3LS0A

Crystal structure of cyanobacterial psbq from synechocystis sp. pcc 6803
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
115
structure length
115
Chain Sequence
TYSPEKIAQLQVYVNPIAVARDGMEKRLQGLIADQNWVDTQTYIHGPLGQLRRDMLGLASSLLPKDQDKAKTLAKEVFGHLERLDAAAKDRNGSQAKIQYQEALADFDSFLNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Sll1638 protein
publication title Crystal Structure of PsbQ from Synechocystis sp. PCC 6803 at 1.8 A: Implications for Binding and Function in Cyanobacterial Photosystem II
pubmed doi rcsb
source organism Synechocystis sp.
total genus 48
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05757 PsbQ Oxygen evolving enhancer protein 3 (PsbQ)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.290 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ls0A00
1VYKA 2MWQA 3LS1A 3ZSUA 3RFYA 3JCUQ 3LS0A 1NZEA
chains in the Genus database with same CATH superfamily
3BRJA 2CYDA 1MMAA 2L9JA 3EHNA 1BR4A 2LSEA 3GM1A 3PHF2 2KYHA 2HSQA 2W4BA 2R7RA 4I1MA 2J8WA 2R7VA 3CAXA 1R5ID 3K7DA 1ZU4A 5GPGB 4XPXA 5KYUB 5A6KA 1U6HA 4MVUA 4I44A 4WJ0A 1KU2A 1CGME 1E85A 3CSKA 3QZCA 4NQFA 2IBFA 4Z9JA 2XL4A 2CNWA 2R7QA 4O7GA 1MQVA 4FAPB 2NUTA 2WZFA 1YA9A 2MHRA 2A68F 4YT8A 2YL1A 4AL1A 3CZ6A 1D1AA 5AGFA 3R7CA 3C63A 4JVSA 2W9YA 2KC3A 3M4BA 3R2PA 1OCRC 4O6YA 2FAPB 1ORYA 5DQZA 3HNLA 2P7VA 5COGA 5L0GA 3ASNC 4FWVA 5AC5A 3QMKA 2BL2A 1VYIA 5KYXB 1JPJA 2C04A 3DJUB 1PD0A 1TKNA 2YLIA 3US6A 1WTYA 1OW8A 3QW1A 4J30B 2LQGA 1J8MF 3GWNA 1ZHWA 1O87A 1D0XA 3L34A 3U3BA 4P6IC 3WAQA 2ASRA 4CIHA 2UUIA 4BEMJ 4OIQF 2JD3A 1FMWA 1SR2A 1FFTC 2PF4E 1W2WA 2F22A 2YEVA 3DM5A 3DMDA 3K33A 2YLGA 1I4ZA 4N06A 3RQEA 3S9OA 1BBHA 4GQHA 5KYNA 3JRMO 4IRUA 4PACA 4CIPA 3EG9B 1RMVA 4KBLA 1IZMA 5KYYB 2Z15A 3GM2A 3WHNA 2LFFA 1M6TA 1KNYA 3JCUQ 4ER9A 2RD9A 4JZAA 4OIOF 2YQYA 1CGNA 1Z5ZA 4E17A 4E7SA 3ZTMA 1UFBA 1AVOB 1RXQA 1LKXA 3QVZA 4OIRF 2GA0A 3AGTA 3C62A 3Q6MA 2XLHA 2TMVP 3T6GB 1QZXA 2M4EA 4JKVA 3QTHA 5HSWA 4G7ZF 4X0RA 3KYJA 4W8KA 2JPUA 3ZQYA 1Z3IX 5F28E 3V5XA 2IM8A 1U0BB 5E3AA 3IHUA 2ZXPA 1SF8A 2PX0A 2QY9A 4U9DA 3OWTA 4G7HF 4MW8A 1AEPA 3W8HA 3UGPA 2GWWA 1ZW2A 3IQCA 2NSGA 3EQLF 1YJGA 1R4TA 4O79A 4P9TA 4C7OB 3ZQVA 5B3IA 1C17M 2EPKX 1T6IA 5L0CA 4IJJA 3LUTB 2C03A 1RCPA 3KL4A 4LLEA 4MVSA 5L0IA 1D1BA 1Z23A 3SYNA 4LLCA 3S90A 4HE8D 2WL8A 1Y4CA 2R9RB 2QNLA 4N6HA 4WGYA 2DGJA 3GODA 1D1CA 3TK0A 4B6IA 5EGYA 1EQ1A 3K6BA 2EIJC 4Z9HA 1XZPA 1VMAA 1CPQA 1K04A 3MYFA 4LDKA 4YL0A 4DBQA 3F47A 4RBNA 4AL0A 1SYQA 4JEBA 2KQ9A 2Y3BA 4AK9A 3VF0A 4E0IA 2EPOA 2EPNA 3EH1A 3V5ZA 3AJMA 3U5SA 3RYLA 2CCYA 1VYKA 4I1OB 3T6JA 2J9BA 4EHPA 4LDQA 3TULA 3A11A 4KC9A 4AX2A 4YL1A 1E83A 2R7TA 1ORJA 3LNRA 1ZZPA 4RDAA 2CW0F 4HEAJ 2XS8A 2XLMA 3HJCA 3NKEA 5EK0A 3KMIA 1TQGA 1QQ3A 1RKEA 5D91A 3ABMC 4XPWA 3EH2A 2OKUA 2L81A 2OJQA 2Q4FA 2XLWA 2A0UA 4EUKB 2NUPB 1H9TA 3RQFA 4MTGA 3HNIA 2J0WA 4O6NA 1GM5A 1NBBA 3VAYA 4OIPF 2ZXRA 2XS1A 5L0JA 4EIYA 3JTLO 2HKVA 4YJWA 2I15A 1I5NA 3JRTA 2XXAB 1HY5A 3RQGA 2QLAA 1FFHA 3T6BA 4XLNF 4CS7A 5DVWA 1LI5A 4AE4B 1WASA 3C8GD 3PMRA 3L0IA 1D0YA 3W8IA 3UMHA 5JSLA 3U3FA 1E84A 4NTAA 4ONSA 4OD5A 1ZHZA 2PBEA 3M1CB 4IAOA 1C02A 4PK4A 1RJ9A 2LIGA 1UG7A 5A6AA 4CJOA 3K1IA 3NMKA 5BUOA 3MX3A 3EGXA 5L0FA 2R7OA 1QVXA 3IPMO 1FMVA 3DE8A 4A4AA 4KI2A 4MVRA 4RD9A 1LE2A 3U9JA 1NU7D 2YL0A 2HUJA 2ICWG 5L3QA 2ETSA 4JCZA 4N4WA 2WB7A 4CS8A 3FDQA 1JAFA 3DI5A 4JJFA 3NYLA 2EILC 3EGDB 4XEKA 2HS5A 5E3CA 4D4NA 5BQHA 4G7OF 2HJ3A 5EHHA 3C8GA 1WATA 2Y69C 3SZRA 4JEAA 4MVQA 3HKKA 2G62A 2IXPA 1NFOA 1VLTA 3O10A 4Z9IA 3JZ0A 3U8VA 2KW3C 2OEXA 3O6XA 2XSEA 4Q7CA 3NYJA 3GORA 5K0IA 2AWCA 3JT1A 3I5QA 4GEHA 1F1MA 4DBRA 4DJ9A 4F4BA 5A6BD 4IWBA 4BJ5A 3X1OA 1ST6A 2VH3A 1NLXA 2YRFA 3ZSUA 4DVZA 2VB6A 1M2VB 2KSFA 2UUHA 3ASOC 3JYHA 4CDVA 4CS9A 3I4UA 3C7JA 2Q9CA 4BJ6C 3PCVA 2W45A 4XWJA 2VASA 2NSFA 3FMSA 3SXZA 5F5HA 5A69A 1TFKB 5JS5A 3Q6NA 1C03A 1M2OA 1VK5A 1GS9A 3M4CA 3SXKA 4CDAA 4BG0A 1GQAA 1T5OA 4W8PA 3RW0A 3EZHA 1EI7A 2P0NA 4JE9A 3K66A 2DYRC 1L7CA 1ZHTA 4DRJB 1T6UA 1YDIA 5CI9A 2PP4A 1SZIA 4H4KC 5T3WA 3L1MA 5FZTA 5KYUA 4YT4A 1XWJA 2G3VA 3Q7GA 3E70C 2L6HA 1U89A 3OEOA 2HMQA 2Q3TA 3U0CA 1OCCC 3QW0A 3FAPB 5E2QA 2ZPAA 2X0CA 1O5HA 4YN0B 1TFOB 1EA8A 2NG1A 3H2UA 3U2MA 3AQBA 3KH2A 3W2WA 4CJGA 3N24A 4U5DE 3TJ5A 3GM3A 3J06A 3BEHA 1H6GA 3B0VC 1V74B 2VCCA 1OW7A 4K1OA 3ZC4A 1OW6A 3EHMA 1LS4A 2ZXWC 1LI7A 3G4XA 4IAQA 3T4RA 3MFNA 1K40A 1J8YF 5KYXA 2BC5A 2YL7A 4MVZA 2XRHA 2V3CC 4U5HA 2LD6A 1V55C 4CSAA 4OINF 5JVEA 2CGEA 3GEHA 3N0TA 1YZCA 2Q00A 4J7TA 2HZ8A 4XPYA 4ZLDA 4ULWA 4HFFB 2WZLA 2IXOA 1A7VA 2WVNA 4XTKA 2L6FA 1LIHA 2E87A 1E86A 3GANA 3ATPA 1K05A 2QTVA 5IY5C 3FXHA 3C8ZA 4JTDB 4MVOA 1HW2A 3EG9A 2ZD9A 4JCHA 4YL3A 1TWCA 5KYYA 3CEXA 2YHSA 3G50A 1ZHXA 3FVYA 4MVMA 4BJTA 3FOPA 4NY3A 5KYWA 3V5YA 2MYSA 3TOLA 2OOCA 4KNVA 4EBJA 1RKEB 1A41A 1ORSC 1T6QA 2J46A 2OJED 4G78A 5AC4A 3NDBB 3IQ5A 2R7UA 3ZG1A 1Y6DA 1WGWA 1G4WR 3AG2C 3NMJA 2L7AA 4QI0A 1HE9A 2R03A 2WVOA 3IEEA 2J9UA 1JMWA 2A6EF 2J7PD 3DD7A 3EFOB 1EKYA 3HNJA 4JC7A 4PJJA 2KK1A 3CQZA 2PFDA 4WGZA 2FFHA 2R25A 1T01A 2HV7A 1TR2A 1YYXA 1Q0DA 1CPRA 1G4US 4MTFA 4XEFA 4NTBA 1N1CA 3RKOF 4DRIB 1FR0A 2NPUA 3VYWA 4MNDA 4M63A 4C7OA 1MNEA 1V54C 1XZQA 2EPMX 3SXYA 1OR3A 1RJ9B 3IQTA 4JIOA 2J9WA 3L8IA 4P9FA 4U5BE 1PCXA 1LE4A 3DM9B 4C3EA 2J7PA 4L6RA 3OA1A 5BQIA 2HFIA 3V7OA 1SMYF 2KJGA 2YVKA 4ULVA 5E33A 3UGOA 2O9XA 4YK5A 1YARO 1APCA 1S05A 1OKKD 2P61A 3ABLC 2H8AA 2X51A 4I3MA 2QUPA 3VM6A 4D4XA 5A6JA 3MYIA 2YZSA 4UDVA 2R02A 3KYIA 2B0JA 3L8JA 1HMDA 2XLOA 1DOWA 1T9KA 4C3DA 1B68A 4JJGA 3ECSA 2PNOA 4U5CE 4XEVA 1M57C 3B0UX 1MMNA 3SXMA 5JUAA 1MNDA 5L0HA 1A7EA 4IB4A 3NG1A 1BDJB 4EWCA 3M79A 1Q0MA 2DB4A 2NUTB 2QE9A 3EZIA 3ZWIA 1OXBA 2WVQA 3TOMA 2LCHA 3AOUA 2NUPA 1G5ZA 4A2NB 2YLDA 4PR9A 2OG2A 2HJMA 1OKKA 2EIMC 1FNTc 4JTCB 3GWLA 4Q5SF 3G4ZA 1OCOC 3RVYA 2AWYA 3KKBA 2XXAA 1ZYRF 3WG7C 1VOMA 3RIPA 4R32A 3S0XA 4BJ1A 4WABA 3AQCA 3E9VA 1AUEA 2IYLD 4AE4A 2XL6A 4MQ9F 1A7DA 2HSBA 2CDQA 2IOQA 3HLZA 4ANJA 2PX3A 2A1DD 1NSGB 1V4AA 4E0HA 2M64A 2B0HA 1QSPA 1YZAA 5HV9A 1BZ4A 3W2VA 2A0BA 1Q0FA 5JRAA 2AVKA 2KGOA 1A0BA 3AG4C 3LLKA 3S84A 1ZVZA 3UR3C 3DKAA 3AGUA 2J0XA 1FAPB 2DYSC 2EPLX 3TQOA 3RVZA 3I5PA 5A6BA 2R7WA 4MS2A 5DS6A 2YL3A 4Q4ZF 1Q0GA 2HV6A 3FAJA 3K1HA 3EGDA 4EKWA 5FCLA 4NC3A 1OQCA 4H54A 1CGOA 2OU6A 3M15A 1LVKA 3LESA 3NRHA 1QLEC 4K7BA 3TJ6A 4E7ZA 3U9MA 1HMOA 1YA7O 2JX0A 2R05A 3ZVRA 2EIKC 4J32B 1I4YA 4PJNA 3RH3A 4DRHB 4GYTA 2P1AA 1JRAA 3EJNA 4BEJA 1Z7Qc 1S7ZA 1HE1A 3FHDA 4YWQA 3DXJF 1LM3B 5JT4A 5T3TA 2AU5A 2VCAA 3HNKA 1QKRA 3LEVA 4G0HA 3UMIA 2R7XA 3JSZA 3O39A 2OQMA 3K1IC 5CIVA 2AP3A 1M2VA 5DLJA 5TJ5E 3DJNB 4XQ1A 3X2QC 3W4YA 5L3VA 3Q7LA 2Q9AA 4J7YA 3HTKC 2Q7RA 2EINC 2BE5F 1HW1A 2YWAA 4JURI 3ITFA 4JW1A 4LDRA 3POVA 4E18A 4HFKB 4CS8C 2D5RB 2J9VA 3O55A 1NG1A 3NYMA 2XLEA 4K0DA 2G3KA 2Y39A 3B0PA 1JR8A 3SNHA 1JPNA 5BQGA 2P6VA 5KYWB 2H7BA 3ZDLA 1OXKA 3LNMB 3FOOA 1OR2A 1PD1A 4CX9A 5T1DB 1TWHA 4LERA 4DXWA 4DVYP 1G8XA 3C18A 3RFYA 1YAUO 2A6HF 2XLDA 3DAFA 3LJBA 4BJ5C 2Q9BA 1FTSA 1NZEA 1YLMA 1VB5A 2XM4A 2J45A 3F46A 4O6MA 4CS9C 3SP1A 4FESA 2H7VC 3U8PA 1PV3A 1WN0A 3WODF 1TWGA 4YT5A 2V26A 2GFHA 3LS1A 4IGGA 2DI3A 2IXNA 1LS1A 2XL8A 3DE9A 2VCBA 3U2LA 3B29A 1OCZC 2Y3HA 3KPHA 5JLIA 4EBKA 2OEVA 1H9GA 1L3PA 2W4MA 3LLIA 4FX5A 5CI8A 5DS4A 1NU9C 3N2ZB 3QVYA 4XLPF 3ABKC 3LS0A 4PFPA 5JP7A 1YYJA 1TWAA 3S27A 4PJLA 1ZHYA 1LPEA 3B9QA 3RF3A 1QPUA 5B1BC 3B71A 1BR2A 4IARA 2LFDA 4PFOA 5D92A 3MBGA 2RSEB 4DOZA 3AG1C 2H7OA 3SEOA 1ZU5A 3LAYA 1JOGA 1Q0KA 1VLSA 5DQTA 3DZAA 3MLGA 4NCQA 1H7IA 1WOLA 1BR1A 2KNHA 3EGXB 2FGYA 1M56C 5B1AC 4U9EA 4ZLCA 4CDYA 3S28A 4C3BA 2R7SA 2I8BA 3NKDA 1MMDA 3IQ6A 3S29A 1GGQA 256BA 4BJ6A 1WWPA 1KTMA 1O3UA 4OD4A 1MMGA 3UMKA 2GDCA 3DWWA 4PJMA 1Z63A 2OCCC 1RKCA 2IXMA 3C8GB 4U5EE 2Y3GA 2GAQA 2YKZA 4U5FE 2D4UA 3UNGC 2L6GA 4EBBA 3ZIBA 5L0DA 1DOVA 3GEEA 1ZW3A 3JSEO 4JRZA 3PDMP 1E2XA 3LEOA 5COFA 4QDLA 2HMZA 3EFOA 4CSAC 3NMIA 5F5FA 2Y3DA 4JTAB 1IW7F 4U5GA 4BPMA 5B3SC 4MW3A 3VRCA 2VC9A 3JYYA 1D0ZA 5DS5A 1NFNA 1YVIA 3H2VA 4QI2A 4CBEA 3ZTZA 4NTFA 3TD7A 3A9CA 3EPVA 2MWQA 2XLVA 3DAGA 3GEIA 3H65A 3T9OA 4LACB 4MTOA 2LK4A 2LP4A 2CNWD 2WZGA 2XM0A 2ZXOA 4KNWA 1Z6AA 4N6CA 5COMA 3AG3C 4YT2A 1VTMP 2A69F
chains in the Genus database with same CATH topology
1MMAA 2L9JA 3EHNA 1BR4A 2LSEA 3PHF2 2W4BA 2R7RA 4I1MA 2R7VA 3K7DA 1ZU4A 5KYUB 4I44A 4WJ0A 1KU2A 3CSKA 3QZCA 2XL4A 2CNWA 2R7QA 4O7GA 2NUTA 2WZFA 2A68F 4YT8A 3CZ6A 1D1AA 4JVSA 2W9YA 1OCRC 4O6YA 5DQZA 2P7VA 3ASNC 4FWVA 3QMKA 1VYIA 5KYXB 1JPJA 2C04A 3DJUB 1PD0A 1TKNA 4J30B 1J8MF 1ZHWA 1O87A 1D0XA 3L34A 4CIHA 4P6IC 4OIQF 2JD3A 1FMWA 2PF4E 1FFTC 2YEVA 1W2WA 3DM5A 3DMDA 3K33A 4N06A 5KYNA 4IRUA 3EG9B 4KBLA 1IZMA 5KYYB 2Z15A 3JCUQ 4JZAA 4OIOF 1Z5ZA 4E7SA 1LKXA 4OIRF 3Q6MA 1QZXA 2M4EA 5HSWA 4G7ZF 4X0RA 4W8KA 1Z3IX 5E3AA 2ZXPA 1SF8A 2PX0A 2QY9A 3OWTA 4G7HF 3W8HA 3UGPA 3EQLF 4O79A 4C7OB 4IJJA 4LLEA 2C03A 3KL4A 1D1BA 1Z23A 3SYNA 4LLCA 4HE8D 2WL8A 2DGJA 3GODA 1D1CA 4B6IA 5EGYA 3K6BA 2EIJC 1VMAA 4DBQA 3F47A 4RBNA 2KQ9A 2Y3BA 4AK9A 3EH1A 3RYLA 3T6JA 1VYKA 4I1OB 4KC9A 4AX2A 2R7TA 3LNRA 4RDAA 2CW0F 4HEAJ 3HJCA 3NKEA 3KMIA 5D91A 3ABMC 3EH2A 2L81A 2NUPB 2J0WA 4O6NA 4OIPF 3VAYA 2ZXRA 4YJWA 3JRTA 2XXAB 1FFHA 3T6BA 4XLNF 4CS7A 5DVWA 4AE4B 3PMRA 3L0IA 1D0YA 3W8IA 3UMHA 4OD5A 1ZHZA 3M1CB 4IAOA 4PK4A 1RJ9A 5BUOA 3MX3A 3EGXA 2R7OA 4KI2A 1FMVA 4RD9A 1NU7D 5L3QA 2WB7A 4CS8A 3FDQA 4JJFA 3NYLA 2EILC 3EGDB 5E3CA 4G7OF 5EHHA 3SZRA 2Y69C 2G62A 2IXPA 2KW3C 3O6XA 2XSEA 4Q7CA 3NYJA 3JT1A 3I5QA 4GEHA 4DBRA 4F4BA 4IWBA 4BJ5A 3X1OA 1ST6A 2VH3A 4DVZA 3ZSUA 2VB6A 1M2VB 3ASOC 3JYHA 4CS9A 3I4UA 2Q9CA 4BJ6C 2W45A 4XWJA 2VASA 5F5HA 3Q6NA 1M2OA 1VK5A 4BG0A 3EZHA 3K66A 2DYRC 1ZHTA 5CI9A 2PP4A 1SZIA 4H4KC 5T3WA 5KYUA 4YT4A 2G3VA 3Q7GA 3E70C 3OEOA 2Q3TA 1OCCC 5E2QA 2ZPAA 1O5HA 4YN0B 2NG1A 3AQBA 3KH2A 3W2WA 3N24A 4U5DE 3B0VC 3ZC4A 3EHMA 2ZXWC 3T4RA 1J8YF 5KYXA 2XRHA 2V3CC 4U5HA 1V55C 4CSAA 4OINF 2CGEA 3N0TA 4ZLDA 4ULWA 4HFFB 2WZLA 2IXOA 2WVNA 4XTKA 2E87A 3GANA 2QTVA 5IY5C 3EG9A 4JCHA 1TWCA 5KYYA 3FVYA 2YHSA 1ZHXA 4BJTA 5KYWA 4NY3A 2MYSA 4KNVA 2J46A 3NDBB 2R7UA 3ZG1A 1WGWA 3AG2C 4QI0A 2WVOA 3IEEA 2J9UA 2A6EF 2J7PD 3DD7A 3EFOB 4PJJA 3CQZA 2PFDA 2FFHA 2HV7A 1TR2A 3RKOF 1N1CA 3VYWA 4MNDA 4M63A 4C7OA 1MNEA 1V54C 1RJ9B 2J9WA 4U5BE 1PCXA 3DM9B 4C3EA 2J7PA 3OA1A 3V7OA 1SMYF 2KJGA 5E33A 3UGOA 2O9XA 1OKKD 3ABLC 4I3MA 2X51A 2YZSA 2B0JA 4C3DA 4JJGA 3ECSA 4U5CE 3B0UX 1M57C 1MMNA 1MNDA 3NG1A 4EWCA 3EZIA 2NUTB 2WVQA 2NUPA 4A2NB 2OG2A 1OKKA 2EIMC 4Q5SF 1OCOC 2XXAA 3KKBA 1ZYRF 3WG7C 1VOMA 3RIPA 3S0XA 4BJ1A 3AQCA 3E9VA 2IYLD 4AE4A 4MQ9F 2CDQA 2IOQA 3HLZA 4ANJA 2PX3A 2A1DD 3W2VA 2KGOA 3AG4C 3LLKA 3UR3C 2J0XA 2DYSC 3I5PA 2R7WA 5DS6A 4Q4ZF 2HV6A 3FAJA 3K1HA 3EGDA 5FCLA 4K7BA 1LVKA 3LESA 3NRHA 1QLEC 4E7ZA 3ZVRA 2EIKC 4J32B 4PJNA 3RH3A 4GYTA 3EJNA 4BEJA 3FHDA 1S7ZA 4YWQA 3DXJF 5T3TA 4G0HA 3LEVA 2R7XA 3JSZA 3O39A 3K1IC 1M2VA 5DLJA 5L3VA 3DJNB 3X2QC 3Q7LA 2Q9AA 3HTKC 2EINC 2BE5F 4JURI 4JW1A 3POVA 3ITFA 4HFKB 4CS8C 2D5RB 2J9VA 1NG1A 3NYMA 4K0DA 2G3KA 2Y39A 3B0PA 3SNHA 1JPNA 2P6VA 5KYWB 2H7BA 1PD1A 5T1DB 1TWHA 4LERA 4DVYP 1G8XA 3RFYA 2A6HF 3DAFA 3LJBA 4BJ5C 2Q9BA 1FTSA 1NZEA 2J45A 3F46A 4O6MA 4CS9C 3SP1A 4FESA 2H7VC 3WODF 1TWGA 4YT5A 2V26A 2GFHA 3LS1A 2IXNA 1LS1A 1OCZC 2Y3HA 3LLIA 2W4MA 4FX5A 5CI8A 5DS4A 1NU9C 3N2ZB 4XLPF 3ABKC 3LS0A 4PFPA 1TWAA 3S27A 4PJLA 1ZHYA 3B9QA 5B1BC 1BR2A 4PFOA 5D92A 4DOZA 3AG1C 2H7OA 3SEOA 1ZU5A 3LAYA 5DQTA 3DZAA 3MLGA 1BR1A 2KNHA 3EGXB 2FGYA 1M56C 5B1AC 4ZLCA 3S28A 4C3BA 2R7SA 2I8BA 3NKDA 1MMDA 3S29A 4BJ6A 4OD4A 1MMGA 3UMKA 4PJMA 1Z63A 2OCCC 2IXMA 4U5EE 2Y3GA 4U5FE 4EBBA 3UNGC 3ZIBA 4QDLA 4CSAC 3EFOA 5F5FA 2Y3DA 1IW7F 4U5GA 5B3SC 1D0ZA 5DS5A 4QI2A 4CBEA 3TD7A 3EPVA 2MWQA 3DAGA 3H65A 4LACB 3UMIA 2CNWD 2WZGA 2ZXOA 4KNWA 4YT2A 1Z6AA 3AG3C 2A69F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYK A;  2MWQ A;  3LS1 A;  3ZSU A;  3RFY A;  3JCU Q;  3LS0 A;  1NZE A; 
#chains in the Genus database with same CATH topology
 3BRJ A;  2CYD A;  1MMA A;  2L9J A;  3EHN A;  1BR4 A;  2LSE A;  3GM1 A;  3PHF 2;  2KYH A;  2HSQ A;  2W4B A;  2R7R A;  4I1M A;  2J8W A;  2R7V A;  3CAX A;  1R5I D;  3K7D A;  1ZU4 A;  5GPG B;  4XPX A;  5KYU B;  5A6K A;  1U6H A;  4MVU A;  4I44 A;  4WJ0 A;  1KU2 A;  1CGM E;  1E85 A;  3CSK A;  3QZC A;  4NQF A;  2IBF A;  4Z9J A;  2XL4 A;  2CNW A;  2R7Q A;  4O7G A;  1MQV A;  4FAP B;  2NUT A;  2WZF A;  1YA9 A;  2MHR A;  2A68 F;  4YT8 A;  2YL1 A;  4AL1 A;  3CZ6 A;  1D1A A;  5AGF A;  3R7C A;  3C63 A;  4JVS A;  2W9Y A;  2KC3 A;  3M4B A;  3R2P A;  1OCR C;  4O6Y A;  2FAP B;  1ORY A;  5DQZ A;  3HNL A;  2P7V A;  5COG A;  5L0G A;  3ASN C;  4FWV A;  5AC5 A;  3QMK A;  2BL2 A;  1VYI A;  5KYX B;  1JPJ A;  2C04 A;  3DJU B;  1PD0 A;  1TKN A;  2YLI A;  3US6 A;  1WTY A;  1OW8 A;  3QW1 A;  4J30 B;  2LQG A;  1J8M F;  3GWN A;  1ZHW A;  1O87 A;  1D0X A;  3L34 A;  3U3B A;  4P6I C;  3WAQ A;  2ASR A;  4CIH A;  2UUI A;  4BEM J;  4OIQ F;  2JD3 A;  1FMW A;  1SR2 A;  1FFT C;  2PF4 E;  1W2W A;  2F22 A;  2YEV A;  3DM5 A;  3DMD A;  3K33 A;  2YLG A;  1I4Z A;  4N06 A;  3RQE A;  3S9O A;  1BBH A;  4GQH A;  5KYN A;  3JRM O;  4IRU A;  4PAC A;  4CIP A;  3EG9 B;  1RMV A;  4KBL A;  1IZM A;  5KYY B;  2Z15 A;  3GM2 A;  3WHN A;  2LFF A;  1M6T A;  1KNY A;  3JCU Q;  4ER9 A;  2RD9 A;  4JZA A;  4OIO F;  2YQY A;  1CGN A;  1Z5Z A;  4E17 A;  4E7S A;  3ZTM A;  1UFB A;  1AVO B;  1RXQ A;  1LKX A;  3QVZ A;  4OIR F;  2GA0 A;  3AGT A;  3C62 A;  3Q6M A;  2XLH A;  2TMV P;  3T6G B;  1QZX A;  2M4E A;  4JKV A;  3QTH A;  5HSW A;  4G7Z F;  4X0R A;  3KYJ A;  4W8K A;  2JPU A;  3ZQY A;  1Z3I X;  5F28 E;  3V5X A;  2IM8 A;  1U0B B;  5E3A A;  3IHU A;  2ZXP A;  1SF8 A;  2PX0 A;  2QY9 A;  4U9D A;  3OWT A;  4G7H F;  4MW8 A;  1AEP A;  3W8H A;  3UGP A;  2GWW A;  1ZW2 A;  3IQC A;  2NSG A;  3EQL F;  1YJG A;  1R4T A;  4O79 A;  4P9T A;  4C7O B;  3ZQV A;  5B3I A;  1C17 M;  2EPK X;  1T6I A;  5L0C A;  4IJJ A;  3LUT B;  2C03 A;  1RCP A;  3KL4 A;  4LLE A;  4MVS A;  5L0I A;  1D1B A;  1Z23 A;  3SYN A;  4LLC A;  3S90 A;  4HE8 D;  2WL8 A;  1Y4C A;  2R9R B;  2QNL A;  4N6H A;  4WGY A;  2DGJ A;  3GOD A;  1D1C A;  3TK0 A;  4B6I A;  5EGY A;  1EQ1 A;  3K6B A;  2EIJ C;  4Z9H A;  1XZP A;  1VMA A;  1CPQ A;  1K04 A;  3MYF A;  4LDK A;  4YL0 A;  4DBQ A;  3F47 A;  4RBN A;  4AL0 A;  1SYQ A;  4JEB A;  2KQ9 A;  2Y3B A;  4AK9 A;  3VF0 A;  4E0I A;  2EPO A;  2EPN A;  3EH1 A;  3V5Z A;  3AJM A;  3U5S A;  3RYL A;  2CCY A;  1VYK A;  4I1O B;  3T6J A;  2J9B A;  4EHP A;  4LDQ A;  3TUL A;  3A11 A;  4KC9 A;  4AX2 A;  4YL1 A;  1E83 A;  2R7T A;  1ORJ A;  3LNR A;  1ZZP A;  4RDA A;  2CW0 F;  4HEA J;  2XS8 A;  2XLM A;  3HJC A;  3NKE A;  5EK0 A;  3KMI A;  1TQG A;  1QQ3 A;  1RKE A;  5D91 A;  3ABM C;  4XPW A;  3EH2 A;  2OKU A;  2L81 A;  2OJQ A;  2Q4F A;  2XLW A;  2A0U A;  4EUK B;  2NUP B;  1H9T A;  3RQF A;  4MTG A;  3HNI A;  2J0W A;  4O6N A;  1GM5 A;  1NBB A;  3VAY A;  4OIP F;  2ZXR A;  2XS1 A;  5L0J A;  4EIY A;  3JTL O;  2HKV A;  4YJW A;  2I15 A;  1I5N A;  3JRT A;  2XXA B;  1HY5 A;  3RQG A;  2QLA A;  1FFH A;  3T6B A;  4XLN F;  4CS7 A;  5DVW A;  1LI5 A;  4AE4 B;  1WAS A;  3C8G D;  3PMR A;  3L0I A;  1D0Y A;  3W8I A;  3UMH A;  5JSL A;  3U3F A;  1E84 A;  4NTA A;  4ONS A;  4OD5 A;  1ZHZ A;  2PBE A;  3M1C B;  4IAO A;  1C02 A;  4PK4 A;  1RJ9 A;  2LIG A;  1UG7 A;  5A6A A;  4CJO A;  3K1I A;  3NMK A;  5BUO A;  3MX3 A;  3EGX A;  5L0F A;  2R7O A;  1QVX A;  3IPM O;  1FMV A;  3DE8 A;  4A4A A;  4KI2 A;  4MVR A;  4RD9 A;  1LE2 A;  3U9J A;  1NU7 D;  2YL0 A;  2HUJ A;  2ICW G;  5L3Q A;  2ETS A;  4JCZ A;  4N4W A;  2WB7 A;  4CS8 A;  3FDQ A;  1JAF A;  3DI5 A;  4JJF A;  3NYL A;  2EIL C;  3EGD B;  4XEK A;  2HS5 A;  5E3C A;  4D4N A;  5BQH A;  4G7O F;  2HJ3 A;  5EHH A;  3C8G A;  1WAT A;  2Y69 C;  3SZR A;  4JEA A;  4MVQ A;  3HKK A;  2G62 A;  2IXP A;  1NFO A;  1VLT A;  3O10 A;  4Z9I A;  3JZ0 A;  3U8V A;  2KW3 C;  2OEX A;  3O6X A;  2XSE A;  4Q7C A;  3NYJ A;  3GOR A;  5K0I A;  2AWC A;  3JT1 A;  3I5Q A;  4GEH A;  1F1M A;  4DBR A;  4DJ9 A;  4F4B A;  5A6B D;  4IWB A;  4BJ5 A;  3X1O A;  1ST6 A;  2VH3 A;  1NLX A;  2YRF A;  3ZSU A;  4DVZ A;  2VB6 A;  1M2V B;  2KSF A;  2UUH A;  3ASO C;  3JYH A;  4CDV A;  4CS9 A;  3I4U A;  3C7J A;  2Q9C A;  4BJ6 C;  3PCV A;  2W45 A;  4XWJ A;  2VAS A;  2NSF A;  3FMS A;  3SXZ A;  5F5H A;  5A69 A;  1TFK B;  5JS5 A;  3Q6N A;  1C03 A;  1M2O A;  1VK5 A;  1GS9 A;  3M4C A;  3SXK A;  4CDA A;  4BG0 A;  1GQA A;  1T5O A;  4W8P A;  3RW0 A;  3EZH A;  1EI7 A;  2P0N A;  4JE9 A;  3K66 A;  2DYR C;  1L7C A;  1ZHT A;  4DRJ B;  1T6U A;  1YDI A;  5CI9 A;  2PP4 A;  1SZI A;  4H4K C;  5T3W A;  3L1M A;  5FZT A;  5KYU A;  4YT4 A;  1XWJ A;  2G3V A;  3Q7G A;  3E70 C;  2L6H A;  1U89 A;  3OEO A;  2HMQ A;  2Q3T A;  3U0C A;  1OCC C;  3QW0 A;  3FAP B;  5E2Q A;  2ZPA A;  2X0C A;  1O5H A;  4YN0 B;  1TFO B;  1EA8 A;  2NG1 A;  3H2U A;  3U2M A;  3AQB A;  3KH2 A;  3W2W A;  4CJG A;  3N24 A;  4U5D E;  3TJ5 A;  3GM3 A;  3J06 A;  3BEH A;  1H6G A;  3B0V C;  1V74 B;  2VCC A;  1OW7 A;  4K1O A;  3ZC4 A;  1OW6 A;  3EHM A;  1LS4 A;  2ZXW C;  1LI7 A;  3G4X A;  4IAQ A;  3T4R A;  3MFN A;  1K40 A;  1J8Y F;  5KYX A;  2BC5 A;  2YL7 A;  4MVZ A;  2XRH A;  2V3C C;  4U5H A;  2LD6 A;  1V55 C;  4CSA A;  4OIN F;  5JVE A;  2CGE A;  3GEH A;  3N0T A;  1YZC A;  2Q00 A;  4J7T A;  2HZ8 A;  4XPY A;  4ZLD A;  4ULW A;  4HFF B;  2WZL A;  2IXO A;  1A7V A;  2WVN A;  4XTK A;  2L6F A;  1LIH A;  2E87 A;  1E86 A;  3GAN A;  3ATP A;  1K05 A;  2QTV A;  5IY5 C;  3FXH A;  3C8Z A;  4JTD B;  4MVO A;  1HW2 A;  3EG9 A;  2ZD9 A;  4JCH A;  4YL3 A;  1TWC A;  5KYY A;  3CEX A;  2YHS A;  3G50 A;  1ZHX A;  3FVY A;  4MVM A;  4BJT A;  3FOP A;  4NY3 A;  5KYW A;  3V5Y A;  2MYS A;  3TOL A;  2OOC A;  4KNV A;  4EBJ A;  1RKE B;  1A41 A;  1ORS C;  1T6Q A;  2J46 A;  2OJE D;  4G78 A;  5AC4 A;  3NDB B;  3IQ5 A;  2R7U A;  3ZG1 A;  1Y6D A;  1WGW A;  1G4W R;  3AG2 C;  3NMJ A;  2L7A A;  4QI0 A;  1HE9 A;  2R03 A;  2WVO A;  3IEE A;  2J9U A;  1JMW A;  2A6E F;  2J7P D;  3DD7 A;  3EFO B;  1EKY A;  3HNJ A;  4JC7 A;  4PJJ A;  2KK1 A;  3CQZ A;  2PFD A;  4WGZ A;  2FFH A;  2R25 A;  1T01 A;  2HV7 A;  1TR2 A;  1YYX A;  1Q0D A;  1CPR A;  1G4U S;  4MTF A;  4XEF A;  4NTB A;  1N1C A;  3RKO F;  4DRI B;  1FR0 A;  2NPU A;  3VYW A;  4MND A;  4M63 A;  4C7O A;  1MNE A;  1V54 C;  1XZQ A;  2EPM X;  3SXY A;  1OR3 A;  1RJ9 B;  3IQT A;  4JIO A;  2J9W A;  3L8I A;  4P9F A;  4U5B E;  1PCX A;  1LE4 A;  3DM9 B;  4C3E A;  2J7P A;  4L6R A;  3OA1 A;  5BQI A;  2HFI A;  3V7O A;  1SMY F;  2KJG A;  2YVK A;  4ULV A;  5E33 A;  3UGO A;  2O9X A;  4YK5 A;  1YAR O;  1APC A;  1S05 A;  1OKK D;  2P61 A;  3ABL C;  2H8A A;  2X51 A;  4I3M A;  2QUP A;  3VM6 A;  4D4X A;  5A6J A;  3MYI A;  2YZS A;  4UDV A;  2R02 A;  3KYI A;  2B0J A;  3L8J A;  1HMD A;  2XLO A;  1DOW A;  1T9K A;  4C3D A;  1B68 A;  4JJG A;  3ECS A;  2PNO A;  4U5C E;  4XEV A;  1M57 C;  3B0U X;  1MMN A;  3SXM A;  5JUA A;  1MND A;  5L0H A;  1A7E A;  4IB4 A;  3NG1 A;  1BDJ B;  4EWC A;  3M79 A;  1Q0M A;  2DB4 A;  2NUT B;  2QE9 A;  3EZI A;  3ZWI A;  1OXB A;  2WVQ A;  3TOM A;  2LCH A;  3AOU A;  2NUP A;  1G5Z A;  4A2N B;  2YLD A;  4PR9 A;  2OG2 A;  2HJM A;  1OKK A;  2EIM C;  1FNT c;  4JTC B;  3GWL A;  4Q5S F;  3G4Z A;  1OCO C;  3RVY A;  2AWY A;  3KKB A;  2XXA A;  1ZYR F;  3WG7 C;  1VOM A;  3RIP A;  4R32 A;  3S0X A;  4BJ1 A;  4WAB A;  3AQC A;  3E9V A;  1AUE A;  2IYL D;  4AE4 A;  2XL6 A;  4MQ9 F;  1A7D A;  2HSB A;  2CDQ A;  2IOQ A;  3HLZ A;  4ANJ A;  2PX3 A;  2A1D D;  1NSG B;  1V4A A;  4E0H A;  2M64 A;  2B0H A;  1QSP A;  1YZA A;  5HV9 A;  1BZ4 A;  3W2V A;  2A0B A;  1Q0F A;  5JRA A;  2AVK A;  2KGO A;  1A0B A;  3AG4 C;  3LLK A;  3S84 A;  1ZVZ A;  3UR3 C;  3DKA A;  3AGU A;  2J0X A;  1FAP B;  2DYS C;  2EPL X;  3TQO A;  3RVZ A;  3I5P A;  5A6B A;  2R7W A;  4MS2 A;  5DS6 A;  2YL3 A;  4Q4Z F;  1Q0G A;  2HV6 A;  3FAJ A;  3K1H A;  3EGD A;  4EKW A;  5FCL A;  4NC3 A;  1OQC A;  4H54 A;  1CGO A;  2OU6 A;  3M15 A;  1LVK A;  3LES A;  3NRH A;  1QLE C;  4K7B A;  3TJ6 A;  4E7Z A;  3U9M A;  1HMO A;  1YA7 O;  2JX0 A;  2R05 A;  3ZVR A;  2EIK C;  4J32 B;  1I4Y A;  4PJN A;  3RH3 A;  4DRH B;  4GYT A;  2P1A A;  1JRA A;  3EJN A;  4BEJ A;  1Z7Q c;  1S7Z A;  1HE1 A;  3FHD A;  4YWQ A;  3DXJ F;  1LM3 B;  5JT4 A;  5T3T A;  2AU5 A;  2VCA A;  3HNK A;  1QKR A;  3LEV A;  4G0H A;  3UMI A;  2R7X A;  3JSZ A;  3O39 A;  2OQM A;  3K1I C;  5CIV A;  2AP3 A;  1M2V A;  5DLJ A;  5TJ5 E;  3DJN B;  4XQ1 A;  3X2Q C;  3W4Y A;  5L3V A;  3Q7L A;  2Q9A A;  4J7Y A;  3HTK C;  2Q7R A;  2EIN C;  2BE5 F;  1HW1 A;  2YWA A;  4JUR I;  3ITF A;  4JW1 A;  4LDR A;  3POV A;  4E18 A;  4HFK B;  4CS8 C;  2D5R B;  2J9V A;  3O55 A;  1NG1 A;  3NYM A;  2XLE A;  4K0D A;  2G3K A;  2Y39 A;  3B0P A;  1JR8 A;  3SNH A;  1JPN A;  5BQG A;  2P6V A;  5KYW B;  2H7B A;  3ZDL A;  1OXK A;  3LNM B;  3FOO A;  1OR2 A;  1PD1 A;  4CX9 A;  5T1D B;  1TWH A;  4LER A;  4DXW A;  4DVY P;  1G8X A;  3C18 A;  3RFY A;  1YAU O;  2A6H F;  2XLD A;  3DAF A;  3LJB A;  4BJ5 C;  2Q9B A;  1FTS A;  1NZE A;  1YLM A;  1VB5 A;  2XM4 A;  2J45 A;  3F46 A;  4O6M A;  4CS9 C;  3SP1 A;  4FES A;  2H7V C;  3U8P A;  1PV3 A;  1WN0 A;  3WOD F;  1TWG A;  4YT5 A;  2V26 A;  2GFH A;  3LS1 A;  4IGG A;  2DI3 A;  2IXN A;  1LS1 A;  2XL8 A;  3DE9 A;  2VCB A;  3U2L A;  3B29 A;  1OCZ C;  2Y3H A;  3KPH A;  5JLI A;  4EBK A;  2OEV A;  1H9G A;  1L3P A;  2W4M A;  3LLI A;  4FX5 A;  5CI8 A;  5DS4 A;  1NU9 C;  3N2Z B;  3QVY A;  4XLP F;  3ABK C;  3LS0 A;  4PFP A;  5JP7 A;  1YYJ A;  1TWA A;  3S27 A;  4PJL A;  1ZHY A;  1LPE A;  3B9Q A;  3RF3 A;  1QPU A;  5B1B C;  3B71 A;  1BR2 A;  4IAR A;  2LFD A;  4PFO A;  5D92 A;  3MBG A;  2RSE B;  4DOZ A;  3AG1 C;  2H7O A;  3SEO A;  1ZU5 A;  3LAY A;  1JOG A;  1Q0K A;  1VLS A;  5DQT A;  3DZA A;  3MLG A;  4NCQ A;  1H7I A;  1WOL A;  1BR1 A;  2KNH A;  3EGX B;  2FGY A;  1M56 C;  5B1A C;  4U9E A;  4ZLC A;  4CDY A;  3S28 A;  4C3B A;  2R7S A;  2I8B A;  3NKD A;  1MMD A;  3IQ6 A;  3S29 A;  1GGQ A;  256B A;  4BJ6 A;  1WWP A;  1KTM A;  1O3U A;  4OD4 A;  1MMG A;  3UMK A;  2GDC A;  3DWW A;  4PJM A;  1Z63 A;  2OCC C;  1RKC A;  2IXM A;  3C8G B;  4U5E E;  2Y3G A;  2GAQ A;  2YKZ A;  4U5F E;  2D4U A;  3UNG C;  2L6G A;  4EBB A;  3ZIB A;  5L0D A;  1DOV A;  3GEE A;  1ZW3 A;  3JSE O;  4JRZ A;  3PDM P;  1E2X A;  3LEO A;  5COF A;  4QDL A;  2HMZ A;  3EFO A;  4CSA C;  3NMI A;  5F5F A;  2Y3D A;  4JTA B;  1IW7 F;  4U5G A;  4BPM A;  5B3S C;  4MW3 A;  3VRC A;  2VC9 A;  3JYY A;  1D0Z A;  5DS5 A;  1NFN A;  1YVI A;  3H2V A;  4QI2 A;  4CBE A;  3ZTZ A;  4NTF A;  3TD7 A;  3A9C A;  3EPV A;  2MWQ A;  2XLV A;  3DAG A;  3GEI A;  3H65 A;  3T9O A;  4LAC B;  4MTO A;  2LK4 A;  2LP4 A;  2CNW D;  2WZG A;  2XM0 A;  2ZXO A;  4KNW A;  1Z6A A;  4N6C A;  5COM A;  3AG3 C;  4YT2 A;  1VTM P;  2A69 F; 
#chains in the Genus database with same CATH homology
 1MMA A;  2L9J A;  3EHN A;  1BR4 A;  2LSE A;  3PHF 2;  2W4B A;  2R7R A;  4I1M A;  2R7V A;  3K7D A;  1ZU4 A;  5KYU B;  4I44 A;  4WJ0 A;  1KU2 A;  3CSK A;  3QZC A;  2XL4 A;  2CNW A;  2R7Q A;  4O7G A;  2NUT A;  2WZF A;  2A68 F;  4YT8 A;  3CZ6 A;  1D1A A;  4JVS A;  2W9Y A;  1OCR C;  4O6Y A;  5DQZ A;  2P7V A;  3ASN C;  4FWV A;  3QMK A;  1VYI A;  5KYX B;  1JPJ A;  2C04 A;  3DJU B;  1PD0 A;  1TKN A;  4J30 B;  1J8M F;  1ZHW A;  1O87 A;  1D0X A;  3L34 A;  4CIH A;  4P6I C;  4OIQ F;  2JD3 A;  1FMW A;  2PF4 E;  1FFT C;  2YEV A;  1W2W A;  3DM5 A;  3DMD A;  3K33 A;  4N06 A;  5KYN A;  4IRU A;  3EG9 B;  4KBL A;  1IZM A;  5KYY B;  2Z15 A;  3JCU Q;  4JZA A;  4OIO F;  1Z5Z A;  4E7S A;  1LKX A;  4OIR F;  3Q6M A;  1QZX A;  2M4E A;  5HSW A;  4G7Z F;  4X0R A;  4W8K A;  1Z3I X;  5E3A A;  2ZXP A;  1SF8 A;  2PX0 A;  2QY9 A;  3OWT A;  4G7H F;  3W8H A;  3UGP A;  3EQL F;  4O79 A;  4C7O B;  4IJJ A;  4LLE A;  2C03 A;  3KL4 A;  1D1B A;  1Z23 A;  3SYN A;  4LLC A;  4HE8 D;  2WL8 A;  2DGJ A;  3GOD A;  1D1C A;  4B6I A;  5EGY A;  3K6B A;  2EIJ C;  1VMA A;  4DBQ A;  3F47 A;  4RBN A;  2KQ9 A;  2Y3B A;  4AK9 A;  3EH1 A;  3RYL A;  3T6J A;  1VYK A;  4I1O B;  4KC9 A;  4AX2 A;  2R7T A;  3LNR A;  4RDA A;  2CW0 F;  4HEA J;  3HJC A;  3NKE A;  3KMI A;  5D91 A;  3ABM C;  3EH2 A;  2L81 A;  2NUP B;  2J0W A;  4O6N A;  4OIP F;  3VAY A;  2ZXR A;  4YJW A;  3JRT A;  2XXA B;  1FFH A;  3T6B A;  4XLN F;  4CS7 A;  5DVW A;  4AE4 B;  3PMR A;  3L0I A;  1D0Y A;  3W8I A;  3UMH A;  4OD5 A;  1ZHZ A;  3M1C B;  4IAO A;  4PK4 A;  1RJ9 A;  5BUO A;  3MX3 A;  3EGX A;  2R7O A;  4KI2 A;  1FMV A;  4RD9 A;  1NU7 D;  5L3Q A;  2WB7 A;  4CS8 A;  3FDQ A;  4JJF A;  3NYL A;  2EIL C;  3EGD B;  5E3C A;  4G7O F;  5EHH A;  3SZR A;  2Y69 C;  2G62 A;  2IXP A;  2KW3 C;  3O6X A;  2XSE A;  4Q7C A;  3NYJ A;  3JT1 A;  3I5Q A;  4GEH A;  4DBR A;  4F4B A;  4IWB A;  4BJ5 A;  3X1O A;  1ST6 A;  2VH3 A;  4DVZ A;  3ZSU A;  2VB6 A;  1M2V B;  3ASO C;  3JYH A;  4CS9 A;  3I4U A;  2Q9C A;  4BJ6 C;  2W45 A;  4XWJ A;  2VAS A;  5F5H A;  3Q6N A;  1M2O A;  1VK5 A;  4BG0 A;  3EZH A;  3K66 A;  2DYR C;  1ZHT A;  5CI9 A;  2PP4 A;  1SZI A;  4H4K C;  5T3W A;  5KYU A;  4YT4 A;  2G3V A;  3Q7G A;  3E70 C;  3OEO A;  2Q3T A;  1OCC C;  5E2Q A;  2ZPA A;  1O5H A;  4YN0 B;  2NG1 A;  3AQB A;  3KH2 A;  3W2W A;  3N24 A;  4U5D E;  3B0V C;  3ZC4 A;  3EHM A;  2ZXW C;  3T4R A;  1J8Y F;  5KYX A;  2XRH A;  2V3C C;  4U5H A;  1V55 C;  4CSA A;  4OIN F;  2CGE A;  3N0T A;  4ZLD A;  4ULW A;  4HFF B;  2WZL A;  2IXO A;  2WVN A;  4XTK A;  2E87 A;  3GAN A;  2QTV A;  5IY5 C;  3EG9 A;  4JCH A;  1TWC A;  5KYY A;  3FVY A;  2YHS A;  1ZHX A;  4BJT A;  5KYW A;  4NY3 A;  2MYS A;  4KNV A;  2J46 A;  3NDB B;  2R7U A;  3ZG1 A;  1WGW A;  3AG2 C;  4QI0 A;  2WVO A;  3IEE A;  2J9U A;  2A6E F;  2J7P D;  3DD7 A;  3EFO B;  4PJJ A;  3CQZ A;  2PFD A;  2FFH A;  2HV7 A;  1TR2 A;  3RKO F;  1N1C A;  3VYW A;  4MND A;  4M63 A;  4C7O A;  1MNE A;  1V54 C;  1RJ9 B;  2J9W A;  4U5B E;  1PCX A;  3DM9 B;  4C3E A;  2J7P A;  3OA1 A;  3V7O A;  1SMY F;  2KJG A;  5E33 A;  3UGO A;  2O9X A;  1OKK D;  3ABL C;  4I3M A;  2X51 A;  2YZS A;  2B0J A;  4C3D A;  4JJG A;  3ECS A;  4U5C E;  3B0U X;  1M57 C;  1MMN A;  1MND A;  3NG1 A;  4EWC A;  3EZI A;  2NUT B;  2WVQ A;  2NUP A;  4A2N B;  2OG2 A;  1OKK A;  2EIM C;  4Q5S F;  1OCO C;  2XXA A;  3KKB A;  1ZYR F;  3WG7 C;  1VOM A;  3RIP A;  3S0X A;  4BJ1 A;  3AQC A;  3E9V A;  2IYL D;  4AE4 A;  4MQ9 F;  2CDQ A;  2IOQ A;  3HLZ A;  4ANJ A;  2PX3 A;  2A1D D;  3W2V A;  2KGO A;  3AG4 C;  3LLK A;  3UR3 C;  2J0X A;  2DYS C;  3I5P A;  2R7W A;  5DS6 A;  4Q4Z F;  2HV6 A;  3FAJ A;  3K1H A;  3EGD A;  5FCL A;  4K7B A;  1LVK A;  3LES A;  3NRH A;  1QLE C;  4E7Z A;  3ZVR A;  2EIK C;  4J32 B;  4PJN A;  3RH3 A;  4GYT A;  3EJN A;  4BEJ A;  3FHD A;  1S7Z A;  4YWQ A;  3DXJ F;  5T3T A;  4G0H A;  3LEV A;  2R7X A;  3JSZ A;  3O39 A;  3K1I C;  1M2V A;  5DLJ A;  5L3V A;  3DJN B;  3X2Q C;  3Q7L A;  2Q9A A;  3HTK C;  2EIN C;  2BE5 F;  4JUR I;  4JW1 A;  3POV A;  3ITF A;  4HFK B;  4CS8 C;  2D5R B;  2J9V A;  1NG1 A;  3NYM A;  4K0D A;  2G3K A;  2Y39 A;  3B0P A;  3SNH A;  1JPN A;  2P6V A;  5KYW B;  2H7B A;  1PD1 A;  5T1D B;  1TWH A;  4LER A;  4DVY P;  1G8X A;  3RFY A;  2A6H F;  3DAF A;  3LJB A;  4BJ5 C;  2Q9B A;  1FTS A;  1NZE A;  2J45 A;  3F46 A;  4O6M A;  4CS9 C;  3SP1 A;  4FES A;  2H7V C;  3WOD F;  1TWG A;  4YT5 A;  2V26 A;  2GFH A;  3LS1 A;  2IXN A;  1LS1 A;  1OCZ C;  2Y3H A;  3LLI A;  2W4M A;  4FX5 A;  5CI8 A;  5DS4 A;  1NU9 C;  3N2Z B;  4XLP F;  3ABK C;  3LS0 A;  4PFP A;  1TWA A;  3S27 A;  4PJL A;  1ZHY A;  3B9Q A;  5B1B C;  1BR2 A;  4PFO A;  5D92 A;  4DOZ A;  3AG1 C;  2H7O A;  3SEO A;  1ZU5 A;  3LAY A;  5DQT A;  3DZA A;  3MLG A;  1BR1 A;  2KNH A;  3EGX B;  2FGY A;  1M56 C;  5B1A C;  4ZLC A;  3S28 A;  4C3B A;  2R7S A;  2I8B A;  3NKD A;  1MMD A;  3S29 A;  4BJ6 A;  4OD4 A;  1MMG A;  3UMK A;  4PJM A;  1Z63 A;  2OCC C;  2IXM A;  4U5E E;  2Y3G A;  4U5F E;  4EBB A;  3UNG C;  3ZIB A;  4QDL A;  4CSA C;  3EFO A;  5F5F A;  2Y3D A;  1IW7 F;  4U5G A;  5B3S C;  1D0Z A;  5DS5 A;  4QI2 A;  4CBE A;  3TD7 A;  3EPV A;  2MWQ A;  3DAG A;  3H65 A;  4LAC B;  3UMI A;  2CNW D;  2WZG A;  2ZXO A;  4KNW A;  4YT2 A;  1Z6A A;  3AG3 C;  2A69 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...