2GWWA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 99
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2006-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA01
1L7CA 4E18A 1YDIA 1TR2A 1SYQA 2X0CA 2IBFA 1RKEA 1U6HA 4PR9A 4ONSA 1DOWA 2B0HA 4IGGA 3RF3A 3ZDLA 1ST6A 5L0IA 3MYIA 2GWWA 4P9TA 4W8PA 4E17A 1DOVA 3H2VA 2HSQA 5L0FA 3TJ5A 4K1OA 3TJ6A 5L0GA 2GDCA 1T01A 2LQGA 5L0HA 5L0CA 2L7AA 4DJ9A 1RKCA 3H2UA 3S90A 1H6GA 1ZW2A 1ZVZA 4EHPA 5FZTA 1XWJA 1U89A 3T6GB 1ZW3A 5L0DA 1RKEB 1QKRA 3VF0A 5L0JA
chains in the Genus database with same CATH superfamily
3NKDA 4JCHA 1SYQA 2IXNA 2PX0A 3B0PA 4KI2A 1M2OA 1HW2A 3UGOA 2R03A 2VH3A 1U6HA 4ZLDA 3ZIBA 4P9FA 3ZC4A 3ZTZA 2HV7A 1HMOA 4IGGA 4LDQA 4E7ZA 3G50A 1A7VA 5CIVA 2QY9A 3IQ5A 4F4BA 2MYSA 1HMDA 3BEHA 4JE9A 1LS1A 3L34A 1WASA 5COGA 4AK9A 1RXQA 3NMIA 1Q0MA 1WATA 2OEXA 4L6RA 1T9KA 2PP4A 5GPGB 4U5GA 1AVOB 3T6JA 3SXZA 3V5YA 1CPQA 4HFFB 4MTOA 3WAQA 1ZHYA 3B71A 5D92A 2CDQA 2JPUA 4W8KA 4WGZA 4DJ9A 1RKCA 5F5FA 3RIPA 3H2UA 2EPLX 3OA1A 3ZSUA 4JTCB 4AE4B 5EHHA 5FZTA 4G7HF 3KMIA 3K33A 1U89A 1FNTc 2LFDA 3HTKC 2HMZA 3EHNA 3KH2A 1Z23A 1G4WR 1WTYA 2IYLD 2J9BA 4C3DA 2GAQA 2W4MA 1HE1A 3RVZA 3PCVA 1K05A 1H9TA 3O55A 3SZRA 1OR2A 4O6NA 2XLWA 2J7PA 4CIPA 2OEVA 2J46A 2IM8A 1W2WA 4K7BA 2MWQA 2VCBA 1TQGA 4P9TA 1QSPA 5KYUB 2LCHA 3JSEO 1PD0A 4CX9A 1ZU4A 4QI2A 3IPMO 4YL0A 2LQGA 4B6IA 2KSFA 4C3BA 2KQ9A 2DB4A 3H65A 2YVKA 3EFOB 2NUTB 4N6CA 1M2VB 4OINF 3Q6NA 3AQBA 1R5ID 5DQZA 1VLSA 3SEOA 1UFBA 3LLKA 1YZAA 3LESA 1LVKA 1SMYF 5JS5A 1LI7A 2OKUA 1OQCA 4U5FE 1QZXA 4O6YA 4JVSA 5CI9A 4XPXA 2AU5A 4OIOF 4DXWA 4MVZA 1KU2A 1QQ3A 3B0VC 2VC9A 1Z5ZA 1ORYA 3TJ5A 1AUEA 1D1AA 2Y3BA 5L3VA 1WWPA 1IZMA 1F1MA 5KYUA 5E3AA 2PX3A 4JURI 2A68F 3JZ0A 3SYNA 2WVNA 1LM3B 3A9CA 2CCYA 4NC3A 3CSKA 4ULWA 4U5DE 3VRCA 4Q5SF 1NU7D 3S9OA 3NG1A 1O3UA 1NBBA 1Q0KA 1MMAA 1O87A 3C63A 2NUTA 3RQGA 4H4KC 1ZHXA 3EGXA 2J0XA 3QTHA 4XEKA 3ZTMA 1U0BB 1PV3A 3R2PA 1V74B 1I5NA 5HSWA 2WZGA 1OR3A 3JT1A 2YLGA 1RMVA 4BEMJ 3VYWA 4DBQA 4U5EE 1VYIA 4PJLA 3PDMP 3E70C 1O5HA 3G4ZA 4G7OF 2OOCA 1SF8A 3U3FA 1MMGA 1Y6DA 1UG7A 3QW1A 5JVEA 2NSGA 2YL0A 4Z9JA 2P1AA 2NG1A 5HV9A 3DD7A 3U2MA 4BJ6C 5A69A 1CGME 2R7XA 3ZWIA 4BJ5A 3HJCA 4HFKB 3CAXA 2D4UA 3SP1A 1B68A 2R05A 1ORJA 1A7EA 1C03A 1VLTA 2A0BA 3QVZA 4EWCA 2HUJA 1BZ4A 4KC9A 1NU9C 3AGTA 2OU6A 2BE5F 2R7VA 3SNHA 3SXMA 1TR2A 3S28A 3ASOC 3DJUB 3QVYA 2R7UA 2JD3A 1NLXA 2HS5A 4YT8A 2B0HA 1OW7A 2A0UA 2ZXPA 3O6XA 3Q6MA 1K04A 1FMVA 1LIHA 1OW8A 3JYHA 2BL2A 2NUPB 3EPVA 3LEVA 3HNJA 3RKOF 2V26A 4OIQF 4CBEA 1NZEA 3U9JA 3C62A 1T6IA 4CS9A 3RQFA 3JYYA 4JEBA 3CQZA 3GWNA 5L0GA 3HNLA 5COFA 5F28E 5B1BC 1T6QA 3K1IC 3A11A 1RJ9B 2EILC 2YQYA 4JJFA 3UMIA 2IOQA 1D0ZA 4HEAJ 1YZCA 3KKBA 2J9UA 1S7ZA 4JEAA 2OCCC 3EQLF 2HKVA 5E3CA 2XL4A 4YL3A 1V4AA 1YDIA 2YLDA 3ABKC 4JC7A 2KK1A 2OJQA 4DRIB 1TWGA 5BQHA 2HJ3A 3DZAA 1APCA 1N1CA 2J8WA 2H7OA 3K1HA 1TKNA 2I15A 2R9RB 1HW1A 2OQMA 4MVOA 5KYNA 4XEVA 5K0IA 4G7ZF 4JJGA 2NUPA 1MMDA 2R02A 4MVSA 5T3TA 1LS4A 2A69F 3QW0A 4IB4A 2DYSC 3GORA 2QUPA 4GEHA 4E7SA 4PK4A 3U5SA 3WODF 4EUKB 4YWQA 3FAPB 3GODA 3W2VA 3EH1A 4CDAA 1ZW2A 1ZZPA 2MHRA 1ZVZA 2Q7RA 3LNRA 2G62A 2XM0A 4DRHB 5A6AA 1YYXA 1RJ9A 4YK5A 3ABMC 1HY5A 2OJED 1L7CA 4G0HA 4BG0A 3FMSA 3F46A 1Z63A 2A6EF 2YL3A 4MTFA 3B0UX 1KTMA 2I8BA 3LS1A 2RD9A 3RF3A 3UMHA 4ZLCA 2Y69C 4KNVA 3E9VA 4MQ9F 4OD4A 4JRZA 1D1CA 3GM3A 3IEEA 4IRUA 3I5PA 2XLMA 4OD5A 4YT4A 5KYWB 2Q9AA 3RW0A 2XLHA 3LEOA 3LUTB 5DVWA 4BPMA 1BDJB 2DI3A 3X1OA 5BQIA 2XS8A 1KNYA 3NKEA 4NTBA 2R7OA 2EPMX 4O6MA 3M4CA 2R7TA 1BR2A 2IXOA 1D1BA 1FFTC 1HE9A 1LE2A 2J0WA 3C8GB 3HLZA 4AX2A 3DJNB 4U9DA 1I4YA 1V54C 3W2WA 2KC3A 3C7JA 3ECSA 4JTDB 2DGJA 1H7IA 4MVUA 5L0DA 3PHF2 3N24A 3U2LA 4AL0A 3S84A 1FR0A 1BR4A 2FGYA 1IW7F 3JRTA 1JRAA 4AE4A 4Q7CA 4BJTA 5KYWA 4LACB 2OG2A 3W4YA 3DM9B 3LNMB 3OEOA 2J45A 2ZD9A 1OCOC 1JMWA 4G78A 2EINC 1NFOA 4I3MA 2G3KA 2JX0A 3DE8A 3L1MA 3SXKA 4JW1A 2UUHA 3N0TA 3FXHA 2QE9A 5COMA 3K7DA 4ULVA 3H2VA 1H9GA 3FOPA 2HZ8A 3GM2A 1Z7Qc 3AG4C 4YN0B 3LAYA 1Q0FA 1AEPA 1VMAA 2EPNA 4JKVA 2P6VA 4PJJA 3AGUA 2P61A 4J7TA 2CNWD 4I44A 4PFPA 1QVXA 5AC4A 4N06A 3AJMA 3MBGA 2RSEB 1WOLA 3C8GA 4WGYA 1FMWA 5A6BA 2F22A 3EFOA 3W8HA 4IAOA 1NSGB 4E18A 1YA9A 1M2VA 1R4TA 2VCCA 4DVYP 4XLPF 4R32A 1TFOB 4MNDA 3J06A 3HNKA 1L3PA 4C7OB 1E83A 1NG1A 2GFHA 3L8JA 4IAQA 3NYJA 2YZSA 4XPWA 3ZG1A 3EGDB 4CSAA 3ZDLA 3C8ZA 5EGYA 5L0IA 4EIYA 3FVYA 4W8PA 2X51A 2YL1A 1LI5A 2QNLA 3B29A 5E33A 5JSLA 1FTSA 3POVA 1SR2A 1JAFA 1T01A 4N6HA 2XRHA 3W8IA 5KYXB 1JPJA 1J8YF 2YHSA 1G5ZA 4U5CE 3I5QA 3UNGC 3V7OA 1FAPB 2WVOA 4ANJA 2XXAB 2ZXOA 1T5OA 2ZPAA 2CYDA 2C04A 3VM6A 5L0FA 5L0JA 1OCRC 1JPNA 3MFNA 5DQTA 3EH2A 1OXBA 1M56C 3ZQYA 3WHNA 4NTFA 2H8AA 1Z6AA 4MVMA 4J7YA 5D91A 3ITFA 3TK0A 1OCZC 2WL8A 3KL4A 4C7OA 2XL8A 2YEVA 2R25A 4NTAA 2HV6A 4WABA 2WZFA 2AP3A 4CJGA 1EQ1A 2EIJC 1VB5A 3EGDA 2H7BA 3MLGA 4NCQA 5TJ5E 4QI0A 4E0HA 2YWAA 1JR8A 2HSBA 5A6KA 2P7VA 5AGFA 2PNOA 3RVYA 4CS8C 2CNWA 1C02A 2O9XA 4YT5A 2W4BA 1XZQA 2XLEA 2Y39A 3C18A 4BJ6A 3PMRA 3HNIA 4EBJA 1E86A 256BA 2EPKX 2L6GA 2LIGA 2XM4A 3EZHA 3M79A 3EHMA 3UR3C 2EPOA 1G4US 2H7VC 2VCAA 2CGEA 1E85A 3M4BA 2NSFA 3RYLA 3NMKA 4NY3A 3V5ZA 3O10A 4XEFA 3DE9A 4EBBA 3KYJA 3QZCA 3S27A 4DBRA 1YAUO 3AG2C 2W45A 1YLMA 4MS2A 4FESA 5L3QA 4CJOA 2A1DD 3DWWA 2FFHA 2ICWG 4FX5A 1DOVA 1A0BA 1RCPA 2HSQA 3DI5A 4GQHA 3V5XA 5BQGA 1D0YA 4K1OA 3FOOA 4D4XA 2B0JA 2YL7A 3GANA 1EI7A 3LLIA 2DYRC 2LK4A 3IHUA 1TWHA 1XWJA 3T6GB 2YRFA 2ETSA 3AQCA 1LPEA 3B9QA 1YJGA 3TD7A 1MNEA 2KNHA 4YJWA 3TQOA 5AC5A 4LDKA 4J32B 4JTAB 4RD9A 4BJ1A 3JTLO 4PR9A 1OKKA 4Z9HA 3C8GD 5A6BD 3EZIA 4IWBA 1VK5A 2IXMA 2NPUA 4HE8D 1ST6A 2C03A 3MYIA 3Q7LA 1FFHA 4N4WA 3RH3A 2Y3GA 1MNDA 3MX3A 4UDVA 4EKWA 4H54A 1PD1A 2QLAA 4A4AA 3WG7C 2AWCA 3ASNC 3US6A 1EA8A 1OCCC 4U9EA 2W9YA 2GDCA 3RFYA 3CEXA 2L7AA 2WB7A 1A41A 2M4EA 1MMNA 3DAGA 3KYIA 2WZLA 4NQFA 5T3WA 4JCZA 4FWVA 4P6IC 4XQ1A 1H6GA 3ABLC 3TOMA 1OW6A 3S90A 3EG9B 1ZU5A 3AG1C 3LS0A 1GM5A 3JSZA 4PFOA 4A2NB 4ER9A 4RBNA 4XTKA 2KYHA 2G3VA 2M64A 2ZXWC 3O39A 5T1DB 1ZHWA 4X0RA 4EBKA 1OXKA 1ZYRF 2L9JA 1VYKA 5CI8A 3NYMA 2HMQA 2YLIA 2VB6A 5F5HA 2L6FA 4QDLA 2CW0F 1CGOA 1PCXA 2AVKA 4CDVA 5KYYB 1TWCA 1CGNA 3DMDA 1C17M 4PACA 2XLOA 5JUAA 2XLDA 1E84A 5DS5A 3NDBB 2KW3C 5L0CA 3FHDA 4YT2A 5JLIA 4GYTA 1TFKB 5DLJA 4E0IA 4LDRA 3EGXB 1QPUA 3I4UA 1MQVA 1QLEC 2FAPB 2UUIA 3K66A 3LJBA 4CS7A 3U0CA 1ZW3A 1JOGA 1S05A 3X2QC 1EKYA 2PFDA 2HFIA 2L81A 1YA7O 3U3BA 3EG9A 3NRHA 4IARA 4XWJA 3NYLA 3RQEA 4CSAC 3JCUQ 3BRJA 4KBLA 1DOWA 2ZXRA 1T6UA 4U5HA 1WN0A 2J9VA 3HKKA 3AOUA 4J30B 5EK0A 4JIOA 2Y3DA 5FCLA 2Y3HA 3VAYA 1VOMA 4LLEA 4E17A 4M63A 4C3EA 3GEEA 4BEJA 3TULA 5BUOA 5B3IA 4WJ0A 3TJ6A 1M6TA 5KYYA 4KNWA 5L0HA 3U9MA 3T4RA 4BJ5C 2Q4FA 2LSEA 3DAFA 1D0XA 2TMVP 2KGOA 2AWYA 2Z15A 3MYFA 4U5BE 3SXYA 1G8XA 1Q0GA 3FAJA 3S29A 4Z9IA 3G4XA 4PJNA 1RKEB 2Q00A 4FAPB 4CIHA 2Q9CA 3OWTA 5JT4A 4DRJB 2R7QA 4K0DA 1SZIA 3ZQVA 5JRAA 3M1CB 1LKXA 4MVRA 3F47A 3IQCA 1WGWA 3Q7GA 1M57C 3KPHA 4DOZA 1J8MF 2IXPA 4D4NA 3EJNA 1NFNA 1A7DA 4MW3A 3NMJA 2J9WA 2GA0A 1YVIA 2EIMC 4XPYA 4YL1A 1GQAA 2XLVA 4CS9C 3T6BA 2R7WA 2GWWA 2WVQA 1OKKD 2LD6A 3ATPA 4O79A 3T9OA 4MW8A 5B3SC 3CZ6A 2R7SA 1E2XA 3GM1A 3IQ6A 5E2QA 5DS4A 1GS9A 4XLNF 1Q0DA 2D5RB 2R7RA 2HJMA 1LE4A 4MVQA 4O7GA 4LERA 2E87A 4EHPA 3U8VA 3TOLA 1YARO 2YKZA 3JRMO 3FDQA 5KYXA 1I4ZA 4Q4ZF 3VF0A 4DVZA 4OIPF 3GWLA 4JZAA 1YYJA 3L0IA 4OIRF 2V3CC 1GGQA 3DKAA 1Y4CA 3N2ZB 3K6BA 2Q9BA 4RDAA 2IBFA 2X0CA 5A6JA 2XXAA 1RKEA 3M15A 5JP7A 4ONSA 3ZVRA 4IJJA 2XS1A 3AG3C 2LFFA 4PJMA 1TWAA 1Z3IX 1XZPA 3DXJF 1BR1A 3R7CA 2QTVA 5IY5C 2PBEA 1ZHZA 2VASA 2EIKC 3S0XA 1VTMP 4I1OB 2XSEA 5DS6A 2P0NA 3GEIA 2J7PD 2PF4E 3U8PA 4I1MA 2Q3TA 2LP4A 3IQTA 3QMKA 4LLCA 3UMKA 1ZHTA 4CS8A 2BC5A 3L8IA 1K40A 4AL1A 2KJGA 2ASRA 3GEHA 3K1IA 4MTGA 2L6HA 1V55C 2A6HF 2XL6A 5B1AC 3UGPA 4CDYA 1ORSC 3DM5A 1CPRA 1QKRA 1BBHA
chains in the Genus database with same CATH topology
1L7CA 4E18A 1YDIA 1TR2A 1SYQA 2X0CA 2IBFA 1RKEA 1U6HA 4PR9A 4ONSA 1DOWA 2B0HA 4IGGA 3RF3A 3ZDLA 1ST6A 5L0IA 3MYIA 2GWWA 4P9TA 4W8PA 4E17A 1DOVA 3H2VA 2HSQA 5L0FA 3TJ5A 4K1OA 3TJ6A 5L0GA 2GDCA 1T01A 2LQGA 5L0HA 5L0CA 2L7AA 4DJ9A 1RKCA 3H2UA 3S90A 1H6GA 1ZW2A 1ZVZA 4EHPA 5FZTA 1XWJA 1U89A 3T6GB 1ZW3A 5L0DA 1RKEB 1QKRA 3VF0A 5L0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7C A;  4E18 A;  1YDI A;  1TR2 A;  1SYQ A;  2X0C A;  2IBF A;  1RKE A;  1U6H A;  4PR9 A;  4ONS A;  1DOW A;  2B0H A;  4IGG A;  3RF3 A;  3ZDL A;  1ST6 A;  5L0I A;  3MYI A;  2GWW A;  4P9T A;  4W8P A;  4E17 A;  1DOV A;  3H2V A;  2HSQ A;  5L0F A;  3TJ5 A;  4K1O A;  3TJ6 A;  5L0G A;  2GDC A;  1T01 A;  2LQG A;  5L0H A;  5L0C A;  2L7A A;  4DJ9 A;  1RKC A;  3H2U A;  3S90 A;  1H6G A;  1ZW2 A;  1ZVZ A;  4EHP A;  5FZT A;  1XWJ A;  1U89 A;  3T6G B;  1ZW3 A;  5L0D A;  1RKE B;  1QKR A;  3VF0 A;  5L0J A; 
#chains in the Genus database with same CATH topology
 3NKD A;  4JCH A;  1SYQ A;  2IXN A;  2PX0 A;  3B0P A;  4KI2 A;  1M2O A;  1HW2 A;  3UGO A;  2R03 A;  2VH3 A;  1U6H A;  4ZLD A;  3ZIB A;  4P9F A;  3ZC4 A;  3ZTZ A;  2HV7 A;  1HMO A;  4IGG A;  4LDQ A;  4E7Z A;  3G50 A;  1A7V A;  5CIV A;  2QY9 A;  3IQ5 A;  4F4B A;  2MYS A;  1HMD A;  3BEH A;  4JE9 A;  1LS1 A;  3L34 A;  1WAS A;  5COG A;  4AK9 A;  1RXQ A;  3NMI A;  1Q0M A;  1WAT A;  2OEX A;  4L6R A;  1T9K A;  2PP4 A;  5GPG B;  4U5G A;  1AVO B;  3T6J A;  3SXZ A;  3V5Y A;  1CPQ A;  4HFF B;  4MTO A;  3WAQ A;  1ZHY A;  3B71 A;  5D92 A;  2CDQ A;  2JPU A;  4W8K A;  4WGZ A;  4DJ9 A;  1RKC A;  5F5F A;  3RIP A;  3H2U A;  2EPL X;  3OA1 A;  3ZSU A;  4JTC B;  4AE4 B;  5EHH A;  5FZT A;  4G7H F;  3KMI A;  3K33 A;  1U89 A;  1FNT c;  2LFD A;  3HTK C;  2HMZ A;  3EHN A;  3KH2 A;  1Z23 A;  1G4W R;  1WTY A;  2IYL D;  2J9B A;  4C3D A;  2GAQ A;  2W4M A;  1HE1 A;  3RVZ A;  3PCV A;  1K05 A;  1H9T A;  3O55 A;  3SZR A;  1OR2 A;  4O6N A;  2XLW A;  2J7P A;  4CIP A;  2OEV A;  2J46 A;  2IM8 A;  1W2W A;  4K7B A;  2MWQ A;  2VCB A;  1TQG A;  4P9T A;  1QSP A;  5KYU B;  2LCH A;  3JSE O;  1PD0 A;  4CX9 A;  1ZU4 A;  4QI2 A;  3IPM O;  4YL0 A;  2LQG A;  4B6I A;  2KSF A;  4C3B A;  2KQ9 A;  2DB4 A;  3H65 A;  2YVK A;  3EFO B;  2NUT B;  4N6C A;  1M2V B;  4OIN F;  3Q6N A;  3AQB A;  1R5I D;  5DQZ A;  1VLS A;  3SEO A;  1UFB A;  3LLK A;  1YZA A;  3LES A;  1LVK A;  1SMY F;  5JS5 A;  1LI7 A;  2OKU A;  1OQC A;  4U5F E;  1QZX A;  4O6Y A;  4JVS A;  5CI9 A;  4XPX A;  2AU5 A;  4OIO F;  4DXW A;  4MVZ A;  1KU2 A;  1QQ3 A;  3B0V C;  2VC9 A;  1Z5Z A;  1ORY A;  3TJ5 A;  1AUE A;  1D1A A;  2Y3B A;  5L3V A;  1WWP A;  1IZM A;  1F1M A;  5KYU A;  5E3A A;  2PX3 A;  4JUR I;  2A68 F;  3JZ0 A;  3SYN A;  2WVN A;  1LM3 B;  3A9C A;  2CCY A;  4NC3 A;  3CSK A;  4ULW A;  4U5D E;  3VRC A;  4Q5S F;  1NU7 D;  3S9O A;  3NG1 A;  1O3U A;  1NBB A;  1Q0K A;  1MMA A;  1O87 A;  3C63 A;  2NUT A;  3RQG A;  4H4K C;  1ZHX A;  3EGX A;  2J0X A;  3QTH A;  4XEK A;  3ZTM A;  1U0B B;  1PV3 A;  3R2P A;  1V74 B;  1I5N A;  5HSW A;  2WZG A;  1OR3 A;  3JT1 A;  2YLG A;  1RMV A;  4BEM J;  3VYW A;  4DBQ A;  4U5E E;  1VYI A;  4PJL A;  3PDM P;  3E70 C;  1O5H A;  3G4Z A;  4G7O F;  2OOC A;  1SF8 A;  3U3F A;  1MMG A;  1Y6D A;  1UG7 A;  3QW1 A;  5JVE A;  2NSG A;  2YL0 A;  4Z9J A;  2P1A A;  2NG1 A;  5HV9 A;  3DD7 A;  3U2M A;  4BJ6 C;  5A69 A;  1CGM E;  2R7X A;  3ZWI A;  4BJ5 A;  3HJC A;  4HFK B;  3CAX A;  2D4U A;  3SP1 A;  1B68 A;  2R05 A;  1ORJ A;  1A7E A;  1C03 A;  1VLT A;  2A0B A;  3QVZ A;  4EWC A;  2HUJ A;  1BZ4 A;  4KC9 A;  1NU9 C;  3AGT A;  2OU6 A;  2BE5 F;  2R7V A;  3SNH A;  3SXM A;  1TR2 A;  3S28 A;  3ASO C;  3DJU B;  3QVY A;  2R7U A;  2JD3 A;  1NLX A;  2HS5 A;  4YT8 A;  2B0H A;  1OW7 A;  2A0U A;  2ZXP A;  3O6X A;  3Q6M A;  1K04 A;  1FMV A;  1LIH A;  1OW8 A;  3JYH A;  2BL2 A;  2NUP B;  3EPV A;  3LEV A;  3HNJ A;  3RKO F;  2V26 A;  4OIQ F;  4CBE A;  1NZE A;  3U9J A;  3C62 A;  1T6I A;  4CS9 A;  3RQF A;  3JYY A;  4JEB A;  3CQZ A;  3GWN A;  5L0G A;  3HNL A;  5COF A;  5F28 E;  5B1B C;  1T6Q A;  3K1I C;  3A11 A;  1RJ9 B;  2EIL C;  2YQY A;  4JJF A;  3UMI A;  2IOQ A;  1D0Z A;  4HEA J;  1YZC A;  3KKB A;  2J9U A;  1S7Z A;  4JEA A;  2OCC C;  3EQL F;  2HKV A;  5E3C A;  2XL4 A;  4YL3 A;  1V4A A;  1YDI A;  2YLD A;  3ABK C;  4JC7 A;  2KK1 A;  2OJQ A;  4DRI B;  1TWG A;  5BQH A;  2HJ3 A;  3DZA A;  1APC A;  1N1C A;  2J8W A;  2H7O A;  3K1H A;  1TKN A;  2I15 A;  2R9R B;  1HW1 A;  2OQM A;  4MVO A;  5KYN A;  4XEV A;  5K0I A;  4G7Z F;  4JJG A;  2NUP A;  1MMD A;  2R02 A;  4MVS A;  5T3T A;  1LS4 A;  2A69 F;  3QW0 A;  4IB4 A;  2DYS C;  3GOR A;  2QUP A;  4GEH A;  4E7S A;  4PK4 A;  3U5S A;  3WOD F;  4EUK B;  4YWQ A;  3FAP B;  3GOD A;  3W2V A;  3EH1 A;  4CDA A;  1ZW2 A;  1ZZP A;  2MHR A;  1ZVZ A;  2Q7R A;  3LNR A;  2G62 A;  2XM0 A;  4DRH B;  5A6A A;  1YYX A;  1RJ9 A;  4YK5 A;  3ABM C;  1HY5 A;  2OJE D;  1L7C A;  4G0H A;  4BG0 A;  3FMS A;  3F46 A;  1Z63 A;  2A6E F;  2YL3 A;  4MTF A;  3B0U X;  1KTM A;  2I8B A;  3LS1 A;  2RD9 A;  3RF3 A;  3UMH A;  4ZLC A;  2Y69 C;  4KNV A;  3E9V A;  4MQ9 F;  4OD4 A;  4JRZ A;  1D1C A;  3GM3 A;  3IEE A;  4IRU A;  3I5P A;  2XLM A;  4OD5 A;  4YT4 A;  5KYW B;  2Q9A A;  3RW0 A;  2XLH A;  3LEO A;  3LUT B;  5DVW A;  4BPM A;  1BDJ B;  2DI3 A;  3X1O A;  5BQI A;  2XS8 A;  1KNY A;  3NKE A;  4NTB A;  2R7O A;  2EPM X;  4O6M A;  3M4C A;  2R7T A;  1BR2 A;  2IXO A;  1D1B A;  1FFT C;  1HE9 A;  1LE2 A;  2J0W A;  3C8G B;  3HLZ A;  4AX2 A;  3DJN B;  4U9D A;  1I4Y A;  1V54 C;  3W2W A;  2KC3 A;  3C7J A;  3ECS A;  4JTD B;  2DGJ A;  1H7I A;  4MVU A;  5L0D A;  3PHF 2;  3N24 A;  3U2L A;  4AL0 A;  3S84 A;  1FR0 A;  1BR4 A;  2FGY A;  1IW7 F;  3JRT A;  1JRA A;  4AE4 A;  4Q7C A;  4BJT A;  5KYW A;  4LAC B;  2OG2 A;  3W4Y A;  3DM9 B;  3LNM B;  3OEO A;  2J45 A;  2ZD9 A;  1OCO C;  1JMW A;  4G78 A;  2EIN C;  1NFO A;  4I3M A;  2G3K A;  2JX0 A;  3DE8 A;  3L1M A;  3SXK A;  4JW1 A;  2UUH A;  3N0T A;  3FXH A;  2QE9 A;  5COM A;  3K7D A;  4ULV A;  3H2V A;  1H9G A;  3FOP A;  2HZ8 A;  3GM2 A;  1Z7Q c;  3AG4 C;  4YN0 B;  3LAY A;  1Q0F A;  1AEP A;  1VMA A;  2EPN A;  4JKV A;  2P6V A;  4PJJ A;  3AGU A;  2P61 A;  4J7T A;  2CNW D;  4I44 A;  4PFP A;  1QVX A;  5AC4 A;  4N06 A;  3AJM A;  3MBG A;  2RSE B;  1WOL A;  3C8G A;  4WGY A;  1FMW A;  5A6B A;  2F22 A;  3EFO A;  3W8H A;  4IAO A;  1NSG B;  4E18 A;  1YA9 A;  1M2V A;  1R4T A;  2VCC A;  4DVY P;  4XLP F;  4R32 A;  1TFO B;  4MND A;  3J06 A;  3HNK A;  1L3P A;  4C7O B;  1E83 A;  1NG1 A;  2GFH A;  3L8J A;  4IAQ A;  3NYJ A;  2YZS A;  4XPW A;  3ZG1 A;  3EGD B;  4CSA A;  3ZDL A;  3C8Z A;  5EGY A;  5L0I A;  4EIY A;  3FVY A;  4W8P A;  2X51 A;  2YL1 A;  1LI5 A;  2QNL A;  3B29 A;  5E33 A;  5JSL A;  1FTS A;  3POV A;  1SR2 A;  1JAF A;  1T01 A;  4N6H A;  2XRH A;  3W8I A;  5KYX B;  1JPJ A;  1J8Y F;  2YHS A;  1G5Z A;  4U5C E;  3I5Q A;  3UNG C;  3V7O A;  1FAP B;  2WVO A;  4ANJ A;  2XXA B;  2ZXO A;  1T5O A;  2ZPA A;  2CYD A;  2C04 A;  3VM6 A;  5L0F A;  5L0J A;  1OCR C;  1JPN A;  3MFN A;  5DQT A;  3EH2 A;  1OXB A;  1M56 C;  3ZQY A;  3WHN A;  4NTF A;  2H8A A;  1Z6A A;  4MVM A;  4J7Y A;  5D91 A;  3ITF A;  3TK0 A;  1OCZ C;  2WL8 A;  3KL4 A;  4C7O A;  2XL8 A;  2YEV A;  2R25 A;  4NTA A;  2HV6 A;  4WAB A;  2WZF A;  2AP3 A;  4CJG A;  1EQ1 A;  2EIJ C;  1VB5 A;  3EGD A;  2H7B A;  3MLG A;  4NCQ A;  5TJ5 E;  4QI0 A;  4E0H A;  2YWA A;  1JR8 A;  2HSB A;  5A6K A;  2P7V A;  5AGF A;  2PNO A;  3RVY A;  4CS8 C;  2CNW A;  1C02 A;  2O9X A;  4YT5 A;  2W4B A;  1XZQ A;  2XLE A;  2Y39 A;  3C18 A;  4BJ6 A;  3PMR A;  3HNI A;  4EBJ A;  1E86 A;  256B A;  2EPK X;  2L6G A;  2LIG A;  2XM4 A;  3EZH A;  3M79 A;  3EHM A;  3UR3 C;  2EPO A;  1G4U S;  2H7V C;  2VCA A;  2CGE A;  1E85 A;  3M4B A;  2NSF A;  3RYL A;  3NMK A;  4NY3 A;  3V5Z A;  3O10 A;  4XEF A;  3DE9 A;  4EBB A;  3KYJ A;  3QZC A;  3S27 A;  4DBR A;  1YAU O;  3AG2 C;  2W45 A;  1YLM A;  4MS2 A;  4FES A;  5L3Q A;  4CJO A;  2A1D D;  3DWW A;  2FFH A;  2ICW G;  4FX5 A;  1DOV A;  1A0B A;  1RCP A;  2HSQ A;  3DI5 A;  4GQH A;  3V5X A;  5BQG A;  1D0Y A;  4K1O A;  3FOO A;  4D4X A;  2B0J A;  2YL7 A;  3GAN A;  1EI7 A;  3LLI A;  2DYR C;  2LK4 A;  3IHU A;  1TWH A;  1XWJ A;  3T6G B;  2YRF A;  2ETS A;  3AQC A;  1LPE A;  3B9Q A;  1YJG A;  3TD7 A;  1MNE A;  2KNH A;  4YJW A;  3TQO A;  5AC5 A;  4LDK A;  4J32 B;  4JTA B;  4RD9 A;  4BJ1 A;  3JTL O;  4PR9 A;  1OKK A;  4Z9H A;  3C8G D;  5A6B D;  3EZI A;  4IWB A;  1VK5 A;  2IXM A;  2NPU A;  4HE8 D;  1ST6 A;  2C03 A;  3MYI A;  3Q7L A;  1FFH A;  4N4W A;  3RH3 A;  2Y3G A;  1MND A;  3MX3 A;  4UDV A;  4EKW A;  4H54 A;  1PD1 A;  2QLA A;  4A4A A;  3WG7 C;  2AWC A;  3ASN C;  3US6 A;  1EA8 A;  1OCC C;  4U9E A;  2W9Y A;  2GDC A;  3RFY A;  3CEX A;  2L7A A;  2WB7 A;  1A41 A;  2M4E A;  1MMN A;  3DAG A;  3KYI A;  2WZL A;  4NQF A;  5T3W A;  4JCZ A;  4FWV A;  4P6I C;  4XQ1 A;  1H6G A;  3ABL C;  3TOM A;  1OW6 A;  3S90 A;  3EG9 B;  1ZU5 A;  3AG1 C;  3LS0 A;  1GM5 A;  3JSZ A;  4PFO A;  4A2N B;  4ER9 A;  4RBN A;  4XTK A;  2KYH A;  2G3V A;  2M64 A;  2ZXW C;  3O39 A;  5T1D B;  1ZHW A;  4X0R A;  4EBK A;  1OXK A;  1ZYR F;  2L9J A;  1VYK A;  5CI8 A;  3NYM A;  2HMQ A;  2YLI A;  2VB6 A;  5F5H A;  2L6F A;  4QDL A;  2CW0 F;  1CGO A;  1PCX A;  2AVK A;  4CDV A;  5KYY B;  1TWC A;  1CGN A;  3DMD A;  1C17 M;  4PAC A;  2XLO A;  5JUA A;  2XLD A;  1E84 A;  5DS5 A;  3NDB B;  2KW3 C;  5L0C A;  3FHD A;  4YT2 A;  5JLI A;  4GYT A;  1TFK B;  5DLJ A;  4E0I A;  4LDR A;  3EGX B;  1QPU A;  3I4U A;  1MQV A;  1QLE C;  2FAP B;  2UUI A;  3K66 A;  3LJB A;  4CS7 A;  3U0C A;  1ZW3 A;  1JOG A;  1S05 A;  3X2Q C;  1EKY A;  2PFD A;  2HFI A;  2L81 A;  1YA7 O;  3U3B A;  3EG9 A;  3NRH A;  4IAR A;  4XWJ A;  3NYL A;  3RQE A;  4CSA C;  3JCU Q;  3BRJ A;  4KBL A;  1DOW A;  2ZXR A;  1T6U A;  4U5H A;  1WN0 A;  2J9V A;  3HKK A;  3AOU A;  4J30 B;  5EK0 A;  4JIO A;  2Y3D A;  5FCL A;  2Y3H A;  3VAY A;  1VOM A;  4LLE A;  4E17 A;  4M63 A;  4C3E A;  3GEE A;  4BEJ A;  3TUL A;  5BUO A;  5B3I A;  4WJ0 A;  3TJ6 A;  1M6T A;  5KYY A;  4KNW A;  5L0H A;  3U9M A;  3T4R A;  4BJ5 C;  2Q4F A;  2LSE A;  3DAF A;  1D0X A;  2TMV P;  2KGO A;  2AWY A;  2Z15 A;  3MYF A;  4U5B E;  3SXY A;  1G8X A;  1Q0G A;  3FAJ A;  3S29 A;  4Z9I A;  3G4X A;  4PJN A;  1RKE B;  2Q00 A;  4FAP B;  4CIH A;  2Q9C A;  3OWT A;  5JT4 A;  4DRJ B;  2R7Q A;  4K0D A;  1SZI A;  3ZQV A;  5JRA A;  3M1C B;  1LKX A;  4MVR A;  3F47 A;  3IQC A;  1WGW A;  3Q7G A;  1M57 C;  3KPH A;  4DOZ A;  1J8M F;  2IXP A;  4D4N A;  3EJN A;  1NFN A;  1A7D A;  4MW3 A;  3NMJ A;  2J9W A;  2GA0 A;  1YVI A;  2EIM C;  4XPY A;  4YL1 A;  1GQA A;  2XLV A;  4CS9 C;  3T6B A;  2R7W A;  2GWW A;  2WVQ A;  1OKK D;  2LD6 A;  3ATP A;  4O79 A;  3T9O A;  4MW8 A;  5B3S C;  3CZ6 A;  2R7S A;  1E2X A;  3GM1 A;  3IQ6 A;  5E2Q A;  5DS4 A;  1GS9 A;  4XLN F;  1Q0D A;  2D5R B;  2R7R A;  2HJM A;  1LE4 A;  4MVQ A;  4O7G A;  4LER A;  2E87 A;  4EHP A;  3U8V A;  3TOL A;  1YAR O;  2YKZ A;  3JRM O;  3FDQ A;  5KYX A;  1I4Z A;  4Q4Z F;  3VF0 A;  4DVZ A;  4OIP F;  3GWL A;  4JZA A;  1YYJ A;  3L0I A;  4OIR F;  2V3C C;  1GGQ A;  3DKA A;  1Y4C A;  3N2Z B;  3K6B A;  2Q9B A;  4RDA A;  2IBF A;  2X0C A;  5A6J A;  2XXA A;  1RKE A;  3M15 A;  5JP7 A;  4ONS A;  3ZVR A;  4IJJ A;  2XS1 A;  3AG3 C;  2LFF A;  4PJM A;  1TWA A;  1Z3I X;  1XZP A;  3DXJ F;  1BR1 A;  3R7C A;  2QTV A;  5IY5 C;  2PBE A;  1ZHZ A;  2VAS A;  2EIK C;  3S0X A;  1VTM P;  4I1O B;  2XSE A;  5DS6 A;  2P0N A;  3GEI A;  2J7P D;  2PF4 E;  3U8P A;  4I1M A;  2Q3T A;  2LP4 A;  3IQT A;  3QMK A;  4LLC A;  3UMK A;  1ZHT A;  4CS8 A;  2BC5 A;  3L8I A;  1K40 A;  4AL1 A;  2KJG A;  2ASR A;  3GEH A;  3K1I A;  4MTG A;  2L6H A;  1V55 C;  2A6H F;  2XL6 A;  5B1A C;  3UGP A;  4CDY A;  1ORS C;  3DM5 A;  1CPR A;  1QKR A;  1BBH A; 
#chains in the Genus database with same CATH homology
 1L7C A;  4E18 A;  1YDI A;  1TR2 A;  1SYQ A;  2X0C A;  2IBF A;  1RKE A;  1U6H A;  4PR9 A;  4ONS A;  1DOW A;  2B0H A;  4IGG A;  3RF3 A;  3ZDL A;  1ST6 A;  5L0I A;  3MYI A;  2GWW A;  4P9T A;  4W8P A;  4E17 A;  1DOV A;  3H2V A;  2HSQ A;  5L0F A;  3TJ5 A;  4K1O A;  3TJ6 A;  5L0G A;  2GDC A;  1T01 A;  2LQG A;  5L0H A;  5L0C A;  2L7A A;  4DJ9 A;  1RKC A;  3H2U A;  3S90 A;  1H6G A;  1ZW2 A;  1ZVZ A;  4EHP A;  5FZT A;  1XWJ A;  1U89 A;  3T6G B;  1ZW3 A;  5L0D A;  1RKE B;  1QKR A;  3VF0 A;  5L0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...