2GWWA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
b'HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 99
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2006-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA01
3H2UA 5L0DA 5L0JA 3MYIA 3TJ6A 1RKEB 1RKEA 2X0CA 1ZW2A 1H6GA 1XWJA 2L7AA 4W8PA 5L0IA 2LQGA 1SYQA 4E17A 1TR2A 3RF3A 1DOVA 1U89A 4PR9A 5L0HA 4DJ9A 1YDIA 1T01A 4IGGA 4ONSA 3TJ5A 1L7CA 1RKCA 2B0HA 3VF0A 1QKRA 3T6GB 1U6HA 4EHPA 5L0GA 1ZVZA 3S90A 3H2VA 1DOWA 2GDCA 2IBFA 2HSQA 1ZW3A 5FZTA 4E18A 2GWWA 4P9TA 3ZDLA 5L0FA 4K1OA 5L0CA 1ST6A
chains in the Genus database with same CATH superfamily
1UFBA 5L0JA 1APCA 3ZVRA 4F4BA 1Z7Qc 3HKKA 4AE4A 1LIHA 4BJ1A 3JSEO 2YLGA 3DI5A 4JVSA 3VAYA 4XLPF 2LQGA 2M64A 4XPYA 4MVRA 2JX0A 3DJUB 3Q6NA 4YT5A 4YT8A 4OIOF 2WVOA 2A6HF 2Y3DA 3B71A 3VM6A 1T01A 4MW3A 4PFPA 3RQGA 3ZTZA 3C8GB 2QNLA 1H9GA 4FAPB 3W2WA 5JVEA 3RW0A 3ECSA 2A68F 4LDQA 2YEVA 4H54A 3EZIA 1YA7O 1BZ4A 1YYXA 2L6HA 3ZG1A 5JT4A 4CIHA 3G4ZA 2CDQA 3FOPA 1HY5A 3CQZA 4IWBA 3VRCA 3C7JA 1ZW3A 2GAQA 3M79A 4CDYA 4DBRA 2PBEA 2NG1A 3A9CA 1ZHTA 4PR9A 3UMIA 3J06A 1YZAA 3T4RA 5EGYA 5L0DA 2Y3HA 4G0HA 3NMIA 4QI0A 3S27A 5E3AA 2IXMA 3EPVA 3JTLO 2VC9A 2FAPB 2UUIA 3LEVA 1RKEA 2R7XA 3GM2A 3LNMB 1ZHZA 4OIRF 3RIPA 4BJ5A 4C3DA 3GANA 4CDAA 1E2XA 2AWCA 4MVZA 1R4TA 1J8YF 2EIKC 4E17A 1TQGA 2XL8A 2YLIA 2YL0A 2HMZA 3ATPA 1MMNA 1OW6A 3KMIA 4IAOA 3GEIA 5D91A 3TOLA 5GPGB 3U8PA 5DS4A 2XLWA 3RKOF 4EHPA 4FESA 2XM4A 3UMHA 4WGYA 3TD7A 4XWJA 2Q00A 1M56C 3NYLA 3POVA 1V54C 2ICWG 2LCHA 2EINC 1OXBA 3SXZA 4U9DA 3VYWA 3FDQA 4G7HF 3IEEA 1BR1A 1O3UA 1WTYA 2WZFA 3C8GD 3QMKA 4JC7A 3MFNA 1G8XA 1AEPA 1T6IA 2R7QA 3HNJA 4JZAA 3H2UA 4I3MA 2KJGA 5L0CA 5KYWB 2RSEB 3DE9A 3B0PA 5KYNA 1T6UA 2KGOA 2KW3C 4BJTA 3ABLC 4P6IC 3AGTA 1ZZPA 2AVKA 4JEAA 2LP4A 2NSFA 3GEEA 3KYIA 1YARO 3SNHA 2FGYA 1L3PA 1WOLA 3IQTA 3LS0A 1FMVA 3ZQVA 4A4AA 4G7ZF 3ZTMA 4KNWA 3TOMA 4BEJA 2NPUA 4I44A 3GM3A 3C8GA 3DZAA 3T6GB 1H7IA 3U3BA 2EPMX 2EILC 1TKNA 2XLOA 4MVMA 2IOQA 2LFFA 1K40A 3T9OA 2XL6A 1LS4A 3CSKA 1Q0FA 1RJ9B 1CGNA 4XQ1A 3EH1A 2BC5A 5KYXA 3IPMO 4FWVA 1VMAA 3SYNA 3PDMP 4UDVA 1CPQA 5F5FA 4EIYA 4YT2A 1A41A 2AWYA 5L0FA 2R7SA 1CPRA 4NY3A 1BR4A 1JRAA 2Q4FA 5JLIA 1H9TA 2CCYA 2BE5F 2EPKX 3EHNA 4JCHA 2B0JA 3GM1A 2A69F 1TWHA 4JTAB 4JEBA 5AGFA 3V5XA 4B6IA 5DQTA 4ANJA 2IXOA 2W9YA 4PJLA 1OW8A 5L0GA 3ASOC 5A6AA 1U0BB 2VH3A 4DRJB 1D1BA 2XM0A 3S90A 3NDBB 3E9VA 1S7ZA 3K1IA 2KC3A 1YZCA 4U5GA 3M4CA 1W2WA 2IXNA 4PFOA 2J46A 5FZTA 3V7OA 2A1DD 4O6YA 4K1OA 1PV3A 4MTFA 2OOCA 3DXJF 3KYJA 2OKUA 4WABA 4M63A 1A0BA 4GEHA 3US6A 4ZLCA 3C18A 3U5SA 4IAQA 2KNHA 2VCBA 3L34A 4LDRA 1KNYA 3H65A 1IW7F 1NU7D 1OXKA 2MHRA 5F28E 2A0BA 1XZPA 1NLXA 2Y3BA 4J32B 1CGME 4KBLA 1VTMP 2Q3TA 2B0HA 1CGOA 2NUTA 2L6FA 2PNOA 1BBHA 1RCPA 1VYIA 2UUHA 4XEKA 1K05A 1T5OA 2AP3A 1IZMA 3O39A 4MTOA 3PMRA 1OCOC 3NYJA 3TK0A 4U9EA 5A6KA 1C02A 1OCRC 3C8ZA 4CS8A 2DYRC 1SF8A 3RQFA 1RJ9A 1WN0A 1PD0A 5B1AC 4CDVA 4EUKB 3NMJA 2LIGA 4P9FA 1NFOA 3JCUQ 1ZU5A 1LPEA 5BUOA 2J9VA 2HV7A 3FOOA 4W8KA 3C63A 4CS7A 3K6BA 1JPNA 1FMWA 1MMGA 3QTHA 4NQFA 2HKVA 3C62A 4CS9C 4HE8D 3CAXA 1VB5A 3ZSUA 1YAUO 2NUPA 1PD1A 2DI3A 3SP1A 4N4WA 3TJ5A 1HE9A 4OIPF 4Z9HA 3V5ZA 1WGWA 1OCZC 2ETSA 4MNDA 2JD3A 2HJ3A 1JPJA 2W4MA 2YKZA 4NTBA 2ZD9A 3T6BA 2D4UA 3B0VC 3KKBA 1TFOB 2R03A 3DJNB 3EZHA 3EGXB 4OD4A 3U2MA 5KYXB 1NBBA 1HW1A 2VCAA 5B1BC 2KSFA 3LS1A 2GFHA 2XSEA 3EGDB 1GQAA 4IB4A 4JJGA 4MVOA 2CYDA 4CSAC 2O9XA 1Q0MA 3I4UA 3RQEA 3ABMC 3S9OA 3MLGA 3TULA 1M2OA 2CNWD 1GGQA 3AG1C 3MX3A 3DKAA 2Q7RA 1FR0A 4L6RA 4XPXA 2J9UA 4LERA 5DLJA 1SYQA 1TR2A 2L6GA 1DOVA 3LLKA 3S84A 2J9WA 3NG1A 3JRMO 4BJ6C 3SEOA 4CBEA 5T1DB 1L7CA 2KQ9A 4C3EA 4CX9A 2YRFA 5T3WA 1G4US 2AU5A 1JR8A 3AOUA 5A6BD 4JTCB 2I8BA 1U6HA 1HMDA 1ZVZA 3L8JA 4O6MA 1HE1A 2X51A 4QI2A 4N6CA 4J7TA 3PCVA 2WZLA 3GEHA 3EHMA 2XRHA 2IBFA 4BG0A 1BDJB 2L9JA 4AL1A 1LI7A 4C3BA 3LJBA 4DXWA 4JW1A 2CNWA 1O5HA 4OIQF 2GWWA 3R2PA 4QDLA 4R32A 3HLZA 3L8IA 3AQCA 4MVUA 5FCLA 1Z6AA 2H7BA 3AGUA 3HNKA 4YL3A 4RD9A 5COFA 4EBJA 3F47A 3X1OA 3AQBA 3G4XA 3LEOA 5A6BA 4DBQA 4JIOA 4ULWA 3HNLA 4Z9JA 3O55A 5JSLA 1C17M 3DAGA 3ZIBA 3LUTB 3RH3A 5E3CA 5DS5A 2WB7A 2R7VA 1LM3B 1D0ZA 3QW0A 1OQCA 2NUTB 3R7CA 1YLMA 2JPUA 3UMKA 2EPLX 3ZC4A 2PF4E 1PCXA 1G4WR 2P1AA 1OR3A 4N6HA 1Z5ZA 2FFHA 1E83A 3B0UX 1RXQA 2EPOA 2OJED 3N24A 4OD5A 2PX0A 3I5PA 2Q9BA 3WG7C 2ZPAA 3FAJA 1ORYA 4HFKB 4JKVA 4PJJA 4U5EE 4E18A 4CIPA 2IM8A 2QTVA 4P9TA 1NG1A 3EGXA 1ST6A 2HV6A 5K0IA 3NKDA 1QQ3A 4PK4A 4KI2A 5BQHA 4U5CE 3IQCA 1R5ID 3ZWIA 1OR2A 4BEMJ 1LI5A 3EGDA 2J0WA 3SXYA 3JRTA 3UGPA 3NYMA 5E33A 5A69A 3JZ0A 2NUPB 3JSZA 1S05A 3GORA 3X2QC 1I4ZA 2XLDA 3N0TA 1Q0KA 1XZQA 3EFOB 1RKCA 5JUAA 4I1OB 4MQ9F 2QLAA 3DM9B 1JAFA 1BR2A 2Y39A 2V3CC 1ZU4A 1G5ZA 3OA1A 4D4NA 4U5DE 1E85A 3JYHA 2ASRA 1UG7A 256BA 3AG3C 5A6JA 1A7VA 1ZHWA 2QE9A 3U2LA 4EKWA 1M57C 2V26A 3EQLF 2EIJC 2LFDA 4C7OB 2RD9A 4CJOA 2OU6A 3IQ6A 1V55C 1ZHXA 4MVQA 4XTKA 2PP4A 3I5QA 2DYSC 3FVYA 3EJNA 4KC9A 2LK4A 2TMVP 1ORJA 2XLEA 4RBNA 3UGOA 1F1MA 4D4XA 5B3IA 1B68A 2QY9A 2YL7A 1JOGA 3ITFA 3AG4C 1D0YA 2PX3A 1TFKB 4K7BA 3UNGC 4PJNA 2J9BA 2R05A 2XLVA 2XXAA 4BPMA 4LLCA 2H8AA 1WATA 1FFHA 2QUPA 4AL0A 4Q5SF 1Z63A 1NFNA 1YJGA 3TQOA 4NTAA 4G78A 2KYHA 3MYFA 4E7ZA 4DRHB 1QLEC 3Q7LA 1O87A 1Y4CA 4Z9IA 3T6JA 3JT1A 3DD7A 3RVYA 5KYUB 4E7SA 4DRIB 2J8WA 3LNRA 2CGEA 3M15A 3KL4A 1I5NA 1LE2A 5D92A 1VYKA 5JS5A 1XWJA 5B3SC 3L0IA 3K1IC 4LACB 3M4BA 3GODA 3FHDA 2KK1A 2CW0F 1WASA 2MYSA 1YVIA 3DM5A 4O6NA 2EPNA 3GWNA 3KH2A 4YT4A 1M2VA 1QKRA 2HSBA 2LD6A 3EFOA 3G50A 1T6QA 4I1MA 4ULVA 1FNTc 4PJMA 3ZQYA 2R7UA 2ZXRA 3U8VA 2YL3A 4XEVA 2P6VA 3B29A 3K7DA 4YL1A 3M1CB 1N1CA 5COMA 5L3QA 2R7RA 1SMYF 2OJQA 3O10A 4H4KC 4IARA 2P61A 1Y6DA 3W4YA 4U5HA 3U9JA 2P7VA 1FFTC 2R02A 1D0XA 3ZDLA 1NU9C 2XXAB 4JJFA 2R7WA 1GS9A 1Q0GA 4J30B 4C7OA 2LSEA 1C03A 4YK5A 5DQZA 4J7YA 5L0IA 1H6GA 1K04A 1LKXA 4AK9A 2XLMA 3V5YA 3FMSA 1QPUA 3S29A 4CS8C 1NZEA 3EG9A 2YQYA 4JTDB 2YHSA 2Z15A 3F46A 3WODF 4DJ9A 1SR2A 1VOMA 2R7TA 3QVZA 2R9RB 1WWPA 3AG2C 3EH2A 3SZRA 2IYLD 3VF0A 4IJJA 4U5FE 1Z3IX 1TWGA 2BL2A 3PHF2 4JE9A 2H7VC 2OG2A 2XS8A 3H2VA 2HUJA 5EHHA 5KYYB 5HV9A 3OEOA 1MNEA 4JRZA 4WGZA 2P0NA 3HJCA 1HMOA 5HSWA 5CIVA 1ZYRF 3QW1A 2OCCC 3U3FA 3KPHA 5EK0A 3BRJA 3S0XA 4N06A 1SZIA 1FAPB 2HJMA 5KYUA 1MMDA 2ZXPA 2I15A 2XS1A 1ZW2A 2L7AA 3K66A 4YL0A 3K33A 2R7OA 3DWWA 3IQ5A 1MMAA 1Q0DA 2MWQA 3E70C 3LESA 5JRAA 2VASA 1YA9A 4KNVA 4E0HA 3L1MA 4YWQA 3OWTA 5AC4A 4XLNF 1ORSC 2GA0A 2L81A 3GWLA 4IRUA 4ZLDA 4XEFA 1GM5A 3U9MA 4LLEA 3UR3C 2YVKA 2ZXOA 3W8IA 4NCQA 3IHUA 4K0DA 1TWCA 2WZGA 1E86A 2C03A 2HS5A 4EBBA 4Q7CA 4BJ5C 2W45A 4EWCA 4PACA 4O7GA 4MTGA 1YYJA 4X0RA 1QVXA 3RVZA 4HEAJ 4LDKA 1V74B 4E0IA 3FAPB 2Q9CA 2IXPA 2YZSA 4DVZA 4FX5A 5E2QA 1ZHYA 3NRHA 2HFIA 1U89A 1EQ1A 1Z23A 3HNIA 1YDIA 4CJGA 2XLHA 3ABKC 4HFFB 1M2VB 1EKYA 2YL1A 3QZCA 5T3TA 1M6TA 5CI8A 3QVYA 1I4YA 3SXKA 1KU2A 4Q4ZF 1E84A 3CZ6A 5COGA 3LLIA 2YWAA 2Q9AA 2OQMA 4AX2A 2DGJA 1A7DA 5KYYA 4MS2A 3U0CA 4GYTA 1LS1A 2HZ8A 2YLDA 4G7OF 3ASNC 3Q7GA 1AVOB 4NTFA 1D1AA 2PFDA 5JP7A 1QZXA 2OEVA 3CEXA 2W4BA 1T9KA 1V4AA 3MYIA 4DVYP 2A0UA 4AE4B 3TJ6A 5L3VA 1VK5A 2VCCA 5TJ5E 2A6EF 4GQHA 3NKEA 3W2VA 4MVSA 3EG9B 3RF3A 5L0HA 2XL4A 4DOZA 4IGGA 4ONSA 2G62A 1KTMA 1AUEA 2J0XA 2J7PD 3BEHA 3RFYA 1MNDA 3DMDA 4OINF 3DAFA 3B9QA 1VLTA 1QSPA 1EA8A 2F22A 3MBGA 3JYYA 1DOWA 3N2ZB 1OCCC 4CS9A 2WVQA 1LE4A 1TWAA 3S28A 2OEXA 3A11A 3O6XA 4YN0B 1EI7A 1OKKD 4U5BE 1MQVA 4NC3A 1OW7A 5CI9A 1LVKA 4JCZA 3W8HA 5KYWA 4O79A 2Y69C 2VB6A 2DB4A 1FTSA 1RKEB 1A7EA 3HTKC 3K1HA 2H7OA 4WJ0A 3SXMA 3WHNA 2J7PA 2X0CA 1JMWA 2R25A 2NSGA 3DE8A 4RDAA 4W8PA 5IY5C 4MW8A 2C04A 2M4EA 1D1CA 5DVWA 4XPWA 1J8MF 3WAQA 1VLSA 2E87A 2G3VA 4A2NB 1RMVA 2ZXWC 1NSGB 2WL8A 4CSAA 1OKKA 3LAYA 2Y3GA 3RYLA 5DS6A 4ER9A 5BQIA 2HMQA 2G3KA 5AC5A 3FXHA 2GDCA 4EBKA 1HW2A 2WVNA 3AJMA 3NMKA 3Q6MA 4JURI 5F5HA 2EIMC 2HSQA 2D5RB 5BQGA 4YJWA 4BJ6A 2J45A
chains in the Genus database with same CATH topology
3H2UA 5L0DA 5L0JA 3MYIA 3TJ6A 1RKEB 1RKEA 2X0CA 1ZW2A 1H6GA 1XWJA 2L7AA 4W8PA 5L0IA 2LQGA 1SYQA 4E17A 1TR2A 3RF3A 1DOVA 1U89A 4PR9A 5L0HA 4DJ9A 1YDIA 1T01A 4IGGA 4ONSA 3TJ5A 1L7CA 1RKCA 2B0HA 3VF0A 1QKRA 3T6GB 1U6HA 4EHPA 5L0GA 1ZVZA 3S90A 3H2VA 1DOWA 2GDCA 2IBFA 2HSQA 1ZW3A 5FZTA 4E18A 2GWWA 4P9TA 3ZDLA 5L0FA 4K1OA 5L0CA 1ST6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2U A;  5L0D A;  5L0J A;  3MYI A;  3TJ6 A;  1RKE B;  1RKE A;  2X0C A;  1ZW2 A;  1H6G A;  1XWJ A;  2L7A A;  4W8P A;  5L0I A;  2LQG A;  1SYQ A;  4E17 A;  1TR2 A;  3RF3 A;  1DOV A;  1U89 A;  4PR9 A;  5L0H A;  4DJ9 A;  1YDI A;  1T01 A;  4IGG A;  4ONS A;  3TJ5 A;  1L7C A;  1RKC A;  2B0H A;  3VF0 A;  1QKR A;  3T6G B;  1U6H A;  4EHP A;  5L0G A;  1ZVZ A;  3S90 A;  3H2V A;  1DOW A;  2GDC A;  2IBF A;  2HSQ A;  1ZW3 A;  5FZT A;  4E18 A;  2GWW A;  4P9T A;  3ZDL A;  5L0F A;  4K1O A;  5L0C A;  1ST6 A; 
#chains in the Genus database with same CATH topology
 1UFB A;  5L0J A;  1APC A;  3ZVR A;  4F4B A;  1Z7Q c;  3HKK A;  4AE4 A;  1LIH A;  4BJ1 A;  3JSE O;  2YLG A;  3DI5 A;  4JVS A;  3VAY A;  4XLP F;  2LQG A;  2M64 A;  4XPY A;  4MVR A;  2JX0 A;  3DJU B;  3Q6N A;  4YT5 A;  4YT8 A;  4OIO F;  2WVO A;  2A6H F;  2Y3D A;  3B71 A;  3VM6 A;  1T01 A;  4MW3 A;  4PFP A;  3RQG A;  3ZTZ A;  3C8G B;  2QNL A;  1H9G A;  4FAP B;  3W2W A;  5JVE A;  3RW0 A;  3ECS A;  2A68 F;  4LDQ A;  2YEV A;  4H54 A;  3EZI A;  1YA7 O;  1BZ4 A;  1YYX A;  2L6H A;  3ZG1 A;  5JT4 A;  4CIH A;  3G4Z A;  2CDQ A;  3FOP A;  1HY5 A;  3CQZ A;  4IWB A;  3VRC A;  3C7J A;  1ZW3 A;  2GAQ A;  3M79 A;  4CDY A;  4DBR A;  2PBE A;  2NG1 A;  3A9C A;  1ZHT A;  4PR9 A;  3UMI A;  3J06 A;  1YZA A;  3T4R A;  5EGY A;  5L0D A;  2Y3H A;  4G0H A;  3NMI A;  4QI0 A;  3S27 A;  5E3A A;  2IXM A;  3EPV A;  3JTL O;  2VC9 A;  2FAP B;  2UUI A;  3LEV A;  1RKE A;  2R7X A;  3GM2 A;  3LNM B;  1ZHZ A;  4OIR F;  3RIP A;  4BJ5 A;  4C3D A;  3GAN A;  4CDA A;  1E2X A;  2AWC A;  4MVZ A;  1R4T A;  1J8Y F;  2EIK C;  4E17 A;  1TQG A;  2XL8 A;  2YLI A;  2YL0 A;  2HMZ A;  3ATP A;  1MMN A;  1OW6 A;  3KMI A;  4IAO A;  3GEI A;  5D91 A;  3TOL A;  5GPG B;  3U8P A;  5DS4 A;  2XLW A;  3RKO F;  4EHP A;  4FES A;  2XM4 A;  3UMH A;  4WGY A;  3TD7 A;  4XWJ A;  2Q00 A;  1M56 C;  3NYL A;  3POV A;  1V54 C;  2ICW G;  2LCH A;  2EIN C;  1OXB A;  3SXZ A;  4U9D A;  3VYW A;  3FDQ A;  4G7H F;  3IEE A;  1BR1 A;  1O3U A;  1WTY A;  2WZF A;  3C8G D;  3QMK A;  4JC7 A;  3MFN A;  1G8X A;  1AEP A;  1T6I A;  2R7Q A;  3HNJ A;  4JZA A;  3H2U A;  4I3M A;  2KJG A;  5L0C A;  5KYW B;  2RSE B;  3DE9 A;  3B0P A;  5KYN A;  1T6U A;  2KGO A;  2KW3 C;  4BJT A;  3ABL C;  4P6I C;  3AGT A;  1ZZP A;  2AVK A;  4JEA A;  2LP4 A;  2NSF A;  3GEE A;  3KYI A;  1YAR O;  3SNH A;  2FGY A;  1L3P A;  1WOL A;  3IQT A;  3LS0 A;  1FMV A;  3ZQV A;  4A4A A;  4G7Z F;  3ZTM A;  4KNW A;  3TOM A;  4BEJ A;  2NPU A;  4I44 A;  3GM3 A;  3C8G A;  3DZA A;  3T6G B;  1H7I A;  3U3B A;  2EPM X;  2EIL C;  1TKN A;  2XLO A;  4MVM A;  2IOQ A;  2LFF A;  1K40 A;  3T9O A;  2XL6 A;  1LS4 A;  3CSK A;  1Q0F A;  1RJ9 B;  1CGN A;  4XQ1 A;  3EH1 A;  2BC5 A;  5KYX A;  3IPM O;  4FWV A;  1VMA A;  3SYN A;  3PDM P;  4UDV A;  1CPQ A;  5F5F A;  4EIY A;  4YT2 A;  1A41 A;  2AWY A;  5L0F A;  2R7S A;  1CPR A;  4NY3 A;  1BR4 A;  1JRA A;  2Q4F A;  5JLI A;  1H9T A;  2CCY A;  2BE5 F;  2EPK X;  3EHN A;  4JCH A;  2B0J A;  3GM1 A;  2A69 F;  1TWH A;  4JTA B;  4JEB A;  5AGF A;  3V5X A;  4B6I A;  5DQT A;  4ANJ A;  2IXO A;  2W9Y A;  4PJL A;  1OW8 A;  5L0G A;  3ASO C;  5A6A A;  1U0B B;  2VH3 A;  4DRJ B;  1D1B A;  2XM0 A;  3S90 A;  3NDB B;  3E9V A;  1S7Z A;  3K1I A;  2KC3 A;  1YZC A;  4U5G A;  3M4C A;  1W2W A;  2IXN A;  4PFO A;  2J46 A;  5FZT A;  3V7O A;  2A1D D;  4O6Y A;  4K1O A;  1PV3 A;  4MTF A;  2OOC A;  3DXJ F;  3KYJ A;  2OKU A;  4WAB A;  4M63 A;  1A0B A;  4GEH A;  3US6 A;  4ZLC A;  3C18 A;  3U5S A;  4IAQ A;  2KNH A;  2VCB A;  3L34 A;  4LDR A;  1KNY A;  3H65 A;  1IW7 F;  1NU7 D;  1OXK A;  2MHR A;  5F28 E;  2A0B A;  1XZP A;  1NLX A;  2Y3B A;  4J32 B;  1CGM E;  4KBL A;  1VTM P;  2Q3T A;  2B0H A;  1CGO A;  2NUT A;  2L6F A;  2PNO A;  1BBH A;  1RCP A;  1VYI A;  2UUH A;  4XEK A;  1K05 A;  1T5O A;  2AP3 A;  1IZM A;  3O39 A;  4MTO A;  3PMR A;  1OCO C;  3NYJ A;  3TK0 A;  4U9E A;  5A6K A;  1C02 A;  1OCR C;  3C8Z A;  4CS8 A;  2DYR C;  1SF8 A;  3RQF A;  1RJ9 A;  1WN0 A;  1PD0 A;  5B1A C;  4CDV A;  4EUK B;  3NMJ A;  2LIG A;  4P9F A;  1NFO A;  3JCU Q;  1ZU5 A;  1LPE A;  5BUO A;  2J9V A;  2HV7 A;  3FOO A;  4W8K A;  3C63 A;  4CS7 A;  3K6B A;  1JPN A;  1FMW A;  1MMG A;  3QTH A;  4NQF A;  2HKV A;  3C62 A;  4CS9 C;  4HE8 D;  3CAX A;  1VB5 A;  3ZSU A;  1YAU O;  2NUP A;  1PD1 A;  2DI3 A;  3SP1 A;  4N4W A;  3TJ5 A;  1HE9 A;  4OIP F;  4Z9H A;  3V5Z A;  1WGW A;  1OCZ C;  2ETS A;  4MND A;  2JD3 A;  2HJ3 A;  1JPJ A;  2W4M A;  2YKZ A;  4NTB A;  2ZD9 A;  3T6B A;  2D4U A;  3B0V C;  3KKB A;  1TFO B;  2R03 A;  3DJN B;  3EZH A;  3EGX B;  4OD4 A;  3U2M A;  5KYX B;  1NBB A;  1HW1 A;  2VCA A;  5B1B C;  2KSF A;  3LS1 A;  2GFH A;  2XSE A;  3EGD B;  1GQA A;  4IB4 A;  4JJG A;  4MVO A;  2CYD A;  4CSA C;  2O9X A;  1Q0M A;  3I4U A;  3RQE A;  3ABM C;  3S9O A;  3MLG A;  3TUL A;  1M2O A;  2CNW D;  1GGQ A;  3AG1 C;  3MX3 A;  3DKA A;  2Q7R A;  1FR0 A;  4L6R A;  4XPX A;  2J9U A;  4LER A;  5DLJ A;  1SYQ A;  1TR2 A;  2L6G A;  1DOV A;  3LLK A;  3S84 A;  2J9W A;  3NG1 A;  3JRM O;  4BJ6 C;  3SEO A;  4CBE A;  5T1D B;  1L7C A;  2KQ9 A;  4C3E A;  4CX9 A;  2YRF A;  5T3W A;  1G4U S;  2AU5 A;  1JR8 A;  3AOU A;  5A6B D;  4JTC B;  2I8B A;  1U6H A;  1HMD A;  1ZVZ A;  3L8J A;  4O6M A;  1HE1 A;  2X51 A;  4QI2 A;  4N6C A;  4J7T A;  3PCV A;  2WZL A;  3GEH A;  3EHM A;  2XRH A;  2IBF A;  4BG0 A;  1BDJ B;  2L9J A;  4AL1 A;  1LI7 A;  4C3B A;  3LJB A;  4DXW A;  4JW1 A;  2CNW A;  1O5H A;  4OIQ F;  2GWW A;  3R2P A;  4QDL A;  4R32 A;  3HLZ A;  3L8I A;  3AQC A;  4MVU A;  5FCL A;  1Z6A A;  2H7B A;  3AGU A;  3HNK A;  4YL3 A;  4RD9 A;  5COF A;  4EBJ A;  3F47 A;  3X1O A;  3AQB A;  3G4X A;  3LEO A;  5A6B A;  4DBQ A;  4JIO A;  4ULW A;  3HNL A;  4Z9J A;  3O55 A;  5JSL A;  1C17 M;  3DAG A;  3ZIB A;  3LUT B;  3RH3 A;  5E3C A;  5DS5 A;  2WB7 A;  2R7V A;  1LM3 B;  1D0Z A;  3QW0 A;  1OQC A;  2NUT B;  3R7C A;  1YLM A;  2JPU A;  3UMK A;  2EPL X;  3ZC4 A;  2PF4 E;  1PCX A;  1G4W R;  2P1A A;  1OR3 A;  4N6H A;  1Z5Z A;  2FFH A;  1E83 A;  3B0U X;  1RXQ A;  2EPO A;  2OJE D;  3N24 A;  4OD5 A;  2PX0 A;  3I5P A;  2Q9B A;  3WG7 C;  2ZPA A;  3FAJ A;  1ORY A;  4HFK B;  4JKV A;  4PJJ A;  4U5E E;  4E18 A;  4CIP A;  2IM8 A;  2QTV A;  4P9T A;  1NG1 A;  3EGX A;  1ST6 A;  2HV6 A;  5K0I A;  3NKD A;  1QQ3 A;  4PK4 A;  4KI2 A;  5BQH A;  4U5C E;  3IQC A;  1R5I D;  3ZWI A;  1OR2 A;  4BEM J;  1LI5 A;  3EGD A;  2J0W A;  3SXY A;  3JRT A;  3UGP A;  3NYM A;  5E33 A;  5A69 A;  3JZ0 A;  2NUP B;  3JSZ A;  1S05 A;  3GOR A;  3X2Q C;  1I4Z A;  2XLD A;  3N0T A;  1Q0K A;  1XZQ A;  3EFO B;  1RKC A;  5JUA A;  4I1O B;  4MQ9 F;  2QLA A;  3DM9 B;  1JAF A;  1BR2 A;  2Y39 A;  2V3C C;  1ZU4 A;  1G5Z A;  3OA1 A;  4D4N A;  4U5D E;  1E85 A;  3JYH A;  2ASR A;  1UG7 A;  256B A;  3AG3 C;  5A6J A;  1A7V A;  1ZHW A;  2QE9 A;  3U2L A;  4EKW A;  1M57 C;  2V26 A;  3EQL F;  2EIJ C;  2LFD A;  4C7O B;  2RD9 A;  4CJO A;  2OU6 A;  3IQ6 A;  1V55 C;  1ZHX A;  4MVQ A;  4XTK A;  2PP4 A;  3I5Q A;  2DYS C;  3FVY A;  3EJN A;  4KC9 A;  2LK4 A;  2TMV P;  1ORJ A;  2XLE A;  4RBN A;  3UGO A;  1F1M A;  4D4X A;  5B3I A;  1B68 A;  2QY9 A;  2YL7 A;  1JOG A;  3ITF A;  3AG4 C;  1D0Y A;  2PX3 A;  1TFK B;  4K7B A;  3UNG C;  4PJN A;  2J9B A;  2R05 A;  2XLV A;  2XXA A;  4BPM A;  4LLC A;  2H8A A;  1WAT A;  1FFH A;  2QUP A;  4AL0 A;  4Q5S F;  1Z63 A;  1NFN A;  1YJG A;  3TQO A;  4NTA A;  4G78 A;  2KYH A;  3MYF A;  4E7Z A;  4DRH B;  1QLE C;  3Q7L A;  1O87 A;  1Y4C A;  4Z9I A;  3T6J A;  3JT1 A;  3DD7 A;  3RVY A;  5KYU B;  4E7S A;  4DRI B;  2J8W A;  3LNR A;  2CGE A;  3M15 A;  3KL4 A;  1I5N A;  1LE2 A;  5D92 A;  1VYK A;  5JS5 A;  1XWJ A;  5B3S C;  3L0I A;  3K1I C;  4LAC B;  3M4B A;  3GOD A;  3FHD A;  2KK1 A;  2CW0 F;  1WAS A;  2MYS A;  1YVI A;  3DM5 A;  4O6N A;  2EPN A;  3GWN A;  3KH2 A;  4YT4 A;  1M2V A;  1QKR A;  2HSB A;  2LD6 A;  3EFO A;  3G50 A;  1T6Q A;  4I1M A;  4ULV A;  1FNT c;  4PJM A;  3ZQY A;  2R7U A;  2ZXR A;  3U8V A;  2YL3 A;  4XEV A;  2P6V A;  3B29 A;  3K7D A;  4YL1 A;  3M1C B;  1N1C A;  5COM A;  5L3Q A;  2R7R A;  1SMY F;  2OJQ A;  3O10 A;  4H4K C;  4IAR A;  2P61 A;  1Y6D A;  3W4Y A;  4U5H A;  3U9J A;  2P7V A;  1FFT C;  2R02 A;  1D0X A;  3ZDL A;  1NU9 C;  2XXA B;  4JJF A;  2R7W A;  1GS9 A;  1Q0G A;  4J30 B;  4C7O A;  2LSE A;  1C03 A;  4YK5 A;  5DQZ A;  4J7Y A;  5L0I A;  1H6G A;  1K04 A;  1LKX A;  4AK9 A;  2XLM A;  3V5Y A;  3FMS A;  1QPU A;  3S29 A;  4CS8 C;  1NZE A;  3EG9 A;  2YQY A;  4JTD B;  2YHS A;  2Z15 A;  3F46 A;  3WOD F;  4DJ9 A;  1SR2 A;  1VOM A;  2R7T A;  3QVZ A;  2R9R B;  1WWP A;  3AG2 C;  3EH2 A;  3SZR A;  2IYL D;  3VF0 A;  4IJJ A;  4U5F E;  1Z3I X;  1TWG A;  2BL2 A;  3PHF 2;  4JE9 A;  2H7V C;  2OG2 A;  2XS8 A;  3H2V A;  2HUJ A;  5EHH A;  5KYY B;  5HV9 A;  3OEO A;  1MNE A;  4JRZ A;  4WGZ A;  2P0N A;  3HJC A;  1HMO A;  5HSW A;  5CIV A;  1ZYR F;  3QW1 A;  2OCC C;  3U3F A;  3KPH A;  5EK0 A;  3BRJ A;  3S0X A;  4N06 A;  1SZI A;  1FAP B;  2HJM A;  5KYU A;  1MMD A;  2ZXP A;  2I15 A;  2XS1 A;  1ZW2 A;  2L7A A;  3K66 A;  4YL0 A;  3K33 A;  2R7O A;  3DWW A;  3IQ5 A;  1MMA A;  1Q0D A;  2MWQ A;  3E70 C;  3LES A;  5JRA A;  2VAS A;  1YA9 A;  4KNV A;  4E0H A;  3L1M A;  4YWQ A;  3OWT A;  5AC4 A;  4XLN F;  1ORS C;  2GA0 A;  2L81 A;  3GWL A;  4IRU A;  4ZLD A;  4XEF A;  1GM5 A;  3U9M A;  4LLE A;  3UR3 C;  2YVK A;  2ZXO A;  3W8I A;  4NCQ A;  3IHU A;  4K0D A;  1TWC A;  2WZG A;  1E86 A;  2C03 A;  2HS5 A;  4EBB A;  4Q7C A;  4BJ5 C;  2W45 A;  4EWC A;  4PAC A;  4O7G A;  4MTG A;  1YYJ A;  4X0R A;  1QVX A;  3RVZ A;  4HEA J;  4LDK A;  1V74 B;  4E0I A;  3FAP B;  2Q9C A;  2IXP A;  2YZS A;  4DVZ A;  4FX5 A;  5E2Q A;  1ZHY A;  3NRH A;  2HFI A;  1U89 A;  1EQ1 A;  1Z23 A;  3HNI A;  1YDI A;  4CJG A;  2XLH A;  3ABK C;  4HFF B;  1M2V B;  1EKY A;  2YL1 A;  3QZC A;  5T3T A;  1M6T A;  5CI8 A;  3QVY A;  1I4Y A;  3SXK A;  1KU2 A;  4Q4Z F;  1E84 A;  3CZ6 A;  5COG A;  3LLI A;  2YWA A;  2Q9A A;  2OQM A;  4AX2 A;  2DGJ A;  1A7D A;  5KYY A;  4MS2 A;  3U0C A;  4GYT A;  1LS1 A;  2HZ8 A;  2YLD A;  4G7O F;  3ASN C;  3Q7G A;  1AVO B;  4NTF A;  1D1A A;  2PFD A;  5JP7 A;  1QZX A;  2OEV A;  3CEX A;  2W4B A;  1T9K A;  1V4A A;  3MYI A;  4DVY P;  2A0U A;  4AE4 B;  3TJ6 A;  5L3V A;  1VK5 A;  2VCC A;  5TJ5 E;  2A6E F;  4GQH A;  3NKE A;  3W2V A;  4MVS A;  3EG9 B;  3RF3 A;  5L0H A;  2XL4 A;  4DOZ A;  4IGG A;  4ONS A;  2G62 A;  1KTM A;  1AUE A;  2J0X A;  2J7P D;  3BEH A;  3RFY A;  1MND A;  3DMD A;  4OIN F;  3DAF A;  3B9Q A;  1VLT A;  1QSP A;  1EA8 A;  2F22 A;  3MBG A;  3JYY A;  1DOW A;  3N2Z B;  1OCC C;  4CS9 A;  2WVQ A;  1LE4 A;  1TWA A;  3S28 A;  2OEX A;  3A11 A;  3O6X A;  4YN0 B;  1EI7 A;  1OKK D;  4U5B E;  1MQV A;  4NC3 A;  1OW7 A;  5CI9 A;  1LVK A;  4JCZ A;  3W8H A;  5KYW A;  4O79 A;  2Y69 C;  2VB6 A;  2DB4 A;  1FTS A;  1RKE B;  1A7E A;  3HTK C;  3K1H A;  2H7O A;  4WJ0 A;  3SXM A;  3WHN A;  2J7P A;  2X0C A;  1JMW A;  2R25 A;  2NSG A;  3DE8 A;  4RDA A;  4W8P A;  5IY5 C;  4MW8 A;  2C04 A;  2M4E A;  1D1C A;  5DVW A;  4XPW A;  1J8M F;  3WAQ A;  1VLS A;  2E87 A;  2G3V A;  4A2N B;  1RMV A;  2ZXW C;  1NSG B;  2WL8 A;  4CSA A;  1OKK A;  3LAY A;  2Y3G A;  3RYL A;  5DS6 A;  4ER9 A;  5BQI A;  2HMQ A;  2G3K A;  5AC5 A;  3FXH A;  2GDC A;  4EBK A;  1HW2 A;  2WVN A;  3AJM A;  3NMK A;  3Q6M A;  4JUR I;  5F5H A;  2EIM C;  2HSQ A;  2D5R B;  5BQG A;  4YJW A;  4BJ6 A;  2J45 A; 
#chains in the Genus database with same CATH homology
 3H2U A;  5L0D A;  5L0J A;  3MYI A;  3TJ6 A;  1RKE B;  1RKE A;  2X0C A;  1ZW2 A;  1H6G A;  1XWJ A;  2L7A A;  4W8P A;  5L0I A;  2LQG A;  1SYQ A;  4E17 A;  1TR2 A;  3RF3 A;  1DOV A;  1U89 A;  4PR9 A;  5L0H A;  4DJ9 A;  1YDI A;  1T01 A;  4IGG A;  4ONS A;  3TJ5 A;  1L7C A;  1RKC A;  2B0H A;  3VF0 A;  1QKR A;  3T6G B;  1U6H A;  4EHP A;  5L0G A;  1ZVZ A;  3S90 A;  3H2V A;  1DOW A;  2GDC A;  2IBF A;  2HSQ A;  1ZW3 A;  5FZT A;  4E18 A;  2GWW A;  4P9T A;  3ZDL A;  5L0F A;  4K1O A;  5L0C A;  1ST6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...