3LS0A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
115
structure length
115
Chain Sequence
b'TYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sll1638 protein
molecule tags Photosynthesis
source organism Synechocystis sp.
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
total genus 48
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls0A00
1VYKA 3JCUQ 3ZSUA 3LS0A 2MWQA 1NZEA 3RFYA 3LS1A
chains in the Genus database with same CATH superfamily
5A6AA 1OXKA 3BRJA 4CJOA 3AG3C 3Q7GA 4KNVA 4MW8A 4WABA 5A6BD 2EILC 2QLAA 2YWAA 3AG2C 4FWVA 3ABKC 4Z9JA 1Z7Qc 5EGYA 3C7JA 2J0WA 3JCUQ 2R7RA 2EPNA 3C62A 3GWLA 1BR2A 1YYXA 4U5HA 4YL1A 4JCZA 1H9TA 4Q5SF 2XLEA 4LLCA 2RD9A 5DQTA 4O6NA 4FX5A 2WZGA 3JSZA 4PR9A 4XPXA 5A6KA 1T6UA 3S0XA 2H8AA 4DJ9A 2A68F 4JKVA 2LQGA 1Z23A 3RFYA 4O6MA 3RVYA 2XL6A 2A69F 1LI7A 1FMWA 4ZLCA 3NYLA 2R03A 4NC3A 3K6BA 3S90A 3PDMP 2ZXRA 4W8PA 1GM5A 3K1HA 3QVZA 2NPUA 5JP7A 1Q0GA 5DLJA 2VASA 4EBKA 4YJWA 3DAFA 5JS5A 4WGYA 4MVQA 2M4EA 5FZTA 3O55A 2X0CA 4EHPA 3SNHA 2J7PD 1A7EA 4DXWA 2HUJA 3NMIA 1NBBA 3RIPA 2H7BA 3X1OA 1OCRC 1ZHZA 3KKBA 3DMDA 1MMDA 4YN0B 2J9BA 1QPUA 2J9WA 5E2QA 4XLPF 4CS7A 1MQVA 3QMKA 1NSGB 3U9MA 4CS9A 2R02A 4JE9A 1OW8A 2WVQA 3G4XA 2W4MA 2OU6A 4W8KA 2EPOA 4BJ6A 3EZIA 1JAFA 2YLIA 1YARO 2M64A 4U5BE 4CIPA 2C04A 3B71A 2YL1A 1ZHWA 1M56C 4JEAA 1KU2A 2XS1A 2L81A 5A6BA 3HTKC 3ZQVA 2RSEB 3F46A 3EGDA 1XWJA 2KW3C 3GORA 4ANJA 2ZXOA 1QSPA 1T5OA 3EHMA 4XEVA 1K04A 5KYWA 5JSLA 1RKCA 2KSFA 1A41A 4LACB 3T6GB 5DVWA 3ZC4A 1DOWA 1VOMA 1TFKB 4P6IC 4E0IA 3POVA 2QE9A 2PNOA 4ULWA 1QVXA 3MYIA 1B68A 3DJUB 4MVOA 3TD7A 3HJCA 5B3IA 5BQIA 1V4AA 2XXAB 3NKEA 1ZZPA 5KYUB 1OR2A 3JRTA 2ZPAA 5L0GA 3ECSA 2LFFA 3EG9A 2XM4A 4QI0A 4CDAA 3HLZA 4KBLA 3PCVA 3MX3A 2HMZA 2KK1A 1E86A 1K05A 4MQ9F 4C3BA 1CPQA 2NSGA 3I5QA 4FESA 1G4US 2CYDA 5CI9A 3VRCA 1FTSA 4AX2A 4G7HF 1J8YF 2R25A 5HSWA 1RXQA 3FDQA 2AU5A 4ULVA 4GQHA 3F47A 1G5ZA 4H4KC 3CQZA 4OD4A 1LE4A 1FR0A 4OD5A 3EH1A 2GFHA 4XPYA 3U2LA 1WN0A 2P0NA 3LNMB 1JMWA 2EPKX 4JTDB 5A6JA 1BZ4A 3K1IC 5EK0A 5L3QA 1BBHA 1YAUO 4P9FA 1GGQA 2BE5F 3QTHA 4JZAA 4JIOA 5D91A 2LCHA 1TFOB 2IM8A 3E70C 1OQCA 4OINF 3C63A 1BDJB 3T4RA 1UG7A 2VCAA 5DS5A 4U5CE 2NSFA 4G0HA 4EKWA 1C02A 2J0XA 1MMAA 1ZW3A 2Q9BA 3C8GD 4NTBA 2WZLA 4KNWA 1CPRA 3CZ6A 3ZQYA 2LD6A 1Z6AA 2OEVA 1M2VA 1AEPA 2IXMA 1GS9A 3LESA 1WATA 3U8PA 2NUTB 4M63A 1LS1A 1TR2A 1FAPB 1PD0A 1FFTC 2XLWA 4IB4A 4MVSA 4MVMA 4N6CA 2AWCA 3I5PA 3LNRA 1IW7F 256BA 3LUTB 4J30B 2XLMA 2ETSA 4BJ1A 2D5RB 4BJ5C 1HMOA 2VB6A 4I1OB 1MMGA 4IRUA 2XM0A 3SZRA 3QW1A 3JRMO 4EWCA 2Y39A 1EQ1A 1RMVA 3L0IA 3VF0A 2YEVA 1WGWA 4ER9A 4OIOF 3W2WA 3E9VA 1A0BA 1OKKA 3IQ5A 4PFOA 5COFA 4HE8D 3O39A 1VB5A 4LERA 4JJGA 1YLMA 2B0JA 5BQHA 2XLOA 2EPLX 5F5HA 2O9XA 3QVYA 5L0CA 2Y3DA 4E0HA 1E85A 1D0XA 2EIMC 3QW0A 4RDAA 1OCOC 2KQ9A 1U6HA 4MVRA 1GQAA 3LS1A 3EGXB 4U9DA 4U5EE 3UNGC 5KYUA 2LIGA 4EBJA 3VAYA 3GEIA 3W4YA 3A9CA 1OCCC 1SF8A 2R7QA 4U5DE 4OIRF 2Q9AA 4E7ZA 1M6TA 5B1AC 4YT4A 3AQBA 2CDQA 3CSKA 3DM5A 3V5YA 4NTAA 3IEEA 2L9JA 1EI7A 4N4WA 1YJGA 1WOLA 4IAQA 3T6JA 2HFIA 4C3DA 2H7OA 1U0BB 1O3UA 1TQGA 4DBRA 2J8WA 3CAXA 4ONSA 2R7SA 4EUKB 2XLDA 4P9TA 3DM9B 1R4TA 1RJ9B 2Q3TA 4JVSA 3OWTA 2OCCC 5D92A 4PJJA 3TJ5A 5BUOA 1A7VA 2XLVA 3LAYA 3TK0A 3U8VA 3UMIA 4K7BA 1W2WA 1S7ZA 2P61A 2X51A 4PACA 4XEFA 1VLTA 5DS4A 3RYLA 4DVZA 1XZQA 3RH3A 3IHUA 1D1AA 1D1CA 2JPUA 1JRAA 1YA9A 1C03A 2YQYA 2UUIA 3EGXA 4AL1A 3X2QC 2DI3A 1ZU4A 2Q00A 1HY5A 1I5NA 3W2VA 3S28A 4DVYP 3RQGA 2IBFA 1E83A 2PX3A 3LS0A 2MWQA 1UFBA 3CEXA 3Q7LA 3ABLC 5FCLA 4HFKB 1HE1A 1LVKA 5TJ5E 5JRAA 1Z5ZA 4CDYA 2HV6A 4U5GA 4GEHA 1V54C 5L3VA 1NZEA 4BEJA 3AJMA 5COMA 2R9RB 2ICWG 1MNEA 1LKXA 4LDQA 1VK5A 3HNKA 2XRHA 3B0VC 3DAGA 3FAJA 1ST6A 4JEBA 4KC9A 2R7TA 2C03A 5JT4A 4PJMA 3TQOA 4CS8A 3JYHA 4XTKA 5JLIA 3GM3A 4H54A 2L6HA 2L7AA 1ZHXA 3JZ0A 2NUTA 1H6GA 3RKOF 4A2NB 1VMAA 2H7VC 3G50A 1O5HA 1M2VB 1NU7D 3AG4C 1WTYA 1SR2A 4CJGA 4G7ZF 3EFOB 4AE4A 2J9UA 3LEVA 4KI2A 4JTAB 3GWNA 3K33A 3HKKA 4AK9A 1V74B 2EIJC 1LPEA 1TWAA 3IQCA 2W4BA 3HNLA 2LP4A 4JJFA 3GANA 3UMKA 2EPMX 1H7IA 2KNHA 2CW0F 2R05A 2AVKA 5AGFA 5L0FA 5L0HA 3ZVRA 2HMQA 1Y6DA 3LLIA 5F28E 1QKRA 3S29A 4D4NA 3B0UX 4DRHB 4CSAC 4MTGA 4N6HA 2YL0A 4OIQF 4YK5A 1QQ3A 4E7SA 2XL8A 1AUEA 2Y3BA 1TWCA 3HNIA 2R7XA 2CCYA 3AOUA 4DBQA 3ITFA 3O10A 3US6A 4UDVA 4IARA 3NYJA 3U3FA 5DQZA 4IGGA 4IJJA 4QDLA 4D4XA 4BEMJ 1K40A 2HJ3A 1D0ZA 1MNDA 3TOMA 2QNLA 2A0UA 3IQ6A 1YDIA 3KH2A 4RBNA 2IXPA 3DE8A 1O87A 1A7DA 2BL2A 4AL0A 2V26A 2WL8A 2GWWA 3KYJA 2HS5A 2XXAA 1TKNA 2L6GA 3RF3A 1T01A 2YRFA 2ASRA 1N1CA 3T9OA 2E87A 3OEOA 4JCHA 3RVZA 2QUPA 1L3PA 1T6IA 4E17A 3N2ZB 3G4ZA 1LIHA 4YT5A 1NLXA 1PCXA 2GDCA 1C17M 3N0TA 4MTFA 4CIHA 3K1IA 3H65A 2WVNA 1NG1A 2JD3A 2LK4A 3FHDA 4JW1A 1EA8A 1YYJA 2YL7A 5CI8A 2CNWA 1YVIA 4PFPA 5E3CA 1SMYF 3HNJA 3NDBB 4JTCB 2OJED 1T9KA 1JPNA 4WGZA 4JRZA 2Q7RA 3U5SA 4U5FE 1OCZC 4RD9A 4YT2A 2UUHA 3IQTA 4Z9HA 1AVOB 4CDVA 3N24A 2IXNA 2OJQA 2Y69C 3C8ZA 4BG0A 2W45A 2IYLD 4MNDA 3ZTMA 2KJGA 3C8GB 4CS8C 1E84A 1QZXA 4L6RA 2R7VA 2ZXWC 2LFDA 2XSEA 1VTMP 1SYQA 2I8BA 2IXOA 2VCCA 1BR1A 3EFOA 3WAQA 3FOPA 4AE4B 3K66A 2DB4A 2PX0A 3SYNA 1R5ID 2NUPB 3DI5A 3M79A 2Z15A 3UMHA 2GA0A 3UR3C 3DE9A 3U0CA 4J7TA 2A0BA 3S84A 2HKVA 4YL0A 4C7OA 3AQCA 2OG2A 1BR4A 2DYRC 1WASA 3ZSUA 1OKKD 1RKEB 4DOZA 1OW6A 3KPHA 1TWHA 5K0IA 4J32B 4HEAJ 3FAPB 4EBBA 1G8XA 4K1OA 4PJNA 2FAPB 5KYYA 1IZMA 3OA1A 1Q0MA 3RQFA 4E18A 2AP3A 4CBEA 1DOVA 2PBEA 1LI5A 4CS9C 2BC5A 5KYXB 2Q4FA 1WWPA 1ZVZA 2F22A 3EG9B 1RCPA 3FVYA 1YZCA 1S05A 3KL4A 1TWGA 3M1CB 4LLEA 4NQFA 3TULA 3MYFA 2Y3GA 3SXMA 1Q0FA 3FXHA 3J06A 2CNWD 4G78A 1H9GA 2A1DD 1ORYA 4BJTA 4OIPF 3UGPA 2NG1A 3NKDA 4N06A 3BEHA 4B6IA 3VM6A 1Q0DA 3V7OA 3JT1A 3WHNA 1APCA 4G7OF 2Y3HA 5DS6A 1CGOA 3JTLO 1LE2A 2VCBA 1Z63A 4FAPB 1HE9A 5T3TA 4NTFA 2VH3A 1I4YA 3KMIA 1KNYA 3QZCA 2FGYA 3EPVA 1ZU5A 3PHF2 1LM3B 3EHNA 4ZLDA 3EQLF 5GPGB 4IAOA 3Q6NA 5JUAA 2MYSA 4LDKA 1G4WR 1HW2A 3ATPA 5AC5A 3PMRA 4IWBA 4XWJA 4O7GA 2YLDA 4LDRA 3W8IA 2R7WA 1E2XA 1Y4CA 1ORSC 3C18A 5IY5C 1PV3A 3FOOA 3EJNA 4BJ6C 3ZWIA 4QI2A 1EKYA 3O6XA 2DGJA 5HV9A 3K7DA 5A69A 2HV7A 5E3AA 1ORJA 2MHRA 3IPMO 3NMJA 3B9QA 4XQ1A 3WODF 4C3EA 5L0JA 3NMKA 1SZIA 2XL4A 2NUPA 2YZSA 3ASOC 3U2MA 2A6EF 3V5XA 3ZTZA 4MW3A 2I15A 2OKUA 3NG1A 3MBGA 2GAQA 3L8IA 3DD7A 3SXKA 3S9OA 5KYWB 4MVUA 2TMVP 5KYXA 2EINC 2DYSC 2HSBA 2EIKC 4O79A 3U3BA 3B0PA 3FMSA 4CX9A 1Q0KA 1VLSA 5KYYB 1KTMA 3TOLA 2YLGA 2IOQA 2W9YA 4Q4ZF 4YL3A 1D0YA 1MMNA 1OXBA 1QLEC 3W8HA 4NY3A 2VC9A 4I44A 2OQMA 2P7VA 1RKEA 3L34A 5L0DA 4MVZA 4PJLA 1M57C 1FNTc 2PP4A 2QTVA 2KGOA 2J9VA 5CIVA 4K0DA 1I4ZA 2D4UA 3ZG1A 4EIYA 1PD1A 3EZHA 2YVKA 3JYYA 1VYKA 1JR8A 3R7CA 2G3VA 2HZ8A 1D1BA 5COGA 5KYNA 4CSAA 2KC3A 2P1AA 2OEXA 4JURI 2KYHA 5T3WA 1ZW2A 2XS8A 1ZHTA 2WVOA 4BJ5A 4WJ0A 3LEOA 3M15A 2PF4E 1HW1A 2J46A 3ZDLA 2JX0A 4I1MA 5EHHA 3C8GA 1VYIA 3GM2A 1YA7O 1M2OA 3H2VA 4X0RA 4DRIB 3LJBA 2A6HF 3R2PA 4JC7A 5E33A 2AWYA 5B3SC 1JOGA 1Z3IX 1XZPA 3I4UA 4XLNF 1RJ9A 4Z9IA 4A4AA 3SP1A 5B1BC 4NCQA 3GM1A 3B29A 3VYWA 1OR3A 3EH2A 5BQGA 3GEEA 2R7OA 2ZD9A 2FFHA 1U89A 3ABMC 2ZXPA 2CGEA 2Q9CA 1T6QA 2HSQA 3SEOA 1FMVA 2B0HA 5AC4A 2J7PA 3DZAA 4HFFB 2HJMA 2V3CC 3ASNC 4F4BA 2WZFA 4U9EA 4YWQA 2YL3A 2G3KA 1CGNA 3T6BA 3L1MA 1OW7A 4R32A 3M4BA 3MLGA 2LSEA 2XLHA 3ZIBA 3NRHA 1L7CA 1F1MA 2L6FA 3AGTA 2G62A 2YKZA 3Q6MA 1NFNA 1NFOA 3M4CA 3L8JA 5T1DB 1CGME 5F5FA 3KYIA 3TJ6A 3NYMA 4J7YA 4Q7CA 1V55C 4XPWA 3RW0A 3EGDB 4YT8A 3GEHA 1ZHYA 4PK4A 3DWWA 3U9JA 1HMDA 3AGUA 3WG7C 2YHSA 4DRJB 4MTOA 1ZYRF 1J8MF 3UGOA 4I3MA 1LS4A 3DXJF 2OOCA 2QY9A 5JVEA 4O6YA 3MFNA 3A11A 3SXYA 4MS2A 2R7UA 4XEKA 1NU9C 3LLKA 3V5ZA 3AG1C 3SXZA 4C7OB 1FFHA 3RQEA 3GODA 3DJNB 3JSEO 2WB7A 1YZAA 2P6VA 4GYTA 2PFDA 5L0IA 2J45A 3H2UA 3S27A 3DKAA 4BPMA 1JPJA
chains in the Genus database with same CATH topology
3AG3C 3Q7GA 4KNVA 2EILC 3AG2C 5EGYA 4FWVA 3ABKC 2J0WA 3JCUQ 1BR2A 4U5HA 4Q5SF 5DQTA 4LLCA 4O6NA 4FX5A 2WZGA 3JSZA 3S0XA 2A68F 3RFYA 1Z23A 4O6MA 2A69F 1FMWA 4ZLCA 3NYLA 3K6BA 2ZXRA 3K1HA 5DLJA 2VASA 4YJWA 3DAFA 2M4EA 3SNHA 2J7PD 3RIPA 2H7BA 3X1OA 1OCRC 1ZHZA 3KKBA 3DMDA 1MMDA 4YN0B 4XLPF 2J9WA 5E2QA 4CS7A 3QMKA 4CS9A 2WVQA 2W4MA 4W8KA 4BJ6A 3EZIA 4U5BE 2C04A 1ZHWA 1M56C 1KU2A 2L81A 3HTKC 3F46A 3EGDA 2KW3C 4ANJA 2ZXOA 3EHMA 5KYWA 4LACB 5DVWA 3ZC4A 1VOMA 4P6IC 3POVA 4ULWA 3TD7A 3DJUB 3HJCA 2XXAB 3NKEA 5KYUB 3JRTA 2ZPAA 3ECSA 3EG9A 4QI0A 3HLZA 4KBLA 3MX3A 4MQ9F 4C3BA 3I5QA 4FESA 5CI9A 1FTSA 4AX2A 4G7HF 1J8YF 5HSWA 3FDQA 3F47A 4OD4A 4H4KC 3CQZA 4OD5A 3EH1A 2GFHA 3K1IC 5L3QA 2BE5F 4JZAA 5D91A 3E70C 4OINF 3T4RA 5DS5A 4U5CE 4G0HA 2J0XA 1MMAA 2Q9BA 2WZLA 4KNWA 3CZ6A 1Z6AA 1M2VA 2IXMA 3LESA 2NUTB 4M63A 1LS1A 1TR2A 1PD0A 1FFTC 3I5PA 4J30B 3LNRA 1IW7F 4BJ1A 2D5RB 4BJ5C 2VB6A 4I1OB 1MMGA 4IRUA 4EWCA 3SZRA 2Y39A 3L0IA 2YEVA 1WGWA 4OIOF 3W2WA 3E9VA 1OKKA 4PFOA 4HE8D 3O39A 4LERA 4JJGA 2B0JA 5F5HA 2O9XA 2Y3DA 1D0XA 2EIMC 4RDAA 1OCOC 2KQ9A 3LS1A 3EGXB 3UNGC 4U5EE 5KYUA 3VAYA 1OCCC 1SF8A 2R7QA 4U5DE 4OIRF 2Q9AA 4E7ZA 5B1AC 4YT4A 3AQBA 2CDQA 3CSKA 3DM5A 3IEEA 2L9JA 3T6JA 4C3DA 2H7OA 4DBRA 2R7SA 3DM9B 1RJ9B 2Q3TA 4JVSA 3OWTA 2OCCC 5D92A 4PJJA 5BUOA 3LAYA 3UMIA 4K7BA 1W2WA 1S7ZA 2X51A 5DS4A 3RYLA 4DVZA 3RH3A 1D1AA 1D1CA 3EGXA 3X2QC 1ZU4A 3W2VA 3S28A 4DVYP 2PX3A 3LS0A 2MWQA 3Q7LA 3ABLC 5FCLA 4HFKB 1LVKA 1Z5ZA 2HV6A 4U5GA 4GEHA 1V54C 5L3VA 1NZEA 4BEJA 1MNEA 1LKXA 1VK5A 3B0VC 2XRHA 3DAGA 3FAJA 1ST6A 4KC9A 2R7TA 2C03A 4PJMA 4CS8A 3JYHA 4XTKA 4A2NB 1ZHXA 2NUTA 3RKOF 1VMAA 2H7VC 1O5HA 1M2VB 1NU7D 3AG4C 4G7ZF 3EFOB 4AE4A 2J9UA 3LEVA 4KI2A 3K33A 4AK9A 2EIJC 1TWAA 2W4BA 4JJFA 3GANA 3UMKA 2KNHA 2CW0F 3ZVRA 3S29A 3LLIA 3B0UX 4CSAC 4OIQF 4E7SA 2Y3BA 1TWCA 2R7XA 4DBQA 3ITFA 3NYJA 5DQZA 4QDLA 4IJJA 1D0ZA 1MNDA 3KH2A 4RBNA 2IXPA 1O87A 2V26A 2WL8A 2XXAA 1TKNA 1N1CA 2E87A 3OEOA 4JCHA 3N2ZB 4YT5A 1PCXA 4CIHA 3N0TA 3H65A 2WVNA 1NG1A 2JD3A 3FHDA 4JW1A 5CI8A 2CNWA 4PFPA 5E3CA 1SMYF 3NDBB 1JPNA 4U5FE 1OCZC 4RD9A 4YT2A 3N24A 2IXNA 2Y69C 4BG0A 2W45A 2IYLD 4MNDA 2KJGA 4CS8C 1QZXA 2R7VA 2ZXWC 2XSEA 2I8BA 2IXOA 1BR1A 3EFOA 4AE4B 3K66A 2PX0A 3SYNA 2NUPB 2Z15A 3UMHA 3UR3C 4C7OA 3AQCA 2OG2A 1BR4A 2DYRC 3ZSUA 1OKKD 4DOZA 1TWHA 4J32B 4HEAJ 4EBBA 1G8XA 4PJNA 5KYYA 1IZMA 3OA1A 4CBEA 4CS9C 5KYXB 3EG9B 3FVYA 3KL4A 3M1CB 4LLEA 1TWGA 2Y3GA 2CNWD 2A1DD 4BJTA 4OIPF 3UGPA 2NG1A 3NKDA 4N06A 4B6IA 3V7OA 3JT1A 4G7OF 2Y3HA 5DS6A 1Z63A 5T3TA 2VH3A 3KMIA 3QZCA 2FGYA 3EPVA 1ZU5A 3PHF2 4ZLDA 3EHNA 3EQLF 4IAOA 3Q6NA 2MYSA 3PMRA 4IWBA 4XWJA 4O7GA 2R7WA 3W8IA 5IY5C 3EJNA 4BJ6C 4QI2A 3O6XA 2DGJA 3K7DA 2HV7A 5E3AA 4C3EA 3WODF 3B9QA 1SZIA 2XL4A 2NUPA 2YZSA 3ASOC 2A6EF 3NG1A 3DD7A 5KYWB 5KYXA 2EINC 2DYSC 2EIKC 4O79A 3B0PA 5KYYB 2IOQA 2W9YA 4Q4ZF 1D0YA 1MMNA 1QLEC 3W8HA 4NY3A 4I44A 2P7VA 3L34A 4PJLA 1M57C 2PP4A 2QTVA 2KGOA 2J9VA 4K0DA 3ZG1A 1PD1A 3EZHA 1VYKA 2G3VA 1D1BA 5KYNA 4CSAA 4JURI 5T3WA 1ZHTA 2WVOA 4BJ5A 4WJ0A 2PF4E 2J46A 4I1MA 5EHHA 1VYIA 4X0RA 1M2OA 3LJBA 2A6HF 5E33A 5B3SC 1Z3IX 3I4UA 4XLNF 1RJ9A 3SP1A 5B1BC 3VYWA 3EH2A 2R7OA 2FFHA 3ABMC 2ZXPA 2CGEA 2Q9CA 3SEOA 1FMVA 2J7PA 3DZAA 4HFFB 2V3CC 3ASNC 4F4BA 2WZFA 4YWQA 2G3KA 3T6BA 3MLGA 2LSEA 3ZIBA 3NRHA 3Q6MA 2G62A 5T1DB 5F5FA 3NYMA 4Q7CA 1V55C 3EGDB 4YT8A 1ZHYA 4PK4A 3WG7C 2YHSA 1ZYRF 1J8MF 3UGOA 4I3MA 3DXJF 2QY9A 4O6YA 2R7UA 1NU9C 3LLKA 3AG1C 4C7OB 1FFHA 3GODA 3DJNB 2WB7A 2P6VA 4GYTA 2PFDA 2J45A 3S27A 2R7RA 1JPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYK A;  3JCU Q;  3ZSU A;  3LS0 A;  2MWQ A;  1NZE A;  3RFY A;  3LS1 A; 
#chains in the Genus database with same CATH topology
 5A6A A;  1OXK A;  3BRJ A;  4CJO A;  3AG3 C;  3Q7G A;  4KNV A;  4MW8 A;  4WAB A;  5A6B D;  2EIL C;  2QLA A;  2YWA A;  3AG2 C;  4FWV A;  3ABK C;  4Z9J A;  1Z7Q c;  5EGY A;  3C7J A;  2J0W A;  3JCU Q;  2R7R A;  2EPN A;  3C62 A;  3GWL A;  1BR2 A;  1YYX A;  4U5H A;  4YL1 A;  4JCZ A;  1H9T A;  4Q5S F;  2XLE A;  4LLC A;  2RD9 A;  5DQT A;  4O6N A;  4FX5 A;  2WZG A;  3JSZ A;  4PR9 A;  4XPX A;  5A6K A;  1T6U A;  3S0X A;  2H8A A;  4DJ9 A;  2A68 F;  4JKV A;  2LQG A;  1Z23 A;  3RFY A;  4O6M A;  3RVY A;  2XL6 A;  2A69 F;  1LI7 A;  1FMW A;  4ZLC A;  3NYL A;  2R03 A;  4NC3 A;  3K6B A;  3S90 A;  3PDM P;  2ZXR A;  4W8P A;  1GM5 A;  3K1H A;  3QVZ A;  2NPU A;  5JP7 A;  1Q0G A;  5DLJ A;  2VAS A;  4EBK A;  4YJW A;  3DAF A;  5JS5 A;  4WGY A;  4MVQ A;  2M4E A;  5FZT A;  3O55 A;  2X0C A;  4EHP A;  3SNH A;  2J7P D;  1A7E A;  4DXW A;  2HUJ A;  3NMI A;  1NBB A;  3RIP A;  2H7B A;  3X1O A;  1OCR C;  1ZHZ A;  3KKB A;  3DMD A;  1MMD A;  4YN0 B;  2J9B A;  1QPU A;  2J9W A;  5E2Q A;  4XLP F;  4CS7 A;  1MQV A;  3QMK A;  1NSG B;  3U9M A;  4CS9 A;  2R02 A;  4JE9 A;  1OW8 A;  2WVQ A;  3G4X A;  2W4M A;  2OU6 A;  4W8K A;  2EPO A;  4BJ6 A;  3EZI A;  1JAF A;  2YLI A;  1YAR O;  2M64 A;  4U5B E;  4CIP A;  2C04 A;  3B71 A;  2YL1 A;  1ZHW A;  1M56 C;  4JEA A;  1KU2 A;  2XS1 A;  2L81 A;  5A6B A;  3HTK C;  3ZQV A;  2RSE B;  3F46 A;  3EGD A;  1XWJ A;  2KW3 C;  3GOR A;  4ANJ A;  2ZXO A;  1QSP A;  1T5O A;  3EHM A;  4XEV A;  1K04 A;  5KYW A;  5JSL A;  1RKC A;  2KSF A;  1A41 A;  4LAC B;  3T6G B;  5DVW A;  3ZC4 A;  1DOW A;  1VOM A;  1TFK B;  4P6I C;  4E0I A;  3POV A;  2QE9 A;  2PNO A;  4ULW A;  1QVX A;  3MYI A;  1B68 A;  3DJU B;  4MVO A;  3TD7 A;  3HJC A;  5B3I A;  5BQI A;  1V4A A;  2XXA B;  3NKE A;  1ZZP A;  5KYU B;  1OR2 A;  3JRT A;  2ZPA A;  5L0G A;  3ECS A;  2LFF A;  3EG9 A;  2XM4 A;  4QI0 A;  4CDA A;  3HLZ A;  4KBL A;  3PCV A;  3MX3 A;  2HMZ A;  2KK1 A;  1E86 A;  1K05 A;  4MQ9 F;  4C3B A;  1CPQ A;  2NSG A;  3I5Q A;  4FES A;  1G4U S;  2CYD A;  5CI9 A;  3VRC A;  1FTS A;  4AX2 A;  4G7H F;  1J8Y F;  2R25 A;  5HSW A;  1RXQ A;  3FDQ A;  2AU5 A;  4ULV A;  4GQH A;  3F47 A;  1G5Z A;  4H4K C;  3CQZ A;  4OD4 A;  1LE4 A;  1FR0 A;  4OD5 A;  3EH1 A;  2GFH A;  4XPY A;  3U2L A;  1WN0 A;  2P0N A;  3LNM B;  1JMW A;  2EPK X;  4JTD B;  5A6J A;  1BZ4 A;  3K1I C;  5EK0 A;  5L3Q A;  1BBH A;  1YAU O;  4P9F A;  1GGQ A;  2BE5 F;  3QTH A;  4JZA A;  4JIO A;  5D91 A;  2LCH A;  1TFO B;  2IM8 A;  3E70 C;  1OQC A;  4OIN F;  3C63 A;  1BDJ B;  3T4R A;  1UG7 A;  2VCA A;  5DS5 A;  4U5C E;  2NSF A;  4G0H A;  4EKW A;  1C02 A;  2J0X A;  1MMA A;  1ZW3 A;  2Q9B A;  3C8G D;  4NTB A;  2WZL A;  4KNW A;  1CPR A;  3CZ6 A;  3ZQY A;  2LD6 A;  1Z6A A;  2OEV A;  1M2V A;  1AEP A;  2IXM A;  1GS9 A;  3LES A;  1WAT A;  3U8P A;  2NUT B;  4M63 A;  1LS1 A;  1TR2 A;  1FAP B;  1PD0 A;  1FFT C;  2XLW A;  4IB4 A;  4MVS A;  4MVM A;  4N6C A;  2AWC A;  3I5P A;  3LNR A;  1IW7 F;  256B A;  3LUT B;  4J30 B;  2XLM A;  2ETS A;  4BJ1 A;  2D5R B;  4BJ5 C;  1HMO A;  2VB6 A;  4I1O B;  1MMG A;  4IRU A;  2XM0 A;  3SZR A;  3QW1 A;  3JRM O;  4EWC A;  2Y39 A;  1EQ1 A;  1RMV A;  3L0I A;  3VF0 A;  2YEV A;  1WGW A;  4ER9 A;  4OIO F;  3W2W A;  3E9V A;  1A0B A;  1OKK A;  3IQ5 A;  4PFO A;  5COF A;  4HE8 D;  3O39 A;  1VB5 A;  4LER A;  4JJG A;  1YLM A;  2B0J A;  5BQH A;  2XLO A;  2EPL X;  5F5H A;  2O9X A;  3QVY A;  5L0C A;  2Y3D A;  4E0H A;  1E85 A;  1D0X A;  2EIM C;  3QW0 A;  4RDA A;  1OCO C;  2KQ9 A;  1U6H A;  4MVR A;  1GQA A;  3LS1 A;  3EGX B;  4U9D A;  4U5E E;  3UNG C;  5KYU A;  2LIG A;  4EBJ A;  3VAY A;  3GEI A;  3W4Y A;  3A9C A;  1OCC C;  1SF8 A;  2R7Q A;  4U5D E;  4OIR F;  2Q9A A;  4E7Z A;  1M6T A;  5B1A C;  4YT4 A;  3AQB A;  2CDQ A;  3CSK A;  3DM5 A;  3V5Y A;  4NTA A;  3IEE A;  2L9J A;  1EI7 A;  4N4W A;  1YJG A;  1WOL A;  4IAQ A;  3T6J A;  2HFI A;  4C3D A;  2H7O A;  1U0B B;  1O3U A;  1TQG A;  4DBR A;  2J8W A;  3CAX A;  4ONS A;  2R7S A;  4EUK B;  2XLD A;  4P9T A;  3DM9 B;  1R4T A;  1RJ9 B;  2Q3T A;  4JVS A;  3OWT A;  2OCC C;  5D92 A;  4PJJ A;  3TJ5 A;  5BUO A;  1A7V A;  2XLV A;  3LAY A;  3TK0 A;  3U8V A;  3UMI A;  4K7B A;  1W2W A;  1S7Z A;  2P61 A;  2X51 A;  4PAC A;  4XEF A;  1VLT A;  5DS4 A;  3RYL A;  4DVZ A;  1XZQ A;  3RH3 A;  3IHU A;  1D1A A;  1D1C A;  2JPU A;  1JRA A;  1YA9 A;  1C03 A;  2YQY A;  2UUI A;  3EGX A;  4AL1 A;  3X2Q C;  2DI3 A;  1ZU4 A;  2Q00 A;  1HY5 A;  1I5N A;  3W2V A;  3S28 A;  4DVY P;  3RQG A;  2IBF A;  1E83 A;  2PX3 A;  3LS0 A;  2MWQ A;  1UFB A;  3CEX A;  3Q7L A;  3ABL C;  5FCL A;  4HFK B;  1HE1 A;  1LVK A;  5TJ5 E;  5JRA A;  1Z5Z A;  4CDY A;  2HV6 A;  4U5G A;  4GEH A;  1V54 C;  5L3V A;  1NZE A;  4BEJ A;  3AJM A;  5COM A;  2R9R B;  2ICW G;  1MNE A;  1LKX A;  4LDQ A;  1VK5 A;  3HNK A;  2XRH A;  3B0V C;  3DAG A;  3FAJ A;  1ST6 A;  4JEB A;  4KC9 A;  2R7T A;  2C03 A;  5JT4 A;  4PJM A;  3TQO A;  4CS8 A;  3JYH A;  4XTK A;  5JLI A;  3GM3 A;  4H54 A;  2L6H A;  2L7A A;  1ZHX A;  3JZ0 A;  2NUT A;  1H6G A;  3RKO F;  4A2N B;  1VMA A;  2H7V C;  3G50 A;  1O5H A;  1M2V B;  1NU7 D;  3AG4 C;  1WTY A;  1SR2 A;  4CJG A;  4G7Z F;  3EFO B;  4AE4 A;  2J9U A;  3LEV A;  4KI2 A;  4JTA B;  3GWN A;  3K33 A;  3HKK A;  4AK9 A;  1V74 B;  2EIJ C;  1LPE A;  1TWA A;  3IQC A;  2W4B A;  3HNL A;  2LP4 A;  4JJF A;  3GAN A;  3UMK A;  2EPM X;  1H7I A;  2KNH A;  2CW0 F;  2R05 A;  2AVK A;  5AGF A;  5L0F A;  5L0H A;  3ZVR A;  2HMQ A;  1Y6D A;  3LLI A;  5F28 E;  1QKR A;  3S29 A;  4D4N A;  3B0U X;  4DRH B;  4CSA C;  4MTG A;  4N6H A;  2YL0 A;  4OIQ F;  4YK5 A;  1QQ3 A;  4E7S A;  2XL8 A;  1AUE A;  2Y3B A;  1TWC A;  3HNI A;  2R7X A;  2CCY A;  3AOU A;  4DBQ A;  3ITF A;  3O10 A;  3US6 A;  4UDV A;  4IAR A;  3NYJ A;  3U3F A;  5DQZ A;  4IGG A;  4IJJ A;  4QDL A;  4D4X A;  4BEM J;  1K40 A;  2HJ3 A;  1D0Z A;  1MND A;  3TOM A;  2QNL A;  2A0U A;  3IQ6 A;  1YDI A;  3KH2 A;  4RBN A;  2IXP A;  3DE8 A;  1O87 A;  1A7D A;  2BL2 A;  4AL0 A;  2V26 A;  2WL8 A;  2GWW A;  3KYJ A;  2HS5 A;  2XXA A;  1TKN A;  2L6G A;  3RF3 A;  1T01 A;  2YRF A;  2ASR A;  1N1C A;  3T9O A;  2E87 A;  3OEO A;  4JCH A;  3RVZ A;  2QUP A;  1L3P A;  1T6I A;  4E17 A;  3N2Z B;  3G4Z A;  1LIH A;  4YT5 A;  1NLX A;  1PCX A;  2GDC A;  1C17 M;  3N0T A;  4MTF A;  4CIH A;  3K1I A;  3H65 A;  2WVN A;  1NG1 A;  2JD3 A;  2LK4 A;  3FHD A;  4JW1 A;  1EA8 A;  1YYJ A;  2YL7 A;  5CI8 A;  2CNW A;  1YVI A;  4PFP A;  5E3C A;  1SMY F;  3HNJ A;  3NDB B;  4JTC B;  2OJE D;  1T9K A;  1JPN A;  4WGZ A;  4JRZ A;  2Q7R A;  3U5S A;  4U5F E;  1OCZ C;  4RD9 A;  4YT2 A;  2UUH A;  3IQT A;  4Z9H A;  1AVO B;  4CDV A;  3N24 A;  2IXN A;  2OJQ A;  2Y69 C;  3C8Z A;  4BG0 A;  2W45 A;  2IYL D;  4MND A;  3ZTM A;  2KJG A;  3C8G B;  4CS8 C;  1E84 A;  1QZX A;  4L6R A;  2R7V A;  2ZXW C;  2LFD A;  2XSE A;  1VTM P;  1SYQ A;  2I8B A;  2IXO A;  2VCC A;  1BR1 A;  3EFO A;  3WAQ A;  3FOP A;  4AE4 B;  3K66 A;  2DB4 A;  2PX0 A;  3SYN A;  1R5I D;  2NUP B;  3DI5 A;  3M79 A;  2Z15 A;  3UMH A;  2GA0 A;  3UR3 C;  3DE9 A;  3U0C A;  4J7T A;  2A0B A;  3S84 A;  2HKV A;  4YL0 A;  4C7O A;  3AQC A;  2OG2 A;  1BR4 A;  2DYR C;  1WAS A;  3ZSU A;  1OKK D;  1RKE B;  4DOZ A;  1OW6 A;  3KPH A;  1TWH A;  5K0I A;  4J32 B;  4HEA J;  3FAP B;  4EBB A;  1G8X A;  4K1O A;  4PJN A;  2FAP B;  5KYY A;  1IZM A;  3OA1 A;  1Q0M A;  3RQF A;  4E18 A;  2AP3 A;  4CBE A;  1DOV A;  2PBE A;  1LI5 A;  4CS9 C;  2BC5 A;  5KYX B;  2Q4F A;  1WWP A;  1ZVZ A;  2F22 A;  3EG9 B;  1RCP A;  3FVY A;  1YZC A;  1S05 A;  3KL4 A;  1TWG A;  3M1C B;  4LLE A;  4NQF A;  3TUL A;  3MYF A;  2Y3G A;  3SXM A;  1Q0F A;  3FXH A;  3J06 A;  2CNW D;  4G78 A;  1H9G A;  2A1D D;  1ORY A;  4BJT A;  4OIP F;  3UGP A;  2NG1 A;  3NKD A;  4N06 A;  3BEH A;  4B6I A;  3VM6 A;  1Q0D A;  3V7O A;  3JT1 A;  3WHN A;  1APC A;  4G7O F;  2Y3H A;  5DS6 A;  1CGO A;  3JTL O;  1LE2 A;  2VCB A;  1Z63 A;  4FAP B;  1HE9 A;  5T3T A;  4NTF A;  2VH3 A;  1I4Y A;  3KMI A;  1KNY A;  3QZC A;  2FGY A;  3EPV A;  1ZU5 A;  3PHF 2;  1LM3 B;  3EHN A;  4ZLD A;  3EQL F;  5GPG B;  4IAO A;  3Q6N A;  5JUA A;  2MYS A;  4LDK A;  1G4W R;  1HW2 A;  3ATP A;  5AC5 A;  3PMR A;  4IWB A;  4XWJ A;  4O7G A;  2YLD A;  4LDR A;  3W8I A;  2R7W A;  1E2X A;  1Y4C A;  1ORS C;  3C18 A;  5IY5 C;  1PV3 A;  3FOO A;  3EJN A;  4BJ6 C;  3ZWI A;  4QI2 A;  1EKY A;  3O6X A;  2DGJ A;  5HV9 A;  3K7D A;  5A69 A;  2HV7 A;  5E3A A;  1ORJ A;  2MHR A;  3IPM O;  3NMJ A;  3B9Q A;  4XQ1 A;  3WOD F;  4C3E A;  5L0J A;  3NMK A;  1SZI A;  2XL4 A;  2NUP A;  2YZS A;  3ASO C;  3U2M A;  2A6E F;  3V5X A;  3ZTZ A;  4MW3 A;  2I15 A;  2OKU A;  3NG1 A;  3MBG A;  2GAQ A;  3L8I A;  3DD7 A;  3SXK A;  3S9O A;  5KYW B;  4MVU A;  2TMV P;  5KYX A;  2EIN C;  2DYS C;  2HSB A;  2EIK C;  4O79 A;  3U3B A;  3B0P A;  3FMS A;  4CX9 A;  1Q0K A;  1VLS A;  5KYY B;  1KTM A;  3TOL A;  2YLG A;  2IOQ A;  2W9Y A;  4Q4Z F;  4YL3 A;  1D0Y A;  1MMN A;  1OXB A;  1QLE C;  3W8H A;  4NY3 A;  2VC9 A;  4I44 A;  2OQM A;  2P7V A;  1RKE A;  3L34 A;  5L0D A;  4MVZ A;  4PJL A;  1M57 C;  1FNT c;  2PP4 A;  2QTV A;  2KGO A;  2J9V A;  5CIV A;  4K0D A;  1I4Z A;  2D4U A;  3ZG1 A;  4EIY A;  1PD1 A;  3EZH A;  2YVK A;  3JYY A;  1VYK A;  1JR8 A;  3R7C A;  2G3V A;  2HZ8 A;  1D1B A;  5COG A;  5KYN A;  4CSA A;  2KC3 A;  2P1A A;  2OEX A;  4JUR I;  2KYH A;  5T3W A;  1ZW2 A;  2XS8 A;  1ZHT A;  2WVO A;  4BJ5 A;  4WJ0 A;  3LEO A;  3M15 A;  2PF4 E;  1HW1 A;  2J46 A;  3ZDL A;  2JX0 A;  4I1M A;  5EHH A;  3C8G A;  1VYI A;  3GM2 A;  1YA7 O;  1M2O A;  3H2V A;  4X0R A;  4DRI B;  3LJB A;  2A6H F;  3R2P A;  4JC7 A;  5E33 A;  2AWY A;  5B3S C;  1JOG A;  1Z3I X;  1XZP A;  3I4U A;  4XLN F;  1RJ9 A;  4Z9I A;  4A4A A;  3SP1 A;  5B1B C;  4NCQ A;  3GM1 A;  3B29 A;  3VYW A;  1OR3 A;  3EH2 A;  5BQG A;  3GEE A;  2R7O A;  2ZD9 A;  2FFH A;  1U89 A;  3ABM C;  2ZXP A;  2CGE A;  2Q9C A;  1T6Q A;  2HSQ A;  3SEO A;  1FMV A;  2B0H A;  5AC4 A;  2J7P A;  3DZA A;  4HFF B;  2HJM A;  2V3C C;  3ASN C;  4F4B A;  2WZF A;  4U9E A;  4YWQ A;  2YL3 A;  2G3K A;  1CGN A;  3T6B A;  3L1M A;  1OW7 A;  4R32 A;  3M4B A;  3MLG A;  2LSE A;  2XLH A;  3ZIB A;  3NRH A;  1L7C A;  1F1M A;  2L6F A;  3AGT A;  2G62 A;  2YKZ A;  3Q6M A;  1NFN A;  1NFO A;  3M4C A;  3L8J A;  5T1D B;  1CGM E;  5F5F A;  3KYI A;  3TJ6 A;  3NYM A;  4J7Y A;  4Q7C A;  1V55 C;  4XPW A;  3RW0 A;  3EGD B;  4YT8 A;  3GEH A;  1ZHY A;  4PK4 A;  3DWW A;  3U9J A;  1HMD A;  3AGU A;  3WG7 C;  2YHS A;  4DRJ B;  4MTO A;  1ZYR F;  1J8M F;  3UGO A;  4I3M A;  1LS4 A;  3DXJ F;  2OOC A;  2QY9 A;  5JVE A;  4O6Y A;  3MFN A;  3A11 A;  3SXY A;  4MS2 A;  2R7U A;  4XEK A;  1NU9 C;  3LLK A;  3V5Z A;  3AG1 C;  3SXZ A;  4C7O B;  1FFH A;  3RQE A;  3GOD A;  3DJN B;  3JSE O;  2WB7 A;  1YZA A;  2P6V A;  4GYT A;  2PFD A;  5L0I A;  2J45 A;  3H2U A;  3S27 A;  3DKA A;  4BPM A;  1JPJ A; 
#chains in the Genus database with same CATH homology
 3AG3 C;  3Q7G A;  4KNV A;  2EIL C;  3AG2 C;  5EGY A;  4FWV A;  3ABK C;  2J0W A;  3JCU Q;  1BR2 A;  4U5H A;  4Q5S F;  5DQT A;  4LLC A;  4O6N A;  4FX5 A;  2WZG A;  3JSZ A;  3S0X A;  2A68 F;  3RFY A;  1Z23 A;  4O6M A;  2A69 F;  1FMW A;  4ZLC A;  3NYL A;  3K6B A;  2ZXR A;  3K1H A;  5DLJ A;  2VAS A;  4YJW A;  3DAF A;  2M4E A;  3SNH A;  2J7P D;  3RIP A;  2H7B A;  3X1O A;  1OCR C;  1ZHZ A;  3KKB A;  3DMD A;  1MMD A;  4YN0 B;  4XLP F;  2J9W A;  5E2Q A;  4CS7 A;  3QMK A;  4CS9 A;  2WVQ A;  2W4M A;  4W8K A;  4BJ6 A;  3EZI A;  4U5B E;  2C04 A;  1ZHW A;  1M56 C;  1KU2 A;  2L81 A;  3HTK C;  3F46 A;  3EGD A;  2KW3 C;  4ANJ A;  2ZXO A;  3EHM A;  5KYW A;  4LAC B;  5DVW A;  3ZC4 A;  1VOM A;  4P6I C;  3POV A;  4ULW A;  3TD7 A;  3DJU B;  3HJC A;  2XXA B;  3NKE A;  5KYU B;  3JRT A;  2ZPA A;  3ECS A;  3EG9 A;  4QI0 A;  3HLZ A;  4KBL A;  3MX3 A;  4MQ9 F;  4C3B A;  3I5Q A;  4FES A;  5CI9 A;  1FTS A;  4AX2 A;  4G7H F;  1J8Y F;  5HSW A;  3FDQ A;  3F47 A;  4OD4 A;  4H4K C;  3CQZ A;  4OD5 A;  3EH1 A;  2GFH A;  3K1I C;  5L3Q A;  2BE5 F;  4JZA A;  5D91 A;  3E70 C;  4OIN F;  3T4R A;  5DS5 A;  4U5C E;  4G0H A;  2J0X A;  1MMA A;  2Q9B A;  2WZL A;  4KNW A;  3CZ6 A;  1Z6A A;  1M2V A;  2IXM A;  3LES A;  2NUT B;  4M63 A;  1LS1 A;  1TR2 A;  1PD0 A;  1FFT C;  3I5P A;  4J30 B;  3LNR A;  1IW7 F;  4BJ1 A;  2D5R B;  4BJ5 C;  2VB6 A;  4I1O B;  1MMG A;  4IRU A;  4EWC A;  3SZR A;  2Y39 A;  3L0I A;  2YEV A;  1WGW A;  4OIO F;  3W2W A;  3E9V A;  1OKK A;  4PFO A;  4HE8 D;  3O39 A;  4LER A;  4JJG A;  2B0J A;  5F5H A;  2O9X A;  2Y3D A;  1D0X A;  2EIM C;  4RDA A;  1OCO C;  2KQ9 A;  3LS1 A;  3EGX B;  3UNG C;  4U5E E;  5KYU A;  3VAY A;  1OCC C;  1SF8 A;  2R7Q A;  4U5D E;  4OIR F;  2Q9A A;  4E7Z A;  5B1A C;  4YT4 A;  3AQB A;  2CDQ A;  3CSK A;  3DM5 A;  3IEE A;  2L9J A;  3T6J A;  4C3D A;  2H7O A;  4DBR A;  2R7S A;  3DM9 B;  1RJ9 B;  2Q3T A;  4JVS A;  3OWT A;  2OCC C;  5D92 A;  4PJJ A;  5BUO A;  3LAY A;  3UMI A;  4K7B A;  1W2W A;  1S7Z A;  2X51 A;  5DS4 A;  3RYL A;  4DVZ A;  3RH3 A;  1D1A A;  1D1C A;  3EGX A;  3X2Q C;  1ZU4 A;  3W2V A;  3S28 A;  4DVY P;  2PX3 A;  3LS0 A;  2MWQ A;  3Q7L A;  3ABL C;  5FCL A;  4HFK B;  1LVK A;  1Z5Z A;  2HV6 A;  4U5G A;  4GEH A;  1V54 C;  5L3V A;  1NZE A;  4BEJ A;  1MNE A;  1LKX A;  1VK5 A;  3B0V C;  2XRH A;  3DAG A;  3FAJ A;  1ST6 A;  4KC9 A;  2R7T A;  2C03 A;  4PJM A;  4CS8 A;  3JYH A;  4XTK A;  4A2N B;  1ZHX A;  2NUT A;  3RKO F;  1VMA A;  2H7V C;  1O5H A;  1M2V B;  1NU7 D;  3AG4 C;  4G7Z F;  3EFO B;  4AE4 A;  2J9U A;  3LEV A;  4KI2 A;  3K33 A;  4AK9 A;  2EIJ C;  1TWA A;  2W4B A;  4JJF A;  3GAN A;  3UMK A;  2KNH A;  2CW0 F;  3ZVR A;  3S29 A;  3LLI A;  3B0U X;  4CSA C;  4OIQ F;  4E7S A;  2Y3B A;  1TWC A;  2R7X A;  4DBQ A;  3ITF A;  3NYJ A;  5DQZ A;  4QDL A;  4IJJ A;  1D0Z A;  1MND A;  3KH2 A;  4RBN A;  2IXP A;  1O87 A;  2V26 A;  2WL8 A;  2XXA A;  1TKN A;  1N1C A;  2E87 A;  3OEO A;  4JCH A;  3N2Z B;  4YT5 A;  1PCX A;  4CIH A;  3N0T A;  3H65 A;  2WVN A;  1NG1 A;  2JD3 A;  3FHD A;  4JW1 A;  5CI8 A;  2CNW A;  4PFP A;  5E3C A;  1SMY F;  3NDB B;  1JPN A;  4U5F E;  1OCZ C;  4RD9 A;  4YT2 A;  3N24 A;  2IXN A;  2Y69 C;  4BG0 A;  2W45 A;  2IYL D;  4MND A;  2KJG A;  4CS8 C;  1QZX A;  2R7V A;  2ZXW C;  2XSE A;  2I8B A;  2IXO A;  1BR1 A;  3EFO A;  4AE4 B;  3K66 A;  2PX0 A;  3SYN A;  2NUP B;  2Z15 A;  3UMH A;  3UR3 C;  4C7O A;  3AQC A;  2OG2 A;  1BR4 A;  2DYR C;  3ZSU A;  1OKK D;  4DOZ A;  1TWH A;  4J32 B;  4HEA J;  4EBB A;  1G8X A;  4PJN A;  5KYY A;  1IZM A;  3OA1 A;  4CBE A;  4CS9 C;  5KYX B;  3EG9 B;  3FVY A;  3KL4 A;  3M1C B;  4LLE A;  1TWG A;  2Y3G A;  2CNW D;  2A1D D;  4BJT A;  4OIP F;  3UGP A;  2NG1 A;  3NKD A;  4N06 A;  4B6I A;  3V7O A;  3JT1 A;  4G7O F;  2Y3H A;  5DS6 A;  1Z63 A;  5T3T A;  2VH3 A;  3KMI A;  3QZC A;  2FGY A;  3EPV A;  1ZU5 A;  3PHF 2;  4ZLD A;  3EHN A;  3EQL F;  4IAO A;  3Q6N A;  2MYS A;  3PMR A;  4IWB A;  4XWJ A;  4O7G A;  2R7W A;  3W8I A;  5IY5 C;  3EJN A;  4BJ6 C;  4QI2 A;  3O6X A;  2DGJ A;  3K7D A;  2HV7 A;  5E3A A;  4C3E A;  3WOD F;  3B9Q A;  1SZI A;  2XL4 A;  2NUP A;  2YZS A;  3ASO C;  2A6E F;  3NG1 A;  3DD7 A;  5KYW B;  5KYX A;  2EIN C;  2DYS C;  2EIK C;  4O79 A;  3B0P A;  5KYY B;  2IOQ A;  2W9Y A;  4Q4Z F;  1D0Y A;  1MMN A;  1QLE C;  3W8H A;  4NY3 A;  4I44 A;  2P7V A;  3L34 A;  4PJL A;  1M57 C;  2PP4 A;  2QTV A;  2KGO A;  2J9V A;  4K0D A;  3ZG1 A;  1PD1 A;  3EZH A;  1VYK A;  2G3V A;  1D1B A;  5KYN A;  4CSA A;  4JUR I;  5T3W A;  1ZHT A;  2WVO A;  4BJ5 A;  4WJ0 A;  2PF4 E;  2J46 A;  4I1M A;  5EHH A;  1VYI A;  4X0R A;  1M2O A;  3LJB A;  2A6H F;  5E33 A;  5B3S C;  1Z3I X;  3I4U A;  4XLN F;  1RJ9 A;  3SP1 A;  5B1B C;  3VYW A;  3EH2 A;  2R7O A;  2FFH A;  3ABM C;  2ZXP A;  2CGE A;  2Q9C A;  3SEO A;  1FMV A;  2J7P A;  3DZA A;  4HFF B;  2V3C C;  3ASN C;  4F4B A;  2WZF A;  4YWQ A;  2G3K A;  3T6B A;  3MLG A;  2LSE A;  3ZIB A;  3NRH A;  3Q6M A;  2G62 A;  5T1D B;  5F5F A;  3NYM A;  4Q7C A;  1V55 C;  3EGD B;  4YT8 A;  1ZHY A;  4PK4 A;  3WG7 C;  2YHS A;  1ZYR F;  1J8M F;  3UGO A;  4I3M A;  3DXJ F;  2QY9 A;  4O6Y A;  2R7U A;  1NU9 C;  3LLK A;  3AG1 C;  4C7O B;  1FFH A;  3GOD A;  3DJN B;  2WB7 A;  2P6V A;  4GYT A;  2PFD A;  2J45 A;  3S27 A;  2R7R A;  1JPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...