2GWWA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords vinculin
total genus 99
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2006-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA01
1QKRA 3ZDLA 4W8PA 3MYIA 5L0CA 3S90A 1ST6A 1ZVZA 2LQGA 4ONSA 4P9TA 5L0IA 4K1OA 2GDCA 1L7CA 1T01A 5FZTA 3H2UA 3H2VA 2X0CA 1U6HA 1XWJA 1RKEB 1ZW3A 2B0HA 1SYQA 2GWWA 3T6GB 4E18A 5L0GA 2HSQA 4PR9A 1ZW2A 5L0JA 2L7AA 1RKEA 3VF0A 1DOWA 1H6GA 3TJ6A 5L0FA 1DOVA 4E17A 2IBFA 1TR2A 5L0HA 1YDIA 5L0DA 4EHPA 4IGGA 1U89A 1RKCA 4DJ9A 3RF3A 3TJ5A
chains in the Genus database with same CATH superfamily
1VK5A 2FGYA 2XLWA 4YT5A 4CBEA 5A6KA 1Y6DA 3DMDA 2AU5A 2AWCA 2L9JA 3U5SA 2UUIA 4CSAC 4P9TA 1NLXA 1JPJA 3JSEO 2XRHA 2EILC 4JC7A 3RQGA 1L7CA 1WASA 2D4UA 3BRJA 3C63A 3GORA 3H2UA 5A6JA 1FR0A 1TWAA 2LK4A 1FFHA 3CAXA 3DM9B 3O55A 4YN0B 3W2VA 1FAPB 2KK1A 4JJFA 4H4KC 2LIGA 2PBEA 3TOMA 3V5ZA 1IZMA 4IAQA 2R7OA 2R25A 4DBQA 3NDBB 4NC3A 3K33A 3X1OA 4PK4A 1JRAA 3HNKA 4JZAA 4UDVA 2Q3TA 1QZXA 3GEIA 5L0DA 2HFIA 4E0IA 1OR3A 2EINC 2EPKX 2RSEB 5BUOA 2VH3A 4W8PA 1KNYA 4E7SA 3EG9B 2ZXRA 3GM3A 5T3WA 4KNVA 4YK5A 2HJ3A 1M56C 4PJMA 5JRAA 1WOLA 3U8PA 2ZPAA 2YLGA 4XEFA 3U3BA 1YJGA 4WGZA 3WHNA 1CGME 3HTKC 1YVIA 5E3CA 5KYNA 2L6FA 1MMAA 2IM8A 1PD0A 3AG3C 2NG1A 4Q5SF 3HNIA 2LCHA 2Q00A 4K7BA 1RKEB 1VYKA 3UNGC 4C3EA 4CS8A 2H7VC 5A6AA 2GA0A 1LS1A 1R5ID 3CSKA 3U2MA 1FTSA 4OD4A 1VB5A 2J9VA 4PACA 4MQ9F 3UMIA 2ETSA 3JTLO 4KC9A 1E85A 1OCRC 3BEHA 2EIMC 3N0TA 1Z5ZA 2OOCA 2R02A 3J06A 3LEVA 3RW0A 3V5XA 3ECSA 5A6BA 1VLSA 3RKOF 4BG0A 3IQ6A 5BQIA 5DLJA 2XL8A 3AOUA 3CEXA 2V26A 1JOGA 1LPEA 1OCOC 2OJED 2P7VA 1Q0KA 2Y69C 3EGXB 4JKVA 2Q9AA 2IXPA 3C62A 1A0BA 2P0NA 4PFOA 256BA 1NU9C 3TD7A 1LE4A 2DYSC 4YWQA 2YQYA 4OD5A 2BE5F 1NFOA 1JAFA 1V55C 1GS9A 2J8WA 2LP4A 4JVSA 3K1IC 5DVWA 3NKDA 3QZCA 4YJWA 4M63A 4LDRA 3HNLA 3FMSA 4G78A 3U9MA 3LS0A 4X0RA 2A0BA 2D5RB 4MVSA 4ULVA 2Q9BA 1U89A 3KL4A 4W8KA 4XPXA 2B0JA 1HE9A 2ZXPA 3CQZA 4JCHA 3ZC4A 2IXOA 4ZLCA 3EG9A 2J7PA 3AJMA 5L0CA 4PFPA 1Q0FA 3IPMO 3JYHA 1OKKD 1O5HA 3E70C 3HNJA 3MYFA 1ZU5A 3DJUB 4FESA 3GEHA 2V3CC 5CI8A 1FMWA 3HJCA 1MNEA 3SXYA 3C7JA 2WL8A 1QPUA 2H8AA 2LFFA 4N06A 4QDLA 3RH3A 2HV6A 1LVKA 2LFDA 3L8IA 4DBRA 2J9BA 2VB6A 1ZZPA 3AG4C 4C3DA 4YT8A 4BJ5C 3OA1A 5EHHA 4O7GA 1OCZC 3F46A 3ZVRA 1OR2A 1DOWA 5DS5A 3KMIA 4AL0A 3AQCA 2DB4A 1DOVA 1SMYF 2WVQA 2YL0A 3NMKA 1FMVA 4EHPA 1MNDA 2CNWA 3AG2C 4ANJA 1J8YF 4LDQA 5JVEA 3UGOA 4Z9JA 2AVKA 4XPWA 5F5HA 1OKKA 1AVOB 1YYXA 1Y4CA 1Z6AA 1EA8A 2AP3A 2NUTB 3FVYA 1HW1A 3MYIA 2NUTA 1O87A 1ZHXA 2ASRA 4P9FA 5KYXB 1M2OA 3AGUA 4K1OA 3EJNA 3SP1A 4D4XA 3MFNA 2R03A 1FNTc 1H9TA 5DQZA 1CPRA 2A6EF 2Z15A 2G62A 4MS2A 3IEEA 3U2LA 3W8HA 3W2WA 1U6HA 3NMIA 2XLVA 4E18A 2NPUA 3W8IA 3Q6MA 1ZW2A 3LLIA 4O79A 2DYRC 1NG1A 3ZQYA 4CIHA 5L0FA 3T6BA 3LS1A 3NYMA 2OKUA 3QMKA 5L0HA 2BL2A 2L6HA 3RYLA 2XLDA 4JJGA 1ZU4A 4WABA 1RKCA 2A0UA 2ICWG 2XLMA 4ULWA 3S27A 1HMOA 2G3VA 2EPOA 3ABLC 1A41A 1EQ1A 5COFA 1K05A 3DZAA 2AWYA 2CW0F 3EGDA 2Y3BA 5F28E 2Q4FA 4JTDB 3JRMO 1XZQA 5JUAA 3B0VC 2A1DD 2WZLA 4JCZA 2HSBA 2Q7RA 4XLPF 1PD1A 3UMHA 4NCQA 3CZ6A 4BJTA 2A69F 1BZ4A 1WATA 2IYLD 2YL3A 5B1BC 3U0CA 1YZAA 4CSAA 1CGNA 2HS5A 5DQTA 2OG2A 3C18A 3NRHA 3QVYA 4PJNA 3A11A 4RD9A 1WWPA 3LJBA 2WZGA 2XS8A 2YZSA 3DKAA 2W4MA 4U5GA 4XWJA 2C03A 1G8XA 2IXNA 1OW8A 3UR3C 3ZDLA 1TQGA 2YLIA 3ASOC 1AEPA 5JSLA 2GFHA 2QNLA 2VC9A 1T6UA 2JPUA 4FX5A 1NU7D 3US6A 1CPQA 4BPMA 1QSPA 5D92A 3R7CA 1KTMA 1TWGA 1NFNA 4Q4ZF 1YLMA 2P6VA 4IARA 4H54A 3E9VA 5E3AA 1U0BB 3HKKA 3RVYA 2HUJA 3M4BA 1D0ZA 1JPNA 5DS6A 2P61A 2J0XA 3VF0A 5E33A 1K04A 4CX9A 1VMAA 1E84A 4EWCA 5F5FA 4XEKA 1SZIA 3GWLA 1E86A 3POVA 3O39A 2XM4A 4QI0A 4N6CA 4XLNF 4CDAA 4D4NA 1Z3IX 2A68F 4U5DE 1LI7A 2WB7A 1KU2A 3L34A 1YA7O 4A4AA 4DRHB 5KYWA 4JEAA 3EPVA 1RCPA 2VCBA 3ZTMA 2Y39A 4O6NA 2EPLX 4DVZA 5D91A 5KYUB 3O6XA 1A7EA 1GQAA 2NSGA 4B6IA 4EUKB 5EGYA 1QLEC 3Q7GA 2JD3A 1OW7A 2XXAA 2KW3C 1OCCC 3JCUQ 3VM6A 2HKVA 3ZIBA 3ABMC 1BR1A 1K40A 1ORJA 1BR2A 4YL1A 3S0XA 4JIOA 2GWWA 3QW0A 4R32A 2CYDA 2IOQA 4XEVA 1I5NA 1I4YA 4MVQA 2X51A 3N2ZB 3X2QC 1M2VB 3EHMA 3NKEA 5COGA 5EK0A 2R9RB 5L3QA 1ZHZA 4J30B 2R7TA 2YRFA 5JT4A 3M15A 1I4ZA 2XM0A 1ORYA 2GAQA 2QTVA 1RJ9B 1Z63A 4DJ9A 4OIOF 1UG7A 4EBKA 3I5PA 2I15A 3TJ5A 3UGPA 2Y3HA 1H9GA 4DXWA 1PCXA 1G5ZA 4PJLA 2JX0A 3K1IA 3KYIA 3DD7A 2R05A 5T3TA 3M79A 2CDQA 3Q7LA 1RMVA 4IAOA 2IXMA 3IQCA 4JURI 1OQCA 3AQBA 2DI3A 4I1OB 3DE8A 4DRIB 2QY9A 5JLIA 3PHF2 3LESA 3T6GB 1YAUO 2CGEA 2F22A 2YLDA 1M6TA 4HEAJ 2Q9CA 5AC4A 2XXAB 3V7OA 4MVMA 4CJOA 3DAFA 2Y3DA 4Z9IA 1MMDA 2VASA 1BDJB 3GANA 4YT2A 1EI7A 3DE9A 3JT1A 1F1MA 4CS9A 5KYWB 1YDIA 4O6YA 5TJ5E 2R7UA 4U5FE 1AUEA 4EBBA 3L8JA 1VYIA 3B71A 3B29A 1YARO 4E0HA 3VYWA 4DVYP 1VOMA 4U5CE 1S05A 2J9WA 1T6QA 3LEOA 4J7TA 1LE2A 1QVXA 4U5BE 4CJGA 1HY5A 5L0IA 1RXQA 1T01A 3NYLA 4I3MA 1RJ9A 4OIRF 2ZXOA 4NTFA 5GPGB 1A7VA 4OIQF 4MNDA 4IB4A 3RQFA 3KKBA 4BJ6A 4CIPA 2OEVA 3KH2A 4HFKB 1APCA 4G7ZF 1M57C 1TWHA 4E17A 1PV3A 3JSZA 3R2PA 4MTFA 2R7VA 4CDVA 4F4BA 2L6GA 2MHRA 1Q0DA 4NTAA 3PDMP 4ER9A 2XLOA 2OEXA 2VCAA 4MW8A 1LS4A 3EHNA 2DGJA 3GODA 4OIPF 4GEHA 1L3PA 3G4ZA 5HSWA 3NMJA 5COMA 2KYHA 3ZWIA 1LM3B 5HV9A 5K0IA 4G7HF 1D0XA 1ZVZA 3F47A 4YT4A 2HV7A 4K0DA 4RDAA 5AC5A 4OINF 1LKXA 3IQ5A 1ZHTA 5FZTA 2KSFA 2XLEA 1V4AA 2J46A 3FAJA 1D0YA 1HMDA 4MW3A 3TULA 1TKNA 4A2NB 4C7OA 3I4UA 3RQEA 5KYUA 1WTYA 4EKWA 2OCCC 1BBHA 3PMRA 4AL1A 1D1BA 1WGWA 1RKEA 2L7AA 2LD6A 4U5HA 2E87A 3ABKC 2C04A 3K66A 1O3UA 3IHUA 4LLEA 3T4RA 2R7QA 1TFOB 4G0HA 4GYTA 2P1AA 4C7OB 2UUHA 5BQHA 5JP7A 4AX2A 5L3VA 2TMVP 3QTHA 3EGXA 2YL1A 1G4US 2XL4A 3ZG1A 1XZPA 2XL6A 3FXHA 4WGYA 1MMGA 1YYJA 2YL7A 3L0IA 2LQGA 5JS5A 4JEBA 3LNRA 2YKZA 3EH2A 4YL3A 3EZIA 3MLGA 1SR2A 3UMKA 2FFHA 2X0CA 3VRCA 4RBNA 4I44A 2B0HA 2HMZA 4G7OF 5CI9A 3OEOA 4MVZA 2R7XA 1T6IA 3LNMB 2O9XA 3M1CB 4LDKA 1E2XA 4PR9A 4PJJA 3SXMA 4CS7A 3T9OA 1HE1A 2G3KA 3RIPA 3TJ6A 1H6GA 4J32B 1T5OA 3AG1C 2OQMA 1MQVA 2H7BA 2M4EA 1C02A 1T9KA 2KQ9A 1V54C 3PCVA 3FDQA 3B9QA 5KYYA 3LUTB 4IGGA 5KYXA 4ZLDA 1CGOA 2PX0A 2QUPA 4CS8C 2EPNA 1N1CA 1JMWA 2MWQA 1B68A 2WVNA 2YHSA 4U9EA 4AE4A 5CIVA 2XLHA 3MBGA 1M2VA 3S29A 5E2QA 4JTCB 2J7PD 2W45A 4LACB 5A6BD 3C8GD 3B0UX 3EQLF 1H7IA 2GDCA 1HW2A 3DWWA 2PX3A 1EKYA 4P6IC 2FAPB 4N6HA 5IY5C 3SZRA 3EGDB 4JRZA 3TOLA 3AGTA 3B0PA 5L0GA 4HE8D 4QI2A 3KYJA 3ZTZA 3SEOA 2YWAA 2KC3A 5L0JA 4CDYA 3WODF 3JYYA 3SYNA 2R7RA 3M4CA 3EFOB 2EPMX 2PFDA 1D1CA 1OXKA 1LI5A 1R4TA 3K7DA 4NY3A 3DAGA 4BEMJ 4FAPB 1OXBA 1A7DA 4O6MA 1VTMP 3FOPA 3ZSUA 3LAYA 3OWTA 4Z9HA 1ST6A 2H7OA 3G4XA 3QVZA 3HLZA 4AE4B 1UFBA 2EIKC 1S7ZA 4IJJA 4XQ1A 3K1HA 4XTKA 5BQGA 2ZXWC 2XS1A 2KNHA 4JTAB 5A69A 3DXJF 5KYYB 2W4BA 2OU6A 4MTOA 1MMNA 1ZW3A 3S84A 1SYQA 4BJ6C 1NBBA 3ATPA 1YZCA 3RFYA 5FCLA 3SXKA 2CCYA 1Z23A 3RVZA 3WG7C 4C3BA 2HMQA 2J45A 1GGQA 3VAYA 2J0WA 2PF4E 3C8GB 1C03A 3ITFA 3NYJA 2IBFA 1TR2A 3LLKA 4HFFB 4J7YA 5B1AC 3A9CA 4EBJA 2LSEA 3GM2A 1G4WR 4JW1A 2R7WA 4LERA 5B3SC 3EZHA 1NZEA 3C8GA 1SF8A 3FHDA 3QW1A 4KNWA 2QLAA 1IW7F 4KI2A 2NUPB 2A6HF 3S90A 2W9YA 1WN0A 2J9UA 4E7ZA 4ONSA 1E83A 3EH1A 4FWVA 2PNOA 2CNWD 2KJGA 4Q7CA 4U9DA 4EIYA 3DM5A 3ZQVA 4JE9A 2Y3GA 3H2VA 4LLCA 5T1DB 3U3FA 4KBLA 4DOZA 2HZ8A 3GEEA 2MYSA 1D1AA 3U9JA 2R7SA 1LIHA 2HSQA 4N4WA 4NQFA 2M64A 2PP4A 3S9OA 4IWBA 1YA9A 1TWCA 1OW6A 1ORSC 3FAPB 4XPYA 1ZHYA 5B3IA 2QE9A 2ZD9A 3T6JA 1J8MF 4NTBA 4U5EE 4AK9A 1ZYRF 2I8BA 3TK0A 3WAQA 1QQ3A 1JR8A 3RF3A 4BJ1A 1Z7Qc 1QKRA 3GWNA 4IRUA 3EFOA 4I1MA 1ZHWA 3ASNC 3O10A 3V5YA 3DJNB 2WVOA 4BEJA 2YVKA 4MVRA 3G50A 5AGFA 4WJ0A 2OJQA 1Q0MA 1FFTC 3GM1A 4MVUA 3K6BA 3S28A 2BC5A 4CS9C 3N24A 2WZFA 4YL0A 2HJMA 2NSFA 4MVOA 3DI5A 1TFKB 3SNHA 3H65A 3IQTA 2YEVA 4MTGA 1XWJA 1V74B 3JRTA 2L81A 3C8ZA 3U8VA 1GM5A 1BR4A 2NUPA 3I5QA 3KPHA 1W2WA 3FOOA 4GQHA 4L6RA 4BJ5A 2XSEA 2VCCA 3TQOA 1VLTA 2RD9A 1Q0GA 1C17M 3SXZA 3L1MA 2KGOA 5DS4A 3Q6NA 2EIJC 3NG1A 4DRJB 3JZ0A 3MX3A 1NSGB 3W4YA
chains in the Genus database with same CATH topology
1QKRA 3ZDLA 4W8PA 3MYIA 5L0CA 3S90A 1ST6A 1ZVZA 2LQGA 4ONSA 4P9TA 5L0IA 4K1OA 2GDCA 1L7CA 1T01A 5FZTA 3H2UA 3H2VA 2X0CA 1U6HA 1XWJA 1RKEB 1ZW3A 2B0HA 1SYQA 2GWWA 3T6GB 4E18A 5L0GA 2HSQA 4PR9A 1ZW2A 5L0JA 2L7AA 1RKEA 3VF0A 1DOWA 1H6GA 3TJ6A 5L0FA 1DOVA 4E17A 2IBFA 1TR2A 5L0HA 1YDIA 5L0DA 4EHPA 4IGGA 1U89A 1RKCA 4DJ9A 3RF3A 3TJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKR A;  3ZDL A;  4W8P A;  3MYI A;  5L0C A;  3S90 A;  1ST6 A;  1ZVZ A;  2LQG A;  4ONS A;  4P9T A;  5L0I A;  4K1O A;  2GDC A;  1L7C A;  1T01 A;  5FZT A;  3H2U A;  3H2V A;  2X0C A;  1U6H A;  1XWJ A;  1RKE B;  1ZW3 A;  2B0H A;  1SYQ A;  2GWW A;  3T6G B;  4E18 A;  5L0G A;  2HSQ A;  4PR9 A;  1ZW2 A;  5L0J A;  2L7A A;  1RKE A;  3VF0 A;  1DOW A;  1H6G A;  3TJ6 A;  5L0F A;  1DOV A;  4E17 A;  2IBF A;  1TR2 A;  5L0H A;  1YDI A;  5L0D A;  4EHP A;  4IGG A;  1U89 A;  1RKC A;  4DJ9 A;  3RF3 A;  3TJ5 A; 
#chains in the Genus database with same CATH topology
 1VK5 A;  2FGY A;  2XLW A;  4YT5 A;  4CBE A;  5A6K A;  1Y6D A;  3DMD A;  2AU5 A;  2AWC A;  2L9J A;  3U5S A;  2UUI A;  4CSA C;  4P9T A;  1NLX A;  1JPJ A;  3JSE O;  2XRH A;  2EIL C;  4JC7 A;  3RQG A;  1L7C A;  1WAS A;  2D4U A;  3BRJ A;  3C63 A;  3GOR A;  3H2U A;  5A6J A;  1FR0 A;  1TWA A;  2LK4 A;  1FFH A;  3CAX A;  3DM9 B;  3O55 A;  4YN0 B;  3W2V A;  1FAP B;  2KK1 A;  4JJF A;  4H4K C;  2LIG A;  2PBE A;  3TOM A;  3V5Z A;  1IZM A;  4IAQ A;  2R7O A;  2R25 A;  4DBQ A;  3NDB B;  4NC3 A;  3K33 A;  3X1O A;  4PK4 A;  1JRA A;  3HNK A;  4JZA A;  4UDV A;  2Q3T A;  1QZX A;  3GEI A;  5L0D A;  2HFI A;  4E0I A;  1OR3 A;  2EIN C;  2EPK X;  2RSE B;  5BUO A;  2VH3 A;  4W8P A;  1KNY A;  4E7S A;  3EG9 B;  2ZXR A;  3GM3 A;  5T3W A;  4KNV A;  4YK5 A;  2HJ3 A;  1M56 C;  4PJM A;  5JRA A;  1WOL A;  3U8P A;  2ZPA A;  2YLG A;  4XEF A;  3U3B A;  1YJG A;  4WGZ A;  3WHN A;  1CGM E;  3HTK C;  1YVI A;  5E3C A;  5KYN A;  2L6F A;  1MMA A;  2IM8 A;  1PD0 A;  3AG3 C;  2NG1 A;  4Q5S F;  3HNI A;  2LCH A;  2Q00 A;  4K7B A;  1RKE B;  1VYK A;  3UNG C;  4C3E A;  4CS8 A;  2H7V C;  5A6A A;  2GA0 A;  1LS1 A;  1R5I D;  3CSK A;  3U2M A;  1FTS A;  4OD4 A;  1VB5 A;  2J9V A;  4PAC A;  4MQ9 F;  3UMI A;  2ETS A;  3JTL O;  4KC9 A;  1E85 A;  1OCR C;  3BEH A;  2EIM C;  3N0T A;  1Z5Z A;  2OOC A;  2R02 A;  3J06 A;  3LEV A;  3RW0 A;  3V5X A;  3ECS A;  5A6B A;  1VLS A;  3RKO F;  4BG0 A;  3IQ6 A;  5BQI A;  5DLJ A;  2XL8 A;  3AOU A;  3CEX A;  2V26 A;  1JOG A;  1LPE A;  1OCO C;  2OJE D;  2P7V A;  1Q0K A;  2Y69 C;  3EGX B;  4JKV A;  2Q9A A;  2IXP A;  3C62 A;  1A0B A;  2P0N A;  4PFO A;  256B A;  1NU9 C;  3TD7 A;  1LE4 A;  2DYS C;  4YWQ A;  2YQY A;  4OD5 A;  2BE5 F;  1NFO A;  1JAF A;  1V55 C;  1GS9 A;  2J8W A;  2LP4 A;  4JVS A;  3K1I C;  5DVW A;  3NKD A;  3QZC A;  4YJW A;  4M63 A;  4LDR A;  3HNL A;  3FMS A;  4G78 A;  3U9M A;  3LS0 A;  4X0R A;  2A0B A;  2D5R B;  4MVS A;  4ULV A;  2Q9B A;  1U89 A;  3KL4 A;  4W8K A;  4XPX A;  2B0J A;  1HE9 A;  2ZXP A;  3CQZ A;  4JCH A;  3ZC4 A;  2IXO A;  4ZLC A;  3EG9 A;  2J7P A;  3AJM A;  5L0C A;  4PFP A;  1Q0F A;  3IPM O;  3JYH A;  1OKK D;  1O5H A;  3E70 C;  3HNJ A;  3MYF A;  1ZU5 A;  3DJU B;  4FES A;  3GEH A;  2V3C C;  5CI8 A;  1FMW A;  3HJC A;  1MNE A;  3SXY A;  3C7J A;  2WL8 A;  1QPU A;  2H8A A;  2LFF A;  4N06 A;  4QDL A;  3RH3 A;  2HV6 A;  1LVK A;  2LFD A;  3L8I A;  4DBR A;  2J9B A;  2VB6 A;  1ZZP A;  3AG4 C;  4C3D A;  4YT8 A;  4BJ5 C;  3OA1 A;  5EHH A;  4O7G A;  1OCZ C;  3F46 A;  3ZVR A;  1OR2 A;  1DOW A;  5DS5 A;  3KMI A;  4AL0 A;  3AQC A;  2DB4 A;  1DOV A;  1SMY F;  2WVQ A;  2YL0 A;  3NMK A;  1FMV A;  4EHP A;  1MND A;  2CNW A;  3AG2 C;  4ANJ A;  1J8Y F;  4LDQ A;  5JVE A;  3UGO A;  4Z9J A;  2AVK A;  4XPW A;  5F5H A;  1OKK A;  1AVO B;  1YYX A;  1Y4C A;  1Z6A A;  1EA8 A;  2AP3 A;  2NUT B;  3FVY A;  1HW1 A;  3MYI A;  2NUT A;  1O87 A;  1ZHX A;  2ASR A;  4P9F A;  5KYX B;  1M2O A;  3AGU A;  4K1O A;  3EJN A;  3SP1 A;  4D4X A;  3MFN A;  2R03 A;  1FNT c;  1H9T A;  5DQZ A;  1CPR A;  2A6E F;  2Z15 A;  2G62 A;  4MS2 A;  3IEE A;  3U2L A;  3W8H A;  3W2W A;  1U6H A;  3NMI A;  2XLV A;  4E18 A;  2NPU A;  3W8I A;  3Q6M A;  1ZW2 A;  3LLI A;  4O79 A;  2DYR C;  1NG1 A;  3ZQY A;  4CIH A;  5L0F A;  3T6B A;  3LS1 A;  3NYM A;  2OKU A;  3QMK A;  5L0H A;  2BL2 A;  2L6H A;  3RYL A;  2XLD A;  4JJG A;  1ZU4 A;  4WAB A;  1RKC A;  2A0U A;  2ICW G;  2XLM A;  4ULW A;  3S27 A;  1HMO A;  2G3V A;  2EPO A;  3ABL C;  1A41 A;  1EQ1 A;  5COF A;  1K05 A;  3DZA A;  2AWY A;  2CW0 F;  3EGD A;  2Y3B A;  5F28 E;  2Q4F A;  4JTD B;  3JRM O;  1XZQ A;  5JUA A;  3B0V C;  2A1D D;  2WZL A;  4JCZ A;  2HSB A;  2Q7R A;  4XLP F;  1PD1 A;  3UMH A;  4NCQ A;  3CZ6 A;  4BJT A;  2A69 F;  1BZ4 A;  1WAT A;  2IYL D;  2YL3 A;  5B1B C;  3U0C A;  1YZA A;  4CSA A;  1CGN A;  2HS5 A;  5DQT A;  2OG2 A;  3C18 A;  3NRH A;  3QVY A;  4PJN A;  3A11 A;  4RD9 A;  1WWP A;  3LJB A;  2WZG A;  2XS8 A;  2YZS A;  3DKA A;  2W4M A;  4U5G A;  4XWJ A;  2C03 A;  1G8X A;  2IXN A;  1OW8 A;  3UR3 C;  3ZDL A;  1TQG A;  2YLI A;  3ASO C;  1AEP A;  5JSL A;  2GFH A;  2QNL A;  2VC9 A;  1T6U A;  2JPU A;  4FX5 A;  1NU7 D;  3US6 A;  1CPQ A;  4BPM A;  1QSP A;  5D92 A;  3R7C A;  1KTM A;  1TWG A;  1NFN A;  4Q4Z F;  1YLM A;  2P6V A;  4IAR A;  4H54 A;  3E9V A;  5E3A A;  1U0B B;  3HKK A;  3RVY A;  2HUJ A;  3M4B A;  1D0Z A;  1JPN A;  5DS6 A;  2P61 A;  2J0X A;  3VF0 A;  5E33 A;  1K04 A;  4CX9 A;  1VMA A;  1E84 A;  4EWC A;  5F5F A;  4XEK A;  1SZI A;  3GWL A;  1E86 A;  3POV A;  3O39 A;  2XM4 A;  4QI0 A;  4N6C A;  4XLN F;  4CDA A;  4D4N A;  1Z3I X;  2A68 F;  4U5D E;  1LI7 A;  2WB7 A;  1KU2 A;  3L34 A;  1YA7 O;  4A4A A;  4DRH B;  5KYW A;  4JEA A;  3EPV A;  1RCP A;  2VCB A;  3ZTM A;  2Y39 A;  4O6N A;  2EPL X;  4DVZ A;  5D91 A;  5KYU B;  3O6X A;  1A7E A;  1GQA A;  2NSG A;  4B6I A;  4EUK B;  5EGY A;  1QLE C;  3Q7G A;  2JD3 A;  1OW7 A;  2XXA A;  2KW3 C;  1OCC C;  3JCU Q;  3VM6 A;  2HKV A;  3ZIB A;  3ABM C;  1BR1 A;  1K40 A;  1ORJ A;  1BR2 A;  4YL1 A;  3S0X A;  4JIO A;  2GWW A;  3QW0 A;  4R32 A;  2CYD A;  2IOQ A;  4XEV A;  1I5N A;  1I4Y A;  4MVQ A;  2X51 A;  3N2Z B;  3X2Q C;  1M2V B;  3EHM A;  3NKE A;  5COG A;  5EK0 A;  2R9R B;  5L3Q A;  1ZHZ A;  4J30 B;  2R7T A;  2YRF A;  5JT4 A;  3M15 A;  1I4Z A;  2XM0 A;  1ORY A;  2GAQ A;  2QTV A;  1RJ9 B;  1Z63 A;  4DJ9 A;  4OIO F;  1UG7 A;  4EBK A;  3I5P A;  2I15 A;  3TJ5 A;  3UGP A;  2Y3H A;  1H9G A;  4DXW A;  1PCX A;  1G5Z A;  4PJL A;  2JX0 A;  3K1I A;  3KYI A;  3DD7 A;  2R05 A;  5T3T A;  3M79 A;  2CDQ A;  3Q7L A;  1RMV A;  4IAO A;  2IXM A;  3IQC A;  4JUR I;  1OQC A;  3AQB A;  2DI3 A;  4I1O B;  3DE8 A;  4DRI B;  2QY9 A;  5JLI A;  3PHF 2;  3LES A;  3T6G B;  1YAU O;  2CGE A;  2F22 A;  2YLD A;  1M6T A;  4HEA J;  2Q9C A;  5AC4 A;  2XXA B;  3V7O A;  4MVM A;  4CJO A;  3DAF A;  2Y3D A;  4Z9I A;  1MMD A;  2VAS A;  1BDJ B;  3GAN A;  4YT2 A;  1EI7 A;  3DE9 A;  3JT1 A;  1F1M A;  4CS9 A;  5KYW B;  1YDI A;  4O6Y A;  5TJ5 E;  2R7U A;  4U5F E;  1AUE A;  4EBB A;  3L8J A;  1VYI A;  3B71 A;  3B29 A;  1YAR O;  4E0H A;  3VYW A;  4DVY P;  1VOM A;  4U5C E;  1S05 A;  2J9W A;  1T6Q A;  3LEO A;  4J7T A;  1LE2 A;  1QVX A;  4U5B E;  4CJG A;  1HY5 A;  5L0I A;  1RXQ A;  1T01 A;  3NYL A;  4I3M A;  1RJ9 A;  4OIR F;  2ZXO A;  4NTF A;  5GPG B;  1A7V A;  4OIQ F;  4MND A;  4IB4 A;  3RQF A;  3KKB A;  4BJ6 A;  4CIP A;  2OEV A;  3KH2 A;  4HFK B;  1APC A;  4G7Z F;  1M57 C;  1TWH A;  4E17 A;  1PV3 A;  3JSZ A;  3R2P A;  4MTF A;  2R7V A;  4CDV A;  4F4B A;  2L6G A;  2MHR A;  1Q0D A;  4NTA A;  3PDM P;  4ER9 A;  2XLO A;  2OEX A;  2VCA A;  4MW8 A;  1LS4 A;  3EHN A;  2DGJ A;  3GOD A;  4OIP F;  4GEH A;  1L3P A;  3G4Z A;  5HSW A;  3NMJ A;  5COM A;  2KYH A;  3ZWI A;  1LM3 B;  5HV9 A;  5K0I A;  4G7H F;  1D0X A;  1ZVZ A;  3F47 A;  4YT4 A;  2HV7 A;  4K0D A;  4RDA A;  5AC5 A;  4OIN F;  1LKX A;  3IQ5 A;  1ZHT A;  5FZT A;  2KSF A;  2XLE A;  1V4A A;  2J46 A;  3FAJ A;  1D0Y A;  1HMD A;  4MW3 A;  3TUL A;  1TKN A;  4A2N B;  4C7O A;  3I4U A;  3RQE A;  5KYU A;  1WTY A;  4EKW A;  2OCC C;  1BBH A;  3PMR A;  4AL1 A;  1D1B A;  1WGW A;  1RKE A;  2L7A A;  2LD6 A;  4U5H A;  2E87 A;  3ABK C;  2C04 A;  3K66 A;  1O3U A;  3IHU A;  4LLE A;  3T4R A;  2R7Q A;  1TFO B;  4G0H A;  4GYT A;  2P1A A;  4C7O B;  2UUH A;  5BQH A;  5JP7 A;  4AX2 A;  5L3V A;  2TMV P;  3QTH A;  3EGX A;  2YL1 A;  1G4U S;  2XL4 A;  3ZG1 A;  1XZP A;  2XL6 A;  3FXH A;  4WGY A;  1MMG A;  1YYJ A;  2YL7 A;  3L0I A;  2LQG A;  5JS5 A;  4JEB A;  3LNR A;  2YKZ A;  3EH2 A;  4YL3 A;  3EZI A;  3MLG A;  1SR2 A;  3UMK A;  2FFH A;  2X0C A;  3VRC A;  4RBN A;  4I44 A;  2B0H A;  2HMZ A;  4G7O F;  5CI9 A;  3OEO A;  4MVZ A;  2R7X A;  1T6I A;  3LNM B;  2O9X A;  3M1C B;  4LDK A;  1E2X A;  4PR9 A;  4PJJ A;  3SXM A;  4CS7 A;  3T9O A;  1HE1 A;  2G3K A;  3RIP A;  3TJ6 A;  1H6G A;  4J32 B;  1T5O A;  3AG1 C;  2OQM A;  1MQV A;  2H7B A;  2M4E A;  1C02 A;  1T9K A;  2KQ9 A;  1V54 C;  3PCV A;  3FDQ A;  3B9Q A;  5KYY A;  3LUT B;  4IGG A;  5KYX A;  4ZLD A;  1CGO A;  2PX0 A;  2QUP A;  4CS8 C;  2EPN A;  1N1C A;  1JMW A;  2MWQ A;  1B68 A;  2WVN A;  2YHS A;  4U9E A;  4AE4 A;  5CIV A;  2XLH A;  3MBG A;  1M2V A;  3S29 A;  5E2Q A;  4JTC B;  2J7P D;  2W45 A;  4LAC B;  5A6B D;  3C8G D;  3B0U X;  3EQL F;  1H7I A;  2GDC A;  1HW2 A;  3DWW A;  2PX3 A;  1EKY A;  4P6I C;  2FAP B;  4N6H A;  5IY5 C;  3SZR A;  3EGD B;  4JRZ A;  3TOL A;  3AGT A;  3B0P A;  5L0G A;  4HE8 D;  4QI2 A;  3KYJ A;  3ZTZ A;  3SEO A;  2YWA A;  2KC3 A;  5L0J A;  4CDY A;  3WOD F;  3JYY A;  3SYN A;  2R7R A;  3M4C A;  3EFO B;  2EPM X;  2PFD A;  1D1C A;  1OXK A;  1LI5 A;  1R4T A;  3K7D A;  4NY3 A;  3DAG A;  4BEM J;  4FAP B;  1OXB A;  1A7D A;  4O6M A;  1VTM P;  3FOP A;  3ZSU A;  3LAY A;  3OWT A;  4Z9H A;  1ST6 A;  2H7O A;  3G4X A;  3QVZ A;  3HLZ A;  4AE4 B;  1UFB A;  2EIK C;  1S7Z A;  4IJJ A;  4XQ1 A;  3K1H A;  4XTK A;  5BQG A;  2ZXW C;  2XS1 A;  2KNH A;  4JTA B;  5A69 A;  3DXJ F;  5KYY B;  2W4B A;  2OU6 A;  4MTO A;  1MMN A;  1ZW3 A;  3S84 A;  1SYQ A;  4BJ6 C;  1NBB A;  3ATP A;  1YZC A;  3RFY A;  5FCL A;  3SXK A;  2CCY A;  1Z23 A;  3RVZ A;  3WG7 C;  4C3B A;  2HMQ A;  2J45 A;  1GGQ A;  3VAY A;  2J0W A;  2PF4 E;  3C8G B;  1C03 A;  3ITF A;  3NYJ A;  2IBF A;  1TR2 A;  3LLK A;  4HFF B;  4J7Y A;  5B1A C;  3A9C A;  4EBJ A;  2LSE A;  3GM2 A;  1G4W R;  4JW1 A;  2R7W A;  4LER A;  5B3S C;  3EZH A;  1NZE A;  3C8G A;  1SF8 A;  3FHD A;  3QW1 A;  4KNW A;  2QLA A;  1IW7 F;  4KI2 A;  2NUP B;  2A6H F;  3S90 A;  2W9Y A;  1WN0 A;  2J9U A;  4E7Z A;  4ONS A;  1E83 A;  3EH1 A;  4FWV A;  2PNO A;  2CNW D;  2KJG A;  4Q7C A;  4U9D A;  4EIY A;  3DM5 A;  3ZQV A;  4JE9 A;  2Y3G A;  3H2V A;  4LLC A;  5T1D B;  3U3F A;  4KBL A;  4DOZ A;  2HZ8 A;  3GEE A;  2MYS A;  1D1A A;  3U9J A;  2R7S A;  1LIH A;  2HSQ A;  4N4W A;  4NQF A;  2M64 A;  2PP4 A;  3S9O A;  4IWB A;  1YA9 A;  1TWC A;  1OW6 A;  1ORS C;  3FAP B;  4XPY A;  1ZHY A;  5B3I A;  2QE9 A;  2ZD9 A;  3T6J A;  1J8M F;  4NTB A;  4U5E E;  4AK9 A;  1ZYR F;  2I8B A;  3TK0 A;  3WAQ A;  1QQ3 A;  1JR8 A;  3RF3 A;  4BJ1 A;  1Z7Q c;  1QKR A;  3GWN A;  4IRU A;  3EFO A;  4I1M A;  1ZHW A;  3ASN C;  3O10 A;  3V5Y A;  3DJN B;  2WVO A;  4BEJ A;  2YVK A;  4MVR A;  3G50 A;  5AGF A;  4WJ0 A;  2OJQ A;  1Q0M A;  1FFT C;  3GM1 A;  4MVU A;  3K6B A;  3S28 A;  2BC5 A;  4CS9 C;  3N24 A;  2WZF A;  4YL0 A;  2HJM A;  2NSF A;  4MVO A;  3DI5 A;  1TFK B;  3SNH A;  3H65 A;  3IQT A;  2YEV A;  4MTG A;  1XWJ A;  1V74 B;  3JRT A;  2L81 A;  3C8Z A;  3U8V A;  1GM5 A;  1BR4 A;  2NUP A;  3I5Q A;  3KPH A;  1W2W A;  3FOO A;  4GQH A;  4L6R A;  4BJ5 A;  2XSE A;  2VCC A;  3TQO A;  1VLT A;  2RD9 A;  1Q0G A;  1C17 M;  3SXZ A;  3L1M A;  2KGO A;  5DS4 A;  3Q6N A;  2EIJ C;  3NG1 A;  4DRJ B;  3JZ0 A;  3MX3 A;  1NSG B;  3W4Y A; 
#chains in the Genus database with same CATH homology
 1QKR A;  3ZDL A;  4W8P A;  3MYI A;  5L0C A;  3S90 A;  1ST6 A;  1ZVZ A;  2LQG A;  4ONS A;  4P9T A;  5L0I A;  4K1O A;  2GDC A;  1L7C A;  1T01 A;  5FZT A;  3H2U A;  3H2V A;  2X0C A;  1U6H A;  1XWJ A;  1RKE B;  1ZW3 A;  2B0H A;  1SYQ A;  2GWW A;  3T6G B;  4E18 A;  5L0G A;  2HSQ A;  4PR9 A;  1ZW2 A;  5L0J A;  2L7A A;  1RKE A;  3VF0 A;  1DOW A;  1H6G A;  3TJ6 A;  5L0F A;  1DOV A;  4E17 A;  2IBF A;  1TR2 A;  5L0H A;  1YDI A;  5L0D A;  4EHP A;  4IGG A;  1U89 A;  1RKC A;  4DJ9 A;  3RF3 A;  3TJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...