5COMA

Crystal structure of uncharacterized protein q187f5 from clostridium difficile 630
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
171
structure length
171
Chain Sequence
RVYENKEELKSEINKTFEKYIAEFDNIPESLKDKRIDEVDRTPAENLAYQVGWTTLVLKWEEDERNGLQVKTPSDEFKWNQLGELYQWFTDTYAYLSLQELKSKLNENINSIYVMIDSLSDEELFKPHMRKWADDATKTAVWEVYKFIHVNTVAPFKTFRNKIRKWKKIVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative conjugative transposon protein Tn1549-like, CTn5-Or
publication title Structures of the DfsB Protein Family Suggest a Cationic, Helical Sibling Lethal Factor Peptide.
pubmed doi rcsb
source organism Peptoclostridium difficile 630
total genus 74
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 5comA00
2RD9A 2HKVA 3QTHA 3GORA 2QE9A 2F22A 3DKAA 1RXQA 5CIVA 3DI5A 5COGA 2OQMA 2NSGA 2P1AA 2YQYA 5COFA 2OU6A 4N6CA 2QNLA 2NSFA 5COMA 3CEXA
chains in the Genus database with same CATH superfamily
4DRIB 2HKVA 1YA9A 1GGQA 3C8ZA 4P9FA 2XSEA 3ZDLA 1QQ3A 3AQCA 2B0JA 1Y4CA 3LLIA 3GM1A 3VRCA 3GORA 5AC5A 1KNYA 3C62A 2C03A 4J7YA 1LI5A 4IWBA 3DM9B 1S05A 3LEOA 3EPVA 2AVKA 1AVOB 1RJ9B 4Q4ZF 4XPYA 2EINC 2ZXWC 2PNOA 4N06A 3U3FA 3JZ0A 2XLMA 5JVEA 2EPLX 1J8YF 2ASRA 4CS9C 1KU2A 1OCCC 4PJLA 1SYQA 4JEBA 2XXAA 1NZEA 2CCYA 2J9VA 4LLCA 2DYRC 5A6BD 2JD3A 5DQTA 1VYIA 3B71A 4IRUA 3EG9B 5A6BA 3PDMP 4WGYA 1WN0A 4OINF 1OW7A 3NYJA 2HMQA 4JZAA 2G62A 1PV3A 1WTYA 5CI8A 1Z7Qc 3RKOF 3SYNA 2NPUA 2R05A 2YKZA 3ZWIA 1JAFA 1HE1A 3NG1A 5L0HA 2XL4A 2EPKX 2H8AA 2YRFA 3M15A 3PMRA 5F5FA 4JTAB 2HUJA 1ZU5A 1WGWA 2F22A 2KNHA 3KH2A 1R5ID 2YZSA 3KMIA 1WASA 1UG7A 4N6HA 1RXQA 2Y3DA 4YL3A 2OCCC 2R7UA 1OCOC 2OOCA 1A41A 4PJJA 3LJBA 4OD4A 2M4EA 2QLAA 1LS1A 2Y3GA 3ZSUA 3DD7A 3C63A 1DOVA 3CZ6A 1O3UA 2OU6A 1EI7A 1OW8A 4MVZA 2EPNA 5T3TA 2WZFA 3R7CA 2MWQA 4R32A 3ZC4A 1BR4A 3CQZA 1D1CA 4H4KC 1LE2A 3AG1C 1E83A 3EQLF 1G8XA 5F28E 2J45A 1BBHA 2ZXRA 3RFYA 4BJ5A 4I44A 2Q9BA 1BR1A 3N0TA 5E3AA 2P61A 5FCLA 1HW2A 1YVIA 2QY9A 1CGOA 4LERA 3AG4C 2XLWA 1MMGA 2HSBA 2VCAA 3Q7LA 4FWVA 2NUTA 3UGOA 4P6IC 1T6IA 3UGPA 2FAPB 2HFIA 4E0IA 3LUTB 3U2LA 3ITFA 3K33A 3WG7C 4CDVA 3UMIA 3FOOA 4UDVA 2A1DD 1CGNA 2XLHA 2YLGA 5A69A 3TOMA 1D0YA 5E3CA 2YLDA 3NMIA 3BRJA 1HMDA 3N24A 2XS1A 4O6YA 5L0IA 2H7OA 2M64A 3KL4A 2J9UA 3L8IA 3DE9A 4NTFA 2D5RB 3R2PA 1LVKA 2ZPAA 2R9RB 1RCPA 1HE9A 2A6HF 3IQ5A 3FXHA 3DZAA 4CIPA 1LPEA 4G7OF 3MBGA 4MTOA 4MTGA 1PD1A 3A11A 2KQ9A 2IM8A 1NSGB 1FFTC 3EH1A 3K7DA 4NC3A 1M57C 4JURI 2BL2A 3NMKA 3ZG1A 4GEHA 1YZAA 2Y3BA 2UUHA 4E7SA 5EGYA 2Y69C 4YWQA 2YL1A 1JRAA 2LSEA 2Z15A 3SXYA 2QTVA 2LQGA 1H7IA 2R7OA 2YVKA 3O39A 4YN0B 4AK9A 2CGEA 5JS5A 4ULVA 1V74B 4N6CA 2NUTB 2NSFA 2OEXA 3S9OA 3RVZA 3SXZA 1M2VA 4JJFA 1H6GA 1Q0FA 1LIHA 3TQOA 4E18A 2XM4A 4PJNA 3B0VC 1D0ZA 4KBLA 1KTMA 1ZHYA 3QVZA 2GFHA 2R02A 3ZQYA 1Q0DA 1GQAA 1VLTA 2LFFA 2Q3TA 1LM3B 4KC9A 2R7VA 1Z63A 2PP4A 1YJGA 2Y3HA 3TOLA 1ORSC 256BA 4D4NA 2KJGA 5L0DA 2PX3A 2J9BA 4O7GA 3V5XA 3JYYA 3MYFA 5FZTA 3I4UA 4MVMA 3EH2A 1TWGA 5GPGB 3NDBB 4JEAA 5D92A 1YYJA 2I15A 2MHRA 3JSEO 5DQZA 1MQVA 3U2MA 4BEMJ 5EHHA 3GEEA 3HJCA 3X1OA 4HFFB 2ZD9A 1RKEB 3ZIBA 1TR2A 2P7VA 3L8JA 4EBKA 1JMWA 1SF8A 5JLIA 3IQCA 2AWYA 3JCUQ 1M56C 3C7JA 1S7ZA 3LEVA 3JYHA 4HE8D 2I8BA 1ORYA 3BEHA 4E17A 4OIRF 5L0FA 4J30B 3FDQA 4M63A 2H7BA 3LS0A 3PCVA 1MMDA 4RD9A 3VM6A 2R7QA 4HFKB 2IXNA 3Q7GA 2R7TA 2ICWG 4HEAJ 2EPMX 3ECSA 3UR3C 4MVUA 5KYWA 1Q0GA 1EKYA 1M2VB 3O10A 2YEVA 5BUOA 3HKKA 4RBNA 1QLEC 3CAXA 5E2QA 1I4ZA 3AGUA 3F47A 1FR0A 3K1IA 4IJJA 2PF4E 3GWLA 2Q9AA 1E2XA 1LKXA 2YL3A 1AUEA 4DVZA 2VC9A 4U5HA 4YL1A 4C7OB 2YHSA 4ONSA 4CSAC 5HSWA 4CJOA 3I5QA 1WWPA 3HNKA 3K66A 1TQGA 2HV7A 3IHUA 1T9KA 4I1OB 2LD6A 4KNWA 1HMOA 4XEVA 2EIMC 3QMKA 4PK4A 2IXOA 4CX9A 5L0JA 1E85A 2AU5A 3EZIA 3T6GB 1ZVZA 4E7ZA 2X51A 2P6VA 3A9CA 4D4XA 2GAQA 1G4WR 3T4RA 1PCXA 3S84A 2Q9CA 1LS4A 3WHNA 2A6EF 1CPRA 2L81A 2OEVA 3E9VA 4QI0A 4PFPA 4DRHB 4XPXA 2J9WA 3DAGA 4NTAA 4WGZA 1BDJB 4JW1A 3U5SA 2VH3A 1W2WA 3H2UA 3LAYA 1JPJA 4G0HA 3RQEA 2KYHA 3N2ZB 1XZPA 2YQYA 2P0NA 3GANA 4MVRA 5BQGA 4PR9A 2R7XA 2XS8A 3JTLO 3RQGA 1FFHA 5L0GA 5IY5C 5KYWB 4WJ0A 3EJNA 1SZIA 4U9EA 3V5ZA 2R7SA 5BQIA 1E86A 3ASOC 1L7CA 1D0XA 1LE4A 1IZMA 3HTKC 1YYXA 1XZQA 5L0CA 1QKRA 2XRHA 2HMZA 2L6HA 5D91A 1YZCA 3DJUB 3V7OA 4DJ9A 1YAUO 2A69F 2EIJC 3O6XA 4NY3A 3RYLA 4CS7A 2O9XA 1TWHA 3MYIA 4DRJB 3C18A 5JRAA 3Q6NA 3LESA 5T3WA 2KGOA 1RKCA 3S27A 3S28A 4U5CE 3NKEA 5AGFA 3AQBA 2IXMA 3GM3A 4Z9JA 1JPNA 1T01A 3W8IA 5KYXA 4YJWA 5COFA 2BC5A 1MMNA 3U9MA 1GM5A 3T9OA 2KSFA 4CS8A 1FAPB 4AE4B 3ASNC 4JVSA 2LK4A 4DBQA 4BG0A 2G3VA 3W2WA 1ZHWA 4JKVA 4CDYA 1BZ4A 5JT4A 2V3CC 4E0HA 3M4BA 4DVYP 3FMSA 1NU7D 1NU9C 2GDCA 4YT5A 2L7AA 4C3DA 1MNEA 2LP4A 2W4MA 4U5DE 1R4TA 3NYMA 3C8GB 4BJ6A 1ST6A 1QSPA 1RKEA 3HNLA 5BQHA 2EILC 2MYSA 3M4CA 1ZHZA 4IARA 3POVA 2EIKC 2WL8A 4LDQA 4EHPA 3DI5A 1QZXA 2DYSC 3LS1A 5KYYA 1YARO 3NYLA 3TD7A 3E70C 4QI2A 2L6GA 3U0CA 5AC4A 3SXKA 5L3VA 3AJMA 2HZ8A 4NTBA 4DOZA 2CYDA 3CSKA 3RW0A 1C03A 2NG1A 2OG2A 2QUPA 2V26A 4ER9A 1AEPA 3KYIA 4BJ5C 2A0UA 2JX0A 2VASA 2KW3C 4MQ9F 2A68F 3GM2A 3JRTA 1Z5ZA 2HSQA 5KYXB 3JSZA 3FAJA 3GEHA 5KYNA 2W9YA 3GWNA 1MMAA 1V54C 2J8WA 3GODA 3HNIA 1H9TA 2JPUA 4C7OA 1Y6DA 3DAFA 3G4XA 2CDQA 3TJ6A 1D1AA 1A7DA 2C04A 2Q4FA 3EGXA 3KKBA 3W8HA 4EUKB 4I1MA 2FFHA 5B3IA 1TFOB 3RVYA 4EKWA 1VOMA 1ORJA 4ANJA 2YL7A 4FAPB 1Z6AA 4P9TA 2P1AA 1ZZPA 2YWAA 2HJMA 3DE8A 3F46A 4O79A 1OKKA 1VLSA 3NRHA 2R25A 3O55A 4MS2A 3ABLC 4XQ1A 1K05A 3DWWA 4PJMA 2QNLA 1OW6A 3ABKC 4U5FE 2B0HA 3FVYA 4X0RA 5DS4A 3J06A 2J7PD 3MFNA 4CDAA 4K7BA 4YL0A 5K0IA 1VK5A 1K40A 1E84A 2CW0F 2J7PA 3JT1A 4J32B 5KYYB 3AOUA 3T6JA 3OWTA 2XL8A 4KI2A 1VTMP 2HV6A 2HJ3A 1D1BA 3MX3A 3QVYA 4JCZA 1NBBA 2BE5F 4K0DA 4JRZA 2LIGA 1Q0MA 4JTCB 3PHF2 3SNHA 1OCRC 3ZTMA 5A6JA 3H2VA 5DLJA 4CS9A 2DB4A 3L0IA 5E33A 5CIVA 1CPQA 1YDIA 3KPHA 3ABMC 3VF0A 2WVOA 2EPOA 4CIHA 5KYUA 4JCHA 4I3MA 1J8MF 1U89A 1XWJA 4MNDA 1NFNA 3UMKA 5L3QA 1Z3IX 1ZW2A 3EGXB 1T5OA 3M79A 1NLXA 3U3BA 3FHDA 1I4YA 4RDAA 5CI9A 5JUAA 1CGME 4IGGA 3GEIA 4U9DA 3MLGA 4Q7CA 4ZLCA 2XLOA 1VMAA 5DS5A 3EGDB 2QE9A 3EHNA 3B9QA 4OD5A 4U5EE 4MW8A 1A0BA 3VAYA 4LLEA 1NG1A 2XLDA 3ZVRA 4AL0A 3DM5A 4LDKA 4AE4A 5DS6A 4BPMA 1NFOA 5COGA 3ZQVA 1EQ1A 3IEEA 3TULA 2J46A 2NSGA 1Z23A 1ZYRF 2G3KA 2E87A 2PFDA 5TJ5E 3ZTZA 4YT2A 2PX0A 3IQ6A 4OIQF 3L34A 3UMHA 1U0BB 1VB5A 3C8GD 3C8GA 4PACA 3NKDA 4EIYA 4O6MA 5COMA 1M2OA 1OCZC 3QZCA 4N4WA 3S29A 4IB4A 2HS5A 4DXWA 1OQCA 4J7TA 3NMJA 2OKUA 3TK0A 4YT4A 4MVSA 1V55C 4MVQA 4NCQA 1TKNA 3IPMO 2X0CA 1F1MA 2A0BA 2WVNA 3QTHA 3U9JA 5KYUB 4G7ZF 2LCHA 3US6A 4CBEA 3RQFA 1BR2A 5HV9A 3I5PA 2DGJA 3K1IC 4JIOA 4C3EA 1O87A 4B6IA 4OIPF 1ZW3A 3T6BA 3SXMA 1OR3A 2OQMA 3LNMB 5B1AC 1ZHTA 3AG3C 3W2VA 4JJGA 2NUPA 1C02A 1PD0A 4YK5A 4BEJA 4Z9HA 2XLVA 3KYJA 3RH3A 4BJTA 2ETSA 2OJQA 2R03A 2VB6A 1DOWA 3S0XA 3SP1A 1WOLA 3DXJF 4JC7A 1G5ZA 2W4BA 1A7VA 4AL1A 4XLPF 3IQTA 1FTSA 5JP7A 5DVWA 3K1HA 4XEKA 3X2QC 3OEOA 2J0WA 2Q00A 3EFOA 1QVXA 2ZXPA 1U6HA 1Q0KA 4C3BA 4F4BA 2PBEA 2L9JA 3V5YA 3DKAA 4H54A 1LI7A 4XTKA 1K04A 4A2NB 2AWCA 4IAQA 2R7WA 4W8PA 3L1MA 4MW3A 4Z9IA 3UNGC 1VYKA 2YL0A 2IXPA 3B29A 3JRMO 4WABA 4W8KA 2LFDA 1RMVA 1V4AA 3FOPA 1FMVA 1H9GA 2XL6A 3OA1A 3QW0A 4ULWA 4XPWA 2KK1A 1OR2A 2XM0A 2RSEB 2VCBA 3QW1A 4U5GA 2KC3A 4BJ1A 4MVOA 3LNRA 1SR2A 2WB7A 3HNJA 5EK0A 2AP3A 1T6UA 4Q5SF 1JR8A 4A4AA 4IAOA 2GA0A 2FGYA 4CJGA 2NUPB 1OXBA 4MTFA 2OJED 1N1CA 2YLIA 5A6AA 3B0UX 1O5HA 1WATA 4LDRA 3SEOA 1HY5A 2Y39A 3Q6MA 2WVQA 3LLKA 4EBJA 1JOGA 2TMVP 4XLNF 1YLMA 4K1OA 4G7HF 1B68A 1OKKD 2DI3A 4KNVA 3EFOB 4CS8C 1OXKA 2H7VC 1EA8A 3U8VA 1HW1A 1L3PA 1SMYF 1UFBA 3EGDA 3TJ5A 3VYWA 2WZGA 3S90A 2Q7RA 1TWAA 4CSAA 3FAPB 4QDLA 2GWWA 4FX5A 2ZXOA 1C17M 4G78A 1RJ9A 3RF3A 3DJNB 1GS9A 1ZU4A 2RD9A 3EHMA 3WAQA 3WODF 2VCCA 4XEFA 5A6KA 2CNWD 3ATPA 4U5BE 1MNDA 1TFKB 2D4UA 3AG2C 5T1DB 1QPUA 2W45A 3SZRA 4BJ6C 1FNTc 1FMWA 2CNWA 2XLEA 3HLZA 4FESA 4YT8A 1G4US 1A7EA 2L6FA 4L6RA 4NQFA 2IOQA 1I5NA 1YA7O 3G50A 2WZLA 2R7RA 4ZLDA 3RIPA 1APCA 2UUIA 1TWCA 4LACB 3W4YA 3EG9A 4AX2A 4EWCA 5B3SC 3U8PA 4O6NA 4EBBA 3DMDA 4GYTA 2IBFA 3M1CB 3G4ZA 4PFOA 4GQHA 3K6BA 5F5HA 1T6QA 2J0XA 3AGTA 4XWJA 5B1BC 3H65A 4DBRA 4OIOF 2XXAB 1M6TA 3EZHA 1IW7F 3B0PA 5JSLA 4JE9A 1ZHXA 4JTDB 2IYLD 3CEXA
chains in the Genus database with same CATH topology
2RD9A 2HKVA 3QTHA 3GORA 2QE9A 2F22A 3DKAA 1RXQA 5CIVA 3DI5A 5COGA 2OQMA 2NSGA 2P1AA 2YQYA 5COFA 2OU6A 4N6CA 2QNLA 2NSFA 5COMA 3CEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RD9 A;  2HKV A;  3QTH A;  3GOR A;  2QE9 A;  2F22 A;  3DKA A;  1RXQ A;  5CIV A;  3DI5 A;  5COG A;  2OQM A;  2NSG A;  2P1A A;  2YQY A;  5COF A;  2OU6 A;  4N6C A;  2QNL A;  2NSF A;  5COM A;  3CEX A; 
#chains in the Genus database with same CATH topology
 4DRI B;  2HKV A;  1YA9 A;  1GGQ A;  3C8Z A;  4P9F A;  2XSE A;  3ZDL A;  1QQ3 A;  3AQC A;  2B0J A;  1Y4C A;  3LLI A;  3GM1 A;  3VRC A;  3GOR A;  5AC5 A;  1KNY A;  3C62 A;  2C03 A;  4J7Y A;  1LI5 A;  4IWB A;  3DM9 B;  1S05 A;  3LEO A;  3EPV A;  2AVK A;  1AVO B;  1RJ9 B;  4Q4Z F;  4XPY A;  2EIN C;  2ZXW C;  2PNO A;  4N06 A;  3U3F A;  3JZ0 A;  2XLM A;  5JVE A;  2EPL X;  1J8Y F;  2ASR A;  4CS9 C;  1KU2 A;  1OCC C;  4PJL A;  1SYQ A;  4JEB A;  2XXA A;  1NZE A;  2CCY A;  2J9V A;  4LLC A;  2DYR C;  5A6B D;  2JD3 A;  5DQT A;  1VYI A;  3B71 A;  4IRU A;  3EG9 B;  5A6B A;  3PDM P;  4WGY A;  1WN0 A;  4OIN F;  1OW7 A;  3NYJ A;  2HMQ A;  4JZA A;  2G62 A;  1PV3 A;  1WTY A;  5CI8 A;  1Z7Q c;  3RKO F;  3SYN A;  2NPU A;  2R05 A;  2YKZ A;  3ZWI A;  1JAF A;  1HE1 A;  3NG1 A;  5L0H A;  2XL4 A;  2EPK X;  2H8A A;  2YRF A;  3M15 A;  3PMR A;  5F5F A;  4JTA B;  2HUJ A;  1ZU5 A;  1WGW A;  2F22 A;  2KNH A;  3KH2 A;  1R5I D;  2YZS A;  3KMI A;  1WAS A;  1UG7 A;  4N6H A;  1RXQ A;  2Y3D A;  4YL3 A;  2OCC C;  2R7U A;  1OCO C;  2OOC A;  1A41 A;  4PJJ A;  3LJB A;  4OD4 A;  2M4E A;  2QLA A;  1LS1 A;  2Y3G A;  3ZSU A;  3DD7 A;  3C63 A;  1DOV A;  3CZ6 A;  1O3U A;  2OU6 A;  1EI7 A;  1OW8 A;  4MVZ A;  2EPN A;  5T3T A;  2WZF A;  3R7C A;  2MWQ A;  4R32 A;  3ZC4 A;  1BR4 A;  3CQZ A;  1D1C A;  4H4K C;  1LE2 A;  3AG1 C;  1E83 A;  3EQL F;  1G8X A;  5F28 E;  2J45 A;  1BBH A;  2ZXR A;  3RFY A;  4BJ5 A;  4I44 A;  2Q9B A;  1BR1 A;  3N0T A;  5E3A A;  2P61 A;  5FCL A;  1HW2 A;  1YVI A;  2QY9 A;  1CGO A;  4LER A;  3AG4 C;  2XLW A;  1MMG A;  2HSB A;  2VCA A;  3Q7L A;  4FWV A;  2NUT A;  3UGO A;  4P6I C;  1T6I A;  3UGP A;  2FAP B;  2HFI A;  4E0I A;  3LUT B;  3U2L A;  3ITF A;  3K33 A;  3WG7 C;  4CDV A;  3UMI A;  3FOO A;  4UDV A;  2A1D D;  1CGN A;  2XLH A;  2YLG A;  5A69 A;  3TOM A;  1D0Y A;  5E3C A;  2YLD A;  3NMI A;  3BRJ A;  1HMD A;  3N24 A;  2XS1 A;  4O6Y A;  5L0I A;  2H7O A;  2M64 A;  3KL4 A;  2J9U A;  3L8I A;  3DE9 A;  4NTF A;  2D5R B;  3R2P A;  1LVK A;  2ZPA A;  2R9R B;  1RCP A;  1HE9 A;  2A6H F;  3IQ5 A;  3FXH A;  3DZA A;  4CIP A;  1LPE A;  4G7O F;  3MBG A;  4MTO A;  4MTG A;  1PD1 A;  3A11 A;  2KQ9 A;  2IM8 A;  1NSG B;  1FFT C;  3EH1 A;  3K7D A;  4NC3 A;  1M57 C;  4JUR I;  2BL2 A;  3NMK A;  3ZG1 A;  4GEH A;  1YZA A;  2Y3B A;  2UUH A;  4E7S A;  5EGY A;  2Y69 C;  4YWQ A;  2YL1 A;  1JRA A;  2LSE A;  2Z15 A;  3SXY A;  2QTV A;  2LQG A;  1H7I A;  2R7O A;  2YVK A;  3O39 A;  4YN0 B;  4AK9 A;  2CGE A;  5JS5 A;  4ULV A;  1V74 B;  4N6C A;  2NUT B;  2NSF A;  2OEX A;  3S9O A;  3RVZ A;  3SXZ A;  1M2V A;  4JJF A;  1H6G A;  1Q0F A;  1LIH A;  3TQO A;  4E18 A;  2XM4 A;  4PJN A;  3B0V C;  1D0Z A;  4KBL A;  1KTM A;  1ZHY A;  3QVZ A;  2GFH A;  2R02 A;  3ZQY A;  1Q0D A;  1GQA A;  1VLT A;  2LFF A;  2Q3T A;  1LM3 B;  4KC9 A;  2R7V A;  1Z63 A;  2PP4 A;  1YJG A;  2Y3H A;  3TOL A;  1ORS C;  256B A;  4D4N A;  2KJG A;  5L0D A;  2PX3 A;  2J9B A;  4O7G A;  3V5X A;  3JYY A;  3MYF A;  5FZT A;  3I4U A;  4MVM A;  3EH2 A;  1TWG A;  5GPG B;  3NDB B;  4JEA A;  5D92 A;  1YYJ A;  2I15 A;  2MHR A;  3JSE O;  5DQZ A;  1MQV A;  3U2M A;  4BEM J;  5EHH A;  3GEE A;  3HJC A;  3X1O A;  4HFF B;  2ZD9 A;  1RKE B;  3ZIB A;  1TR2 A;  2P7V A;  3L8J A;  4EBK A;  1JMW A;  1SF8 A;  5JLI A;  3IQC A;  2AWY A;  3JCU Q;  1M56 C;  3C7J A;  1S7Z A;  3LEV A;  3JYH A;  4HE8 D;  2I8B A;  1ORY A;  3BEH A;  4E17 A;  4OIR F;  5L0F A;  4J30 B;  3FDQ A;  4M63 A;  2H7B A;  3LS0 A;  3PCV A;  1MMD A;  4RD9 A;  3VM6 A;  2R7Q A;  4HFK B;  2IXN A;  3Q7G A;  2R7T A;  2ICW G;  4HEA J;  2EPM X;  3ECS A;  3UR3 C;  4MVU A;  5KYW A;  1Q0G A;  1EKY A;  1M2V B;  3O10 A;  2YEV A;  5BUO A;  3HKK A;  4RBN A;  1QLE C;  3CAX A;  5E2Q A;  1I4Z A;  3AGU A;  3F47 A;  1FR0 A;  3K1I A;  4IJJ A;  2PF4 E;  3GWL A;  2Q9A A;  1E2X A;  1LKX A;  2YL3 A;  1AUE A;  4DVZ A;  2VC9 A;  4U5H A;  4YL1 A;  4C7O B;  2YHS A;  4ONS A;  4CSA C;  5HSW A;  4CJO A;  3I5Q A;  1WWP A;  3HNK A;  3K66 A;  1TQG A;  2HV7 A;  3IHU A;  1T9K A;  4I1O B;  2LD6 A;  4KNW A;  1HMO A;  4XEV A;  2EIM C;  3QMK A;  4PK4 A;  2IXO A;  4CX9 A;  5L0J A;  1E85 A;  2AU5 A;  3EZI A;  3T6G B;  1ZVZ A;  4E7Z A;  2X51 A;  2P6V A;  3A9C A;  4D4X A;  2GAQ A;  1G4W R;  3T4R A;  1PCX A;  3S84 A;  2Q9C A;  1LS4 A;  3WHN A;  2A6E F;  1CPR A;  2L81 A;  2OEV A;  3E9V A;  4QI0 A;  4PFP A;  4DRH B;  4XPX A;  2J9W A;  3DAG A;  4NTA A;  4WGZ A;  1BDJ B;  4JW1 A;  3U5S A;  2VH3 A;  1W2W A;  3H2U A;  3LAY A;  1JPJ A;  4G0H A;  3RQE A;  2KYH A;  3N2Z B;  1XZP A;  2YQY A;  2P0N A;  3GAN A;  4MVR A;  5BQG A;  4PR9 A;  2R7X A;  2XS8 A;  3JTL O;  3RQG A;  1FFH A;  5L0G A;  5IY5 C;  5KYW B;  4WJ0 A;  3EJN A;  1SZI A;  4U9E A;  3V5Z A;  2R7S A;  5BQI A;  1E86 A;  3ASO C;  1L7C A;  1D0X A;  1LE4 A;  1IZM A;  3HTK C;  1YYX A;  1XZQ A;  5L0C A;  1QKR A;  2XRH A;  2HMZ A;  2L6H A;  5D91 A;  1YZC A;  3DJU B;  3V7O A;  4DJ9 A;  1YAU O;  2A69 F;  2EIJ C;  3O6X A;  4NY3 A;  3RYL A;  4CS7 A;  2O9X A;  1TWH A;  3MYI A;  4DRJ B;  3C18 A;  5JRA A;  3Q6N A;  3LES A;  5T3W A;  2KGO A;  1RKC A;  3S27 A;  3S28 A;  4U5C E;  3NKE A;  5AGF A;  3AQB A;  2IXM A;  3GM3 A;  4Z9J A;  1JPN A;  1T01 A;  3W8I A;  5KYX A;  4YJW A;  5COF A;  2BC5 A;  1MMN A;  3U9M A;  1GM5 A;  3T9O A;  2KSF A;  4CS8 A;  1FAP B;  4AE4 B;  3ASN C;  4JVS A;  2LK4 A;  4DBQ A;  4BG0 A;  2G3V A;  3W2W A;  1ZHW A;  4JKV A;  4CDY A;  1BZ4 A;  5JT4 A;  2V3C C;  4E0H A;  3M4B A;  4DVY P;  3FMS A;  1NU7 D;  1NU9 C;  2GDC A;  4YT5 A;  2L7A A;  4C3D A;  1MNE A;  2LP4 A;  2W4M A;  4U5D E;  1R4T A;  3NYM A;  3C8G B;  4BJ6 A;  1ST6 A;  1QSP A;  1RKE A;  3HNL A;  5BQH A;  2EIL C;  2MYS A;  3M4C A;  1ZHZ A;  4IAR A;  3POV A;  2EIK C;  2WL8 A;  4LDQ A;  4EHP A;  3DI5 A;  1QZX A;  2DYS C;  3LS1 A;  5KYY A;  1YAR O;  3NYL A;  3TD7 A;  3E70 C;  4QI2 A;  2L6G A;  3U0C A;  5AC4 A;  3SXK A;  5L3V A;  3AJM A;  2HZ8 A;  4NTB A;  4DOZ A;  2CYD A;  3CSK A;  3RW0 A;  1C03 A;  2NG1 A;  2OG2 A;  2QUP A;  2V26 A;  4ER9 A;  1AEP A;  3KYI A;  4BJ5 C;  2A0U A;  2JX0 A;  2VAS A;  2KW3 C;  4MQ9 F;  2A68 F;  3GM2 A;  3JRT A;  1Z5Z A;  2HSQ A;  5KYX B;  3JSZ A;  3FAJ A;  3GEH A;  5KYN A;  2W9Y A;  3GWN A;  1MMA A;  1V54 C;  2J8W A;  3GOD A;  3HNI A;  1H9T A;  2JPU A;  4C7O A;  1Y6D A;  3DAF A;  3G4X A;  2CDQ A;  3TJ6 A;  1D1A A;  1A7D A;  2C04 A;  2Q4F A;  3EGX A;  3KKB A;  3W8H A;  4EUK B;  4I1M A;  2FFH A;  5B3I A;  1TFO B;  3RVY A;  4EKW A;  1VOM A;  1ORJ A;  4ANJ A;  2YL7 A;  4FAP B;  1Z6A A;  4P9T A;  2P1A A;  1ZZP A;  2YWA A;  2HJM A;  3DE8 A;  3F46 A;  4O79 A;  1OKK A;  1VLS A;  3NRH A;  2R25 A;  3O55 A;  4MS2 A;  3ABL C;  4XQ1 A;  1K05 A;  3DWW A;  4PJM A;  2QNL A;  1OW6 A;  3ABK C;  4U5F E;  2B0H A;  3FVY A;  4X0R A;  5DS4 A;  3J06 A;  2J7P D;  3MFN A;  4CDA A;  4K7B A;  4YL0 A;  5K0I A;  1VK5 A;  1K40 A;  1E84 A;  2CW0 F;  2J7P A;  3JT1 A;  4J32 B;  5KYY B;  3AOU A;  3T6J A;  3OWT A;  2XL8 A;  4KI2 A;  1VTM P;  2HV6 A;  2HJ3 A;  1D1B A;  3MX3 A;  3QVY A;  4JCZ A;  1NBB A;  2BE5 F;  4K0D A;  4JRZ A;  2LIG A;  1Q0M A;  4JTC B;  3PHF 2;  3SNH A;  1OCR C;  3ZTM A;  5A6J A;  3H2V A;  5DLJ A;  4CS9 A;  2DB4 A;  3L0I A;  5E33 A;  5CIV A;  1CPQ A;  1YDI A;  3KPH A;  3ABM C;  3VF0 A;  2WVO A;  2EPO A;  4CIH A;  5KYU A;  4JCH A;  4I3M A;  1J8M F;  1U89 A;  1XWJ A;  4MND A;  1NFN A;  3UMK A;  5L3Q A;  1Z3I X;  1ZW2 A;  3EGX B;  1T5O A;  3M79 A;  1NLX A;  3U3B A;  3FHD A;  1I4Y A;  4RDA A;  5CI9 A;  5JUA A;  1CGM E;  4IGG A;  3GEI A;  4U9D A;  3MLG A;  4Q7C A;  4ZLC A;  2XLO A;  1VMA A;  5DS5 A;  3EGD B;  2QE9 A;  3EHN A;  3B9Q A;  4OD5 A;  4U5E E;  4MW8 A;  1A0B A;  3VAY A;  4LLE A;  1NG1 A;  2XLD A;  3ZVR A;  4AL0 A;  3DM5 A;  4LDK A;  4AE4 A;  5DS6 A;  4BPM A;  1NFO A;  5COG A;  3ZQV A;  1EQ1 A;  3IEE A;  3TUL A;  2J46 A;  2NSG A;  1Z23 A;  1ZYR F;  2G3K A;  2E87 A;  2PFD A;  5TJ5 E;  3ZTZ A;  4YT2 A;  2PX0 A;  3IQ6 A;  4OIQ F;  3L34 A;  3UMH A;  1U0B B;  1VB5 A;  3C8G D;  3C8G A;  4PAC A;  3NKD A;  4EIY A;  4O6M A;  5COM A;  1M2O A;  1OCZ C;  3QZC A;  4N4W A;  3S29 A;  4IB4 A;  2HS5 A;  4DXW A;  1OQC A;  4J7T A;  3NMJ A;  2OKU A;  3TK0 A;  4YT4 A;  4MVS A;  1V55 C;  4MVQ A;  4NCQ A;  1TKN A;  3IPM O;  2X0C A;  1F1M A;  2A0B A;  2WVN A;  3QTH A;  3U9J A;  5KYU B;  4G7Z F;  2LCH A;  3US6 A;  4CBE A;  3RQF A;  1BR2 A;  5HV9 A;  3I5P A;  2DGJ A;  3K1I C;  4JIO A;  4C3E A;  1O87 A;  4B6I A;  4OIP F;  1ZW3 A;  3T6B A;  3SXM A;  1OR3 A;  2OQM A;  3LNM B;  5B1A C;  1ZHT A;  3AG3 C;  3W2V A;  4JJG A;  2NUP A;  1C02 A;  1PD0 A;  4YK5 A;  4BEJ A;  4Z9H A;  2XLV A;  3KYJ A;  3RH3 A;  4BJT A;  2ETS A;  2OJQ A;  2R03 A;  2VB6 A;  1DOW A;  3S0X A;  3SP1 A;  1WOL A;  3DXJ F;  4JC7 A;  1G5Z A;  2W4B A;  1A7V A;  4AL1 A;  4XLP F;  3IQT A;  1FTS A;  5JP7 A;  5DVW A;  3K1H A;  4XEK A;  3X2Q C;  3OEO A;  2J0W A;  2Q00 A;  3EFO A;  1QVX A;  2ZXP A;  1U6H A;  1Q0K A;  4C3B A;  4F4B A;  2PBE A;  2L9J A;  3V5Y A;  3DKA A;  4H54 A;  1LI7 A;  4XTK A;  1K04 A;  4A2N B;  2AWC A;  4IAQ A;  2R7W A;  4W8P A;  3L1M A;  4MW3 A;  4Z9I A;  3UNG C;  1VYK A;  2YL0 A;  2IXP A;  3B29 A;  3JRM O;  4WAB A;  4W8K A;  2LFD A;  1RMV A;  1V4A A;  3FOP A;  1FMV A;  1H9G A;  2XL6 A;  3OA1 A;  3QW0 A;  4ULW A;  4XPW A;  2KK1 A;  1OR2 A;  2XM0 A;  2RSE B;  2VCB A;  3QW1 A;  4U5G A;  2KC3 A;  4BJ1 A;  4MVO A;  3LNR A;  1SR2 A;  2WB7 A;  3HNJ A;  5EK0 A;  2AP3 A;  1T6U A;  4Q5S F;  1JR8 A;  4A4A A;  4IAO A;  2GA0 A;  2FGY A;  4CJG A;  2NUP B;  1OXB A;  4MTF A;  2OJE D;  1N1C A;  2YLI A;  5A6A A;  3B0U X;  1O5H A;  1WAT A;  4LDR A;  3SEO A;  1HY5 A;  2Y39 A;  3Q6M A;  2WVQ A;  3LLK A;  4EBJ A;  1JOG A;  2TMV P;  4XLN F;  1YLM A;  4K1O A;  4G7H F;  1B68 A;  1OKK D;  2DI3 A;  4KNV A;  3EFO B;  4CS8 C;  1OXK A;  2H7V C;  1EA8 A;  3U8V A;  1HW1 A;  1L3P A;  1SMY F;  1UFB A;  3EGD A;  3TJ5 A;  3VYW A;  2WZG A;  3S90 A;  2Q7R A;  1TWA A;  4CSA A;  3FAP B;  4QDL A;  2GWW A;  4FX5 A;  2ZXO A;  1C17 M;  4G78 A;  1RJ9 A;  3RF3 A;  3DJN B;  1GS9 A;  1ZU4 A;  2RD9 A;  3EHM A;  3WAQ A;  3WOD F;  2VCC A;  4XEF A;  5A6K A;  2CNW D;  3ATP A;  4U5B E;  1MND A;  1TFK B;  2D4U A;  3AG2 C;  5T1D B;  1QPU A;  2W45 A;  3SZR A;  4BJ6 C;  1FNT c;  1FMW A;  2CNW A;  2XLE A;  3HLZ A;  4FES A;  4YT8 A;  1G4U S;  1A7E A;  2L6F A;  4L6R A;  4NQF A;  2IOQ A;  1I5N A;  1YA7 O;  3G50 A;  2WZL A;  2R7R A;  4ZLD A;  3RIP A;  1APC A;  2UUI A;  1TWC A;  4LAC B;  3W4Y A;  3EG9 A;  4AX2 A;  4EWC A;  5B3S C;  3U8P A;  4O6N A;  4EBB A;  3DMD A;  4GYT A;  2IBF A;  3M1C B;  3G4Z A;  4PFO A;  4GQH A;  3K6B A;  5F5H A;  1T6Q A;  2J0X A;  3AGT A;  4XWJ A;  5B1B C;  3H65 A;  4DBR A;  4OIO F;  2XXA B;  1M6T A;  3EZH A;  1IW7 F;  3B0P A;  5JSL A;  4JE9 A;  1ZHX A;  4JTD B;  2IYL D;  3CEX A; 
#chains in the Genus database with same CATH homology
 2RD9 A;  2HKV A;  3QTH A;  3GOR A;  2QE9 A;  2F22 A;  3DKA A;  1RXQ A;  5CIV A;  3DI5 A;  5COG A;  2OQM A;  2NSG A;  2P1A A;  2YQY A;  5COF A;  2OU6 A;  4N6C A;  2QNL A;  2NSF A;  5COM A;  3CEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...