3LS0A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
115
structure length
115
Chain Sequence
TYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Photosynthesis
total genus 48
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls0A00
3JCUQ 1VYKA 3ZSUA 3RFYA 1NZEA 2MWQA 3LS0A 3LS1A
chains in the Genus database with same CATH superfamily
2ZD9A 1E85A 2R7QA 1LVKA 5AC5A 3GEEA 3T4RA 2DYSC 1VMAA 4LDKA 1WN0A 2KGOA 3MFNA 3L0IA 2ZXWC 1BR4A 3QMKA 4JW1A 2HJMA 1D1BA 2J9BA 3FDQA 3FOOA 3HNJA 2TMVP 3NMKA 1Z23A 3I5QA 2VCBA 2X0CA 1AVOB 3LESA 3SEOA 2L7AA 1I4YA 2G62A 3EGDB 4OD4A 3LNRA 1RKEB 2YZSA 3DAGA 5EK0A 1EI7A 2XL8A 1K40A 5KYWB 4JEBA 2WL8A 5DLJA 4HEAJ 1TFKB 2J8WA 1U6HA 3RVYA 1RJ9A 3VM6A 2H8AA 1M57C 1OCOC 2H7OA 3U9JA 3K1IC 3RH3A 2E87A 3SXMA 4YL3A 4G7OF 4N6CA 1HY5A 3C63A 4MVQA 5DQTA 1T6IA 3S90A 3V5YA 2MYSA 3EGXB 2A6EF 1VOMA 3HLZA 3KYIA 4PFPA 3VRCA 5AC4A 3T6BA 2A69F 4E0IA 1IW7F 1V54C 4WGYA 3JCUQ 1YA7O 1MMAA 1TKNA 4XLNF 2OOCA 3Q7LA 2VCAA 5F28E 3BRJA 1KU2A 1R5ID 4WGZA 1JOGA 4H54A 1KNYA 2GDCA 4DJ9A 2J7PD 2YL0A 3EHNA 2JX0A 3NMIA 4HFKB 4IB4A 2WZFA 3CEXA 2XLDA 1MNDA 2XS1A 5JP7A 2ETSA 4JCZA 3JRMO 3U5SA 3ZSUA 3PHF2 3Q6NA 5AGFA 2NUPA 2YVKA 1J8MF 3LUTB 2L6GA 3RQEA 3DWWA 2EIKC 2A6HF 1BDJB 4E0HA 2R7SA 2WVQA 2XL4A 2H7BA 3M4CA 3DE9A 1HE9A 3LS1A 1S7ZA 3EG9A 4XWJA 3NYJA 1YA9A 4DXWA 3O6XA 5GPGB 2CYDA 2UUHA 4MTOA 4A2NB 1LS1A 3R7CA 2KK1A 1Z63A 5BQGA 1JMWA 4IJJA 3U2LA 5JUAA 4QI2A 2FGYA 2XXAB 4OINF 1OKKA 3MX3A 1G4WR 4YK5A 2R7UA 3W2WA 2MHRA 4U5CE 4IAQA 3AG4C 3UMIA 4Q5SF 2QUPA 1SF8A 2G3VA 2J0XA 1FFTC 2WB7A 1YLMA 4OIOF 4PACA 1MQVA 2Q4FA 4O6YA 3U3BA 4JE9A 4D4NA 4DVZA 4OIQF 5B1BC 3EQLF 3EFOB 1GQAA 2XLEA 1I4ZA 3ASOC 4CJGA 4CS8C 5L0JA 4FAPB 4BJ5C 2J46A 1LE2A 1UFBA 1YJGA 3E9VA 4G7HF 3ZVRA 2L9JA 2YKZA 3TULA 2G3KA 1FAPB 4PJNA 1UG7A 3G50A 3HNKA 3S0XA 2LFDA 3L1MA 2J9WA 1ORJA 1ZU5A 1T9KA 3UMHA 4E18A 4XPYA 1XWJA 5L0CA 2FFHA 1U0BB 3ATPA 3QW1A 3RFYA 3TJ6A 5JSLA 3WHNA 5JLIA 5KYXB 2P61A 1V4AA 2YLDA 2YEVA 3NKDA 4MQ9F 2ZPAA 3ZTMA 5IY5C 4MVOA 3GM1A 3C18A 2R25A 5KYNA 3MYIA 4CBEA 4J7TA 2OJED 1E83A 4CIHA 3X2QC 5JRAA 1DOWA 2WZLA 2XS8A 2V3CC 1Q0FA 1WTYA 2W4BA 5JS5A 1JAFA 4OD5A 1FR0A 2KW3C 3DJUB 2R02A 1A7VA 4IWBA 2LP4A 4MW8A 2IXNA 1OQCA 3O39A 3UR3C 2J7PA 2D4UA 3SZRA 3WG7C 3IEEA 1RJ9B 1ZVZA 2IBFA 1D0ZA 2NPUA 1T6QA 3JRTA 4CDYA 2P0NA 1CPQA 1FTSA 2IXOA 4AK9A 2R7XA 2DYRC 3UNGC 4WABA 2M64A 4XLPF 5FCLA 4CSAC 1VLSA 1ZHYA 1ZZPA 2J9VA 1YARO 2KSFA 2XLOA 2YRFA 4ANJA 3ZTZA 1T6UA 1TFOB 2YL3A 3QVYA 3NKEA 3RQGA 3AJMA 4AL0A 3LLKA 3S9OA 3VYWA 2O9XA 2GA0A 3B0VC 4XEVA 4CS9A 5KYUB 4IARA 2HJ3A 1NG1A 5DS6A 4PR9A 2LIGA 2HMQA 2WVOA 4RBNA 5E3AA 2A68F 4EBKA 1VYKA 4KC9A 1TWGA 2XSEA 4QDLA 4Z9HA 4PJJA 3JT1A 2NUTA 4FX5A 4B6IA 1FMWA 3JSZA 3MYFA 4JJFA 2OEXA 2ASRA 1IZMA 3CSKA 3K1HA 4C7OA 5EHHA 3DD7A 3U3FA 5L0IA 3W4YA 3J06A 1HMOA 4E17A 2LK4A 2CCYA 1U89A 2OG2A 3DM5A 2XM0A 3TJ5A 2DB4A 4IRUA 1D0XA 3FXHA 3U0CA 2IXMA 2HV7A 5A6JA 2YLIA 4A4AA 2J0WA 3B29A 1I5NA 2NUPB 3S27A 1CGNA 2YLGA 3SXZA 4HFFB 1LPEA 1NSGB 2EINC 3IHUA 5L0HA 2HZ8A 1LI5A 1M56C 1VYIA 3N2ZB 1NLXA 2Q9AA 4R32A 5T3WA 3K66A 3S84A 1KTMA 2R9RB 3W2VA 4JKVA 5KYUA 4AE4A 4MVMA 1S05A 2HUJA 3EG9B 4PFOA 4C3DA 3QZCA 1OR2A 4MVUA 4H4KC 4CIPA 4YL0A 3K7DA 2GFHA 4JTAB 1ST6A 4EUKB 3LS0A 2C03A 5COMA 3DAFA 4BJ6C 4QI0A 3AOUA 5DQZA 1G5ZA 4E7ZA 3C8GD 4I1OB 4L6RA 4NQFA 4YT5A 1FNTc 1OXKA 2Y3HA 2YL7A 4IAOA 5L3VA 3DJNB 1FMVA 1NBBA 2IYLD 3SNHA 3UGPA 2JD3A 4ZLCA 3DE8A 4DRHB 1L3PA 3GORA 1CGME 3NYMA 5HV9A 4NY3A 3B0UX 2P1AA 2P6VA 4GEHA 3QW0A 2PF4E 4LDQA 3GWNA 1A0BA 2KQ9A 3CAXA 1MMGA 2M4EA 3U8VA 1R4TA 1H7IA 4YWQA 4YT8A 1Y4CA 4DRJB 3SYNA 1TQGA 4U5BE 3U9MA 5FZTA 2Y3DA 2DI3A 3S28A 1GM5A 1JRAA 2BL2A 1A41A 3B71A 4NTBA 2A0UA 1K05A 2VCCA 5EGYA 4YT4A 1LS4A 2VH3A 4XEFA 4RD9A 3TK0A 3UMKA 4YT2A 2VB6A 3DM9B 5TJ5E 3ZQYA 3ABMC 4J30B 3A9CA 4G78A 2R03A 3HKKA 3AQBA 4FESA 4P9FA 1M6TA 2R7RA 3US6A 1Q0GA 3B0PA 3FOPA 1GGQA 2AWYA 4EKWA 2X51A 2KNHA 4MVZA 1E84A 1LE4A 1ZU4A 3KMIA 3W8HA 4M63A 1EQ1A 2C04A 4JTDB 3GEIA 4U5HA 3H65A 2KYHA 2CDQA 3QVZA 1NZEA 3SP1A 3ZC4A 5A6KA 5B3IA 4CJOA 2VASA 3FAJA 3K1IA 4U5FE 4XEKA 3IQCA 1QLEC 1LKXA 1C02A 3VF0A 1YDIA 2ZXOA 4O7GA 1V55C 3AG2C 4JURI 5BUOA 1Q0KA 3ZDLA 3AG1C 1ORSC 3M1CB 5JT4A 1JR8A 4LLEA 4Z9JA 3EJNA 3T6JA 3N0TA 4XPWA 4BEJA 5A6BD 3DMDA 3DI5A 1D1AA 1NU7D 3KH2A 4P6IC 1AUEA 1VTMP 4LACB 1O3UA 1SZIA 2LSEA 3U8PA 2W9YA 5L0GA 1JPJA 1TWAA 1N1CA 4OIRF 3RIPA 3LNMB 3Q6MA 4W8KA 3LLIA 3ITFA 1MMDA 1HW1A 1Z3IX 1MMNA 4JC7A 2R7WA 2LFFA 3JYYA 2YL1A 2PFDA 3FVYA 1QKRA 4G7ZF 3ABLC 4G0HA 1FFHA 2XLHA 4U9DA 1M2OA 2NUTB 3PMRA 4YN0B 1YVIA 4K7BA 3POVA 2OCCC 2RD9A 3UGOA 4PK4A 3C8GA 3RW0A 4C7OB 3IQ5A 3NYLA 4MVRA 4JCHA 2I8BA 4LERA 4BJTA 1EKYA 5KYYA 4MVSA 3RF3A 1K04A 4I3MA 2Y39A 4O6NA 5T3TA 3KKBA 2YWAA 5DS5A 1B68A 5A6AA 3PDMP 3DKAA 2PX0A 3S29A 2I15A 4EBJA 2F22A 3E70C 4NTAA 3W8IA 4JIOA 4ZLDA 3RQFA 1OW8A 2CW0F 2V26A 3L34A 4JEAA 3GWLA 3KYJA 5CI9A 1Q0MA 4KBLA 3H2UA 3HNLA 4YJWA 2QTVA 3K33A 4CX9A 2ICWG 2AVKA 2EPKX 2IOQA 3A11A 4AE4B 1OXBA 1RXQA 2CNWD 3JTLO 3L8IA 1NFNA 3EZHA 1QZXA 4HE8D 4MW3A 2Y3GA 1WWPA 4ER9A 1A7DA 2HSQA 4ONSA 5JVEA 4LDRA 2PX3A 4U5EE 3RVZA 1VB5A 1YZCA 2IM8A 2J45A 5DVWA 3ZIBA 5L3QA 3OWTA 1LIHA 1OW6A 3B9QA 4NCQA 4N4WA 1Z6AA 3FMSA 5DS4A 2XM4A 3F46A 2LQGA 1Q0DA 4CS8A 5F5HA 2B0HA 4BJ5A 1E2XA 4EBBA 1A7EA 2WVNA 3HNIA 4NTFA 3BEHA 4GQHA 2Q00A 1C03A 2EIJC 2L81A 1M2VA 2UUIA 3MBGA 1NFOA 3EH1A 2YQYA 5D92A 4J32B 3LEOA 256BA 4KNVA 4W8PA 2WZGA 1GS9A 3ECSA 1BZ4A 3SXYA 4IGGA 1H9GA 2VC9A 3DXJF 2QNLA 3RKOF 1C17M 1L7CA 1YAUO 3G4ZA 4XQ1A 1TR2A 1D0YA 3M79A 3F47A 3EZIA 2P7VA 1WGWA 3L8JA 4PJLA 1Z7Qc 1EA8A 3GODA 2L6FA 1O5HA 1LI7A 5A6BA 4DBQA 1PD1A 3M4BA 1ZHZA 1SYQA 4BG0A 3HJCA 2HMZA 2W45A 4JRZA 4Z9IA 5E2QA 1YZAA 4ULVA 2R7TA 5F5FA 2CGEA 4C3EA 3T6GB 2HV6A 3C62A 5E33A 1Y6DA 2R05A 1BR2A 3GM3A 4LLCA 4N06A 3JYHA 2HS5A 2NG1A 5HSWA 2R7VA 1ZHTA 3ASNC 5L0FA 1VLTA 1CPRA 2Q3TA 4JVSA 2ZXRA 4BEMJ 3GANA 3EGDA 4MTFA 3C8ZA 1QPUA 2Y3BA 3HTKC 5B1AC 5B3SC 1RKEA 2FAPB 2HKVA 3AQCA 5E3CA 4CSAA 2GAQA 4U5GA 2QLAA 1OCRC 2MWQA 4J7YA 4WJ0A 5KYWA 1AEPA 1ZHWA 1ZW2A 2ZXPA 3RYLA 3V5ZA 2EILC 3FAPB 2GWWA 2BE5F 2XLMA 1BR1A 3R2PA 2Q9BA 4AL1A 1Z5ZA 3U2MA 3VAYA 1BBHA 1JPNA 4EIYA 4EWCA 2OU6A 5K0IA 3GEHA 4UDVA 2B0JA 2OJQA 4DRIB 2R7OA 3NRHA 1ZHXA 4I1MA 4RDAA 3EGXA 3NDBB 4F4BA 3AGUA 2EPOA 3MLGA 3Q7GA 3TOLA 4BJ1A 3EHMA 1YYXA 1PCXA 3KL4A 4JTCB 4XPXA 1RMVA 2CNWA 2NSGA 4MNDA 3LEVA 5T1DB 4D4XA 2Z15A 1OCZC 2DGJA 2JPUA 1HW2A 1NU9C 2KC3A 4ULWA 3IQ6A 1QVXA 2PP4A 1J8YF 3K6BA 2PBEA 3V7OA 2Q9CA 1WOLA 4PJMA 3AG3C 1SMYF 3C8GB 3JZ0A 4CS9C 3X1OA 2IXPA 4N6HA 4NC3A 1SR2A 2OQMA 4K0DA 4I44A 3QTHA 1RCPA 5KYYB 1YYJA 2Q7RA 2KJGA 2XLWA 3JSEO 3PCVA 1WATA 3IQTA 4JZAA 1G8XA 2A1DD 4X0RA 3TQOA 4CS7A 4DVYP 1APCA 1V74B 2XRHA 3LJBA 3LAYA 4E7SA 4MS2A 4BJ6A 3O10A 4XTKA 3G4XA 2HSBA 2PNOA 1LM3B 2HFIA 4YL1A 2EPMX 1CGOA 1PD0A 1TWHA 2Y69C 4BPMA 1W2WA 3N24A 1XZQA 2YHSA 2EPLX 4MTGA 3TD7A 3TOMA 2EPNA 4CDAA 3NMJA 1DOVA 2XLVA 3WODF 3GM2A 2A0BA 2H7VC 5CI8A 1OR3A 3ZQVA 3CQZA 1TWCA 1O87A 1ZW3A 1D1CA 4KNWA 1QQ3A 2AP3A 3I5PA 4O79A 3AGTA 3ZWIA 2OEVA 3ZG1A 5A69A 2XXAA 5D91A 1HE1A 3OA1A 4GYTA 5L0DA 1T5OA 4CDVA 3SXKA 1G4US 2QE9A 5COFA 4Q4ZF 1VK5A 1OW7A 3NG1A 3KPHA 3IPMO 3OEOA 4Q7CA 1H9TA 2NSFA 3C7JA 1F1MA 5BQHA 1H6GA 2AWCA 1WASA 2XL6A 1E86A 5COGA 2RSEB 2AU5A 1M2VB 2J9UA 3FHDA 1XZPA 3EFOA 4DBRA 3O55A 4P9TA 2D5RB 3EPVA 4DOZA 2OKUA 2L6HA 1T01A 3DZAA 1QSPA 3M15A 1ZYRF 4C3BA 2QY9A 5CIVA 4O6MA 4U5DE 2LCHA 3T9OA 3V5XA 4OIPF 3CZ6A 1ORYA 1MNEA 1RKCA 3ABKC 1OCCC 4JJGA 4EHPA 2EIMC 2BC5A 1HMDA 2LD6A 4K1OA 3H2VA 3EH2A 4FWVA 4U9EA 4KI2A 1PV3A 4AX2A 3I4UA 5KYXA 5BQIA 2W4MA 3WAQA 1OKKD
chains in the Genus database with same CATH topology
2R7QA 1LVKA 3T4RA 2DYSC 1VMAA 2KGOA 3L0IA 2ZXWC 1BR4A 3QMKA 4JW1A 1D1BA 3FDQA 1Z23A 3I5QA 3SEOA 3LESA 3EGDB 2G62A 4OD4A 3LNRA 2YZSA 3DAGA 5KYWB 2WL8A 5DLJA 4HEAJ 1RJ9A 1M57C 1OCOC 2H7OA 3K1IC 3RH3A 2E87A 4G7OF 5DQTA 2MYSA 3EGXB 2A6EF 1VOMA 3HLZA 4PFPA 3T6BA 2A69F 1IW7F 1V54C 3JCUQ 1MMAA 1TKNA 4XLNF 3Q7LA 1KU2A 2J7PD 3EHNA 4HFKB 2WZFA 1MNDA 3ZSUA 3PHF2 3Q6NA 2NUPA 1J8MF 2EIKC 2A6HF 2R7SA 2WVQA 2XL4A 2H7BA 3LS1A 1S7ZA 3EG9A 4XWJA 3NYJA 3O6XA 4A2NB 1LS1A 1Z63A 4IJJA 4QI2A 2FGYA 2XXAB 4OINF 1OKKA 3MX3A 2R7UA 3W2WA 4U5CE 3AG4C 3UMIA 4Q5SF 1SF8A 2G3VA 2J0XA 1FFTC 2WB7A 4O6YA 4DVZA 4OIQF 5B1BC 3EQLF 3EFOB 3ASOC 4CS8C 4BJ5C 2J46A 3E9VA 4G7HF 3ZVRA 2L9JA 2G3KA 4PJNA 3S0XA 2J9WA 1ZU5A 3UMHA 2FFHA 3RFYA 5KYXB 2YEVA 3NKDA 4MQ9F 2ZPAA 5IY5C 5KYNA 4CBEA 4CIHA 3X2QC 2WZLA 2V3CC 2W4BA 4OD5A 2KW3C 3DJUB 4IWBA 3UR3C 2IXNA 3O39A 3WG7C 2J7PA 3SZRA 3IEEA 1RJ9B 3JRTA 1D0ZA 1FTSA 2IXOA 4AK9A 2R7XA 2DYRC 3UNGC 4XLPF 4CSAC 5FCLA 1ZHYA 2J9VA 4ANJA 3NKEA 3LLKA 3VYWA 2O9XA 3B0VC 4CS9A 5KYUB 1NG1A 5DS6A 2WVOA 4RBNA 5E3AA 2A68F 1VYKA 4KC9A 1TWGA 2XSEA 4QDLA 2NUTA 4PJJA 3JT1A 4FX5A 4B6IA 1FMWA 3JSZA 4JJFA 4C7OA 1IZMA 3CSKA 3K1HA 5EHHA 3DD7A 3DM5A 2OG2A 4IRUA 1D0XA 2IXMA 2HV7A 2J0WA 2NUPB 3S27A 4HFFB 2EINC 1M56C 1VYIA 3N2ZB 2Q9AA 5T3WA 3K66A 3W2VA 5KYUA 4AE4A 3EG9B 4PFOA 4C3DA 3QZCA 4H4KC 3K7DA 2GFHA 1ST6A 3LS0A 2C03A 4BJ6C 3DAFA 4QI0A 5DQZA 4E7ZA 4I1OB 4YT5A 2Y3HA 4IAOA 5L3VA 3DJNB 1FMVA 2IYLD 3SNHA 3UGPA 2JD3A 4ZLCA 3NYMA 4NY3A 3B0UX 2P6VA 4GEHA 2PF4E 2KQ9A 1MMGA 2M4EA 4YT8A 3SYNA 4U5BE 2Y3DA 3S28A 5EGYA 4YT4A 2VH3A 4YT2A 4RD9A 3UMKA 2VB6A 3DM9B 3ABMC 4J30B 3AQBA 4FESA 2R7RA 3B0PA 2X51A 2KNHA 3KMIA 1ZU4A 3W8HA 4M63A 2C04A 4U5HA 3H65A 2CDQA 1NZEA 3SP1A 3ZC4A 2VASA 3FAJA 4U5FE 1QLEC 1LKXA 2ZXOA 4O7GA 1V55C 3AG2C 4JURI 5BUOA 3AG1C 3M1CB 4LLEA 3EJNA 3T6JA 3N0TA 4BEJA 3DMDA 1D1AA 1NU7D 3KH2A 4P6IC 4LACB 1SZIA 2LSEA 2W9YA 1JPJA 1TWAA 1N1CA 4OIRF 3RIPA 3Q6MA 4W8KA 3LLIA 3ITFA 1MMDA 1Z3IX 1MMNA 2R7WA 2PFDA 3FVYA 4G7ZF 3ABLC 4G0HA 1FFHA 1M2OA 2NUTB 3PMRA 4YN0B 3POVA 4K7BA 2OCCC 3UGOA 4PK4A 4C7OB 3NYLA 4JCHA 2I8BA 4LERA 4BJTA 5KYYA 4O6NA 4I3MA 2Y39A 5T3TA 3KKBA 5DS5A 2PX0A 3S29A 3E70C 3W8IA 4ZLDA 2CW0F 3L34A 2V26A 4OIOF 5CI9A 4KBLA 4YJWA 2QTVA 3K33A 2IOQA 4AE4B 2CNWD 4YWQA 4HE8D 3EZHA 1QZXA 2Y3GA 2PX3A 4U5EE 2J45A 3ZIBA 5DVWA 5L3QA 3OWTA 3B9QA 1Z6AA 5DS4A 3F46A 4CS8A 5F5HA 4BJ5A 4EBBA 2WVNA 2EIJC 2L81A 1M2VA 3EH1A 5D92A 4J32B 4KNVA 2WZGA 3ECSA 3DXJF 3RKOF 1TR2A 1D0YA 3F47A 3EZIA 2P7VA 1WGWA 4PJLA 3GODA 1O5HA 4DBQA 1PD1A 1ZHZA 4BG0A 3HJCA 2W45A 5E2QA 2R7TA 5F5FA 2CGEA 4C3EA 2HV6A 5E33A 1BR2A 4LLCA 4N06A 5HSWA 3JYHA 2NG1A 2R7VA 1ZHTA 3ASNC 2Q3TA 4JVSA 2ZXRA 3GANA 3EGDA 5B1AC 2Y3BA 3HTKC 5B3SC 4CSAA 3AQCA 5E3CA 4U5GA 1OCRC 2MWQA 4WJ0A 5KYWA 1ZHWA 2ZXPA 3RYLA 2EILC 2BE5F 1BR1A 2Q9BA 1Z5ZA 3VAYA 1JPNA 4EWCA 2B0JA 2R7OA 3NRHA 1ZHXA 4I1MA 4RDAA 3EGXA 3NDBB 4F4BA 3MLGA 3Q7GA 4BJ1A 3EHMA 1PCXA 3KL4A 2CNWA 4MNDA 3LEVA 5T1DB 2Z15A 1OCZC 2DGJA 1NU9C 4ULWA 2PP4A 1J8YF 3K6BA 3V7OA 2Q9CA 4PJMA 3AG3C 1SMYF 4CS9C 3X1OA 2IXPA 5KYYB 4K0DA 4I44A 2KJGA 4JZAA 1G8XA 2A1DD 4X0RA 4CS7A 4DVYP 2XRHA 3LJBA 3LAYA 4E7SA 4BJ6A 4XTKA 2Y69C 1TWHA 1PD0A 1W2WA 3N24A 2YHSA 3TD7A 3WODF 2H7VC 5CI8A 3CQZA 1TWCA 1O87A 4KNWA 1D1CA 3I5PA 4O79A 3ZG1A 2XXAA 5D91A 3OA1A 4GYTA 4Q4ZF 1VK5A 3NG1A 3OEOA 4Q7CA 2J9UA 1M2VB 3FHDA 3EFOA 4DBRA 4DOZA 2D5RB 3EPVA 3DZAA 4C3BA 1ZYRF 2QY9A 4O6MA 4U5DE 4OIPF 3CZ6A 1MNEA 3ABKC 1OCCC 4JJGA 2EIMC 3EH2A 4FWVA 4KI2A 4AX2A 3I4UA 5KYXA 2W4MA 1OKKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU Q;  1VYK A;  3ZSU A;  3RFY A;  1NZE A;  2MWQ A;  3LS0 A;  3LS1 A; 
#chains in the Genus database with same CATH topology
 2ZD9 A;  1E85 A;  2R7Q A;  1LVK A;  5AC5 A;  3GEE A;  3T4R A;  2DYS C;  1VMA A;  4LDK A;  1WN0 A;  2KGO A;  3MFN A;  3L0I A;  2ZXW C;  1BR4 A;  3QMK A;  4JW1 A;  2HJM A;  1D1B A;  2J9B A;  3FDQ A;  3FOO A;  3HNJ A;  2TMV P;  3NMK A;  1Z23 A;  3I5Q A;  2VCB A;  2X0C A;  1AVO B;  3LES A;  3SEO A;  2L7A A;  1I4Y A;  2G62 A;  3EGD B;  4OD4 A;  3LNR A;  1RKE B;  2YZS A;  3DAG A;  5EK0 A;  1EI7 A;  2XL8 A;  1K40 A;  5KYW B;  4JEB A;  2WL8 A;  5DLJ A;  4HEA J;  1TFK B;  2J8W A;  1U6H A;  3RVY A;  1RJ9 A;  3VM6 A;  2H8A A;  1M57 C;  1OCO C;  2H7O A;  3U9J A;  3K1I C;  3RH3 A;  2E87 A;  3SXM A;  4YL3 A;  4G7O F;  4N6C A;  1HY5 A;  3C63 A;  4MVQ A;  5DQT A;  1T6I A;  3S90 A;  3V5Y A;  2MYS A;  3EGX B;  2A6E F;  1VOM A;  3HLZ A;  3KYI A;  4PFP A;  3VRC A;  5AC4 A;  3T6B A;  2A69 F;  4E0I A;  1IW7 F;  1V54 C;  4WGY A;  3JCU Q;  1YA7 O;  1MMA A;  1TKN A;  4XLN F;  2OOC A;  3Q7L A;  2VCA A;  5F28 E;  3BRJ A;  1KU2 A;  1R5I D;  4WGZ A;  1JOG A;  4H54 A;  1KNY A;  2GDC A;  4DJ9 A;  2J7P D;  2YL0 A;  3EHN A;  2JX0 A;  3NMI A;  4HFK B;  4IB4 A;  2WZF A;  3CEX A;  2XLD A;  1MND A;  2XS1 A;  5JP7 A;  2ETS A;  4JCZ A;  3JRM O;  3U5S A;  3ZSU A;  3PHF 2;  3Q6N A;  5AGF A;  2NUP A;  2YVK A;  1J8M F;  3LUT B;  2L6G A;  3RQE A;  3DWW A;  2EIK C;  2A6H F;  1BDJ B;  4E0H A;  2R7S A;  2WVQ A;  2XL4 A;  2H7B A;  3M4C A;  3DE9 A;  1HE9 A;  3LS1 A;  1S7Z A;  3EG9 A;  4XWJ A;  3NYJ A;  1YA9 A;  4DXW A;  3O6X A;  5GPG B;  2CYD A;  2UUH A;  4MTO A;  4A2N B;  1LS1 A;  3R7C A;  2KK1 A;  1Z63 A;  5BQG A;  1JMW A;  4IJJ A;  3U2L A;  5JUA A;  4QI2 A;  2FGY A;  2XXA B;  4OIN F;  1OKK A;  3MX3 A;  1G4W R;  4YK5 A;  2R7U A;  3W2W A;  2MHR A;  4U5C E;  4IAQ A;  3AG4 C;  3UMI A;  4Q5S F;  2QUP A;  1SF8 A;  2G3V A;  2J0X A;  1FFT C;  2WB7 A;  1YLM A;  4OIO F;  4PAC A;  1MQV A;  2Q4F A;  4O6Y A;  3U3B A;  4JE9 A;  4D4N A;  4DVZ A;  4OIQ F;  5B1B C;  3EQL F;  3EFO B;  1GQA A;  2XLE A;  1I4Z A;  3ASO C;  4CJG A;  4CS8 C;  5L0J A;  4FAP B;  4BJ5 C;  2J46 A;  1LE2 A;  1UFB A;  1YJG A;  3E9V A;  4G7H F;  3ZVR A;  2L9J A;  2YKZ A;  3TUL A;  2G3K A;  1FAP B;  4PJN A;  1UG7 A;  3G50 A;  3HNK A;  3S0X A;  2LFD A;  3L1M A;  2J9W A;  1ORJ A;  1ZU5 A;  1T9K A;  3UMH A;  4E18 A;  4XPY A;  1XWJ A;  5L0C A;  2FFH A;  1U0B B;  3ATP A;  3QW1 A;  3RFY A;  3TJ6 A;  5JSL A;  3WHN A;  5JLI A;  5KYX B;  2P61 A;  1V4A A;  2YLD A;  2YEV A;  3NKD A;  4MQ9 F;  2ZPA A;  3ZTM A;  5IY5 C;  4MVO A;  3GM1 A;  3C18 A;  2R25 A;  5KYN A;  3MYI A;  4CBE A;  4J7T A;  2OJE D;  1E83 A;  4CIH A;  3X2Q C;  5JRA A;  1DOW A;  2WZL A;  2XS8 A;  2V3C C;  1Q0F A;  1WTY A;  2W4B A;  5JS5 A;  1JAF A;  4OD5 A;  1FR0 A;  2KW3 C;  3DJU B;  2R02 A;  1A7V A;  4IWB A;  2LP4 A;  4MW8 A;  2IXN A;  1OQC A;  3O39 A;  3UR3 C;  2J7P A;  2D4U A;  3SZR A;  3WG7 C;  3IEE A;  1RJ9 B;  1ZVZ A;  2IBF A;  1D0Z A;  2NPU A;  1T6Q A;  3JRT A;  4CDY A;  2P0N A;  1CPQ A;  1FTS A;  2IXO A;  4AK9 A;  2R7X A;  2DYR C;  3UNG C;  4WAB A;  2M64 A;  4XLP F;  5FCL A;  4CSA C;  1VLS A;  1ZHY A;  1ZZP A;  2J9V A;  1YAR O;  2KSF A;  2XLO A;  2YRF A;  4ANJ A;  3ZTZ A;  1T6U A;  1TFO B;  2YL3 A;  3QVY A;  3NKE A;  3RQG A;  3AJM A;  4AL0 A;  3LLK A;  3S9O A;  3VYW A;  2O9X A;  2GA0 A;  3B0V C;  4XEV A;  4CS9 A;  5KYU B;  4IAR A;  2HJ3 A;  1NG1 A;  5DS6 A;  4PR9 A;  2LIG A;  2HMQ A;  2WVO A;  4RBN A;  5E3A A;  2A68 F;  4EBK A;  1VYK A;  4KC9 A;  1TWG A;  2XSE A;  4QDL A;  4Z9H A;  4PJJ A;  3JT1 A;  2NUT A;  4FX5 A;  4B6I A;  1FMW A;  3JSZ A;  3MYF A;  4JJF A;  2OEX A;  2ASR A;  1IZM A;  3CSK A;  3K1H A;  4C7O A;  5EHH A;  3DD7 A;  3U3F A;  5L0I A;  3W4Y A;  3J06 A;  1HMO A;  4E17 A;  2LK4 A;  2CCY A;  1U89 A;  2OG2 A;  3DM5 A;  2XM0 A;  3TJ5 A;  2DB4 A;  4IRU A;  1D0X A;  3FXH A;  3U0C A;  2IXM A;  2HV7 A;  5A6J A;  2YLI A;  4A4A A;  2J0W A;  3B29 A;  1I5N A;  2NUP B;  3S27 A;  1CGN A;  2YLG A;  3SXZ A;  4HFF B;  1LPE A;  1NSG B;  2EIN C;  3IHU A;  5L0H A;  2HZ8 A;  1LI5 A;  1M56 C;  1VYI A;  3N2Z B;  1NLX A;  2Q9A A;  4R32 A;  5T3W A;  3K66 A;  3S84 A;  1KTM A;  2R9R B;  3W2V A;  4JKV A;  5KYU A;  4AE4 A;  4MVM A;  1S05 A;  2HUJ A;  3EG9 B;  4PFO A;  4C3D A;  3QZC A;  1OR2 A;  4MVU A;  4H4K C;  4CIP A;  4YL0 A;  3K7D A;  2GFH A;  4JTA B;  1ST6 A;  4EUK B;  3LS0 A;  2C03 A;  5COM A;  3DAF A;  4BJ6 C;  4QI0 A;  3AOU A;  5DQZ A;  1G5Z A;  4E7Z A;  3C8G D;  4I1O B;  4L6R A;  4NQF A;  4YT5 A;  1FNT c;  1OXK A;  2Y3H A;  2YL7 A;  4IAO A;  5L3V A;  3DJN B;  1FMV A;  1NBB A;  2IYL D;  3SNH A;  3UGP A;  2JD3 A;  4ZLC A;  3DE8 A;  4DRH B;  1L3P A;  3GOR A;  1CGM E;  3NYM A;  5HV9 A;  4NY3 A;  3B0U X;  2P1A A;  2P6V A;  4GEH A;  3QW0 A;  2PF4 E;  4LDQ A;  3GWN A;  1A0B A;  2KQ9 A;  3CAX A;  1MMG A;  2M4E A;  3U8V A;  1R4T A;  1H7I A;  4YWQ A;  4YT8 A;  1Y4C A;  4DRJ B;  3SYN A;  1TQG A;  4U5B E;  3U9M A;  5FZT A;  2Y3D A;  2DI3 A;  3S28 A;  1GM5 A;  1JRA A;  2BL2 A;  1A41 A;  3B71 A;  4NTB A;  2A0U A;  1K05 A;  2VCC A;  5EGY A;  4YT4 A;  1LS4 A;  2VH3 A;  4XEF A;  4RD9 A;  3TK0 A;  3UMK A;  4YT2 A;  2VB6 A;  3DM9 B;  5TJ5 E;  3ZQY A;  3ABM C;  4J30 B;  3A9C A;  4G78 A;  2R03 A;  3HKK A;  3AQB A;  4FES A;  4P9F A;  1M6T A;  2R7R A;  3US6 A;  1Q0G A;  3B0P A;  3FOP A;  1GGQ A;  2AWY A;  4EKW A;  2X51 A;  2KNH A;  4MVZ A;  1E84 A;  1LE4 A;  1ZU4 A;  3KMI A;  3W8H A;  4M63 A;  1EQ1 A;  2C04 A;  4JTD B;  3GEI A;  4U5H A;  3H65 A;  2KYH A;  2CDQ A;  3QVZ A;  1NZE A;  3SP1 A;  3ZC4 A;  5A6K A;  5B3I A;  4CJO A;  2VAS A;  3FAJ A;  3K1I A;  4U5F E;  4XEK A;  3IQC A;  1QLE C;  1LKX A;  1C02 A;  3VF0 A;  1YDI A;  2ZXO A;  4O7G A;  1V55 C;  3AG2 C;  4JUR I;  5BUO A;  1Q0K A;  3ZDL A;  3AG1 C;  1ORS C;  3M1C B;  5JT4 A;  1JR8 A;  4LLE A;  4Z9J A;  3EJN A;  3T6J A;  3N0T A;  4XPW A;  4BEJ A;  5A6B D;  3DMD A;  3DI5 A;  1D1A A;  1NU7 D;  3KH2 A;  4P6I C;  1AUE A;  1VTM P;  4LAC B;  1O3U A;  1SZI A;  2LSE A;  3U8P A;  2W9Y A;  5L0G A;  1JPJ A;  1TWA A;  1N1C A;  4OIR F;  3RIP A;  3LNM B;  3Q6M A;  4W8K A;  3LLI A;  3ITF A;  1MMD A;  1HW1 A;  1Z3I X;  1MMN A;  4JC7 A;  2R7W A;  2LFF A;  3JYY A;  2YL1 A;  2PFD A;  3FVY A;  1QKR A;  4G7Z F;  3ABL C;  4G0H A;  1FFH A;  2XLH A;  4U9D A;  1M2O A;  2NUT B;  3PMR A;  4YN0 B;  1YVI A;  4K7B A;  3POV A;  2OCC C;  2RD9 A;  3UGO A;  4PK4 A;  3C8G A;  3RW0 A;  4C7O B;  3IQ5 A;  3NYL A;  4MVR A;  4JCH A;  2I8B A;  4LER A;  4BJT A;  1EKY A;  5KYY A;  4MVS A;  3RF3 A;  1K04 A;  4I3M A;  2Y39 A;  4O6N A;  5T3T A;  3KKB A;  2YWA A;  5DS5 A;  1B68 A;  5A6A A;  3PDM P;  3DKA A;  2PX0 A;  3S29 A;  2I15 A;  4EBJ A;  2F22 A;  3E70 C;  4NTA A;  3W8I A;  4JIO A;  4ZLD A;  3RQF A;  1OW8 A;  2CW0 F;  2V26 A;  3L34 A;  4JEA A;  3GWL A;  3KYJ A;  5CI9 A;  1Q0M A;  4KBL A;  3H2U A;  3HNL A;  4YJW A;  2QTV A;  3K33 A;  4CX9 A;  2ICW G;  2AVK A;  2EPK X;  2IOQ A;  3A11 A;  4AE4 B;  1OXB A;  1RXQ A;  2CNW D;  3JTL O;  3L8I A;  1NFN A;  3EZH A;  1QZX A;  4HE8 D;  4MW3 A;  2Y3G A;  1WWP A;  4ER9 A;  1A7D A;  2HSQ A;  4ONS A;  5JVE A;  4LDR A;  2PX3 A;  4U5E E;  3RVZ A;  1VB5 A;  1YZC A;  2IM8 A;  2J45 A;  5DVW A;  3ZIB A;  5L3Q A;  3OWT A;  1LIH A;  1OW6 A;  3B9Q A;  4NCQ A;  4N4W A;  1Z6A A;  3FMS A;  5DS4 A;  2XM4 A;  3F46 A;  2LQG A;  1Q0D A;  4CS8 A;  5F5H A;  2B0H A;  4BJ5 A;  1E2X A;  4EBB A;  1A7E A;  2WVN A;  3HNI A;  4NTF A;  3BEH A;  4GQH A;  2Q00 A;  1C03 A;  2EIJ C;  2L81 A;  1M2V A;  2UUI A;  3MBG A;  1NFO A;  3EH1 A;  2YQY A;  5D92 A;  4J32 B;  3LEO A;  256B A;  4KNV A;  4W8P A;  2WZG A;  1GS9 A;  3ECS A;  1BZ4 A;  3SXY A;  4IGG A;  1H9G A;  2VC9 A;  3DXJ F;  2QNL A;  3RKO F;  1C17 M;  1L7C A;  1YAU O;  3G4Z A;  4XQ1 A;  1TR2 A;  1D0Y A;  3M79 A;  3F47 A;  3EZI A;  2P7V A;  1WGW A;  3L8J A;  4PJL A;  1Z7Q c;  1EA8 A;  3GOD A;  2L6F A;  1O5H A;  1LI7 A;  5A6B A;  4DBQ A;  1PD1 A;  3M4B A;  1ZHZ A;  1SYQ A;  4BG0 A;  3HJC A;  2HMZ A;  2W45 A;  4JRZ A;  4Z9I A;  5E2Q A;  1YZA A;  4ULV A;  2R7T A;  5F5F A;  2CGE A;  4C3E A;  3T6G B;  2HV6 A;  3C62 A;  5E33 A;  1Y6D A;  2R05 A;  1BR2 A;  3GM3 A;  4LLC A;  4N06 A;  3JYH A;  2HS5 A;  2NG1 A;  5HSW A;  2R7V A;  1ZHT A;  3ASN C;  5L0F A;  1VLT A;  1CPR A;  2Q3T A;  4JVS A;  2ZXR A;  4BEM J;  3GAN A;  3EGD A;  4MTF A;  3C8Z A;  1QPU A;  2Y3B A;  3HTK C;  5B1A C;  5B3S C;  1RKE A;  2FAP B;  2HKV A;  3AQC A;  5E3C A;  4CSA A;  2GAQ A;  4U5G A;  2QLA A;  1OCR C;  2MWQ A;  4J7Y A;  4WJ0 A;  5KYW A;  1AEP A;  1ZHW A;  1ZW2 A;  2ZXP A;  3RYL A;  3V5Z A;  2EIL C;  3FAP B;  2GWW A;  2BE5 F;  2XLM A;  1BR1 A;  3R2P A;  2Q9B A;  4AL1 A;  1Z5Z A;  3U2M A;  3VAY A;  1BBH A;  1JPN A;  4EIY A;  4EWC A;  2OU6 A;  5K0I A;  3GEH A;  4UDV A;  2B0J A;  2OJQ A;  4DRI B;  2R7O A;  3NRH A;  1ZHX A;  4I1M A;  4RDA A;  3EGX A;  3NDB B;  4F4B A;  3AGU A;  2EPO A;  3MLG A;  3Q7G A;  3TOL A;  4BJ1 A;  3EHM A;  1YYX A;  1PCX A;  3KL4 A;  4JTC B;  4XPX A;  1RMV A;  2CNW A;  2NSG A;  4MND A;  3LEV A;  5T1D B;  4D4X A;  2Z15 A;  1OCZ C;  2DGJ A;  2JPU A;  1HW2 A;  1NU9 C;  2KC3 A;  4ULW A;  3IQ6 A;  1QVX A;  2PP4 A;  1J8Y F;  3K6B A;  2PBE A;  3V7O A;  2Q9C A;  1WOL A;  4PJM A;  3AG3 C;  1SMY F;  3C8G B;  3JZ0 A;  4CS9 C;  3X1O A;  2IXP A;  4N6H A;  4NC3 A;  1SR2 A;  2OQM A;  4K0D A;  4I44 A;  3QTH A;  1RCP A;  5KYY B;  1YYJ A;  2Q7R A;  2KJG A;  2XLW A;  3JSE O;  3PCV A;  1WAT A;  3IQT A;  4JZA A;  1G8X A;  2A1D D;  4X0R A;  3TQO A;  4CS7 A;  4DVY P;  1APC A;  1V74 B;  2XRH A;  3LJB A;  3LAY A;  4E7S A;  4MS2 A;  4BJ6 A;  3O10 A;  4XTK A;  3G4X A;  2HSB A;  2PNO A;  1LM3 B;  2HFI A;  4YL1 A;  2EPM X;  1CGO A;  1PD0 A;  1TWH A;  2Y69 C;  4BPM A;  1W2W A;  3N24 A;  1XZQ A;  2YHS A;  2EPL X;  4MTG A;  3TD7 A;  3TOM A;  2EPN A;  4CDA A;  3NMJ A;  1DOV A;  2XLV A;  3WOD F;  3GM2 A;  2A0B A;  2H7V C;  5CI8 A;  1OR3 A;  3ZQV A;  3CQZ A;  1TWC A;  1O87 A;  1ZW3 A;  1D1C A;  4KNW A;  1QQ3 A;  2AP3 A;  3I5P A;  4O79 A;  3AGT A;  3ZWI A;  2OEV A;  3ZG1 A;  5A69 A;  2XXA A;  5D91 A;  1HE1 A;  3OA1 A;  4GYT A;  5L0D A;  1T5O A;  4CDV A;  3SXK A;  1G4U S;  2QE9 A;  5COF A;  4Q4Z F;  1VK5 A;  1OW7 A;  3NG1 A;  3KPH A;  3IPM O;  3OEO A;  4Q7C A;  1H9T A;  2NSF A;  3C7J A;  1F1M A;  5BQH A;  1H6G A;  2AWC A;  1WAS A;  2XL6 A;  1E86 A;  5COG A;  2RSE B;  2AU5 A;  1M2V B;  2J9U A;  3FHD A;  1XZP A;  3EFO A;  4DBR A;  3O55 A;  4P9T A;  2D5R B;  3EPV A;  4DOZ A;  2OKU A;  2L6H A;  1T01 A;  3DZA A;  1QSP A;  3M15 A;  1ZYR F;  4C3B A;  2QY9 A;  5CIV A;  4O6M A;  4U5D E;  2LCH A;  3T9O A;  3V5X A;  4OIP F;  3CZ6 A;  1ORY A;  1MNE A;  1RKC A;  3ABK C;  1OCC C;  4JJG A;  4EHP A;  2EIM C;  2BC5 A;  1HMD A;  2LD6 A;  4K1O A;  3H2V A;  3EH2 A;  4FWV A;  4U9E A;  4KI2 A;  1PV3 A;  4AX2 A;  3I4U A;  5KYX A;  5BQI A;  2W4M A;  3WAQ A;  1OKK D; 
#chains in the Genus database with same CATH homology
 2R7Q A;  1LVK A;  3T4R A;  2DYS C;  1VMA A;  2KGO A;  3L0I A;  2ZXW C;  1BR4 A;  3QMK A;  4JW1 A;  1D1B A;  3FDQ A;  1Z23 A;  3I5Q A;  3SEO A;  3LES A;  3EGD B;  2G62 A;  4OD4 A;  3LNR A;  2YZS A;  3DAG A;  5KYW B;  2WL8 A;  5DLJ A;  4HEA J;  1RJ9 A;  1M57 C;  1OCO C;  2H7O A;  3K1I C;  3RH3 A;  2E87 A;  4G7O F;  5DQT A;  2MYS A;  3EGX B;  2A6E F;  1VOM A;  3HLZ A;  4PFP A;  3T6B A;  2A69 F;  1IW7 F;  1V54 C;  3JCU Q;  1MMA A;  1TKN A;  4XLN F;  3Q7L A;  1KU2 A;  2J7P D;  3EHN A;  4HFK B;  2WZF A;  1MND A;  3ZSU A;  3PHF 2;  3Q6N A;  2NUP A;  1J8M F;  2EIK C;  2A6H F;  2R7S A;  2WVQ A;  2XL4 A;  2H7B A;  3LS1 A;  1S7Z A;  3EG9 A;  4XWJ A;  3NYJ A;  3O6X A;  4A2N B;  1LS1 A;  1Z63 A;  4IJJ A;  4QI2 A;  2FGY A;  2XXA B;  4OIN F;  1OKK A;  3MX3 A;  2R7U A;  3W2W A;  4U5C E;  3AG4 C;  3UMI A;  4Q5S F;  1SF8 A;  2G3V A;  2J0X A;  1FFT C;  2WB7 A;  4O6Y A;  4DVZ A;  4OIQ F;  5B1B C;  3EQL F;  3EFO B;  3ASO C;  4CS8 C;  4BJ5 C;  2J46 A;  3E9V A;  4G7H F;  3ZVR A;  2L9J A;  2G3K A;  4PJN A;  3S0X A;  2J9W A;  1ZU5 A;  3UMH A;  2FFH A;  3RFY A;  5KYX B;  2YEV A;  3NKD A;  4MQ9 F;  2ZPA A;  5IY5 C;  5KYN A;  4CBE A;  4CIH A;  3X2Q C;  2WZL A;  2V3C C;  2W4B A;  4OD5 A;  2KW3 C;  3DJU B;  4IWB A;  3UR3 C;  2IXN A;  3O39 A;  3WG7 C;  2J7P A;  3SZR A;  3IEE A;  1RJ9 B;  3JRT A;  1D0Z A;  1FTS A;  2IXO A;  4AK9 A;  2R7X A;  2DYR C;  3UNG C;  4XLP F;  4CSA C;  5FCL A;  1ZHY A;  2J9V A;  4ANJ A;  3NKE A;  3LLK A;  3VYW A;  2O9X A;  3B0V C;  4CS9 A;  5KYU B;  1NG1 A;  5DS6 A;  2WVO A;  4RBN A;  5E3A A;  2A68 F;  1VYK A;  4KC9 A;  1TWG A;  2XSE A;  4QDL A;  2NUT A;  4PJJ A;  3JT1 A;  4FX5 A;  4B6I A;  1FMW A;  3JSZ A;  4JJF A;  4C7O A;  1IZM A;  3CSK A;  3K1H A;  5EHH A;  3DD7 A;  3DM5 A;  2OG2 A;  4IRU A;  1D0X A;  2IXM A;  2HV7 A;  2J0W A;  2NUP B;  3S27 A;  4HFF B;  2EIN C;  1M56 C;  1VYI A;  3N2Z B;  2Q9A A;  5T3W A;  3K66 A;  3W2V A;  5KYU A;  4AE4 A;  3EG9 B;  4PFO A;  4C3D A;  3QZC A;  4H4K C;  3K7D A;  2GFH A;  1ST6 A;  3LS0 A;  2C03 A;  4BJ6 C;  3DAF A;  4QI0 A;  5DQZ A;  4E7Z A;  4I1O B;  4YT5 A;  2Y3H A;  4IAO A;  5L3V A;  3DJN B;  1FMV A;  2IYL D;  3SNH A;  3UGP A;  2JD3 A;  4ZLC A;  3NYM A;  4NY3 A;  3B0U X;  2P6V A;  4GEH A;  2PF4 E;  2KQ9 A;  1MMG A;  2M4E A;  4YT8 A;  3SYN A;  4U5B E;  2Y3D A;  3S28 A;  5EGY A;  4YT4 A;  2VH3 A;  4YT2 A;  4RD9 A;  3UMK A;  2VB6 A;  3DM9 B;  3ABM C;  4J30 B;  3AQB A;  4FES A;  2R7R A;  3B0P A;  2X51 A;  2KNH A;  3KMI A;  1ZU4 A;  3W8H A;  4M63 A;  2C04 A;  4U5H A;  3H65 A;  2CDQ A;  1NZE A;  3SP1 A;  3ZC4 A;  2VAS A;  3FAJ A;  4U5F E;  1QLE C;  1LKX A;  2ZXO A;  4O7G A;  1V55 C;  3AG2 C;  4JUR I;  5BUO A;  3AG1 C;  3M1C B;  4LLE A;  3EJN A;  3T6J A;  3N0T A;  4BEJ A;  3DMD A;  1D1A A;  1NU7 D;  3KH2 A;  4P6I C;  4LAC B;  1SZI A;  2LSE A;  2W9Y A;  1JPJ A;  1TWA A;  1N1C A;  4OIR F;  3RIP A;  3Q6M A;  4W8K A;  3LLI A;  3ITF A;  1MMD A;  1Z3I X;  1MMN A;  2R7W A;  2PFD A;  3FVY A;  4G7Z F;  3ABL C;  4G0H A;  1FFH A;  1M2O A;  2NUT B;  3PMR A;  4YN0 B;  3POV A;  4K7B A;  2OCC C;  3UGO A;  4PK4 A;  4C7O B;  3NYL A;  4JCH A;  2I8B A;  4LER A;  4BJT A;  5KYY A;  4O6N A;  4I3M A;  2Y39 A;  5T3T A;  3KKB A;  5DS5 A;  2PX0 A;  3S29 A;  3E70 C;  3W8I A;  4ZLD A;  2CW0 F;  3L34 A;  2V26 A;  4OIO F;  5CI9 A;  4KBL A;  4YJW A;  2QTV A;  3K33 A;  2IOQ A;  4AE4 B;  2CNW D;  4YWQ A;  4HE8 D;  3EZH A;  1QZX A;  2Y3G A;  2PX3 A;  4U5E E;  2J45 A;  3ZIB A;  5DVW A;  5L3Q A;  3OWT A;  3B9Q A;  1Z6A A;  5DS4 A;  3F46 A;  4CS8 A;  5F5H A;  4BJ5 A;  4EBB A;  2WVN A;  2EIJ C;  2L81 A;  1M2V A;  3EH1 A;  5D92 A;  4J32 B;  4KNV A;  2WZG A;  3ECS A;  3DXJ F;  3RKO F;  1TR2 A;  1D0Y A;  3F47 A;  3EZI A;  2P7V A;  1WGW A;  4PJL A;  3GOD A;  1O5H A;  4DBQ A;  1PD1 A;  1ZHZ A;  4BG0 A;  3HJC A;  2W45 A;  5E2Q A;  2R7T A;  5F5F A;  2CGE A;  4C3E A;  2HV6 A;  5E33 A;  1BR2 A;  4LLC A;  4N06 A;  5HSW A;  3JYH A;  2NG1 A;  2R7V A;  1ZHT A;  3ASN C;  2Q3T A;  4JVS A;  2ZXR A;  3GAN A;  3EGD A;  5B1A C;  2Y3B A;  3HTK C;  5B3S C;  4CSA A;  3AQC A;  5E3C A;  4U5G A;  1OCR C;  2MWQ A;  4WJ0 A;  5KYW A;  1ZHW A;  2ZXP A;  3RYL A;  2EIL C;  2BE5 F;  1BR1 A;  2Q9B A;  1Z5Z A;  3VAY A;  1JPN A;  4EWC A;  2B0J A;  2R7O A;  3NRH A;  1ZHX A;  4I1M A;  4RDA A;  3EGX A;  3NDB B;  4F4B A;  3MLG A;  3Q7G A;  4BJ1 A;  3EHM A;  1PCX A;  3KL4 A;  2CNW A;  4MND A;  3LEV A;  5T1D B;  2Z15 A;  1OCZ C;  2DGJ A;  1NU9 C;  4ULW A;  2PP4 A;  1J8Y F;  3K6B A;  3V7O A;  2Q9C A;  4PJM A;  3AG3 C;  1SMY F;  4CS9 C;  3X1O A;  2IXP A;  5KYY B;  4K0D A;  4I44 A;  2KJG A;  4JZA A;  1G8X A;  2A1D D;  4X0R A;  4CS7 A;  4DVY P;  2XRH A;  3LJB A;  3LAY A;  4E7S A;  4BJ6 A;  4XTK A;  2Y69 C;  1TWH A;  1PD0 A;  1W2W A;  3N24 A;  2YHS A;  3TD7 A;  3WOD F;  2H7V C;  5CI8 A;  3CQZ A;  1TWC A;  1O87 A;  4KNW A;  1D1C A;  3I5P A;  4O79 A;  3ZG1 A;  2XXA A;  5D91 A;  3OA1 A;  4GYT A;  4Q4Z F;  1VK5 A;  3NG1 A;  3OEO A;  4Q7C A;  2J9U A;  1M2V B;  3FHD A;  3EFO A;  4DBR A;  4DOZ A;  2D5R B;  3EPV A;  3DZA A;  4C3B A;  1ZYR F;  2QY9 A;  4O6M A;  4U5D E;  4OIP F;  3CZ6 A;  1MNE A;  3ABK C;  1OCC C;  4JJG A;  2EIM C;  3EH2 A;  4FWV A;  4KI2 A;  4AX2 A;  3I4U A;  5KYX A;  2W4M A;  1OKK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...