2GWWA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 99
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2006-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA01
3ZDLA 5L0DA 4W8PA 3MYIA 1SYQA 5L0HA 1ZVZA 1RKEA 1ST6A 3TJ6A 3VF0A 3TJ5A 5L0CA 4DJ9A 1DOVA 2L7AA 4K1OA 4ONSA 3T6GB 3S90A 1U89A 4IGGA 1DOWA 4EHPA 3H2UA 5L0IA 3H2VA 2IBFA 1YDIA 1T01A 4E17A 5L0JA 2GDCA 1QKRA 2B0HA 1XWJA 2X0CA 2LQGA 1TR2A 2HSQA 4P9TA 4PR9A 1ZW3A 4E18A 1RKEB 1ZW2A 5L0FA 1RKCA 3RF3A 2GWWA 1L7CA 1H6GA 5FZTA 5L0GA 1U6HA
chains in the Genus database with same CATH superfamily
2PX0A 1HE1A 1Z23A 2JD3A 2L6FA 1IZMA 1E83A 2A0UA 1V4AA 5COGA 1YLMA 1H9GA 3LEOA 5A6KA 4CS9A 3C7JA 3FOPA 2MYSA 4JEBA 4C3BA 2RSEB 4CIHA 4OD4A 3JYYA 1O3UA 2R7VA 1ORYA 1M57C 3L8JA 3GWNA 1G4WR 2H7BA 1J8YF 3CQZA 4PJJA 1QPUA 5HSWA 2LK4A 2HSQA 1FFHA 3SXZA 2IOQA 4XLNF 3EGDB 2LSEA 3IQTA 3JSEO 4E18A 5AC5A 5L0FA 3IEEA 4L6RA 3TQOA 5DS4A 4CDVA 5A69A 2OG2A 2I8BA 4YT4A 1GGQA 1OCOC 1U6HA 1T5OA 1YVIA 2NG1A 4JZAA 4MVQA 5COFA 2JX0A 4DRJB 1U0BB 3DE8A 3O55A 4I44A 2P7VA 2J7PA 2QTVA 2YWAA 1EQ1A 4IB4A 3VF0A 3NYLA 2KJGA 1OW8A 5AGFA 3V5ZA 1NU7D 3KPHA 2R7XA 3S90A 3KMIA 2Q3TA 1DOWA 1HY5A 4C7OB 4YL1A 4E17A 2DI3A 2BE5F 2HJMA 3QW1A 4U5FE 1LVKA 2A1DD 2XLDA 3F47A 1CPQA 1RJ9A 5T3TA 3UNGC 2KK1A 3TOLA 1LS1A 2WB7A 3DAFA 3RYLA 2XM0A 3DJNB 2NPUA 2OEVA 3LJBA 1T9KA 3ATPA 4D4NA 5JVEA 4LDKA 3EJNA 1H6GA 2CNWD 4YN0B 3NYMA 1TKNA 3WAQA 4E7ZA 4AX2A 3S29A 2H8AA 3CAXA 3RQEA 1SR2A 3M4BA 2H7VC 4MTOA 1WASA 2DB4A 3QTHA 4YK5A 4AK9A 1ZHWA 2Q9BA 2Q9AA 2VH3A 4QI0A 4XTKA 1FTSA 2VCCA 5KYNA 3UGOA 3B0UX 2XL4A 4OIOF 2P6VA 2WL8A 5AC4A 3L34A 4NCQA 3C8GD 1ZHXA 1E2XA 3R7CA 2GDCA 5L0JA 4BJ5C 1YAUO 1UFBA 4JEAA 4Z9IA 2MWQA 1TFOB 4AL1A 5KYXA 3U8VA 2Y39A 1JR8A 2Q00A 3JCUQ 4LDQA 2HKVA 1ORJA 3LLKA 4U5EE 5BQGA 4OIRF 4G7OF 2HFIA 2J9UA 3S9OA 4G7HF 1QQ3A 1CPRA 3GODA 1LI7A 1VLTA 4O79A 1QLEC 4CS8C 3ZDLA 4J30B 4PK4A 3U0CA 1D1BA 2XLMA 1JRAA 2HS5A 1OCRC 2D5RB 3JSZA 3ZWIA 3ABMC 1Z7Qc 1Q0MA 3EFOA 1V55C 4A2NB 2PBEA 3S84A 2J45A 2QUPA 1RJ9B 2ZXRA 3RW0A 2NUPA 1DOVA 2CYDA 3ZSUA 1F1MA 3X1OA 1BR4A 4CSAC 3HNIA 3B0PA 3ECSA 3E70C 2CDQA 3DXJF 1LPEA 2R7UA 2VCBA 2VASA 4MVZA 1K40A 1NG1A 2WVOA 5BQHA 5DQZA 1MMDA 2B0HA 2KC3A 2UUIA 3M1CB 2QLAA 3MYFA 5B1BC 3AGUA 1HW2A 1C02A 4CBEA 1JAFA 3B71A 1LE4A 3FAJA 3MFNA 1BDJB 2YL0A 2KGOA 4KNWA 2R9RB 3KYJA 5JLIA 2EINC 4OIPF 3RH3A 3IQ6A 2EILC 2GAQA 4NTFA 3MBGA 4MQ9F 4R32A 2PF4E 4O6MA 4YT5A 4RD9A 1B68A 5TJ5E 3V5XA 5KYXB 2J8WA 1D0ZA 3U9JA 3EHNA 2R7SA 2IYLD 1TWAA 2YLIA 2ZXWC 3HNKA 4HE8D 4MS2A 1KU2A 4IGGA 3AG1C 2L6HA 4WABA 1T6QA 4U5CE 3POVA 3NG1A 2D4UA 3ZQYA 1OXBA 3M15A 4GQHA 2XLWA 3FHDA 4IJJA 4QDLA 2J9WA 3AG4C 3JTLO 4XLPF 3EFOB 3OEOA 3K1IC 1FMVA 2M64A 3E9VA 2XXAA 4ZLDA 2NUPB 1H7IA 1V74B 5FZTA 4BPMA 5BQIA 1MMGA 3IPMO 2R7TA 5L0DA 2NSFA 1LI5A 3MYIA 1LKXA 1Q0GA 4IWBA 3RQGA 3UR3C 4WGYA 5D92A 4E0IA 1KNYA 5CI9A 2QY9A 1JPNA 1CGOA 1YARO 2R05A 3KL4A 3PCVA 1O87A 3Q7LA 1LIHA 2Y3GA 3RFYA 3C8ZA 1U89A 1RMVA 1Q0DA 2KYHA 5F5HA 3VYWA 1TFKB 2IBFA 4FWVA 4G7ZF 2W4BA 2AVKA 1GS9A 1M6TA 4P9FA 1GQAA 4U5DE 2G62A 3AG3C 3WHNA 3PDMP 3UGPA 2WVNA 2XLVA 4E7SA 1G8XA 2AU5A 3U3BA 1EKYA 2YEVA 4FAPB 1FFTC 2C04A 4K7BA 2GWWA 3I5PA 2V3CC 1ZZPA 2R7WA 1QVXA 2YL1A 3LS0A 4YL3A 5DLJA 3EHMA 1LM3B 1UG7A 3SXYA 1Z3IX 4JURI 4NTBA 3EG9A 4IRUA 5L0CA 2Y3BA 1NFOA 2L7AA 2Y69C 4MTGA 5T1DB 2BL2A 2EIKC 3F46A 1TWGA 2HJ3A 1AEPA 1VMAA 3EGXA 3M4CA 3GEIA 3OWTA 4I3MA 1PV3A 4KBLA 4LLCA 3SEOA 5DS6A 1E84A 4WJ0A 2EIMC 2J7PD 4NTAA 3FDQA 1YDIA 3LNRA 5D91A 3GM1A 2J46A 4DRHB 2XRHA 5JP7A 1D1CA 4JKVA 2FGYA 2AWCA 5KYWB 2EPLX 1R5ID 2F22A 2HMZA 4N06A 3GORA 3AG2C 2VC9A 3FMSA 3K1HA 1WTYA 2WZFA 1AUEA 1LE2A 1PD0A 2A6EF 3R2PA 1SF8A 2R7QA 3T6GB 4CX9A 3K66A 4XPWA 1N1CA 2XS8A 2H7OA 2R7OA 4OIQF 2VB6A 1A41A 3W8IA 2V26A 4U5BE 1VB5A 2JPUA 3O6XA 3MX3A 3ZVRA 1D0XA 4AL0A 1YA7O 2R7RA 2QNLA 3CZ6A 2OJED 1TWHA 3C63A 4JTCB 4BG0A 4YT8A 1Y6DA 3UMHA 3BRJA 3T4RA 2FAPB 2Q9CA 3W8HA 2OJQA 3DJUB 1D1AA 2YZSA 3ASNC 3HTKC 2HV7A 1RCPA 4KI2A 1BR1A 1TQGA 2DYSC 3H65A 4D4XA 1D0YA 4NQFA 2LQGA 2Q4FA 2W9YA 4EBKA 4P9TA 4JJFA 1OKKA 1Y4CA 4O6NA 3EG9B 2YVKA 1NLXA 4G78A 3U2MA 3RF3A 1JOGA 2ICWG 3NMJA 3LLIA 2L81A 4PACA 4YJWA 1RXQA 1Z5ZA 4DOZA 4E0HA 5EHHA 3NMKA 4FX5A 2IXPA 4CIPA 1OR2A 1ZHTA 3B29A 4J7TA 1YYXA 3KYIA 4XEKA 1MMAA 5A6AA 4MVSA 4G0HA 1JPJA 1M2OA 1CGNA 1SZIA 2YLDA 1ZYRF 3HLZA 4ULWA 1FR0A 2XLOA 2Y3HA 4O6YA 4JTAB 4BJ1A 4BEJA 1XZQA 1A7VA 1T01A 4BJ5A 2LFFA 3AJMA 5GPGB 4EUKB 3LESA 3DE9A 1MMNA 4DRIB 1QSPA 3DWWA 5JUAA 2TMVP 1OW7A 2J9VA 3Q6NA 1NSGB 3JRMO 4PR9A 3VM6A 3EH1A 3QVZA 4BJ6C 3L1MA 1OCZC 4QI2A 4OINF 4C3EA 1S05A 1NFNA 2XS1A 4CS8A 1C03A 2CCYA 1O5HA 4ER9A 3SYNA 5HV9A 2YHSA 3T6BA 1J8MF 1RKEA 1E86A 4MVOA 1CGME 3ZC4A 3PMRA 4CSAA 3O39A 4CS7A 2NUTA 256BA 1ORSC 4B6IA 3B0VC 2HMQA 3SNHA 4M63A 4EHPA 3H2UA 5L0IA 5L3QA 4UDVA 1I4YA 2PNOA 4XPYA 4Z9HA 2I15A 1YZAA 1WATA 3UMIA 4W8KA 4XEVA 1OQCA 5CIVA 4CDAA 3S28A 4Q4ZF 1GM5A 2KSFA 3CSKA 1HMOA 5E2QA 1IW7F 3SZRA 1ZW2A 4NC3A 4Z9JA 1BZ4A 2OEXA 2MHRA 4CJOA 3S27A 1A7EA 4BEMJ 2OQMA 3A9CA 4MVRA 2LD6A 1FAPB 1L3PA 3DMDA 1MNDA 4F4BA 4JVSA 3GWLA 1AVOB 4FESA 2FFHA 2L9JA 1WWPA 1YZCA 4W8PA 2A6HF 1WOLA 3EGDA 3RIPA 3AGTA 2XL6A 3N2ZB 2OCCC 1ZVZA 3NKDA 3C62A 4J7YA 3ZG1A 4PFOA 1T6IA 3ASOC 4U5HA 3PHF2 4NY3A 2XM4A 2P61A 2LIGA 4JIOA 4LLEA 1QZXA 1Z6AA 2UUHA 4CS9C 3A11A 3AQCA 3G4ZA 3JRTA 3JZ0A 4YWQA 5DQTA 1G5ZA 1C17M 4MVUA 4U9DA 2WVQA 4PJNA 4RDAA 3U3FA 1FNTc 2XLEA 2WZGA 2R25A 3NDBB 1A0BA 4DBQA 1BBHA 4H54A 3K1IA 3G4XA 1ZW3A 1ZHZA 1RKEB 3ITFA 3U9MA 1MQVA 2R03A 3DZAA 4PFPA 3SXMA 2NUTB 1NZEA 5KYWA 3JT1A 4N6CA 2G3VA 3QW0A 2GA0A 4JCHA 3K33A 2PFDA 4LDRA 4P6IC 5B3SC 4RBNA 2VCAA 1YA9A 2EPKX 1BR2A 3GANA 4JJGA 5E3CA 4DVZA 3EH2A 2X51A 1Q0KA 3NYJA 4IAOA 3US6A 5A6JA 3MLGA 2E87A 3EPVA 3EQLF 3WODF 1EI7A 3X2QC 2LCHA 4EWCA 3U2LA 4C3DA 3QZCA 3H2VA 3RKOF 3Q6MA 1MNEA 3RQFA 5KYYA 2PP4A 2HV6A 3V7OA 3RVZA 2O9XA 2X0CA 3K6BA 2HZ8A 4JRZA 3VRCA 1PCXA 2YL3A 2BC5A 3DD7A 4OD5A 2OU6A 4U9EA 4WGZA 1T6UA 3RVYA 3VAYA 3HJCA 3W4YA 4EIYA 3S0XA 5F5FA 4I1OB 3U8PA 2OOCA 4JC7A 1M56C 1Q0FA 4JCZA 5EGYA 4A4AA 4I1MA 1VOMA 3LUTB 3ABKC 4JTDB 3U5SA 1YJGA 4CJGA 2EPOA 2ZPAA 5IY5C 3KKBA 3IQ5A 2Q7RA 4K0DA 3IHUA 2A0BA 3V5YA 2P1AA 1I5NA 4K1OA 5L3VA 1XZPA 2Z15A 3T9OA 3ZQVA 2YKZA 2DYRC 4J32B 1SMYF 3B9QA 3I4UA 3IQCA 5EK0A 2CNWA 4JE9A 1XWJA 1VTMP 1APCA 1HW1A 2ZD9A 3L8IA 1HMDA 4N6HA 1H9TA 2YLGA 1RKCA 3HNLA 4XQ1A 5COMA 5T3WA 2PX3A 2J9BA 4YL0A 1WN0A 1K05A 2EPNA 2J0XA 3EGXB 2EIJC 2G3KA 5F28E 4CDYA 3CEXA 2RD9A 1OKKD 4KNVA 5CI8A 5KYYB 2W4MA 3C8GA 1ST6A 2GFHA 3LNMB 3TJ6A 4DBRA 1ZU5A 3J06A 3FVYA 4GYTA 2XL8A 2YL7A 2IXNA 1Z63A 3TK0A 4U5GA 2QE9A 4HFKB 3ZIBA 3QVYA 2CGEA 3WG7C 1I4ZA 2A69F 2J0WA 3W2WA 3ZTZA 1QKRA 4DXWA 2NSGA 3N24A 2XXAB 1TR2A 2P0NA 4AE4A 4ULVA 3DM9B 3GEEA 3AQBA 2ZXPA 2CW0F 5JS5A 3ZTMA 5E33A 3NRHA 4Q7CA 2L6GA 1OR3A 4ANJA 3N0TA 4JW1A 5KYUA 1M2VA 5L0GA 3DM5A 2IM8A 1A7DA 3EZHA 1ZU4A 5E3AA 5K0IA 2KNHA 2ASRA 5DVWA 3GEHA 3DAGA 1OXKA 4BJTA 1V54C 3G50A 1OW6A 3T6JA 3UMKA 1G4US 3NKEA 1EA8A 3W2VA 4O7GA 4DVYP 1TWCA 2A68F 2ETSA 3BEHA 2HUJA 4DJ9A 5DS5A 4IAQA 2WZLA 4ONSA 5JRAA 3KH2A 3HNJA 1E85A 2LP4A 5B3IA 4PJLA 3ABLC 2YQYA 3M79A 4XPXA 5B1AC 4YT2A 4MW3A 3K7DA 3TOMA 1VYIA 4X0RA 1R4TA 2Y3DA 4GEHA 1PD1A 3I5QA 4N4WA 4XWJA 5A6BA 1VYKA 2M4EA 3C8GB 4KC9A 1KTMA 4BJ6A 4H4KC 1FMWA 4PJMA 1NU9C 4LACB 4EBJA 4HFFB 4MTFA 4MVMA 1ZHYA 1L7CA 2C03A 5JSLA 4XEFA 3TULA 2ZXOA 3LS1A 4MW8A 1WGWA 1HE9A 5A6BD 2XLHA 4IARA 3L0IA 5JT4A 1SYQA 5L0HA 3NMIA 3C18A 1K04A 1VK5A 3TJ5A 2KW3C 3TD7A 4AE4B 5BUOA 1LS4A 3FOOA 4MNDA 4ZLCA 3AOUA 1YYJA 3QMKA 3JYHA 3Q7GA 4LERA 1OCCC 2IXMA 3GM3A 3DKAA 3EZIA 3OA1A 1M2VB 5KYUB 3DI5A 1JMWA 3FXHA 2B0JA 2XSEA 3LAYA 3FAPB 3SXKA 5FCLA 3HKKA 2R02A 1VLSA 2LFDA 2KQ9A 3O10A 4Q5SF 4EBBA 2DGJA 1W2WA 2HSBA 1S7ZA 4HEAJ 2OKUA 2AWYA 2EPMX 4C7OA 3SP1A 4EKWA 2YRFA 3LEVA 1NBBA 2AP3A 3GM2A 2IXOA 2W45A
chains in the Genus database with same CATH topology
3ZDLA 5L0DA 4W8PA 3MYIA 1SYQA 5L0HA 1ZVZA 1RKEA 1ST6A 3TJ6A 3VF0A 3TJ5A 5L0CA 4DJ9A 1DOVA 2L7AA 4K1OA 4ONSA 3T6GB 3S90A 1U89A 4IGGA 1DOWA 4EHPA 3H2UA 5L0IA 3H2VA 2IBFA 1YDIA 1T01A 4E17A 5L0JA 2GDCA 1QKRA 2B0HA 1XWJA 2X0CA 2LQGA 1TR2A 2HSQA 4P9TA 4PR9A 1ZW3A 4E18A 1RKEB 1ZW2A 5L0FA 1RKCA 3RF3A 2GWWA 1L7CA 1H6GA 5FZTA 5L0GA 1U6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDL A;  5L0D A;  4W8P A;  3MYI A;  1SYQ A;  5L0H A;  1ZVZ A;  1RKE A;  1ST6 A;  3TJ6 A;  3VF0 A;  3TJ5 A;  5L0C A;  4DJ9 A;  1DOV A;  2L7A A;  4K1O A;  4ONS A;  3T6G B;  3S90 A;  1U89 A;  4IGG A;  1DOW A;  4EHP A;  3H2U A;  5L0I A;  3H2V A;  2IBF A;  1YDI A;  1T01 A;  4E17 A;  5L0J A;  2GDC A;  1QKR A;  2B0H A;  1XWJ A;  2X0C A;  2LQG A;  1TR2 A;  2HSQ A;  4P9T A;  4PR9 A;  1ZW3 A;  4E18 A;  1RKE B;  1ZW2 A;  5L0F A;  1RKC A;  3RF3 A;  2GWW A;  1L7C A;  1H6G A;  5FZT A;  5L0G A;  1U6H A; 
#chains in the Genus database with same CATH topology
 2PX0 A;  1HE1 A;  1Z23 A;  2JD3 A;  2L6F A;  1IZM A;  1E83 A;  2A0U A;  1V4A A;  5COG A;  1YLM A;  1H9G A;  3LEO A;  5A6K A;  4CS9 A;  3C7J A;  3FOP A;  2MYS A;  4JEB A;  4C3B A;  2RSE B;  4CIH A;  4OD4 A;  3JYY A;  1O3U A;  2R7V A;  1ORY A;  1M57 C;  3L8J A;  3GWN A;  1G4W R;  2H7B A;  1J8Y F;  3CQZ A;  4PJJ A;  1QPU A;  5HSW A;  2LK4 A;  2HSQ A;  1FFH A;  3SXZ A;  2IOQ A;  4XLN F;  3EGD B;  2LSE A;  3IQT A;  3JSE O;  4E18 A;  5AC5 A;  5L0F A;  3IEE A;  4L6R A;  3TQO A;  5DS4 A;  4CDV A;  5A69 A;  2OG2 A;  2I8B A;  4YT4 A;  1GGQ A;  1OCO C;  1U6H A;  1T5O A;  1YVI A;  2NG1 A;  4JZA A;  4MVQ A;  5COF A;  2JX0 A;  4DRJ B;  1U0B B;  3DE8 A;  3O55 A;  4I44 A;  2P7V A;  2J7P A;  2QTV A;  2YWA A;  1EQ1 A;  4IB4 A;  3VF0 A;  3NYL A;  2KJG A;  1OW8 A;  5AGF A;  3V5Z A;  1NU7 D;  3KPH A;  2R7X A;  3S90 A;  3KMI A;  2Q3T A;  1DOW A;  1HY5 A;  4C7O B;  4YL1 A;  4E17 A;  2DI3 A;  2BE5 F;  2HJM A;  3QW1 A;  4U5F E;  1LVK A;  2A1D D;  2XLD A;  3F47 A;  1CPQ A;  1RJ9 A;  5T3T A;  3UNG C;  2KK1 A;  3TOL A;  1LS1 A;  2WB7 A;  3DAF A;  3RYL A;  2XM0 A;  3DJN B;  2NPU A;  2OEV A;  3LJB A;  1T9K A;  3ATP A;  4D4N A;  5JVE A;  4LDK A;  3EJN A;  1H6G A;  2CNW D;  4YN0 B;  3NYM A;  1TKN A;  3WAQ A;  4E7Z A;  4AX2 A;  3S29 A;  2H8A A;  3CAX A;  3RQE A;  1SR2 A;  3M4B A;  2H7V C;  4MTO A;  1WAS A;  2DB4 A;  3QTH A;  4YK5 A;  4AK9 A;  1ZHW A;  2Q9B A;  2Q9A A;  2VH3 A;  4QI0 A;  4XTK A;  1FTS A;  2VCC A;  5KYN A;  3UGO A;  3B0U X;  2XL4 A;  4OIO F;  2P6V A;  2WL8 A;  5AC4 A;  3L34 A;  4NCQ A;  3C8G D;  1ZHX A;  1E2X A;  3R7C A;  2GDC A;  5L0J A;  4BJ5 C;  1YAU O;  1UFB A;  4JEA A;  4Z9I A;  2MWQ A;  1TFO B;  4AL1 A;  5KYX A;  3U8V A;  2Y39 A;  1JR8 A;  2Q00 A;  3JCU Q;  4LDQ A;  2HKV A;  1ORJ A;  3LLK A;  4U5E E;  5BQG A;  4OIR F;  4G7O F;  2HFI A;  2J9U A;  3S9O A;  4G7H F;  1QQ3 A;  1CPR A;  3GOD A;  1LI7 A;  1VLT A;  4O79 A;  1QLE C;  4CS8 C;  3ZDL A;  4J30 B;  4PK4 A;  3U0C A;  1D1B A;  2XLM A;  1JRA A;  2HS5 A;  1OCR C;  2D5R B;  3JSZ A;  3ZWI A;  3ABM C;  1Z7Q c;  1Q0M A;  3EFO A;  1V55 C;  4A2N B;  2PBE A;  3S84 A;  2J45 A;  2QUP A;  1RJ9 B;  2ZXR A;  3RW0 A;  2NUP A;  1DOV A;  2CYD A;  3ZSU A;  1F1M A;  3X1O A;  1BR4 A;  4CSA C;  3HNI A;  3B0P A;  3ECS A;  3E70 C;  2CDQ A;  3DXJ F;  1LPE A;  2R7U A;  2VCB A;  2VAS A;  4MVZ A;  1K40 A;  1NG1 A;  2WVO A;  5BQH A;  5DQZ A;  1MMD A;  2B0H A;  2KC3 A;  2UUI A;  3M1C B;  2QLA A;  3MYF A;  5B1B C;  3AGU A;  1HW2 A;  1C02 A;  4CBE A;  1JAF A;  3B71 A;  1LE4 A;  3FAJ A;  3MFN A;  1BDJ B;  2YL0 A;  2KGO A;  4KNW A;  2R9R B;  3KYJ A;  5JLI A;  2EIN C;  4OIP F;  3RH3 A;  3IQ6 A;  2EIL C;  2GAQ A;  4NTF A;  3MBG A;  4MQ9 F;  4R32 A;  2PF4 E;  4O6M A;  4YT5 A;  4RD9 A;  1B68 A;  5TJ5 E;  3V5X A;  5KYX B;  2J8W A;  1D0Z A;  3U9J A;  3EHN A;  2R7S A;  2IYL D;  1TWA A;  2YLI A;  2ZXW C;  3HNK A;  4HE8 D;  4MS2 A;  1KU2 A;  4IGG A;  3AG1 C;  2L6H A;  4WAB A;  1T6Q A;  4U5C E;  3POV A;  3NG1 A;  2D4U A;  3ZQY A;  1OXB A;  3M15 A;  4GQH A;  2XLW A;  3FHD A;  4IJJ A;  4QDL A;  2J9W A;  3AG4 C;  3JTL O;  4XLP F;  3EFO B;  3OEO A;  3K1I C;  1FMV A;  2M64 A;  3E9V A;  2XXA A;  4ZLD A;  2NUP B;  1H7I A;  1V74 B;  5FZT A;  4BPM A;  5BQI A;  1MMG A;  3IPM O;  2R7T A;  5L0D A;  2NSF A;  1LI5 A;  3MYI A;  1LKX A;  1Q0G A;  4IWB A;  3RQG A;  3UR3 C;  4WGY A;  5D92 A;  4E0I A;  1KNY A;  5CI9 A;  2QY9 A;  1JPN A;  1CGO A;  1YAR O;  2R05 A;  3KL4 A;  3PCV A;  1O87 A;  3Q7L A;  1LIH A;  2Y3G A;  3RFY A;  3C8Z A;  1U89 A;  1RMV A;  1Q0D A;  2KYH A;  5F5H A;  3VYW A;  1TFK B;  2IBF A;  4FWV A;  4G7Z F;  2W4B A;  2AVK A;  1GS9 A;  1M6T A;  4P9F A;  1GQA A;  4U5D E;  2G62 A;  3AG3 C;  3WHN A;  3PDM P;  3UGP A;  2WVN A;  2XLV A;  4E7S A;  1G8X A;  2AU5 A;  3U3B A;  1EKY A;  2YEV A;  4FAP B;  1FFT C;  2C04 A;  4K7B A;  2GWW A;  3I5P A;  2V3C C;  1ZZP A;  2R7W A;  1QVX A;  2YL1 A;  3LS0 A;  4YL3 A;  5DLJ A;  3EHM A;  1LM3 B;  1UG7 A;  3SXY A;  1Z3I X;  4JUR I;  4NTB A;  3EG9 A;  4IRU A;  5L0C A;  2Y3B A;  1NFO A;  2L7A A;  2Y69 C;  4MTG A;  5T1D B;  2BL2 A;  2EIK C;  3F46 A;  1TWG A;  2HJ3 A;  1AEP A;  1VMA A;  3EGX A;  3M4C A;  3GEI A;  3OWT A;  4I3M A;  1PV3 A;  4KBL A;  4LLC A;  3SEO A;  5DS6 A;  1E84 A;  4WJ0 A;  2EIM C;  2J7P D;  4NTA A;  3FDQ A;  1YDI A;  3LNR A;  5D91 A;  3GM1 A;  2J46 A;  4DRH B;  2XRH A;  5JP7 A;  1D1C A;  4JKV A;  2FGY A;  2AWC A;  5KYW B;  2EPL X;  1R5I D;  2F22 A;  2HMZ A;  4N06 A;  3GOR A;  3AG2 C;  2VC9 A;  3FMS A;  3K1H A;  1WTY A;  2WZF A;  1AUE A;  1LE2 A;  1PD0 A;  2A6E F;  3R2P A;  1SF8 A;  2R7Q A;  3T6G B;  4CX9 A;  3K66 A;  4XPW A;  1N1C A;  2XS8 A;  2H7O A;  2R7O A;  4OIQ F;  2VB6 A;  1A41 A;  3W8I A;  2V26 A;  4U5B E;  1VB5 A;  2JPU A;  3O6X A;  3MX3 A;  3ZVR A;  1D0X A;  4AL0 A;  1YA7 O;  2R7R A;  2QNL A;  3CZ6 A;  2OJE D;  1TWH A;  3C63 A;  4JTC B;  4BG0 A;  4YT8 A;  1Y6D A;  3UMH A;  3BRJ A;  3T4R A;  2FAP B;  2Q9C A;  3W8H A;  2OJQ A;  3DJU B;  1D1A A;  2YZS A;  3ASN C;  3HTK C;  2HV7 A;  1RCP A;  4KI2 A;  1BR1 A;  1TQG A;  2DYS C;  3H65 A;  4D4X A;  1D0Y A;  4NQF A;  2LQG A;  2Q4F A;  2W9Y A;  4EBK A;  4P9T A;  4JJF A;  1OKK A;  1Y4C A;  4O6N A;  3EG9 B;  2YVK A;  1NLX A;  4G78 A;  3U2M A;  3RF3 A;  1JOG A;  2ICW G;  3NMJ A;  3LLI A;  2L81 A;  4PAC A;  4YJW A;  1RXQ A;  1Z5Z A;  4DOZ A;  4E0H A;  5EHH A;  3NMK A;  4FX5 A;  2IXP A;  4CIP A;  1OR2 A;  1ZHT A;  3B29 A;  4J7T A;  1YYX A;  3KYI A;  4XEK A;  1MMA A;  5A6A A;  4MVS A;  4G0H A;  1JPJ A;  1M2O A;  1CGN A;  1SZI A;  2YLD A;  1ZYR F;  3HLZ A;  4ULW A;  1FR0 A;  2XLO A;  2Y3H A;  4O6Y A;  4JTA B;  4BJ1 A;  4BEJ A;  1XZQ A;  1A7V A;  1T01 A;  4BJ5 A;  2LFF A;  3AJM A;  5GPG B;  4EUK B;  3LES A;  3DE9 A;  1MMN A;  4DRI B;  1QSP A;  3DWW A;  5JUA A;  2TMV P;  1OW7 A;  2J9V A;  3Q6N A;  1NSG B;  3JRM O;  4PR9 A;  3VM6 A;  3EH1 A;  3QVZ A;  4BJ6 C;  3L1M A;  1OCZ C;  4QI2 A;  4OIN F;  4C3E A;  1S05 A;  1NFN A;  2XS1 A;  4CS8 A;  1C03 A;  2CCY A;  1O5H A;  4ER9 A;  3SYN A;  5HV9 A;  2YHS A;  3T6B A;  1J8M F;  1RKE A;  1E86 A;  4MVO A;  1CGM E;  3ZC4 A;  3PMR A;  4CSA A;  3O39 A;  4CS7 A;  2NUT A;  256B A;  1ORS C;  4B6I A;  3B0V C;  2HMQ A;  3SNH A;  4M63 A;  4EHP A;  3H2U A;  5L0I A;  5L3Q A;  4UDV A;  1I4Y A;  2PNO A;  4XPY A;  4Z9H A;  2I15 A;  1YZA A;  1WAT A;  3UMI A;  4W8K A;  4XEV A;  1OQC A;  5CIV A;  4CDA A;  3S28 A;  4Q4Z F;  1GM5 A;  2KSF A;  3CSK A;  1HMO A;  5E2Q A;  1IW7 F;  3SZR A;  1ZW2 A;  4NC3 A;  4Z9J A;  1BZ4 A;  2OEX A;  2MHR A;  4CJO A;  3S27 A;  1A7E A;  4BEM J;  2OQM A;  3A9C A;  4MVR A;  2LD6 A;  1FAP B;  1L3P A;  3DMD A;  1MND A;  4F4B A;  4JVS A;  3GWL A;  1AVO B;  4FES A;  2FFH A;  2L9J A;  1WWP A;  1YZC A;  4W8P A;  2A6H F;  1WOL A;  3EGD A;  3RIP A;  3AGT A;  2XL6 A;  3N2Z B;  2OCC C;  1ZVZ A;  3NKD A;  3C62 A;  4J7Y A;  3ZG1 A;  4PFO A;  1T6I A;  3ASO C;  4U5H A;  3PHF 2;  4NY3 A;  2XM4 A;  2P61 A;  2LIG A;  4JIO A;  4LLE A;  1QZX A;  1Z6A A;  2UUH A;  4CS9 C;  3A11 A;  3AQC A;  3G4Z A;  3JRT A;  3JZ0 A;  4YWQ A;  5DQT A;  1G5Z A;  1C17 M;  4MVU A;  4U9D A;  2WVQ A;  4PJN A;  4RDA A;  3U3F A;  1FNT c;  2XLE A;  2WZG A;  2R25 A;  3NDB B;  1A0B A;  4DBQ A;  1BBH A;  4H54 A;  3K1I A;  3G4X A;  1ZW3 A;  1ZHZ A;  1RKE B;  3ITF A;  3U9M A;  1MQV A;  2R03 A;  3DZA A;  4PFP A;  3SXM A;  2NUT B;  1NZE A;  5KYW A;  3JT1 A;  4N6C A;  2G3V A;  3QW0 A;  2GA0 A;  4JCH A;  3K33 A;  2PFD A;  4LDR A;  4P6I C;  5B3S C;  4RBN A;  2VCA A;  1YA9 A;  2EPK X;  1BR2 A;  3GAN A;  4JJG A;  5E3C A;  4DVZ A;  3EH2 A;  2X51 A;  1Q0K A;  3NYJ A;  4IAO A;  3US6 A;  5A6J A;  3MLG A;  2E87 A;  3EPV A;  3EQL F;  3WOD F;  1EI7 A;  3X2Q C;  2LCH A;  4EWC A;  3U2L A;  4C3D A;  3QZC A;  3H2V A;  3RKO F;  3Q6M A;  1MNE A;  3RQF A;  5KYY A;  2PP4 A;  2HV6 A;  3V7O A;  3RVZ A;  2O9X A;  2X0C A;  3K6B A;  2HZ8 A;  4JRZ A;  3VRC A;  1PCX A;  2YL3 A;  2BC5 A;  3DD7 A;  4OD5 A;  2OU6 A;  4U9E A;  4WGZ A;  1T6U A;  3RVY A;  3VAY A;  3HJC A;  3W4Y A;  4EIY A;  3S0X A;  5F5F A;  4I1O B;  3U8P A;  2OOC A;  4JC7 A;  1M56 C;  1Q0F A;  4JCZ A;  5EGY A;  4A4A A;  4I1M A;  1VOM A;  3LUT B;  3ABK C;  4JTD B;  3U5S A;  1YJG A;  4CJG A;  2EPO A;  2ZPA A;  5IY5 C;  3KKB A;  3IQ5 A;  2Q7R A;  4K0D A;  3IHU A;  2A0B A;  3V5Y A;  2P1A A;  1I5N A;  4K1O A;  5L3V A;  1XZP A;  2Z15 A;  3T9O A;  3ZQV A;  2YKZ A;  2DYR C;  4J32 B;  1SMY F;  3B9Q A;  3I4U A;  3IQC A;  5EK0 A;  2CNW A;  4JE9 A;  1XWJ A;  1VTM P;  1APC A;  1HW1 A;  2ZD9 A;  3L8I A;  1HMD A;  4N6H A;  1H9T A;  2YLG A;  1RKC A;  3HNL A;  4XQ1 A;  5COM A;  5T3W A;  2PX3 A;  2J9B A;  4YL0 A;  1WN0 A;  1K05 A;  2EPN A;  2J0X A;  3EGX B;  2EIJ C;  2G3K A;  5F28 E;  4CDY A;  3CEX A;  2RD9 A;  1OKK D;  4KNV A;  5CI8 A;  5KYY B;  2W4M A;  3C8G A;  1ST6 A;  2GFH A;  3LNM B;  3TJ6 A;  4DBR A;  1ZU5 A;  3J06 A;  3FVY A;  4GYT A;  2XL8 A;  2YL7 A;  2IXN A;  1Z63 A;  3TK0 A;  4U5G A;  2QE9 A;  4HFK B;  3ZIB A;  3QVY A;  2CGE A;  3WG7 C;  1I4Z A;  2A69 F;  2J0W A;  3W2W A;  3ZTZ A;  1QKR A;  4DXW A;  2NSG A;  3N24 A;  2XXA B;  1TR2 A;  2P0N A;  4AE4 A;  4ULV A;  3DM9 B;  3GEE A;  3AQB A;  2ZXP A;  2CW0 F;  5JS5 A;  3ZTM A;  5E33 A;  3NRH A;  4Q7C A;  2L6G A;  1OR3 A;  4ANJ A;  3N0T A;  4JW1 A;  5KYU A;  1M2V A;  5L0G A;  3DM5 A;  2IM8 A;  1A7D A;  3EZH A;  1ZU4 A;  5E3A A;  5K0I A;  2KNH A;  2ASR A;  5DVW A;  3GEH A;  3DAG A;  1OXK A;  4BJT A;  1V54 C;  3G50 A;  1OW6 A;  3T6J A;  3UMK A;  1G4U S;  3NKE A;  1EA8 A;  3W2V A;  4O7G A;  4DVY P;  1TWC A;  2A68 F;  2ETS A;  3BEH A;  2HUJ A;  4DJ9 A;  5DS5 A;  4IAQ A;  2WZL A;  4ONS A;  5JRA A;  3KH2 A;  3HNJ A;  1E85 A;  2LP4 A;  5B3I A;  4PJL A;  3ABL C;  2YQY A;  3M79 A;  4XPX A;  5B1A C;  4YT2 A;  4MW3 A;  3K7D A;  3TOM A;  1VYI A;  4X0R A;  1R4T A;  2Y3D A;  4GEH A;  1PD1 A;  3I5Q A;  4N4W A;  4XWJ A;  5A6B A;  1VYK A;  2M4E A;  3C8G B;  4KC9 A;  1KTM A;  4BJ6 A;  4H4K C;  1FMW A;  4PJM A;  1NU9 C;  4LAC B;  4EBJ A;  4HFF B;  4MTF A;  4MVM A;  1ZHY A;  1L7C A;  2C03 A;  5JSL A;  4XEF A;  3TUL A;  2ZXO A;  3LS1 A;  4MW8 A;  1WGW A;  1HE9 A;  5A6B D;  2XLH A;  4IAR A;  3L0I A;  5JT4 A;  1SYQ A;  5L0H A;  3NMI A;  3C18 A;  1K04 A;  1VK5 A;  3TJ5 A;  2KW3 C;  3TD7 A;  4AE4 B;  5BUO A;  1LS4 A;  3FOO A;  4MND A;  4ZLC A;  3AOU A;  1YYJ A;  3QMK A;  3JYH A;  3Q7G A;  4LER A;  1OCC C;  2IXM A;  3GM3 A;  3DKA A;  3EZI A;  3OA1 A;  1M2V B;  5KYU B;  3DI5 A;  1JMW A;  3FXH A;  2B0J A;  2XSE A;  3LAY A;  3FAP B;  3SXK A;  5FCL A;  3HKK A;  2R02 A;  1VLS A;  2LFD A;  2KQ9 A;  3O10 A;  4Q5S F;  4EBB A;  2DGJ A;  1W2W A;  2HSB A;  1S7Z A;  4HEA J;  2OKU A;  2AWY A;  2EPM X;  4C7O A;  3SP1 A;  4EKW A;  2YRF A;  3LEV A;  1NBB A;  2AP3 A;  3GM2 A;  2IXO A;  2W45 A; 
#chains in the Genus database with same CATH homology
 3ZDL A;  5L0D A;  4W8P A;  3MYI A;  1SYQ A;  5L0H A;  1ZVZ A;  1RKE A;  1ST6 A;  3TJ6 A;  3VF0 A;  3TJ5 A;  5L0C A;  4DJ9 A;  1DOV A;  2L7A A;  4K1O A;  4ONS A;  3T6G B;  3S90 A;  1U89 A;  4IGG A;  1DOW A;  4EHP A;  3H2U A;  5L0I A;  3H2V A;  2IBF A;  1YDI A;  1T01 A;  4E17 A;  5L0J A;  2GDC A;  1QKR A;  2B0H A;  1XWJ A;  2X0C A;  2LQG A;  1TR2 A;  2HSQ A;  4P9T A;  4PR9 A;  1ZW3 A;  4E18 A;  1RKE B;  1ZW2 A;  5L0F A;  1RKC A;  3RF3 A;  2GWW A;  1L7C A;  1H6G A;  5FZT A;  5L0G A;  1U6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...