3LS0A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
115
structure length
115
Chain Sequence
TYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
molecule keywords Sll1638 protein
total genus 48
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls0A00
3ZSUA 1VYKA 3JCUQ 3RFYA 3LS1A 3LS0A 1NZEA 2MWQA
chains in the Genus database with same CATH superfamily
2BC5A 1H6GA 1AUEA 1Q0DA 2ZXPA 4A2NB 1OW8A 4J7YA 1YA9A 2ZXRA 3Q7LA 2HS5A 1HE1A 1ZYRF 4U5DE 1YDIA 1WN0A 3EGDA 2EPMX 1M6TA 3I4UA 2J9WA 5A69A 1NBBA 3DMDA 1KNYA 2LFFA 2KW3C 2PX0A 2WVOA 3A11A 3GODA 2JD3A 2LP4A 3LEOA 1QKRA 2J45A 2XXAB 1OKKA 2EIJC 2A6EF 4NC3A 3DKAA 3GEEA 3K33A 3GEIA 4XEFA 4K1OA 2CW0F 3CQZA 1D1CA 4XPWA 1TWHA 2F22A 1CPQA 1OW6A 3CEXA 3N2ZB 1V54C 4LLEA 4IJJA 1Q0KA 3JSZA 4NTBA 4Z9JA 2R7RA 4D4XA 4CIPA 5DS5A 1M56C 1O3UA 2XLDA 1JOGA 2NUPB 3DWWA 3NYLA 5BQGA 1WGWA 3C7JA 4J32B 1HW2A 1GGQA 2YWAA 1R4TA 3LAYA 4P6IC 4NY3A 4Z9HA 4JZAA 3OWTA 4EKWA 5KYNA 4OD5A 1OQCA 3M79A 2YL7A 3N0TA 1M2VB 5JLIA 2BL2A 2XLWA 4BEJA 1E2XA 3KMIA 2RSEB 4YN0B 2Q9AA 4IAOA 1RXQA 2ZXOA 5IY5C 5L0FA 3EJNA 4F4BA 1VYIA 2OU6A 4KNWA 1T6IA 4I44A 3T4RA 3RKOF 3X2QC 1M2VA 4JC7A 5EHHA 1MNDA 1WATA 1CGNA 3C63A 3EGXB 2WB7A 3HNJA 3TK0A 3U2LA 4JCHA 2L6HA 1V4AA 2LD6A 1A7EA 1LKXA 1BDJB 2CNWD 4IARA 4XPYA 1JMWA 1YVIA 1CGOA 2J8WA 2PP4A 2YLDA 4WGYA 3UR3C 3AGTA 2R7XA 4C7OB 2Q9BA 3GWNA 4JVSA 5AGFA 1IW7F 2Q9CA 4KC9A 2YEVA 2GWWA 3RVZA 1HW1A 2DB4A 1Z7Qc 3T6BA 1SYQA 4XLNF 1U0BB 2WL8A 3LNRA 1O87A 2NUTB 1BZ4A 3L8JA 1RKEB 2VCBA 3JRMO 4GYTA 4HFFB 4O6NA 3RQFA 4I1MA 1T6QA 2HKVA 3AG3C 3SZRA 2HV7A 2R05A 3DZAA 1VTMP 256BA 4DOZA 2GFHA 4LDQA 1V74B 3TJ5A 4E7ZA 5T3TA 1NU7D 3FAPB 4YL0A 2PNOA 4KNVA 1WOLA 5L3VA 3JZ0A 1W2WA 3V5ZA 3O39A 4NQFA 4PACA 5KYYA 2I8BA 2ICWG 3L34A 3PCVA 1V55C 1YA7O 3GWLA 4MVUA 2ETSA 5F28E 5B3IA 5B3SC 4ANJA 2V3CC 3RQGA 3O10A 3E70C 2XSEA 3LLKA 5FZTA 4DXWA 3M4CA 1LI5A 2W4BA 2CGEA 2Q7RA 3ZIBA 3Q6MA 5A6BA 5JVEA 3RFYA 4DVYP 5JUAA 4G7OF 1ORJA 3DAFA 1ZW2A 4MNDA 1EI7A 4MVMA 3TD7A 5KYXB 2YL3A 1E85A 1VK5A 2L9JA 4K0DA 3UMHA 2CNWA 5E3AA 4CDVA 1H7IA 5COMA 2WZLA 3DI5A 3W8HA 4D4NA 5BUOA 3G4XA 3RVYA 3K1IA 1M57C 1M2OA 2HZ8A 2PX3A 2XLOA 3EHNA 3K1IC 5CI8A 3SXKA 4EHPA 3OA1A 4XTKA 3JCUQ 5KYUA 4QI2A 3ABKC 3EQLF 1FMVA 3HKKA 5T1DB 1PV3A 2G62A 4U5EE 3ZTZA 5D91A 3ZWIA 4AK9A 4HFKB 3J06A 2YL1A 1RKCA 2LCHA 3W2WA 1D1BA 5AC4A 2EILC 2PFDA 4KBLA 1LVKA 3KYJA 2Y3GA 3MFNA 4QI0A 4XEKA 1Z6AA 4CX9A 2ZD9A 3MYFA 2XL4A 3OEOA 3ABLC 1Y6DA 4ONSA 4CS8C 2YVKA 2HSBA 5K0IA 1FR0A 3K1HA 3ZG1A 4CS8A 3KYIA 5F5HA 3E9VA 4O6MA 1YAUO 1ORSC 4EWCA 1LE2A 2P6VA 1NFOA 3DE8A 1OCRC 1ZW3A 4JEAA 5JSLA 1G8XA 4AE4A 1F1MA 4LLCA 1OXKA 3IEEA 3VRCA 3DD7A 2QLAA 3R2PA 4BJ5C 4JCZA 1D0ZA 2XLMA 3ZSUA 1ZU5A 3TOMA 5A6BD 4BJ1A 3Q6NA 3I5PA 3C8GA 4XPXA 1OXBA 1XZPA 1Z63A 3I5QA 3C62A 4MTGA 3DM5A 3GANA 1YYXA 2MWQA 3MLGA 4RD9A 4XEVA 3WG7C 4A4AA 3JT1A 1Q0MA 4CDYA 3DM9B 1TQGA 1Z23A 5GPGB 2OOCA 3O6XA 2W4MA 2XS1A 4JEBA 2X0CA 5EGYA 3S84A 5L0IA 2YL0A 2R7TA 1YYJA 2XM0A 2L6FA 1UG7A 4QDLA 4AX2A 2R9RB 4B6IA 2HJ3A 3C18A 2GDCA 3U8VA 4I3MA 1Y4CA 2D5RB 2OCCC 4CDAA 1NFNA 3AG2C 1PD1A 1CPRA 3DJNB 2KNHA 2KSFA 3QW1A 3TOLA 4EUKB 4JTCB 4YT4A 3NRHA 5A6JA 1YJGA 1BR4A 1CGME 4OIPF 1E86A 3ZQVA 2C03A 3FXHA 2R7OA 3AJMA 3JSEO 4N6CA 2R7WA 1N1CA 2OJED 3K66A 2HV6A 3FAJA 3IQ6A 5HV9A 1I4YA 4P9FA 3DAGA 1LE4A 3QMKA 5T3WA 2FFHA 3GEHA 1PCXA 2KGOA 2A68F 4CSAC 3ZDLA 3MYIA 4Q4ZF 2LSEA 2LFDA 4NTAA 4DRHB 3AG4C 2IYLD 3C8GD 4AL1A 5L0JA 2M4EA 3V5YA 3X1OA 3GORA 5L0DA 3JRTA 4FX5A 3ITFA 5BQIA 3RIPA 5CIVA 3VAYA 5JP7A 3F46A 3LUTB 4CIHA 5BQHA 1BBHA 1NU9C 3EFOB 4IRUA 1ORYA 2QUPA 3NMIA 1LI7A 4IAQA 4AE4B 1KU2A 2EIMC 2P0NA 2Q00A 4MVQA 1AVOB 3KH2A 3KPHA 5DQZA 4GEHA 1VLTA 3B9QA 3ABMC 2G3KA 3LNMB 4L6RA 3TJ6A 3NKEA 4Q5SF 3TQOA 3SYNA 3EFOA 2KC3A 3DXJF 3HTKC 3LEVA 1DOVA 1OCCC 3L0IA 2YRFA 4MQ9F 1VMAA 2H7OA 1O5HA 1ZHYA 3VM6A 1SMYF 1WTYA 3B0PA 1MMAA 1A41A 1JAFA 2JPUA 3AQCA 3R7CA 4U5HA 2L6GA 3ECSA 4XQ1A 1OCOC 3ASOC 4YT2A 5AC5A 5A6KA 1TWGA 1KTMA 1GS9A 4EBBA 4JIOA 5E2QA 2J7PD 1JPNA 1I4ZA 2OEXA 1OR3A 1JR8A 1U89A 3LESA 4JTDB 2JX0A 3CAXA 1SR2A 2X51A 4WABA 3U3BA 2XS8A 1BR1A 2EIKC 4CJGA 1C02A 4UDVA 5L0CA 4G7ZF 1TWCA 3NMJA 4E7SA 3UGOA 3AGUA 4IGGA 2J0WA 1MMDA 2IM8A 2ASRA 2J9VA 5E3CA 4ER9A 1A7VA 1G5ZA 1G4US 3H2VA 4FWVA 4ZLCA 2CDQA 4C3EA 3FVYA 3M4BA 4U9EA 5DS6A 1GM5A 3EPVA 3NKDA 1NG1A 2VASA 1E84A 1SF8A 2AVKA 3K7DA 1LS1A 1Z5ZA 4DVZA 2XL8A 3GM2A 2L81A 3WAQA 1K05A 3FDQA 3S27A 3UMIA 3FOPA 3G4ZA 5JRAA 3K6BA 3IQ5A 3LS0A 3PMRA 2R7SA 3DE9A 3RH3A 2HSQA 3T9OA 2WVNA 4E0HA 3DJUB 3JYHA 2HMZA 2LQGA 2MHRA 1ZU4A 4MVSA 1T6UA 3W4YA 2A1DD 2VH3A 3V5XA 2P7VA 2NG1A 2VB6A 1S05A 2ZXWC 4G0HA 3NYMA 3S29A 3ZTMA 4X0RA 5KYWB 1VLSA 4U5BE 3QVYA 4MW3A 4YJWA 1H9TA 2AWCA 2EPKX 3O55A 5KYYB 2Y3DA 3NMKA 2E87A 1SZIA 2KK1A 2J7PA 2A6HF 4MTFA 3FOOA 4OIQF 2J46A 2Y3BA 4LDRA 2R7VA 1EA8A 3M1CB 3HNIA 1ST6A 2B0JA 2P1AA 4PR9A 1C17M 3T6GB 3ATPA 1NLXA 4N6HA 4Z9IA 1Q0FA 2W9YA 2V26A 4BPMA 3UGPA 4E18A 1VB5A 5COGA 4O7GA 1YARO 5A6AA 4MS2A 3S90A 2XLVA 3BRJA 3FMSA 5F5FA 3QTHA 1DOWA 2GA0A 5DVWA 4K7BA 4EIYA 2CYDA 2RD9A 2YZSA 3B0UX 2CCYA 1IZMA 1QQ3A 1MMGA 4DRJB 2H8AA 1LM3B 2QNLA 1HMDA 3LS1A 3HNKA 1TFKB 2IXPA 2M64A 4JE9A 1YLMA 4LERA 1XWJA 3SNHA 2PBEA 3SEOA 3HNLA 1UFBA 1VOMA 1APCA 2R03A 1S7ZA 2HJMA 3S9OA 3W8IA 3TULA 2NPUA 1BR2A 2IOQA 1U6HA 3U2MA 2HMQA 2DYSC 1LIHA 1YZCA 4BG0A 1I5NA 3HJCA 3ZQYA 2KQ9A 4EBKA 3L8IA 4MVOA 5E33A 2WVQA 3M15A 4O6YA 4N4WA 4BEMJ 3C8ZA 5DLJA 4RDAA 2P61A 4BJ5A 1Q0GA 3EG9B 4BJ6C 3NDBB 1T01A 1QPUA 3Q7GA 4HEAJ 3SXZA 3G50A 1T5OA 2YLIA 1RMVA 3US6A 4KI2A 1J8MF 1LS4A 4J7TA 3RQEA 3T6JA 5KYXA 2NUPA 3FHDA 3EG9A 4YT8A 2A0BA 4YT5A 3U9JA 3S28A 2Q3TA 3RYLA 1OR2A 1NZEA 1ZHWA 2DYRC 3IHUA 3MX3A 3VYWA 4XLPF 1D0YA 2FAPB 3IQTA 3EH2A 4JKVA 5DQTA 3QVZA 2IXMA 4YL1A 4C3BA 1R5ID 2OKUA 2UUIA 3EH1A 3EZHA 5B1AC 2GAQA 4N06A 2VC9A 1QZXA 1ZHXA 3H65A 1QLEC 2LK4A 3IPMO 2I15A 4IB4A 5B1BC 2Y69C 1LPEA 4H4KC 1TKNA 3LLIA 2EPLX 2D4UA 2R7UA 3AG1C 2NUTA 3PHF2 4PJMA 3BEHA 2Q4FA 4G78A 1VYKA 4HE8D 4E17A 4OD4A 3PDMP 1OCZC 1XZQA 2J0XA 1ZHTA 2H7VC 4YK5A 1K40A 3U0CA 5DS4A 5FCLA 3VF0A 4NTFA 4ZLDA 2XRHA 2OEVA 3EHMA 2OQMA 4MVRA 1HE9A 2J9BA 2XM4A 3CSKA 4I1OB 2KYHA 2QE9A 1FAPB 1HMOA 2EPOA 2XLHA 2YLGA 3IQCA 3KKBA 1T9KA 4W8PA 4WJ0A 4W8KA 1FMWA 1D1AA 3ASNC 3U3FA 1OW7A 3SP1A 2TMVP 2WZGA 2FGYA 4FAPB 2AU5A 1QVXA 4C7OA 4PJLA 3RF3A 4JTAB 2O9XA 2ZPAA 5TJ5E 2XL6A 2WZFA 4YL3A 1QSPA 4R32A 3N24A 4WGZA 2W45A 4CS9A 3CZ6A 1GQAA 3WHNA 1EQ1A 2R02A 1YZAA 4H54A 1L3PA 2H7BA 5L0HA 4BJ6A 2XLEA 5JT4A 3U5SA 2J9UA 4CBEA 2BE5F 2MYSA 1Z3IX 3AOUA 4OIRF 1WWPA 3GM3A 4JJGA 5JS5A 3EZIA 5D92A 2R7QA 2AWYA 1B68A 1HY5A 4PFOA 4IWBA 5EK0A 2Z15A 2DI3A 3U8PA 2C04A 4CS7A 4MW8A 1JPJA 2OG2A 4CSAA 4U9DA 2DGJA 1MMNA 2A0UA 4BJTA 4ULVA 3QZCA 4LDKA 3U9MA 4Q7CA 3UNGC 3WODF 3ZC4A 3JYYA 4OIOF 3SXYA 4U5GA 3B29A 4PJJA 4DBQA 2IXNA 4C3DA 3B71A 1J8YF 4LACB 1MNEA 5KYWA 5L3QA 1D0XA 1K04A 2OJQA 2XXAA 1ZHZA 2UUHA 4P9TA 3H2UA 1EKYA 2LIGA 2B0HA 3S0XA 1PD0A 2IBFA 2AP3A 3SXMA 1ZZPA 4MTOA 3ZVRA 4U5FE 2Y3HA 2A69F 3EGDB 4PFPA 4YWQA 1NSGB 2EPNA 4O79A 1A0BA 4PJNA 4U5CE 4JRZA 5L0GA 3F47A 4NCQA 1TFOB 1RKEA 3AQBA 3L1MA 4FESA 4AL0A 1E83A 1OKKD 2L7AA 2NSFA 1FFHA 2R25A 4EBJA 2QY9A 1L7CA 3JTLO 4GQHA 3RW0A 3POVA 4DBRA 1MQVA 3QW0A 4RBNA 4E0IA 1FTSA 2NSGA 4M63A 1G4WR 2HUJA 4JURI 4MVZA 3C8GB 3LJBA 5KYUB 3NG1A 2VCCA 3MBGA 3A9CA 2YKZA 3EGXA 1ZVZA 1TWAA 2G3VA 3HLZA 1RCPA 3NYJA 1TR2A 5COFA 4OINF 3W2VA 1RJ9A 5CI9A 1C03A 2VCAA 5HSWA 2YQYA 3B0VC 4J30B 2KJGA 1JRAA 4CJOA 2PF4E 3GM1A 4DJ9A 2Y39A 4DRIB 4ULWA 3UMKA 2IXOA 3V7OA 4PK4A 4XWJA 4JW1A 1FFTC 4G7HF 1AEPA 2EINC 4JJFA 1FNTc 1H9GA 4CS9C 2QTVA 1A7DA 2HFIA 3KL4A 1RJ9B 2YHSA 1WASA
chains in the Genus database with same CATH topology
2ZXPA 4A2NB 2ZXRA 3Q7LA 4U5DE 1ZYRF 3EGDA 3I4UA 2J9WA 3DMDA 2WVOA 2KW3C 2PX0A 3GODA 2JD3A 2J45A 2XXAB 1OKKA 2EIJC 2A6EF 3K33A 2CW0F 3CQZA 1D1CA 1TWHA 3N2ZB 2R7RA 1V54C 4LLEA 4IJJA 3JSZA 5DS5A 1M56C 2NUPB 3NYLA 1WGWA 4J32B 3LAYA 4P6IC 4NY3A 4JZAA 3OWTA 5KYNA 4OD5A 3N0TA 1M2VB 4BEJA 3KMIA 4YN0B 2Q9AA 4IAOA 2ZXOA 5IY5C 3EJNA 4F4BA 1VYIA 4KNWA 4I44A 3T4RA 3RKOF 3X2QC 1M2VA 5EHHA 1MNDA 3EGXB 2WB7A 4JCHA 1LKXA 2CNWD 4OIPF 2PP4A 3UR3C 4C7OB 2Q9BA 4JVSA 1IW7F 2Q9CA 4KC9A 2YEVA 3T6BA 4XLNF 2WL8A 3LNRA 1O87A 2NUTB 4GYTA 4HFFB 4I1MA 3AG3C 3SZRA 2HV7A 3DZAA 4DOZA 2GFHA 4E7ZA 5T3TA 1NU7D 4KNVA 5L3VA 1W2WA 3O39A 5KYYA 2I8BA 3L34A 1V55C 5B3SC 4ANJA 2V3CC 3E70C 2XSEA 3LLKA 2W4BA 2CGEA 3ZIBA 3Q6MA 4G7OF 3RFYA 4DVYP 3DAFA 4MNDA 5KYXB 3TD7A 1VK5A 2L9JA 4K0DA 3UMHA 2CNWA 5E3AA 2WZLA 3W8HA 5BUOA 1M57C 1M2OA 2PX3A 3EHNA 3K1IC 5CI8A 3OA1A 4XTKA 3JCUQ 5KYUA 4QI2A 3ABKC 3EQLF 1FMVA 5T1DB 2G62A 4U5EE 4AK9A 5D91A 4HFKB 3W2WA 1D1BA 2EILC 2PFDA 4KBLA 1LVKA 2Y3GA 4QI0A 1Z6AA 2XL4A 3OEOA 3ABLC 4CS8C 3K1HA 3ZG1A 4CS8A 5F5HA 3E9VA 4O6MA 4EWCA 2P6VA 1OCRC 1G8XA 4AE4A 4LLCA 3IEEA 3DD7A 4BJ5C 1D0ZA 3ZSUA 1ZU5A 4BJ1A 3Q6NA 3I5PA 1Z63A 3I5QA 4RD9A 3DM5A 3GANA 2MWQA 3WG7C 3MLGA 3JT1A 3DM9B 1Z23A 3O6XA 2W4MA 5EGYA 2R7TA 4QDLA 4AX2A 4B6IA 4I3MA 2D5RB 2OCCC 3AG2C 3DJNB 1PD1A 2KNHA 4YT4A 3NRHA 1BR4A 2C03A 2R7OA 2R7WA 1N1CA 3K66A 2HV6A 3FAJA 3DAGA 3QMKA 5T3WA 2FFHA 1PCXA 2KGOA 2A68F 4CSAC 4Q4ZF 2LSEA 3AG4C 2IYLD 2M4EA 3X1OA 3JRTA 4FX5A 3ITFA 3RIPA 3VAYA 3F46A 4CIHA 3EFOB 1NU9C 4IRUA 4AE4B 1KU2A 2EIMC 3KH2A 5DQZA 4GEHA 3B9QA 3ABMC 2G3KA 3NKEA 4Q5SF 3SYNA 3EFOA 3DXJF 3LEVA 3HTKC 1OCCC 3L0IA 4MQ9F 1VMAA 2H7OA 1O5HA 1ZHYA 1SMYF 3B0PA 1MMAA 3AQCA 4U5HA 3ECSA 4YT2A 1OCOC 3ASOC 1TWGA 4EBBA 5E2QA 2J7PD 1JPNA 3LESA 2X51A 1BR1A 2EIKC 4G7ZF 1TWCA 4E7SA 3UGOA 2J0WA 1MMDA 2J9VA 5E3CA 4FWVA 4ZLCA 2CDQA 4C3EA 3FVYA 5DS6A 3EPVA 3NKDA 1NG1A 2VASA 1SF8A 3K7DA 4DVZA 1LS1A 1Z5ZA 2L81A 3FDQA 3S27A 3UMIA 2R7SA 3K6BA 3PMRA 3LS0A 3RH3A 2WVNA 3DJUB 3JYHA 1ZU4A 2A1DD 2VH3A 2P7VA 2NG1A 2VB6A 2ZXWC 4G0HA 3NYMA 3S29A 4X0RA 5KYWB 4U5BE 4YJWA 5KYYB 2Y3DA 2E87A 1SZIA 2J7PA 2A6HF 4OIQF 2J46A 2Y3BA 2R7VA 3M1CB 1ST6A 2B0JA 2W9YA 2V26A 3UGPA 4O7GA 5F5FA 5DVWA 4K7BA 2YZSA 3B0UX 1IZMA 1MMGA 3LS1A 2IXPA 4LERA 3SNHA 3SEOA 1VOMA 1S7ZA 3W8IA 1BR2A 2IOQA 2DYSC 4BG0A 3HJCA 2KQ9A 5E33A 2WVQA 4O6YA 5DLJA 4BJ5A 4RDAA 3EG9B 4BJ6C 3NDBB 3Q7GA 4HEAJ 4KI2A 1J8MF 3T6JA 5KYXA 2NUPA 3FHDA 3EG9A 4YT8A 4YT5A 3S28A 2Q3TA 3RYLA 1NZEA 1ZHWA 2DYRC 3MX3A 3VYWA 4XLPF 1D0YA 3EH2A 5DQTA 2IXMA 4C3BA 3EH1A 5B1AC 3EZHA 4N06A 1QZXA 1ZHXA 3H65A 1QLEC 5B1BC 2Y69C 4H4KC 1TKNA 3LLIA 2R7UA 3AG1C 2NUTA 4PJMA 1VYKA 4HE8D 4OD4A 1OCZC 2J0XA 1ZHTA 2H7VC 5DS4A 5FCLA 4ZLDA 2XRHA 3EHMA 3CSKA 4I1OB 4O6NA 3KKBA 4WJ0A 4W8KA 1FMWA 1D1AA 3ASNC 3SP1A 2WZGA 2FGYA 4C7OA 4PJLA 2O9XA 2ZPAA 2WZFA 3N24A 2W45A 4CS9A 3CZ6A 2H7BA 4BJ6A 2J9UA 4CBEA 2BE5F 2MYSA 1Z3IX 4OIRF 4JJGA 3EZIA 5D92A 2R7QA 4PFOA 4IWBA 2Z15A 2C04A 4CS7A 1JPJA 2OG2A 4CSAA 2DGJA 1MMNA 4BJTA 3QZCA 3WODF 3ZC4A 4Q7CA 3UNGC 4OIOF 4U5GA 4PJJA 4DBQA 2IXNA 4C3DA 1J8YF 4LACB 1MNEA 5KYWA 5L3QA 1D0XA 2XXAA 1ZHZA 3S0XA 1PD0A 3ZVRA 4U5FE 2Y3HA 2A69F 3EGDB 4PFPA 4YWQA 4O79A 2R7XA 4PJNA 4U5CE 3F47A 3AQBA 4FESA 1OKKD 1FFHA 2QY9A 3POVA 4DBRA 4RBNA 1FTSA 4M63A 4JURI 3LJBA 5KYUB 3NG1A 3EGXA 1TWAA 2G3VA 3HLZA 4OINF 3NYJA 1TR2A 3W2VA 1RJ9A 5CI9A 5HSWA 3B0VC 4J30B 2KJGA 2Y39A 4ULWA 3UMKA 2IXOA 3V7OA 4PK4A 4XWJA 4JW1A 1FFTC 4G7HF 2EINC 4JJFA 4CS9C 2QTVA 2PF4E 3KL4A 1RJ9B 2YHSA 3PHF2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSU A;  1VYK A;  3JCU Q;  3RFY A;  3LS1 A;  3LS0 A;  1NZE A;  2MWQ A; 
#chains in the Genus database with same CATH topology
 2BC5 A;  1H6G A;  1AUE A;  1Q0D A;  2ZXP A;  4A2N B;  1OW8 A;  4J7Y A;  1YA9 A;  2ZXR A;  3Q7L A;  2HS5 A;  1HE1 A;  1ZYR F;  4U5D E;  1YDI A;  1WN0 A;  3EGD A;  2EPM X;  1M6T A;  3I4U A;  2J9W A;  5A69 A;  1NBB A;  3DMD A;  1KNY A;  2LFF A;  2KW3 C;  2PX0 A;  2WVO A;  3A11 A;  3GOD A;  2JD3 A;  2LP4 A;  3LEO A;  1QKR A;  2J45 A;  2XXA B;  1OKK A;  2EIJ C;  2A6E F;  4NC3 A;  3DKA A;  3GEE A;  3K33 A;  3GEI A;  4XEF A;  4K1O A;  2CW0 F;  3CQZ A;  1D1C A;  4XPW A;  1TWH A;  2F22 A;  1CPQ A;  1OW6 A;  3CEX A;  3N2Z B;  1V54 C;  4LLE A;  4IJJ A;  1Q0K A;  3JSZ A;  4NTB A;  4Z9J A;  2R7R A;  4D4X A;  4CIP A;  5DS5 A;  1M56 C;  1O3U A;  2XLD A;  1JOG A;  2NUP B;  3DWW A;  3NYL A;  5BQG A;  1WGW A;  3C7J A;  4J32 B;  1HW2 A;  1GGQ A;  2YWA A;  1R4T A;  3LAY A;  4P6I C;  4NY3 A;  4Z9H A;  4JZA A;  3OWT A;  4EKW A;  5KYN A;  4OD5 A;  1OQC A;  3M79 A;  2YL7 A;  3N0T A;  1M2V B;  5JLI A;  2BL2 A;  2XLW A;  4BEJ A;  1E2X A;  3KMI A;  2RSE B;  4YN0 B;  2Q9A A;  4IAO A;  1RXQ A;  2ZXO A;  5IY5 C;  5L0F A;  3EJN A;  4F4B A;  1VYI A;  2OU6 A;  4KNW A;  1T6I A;  4I44 A;  3T4R A;  3RKO F;  3X2Q C;  1M2V A;  4JC7 A;  5EHH A;  1MND A;  1WAT A;  1CGN A;  3C63 A;  3EGX B;  2WB7 A;  3HNJ A;  3TK0 A;  3U2L A;  4JCH A;  2L6H A;  1V4A A;  2LD6 A;  1A7E A;  1LKX A;  1BDJ B;  2CNW D;  4IAR A;  4XPY A;  1JMW A;  1YVI A;  1CGO A;  2J8W A;  2PP4 A;  2YLD A;  4WGY A;  3UR3 C;  3AGT A;  2R7X A;  4C7O B;  2Q9B A;  3GWN A;  4JVS A;  5AGF A;  1IW7 F;  2Q9C A;  4KC9 A;  2YEV A;  2GWW A;  3RVZ A;  1HW1 A;  2DB4 A;  1Z7Q c;  3T6B A;  1SYQ A;  4XLN F;  1U0B B;  2WL8 A;  3LNR A;  1O87 A;  2NUT B;  1BZ4 A;  3L8J A;  1RKE B;  2VCB A;  3JRM O;  4GYT A;  4HFF B;  4O6N A;  3RQF A;  4I1M A;  1T6Q A;  2HKV A;  3AG3 C;  3SZR A;  2HV7 A;  2R05 A;  3DZA A;  1VTM P;  256B A;  4DOZ A;  2GFH A;  4LDQ A;  1V74 B;  3TJ5 A;  4E7Z A;  5T3T A;  1NU7 D;  3FAP B;  4YL0 A;  2PNO A;  4KNV A;  1WOL A;  5L3V A;  3JZ0 A;  1W2W A;  3V5Z A;  3O39 A;  4NQF A;  4PAC A;  5KYY A;  2I8B A;  2ICW G;  3L34 A;  3PCV A;  1V55 C;  1YA7 O;  3GWL A;  4MVU A;  2ETS A;  5F28 E;  5B3I A;  5B3S C;  4ANJ A;  2V3C C;  3RQG A;  3O10 A;  3E70 C;  2XSE A;  3LLK A;  5FZT A;  4DXW A;  3M4C A;  1LI5 A;  2W4B A;  2CGE A;  2Q7R A;  3ZIB A;  3Q6M A;  5A6B A;  5JVE A;  3RFY A;  4DVY P;  5JUA A;  4G7O F;  1ORJ A;  3DAF A;  1ZW2 A;  4MND A;  1EI7 A;  4MVM A;  3TD7 A;  5KYX B;  2YL3 A;  1E85 A;  1VK5 A;  2L9J A;  4K0D A;  3UMH A;  2CNW A;  5E3A A;  4CDV A;  1H7I A;  5COM A;  2WZL A;  3DI5 A;  3W8H A;  4D4N A;  5BUO A;  3G4X A;  3RVY A;  3K1I A;  1M57 C;  1M2O A;  2HZ8 A;  2PX3 A;  2XLO A;  3EHN A;  3K1I C;  5CI8 A;  3SXK A;  4EHP A;  3OA1 A;  4XTK A;  3JCU Q;  5KYU A;  4QI2 A;  3ABK C;  3EQL F;  1FMV A;  3HKK A;  5T1D B;  1PV3 A;  2G62 A;  4U5E E;  3ZTZ A;  5D91 A;  3ZWI A;  4AK9 A;  4HFK B;  3J06 A;  2YL1 A;  1RKC A;  2LCH A;  3W2W A;  1D1B A;  5AC4 A;  2EIL C;  2PFD A;  4KBL A;  1LVK A;  3KYJ A;  2Y3G A;  3MFN A;  4QI0 A;  4XEK A;  1Z6A A;  4CX9 A;  2ZD9 A;  3MYF A;  2XL4 A;  3OEO A;  3ABL C;  1Y6D A;  4ONS A;  4CS8 C;  2YVK A;  2HSB A;  5K0I A;  1FR0 A;  3K1H A;  3ZG1 A;  4CS8 A;  3KYI A;  5F5H A;  3E9V A;  4O6M A;  1YAU O;  1ORS C;  4EWC A;  1LE2 A;  2P6V A;  1NFO A;  3DE8 A;  1OCR C;  1ZW3 A;  4JEA A;  5JSL A;  1G8X A;  4AE4 A;  1F1M A;  4LLC A;  1OXK A;  3IEE A;  3VRC A;  3DD7 A;  2QLA A;  3R2P A;  4BJ5 C;  4JCZ A;  1D0Z A;  2XLM A;  3ZSU A;  1ZU5 A;  3TOM A;  5A6B D;  4BJ1 A;  3Q6N A;  3I5P A;  3C8G A;  4XPX A;  1OXB A;  1XZP A;  1Z63 A;  3I5Q A;  3C62 A;  4MTG A;  3DM5 A;  3GAN A;  1YYX A;  2MWQ A;  3MLG A;  4RD9 A;  4XEV A;  3WG7 C;  4A4A A;  3JT1 A;  1Q0M A;  4CDY A;  3DM9 B;  1TQG A;  1Z23 A;  5GPG B;  2OOC A;  3O6X A;  2W4M A;  2XS1 A;  4JEB A;  2X0C A;  5EGY A;  3S84 A;  5L0I A;  2YL0 A;  2R7T A;  1YYJ A;  2XM0 A;  2L6F A;  1UG7 A;  4QDL A;  4AX2 A;  2R9R B;  4B6I A;  2HJ3 A;  3C18 A;  2GDC A;  3U8V A;  4I3M A;  1Y4C A;  2D5R B;  2OCC C;  4CDA A;  1NFN A;  3AG2 C;  1PD1 A;  1CPR A;  3DJN B;  2KNH A;  2KSF A;  3QW1 A;  3TOL A;  4EUK B;  4JTC B;  4YT4 A;  3NRH A;  5A6J A;  1YJG A;  1BR4 A;  1CGM E;  4OIP F;  1E86 A;  3ZQV A;  2C03 A;  3FXH A;  2R7O A;  3AJM A;  3JSE O;  4N6C A;  2R7W A;  1N1C A;  2OJE D;  3K66 A;  2HV6 A;  3FAJ A;  3IQ6 A;  5HV9 A;  1I4Y A;  4P9F A;  3DAG A;  1LE4 A;  3QMK A;  5T3W A;  2FFH A;  3GEH A;  1PCX A;  2KGO A;  2A68 F;  4CSA C;  3ZDL A;  3MYI A;  4Q4Z F;  2LSE A;  2LFD A;  4NTA A;  4DRH B;  3AG4 C;  2IYL D;  3C8G D;  4AL1 A;  5L0J A;  2M4E A;  3V5Y A;  3X1O A;  3GOR A;  5L0D A;  3JRT A;  4FX5 A;  3ITF A;  5BQI A;  3RIP A;  5CIV A;  3VAY A;  5JP7 A;  3F46 A;  3LUT B;  4CIH A;  5BQH A;  1BBH A;  1NU9 C;  3EFO B;  4IRU A;  1ORY A;  2QUP A;  3NMI A;  1LI7 A;  4IAQ A;  4AE4 B;  1KU2 A;  2EIM C;  2P0N A;  2Q00 A;  4MVQ A;  1AVO B;  3KH2 A;  3KPH A;  5DQZ A;  4GEH A;  1VLT A;  3B9Q A;  3ABM C;  2G3K A;  3LNM B;  4L6R A;  3TJ6 A;  3NKE A;  4Q5S F;  3TQO A;  3SYN A;  3EFO A;  2KC3 A;  3DXJ F;  3HTK C;  3LEV A;  1DOV A;  1OCC C;  3L0I A;  2YRF A;  4MQ9 F;  1VMA A;  2H7O A;  1O5H A;  1ZHY A;  3VM6 A;  1SMY F;  1WTY A;  3B0P A;  1MMA A;  1A41 A;  1JAF A;  2JPU A;  3AQC A;  3R7C A;  4U5H A;  2L6G A;  3ECS A;  4XQ1 A;  1OCO C;  3ASO C;  4YT2 A;  5AC5 A;  5A6K A;  1TWG A;  1KTM A;  1GS9 A;  4EBB A;  4JIO A;  5E2Q A;  2J7P D;  1JPN A;  1I4Z A;  2OEX A;  1OR3 A;  1JR8 A;  1U89 A;  3LES A;  4JTD B;  2JX0 A;  3CAX A;  1SR2 A;  2X51 A;  4WAB A;  3U3B A;  2XS8 A;  1BR1 A;  2EIK C;  4CJG A;  1C02 A;  4UDV A;  5L0C A;  4G7Z F;  1TWC A;  3NMJ A;  4E7S A;  3UGO A;  3AGU A;  4IGG A;  2J0W A;  1MMD A;  2IM8 A;  2ASR A;  2J9V A;  5E3C A;  4ER9 A;  1A7V A;  1G5Z A;  1G4U S;  3H2V A;  4FWV A;  4ZLC A;  2CDQ A;  4C3E A;  3FVY A;  3M4B A;  4U9E A;  5DS6 A;  1GM5 A;  3EPV A;  3NKD A;  1NG1 A;  2VAS A;  1E84 A;  1SF8 A;  2AVK A;  3K7D A;  1LS1 A;  1Z5Z A;  4DVZ A;  2XL8 A;  3GM2 A;  2L81 A;  3WAQ A;  1K05 A;  3FDQ A;  3S27 A;  3UMI A;  3FOP A;  3G4Z A;  5JRA A;  3K6B A;  3IQ5 A;  3LS0 A;  3PMR A;  2R7S A;  3DE9 A;  3RH3 A;  2HSQ A;  3T9O A;  2WVN A;  4E0H A;  3DJU B;  3JYH A;  2HMZ A;  2LQG A;  2MHR A;  1ZU4 A;  4MVS A;  1T6U A;  3W4Y A;  2A1D D;  2VH3 A;  3V5X A;  2P7V A;  2NG1 A;  2VB6 A;  1S05 A;  2ZXW C;  4G0H A;  3NYM A;  3S29 A;  3ZTM A;  4X0R A;  5KYW B;  1VLS A;  4U5B E;  3QVY A;  4MW3 A;  4YJW A;  1H9T A;  2AWC A;  2EPK X;  3O55 A;  5KYY B;  2Y3D A;  3NMK A;  2E87 A;  1SZI A;  2KK1 A;  2J7P A;  2A6H F;  4MTF A;  3FOO A;  4OIQ F;  2J46 A;  2Y3B A;  4LDR A;  2R7V A;  1EA8 A;  3M1C B;  3HNI A;  1ST6 A;  2B0J A;  2P1A A;  4PR9 A;  1C17 M;  3T6G B;  3ATP A;  1NLX A;  4N6H A;  4Z9I A;  1Q0F A;  2W9Y A;  2V26 A;  4BPM A;  3UGP A;  4E18 A;  1VB5 A;  5COG A;  4O7G A;  1YAR O;  5A6A A;  4MS2 A;  3S90 A;  2XLV A;  3BRJ A;  3FMS A;  5F5F A;  3QTH A;  1DOW A;  2GA0 A;  5DVW A;  4K7B A;  4EIY A;  2CYD A;  2RD9 A;  2YZS A;  3B0U X;  2CCY A;  1IZM A;  1QQ3 A;  1MMG A;  4DRJ B;  2H8A A;  1LM3 B;  2QNL A;  1HMD A;  3LS1 A;  3HNK A;  1TFK B;  2IXP A;  2M64 A;  4JE9 A;  1YLM A;  4LER A;  1XWJ A;  3SNH A;  2PBE A;  3SEO A;  3HNL A;  1UFB A;  1VOM A;  1APC A;  2R03 A;  1S7Z A;  2HJM A;  3S9O A;  3W8I A;  3TUL A;  2NPU A;  1BR2 A;  2IOQ A;  1U6H A;  3U2M A;  2HMQ A;  2DYS C;  1LIH A;  1YZC A;  4BG0 A;  1I5N A;  3HJC A;  3ZQY A;  2KQ9 A;  4EBK A;  3L8I A;  4MVO A;  5E33 A;  2WVQ A;  3M15 A;  4O6Y A;  4N4W A;  4BEM J;  3C8Z A;  5DLJ A;  4RDA A;  2P61 A;  4BJ5 A;  1Q0G A;  3EG9 B;  4BJ6 C;  3NDB B;  1T01 A;  1QPU A;  3Q7G A;  4HEA J;  3SXZ A;  3G50 A;  1T5O A;  2YLI A;  1RMV A;  3US6 A;  4KI2 A;  1J8M F;  1LS4 A;  4J7T A;  3RQE A;  3T6J A;  5KYX A;  2NUP A;  3FHD A;  3EG9 A;  4YT8 A;  2A0B A;  4YT5 A;  3U9J A;  3S28 A;  2Q3T A;  3RYL A;  1OR2 A;  1NZE A;  1ZHW A;  2DYR C;  3IHU A;  3MX3 A;  3VYW A;  4XLP F;  1D0Y A;  2FAP B;  3IQT A;  3EH2 A;  4JKV A;  5DQT A;  3QVZ A;  2IXM A;  4YL1 A;  4C3B A;  1R5I D;  2OKU A;  2UUI A;  3EH1 A;  3EZH A;  5B1A C;  2GAQ A;  4N06 A;  2VC9 A;  1QZX A;  1ZHX A;  3H65 A;  1QLE C;  2LK4 A;  3IPM O;  2I15 A;  4IB4 A;  5B1B C;  2Y69 C;  1LPE A;  4H4K C;  1TKN A;  3LLI A;  2EPL X;  2D4U A;  2R7U A;  3AG1 C;  2NUT A;  3PHF 2;  4PJM A;  3BEH A;  2Q4F A;  4G78 A;  1VYK A;  4HE8 D;  4E17 A;  4OD4 A;  3PDM P;  1OCZ C;  1XZQ A;  2J0X A;  1ZHT A;  2H7V C;  4YK5 A;  1K40 A;  3U0C A;  5DS4 A;  5FCL A;  3VF0 A;  4NTF A;  4ZLD A;  2XRH A;  2OEV A;  3EHM A;  2OQM A;  4MVR A;  1HE9 A;  2J9B A;  2XM4 A;  3CSK A;  4I1O B;  2KYH A;  2QE9 A;  1FAP B;  1HMO A;  2EPO A;  2XLH A;  2YLG A;  3IQC A;  3KKB A;  1T9K A;  4W8P A;  4WJ0 A;  4W8K A;  1FMW A;  1D1A A;  3ASN C;  3U3F A;  1OW7 A;  3SP1 A;  2TMV P;  2WZG A;  2FGY A;  4FAP B;  2AU5 A;  1QVX A;  4C7O A;  4PJL A;  3RF3 A;  4JTA B;  2O9X A;  2ZPA A;  5TJ5 E;  2XL6 A;  2WZF A;  4YL3 A;  1QSP A;  4R32 A;  3N24 A;  4WGZ A;  2W45 A;  4CS9 A;  3CZ6 A;  1GQA A;  3WHN A;  1EQ1 A;  2R02 A;  1YZA A;  4H54 A;  1L3P A;  2H7B A;  5L0H A;  4BJ6 A;  2XLE A;  5JT4 A;  3U5S A;  2J9U A;  4CBE A;  2BE5 F;  2MYS A;  1Z3I X;  3AOU A;  4OIR F;  1WWP A;  3GM3 A;  4JJG A;  5JS5 A;  3EZI A;  5D92 A;  2R7Q A;  2AWY A;  1B68 A;  1HY5 A;  4PFO A;  4IWB A;  5EK0 A;  2Z15 A;  2DI3 A;  3U8P A;  2C04 A;  4CS7 A;  4MW8 A;  1JPJ A;  2OG2 A;  4CSA A;  4U9D A;  2DGJ A;  1MMN A;  2A0U A;  4BJT A;  4ULV A;  3QZC A;  4LDK A;  3U9M A;  4Q7C A;  3UNG C;  3WOD F;  3ZC4 A;  3JYY A;  4OIO F;  3SXY A;  4U5G A;  3B29 A;  4PJJ A;  4DBQ A;  2IXN A;  4C3D A;  3B71 A;  1J8Y F;  4LAC B;  1MNE A;  5KYW A;  5L3Q A;  1D0X A;  1K04 A;  2OJQ A;  2XXA A;  1ZHZ A;  2UUH A;  4P9T A;  3H2U A;  1EKY A;  2LIG A;  2B0H A;  3S0X A;  1PD0 A;  2IBF A;  2AP3 A;  3SXM A;  1ZZP A;  4MTO A;  3ZVR A;  4U5F E;  2Y3H A;  2A69 F;  3EGD B;  4PFP A;  4YWQ A;  1NSG B;  2EPN A;  4O79 A;  1A0B A;  4PJN A;  4U5C E;  4JRZ A;  5L0G A;  3F47 A;  4NCQ A;  1TFO B;  1RKE A;  3AQB A;  3L1M A;  4FES A;  4AL0 A;  1E83 A;  1OKK D;  2L7A A;  2NSF A;  1FFH A;  2R25 A;  4EBJ A;  2QY9 A;  1L7C A;  3JTL O;  4GQH A;  3RW0 A;  3POV A;  4DBR A;  1MQV A;  3QW0 A;  4RBN A;  4E0I A;  1FTS A;  2NSG A;  4M63 A;  1G4W R;  2HUJ A;  4JUR I;  4MVZ A;  3C8G B;  3LJB A;  5KYU B;  3NG1 A;  2VCC A;  3MBG A;  3A9C A;  2YKZ A;  3EGX A;  1ZVZ A;  1TWA A;  2G3V A;  3HLZ A;  1RCP A;  3NYJ A;  1TR2 A;  5COF A;  4OIN F;  3W2V A;  1RJ9 A;  5CI9 A;  1C03 A;  2VCA A;  5HSW A;  2YQY A;  3B0V C;  4J30 B;  2KJG A;  1JRA A;  4CJO A;  2PF4 E;  3GM1 A;  4DJ9 A;  2Y39 A;  4DRI B;  4ULW A;  3UMK A;  2IXO A;  3V7O A;  4PK4 A;  4XWJ A;  4JW1 A;  1FFT C;  4G7H F;  1AEP A;  2EIN C;  4JJF A;  1FNT c;  1H9G A;  4CS9 C;  2QTV A;  1A7D A;  2HFI A;  3KL4 A;  1RJ9 B;  2YHS A;  1WAS A; 
#chains in the Genus database with same CATH homology
 2ZXP A;  4A2N B;  2ZXR A;  3Q7L A;  4U5D E;  1ZYR F;  3EGD A;  3I4U A;  2J9W A;  3DMD A;  2WVO A;  2KW3 C;  2PX0 A;  3GOD A;  2JD3 A;  2J45 A;  2XXA B;  1OKK A;  2EIJ C;  2A6E F;  3K33 A;  2CW0 F;  3CQZ A;  1D1C A;  1TWH A;  3N2Z B;  2R7R A;  1V54 C;  4LLE A;  4IJJ A;  3JSZ A;  5DS5 A;  1M56 C;  2NUP B;  3NYL A;  1WGW A;  4J32 B;  3LAY A;  4P6I C;  4NY3 A;  4JZA A;  3OWT A;  5KYN A;  4OD5 A;  3N0T A;  1M2V B;  4BEJ A;  3KMI A;  4YN0 B;  2Q9A A;  4IAO A;  2ZXO A;  5IY5 C;  3EJN A;  4F4B A;  1VYI A;  4KNW A;  4I44 A;  3T4R A;  3RKO F;  3X2Q C;  1M2V A;  5EHH A;  1MND A;  3EGX B;  2WB7 A;  4JCH A;  1LKX A;  2CNW D;  4OIP F;  2PP4 A;  3UR3 C;  4C7O B;  2Q9B A;  4JVS A;  1IW7 F;  2Q9C A;  4KC9 A;  2YEV A;  3T6B A;  4XLN F;  2WL8 A;  3LNR A;  1O87 A;  2NUT B;  4GYT A;  4HFF B;  4I1M A;  3AG3 C;  3SZR A;  2HV7 A;  3DZA A;  4DOZ A;  2GFH A;  4E7Z A;  5T3T A;  1NU7 D;  4KNV A;  5L3V A;  1W2W A;  3O39 A;  5KYY A;  2I8B A;  3L34 A;  1V55 C;  5B3S C;  4ANJ A;  2V3C C;  3E70 C;  2XSE A;  3LLK A;  2W4B A;  2CGE A;  3ZIB A;  3Q6M A;  4G7O F;  3RFY A;  4DVY P;  3DAF A;  4MND A;  5KYX B;  3TD7 A;  1VK5 A;  2L9J A;  4K0D A;  3UMH A;  2CNW A;  5E3A A;  2WZL A;  3W8H A;  5BUO A;  1M57 C;  1M2O A;  2PX3 A;  3EHN A;  3K1I C;  5CI8 A;  3OA1 A;  4XTK A;  3JCU Q;  5KYU A;  4QI2 A;  3ABK C;  3EQL F;  1FMV A;  5T1D B;  2G62 A;  4U5E E;  4AK9 A;  5D91 A;  4HFK B;  3W2W A;  1D1B A;  2EIL C;  2PFD A;  4KBL A;  1LVK A;  2Y3G A;  4QI0 A;  1Z6A A;  2XL4 A;  3OEO A;  3ABL C;  4CS8 C;  3K1H A;  3ZG1 A;  4CS8 A;  5F5H A;  3E9V A;  4O6M A;  4EWC A;  2P6V A;  1OCR C;  1G8X A;  4AE4 A;  4LLC A;  3IEE A;  3DD7 A;  4BJ5 C;  1D0Z A;  3ZSU A;  1ZU5 A;  4BJ1 A;  3Q6N A;  3I5P A;  1Z63 A;  3I5Q A;  4RD9 A;  3DM5 A;  3GAN A;  2MWQ A;  3WG7 C;  3MLG A;  3JT1 A;  3DM9 B;  1Z23 A;  3O6X A;  2W4M A;  5EGY A;  2R7T A;  4QDL A;  4AX2 A;  4B6I A;  4I3M A;  2D5R B;  2OCC C;  3AG2 C;  3DJN B;  1PD1 A;  2KNH A;  4YT4 A;  3NRH A;  1BR4 A;  2C03 A;  2R7O A;  2R7W A;  1N1C A;  3K66 A;  2HV6 A;  3FAJ A;  3DAG A;  3QMK A;  5T3W A;  2FFH A;  1PCX A;  2KGO A;  2A68 F;  4CSA C;  4Q4Z F;  2LSE A;  3AG4 C;  2IYL D;  2M4E A;  3X1O A;  3JRT A;  4FX5 A;  3ITF A;  3RIP A;  3VAY A;  3F46 A;  4CIH A;  3EFO B;  1NU9 C;  4IRU A;  4AE4 B;  1KU2 A;  2EIM C;  3KH2 A;  5DQZ A;  4GEH A;  3B9Q A;  3ABM C;  2G3K A;  3NKE A;  4Q5S F;  3SYN A;  3EFO A;  3DXJ F;  3LEV A;  3HTK C;  1OCC C;  3L0I A;  4MQ9 F;  1VMA A;  2H7O A;  1O5H A;  1ZHY A;  1SMY F;  3B0P A;  1MMA A;  3AQC A;  4U5H A;  3ECS A;  4YT2 A;  1OCO C;  3ASO C;  1TWG A;  4EBB A;  5E2Q A;  2J7P D;  1JPN A;  3LES A;  2X51 A;  1BR1 A;  2EIK C;  4G7Z F;  1TWC A;  4E7S A;  3UGO A;  2J0W A;  1MMD A;  2J9V A;  5E3C A;  4FWV A;  4ZLC A;  2CDQ A;  4C3E A;  3FVY A;  5DS6 A;  3EPV A;  3NKD A;  1NG1 A;  2VAS A;  1SF8 A;  3K7D A;  4DVZ A;  1LS1 A;  1Z5Z A;  2L81 A;  3FDQ A;  3S27 A;  3UMI A;  2R7S A;  3K6B A;  3PMR A;  3LS0 A;  3RH3 A;  2WVN A;  3DJU B;  3JYH A;  1ZU4 A;  2A1D D;  2VH3 A;  2P7V A;  2NG1 A;  2VB6 A;  2ZXW C;  4G0H A;  3NYM A;  3S29 A;  4X0R A;  5KYW B;  4U5B E;  4YJW A;  5KYY B;  2Y3D A;  2E87 A;  1SZI A;  2J7P A;  2A6H F;  4OIQ F;  2J46 A;  2Y3B A;  2R7V A;  3M1C B;  1ST6 A;  2B0J A;  2W9Y A;  2V26 A;  3UGP A;  4O7G A;  5F5F A;  5DVW A;  4K7B A;  2YZS A;  3B0U X;  1IZM A;  1MMG A;  3LS1 A;  2IXP A;  4LER A;  3SNH A;  3SEO A;  1VOM A;  1S7Z A;  3W8I A;  1BR2 A;  2IOQ A;  2DYS C;  4BG0 A;  3HJC A;  2KQ9 A;  5E33 A;  2WVQ A;  4O6Y A;  5DLJ A;  4BJ5 A;  4RDA A;  3EG9 B;  4BJ6 C;  3NDB B;  3Q7G A;  4HEA J;  4KI2 A;  1J8M F;  3T6J A;  5KYX A;  2NUP A;  3FHD A;  3EG9 A;  4YT8 A;  4YT5 A;  3S28 A;  2Q3T A;  3RYL A;  1NZE A;  1ZHW A;  2DYR C;  3MX3 A;  3VYW A;  4XLP F;  1D0Y A;  3EH2 A;  5DQT A;  2IXM A;  4C3B A;  3EH1 A;  5B1A C;  3EZH A;  4N06 A;  1QZX A;  1ZHX A;  3H65 A;  1QLE C;  5B1B C;  2Y69 C;  4H4K C;  1TKN A;  3LLI A;  2R7U A;  3AG1 C;  2NUT A;  4PJM A;  1VYK A;  4HE8 D;  4OD4 A;  1OCZ C;  2J0X A;  1ZHT A;  2H7V C;  5DS4 A;  5FCL A;  4ZLD A;  2XRH A;  3EHM A;  3CSK A;  4I1O B;  4O6N A;  3KKB A;  4WJ0 A;  4W8K A;  1FMW A;  1D1A A;  3ASN C;  3SP1 A;  2WZG A;  2FGY A;  4C7O A;  4PJL A;  2O9X A;  2ZPA A;  2WZF A;  3N24 A;  2W45 A;  4CS9 A;  3CZ6 A;  2H7B A;  4BJ6 A;  2J9U A;  4CBE A;  2BE5 F;  2MYS A;  1Z3I X;  4OIR F;  4JJG A;  3EZI A;  5D92 A;  2R7Q A;  4PFO A;  4IWB A;  2Z15 A;  2C04 A;  4CS7 A;  1JPJ A;  2OG2 A;  4CSA A;  2DGJ A;  1MMN A;  4BJT A;  3QZC A;  3WOD F;  3ZC4 A;  4Q7C A;  3UNG C;  4OIO F;  4U5G A;  4PJJ A;  4DBQ A;  2IXN A;  4C3D A;  1J8Y F;  4LAC B;  1MNE A;  5KYW A;  5L3Q A;  1D0X A;  2XXA A;  1ZHZ A;  3S0X A;  1PD0 A;  3ZVR A;  4U5F E;  2Y3H A;  2A69 F;  3EGD B;  4PFP A;  4YWQ A;  4O79 A;  2R7X A;  4PJN A;  4U5C E;  3F47 A;  3AQB A;  4FES A;  1OKK D;  1FFH A;  2QY9 A;  3POV A;  4DBR A;  4RBN A;  1FTS A;  4M63 A;  4JUR I;  3LJB A;  5KYU B;  3NG1 A;  3EGX A;  1TWA A;  2G3V A;  3HLZ A;  4OIN F;  3NYJ A;  1TR2 A;  3W2V A;  1RJ9 A;  5CI9 A;  5HSW A;  3B0V C;  4J30 B;  2KJG A;  2Y39 A;  4ULW A;  3UMK A;  2IXO A;  3V7O A;  4PK4 A;  4XWJ A;  4JW1 A;  1FFT C;  4G7H F;  2EIN C;  4JJF A;  4CS9 C;  2QTV A;  2PF4 E;  3KL4 A;  1RJ9 B;  2YHS A;  3PHF 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...