1LIHA 2OOCA 1U0BB 3AG4C 5DQTA 2EPLX 2P6VA 2YWAA 5JS5A 1MMAA 2LQGA 1EA8A 3M1CB 1LS1A 2M64A 1TWCA 1YYXA 2Q3TA 2XLDA 2Y39A 4NTAA 5T3WA 3VM6A 5IY5C 2YEVA 3UMIA 1F1MA 4OINF 3L1MA 5AC5A 2XSEA 1OCOC 3E9VA 4OIQF 1D1CA 1PD1A 3SXYA 3T9OA 4XEVA 4BPMA 1RKCA 4MVMA 3SEOA 4MVOA 4EIYA 4DJ9A 1NG1A 5CIVA 3I5QA 1UG7A 2B0HA 2KK1A 3QVYA 1GGQA 1VYIA 1I5NA 2AVKA 3EHNA 2HS5A 4R32A 2OEVA 5BQGA 2I8BA 2KNHA 3VYWA 1GM5A 3EJNA 4LACB 2ETSA 2WVNA 3HNJA 1E86A 4Q4ZF 3JTLO 4Z9IA 3W8IA 1TWHA 4MQ9F 2DGJA 2GA0A 2G3KA 4EWCA 3NDBB 4C3EA 4CDAA 2JX0A 1D0YA 1YAUO 2XLVA 1BBHA 4P9FA 5COFA 2R05A 3O55A 4XQ1A 3K66A 2ZXRA 1XWJA 4NTBA 3Q7LA 2VCBA 3O10A 4E7SA 4G7OF 2H7BA 4MTFA 3UR3C 2M4EA 2HFIA 3M4BA 2W45A 4RD9A 2VCAA 3FOOA 2NUTA 2Q9BA 3BEHA 3GODA 4YL3A 4XWJA 3X2QC 1T6IA 3K1HA 1QSPA 5FZTA 2FGYA 3C8GD 3DWWA 4DVZA 1APCA 2QLAA 1I4ZA 4EUKB 2WB7A 3MYIA 3TD7A 4C7OB 2XL4A 4WABA 1LM3B 1RCPA 3NMKA 4YT5A 2GAQA 4JEAA 1Q0GA 4X0RA 1Q0KA 4G7HF 1G4US 3ZTMA 3O6XA 4KNWA 1YLMA 2IBFA 4OIRF 3MBGA 3EZIA 2GFHA 3H2VA 1GQAA 5BQHA 3QVZA 1CPQA 4YL0A 4IB4A 4PACA 3WAQA 3R7CA 1FR0A 3VAYA 4YK5A 1XZPA 3GM3A 5DS6A 1ZHXA 4WGZA 2EILC 3L34A 4JIOA 2ZD9A 1M57C 1Q0FA 2W4BA 5COGA 5KYUA 2F22A 2PF4E 3A9CA 3EHMA 3JRTA 4XPWA 2HSQA 3SXMA 1LKXA 1CPRA 1NSGB 1V74B 2YLDA 2YLGA 3CEXA 4IAQA 3QW1A 1L7CA 2XLOA 4LDKA 3J06A 4U9EA 2LCHA 5DS4A 1PV3A 1OCCC 3C63A 3M79A 4O6MA 1H9GA 1T6QA 1HY5A 1ZHTA 2HMQA 3AG3C 3ATPA 1ZW3A 3LAYA 3LNRA 3MX3A 4G0HA 3U2LA 3C8GB 5E33A 3TQOA 1WOLA 2R7VA 4OIPF 5BUOA 1MNEA 1PCXA 1ST6A 2WZFA 3TJ5A 1JPJA 1WTYA 2C03A 3DI5A 2YHSA 1MMNA 4BJ6A 2LP4A 2VH3A 3C18A 2JD3A 3V5YA 3GEIA 4H4KC 4IRUA 4Q5SF 4BEMJ 2J9BA 1Z23A 2EIKC 3LESA 3FVYA 2YL1A 1D1BA 1YJGA 1CGOA 3EGDB 4MW3A 3IEEA 5EK0A 3WHNA 5L0GA 3GORA 3TOLA 3KL4A 3AG2C 4Q7CA 3RW0A 2PNOA 2DB4A 5BQIA 5L0JA 5EGYA 2A68F 4MVSA 4JJFA 2DYSC 1Y4CA 1G5ZA 2CNWD 1ZZPA 3B0PA 3VF0A 1CGNA 4E17A 2LIGA 1OKKD 4JTCB 2CNWA 4MVZA 3ZG1A 3W2WA 4AL0A 5L0HA 1Q0MA 3LJBA 1VLTA 3DAGA 2R7UA 3GWNA 3U8PA 3IHUA 1U6HA 2OKUA 4K7BA 3OWTA 4KBLA 5GPGB 2H8AA 4RBNA 1VOMA 1Z6AA 2CCYA 2XLWA 4IJJA 1D0XA 3POVA 1HE9A 1NU7D 1G4WR 3LS0A 4G78A 4UDVA 3EZHA 4W8PA 3NMJA 3EGXA 1DOVA 1M56C 1ORSC 3U3FA 2YL3A 3AG1C 3RKOF 3GEEA 3N2ZB 4N6HA 4A2NB 3I4UA 3B9QA 1YA7O 1FMVA 5B1AC 2XL6A 2OU6A 2L6GA 3SP1A 3EFOB 3TULA 4ULVA 1RJ9B 2NSGA 2EIJC 2WZGA 2Y3HA 2ZPAA 1J8MF 3DJUB 2L9JA 1WATA 3F46A 1N1CA 2HKVA 4CBEA 4J7TA 2H7OA 1ZYRF 3B71A 4IGGA 2Y3DA 4FAPB 4ZLCA 2XS8A 1JMWA 4O7GA 1ZU4A 2O9XA 4U5EE 1S05A 3DKAA 4E7ZA 2TMVP 2J9UA 1BZ4A 1KTMA 2A0UA 4PJNA 2QUPA 3ECSA 3R2PA 2VASA 1E2XA 1M2VA 2J0WA 2EPMX 2PX0A 1R5ID 1EKYA 4PJJA 3SYNA 3W8HA 3LUTB 1UFBA 2Q9CA 1MMDA 3TJ6A 2BC5A 2J0XA 1E84A 2ZXWC 3HJCA 2A6EF 2YL7A 2Y69C 2DYRC 4QDLA 4DRHB 3IQCA 4I44A 1WWPA 3Q6NA 1QKRA 1VMAA 3RQFA 4CIHA 5L0FA 2J45A 4CJOA 1LI5A 4LLCA 5T3TA 3V5ZA 4JE9A 4L6RA 4N4WA 2OCCC 4YWQA 3C7JA 1AUEA 1C03A 1YDIA 2YKZA 4QI0A 1WASA 3TK0A 3CSKA 5E3CA 5JT4A 2HV7A 1V55C 1A7DA 5L0DA 4DRIB 2KSFA 3LEOA 5A6BA 3Q7GA 3OA1A 5F5HA 1JR8A 3FXHA 2NUTB 3PCVA 5JUAA 1IW7F 5HV9A 3ZQVA 2G62A 4XEFA 2A69F 3L0IA 4I1MA 3U5SA 3VRCA 5AGFA 2YRFA 3ZWIA 2QTVA 1VK5A 1T5OA 2VC9A 4K1OA 1TFKB 3JCUQ 4F4BA 2HZ8A 3ITFA 1D1AA 2X51A 3JYHA 3KPHA 4DBRA 2C04A 2XS1A 4H54A 1H6GA 1SR2A 2A1DD 4PFPA 256BA 2WVOA 3QW0A 3RH3A 4YT8A 2Q4FA 3ZDLA 4Z9JA 2WVQA 3PMRA 5L3QA 3FDQA 4OIOF 1QQ3A 1OW6A 3JSEO 3GM2A 3O39A 4U5DE 2R7TA 3K33A 3N24A 1Q0DA 1K05A 2P1AA 4ONSA 3RF3A 3V7OA 2I15A 4W8KA 3WG7C 1I4YA 3RVZA 2J7PA 3W2VA 2NPUA 1MMGA 1KU2A 1OKKA 5AC4A 3S90A 4YN0B 5L3VA 2FAPB 2P7VA 1OXKA 1SYQA 4ZLDA 3TOMA 5KYYA 2LK4A 2NSFA 2YL0A 1JOGA 2CW0F 2J9VA 4LDRA 1FNTc 1NZEA 2GDCA 3H2UA 4O6NA 2EINC 3K1IA 1HE1A 2A0BA 4LDQA 3GM1A 2Z15A 4EBJA 1C02A 5JRAA 3FHDA 3A11A 2Y3GA 1BR2A 1TQGA 5JLIA 3B0UX 3Q6MA 2CGEA 2ICWG 4OD4A 4BJ5C 3SXKA 2L7AA 3S9OA 3DD7A 2YLIA 2NUPB 2R02A 4NQFA 1WN0A 4PR9A 2AWCA 2P61A 4D4XA 3US6A 1H7IA 2IOQA 3UGPA 2AU5A 2YQYA 4N06A 1OCRC 5JVEA 3GEHA 2HJMA 3NMIA 4MS2A 3HNKA 1ZW2A 2XRHA 4HFKB 4C3DA 4U5BE 5TJ5E 4A4AA 2LD6A 4PK4A 4XPYA 4AE4B 2IYLD 4CDYA 2LSEA 3GWLA 3SNHA 1Z7Qc 1SMYF 3S28A 4MTGA 2L81A 2Q00A 3U2MA 4CDVA 4G7ZF 1Z63A 3RYLA 1RXQA 4I3MA 4KNVA 1SF8A 1YYJA 4JCZA 4NY3A 5DLJA 1WGWA 3JSZA 3ZVRA 2AWYA 1OW7A 4LERA 2R7SA 1Z5ZA 3T6JA 3G4ZA 4U5GA 1U89A 4O79A 3U9JA 3EFOA 4BJTA 3WODF 1ZVZA 2R9RB 4HE8D 4XTKA 4LLEA 1BR4A 4D4NA 4OD5A 4PJMA 4EKWA 1LI7A 3NYLA 5B1BC 1QLEC 4AK9A 3C8ZA 3LLIA
chains in the Genus database with same CATH topology
3CEXA 2YQYA 5COMA 2NSGA 2NSFA 5COFA 2HKVA 5CIVA 4N6CA 3DI5A 1RXQA 2QNLA 2QE9A 3DKAA 2P1AA 2OQMA 5COGA 2RD9A 3GORA 2F22A 3QTHA 2OU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CEX A;  2YQY A;  5COM A;  2NSG A;  2NSF A;  5COF A;  2HKV A;  5CIV A;  4N6C A;  3DI5 A;  1RXQ A;  2QNL A;  2QE9 A;  3DKA A;  2P1A A;  2OQM A;  5COG A;  2RD9 A;  3GOR A;  2F22 A;  3QTH A;  2OU6 A; 
#chains in the Genus database with same CATH topology
 5A6K A;  3EH1 A;  1B68 A;  2BE5 F;  2V26 A;  2ZXP A;  5D91 A;  4AX2 A;  4ER9 A;  1IZM A;  3DZA A;  3OEO A;  1ZHY A;  1JRA A;  1NFN A;  1AEP A;  5KYW B;  1E85 A;  2QY9 A;  2ASR A;  2E87 A;  2R7W A;  4JUR I;  3S27 A;  1V4A A;  3JRM O;  3NYJ A;  4CJG A;  3C8G A;  5E3A A;  3DAF A;  4J30 B;  4AL1 A;  5A69 A;  3DMD A;  1JAF A;  2XXA A;  1HW1 A;  4NTF A;  2EPN A;  3NKE A;  5F28 E;  2KW3 C;  1W2W A;  2R7X A;  1S7Z A;  2JPU A;  2CYD A;  3NYM A;  3QZC A;  4DRJ B;  4DOZ A;  4GEH A;  4YT2 A;  2V3C C;  5CI8 A;  4QI2 A;  2XM0 A;  1L3P A;  1MND A;  3EH2 A;  3JYY A;  1OW8 A;  1LE2 A;  2IXM A;  2RD9 A;  2R03 A;  1HMO A;  3DXJ F;  1BR1 A;  4JZA A;  3RIP A;  4C7O A;  3EGD A;  2KJG A;  2Y3B A;  2WL8 A;  3HNI A;  3KYJ A;  3UMK A;  5COM A;  1JPN A;  4K0D A;  4JVS A;  3ZQY A;  1SZI A;  2EIM C;  2L6F A;  3CZ6 A;  3DE8 A;  1TKN A;  3KH2 A;  1VB5 A;  2OJQ A;  3K7D A;  3UNG C;  4U9D A;  2XLH A;  2R7O A;  1C17 M;  3MLG A;  5KYX B;  3S84 A;  1HW2 A;  3AOU A;  3GAN A;  3AGU A;  2A6H F;  2XXA B;  3ZTZ A;  1T6U A;  3RVY A;  4CX9 A;  2QNL A;  4IAO A;  3C62 A;  4KI2 A;  1V54 C;  3IQ5 A;  3EQL F;  2G3V A;  5L0C A;  3ASO C;  5A6B D;  1LS4 A;  3KYI A;  3EPV A;  2J46 A;  1NFO A;  4JC7 A;  3FAJ A;  3K1I C;  3QMK A;  4JRZ A;  4M63 A;  4PJL A;  3ZC4 A;  5KYW A;  3FOP A;  3HTK C;  4HFF B;  1FAP B;  3RFY A;  1VLS A;  3G4X A;  1FFT C;  4MVQ A;  4BJ5 A;  2LFF A;  1EI7 A;  5B3S C;  2XM4 A;  1RJ9 A;  2W4M A;  1FMW A;  1RKE B;  3KMI A;  3NG1 A;  1OR2 A;  4I1O B;  4O6Y A;  4U5H A;  4J7Y A;  3AQC A;  2BL2 A;  4BJ6 C;  1ORY A;  4CS8 A;  4CSA A;  2VCC A;  2R7R A;  3DM9 B;  4WJ0 A;  1VYK A;  1ZHW A;  3SXZ A;  5EHH A;  3EG9 A;  4P9T A;  1R4T A;  3AQB A;  5DS5 A;  1XZQ A;  4Z9H A;  1T9K A;  3M4C A;  1ORJ A;  4HEA J;  3T6G B;  3B0V C;  3T6B A;  3L8I A;  2HMZ A;  2H7V C;  4MTO A;  2QE9 A;  3IQ6 A;  5T1D B;  4XPX A;  4IAR A;  3AJM A;  3KKB A;  1FFH A;  4CS9 C;  2EPO A;  3I5P A;  3T4R A;  4DXW A;  4YL1 A;  5A6A A;  5L0I A;  1QPU A;  1QVX A;  3PHF 2;  2HV6 A;  3V5X A;  2MYS A;  4RDA A;  3DE9 A;  4CIP A;  2FFH A;  4MW8 A;  4AE4 A;  3U3B A;  1H9T A;  1Y6D A;  2OQM A;  3K6B A;  4JTA B;  1YZC A;  1NBB A;  4YT4 A;  3QTH A;  3ABM C;  3LEV A;  3S29 A;  4BG0 A;  5CI9 A;  1PD0 A;  2OG2 A;  1QZX A;  5KYN A;  2Q9A A;  2OEX A;  1ZHZ A;  2OJE D;  2R25 A;  1A41 A;  5DVW A;  3DM5 A;  4YJW A;  3LS1 A;  5DQZ A;  3L8J A;  1YA9 A;  4GYT A;  3JZ0 A;  4DBQ A;  2NUP A;  3E70 C;  2IXN A;  2D5R B;  4IWB A;  3MYF A;  4JCH A;  5D92 A;  2HJ3 A;  5A6J A;  4JTD B;  2IXP A;  1TWA A;  1ZU5 A;  3W4Y A;  1FTS A;  4MND A;  3ZIB A;  3LLK A;  4CS7 A;  4E18 A;  2X0C A;  4JEB A;  1DOW A;  5HSW A;  4NCQ A;  3FAP B;  2P0N A;  1G8X A;  3IPM O;  2VB6 A;  4B6I A;  2HUJ A;  2B0J A;  3SZR A;  2Q7R A;  2L6H A;  1BDJ B;  3HNL A;  1LE4 A;  1K04 A;  1O5H A;  4KC9 A;  1J8Y F;  1A0B A;  2PBE A;  2KGO A;  5KYX A;  1KNY A;  2XLM A;  3X1O A;  1LPE A;  2R7Q A;  1MQV A;  2J8W A;  1T01 A;  1O87 A;  2XL8 A;  1NU9 C;  3CQZ A;  3AGT A;  5F5F A;  2IXO A;  1A7V A;  1M6T A;  4PFO A;  5KYU B;  2MWQ A;  3DJN B;  3G50 A;  4ULW A;  1E83 A;  2ZXO A;  1NLX A;  1O3U A;  2GWW A;  2HSB A;  3CAX A;  3IQT A;  3MFN A;  4FES A;  4J32 B;  4JJG A;  4JW1 A;  3U0C A;  2D4U A;  4N6C A;  2PX3 A;  3ASN C;  2AP3 A;  3B29 A;  3UMH A;  3RQE A;  4WGY A;  4EBK A;  1TR2 A;  4NC3 A;  2J9W A;  5FCL A;  1D0Z A;  3ABK C;  1GS9 A;  1TFO B;  3NKD A;  1M2V B;  4P6I C;  3ABL C;  2RSE B;  4XLP F;  1Z3I X;  3N0T A;  4E0I A;  3JT1 A;  4FWV A;  4U5F E;  4CS8 C;  4CSA C;  3M15 A;  4JKV A;  1A7E A;  2NG1 A;  4XEK A;  1RMV A;  3LNM B;  5JP7 A;  5B3I A;  2MHR A;  4U5C E;  2PFD A;  3EG9 B;  1EQ1 A;  5JSL A;  1AVO B;  4DVY P;  2J7P D;  2UUH A;  2DI3 A;  3BRJ A;  4FX5 A;  3F47 A;  1OCZ C;  3ZSU A;  1LVK A;  1YVI A;  5KYY B;  1VTM P;  1TWG A;  4BEJ A;  1OXB A;  3EGX B;  2EPK X;  2YZS A;  2CDQ A;  4C3B A;  3S0X A;  5K0I A;  3RQG A;  2W9Y A;  2IM8 A;  3HKK A;  2KYH A;  1YAR O;  3FMS A;  2YVK A;  1YZA A;  1RKE A;  3UGO A;  1OR3 A;  2UUI A;  4EHP A;  2KQ9 A;  3NRH A;  2WZL A;  1K40 A;  2LFD A;  3HLZ A;  3U9M A;  5E2Q A;  4GQH A;  1HMD A;  4MVR A;  2PP4 A;  3U8V A;  4ANJ A;  3PDM P;  4CS9 A;  1M2O A;  4MVU A;  2XLE A;  4E0H A;  4EBB A;  1CGM E;  4BJ1 A;  3H65 A;  4XLN F;  1OQC A;  2KC3 A;  1LIH A;  2OOC A;  1U0B B;  3AG4 C;  5DQT A;  2EPL X;  2P6V A;  2YWA A;  5JS5 A;  1MMA A;  2LQG A;  1EA8 A;  3M1C B;  1LS1 A;  2M64 A;  1TWC A;  1YYX A;  2Q3T A;  2XLD A;  2Y39 A;  4NTA A;  5T3W A;  3VM6 A;  5IY5 C;  2YEV A;  3UMI A;  1F1M A;  4OIN F;  3L1M A;  5AC5 A;  2XSE A;  1OCO C;  3E9V A;  4OIQ F;  1D1C A;  1PD1 A;  3SXY A;  3T9O A;  4XEV A;  4BPM A;  1RKC A;  4MVM A;  3SEO A;  4MVO A;  4EIY A;  4DJ9 A;  1NG1 A;  5CIV A;  3I5Q A;  1UG7 A;  2B0H A;  2KK1 A;  3QVY A;  1GGQ A;  1VYI A;  1I5N A;  2AVK A;  3EHN A;  2HS5 A;  4R32 A;  2OEV A;  5BQG A;  2I8B A;  2KNH A;  3VYW A;  1GM5 A;  3EJN A;  4LAC B;  2ETS A;  2WVN A;  3HNJ A;  1E86 A;  4Q4Z F;  3JTL O;  4Z9I A;  3W8I A;  1TWH A;  4MQ9 F;  2DGJ A;  2GA0 A;  2G3K A;  4EWC A;  3NDB B;  4C3E A;  4CDA A;  2JX0 A;  1D0Y A;  1YAU O;  2XLV A;  1BBH A;  4P9F A;  5COF A;  2R05 A;  3O55 A;  4XQ1 A;  3K66 A;  2ZXR A;  1XWJ A;  4NTB A;  3Q7L A;  2VCB A;  3O10 A;  4E7S A;  4G7O F;  2H7B A;  4MTF A;  3UR3 C;  2M4E A;  2HFI A;  3M4B A;  2W45 A;  4RD9 A;  2VCA A;  3FOO A;  2NUT A;  2Q9B A;  3BEH A;  3GOD A;  4YL3 A;  4XWJ A;  3X2Q C;  1T6I A;  3K1H A;  1QSP A;  5FZT A;  2FGY A;  3C8G D;  3DWW A;  4DVZ A;  1APC A;  2QLA A;  1I4Z A;  4EUK B;  2WB7 A;  3MYI A;  3TD7 A;  4C7O B;  2XL4 A;  4WAB A;  1LM3 B;  1RCP A;  3NMK A;  4YT5 A;  2GAQ A;  4JEA A;  1Q0G A;  4X0R A;  1Q0K A;  4G7H F;  1G4U S;  3ZTM A;  3O6X A;  4KNW A;  1YLM A;  2IBF A;  4OIR F;  3MBG A;  3EZI A;  2GFH A;  3H2V A;  1GQA A;  5BQH A;  3QVZ A;  1CPQ A;  4YL0 A;  4IB4 A;  4PAC A;  3WAQ A;  3R7C A;  1FR0 A;  3VAY A;  4YK5 A;  1XZP A;  3GM3 A;  5DS6 A;  1ZHX A;  4WGZ A;  2EIL C;  3L34 A;  4JIO A;  2ZD9 A;  1M57 C;  1Q0F A;  2W4B A;  5COG A;  5KYU A;  2F22 A;  2PF4 E;  3A9C A;  3EHM A;  3JRT A;  4XPW A;  2HSQ A;  3SXM A;  1LKX A;  1CPR A;  1NSG B;  1V74 B;  2YLD A;  2YLG A;  3CEX A;  4IAQ A;  3QW1 A;  1L7C A;  2XLO A;  4LDK A;  3J06 A;  4U9E A;  2LCH A;  5DS4 A;  1PV3 A;  1OCC C;  3C63 A;  3M79 A;  4O6M A;  1H9G A;  1T6Q A;  1HY5 A;  1ZHT A;  2HMQ A;  3AG3 C;  3ATP A;  1ZW3 A;  3LAY A;  3LNR A;  3MX3 A;  4G0H A;  3U2L A;  3C8G B;  5E33 A;  3TQO A;  1WOL A;  2R7V A;  4OIP F;  5BUO A;  1MNE A;  1PCX A;  1ST6 A;  2WZF A;  3TJ5 A;  1JPJ A;  1WTY A;  2C03 A;  3DI5 A;  2YHS A;  1MMN A;  4BJ6 A;  2LP4 A;  2VH3 A;  3C18 A;  2JD3 A;  3V5Y A;  3GEI A;  4H4K C;  4IRU A;  4Q5S F;  4BEM J;  2J9B A;  1Z23 A;  2EIK C;  3LES A;  3FVY A;  2YL1 A;  1D1B A;  1YJG A;  1CGO A;  3EGD B;  4MW3 A;  3IEE A;  5EK0 A;  3WHN A;  5L0G A;  3GOR A;  3TOL A;  3KL4 A;  3AG2 C;  4Q7C A;  3RW0 A;  2PNO A;  2DB4 A;  5BQI A;  5L0J A;  5EGY A;  2A68 F;  4MVS A;  4JJF A;  2DYS C;  1Y4C A;  1G5Z A;  2CNW D;  1ZZP A;  3B0P A;  3VF0 A;  1CGN A;  4E17 A;  2LIG A;  1OKK D;  4JTC B;  2CNW A;  4MVZ A;  3ZG1 A;  3W2W A;  4AL0 A;  5L0H A;  1Q0M A;  3LJB A;  1VLT A;  3DAG A;  2R7U A;  3GWN A;  3U8P A;  3IHU A;  1U6H A;  2OKU A;  4K7B A;  3OWT A;  4KBL A;  5GPG B;  2H8A A;  4RBN A;  1VOM A;  1Z6A A;  2CCY A;  2XLW A;  4IJJ A;  1D0X A;  3POV A;  1HE9 A;  1NU7 D;  1G4W R;  3LS0 A;  4G78 A;  4UDV A;  3EZH A;  4W8P A;  3NMJ A;  3EGX A;  1DOV A;  1M56 C;  1ORS C;  3U3F A;  2YL3 A;  3AG1 C;  3RKO F;  3GEE A;  3N2Z B;  4N6H A;  4A2N B;  3I4U A;  3B9Q A;  1YA7 O;  1FMV A;  5B1A C;  2XL6 A;  2OU6 A;  2L6G A;  3SP1 A;  3EFO B;  3TUL A;  4ULV A;  1RJ9 B;  2NSG A;  2EIJ C;  2WZG A;  2Y3H A;  2ZPA A;  1J8M F;  3DJU B;  2L9J A;  1WAT A;  3F46 A;  1N1C A;  2HKV A;  4CBE A;  4J7T A;  2H7O A;  1ZYR F;  3B71 A;  4IGG A;  2Y3D A;  4FAP B;  4ZLC A;  2XS8 A;  1JMW A;  4O7G A;  1ZU4 A;  2O9X A;  4U5E E;  1S05 A;  3DKA A;  4E7Z A;  2TMV P;  2J9U A;  1BZ4 A;  1KTM A;  2A0U A;  4PJN A;  2QUP A;  3ECS A;  3R2P A;  2VAS A;  1E2X A;  1M2V A;  2J0W A;  2EPM X;  2PX0 A;  1R5I D;  1EKY A;  4PJJ A;  3SYN A;  3W8H A;  3LUT B;  1UFB A;  2Q9C A;  1MMD A;  3TJ6 A;  2BC5 A;  2J0X A;  1E84 A;  2ZXW C;  3HJC A;  2A6E F;  2YL7 A;  2Y69 C;  2DYR C;  4QDL A;  4DRH B;  3IQC A;  4I44 A;  1WWP A;  3Q6N A;  1QKR A;  1VMA A;  3RQF A;  4CIH A;  5L0F A;  2J45 A;  4CJO A;  1LI5 A;  4LLC A;  5T3T A;  3V5Z A;  4JE9 A;  4L6R A;  4N4W A;  2OCC C;  4YWQ A;  3C7J A;  1AUE A;  1C03 A;  1YDI A;  2YKZ A;  4QI0 A;  1WAS A;  3TK0 A;  3CSK A;  5E3C A;  5JT4 A;  2HV7 A;  1V55 C;  1A7D A;  5L0D A;  4DRI B;  2KSF A;  3LEO A;  5A6B A;  3Q7G A;  3OA1 A;  5F5H A;  1JR8 A;  3FXH A;  2NUT B;  3PCV A;  5JUA A;  1IW7 F;  5HV9 A;  3ZQV A;  2G62 A;  4XEF A;  2A69 F;  3L0I A;  4I1M A;  3U5S A;  3VRC A;  5AGF A;  2YRF A;  3ZWI A;  2QTV A;  1VK5 A;  1T5O A;  2VC9 A;  4K1O A;  1TFK B;  3JCU Q;  4F4B A;  2HZ8 A;  3ITF A;  1D1A A;  2X51 A;  3JYH A;  3KPH A;  4DBR A;  2C04 A;  2XS1 A;  4H54 A;  1H6G A;  1SR2 A;  2A1D D;  4PFP A;  256B A;  2WVO A;  3QW0 A;  3RH3 A;  4YT8 A;  2Q4F A;  3ZDL A;  4Z9J A;  2WVQ A;  3PMR A;  5L3Q A;  3FDQ A;  4OIO F;  1QQ3 A;  1OW6 A;  3JSE O;  3GM2 A;  3O39 A;  4U5D E;  2R7T A;  3K33 A;  3N24 A;  1Q0D A;  1K05 A;  2P1A A;  4ONS A;  3RF3 A;  3V7O A;  2I15 A;  4W8K A;  3WG7 C;  1I4Y A;  3RVZ A;  2J7P A;  3W2V A;  2NPU A;  1MMG A;  1KU2 A;  1OKK A;  5AC4 A;  3S90 A;  4YN0 B;  5L3V A;  2FAP B;  2P7V A;  1OXK A;  1SYQ A;  4ZLD A;  3TOM A;  5KYY A;  2LK4 A;  2NSF A;  2YL0 A;  1JOG A;  2CW0 F;  2J9V A;  4LDR A;  1FNT c;  1NZE A;  2GDC A;  3H2U A;  4O6N A;  2EIN C;  3K1I A;  1HE1 A;  2A0B A;  4LDQ A;  3GM1 A;  2Z15 A;  4EBJ A;  1C02 A;  5JRA A;  3FHD A;  3A11 A;  2Y3G A;  1BR2 A;  1TQG A;  5JLI A;  3B0U X;  3Q6M A;  2CGE A;  2ICW G;  4OD4 A;  4BJ5 C;  3SXK A;  2L7A A;  3S9O A;  3DD7 A;  2YLI A;  2NUP B;  2R02 A;  4NQF A;  1WN0 A;  4PR9 A;  2AWC A;  2P61 A;  4D4X A;  3US6 A;  1H7I A;  2IOQ A;  3UGP A;  2AU5 A;  2YQY A;  4N06 A;  1OCR C;  5JVE A;  3GEH A;  2HJM A;  3NMI A;  4MS2 A;  3HNK A;  1ZW2 A;  2XRH A;  4HFK B;  4C3D A;  4U5B E;  5TJ5 E;  4A4A A;  2LD6 A;  4PK4 A;  4XPY A;  4AE4 B;  2IYL D;  4CDY A;  2LSE A;  3GWL A;  3SNH A;  1Z7Q c;  1SMY F;  3S28 A;  4MTG A;  2L81 A;  2Q00 A;  3U2M A;  4CDV A;  4G7Z F;  1Z63 A;  3RYL A;  1RXQ A;  4I3M A;  4KNV A;  1SF8 A;  1YYJ A;  4JCZ A;  4NY3 A;  5DLJ A;  1WGW A;  3JSZ A;  3ZVR A;  2AWY A;  1OW7 A;  4LER A;  2R7S A;  1Z5Z A;  3T6J A;  3G4Z A;  4U5G A;  1U89 A;  4O79 A;  3U9J A;  3EFO A;  4BJT A;  3WOD F;  1ZVZ A;  2R9R B;  4HE8 D;  4XTK A;  4LLE A;  1BR4 A;  4D4N A;  4OD5 A;  4PJM A;  4EKW A;  1LI7 A;  3NYL A;  5B1B C;  1QLE C;  4AK9 A;  3C8Z A;  3LLI A; 
#chains in the Genus database with same CATH homology
 3CEX A;  2YQY A;  5COM A;  2NSG A;  2NSF A;  5COF A;  2HKV A;  5CIV A;  4N6C A;  3DI5 A;  1RXQ A;  2QNL A;  2QE9 A;  3DKA A;  2P1A A;  2OQM A;  5COG A;  2RD9 A;  3GOR A;  2F22 A;  3QTH A;  2OU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...