3LS0A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
115
structure length
115
Chain Sequence
TYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
molecule keywords Sll1638 protein
total genus 48
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls0A00
1VYKA 3JCUQ 1NZEA 3RFYA 3LS0A 2MWQA 3LS1A 3ZSUA
chains in the Genus database with same CATH superfamily
5AC4A 1M2VB 1JMWA 3AG2C 2YL3A 4QI0A 1Z7Qc 1OW6A 3AG4C 1M6TA 3DXJF 1YYJA 1TFOB 1Z5ZA 2WB7A 2KK1A 3DD7A 3RQGA 3WHNA 5CI8A 3ZQYA 1V55C 2OOCA 3VRCA 1YZAA 5IY5C 2LQGA 4J30B 4X0RA 1Z6AA 2B0JA 2J9BA 5JVEA 3QW0A 3O39A 2FFHA 3AJMA 2R7UA 1Q0KA 1TWAA 2J8WA 4I3MA 2L6FA 2LSEA 4EHPA 1KTMA 3C62A 3L8IA 4EIYA 4WJ0A 1NU7D 3HKKA 2LK4A 4ULVA 2PX3A 5AGFA 2KNHA 2R9RB 3K1IA 3SEOA 3U3BA 2HS5A 1T6QA 1SYQA 4NC3A 1L7CA 4PJNA 4YL3A 2KJGA 3ASOC 1OCCC 4MVUA 3K1HA 4G78A 4A2NB 2KC3A 3S9OA 4Z9HA 3QZCA 3U9MA 5KYNA 2X0CA 1YZCA 2L7AA 2YEVA 4N6HA 4MTOA 4JEBA 2Q9BA 3RF3A 5A69A 3U5SA 3FOOA 1MQVA 1OR2A 3RIPA 4WGYA 2QUPA 3LS1A 2XLOA 1EKYA 1J8MF 4I44A 2ASRA 1VYIA 1UFBA 2OKUA 2Q9CA 2WZGA 4IRUA 3M1CB 2OEVA 2R7WA 1HY5A 2NPUA 3DAFA 3ABLC 4E18A 1VTMP 3KMIA 2LFDA 1Q0FA 1BR2A 3L8JA 3LESA 2CCYA 1MNEA 2CNWD 3CQZA 5A6BA 4O6YA 1M2VA 2Q7RA 1E2XA 2G62A 4MW8A 4Q7CA 2F22A 2LFFA 4YL0A 3SYNA 4E7SA 1NSGB 2A68F 3H65A 4BEJA 3BEHA 4RDAA 2WVOA 1ORJA 4CS9A 2ZPAA 2NUPA 1YDIA 1WATA 4YK5A 1OQCA 1XZPA 2R7QA 1V74B 1RKCA 1RJ9A 1CPRA 1YLMA 1WN0A 3TK0A 4MW3A 3UGOA 2V3CC 1NU9C 1RKEB 4I1OB 1OW7A 1ORSC 3JT1A 5DS6A 1EQ1A 4EWCA 3FVYA 4YT2A 4CIHA 2HKVA 1O5HA 3CAXA 1JPNA 1VK5A 1Y6DA 3ECSA 4L6RA 4O79A 3EG9B 2P61A 4R32A 3U3FA 4XEFA 3EHMA 3E9VA 1TKNA 3I5QA 2D4UA 4HE8D 3UMIA 2L6HA 1G4WR 1HE1A 3HTKC 3JYYA 3Q7GA 3SXYA 3IQCA 2UUHA 3W2WA 2A6HF 3RQEA 3R2PA 1ZU4A 3RYLA 1CPQA 5AC5A 1G5ZA 5E33A 4PK4A 4KI2A 1ZYRF 1BZ4A 3UGPA 2OG2A 2JX0A 2HV7A 2HUJA 2BL2A 2HSQA 3EPVA 4AE4B 1SMYF 3DKAA 3K33A 2A69F 2VC9A 4H4KC 4K7BA 3VM6A 3L34A 1ZHXA 3S29A 5F5HA 4DBQA 5GPGB 2OU6A 2A6EF 3NYLA 3IHUA 3Q6NA 1SF8A 1T9KA 4YT4A 2Q4FA 1BR1A 3HNIA 5BQIA 1LKXA 4DRJB 4EUKB 2G3VA 2XXAA 2H7BA 3J06A 2IXNA 5B1AC 3US6A 4ER9A 3MYIA 4G7OF 3I4UA 4J32B 2YWAA 2XLMA 1TR2A 3EHNA 4I1MA 3JRMO 4MVRA 1T01A 4IAQA 1ZHTA 2CW0F 5A6JA 2OQMA 4KNWA 5L3VA 2CYDA 2TMVP 3RQFA 3FDQA 2KYHA 5BQGA 4MVSA 3RVYA 2EIKC 2VH3A 3SP1A 2L6GA 2EINC 3MBGA 2G3KA 2B0HA 3ZQVA 2BE5F 4U5FE 3W8HA 2MHRA 2XLEA 4NTAA 2R7VA 1D1AA 4G7HF 3KL4A 2J0XA 4XPXA 2YVKA 2YZSA 1Y4CA 1ZHYA 4OIQF 1HMDA 3ZC4A 4DOZA 2A1DD 5L0JA 2YHSA 3C8GD 5JSLA 4Z9IA 1JPJA 1TWHA 1M56C 2R05A 1Q0GA 1HW2A 5K0IA 2HMZA 3FMSA 3KPHA 1ZZPA 3O10A 3HJCA 1DOWA 1VLSA 2P6VA 1IW7F 2IYLD 4K1OA 4OD5A 1ZW2A 1LM3B 1ZW3A 4CDAA 1SZIA 2VB6A 2LP4A 2R7RA 1D0YA 1YYXA 2QTVA 4MVMA 2EPNA 2PF4E 3DZAA 3A9CA 3AGTA 1L3PA 3OA1A 2DB4A 3LEOA 4AL1A 3H2VA 3HNJA 4XPWA 1PCXA 2XL6A 2YLIA 3A11A 3LNMB 1S7ZA 3HLZA 4CS9C 2IXOA 2C03A 4O6NA 5E2QA 4U9DA 1WTYA 5T1DB 2RSEB 4CIPA 1V54C 1W2WA 2Y3BA 4NTFA 2P0NA 5EHHA 4NQFA 2EPOA 2R03A 2V26A 2J9VA 2XLWA 2YL7A 1TWCA 4IAOA 4JTDB 1FAPB 3S90A 4QI2A 1JAFA 1JOGA 2PFDA 3ZVRA 4U5BE 3FOPA 2XM4A 2EIMC 3ABMC 3GM1A 5JS5A 3NMJA 1MMAA 2CGEA 2Q3TA 1K40A 3JTLO 3Q6MA 2LD6A 4B6IA 5DS4A 1H7IA 3RFYA 3ZTMA 3M15A 3IQTA 4BJ6C 4EBJA 4Q4ZF 3GEHA 2YLDA 4MTGA 1WASA 1LE2A 1VOMA 2YLGA 4O6MA 3W2VA 4AX2A 4BEMJ 1FMVA 4MVOA 4OINF 1E83A 4C7OB 2R7XA 3FXHA 4CJGA 4XTKA 2AWYA 2EPLX 5L0FA 2CDQA 4Z9JA 1QLEC 3S28A 2R02A 1OCRC 2HJ3A 5D92A 2Y3DA 4U5HA 1RMVA 4YL1A 1MMNA 4QDLA 3TJ5A 4BPMA 2PP4A 5KYUB 1AVOB 3TD7A 1TWGA 3IQ6A 3AQBA 4HFKB 3GANA 5A6AA 1ZVZA 3K1IC 2QE9A 4JRZA 2GDCA 1H6GA 1PD1A 3V5XA 2WL8A 2Y69C 4XLPF 2LCHA 2R25A 3L1MA 3N0TA 4MTFA 3TQOA 1T6IA 2L9JA 1MMDA 4YN0B 4CS8C 4IARA 2Q00A 4JTAB 4DBRA 2HMQA 1FR0A 1A7EA 4MVQA 1KNYA 1TFKB 2ZXWC 5COFA 3U8VA 2EIJC 3SZRA 3VYWA 1U89A 3DAGA 3V5ZA 5L0IA 1ZHZA 3NG1A 5L0GA 3KKBA 1QZXA 4JE9A 3S0XA 1FNTc 4EKWA 4JVSA 2P1AA 3K6BA 3GM2A 5BUOA 4DVYP 5KYXB 1GM5A 1GQAA 3IPMO 1QSPA 4LDQA 3BRJA 4LLCA 4ULWA 3ZWIA 5FZTA 4FAPB 1DOVA 1QKRA 2IM8A 2X51A 3AOUA 3FHDA 3O55A 4RD9A 4H54A 2PX0A 4XEVA 4WGZA 3DM5A 4N06A 3SXZA 3N24A 3G4ZA 4PJMA 2XLDA 1A41A 3VF0A 4CX9A 2LIGA 3EG9A 4P9TA 4KNVA 3ZSUA 3RH3A 2VCAA 2ZXOA 4FWVA 4OIPF 1Z23A 1FTSA 2IBFA 3U8PA 1O3UA 3PHF2 4MNDA 2ZD9A 3U0CA 1N1CA 2D5RB 4U5DE 2WZLA 1E86A 3PDMP 3B29A 3LUTB 2I8BA 5TJ5E 2AVKA 2XLVA 1K04A 4ANJA 5EGYA 3U9JA 5L0CA 5KYWB 3JZ0A 1OXKA 3C8GA 5JUAA 4DXWA 3NMIA 3O6XA 4A4AA 2YQYA 3MFNA 3V5YA 2R7TA 2W9YA 4M63A 2NG1A 2ICWG 3QMKA 2R7SA 1V4AA 1RKEA 3GWLA 3GORA 3JYHA 2J9UA 2AWCA 5COMA 4CS7A 3OEOA 1RXQA 2KQ9A 3NKDA 1RJ9B 4N4WA 5EK0A 3LS0A 4YJWA 1AEPA 1A7VA 1JR8A 4U5CE 4JEAA 4IJJA 4C3BA 2J7PA 2IOQA 1VYKA 3HNKA 3T9OA 2XM0A 1M2OA 5KYYB 3X1OA 1QQ3A 2W4MA 2YL1A 1EI7A 1MNDA 3NYJA 4DJ9A 3B0PA 4JCHA 3N2ZB 4NTBA 4LERA 4W8PA 4YT5A 2J9WA 3UMHA 5KYYA 1E84A 3JCUQ 1U6HA 3G4XA 5JT4A 3W8IA 5JP7A 4FX5A 1OCZC 1NLXA 1CGNA 4WABA 5JRAA 3V7OA 2R7OA 4GYTA 2NSFA 3LJBA 3UR3C 3ZG1A 2XLHA 3F46A 4JTCB 4XLNF 1TQGA 3AGUA 2OJQA 3EFOA 3NMKA 3S27A 3SXMA 1CGOA 1PV3A 1YJGA 2PBEA 3GODA 1VLTA 3PCVA 5DQTA 1NBBA 3Q7LA 4JURI 3R7CA 1APCA 1GS9A 2EILC 5BQHA 3EFOB 4C3EA 4JIOA 3C8ZA 3EQLF 1OKKD 1Z3IX 4XQ1A 4C3DA 3E70C 2J45A 1JRAA 2M64A 4PACA 1ZU5A 2PNOA 2W4BA 4KBLA 3TOMA 1LI7A 1XZQA 2ETSA 2XL4A 4O7GA 3IQ5A 3C7JA 4J7TA 3M4BA 3LNRA 5DQZA 2HV6A 2GAQA 3MX3A 2FAPB 3DE9A 4XWJA 1LS1A 2YKZA 3LLKA 2NUTA 1WWPA 3W4YA 4JC7A 4F4BA 4N6CA 2MYSA 4RBNA 4BJTA 1NFOA 1WGWA 3GWNA 4NCQA 5L0HA 1YA9A 3EGDB 4ONSA 3PMRA 4Q5SF 1NG1A 3H2UA 3GEEA 1C02A 3AQCA 3FAPB 1FFHA 2DI3A 2DYSC 3M79A 1QVXA 3QVYA 5DVWA 5T3WA 2OJED 4W8KA 1OXBA 1LPEA 1D0XA 4IGGA 5CI9A 2JPUA 5L3QA 3QW1A 1I4ZA 1OCOC 4FESA 3TJ6A 1OKKA 2CNWA 5DLJA 3B9QA 2QNLA 3CZ6A 4D4XA 4CSAC 3OWTA 3L0IA 3EZHA 5FCLA 4IB4A 1M57C 2HJMA 3EZIA 3AG3C 3LEVA 5B1BC 1AUEA 1IZMA 4EBBA 3EH2A 4XPYA 1LI5A 2E87A 2XRHA 2RD9A 1PD0A 2Y39A 5E3AA 1VMAA 4HFFB 4BJ5C 3LLIA 2XL8A 2ZXPA 2C04A 4BJ5A 3S84A 4OIRF 3T6GB 1YVIA 3NYMA 3U2MA 4BG0A 4BJ6A 4DVZA 3UMKA 4LACB 4G7ZF 1I4YA 2XS1A 4LDKA 3SNHA 3NRHA 3KYJA 2A0BA 3T6JA 2O9XA 3DMDA 3T4RA 4CBEA 3FAJA 3DM9B 3U2LA 5E3CA 4PFOA 1BR4A 3GEIA 1LE4A 5KYXA 1KU2A 4E17A 3HNLA 1Q0MA 5HSWA 2J7PD 2UUIA 4JJFA 2DYRC 1S05A 3RW0A 2KW3C 3CEXA 3B0VC 5KYUA 1A7DA 3ATPA 3DI5A 4GQHA 4HEAJ 4JKVA 3DJNB 3VAYA 4NY3A 5HV9A 2H7VC 4U5GA 1J8YF 1T5OA 2YRFA 3G50A 1GGQA 1BDJB 2NSGA 1ST6A 4JJGA 2HSBA 4PJLA 4U9EA 1C17M 4E0IA 4DRHB 4C7OA 4J7YA 5A6BD 4MQ9F 3UNGC 2ZXRA 1CGME 3WG7C 3ABKC 4MS2A 3TOLA 3RKOF 2AP3A 3C8GB 2JD3A 2WZFA 4P9FA 4CS8A 1HMOA 1ZHWA 1Q0DA 1T6UA 4U5EE 4AK9A 3DE8A 3JRTA 4XEKA 1G8XA 2Q9AA 2VCBA 3EGXB 4CDVA 2A0UA 4EBKA 2XSEA 2EPMX 2GFHA 2W45A 3ZDLA 2OCCC 1H9TA 1YAUO 3ITFA 4ZLCA 3C63A 3B0UX 2QLAA 2Z15A 1EA8A 2IXPA 3EH1A 5T3TA 4BJ1A 1Z63A 1NZEA 4DRIB 2XXAB 2QY9A 2HFIA 5COGA 2J0WA 5F28E 2H8AA 4JW1A 5B3SC 2WVQA 1C03A 3JSEO 4LLEA 2AU5A 1D1CA 1LIHA 2WVNA 1U0BB 2OEXA 3TULA 1LS4A 4AE4A 5KYWA 3CSKA 1ORYA 1FFTC 3F47A 1MMGA 2IXMA 1A0BA 4CSAA 1YARO 5A6KA 1BBHA 2KGOA 1XWJA 1HE9A 1YA7O 3DJUB 3EGXA 3KYIA 3T6BA 4AL0A 3POVA 4KC9A 5CIVA 3MLGA 2NUPB 3K66A 3K7DA 3LAYA 2J46A 4CDYA 1R5ID 2NUTB 2VCCA 2BC5A 4LDRA 3WODF 3ZTZA 4OIOF 2VASA 1R4TA 1QPUA 1UG7A 4MVZA 4ZLDA 1OW8A 2KSFA 3JSZA 3KH2A 3GM3A 3IEEA 1E85A 1NFNA 3EGDA 4YT8A 256BA 1D1BA 3DWWA 1F1MA 3X2QC 2DGJA 1K05A 5L0DA 4OD4A 1LVKA 2P7VA 3I5PA 4E7ZA 1WOLA 3SXKA 3QTHA 4PR9A 2YL0A 1SR2A 1VB5A 3AG1C 2MWQA 3EJNA 4E0HA 3M4CA 5B3IA 2Y3GA 1H9GA 1O87A 1RCPA 1G4US 3NKEA 4PJJA 2H7OA 2L81A 4K0DA 4PFPA 2I15A 4G0HA 2GWWA 4UDVA 2M4EA 2HZ8A 1B68A 1HW1A 1I5NA 2EPKX 3QVZA 2XS8A 1D0ZA 3B71A 4JCZA 3ASNC 3MYFA 4P6IC 3RVZA 3WAQA 5JLIA 3NDBB 1FMWA 4IWBA 2FGYA 3C18A 4YWQA 4JZAA 2GA0A 4D4NA 5D91A 5DS5A 4CJOA 5F5FA 1OR3A 4GEHA 3ZIBA 2Y3HA
chains in the Genus database with same CATH topology
1M2VB 3AG2C 4QI0A 3AG4C 3DXJF 2WB7A 1Z5ZA 3DD7A 5CI8A 1V55C 5IY5C 4J30B 4X0RA 1Z6AA 2B0JA 3O39A 2FFHA 2R7UA 4I3MA 1TWAA 2LSEA 4WJ0A 1NU7D 2PX3A 2KNHA 3SEOA 4PJNA 2KJGA 3ASOC 1OCCC 4A2NB 3K1HA 3QZCA 5KYNA 2YEVA 2Q9BA 3RIPA 3LS1A 1J8MF 4I44A 1VYIA 2WZGA 2Q9CA 4IRUA 3M1CB 3DAFA 3ABLC 3KMIA 1BR2A 3LESA 1MNEA 2CNWD 3CQZA 4O6YA 1M2VA 2G62A 4Q7CA 3SYNA 2A68F 3H65A 4BEJA 4RDAA 2WVOA 4CS9A 2ZPAA 2NUPA 2R7QA 1RJ9A 3UGOA 2V3CC 1NU9C 4I1OB 3JT1A 5DS6A 4EWCA 3FVYA 4YT2A 4CIHA 1O5HA 1JPNA 1VK5A 3ECSA 4O79A 3EG9B 3EHMA 3E9VA 1TKNA 3I5QA 4HE8D 3UMIA 3HTKC 3Q7GA 3W2WA 2A6HF 3RYLA 4KI2A 1ZU4A 5E33A 4PK4A 1ZYRF 3UGPA 2OG2A 2HV7A 3EPVA 4AE4B 1SMYF 3K33A 2A69F 4H4KC 4K7BA 4DBQA 3L34A 1ZHXA 3S29A 5F5HA 3NYLA 2A6EF 3Q6NA 1SF8A 4YT4A 1BR1A 2XXAA 1LKXA 2G3VA 2H7BA 2IXNA 5B1AC 4G7OF 3I4UA 4J32B 3EHNA 4I1MA 1TR2A 1ZHTA 2CW0F 4KNWA 5L3VA 3FDQA 2EIKC 2VH3A 3SP1A 2EINC 2G3KA 2BE5F 4U5FE 3W8HA 2R7VA 1D1AA 4G7HF 3KL4A 2J0XA 2YZSA 1ZHYA 4OIQF 3ZC4A 4DOZA 2A1DD 2YHSA 1JPJA 1TWHA 1M56C 3HJCA 2P6VA 1IW7F 2IYLD 4OD5A 1SZIA 2VB6A 2R7RA 1D0YA 2QTVA 2PF4E 3DZAA 3OA1A 1PCXA 1S7ZA 3HLZA 4CS9C 2IXOA 2C03A 4O6NA 5E2QA 5T1DB 1V54C 1W2WA 2Y3BA 5EHHA 2V26A 2J9VA 1TWCA 4IAOA 4QI2A 2PFDA 3ZVRA 4U5BE 2EIMC 3ABMC 1MMAA 2CGEA 2Q3TA 4B6IA 3Q6MA 5DS4A 3RFYA 4BJ6C 4Q4ZF 1VOMA 4O6MA 3W2VA 4AX2A 1FMVA 4OINF 4C7OB 2R7XA 4XTKA 2CDQA 1QLEC 3S28A 1OCRC 5D92A 2Y3DA 4U5HA 1MMNA 4QDLA 5KYUB 2PP4A 3TD7A 1TWGA 3AQBA 4HFKB 3GANA 3K1IC 1PD1A 2WL8A 2Y69C 4XLPF 3N0TA 2L9JA 1MMDA 4YN0B 4CS8C 4DBRA 2ZXWC 2EIJC 3SZRA 3VYWA 3DAGA 1ZHZA 3NG1A 3KKBA 1QZXA 3S0XA 4JVSA 3K6BA 5KYXB 5BUOA 4DVYP 4LLCA 4ULWA 2X51A 4RD9A 2PX0A 3DM5A 4N06A 3N24A 4PJMA 3EG9A 4KNVA 3ZSUA 3RH3A 2ZXOA 4FWVA 4OIPF 1Z23A 1FTSA 3PHF2 4MNDA 1N1CA 2D5RB 4U5DE 2WZLA 2I8BA 4ANJA 5EGYA 5KYWB 3O6XA 2R7TA 2W9YA 4M63A 2NG1A 3QMKA 2R7SA 3JYHA 2J9UA 4CS7A 3OEOA 2KQ9A 3NKDA 1RJ9B 3LS0A 4YJWA 4U5CE 4IJJA 4C3BA 2J7PA 2IOQA 1VYKA 1M2OA 5KYYB 3X1OA 2W4MA 3NYJA 1MNDA 3B0PA 4JCHA 3N2ZB 4YT5A 4LERA 3UMHA 5KYYA 2J9WA 3JCUQ 3W8IA 4FX5A 1OCZC 3V7OA 2R7OA 4GYTA 3ZG1A 3LJBA 3UR3C 4OIOF 3F46A 4XLNF 3EFOA 3S27A 3GODA 5DQTA 3Q7LA 4JURI 2EILC 3EFOB 4C3EA 3EQLF 1OKKD 1Z3IX 4C3DA 3E70C 2J45A 1ZU5A 2W4BA 4KBLA 2XL4A 4O7GA 4E7SA 2R7WA 3LNRA 5DQZA 2HV6A 3MX3A 4XWJA 1LS1A 3LLKA 2NUTA 4F4BA 2MYSA 4RBNA 4BJTA 1WGWA 3EGDB 3PMRA 4Q5SF 1NG1A 3AQCA 1FFHA 2DYSC 5DVWA 5T3WA 4BJ6A 4W8KA 1D0XA 5CI9A 5L3QA 4FESA 1OCOC 1OKKA 2CNWA 5DLJA 3B9QA 3CZ6A 4CSAC 3OWTA 3L0IA 3EZHA 5FCLA 1M57C 3LEVA 3EZIA 3AG3C 5B1BC 1IZMA 4EBBA 3EH2A 2E87A 2XRHA 1PD0A 2Y39A 5E3AA 1VMAA 4HFFB 4BJ5C 3LLIA 2ZXPA 2C04A 4BJ5A 4OIRF 4DVZA 3NYMA 4BG0A 4G7ZF 3UMKA 4LACB 3SNHA 3T6JA 3NRHA 4CBEA 2O9XA 3DMDA 3T4RA 3FAJA 3DM9B 5E3CA 4PFOA 1BR4A 5KYXA 1KU2A 5HSWA 2J7PD 4JJFA 2DYRC 2KW3C 3B0VC 5KYUA 4HEAJ 3DJNB 3VAYA 4NY3A 2H7VC 4U5GA 1J8YF 4PJLA 1ST6A 4JJGA 4C7OA 4MQ9F 3UNGC 2ZXRA 3WG7C 3ABKC 3RKOF 2JD3A 2WZFA 4CS8A 1ZHWA 4U5EE 4AK9A 3JRTA 1G8XA 2Q9AA 3EGXB 2XSEA 2GFHA 2W45A 2OCCC 3ITFA 4ZLCA 3B0UX 2Z15A 4BJ1A 2IXPA 3EH1A 5T3TA 1Z63A 1NZEA 2XXAB 2QY9A 2J0WA 4JW1A 5B3SC 2WVQA 4LLEA 1D1CA 2WVNA 4AE4A 5KYWA 3CSKA 1FFTC 3F47A 1MMGA 2IXMA 4CSAA 2KGOA 3EGXA 3DJUB 3T6BA 3POVA 4KC9A 3MLGA 2NUPB 3K66A 3K7DA 3LAYA 2J46A 2NUTB 3WODF 2VASA 4ZLDA 3JSZA 3KH2A 3IEEA 3EGDA 4YT8A 1D1BA 3X2QC 2DGJA 4OD4A 1LVKA 2P7VA 3I5PA 4E7ZA 3AG1C 2MWQA 3EJNA 2Y3GA 1O87A 3NKEA 4PJJA 2H7OA 2L81A 4K0DA 4PFPA 4G0HA 2M4EA 1D0ZA 3ASNC 4P6IC 3NDBB 1FMWA 4IWBA 2FGYA 4YWQA 4JZAA 5D91A 5DS5A 5F5FA 3FHDA 4GEHA 3ZIBA 2Y3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYK A;  3JCU Q;  1NZE A;  3RFY A;  3LS0 A;  2MWQ A;  3LS1 A;  3ZSU A; 
#chains in the Genus database with same CATH topology
 5AC4 A;  1M2V B;  1JMW A;  3AG2 C;  2YL3 A;  4QI0 A;  1Z7Q c;  1OW6 A;  3AG4 C;  1M6T A;  3DXJ F;  1YYJ A;  1TFO B;  1Z5Z A;  2WB7 A;  2KK1 A;  3DD7 A;  3RQG A;  3WHN A;  5CI8 A;  3ZQY A;  1V55 C;  2OOC A;  3VRC A;  1YZA A;  5IY5 C;  2LQG A;  4J30 B;  4X0R A;  1Z6A A;  2B0J A;  2J9B A;  5JVE A;  3QW0 A;  3O39 A;  2FFH A;  3AJM A;  2R7U A;  1Q0K A;  1TWA A;  2J8W A;  4I3M A;  2L6F A;  2LSE A;  4EHP A;  1KTM A;  3C62 A;  3L8I A;  4EIY A;  4WJ0 A;  1NU7 D;  3HKK A;  2LK4 A;  4ULV A;  2PX3 A;  5AGF A;  2KNH A;  2R9R B;  3K1I A;  3SEO A;  3U3B A;  2HS5 A;  1T6Q A;  1SYQ A;  4NC3 A;  1L7C A;  4PJN A;  4YL3 A;  2KJG A;  3ASO C;  1OCC C;  4MVU A;  3K1H A;  4G78 A;  4A2N B;  2KC3 A;  3S9O A;  4Z9H A;  3QZC A;  3U9M A;  5KYN A;  2X0C A;  1YZC A;  2L7A A;  2YEV A;  4N6H A;  4MTO A;  4JEB A;  2Q9B A;  3RF3 A;  5A69 A;  3U5S A;  3FOO A;  1MQV A;  1OR2 A;  3RIP A;  4WGY A;  2QUP A;  3LS1 A;  2XLO A;  1EKY A;  1J8M F;  4I44 A;  2ASR A;  1VYI A;  1UFB A;  2OKU A;  2Q9C A;  2WZG A;  4IRU A;  3M1C B;  2OEV A;  2R7W A;  1HY5 A;  2NPU A;  3DAF A;  3ABL C;  4E18 A;  1VTM P;  3KMI A;  2LFD A;  1Q0F A;  1BR2 A;  3L8J A;  3LES A;  2CCY A;  1MNE A;  2CNW D;  3CQZ A;  5A6B A;  4O6Y A;  1M2V A;  2Q7R A;  1E2X A;  2G62 A;  4MW8 A;  4Q7C A;  2F22 A;  2LFF A;  4YL0 A;  3SYN A;  4E7S A;  1NSG B;  2A68 F;  3H65 A;  4BEJ A;  3BEH A;  4RDA A;  2WVO A;  1ORJ A;  4CS9 A;  2ZPA A;  2NUP A;  1YDI A;  1WAT A;  4YK5 A;  1OQC A;  1XZP A;  2R7Q A;  1V74 B;  1RKC A;  1RJ9 A;  1CPR A;  1YLM A;  1WN0 A;  3TK0 A;  4MW3 A;  3UGO A;  2V3C C;  1NU9 C;  1RKE B;  4I1O B;  1OW7 A;  1ORS C;  3JT1 A;  5DS6 A;  1EQ1 A;  4EWC A;  3FVY A;  4YT2 A;  4CIH A;  2HKV A;  1O5H A;  3CAX A;  1JPN A;  1VK5 A;  1Y6D A;  3ECS A;  4L6R A;  4O79 A;  3EG9 B;  2P61 A;  4R32 A;  3U3F A;  4XEF A;  3EHM A;  3E9V A;  1TKN A;  3I5Q A;  2D4U A;  4HE8 D;  3UMI A;  2L6H A;  1G4W R;  1HE1 A;  3HTK C;  3JYY A;  3Q7G A;  3SXY A;  3IQC A;  2UUH A;  3W2W A;  2A6H F;  3RQE A;  3R2P A;  1ZU4 A;  3RYL A;  1CPQ A;  5AC5 A;  1G5Z A;  5E33 A;  4PK4 A;  4KI2 A;  1ZYR F;  1BZ4 A;  3UGP A;  2OG2 A;  2JX0 A;  2HV7 A;  2HUJ A;  2BL2 A;  2HSQ A;  3EPV A;  4AE4 B;  1SMY F;  3DKA A;  3K33 A;  2A69 F;  2VC9 A;  4H4K C;  4K7B A;  3VM6 A;  3L34 A;  1ZHX A;  3S29 A;  5F5H A;  4DBQ A;  5GPG B;  2OU6 A;  2A6E F;  3NYL A;  3IHU A;  3Q6N A;  1SF8 A;  1T9K A;  4YT4 A;  2Q4F A;  1BR1 A;  3HNI A;  5BQI A;  1LKX A;  4DRJ B;  4EUK B;  2G3V A;  2XXA A;  2H7B A;  3J06 A;  2IXN A;  5B1A C;  3US6 A;  4ER9 A;  3MYI A;  4G7O F;  3I4U A;  4J32 B;  2YWA A;  2XLM A;  1TR2 A;  3EHN A;  4I1M A;  3JRM O;  4MVR A;  1T01 A;  4IAQ A;  1ZHT A;  2CW0 F;  5A6J A;  2OQM A;  4KNW A;  5L3V A;  2CYD A;  2TMV P;  3RQF A;  3FDQ A;  2KYH A;  5BQG A;  4MVS A;  3RVY A;  2EIK C;  2VH3 A;  3SP1 A;  2L6G A;  2EIN C;  3MBG A;  2G3K A;  2B0H A;  3ZQV A;  2BE5 F;  4U5F E;  3W8H A;  2MHR A;  2XLE A;  4NTA A;  2R7V A;  1D1A A;  4G7H F;  3KL4 A;  2J0X A;  4XPX A;  2YVK A;  2YZS A;  1Y4C A;  1ZHY A;  4OIQ F;  1HMD A;  3ZC4 A;  4DOZ A;  2A1D D;  5L0J A;  2YHS A;  3C8G D;  5JSL A;  4Z9I A;  1JPJ A;  1TWH A;  1M56 C;  2R05 A;  1Q0G A;  1HW2 A;  5K0I A;  2HMZ A;  3FMS A;  3KPH A;  1ZZP A;  3O10 A;  3HJC A;  1DOW A;  1VLS A;  2P6V A;  1IW7 F;  2IYL D;  4K1O A;  4OD5 A;  1ZW2 A;  1LM3 B;  1ZW3 A;  4CDA A;  1SZI A;  2VB6 A;  2LP4 A;  2R7R A;  1D0Y A;  1YYX A;  2QTV A;  4MVM A;  2EPN A;  2PF4 E;  3DZA A;  3A9C A;  3AGT A;  1L3P A;  3OA1 A;  2DB4 A;  3LEO A;  4AL1 A;  3H2V A;  3HNJ A;  4XPW A;  1PCX A;  2XL6 A;  2YLI A;  3A11 A;  3LNM B;  1S7Z A;  3HLZ A;  4CS9 C;  2IXO A;  2C03 A;  4O6N A;  5E2Q A;  4U9D A;  1WTY A;  5T1D B;  2RSE B;  4CIP A;  1V54 C;  1W2W A;  2Y3B A;  4NTF A;  2P0N A;  5EHH A;  4NQF A;  2EPO A;  2R03 A;  2V26 A;  2J9V A;  2XLW A;  2YL7 A;  1TWC A;  4IAO A;  4JTD B;  1FAP B;  3S90 A;  4QI2 A;  1JAF A;  1JOG A;  2PFD A;  3ZVR A;  4U5B E;  3FOP A;  2XM4 A;  2EIM C;  3ABM C;  3GM1 A;  5JS5 A;  3NMJ A;  1MMA A;  2CGE A;  2Q3T A;  1K40 A;  3JTL O;  3Q6M A;  2LD6 A;  4B6I A;  5DS4 A;  1H7I A;  3RFY A;  3ZTM A;  3M15 A;  3IQT A;  4BJ6 C;  4EBJ A;  4Q4Z F;  3GEH A;  2YLD A;  4MTG A;  1WAS A;  1LE2 A;  1VOM A;  2YLG A;  4O6M A;  3W2V A;  4AX2 A;  4BEM J;  1FMV A;  4MVO A;  4OIN F;  1E83 A;  4C7O B;  2R7X A;  3FXH A;  4CJG A;  4XTK A;  2AWY A;  2EPL X;  5L0F A;  2CDQ A;  4Z9J A;  1QLE C;  3S28 A;  2R02 A;  1OCR C;  2HJ3 A;  5D92 A;  2Y3D A;  4U5H A;  1RMV A;  4YL1 A;  1MMN A;  4QDL A;  3TJ5 A;  4BPM A;  2PP4 A;  5KYU B;  1AVO B;  3TD7 A;  1TWG A;  3IQ6 A;  3AQB A;  4HFK B;  3GAN A;  5A6A A;  1ZVZ A;  3K1I C;  2QE9 A;  4JRZ A;  2GDC A;  1H6G A;  1PD1 A;  3V5X A;  2WL8 A;  2Y69 C;  4XLP F;  2LCH A;  2R25 A;  3L1M A;  3N0T A;  4MTF A;  3TQO A;  1T6I A;  2L9J A;  1MMD A;  4YN0 B;  4CS8 C;  4IAR A;  2Q00 A;  4JTA B;  4DBR A;  2HMQ A;  1FR0 A;  1A7E A;  4MVQ A;  1KNY A;  1TFK B;  2ZXW C;  5COF A;  3U8V A;  2EIJ C;  3SZR A;  3VYW A;  1U89 A;  3DAG A;  3V5Z A;  5L0I A;  1ZHZ A;  3NG1 A;  5L0G A;  3KKB A;  1QZX A;  4JE9 A;  3S0X A;  1FNT c;  4EKW A;  4JVS A;  2P1A A;  3K6B A;  3GM2 A;  5BUO A;  4DVY P;  5KYX B;  1GM5 A;  1GQA A;  3IPM O;  1QSP A;  4LDQ A;  3BRJ A;  4LLC A;  4ULW A;  3ZWI A;  5FZT A;  4FAP B;  1DOV A;  1QKR A;  2IM8 A;  2X51 A;  3AOU A;  3FHD A;  3O55 A;  4RD9 A;  4H54 A;  2PX0 A;  4XEV A;  4WGZ A;  3DM5 A;  4N06 A;  3SXZ A;  3N24 A;  3G4Z A;  4PJM A;  2XLD A;  1A41 A;  3VF0 A;  4CX9 A;  2LIG A;  3EG9 A;  4P9T A;  4KNV A;  3ZSU A;  3RH3 A;  2VCA A;  2ZXO A;  4FWV A;  4OIP F;  1Z23 A;  1FTS A;  2IBF A;  3U8P A;  1O3U A;  3PHF 2;  4MND A;  2ZD9 A;  3U0C A;  1N1C A;  2D5R B;  4U5D E;  2WZL A;  1E86 A;  3PDM P;  3B29 A;  3LUT B;  2I8B A;  5TJ5 E;  2AVK A;  2XLV A;  1K04 A;  4ANJ A;  5EGY A;  3U9J A;  5L0C A;  5KYW B;  3JZ0 A;  1OXK A;  3C8G A;  5JUA A;  4DXW A;  3NMI A;  3O6X A;  4A4A A;  2YQY A;  3MFN A;  3V5Y A;  2R7T A;  2W9Y A;  4M63 A;  2NG1 A;  2ICW G;  3QMK A;  2R7S A;  1V4A A;  1RKE A;  3GWL A;  3GOR A;  3JYH A;  2J9U A;  2AWC A;  5COM A;  4CS7 A;  3OEO A;  1RXQ A;  2KQ9 A;  3NKD A;  1RJ9 B;  4N4W A;  5EK0 A;  3LS0 A;  4YJW A;  1AEP A;  1A7V A;  1JR8 A;  4U5C E;  4JEA A;  4IJJ A;  4C3B A;  2J7P A;  2IOQ A;  1VYK A;  3HNK A;  3T9O A;  2XM0 A;  1M2O A;  5KYY B;  3X1O A;  1QQ3 A;  2W4M A;  2YL1 A;  1EI7 A;  1MND A;  3NYJ A;  4DJ9 A;  3B0P A;  4JCH A;  3N2Z B;  4NTB A;  4LER A;  4W8P A;  4YT5 A;  2J9W A;  3UMH A;  5KYY A;  1E84 A;  3JCU Q;  1U6H A;  3G4X A;  5JT4 A;  3W8I A;  5JP7 A;  4FX5 A;  1OCZ C;  1NLX A;  1CGN A;  4WAB A;  5JRA A;  3V7O A;  2R7O A;  4GYT A;  2NSF A;  3LJB A;  3UR3 C;  3ZG1 A;  2XLH A;  3F46 A;  4JTC B;  4XLN F;  1TQG A;  3AGU A;  2OJQ A;  3EFO A;  3NMK A;  3S27 A;  3SXM A;  1CGO A;  1PV3 A;  1YJG A;  2PBE A;  3GOD A;  1VLT A;  3PCV A;  5DQT A;  1NBB A;  3Q7L A;  4JUR I;  3R7C A;  1APC A;  1GS9 A;  2EIL C;  5BQH A;  3EFO B;  4C3E A;  4JIO A;  3C8Z A;  3EQL F;  1OKK D;  1Z3I X;  4XQ1 A;  4C3D A;  3E70 C;  2J45 A;  1JRA A;  2M64 A;  4PAC A;  1ZU5 A;  2PNO A;  2W4B A;  4KBL A;  3TOM A;  1LI7 A;  1XZQ A;  2ETS A;  2XL4 A;  4O7G A;  3IQ5 A;  3C7J A;  4J7T A;  3M4B A;  3LNR A;  5DQZ A;  2HV6 A;  2GAQ A;  3MX3 A;  2FAP B;  3DE9 A;  4XWJ A;  1LS1 A;  2YKZ A;  3LLK A;  2NUT A;  1WWP A;  3W4Y A;  4JC7 A;  4F4B A;  4N6C A;  2MYS A;  4RBN A;  4BJT A;  1NFO A;  1WGW A;  3GWN A;  4NCQ A;  5L0H A;  1YA9 A;  3EGD B;  4ONS A;  3PMR A;  4Q5S F;  1NG1 A;  3H2U A;  3GEE A;  1C02 A;  3AQC A;  3FAP B;  1FFH A;  2DI3 A;  2DYS C;  3M79 A;  1QVX A;  3QVY A;  5DVW A;  5T3W A;  2OJE D;  4W8K A;  1OXB A;  1LPE A;  1D0X A;  4IGG A;  5CI9 A;  2JPU A;  5L3Q A;  3QW1 A;  1I4Z A;  1OCO C;  4FES A;  3TJ6 A;  1OKK A;  2CNW A;  5DLJ A;  3B9Q A;  2QNL A;  3CZ6 A;  4D4X A;  4CSA C;  3OWT A;  3L0I A;  3EZH A;  5FCL A;  4IB4 A;  1M57 C;  2HJM A;  3EZI A;  3AG3 C;  3LEV A;  5B1B C;  1AUE A;  1IZM A;  4EBB A;  3EH2 A;  4XPY A;  1LI5 A;  2E87 A;  2XRH A;  2RD9 A;  1PD0 A;  2Y39 A;  5E3A A;  1VMA A;  4HFF B;  4BJ5 C;  3LLI A;  2XL8 A;  2ZXP A;  2C04 A;  4BJ5 A;  3S84 A;  4OIR F;  3T6G B;  1YVI A;  3NYM A;  3U2M A;  4BG0 A;  4BJ6 A;  4DVZ A;  3UMK A;  4LAC B;  4G7Z F;  1I4Y A;  2XS1 A;  4LDK A;  3SNH A;  3NRH A;  3KYJ A;  2A0B A;  3T6J A;  2O9X A;  3DMD A;  3T4R A;  4CBE A;  3FAJ A;  3DM9 B;  3U2L A;  5E3C A;  4PFO A;  1BR4 A;  3GEI A;  1LE4 A;  5KYX A;  1KU2 A;  4E17 A;  3HNL A;  1Q0M A;  5HSW A;  2J7P D;  2UUI A;  4JJF A;  2DYR C;  1S05 A;  3RW0 A;  2KW3 C;  3CEX A;  3B0V C;  5KYU A;  1A7D A;  3ATP A;  3DI5 A;  4GQH A;  4HEA J;  4JKV A;  3DJN B;  3VAY A;  4NY3 A;  5HV9 A;  2H7V C;  4U5G A;  1J8Y F;  1T5O A;  2YRF A;  3G50 A;  1GGQ A;  1BDJ B;  2NSG A;  1ST6 A;  4JJG A;  2HSB A;  4PJL A;  4U9E A;  1C17 M;  4E0I A;  4DRH B;  4C7O A;  4J7Y A;  5A6B D;  4MQ9 F;  3UNG C;  2ZXR A;  1CGM E;  3WG7 C;  3ABK C;  4MS2 A;  3TOL A;  3RKO F;  2AP3 A;  3C8G B;  2JD3 A;  2WZF A;  4P9F A;  4CS8 A;  1HMO A;  1ZHW A;  1Q0D A;  1T6U A;  4U5E E;  4AK9 A;  3DE8 A;  3JRT A;  4XEK A;  1G8X A;  2Q9A A;  2VCB A;  3EGX B;  4CDV A;  2A0U A;  4EBK A;  2XSE A;  2EPM X;  2GFH A;  2W45 A;  3ZDL A;  2OCC C;  1H9T A;  1YAU O;  3ITF A;  4ZLC A;  3C63 A;  3B0U X;  2QLA A;  2Z15 A;  1EA8 A;  2IXP A;  3EH1 A;  5T3T A;  4BJ1 A;  1Z63 A;  1NZE A;  4DRI B;  2XXA B;  2QY9 A;  2HFI A;  5COG A;  2J0W A;  5F28 E;  2H8A A;  4JW1 A;  5B3S C;  2WVQ A;  1C03 A;  3JSE O;  4LLE A;  2AU5 A;  1D1C A;  1LIH A;  2WVN A;  1U0B B;  2OEX A;  3TUL A;  1LS4 A;  4AE4 A;  5KYW A;  3CSK A;  1ORY A;  1FFT C;  3F47 A;  1MMG A;  2IXM A;  1A0B A;  4CSA A;  1YAR O;  5A6K A;  1BBH A;  2KGO A;  1XWJ A;  1HE9 A;  1YA7 O;  3DJU B;  3EGX A;  3KYI A;  3T6B A;  4AL0 A;  3POV A;  4KC9 A;  5CIV A;  3MLG A;  2NUP B;  3K66 A;  3K7D A;  3LAY A;  2J46 A;  4CDY A;  1R5I D;  2NUT B;  2VCC A;  2BC5 A;  4LDR A;  3WOD F;  3ZTZ A;  4OIO F;  2VAS A;  1R4T A;  1QPU A;  1UG7 A;  4MVZ A;  4ZLD A;  1OW8 A;  2KSF A;  3JSZ A;  3KH2 A;  3GM3 A;  3IEE A;  1E85 A;  1NFN A;  3EGD A;  4YT8 A;  256B A;  1D1B A;  3DWW A;  1F1M A;  3X2Q C;  2DGJ A;  1K05 A;  5L0D A;  4OD4 A;  1LVK A;  2P7V A;  3I5P A;  4E7Z A;  1WOL A;  3SXK A;  3QTH A;  4PR9 A;  2YL0 A;  1SR2 A;  1VB5 A;  3AG1 C;  2MWQ A;  3EJN A;  4E0H A;  3M4C A;  5B3I A;  2Y3G A;  1H9G A;  1O87 A;  1RCP A;  1G4U S;  3NKE A;  4PJJ A;  2H7O A;  2L81 A;  4K0D A;  4PFP A;  2I15 A;  4G0H A;  2GWW A;  4UDV A;  2M4E A;  2HZ8 A;  1B68 A;  1HW1 A;  1I5N A;  2EPK X;  3QVZ A;  2XS8 A;  1D0Z A;  3B71 A;  4JCZ A;  3ASN C;  3MYF A;  4P6I C;  3RVZ A;  3WAQ A;  5JLI A;  3NDB B;  1FMW A;  4IWB A;  2FGY A;  3C18 A;  4YWQ A;  4JZA A;  2GA0 A;  4D4N A;  5D91 A;  5DS5 A;  4CJO A;  5F5F A;  1OR3 A;  4GEH A;  3ZIB A;  2Y3H A; 
#chains in the Genus database with same CATH homology
 1M2V B;  3AG2 C;  4QI0 A;  3AG4 C;  3DXJ F;  2WB7 A;  1Z5Z A;  3DD7 A;  5CI8 A;  1V55 C;  5IY5 C;  4J30 B;  4X0R A;  1Z6A A;  2B0J A;  3O39 A;  2FFH A;  2R7U A;  4I3M A;  1TWA A;  2LSE A;  4WJ0 A;  1NU7 D;  2PX3 A;  2KNH A;  3SEO A;  4PJN A;  2KJG A;  3ASO C;  1OCC C;  4A2N B;  3K1H A;  3QZC A;  5KYN A;  2YEV A;  2Q9B A;  3RIP A;  3LS1 A;  1J8M F;  4I44 A;  1VYI A;  2WZG A;  2Q9C A;  4IRU A;  3M1C B;  3DAF A;  3ABL C;  3KMI A;  1BR2 A;  3LES A;  1MNE A;  2CNW D;  3CQZ A;  4O6Y A;  1M2V A;  2G62 A;  4Q7C A;  3SYN A;  2A68 F;  3H65 A;  4BEJ A;  4RDA A;  2WVO A;  4CS9 A;  2ZPA A;  2NUP A;  2R7Q A;  1RJ9 A;  3UGO A;  2V3C C;  1NU9 C;  4I1O B;  3JT1 A;  5DS6 A;  4EWC A;  3FVY A;  4YT2 A;  4CIH A;  1O5H A;  1JPN A;  1VK5 A;  3ECS A;  4O79 A;  3EG9 B;  3EHM A;  3E9V A;  1TKN A;  3I5Q A;  4HE8 D;  3UMI A;  3HTK C;  3Q7G A;  3W2W A;  2A6H F;  3RYL A;  4KI2 A;  1ZU4 A;  5E33 A;  4PK4 A;  1ZYR F;  3UGP A;  2OG2 A;  2HV7 A;  3EPV A;  4AE4 B;  1SMY F;  3K33 A;  2A69 F;  4H4K C;  4K7B A;  4DBQ A;  3L34 A;  1ZHX A;  3S29 A;  5F5H A;  3NYL A;  2A6E F;  3Q6N A;  1SF8 A;  4YT4 A;  1BR1 A;  2XXA A;  1LKX A;  2G3V A;  2H7B A;  2IXN A;  5B1A C;  4G7O F;  3I4U A;  4J32 B;  3EHN A;  4I1M A;  1TR2 A;  1ZHT A;  2CW0 F;  4KNW A;  5L3V A;  3FDQ A;  2EIK C;  2VH3 A;  3SP1 A;  2EIN C;  2G3K A;  2BE5 F;  4U5F E;  3W8H A;  2R7V A;  1D1A A;  4G7H F;  3KL4 A;  2J0X A;  2YZS A;  1ZHY A;  4OIQ F;  3ZC4 A;  4DOZ A;  2A1D D;  2YHS A;  1JPJ A;  1TWH A;  1M56 C;  3HJC A;  2P6V A;  1IW7 F;  2IYL D;  4OD5 A;  1SZI A;  2VB6 A;  2R7R A;  1D0Y A;  2QTV A;  2PF4 E;  3DZA A;  3OA1 A;  1PCX A;  1S7Z A;  3HLZ A;  4CS9 C;  2IXO A;  2C03 A;  4O6N A;  5E2Q A;  5T1D B;  1V54 C;  1W2W A;  2Y3B A;  5EHH A;  2V26 A;  2J9V A;  1TWC A;  4IAO A;  4QI2 A;  2PFD A;  3ZVR A;  4U5B E;  2EIM C;  3ABM C;  1MMA A;  2CGE A;  2Q3T A;  4B6I A;  3Q6M A;  5DS4 A;  3RFY A;  4BJ6 C;  4Q4Z F;  1VOM A;  4O6M A;  3W2V A;  4AX2 A;  1FMV A;  4OIN F;  4C7O B;  2R7X A;  4XTK A;  2CDQ A;  1QLE C;  3S28 A;  1OCR C;  5D92 A;  2Y3D A;  4U5H A;  1MMN A;  4QDL A;  5KYU B;  2PP4 A;  3TD7 A;  1TWG A;  3AQB A;  4HFK B;  3GAN A;  3K1I C;  1PD1 A;  2WL8 A;  2Y69 C;  4XLP F;  3N0T A;  2L9J A;  1MMD A;  4YN0 B;  4CS8 C;  4DBR A;  2ZXW C;  2EIJ C;  3SZR A;  3VYW A;  3DAG A;  1ZHZ A;  3NG1 A;  3KKB A;  1QZX A;  3S0X A;  4JVS A;  3K6B A;  5KYX B;  5BUO A;  4DVY P;  4LLC A;  4ULW A;  2X51 A;  4RD9 A;  2PX0 A;  3DM5 A;  4N06 A;  3N24 A;  4PJM A;  3EG9 A;  4KNV A;  3ZSU A;  3RH3 A;  2ZXO A;  4FWV A;  4OIP F;  1Z23 A;  1FTS A;  3PHF 2;  4MND A;  1N1C A;  2D5R B;  4U5D E;  2WZL A;  2I8B A;  4ANJ A;  5EGY A;  5KYW B;  3O6X A;  2R7T A;  2W9Y A;  4M63 A;  2NG1 A;  3QMK A;  2R7S A;  3JYH A;  2J9U A;  4CS7 A;  3OEO A;  2KQ9 A;  3NKD A;  1RJ9 B;  3LS0 A;  4YJW A;  4U5C E;  4IJJ A;  4C3B A;  2J7P A;  2IOQ A;  1VYK A;  1M2O A;  5KYY B;  3X1O A;  2W4M A;  3NYJ A;  1MND A;  3B0P A;  4JCH A;  3N2Z B;  4YT5 A;  4LER A;  3UMH A;  5KYY A;  2J9W A;  3JCU Q;  3W8I A;  4FX5 A;  1OCZ C;  3V7O A;  2R7O A;  4GYT A;  3ZG1 A;  3LJB A;  3UR3 C;  4OIO F;  3F46 A;  4XLN F;  3EFO A;  3S27 A;  3GOD A;  5DQT A;  3Q7L A;  4JUR I;  2EIL C;  3EFO B;  4C3E A;  3EQL F;  1OKK D;  1Z3I X;  4C3D A;  3E70 C;  2J45 A;  1ZU5 A;  2W4B A;  4KBL A;  2XL4 A;  4O7G A;  4E7S A;  2R7W A;  3LNR A;  5DQZ A;  2HV6 A;  3MX3 A;  4XWJ A;  1LS1 A;  3LLK A;  2NUT A;  4F4B A;  2MYS A;  4RBN A;  4BJT A;  1WGW A;  3EGD B;  3PMR A;  4Q5S F;  1NG1 A;  3AQC A;  1FFH A;  2DYS C;  5DVW A;  5T3W A;  4BJ6 A;  4W8K A;  1D0X A;  5CI9 A;  5L3Q A;  4FES A;  1OCO C;  1OKK A;  2CNW A;  5DLJ A;  3B9Q A;  3CZ6 A;  4CSA C;  3OWT A;  3L0I A;  3EZH A;  5FCL A;  1M57 C;  3LEV A;  3EZI A;  3AG3 C;  5B1B C;  1IZM A;  4EBB A;  3EH2 A;  2E87 A;  2XRH A;  1PD0 A;  2Y39 A;  5E3A A;  1VMA A;  4HFF B;  4BJ5 C;  3LLI A;  2ZXP A;  2C04 A;  4BJ5 A;  4OIR F;  4DVZ A;  3NYM A;  4BG0 A;  4G7Z F;  3UMK A;  4LAC B;  3SNH A;  3T6J A;  3NRH A;  4CBE A;  2O9X A;  3DMD A;  3T4R A;  3FAJ A;  3DM9 B;  5E3C A;  4PFO A;  1BR4 A;  5KYX A;  1KU2 A;  5HSW A;  2J7P D;  4JJF A;  2DYR C;  2KW3 C;  3B0V C;  5KYU A;  4HEA J;  3DJN B;  3VAY A;  4NY3 A;  2H7V C;  4U5G A;  1J8Y F;  4PJL A;  1ST6 A;  4JJG A;  4C7O A;  4MQ9 F;  3UNG C;  2ZXR A;  3WG7 C;  3ABK C;  3RKO F;  2JD3 A;  2WZF A;  4CS8 A;  1ZHW A;  4U5E E;  4AK9 A;  3JRT A;  1G8X A;  2Q9A A;  3EGX B;  2XSE A;  2GFH A;  2W45 A;  2OCC C;  3ITF A;  4ZLC A;  3B0U X;  2Z15 A;  4BJ1 A;  2IXP A;  3EH1 A;  5T3T A;  1Z63 A;  1NZE A;  2XXA B;  2QY9 A;  2J0W A;  4JW1 A;  5B3S C;  2WVQ A;  4LLE A;  1D1C A;  2WVN A;  4AE4 A;  5KYW A;  3CSK A;  1FFT C;  3F47 A;  1MMG A;  2IXM A;  4CSA A;  2KGO A;  3EGX A;  3DJU B;  3T6B A;  3POV A;  4KC9 A;  3MLG A;  2NUP B;  3K66 A;  3K7D A;  3LAY A;  2J46 A;  2NUT B;  3WOD F;  2VAS A;  4ZLD A;  3JSZ A;  3KH2 A;  3IEE A;  3EGD A;  4YT8 A;  1D1B A;  3X2Q C;  2DGJ A;  4OD4 A;  1LVK A;  2P7V A;  3I5P A;  4E7Z A;  3AG1 C;  2MWQ A;  3EJN A;  2Y3G A;  1O87 A;  3NKE A;  4PJJ A;  2H7O A;  2L81 A;  4K0D A;  4PFP A;  4G0H A;  2M4E A;  1D0Z A;  3ASN C;  4P6I C;  3NDB B;  1FMW A;  4IWB A;  2FGY A;  4YWQ A;  4JZA A;  5D91 A;  5DS5 A;  5F5F A;  3FHD A;  4GEH A;  3ZIB A;  2Y3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...