2GWWA

Human vinculin (head domain, vh1, residues 1-258) in complex with shigella's ipaa vinculin binding site (residues 602-633)
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
HMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords vinculin
publication title Shigella applies molecular mimicry to subvert vinculin and invade host cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2006-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2gwwA01
2GWWA 1L7CA 4ONSA 1DOWA 2X0CA 4K1OA 1U89A 1ZW3A 5L0CA 4DJ9A 3MYIA 3ZDLA 4EHPA 5L0GA 5L0DA 3TJ5A 1DOVA 1U6HA 2LQGA 1SYQA 5L0JA 5L0HA 2IBFA 1T01A 2L7AA 3H2UA 4E17A 1XWJA 1ZW2A 1ZVZA 1ST6A 2B0HA 3TJ6A 3VF0A 1QKRA 1TR2A 1RKEA 2HSQA 3H2VA 4IGGA 4W8PA 1RKCA 3RF3A 3T6GB 4P9TA 4PR9A 5L0IA 1RKEB 2GDCA 1H6GA 3S90A 5FZTA 1YDIA 5L0FA 4E18A
chains in the Genus database with same CATH superfamily
1NG1A 2PX3A 2EPKX 4EUKB 2WB7A 3E70C 3ZTMA 4DRJB 2AVKA 4IWBA 1OR3A 3IQ5A 2XXAA 3JSZA 3KH2A 3LJBA 2PBEA 5D91A 3ZTZA 2ZXRA 4CDVA 5L0DA 3VRCA 5KYNA 1MMNA 1TQGA 4CS8A 1VB5A 4CBEA 2L81A 2PP4A 1AUEA 2QY9A 2Y39A 3S84A 1L3PA 3JSEO 5COGA 3B0UX 4YN0B 3ASOC 5JLIA 1CPRA 5E3AA 4JRZA 4E7ZA 2HSQA 4N06A 3AQCA 3C63A 3FDQA 3RF3A 4ZLDA 1YVIA 2NPUA 3JT1A 2GFHA 1D0XA 3EGDB 1C17M 2JD3A 2WL8A 3HLZA 3HNLA 3HNJA 4C3BA 4YT2A 1ZZPA 2HS5A 4M63A 3C8GD 5KYUA 3WHNA 4E0IA 4HFFB 1BDJB 4QI2A 1DOWA 3LEVA 4MVUA 1T6UA 3RQFA 3DKAA 3GM2A 4XLNF 2XL6A 1LE4A 3JYHA 4AE4A 3W8HA 4BJ6C 4CDAA 4YT8A 2IOQA 3S27A 3DZAA 3C8GA 2V26A 4DXWA 3TJ5A 1OW6A 1ZU5A 1N1CA 3KPHA 2LQGA 4PACA 4G78A 1YAUO 1H9TA 3QTHA 1QPUA 2KNHA 2AWYA 3DI5A 1MMAA 5A69A 3RH3A 2B0HA 1CGME 2R7SA 3UMKA 3V7OA 1YYXA 3PCVA 1MNEA 1Q0GA 5A6AA 1PV3A 1K05A 3VAYA 4U5DE 5F5HA 1V4AA 1PD1A 3ATPA 1VTMP 4PFPA 3CQZA 4MQ9F 1CGNA 5DS6A 1GQAA 5L3VA 2DYSC 2OQMA 1NSGB 3M4BA 1G5ZA 2C04A 3S0XA 2FFHA 1TWAA 4I1OB 1ZYRF 5T3TA 4ZLCA 2EPMX 2A6HF 1A7DA 1D1CA 2BE5F 2P1AA 2G62A 2OG2A 2XLDA 4MVZA 4NTAA 4BJ5C 4ANJA 3X2QC 5JRAA 2AU5A 1FFTC 3CSKA 4I44A 3GODA 4CSAA 3K6BA 3T6JA 2IXMA 3IQ6A 2I15A 3EGXA 4DBRA 5CI8A 4LDKA 1R4TA 4JEBA 4X0RA 2ICWG 2IXNA 3SXYA 3U9MA 3DJNB 1T5OA 2NG1A 3OWTA 4YL3A 2A68F 4W8PA 1LS4A 3GM3A 3W8IA 1M2VB 3RW0A 4NC3A 4XPWA 4CIHA 5A6JA 2QE9A 4BG0A 3ZWIA 3NKEA 2KC3A 4YK5A 3UGPA 1NZEA 1TFKB 5IY5C 4E18A 2WZGA 4XEFA 5F28E 1L7CA 1BR1A 4CX9A 5JS5A 1ZW3A 4EWCA 4UDVA 1LS1A 4DOZA 4JW1A 3MLGA 4MW3A 1E83A 1GGQA 4MTFA 1SYQA 2Q3TA 4U5EE 2D4UA 3EH2A 2L6HA 1ZHWA 2LSEA 5CI9A 4JTAB 3EFOB 1VK5A 2VB6A 1HMDA 2B0JA 3MFNA 4PJLA 1TR2A 2WZFA 2L6FA 5DLJA 1QVXA 3ITFA 1OR2A 4F4BA 1SZIA 2M4EA 3LNRA 4R32A 4BEJA 1ZHYA 1D1BA 3H65A 2V3CC 4G7HF 3R7CA 4PJNA 3U3BA 4G7OF 1LVKA 1WATA 2OEXA 3M15A 3O10A 4XTKA 1Z23A 4A4AA 4FAPB 3NMIA 3OA1A 2RSEB 2LD6A 2YEVA 4MVRA 2Q9CA 4ULWA 4EHPA 1SR2A 3ZQVA 2KQ9A 3F47A 3RYLA 1G8XA 2P61A 3B29A 1KNYA 1Q0KA 1V74B 2J8WA 2OOCA 2XLOA 2ZD9A 4YJWA 3ZC4A 4OIOF 3NYMA 1C02A 4U5HA 2XLVA 2KGOA 3FAPB 5DVWA 3QW0A 1M57C 2CDQA 2CGEA 2J9BA 2LFDA 3BRJA 1LPEA 2YWAA 4IGGA 3RQEA 3CEXA 4W8KA 2OEVA 1OQCA 4XEKA 4FESA 2P0NA 3C18A 1H6GA 4EIYA 3JZ0A 3U3FA 1GS9A 1TFOB 3ABKC 3G4XA 1TWGA 3RIPA 2LP4A 3GEIA 2NUTA 4Q5SF 2KYHA 1MMGA 1VYKA 2M64A 3AOUA 2R7XA 3O39A 5KYWA 1A7EA 1U89A 3X1OA 1LM3B 3DM5A 3NG1A 2VASA 1E84A 1Z3IX 3IEEA 3M4CA 3L34A 5DS4A 4C7OA 1DOVA 4L6RA 3WG7C 3EZHA 1I4YA 3TD7A 1AEPA 4LDQA 2XSEA 4CJGA 2C03A 5JT4A 3B71A 3M79A 3TQOA 1RMVA 1TKNA 3UMIA 4NY3A 3K33A 5COFA 4PJMA 2IYLD 4PR9A 2IXOA 4AL0A 2GDCA 3HTKC 4C3DA 2J9UA 3S90A 4EKWA 1J8YF 4U9DA 4YT5A 4HEAJ 2CYDA 3QVZA 4Q4ZF 1S7ZA 4NCQA 1A7VA 5D92A 1CPQA 5KYXB 3ZIBA 2VCAA 5T3WA 1E86A 3RQGA 2XM0A 4MTGA 3GEEA 4CS8C 1ZHXA 2L9JA 2XL8A 1FTSA 2UUHA 5AC4A 3AGTA 4RDAA 1GM5A 4O6MA 1UG7A 2KSFA 2L7AA 2XL4A 4U5BE 1LI5A 3AJMA 4FX5A 4IARA 3U8VA 1Q0DA 4PK4A 1ZU4A 4CDYA 5BQHA 4N4WA 2VH3A 3LEOA 4GYTA 1APCA 4YT4A 3EG9A 2QUPA 3NYJA 4XPXA 3SEOA 2PF4E 2PFDA 2PX0A 2R03A 2W4MA 2W45A 1OCCC 4IAOA 4Z9HA 2YL7A 2KJGA 3NYLA 3V5ZA 2NUPB 4MW8A 1YZAA 3L8JA 1IZMA 3GWNA 4AK9A 4KI2A 2JX0A 4KNWA 1K40A 2XLEA 2XS8A 3GM1A 5DQZA 4U9EA 2X0CA 4XLPF 1EKYA 3KYIA 1YA9A 3A9CA 3ECSA 1V54C 3AG2C 3ZDLA 2H7VC 1HE1A 4LDRA 2F22A 4LERA 3FHDA 3SYNA 4MVSA 4K0DA 4ER9A 3C62A 3OEOA 2XXAB 2R02A 3EH1A 3U0CA 1VMAA 2XM4A 5JUAA 2DI3A 3VF0A 2AP3A 1ZHZA 3IHUA 1RKEA 3K1IA 3KYJA 3EZIA 2HJMA 2R7QA 3FAJA 4KC9A 4MNDA 4AL1A 1JR8A 4P9FA 1OW8A 1A41A 2NSFA 2WVNA 4N6CA 4YL0A 3I5QA 2A69F 2OJED 1RXQA 4O6YA 3EHNA 2Q4FA 1E2XA 1I5NA 4P6IC 3SXZA 5L0FA 2J0WA 4JEAA 3LLKA 3LNMB 1AVOB 3T4RA 2AWCA 1R5ID 3AG4C 5KYUB 4CSAC 1RJ9A 2W4BA 2HSBA 1SF8A 2VCBA 4JJFA 2VC9A 3G4ZA 4CS7A 1FMVA 2ZPAA 4JKVA 4HE8D 5B3SC 4J7TA 4Z9JA 4AE4B 2IBFA 1YYJA 4E17A 3C8GB 5KYYA 4E7SA 2I8BA 1G4WR 1QKRA 4GEHA 1LI7A 1FR0A 5JVEA 2J9WA 4XWJA 2EPOA 1NU7D 2MYSA 1RKCA 4OIRF 3T6GB 3IQTA 3C8ZA 2BL2A 4QI0A 2LIGA 256BA 3C7JA 3CZ6A 3LAYA 2R7UA 1JOGA 2GAQA 3BEHA 1VLTA 3UGOA 1F1MA 3ABMC 3SNHA 1T6IA 2GWWA 2Q00A 3JRMO 4LLEA 2X51A 4MVOA 4D4XA 4PFOA 3L1MA 3CAXA 4NTBA 3RKOF 4B6IA 2YLGA 2P6VA 4GQHA 4JURI 4Q7CA 5AGFA 4BPMA 5L0GA 4JTCB 2KK1A 3I4UA 5L0HA 1D0ZA 2EPNA 3EHMA 4DVZA 3Q7GA 2EIKC 4A2NB 2NSGA 3S29A 2HFIA 2BC5A 2FAPB 4O79A 4YL1A 1T9KA 2HV7A 1NBBA 2R25A 2YKZA 4U5GA 3EGDA 1LE2A 3E9VA 3EGXB 3FXHA 3K7DA 5EHHA 2XLHA 2R7OA 1Y6DA 2J46A 2IM8A 4OD5A 3F46A 1HY5A 2H7OA 3QZCA 5DS5A 1ORSC 3LS0A 4OINF 2YVKA 3S9OA 3T9OA 1VYIA 2HKVA 2Z15A 3GORA 2A0UA 3RFYA 3QMKA 4QDLA 2J0XA 1EI7A 1KU2A 4DJ9A 5A6BA 2OCCC 4WJ0A 4EBBA 5B1AC 1BR4A 2G3KA 3JYYA 1K04A 3KMIA 1IW7F 3I5PA 3TOMA 1ORYA 3W2WA 1KTMA 3L8IA 4NTFA 2R7WA 2MHRA 1ZVZA 3B0VC 5JP7A 1I4ZA 3W4YA 3W2VA 1CGOA 2J7PD 2R9RB 5FCLA 2EPLX 2ASRA 2HV6A 3EJNA 3H2VA 4DRHB 2DB4A 1G4US 1Z5ZA 2ZXPA 3M1CB 4CJOA 1D0YA 1UFBA 4KBLA 3LS1A 1EA8A 3VYWA 4P9TA 3LLIA 4JVSA 1BR2A 3NMJA 3DD7A 4DBQA 1WOLA 4CS9A 1XZQA 3N2ZB 1HMOA 2IXPA 4H54A 1HW2A 3T6BA 3UNGC 3K1HA 2UUIA 2WZLA 1Y4CA 2XLWA 3N24A 4LACB 4WGYA 3FOOA 5L0CA 2QNLA 1LKXA 3JCUQ 4OIQF 4KNVA 5E2QA 3RVYA 1BZ4A 4O7GA 5T1DB 3V5YA 3EQLF 4BJ6A 1FNTc 3H2UA 2HZ8A 3HNKA 3IQCA 3ZVRA 3QW1A 3IPMO 5A6KA 4U5FE 1M2VA 3TK0A 3POVA 1OW7A 2HMZA 3GEHA 1NFOA 2EIMC 4JC7A 1C03A 3DWWA 4MS2A 5E33A 4RBNA 1FAPB 2Q7RA 2VCCA 3S28A 2E87A 5DQTA 4CS9C 1O3UA 2J45A 3ZSUA 2YLDA 3UMHA 3SXMA 5AC5A 4G0HA 1HE9A 1QZXA 2EINC 2ETSA 2L6GA 2YLIA 3G50A 4LLCA 1OXKA 2LCHA 4XEVA 5BQGA 1OCOC 2LK4A 2DYRC 3JRTA 4C3EA 2A6EF 3U2MA 5BQIA 2A0BA 3NMKA 4K1OA 1Z63A 4XPYA 2TMVP 1ORJA 2J9VA 3MYIA 4YWQA 2NUTB 3AG1C 4IB4A 2RD9A 4WABA 3ZQYA 2A1DD 3A11A 3WODF 3DMDA 4BJ5A 3EFOA 1PCXA 1U6HA 4JCZA 4J30B 3U8PA 2JPUA 2R05A 3ZG1A 5L0JA 2Y3GA 1WN0A 3MYFA 4IRUA 5TJ5E 4FWVA 4C7OB 2WVQA 3TJ6A 2GA0A 2OU6A 1MNDA 1LIHA 2QLAA 1YARO 2O9XA 3AQBA 4HFKB 1WASA 3R2PA 4NQFA 1ZHTA 5HSWA 2CCYA 3DE9A 4JTDB 3HNIA 3NKDA 4EBJA 2Y3BA 4O6NA 5FZTA 4BJTA 1HW1A 3NRHA 1QQ3A 1TWHA 3FVYA 4JIOA 5CIVA 2R7RA 2Q9BA 5COMA 4H4KC 5A6BD 2YL1A 3JTLO 1H7IA 2WVOA 2YL0A 2OKUA 4JZAA 3GANA 1JPNA 2YZSA 2LFFA 3Q6NA 2ZXWC 4ULVA 3B9QA 4IAQA 2QTVA 3N0TA 4BEMJ 1Q0FA 3O55A 1NLXA 1YA7O 2KW3C 2W9YA 1JMWA 2YL3A 2Y69C 3MBGA 1OKKD 2XS1A 1O5HA 3AGUA 4WGZA 4JE9A 2XRHA 1FFHA 2OJQA 2PNOA 3K1IC 1JPJA 2HUJA 5GPGB 3UR3C 1Z6AA 4OIPF 3FMSA 3SP1A 3O6XA 1OKKA 2DGJA 3SXKA 5L3QA 1MQVA 1M2OA 1MMDA 5KYWB 3EG9B 3K66A 4EBKA 1EQ1A 4J7YA 1M56C 2G3VA 1VLSA 2EIJC 1NFNA 1O87A 3PMRA 3TOLA 3VM6A 3LESA 2HJ3A 4ONSA 4CIPA 1TWCA 4Z9IA 3FOPA 3PDMP 2R7VA 4DRIB 1H9GA 2HMQA 4I3MA 4K7BA 3LUTB 1OCRC 1YZCA 3B0PA 2YQYA 3KKBA 4RD9A 3DJUB 2Y3HA 3AG3C 4BJ1A 3KL4A 1S05A 2Y3DA 3Q6MA 2FGYA 3U2LA 4J32B 2R7TA 1ZW2A 1Z7Qc 1ST6A 2CW0F 4IJJA 3QVYA 1WWPA 5JSLA 1OXBA 2EILC 4XQ1A 3PHF2 3SZRA 1T6QA 1FMWA 4G7ZF 1YJGA 1XZPA 3U5SA 3DAFA 1RKEB 4N6HA 4PJJA 1U0BB 1SMYF 4MVMA 5E3CA 5KYXA 2D5RB 2Q9AA 4OD4A 1QSPA 5L0IA 4U5CE 4MVQA 5K0IA 1QLEC 2YHSA 3DE8A 2H7BA 1E85A 5F5FA 5HV9A 3U9JA 3TULA 4D4NA 3MX3A 1BBHA 3DM9B 1B68A 3GWLA 2CNWD 3RVZA 2XLMA 1JAFA 4MTOA 4AX2A 1A0BA 4E0HA 3L0IA 1RJ9B 1T01A 1YLMA 1M6TA 1NU9C 1XWJA 3ASNC 4JCHA 4DVYP 3ABLC 1Q0MA 2CNWA 3Q7LA 4JJGA 1WGWA 1PD0A 2H8AA 3HJCA 1J8MF 2P7VA 4I1MA 1VOMA 2MWQA 3US6A 5KYYB 2NUPA 1V55C 5B3IA 3V5XA 1W2WA 5B1BC 1D1AA 1JRAA 1RCPA 1WTYA 3DXJF 5BUOA 5EGYA 2ZXOA 3J06A 3WAQA 3NDBB 2YRFA 1YDIA 2J7PA 3HKKA 5EK0A 3EPVA 3DAGA 1OCZC
chains in the Genus database with same CATH topology
2GWWA 1L7CA 4ONSA 1DOWA 2X0CA 4K1OA 1U89A 1ZW3A 5L0CA 4DJ9A 3MYIA 3ZDLA 4EHPA 5L0GA 5L0DA 3TJ5A 1DOVA 1U6HA 2LQGA 1SYQA 5L0JA 5L0HA 2IBFA 1T01A 2L7AA 3H2UA 4E17A 1XWJA 1ZW2A 1ZVZA 1ST6A 2B0HA 3TJ6A 3VF0A 1QKRA 1TR2A 1RKEA 2HSQA 3H2VA 4IGGA 4W8PA 1RKCA 3RF3A 3T6GB 4P9TA 4PR9A 5L0IA 1RKEB 2GDCA 1H6GA 3S90A 5FZTA 1YDIA 5L0FA 4E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GWW A;  1L7C A;  4ONS A;  1DOW A;  2X0C A;  4K1O A;  1U89 A;  1ZW3 A;  5L0C A;  4DJ9 A;  3MYI A;  3ZDL A;  4EHP A;  5L0G A;  5L0D A;  3TJ5 A;  1DOV A;  1U6H A;  2LQG A;  1SYQ A;  5L0J A;  5L0H A;  2IBF A;  1T01 A;  2L7A A;  3H2U A;  4E17 A;  1XWJ A;  1ZW2 A;  1ZVZ A;  1ST6 A;  2B0H A;  3TJ6 A;  3VF0 A;  1QKR A;  1TR2 A;  1RKE A;  2HSQ A;  3H2V A;  4IGG A;  4W8P A;  1RKC A;  3RF3 A;  3T6G B;  4P9T A;  4PR9 A;  5L0I A;  1RKE B;  2GDC A;  1H6G A;  3S90 A;  5FZT A;  1YDI A;  5L0F A;  4E18 A; 
#chains in the Genus database with same CATH topology
 1NG1 A;  2PX3 A;  2EPK X;  4EUK B;  2WB7 A;  3E70 C;  3ZTM A;  4DRJ B;  2AVK A;  4IWB A;  1OR3 A;  3IQ5 A;  2XXA A;  3JSZ A;  3KH2 A;  3LJB A;  2PBE A;  5D91 A;  3ZTZ A;  2ZXR A;  4CDV A;  5L0D A;  3VRC A;  5KYN A;  1MMN A;  1TQG A;  4CS8 A;  1VB5 A;  4CBE A;  2L81 A;  2PP4 A;  1AUE A;  2QY9 A;  2Y39 A;  3S84 A;  1L3P A;  3JSE O;  5COG A;  3B0U X;  4YN0 B;  3ASO C;  5JLI A;  1CPR A;  5E3A A;  4JRZ A;  4E7Z A;  2HSQ A;  4N06 A;  3AQC A;  3C63 A;  3FDQ A;  3RF3 A;  4ZLD A;  1YVI A;  2NPU A;  3JT1 A;  2GFH A;  1D0X A;  3EGD B;  1C17 M;  2JD3 A;  2WL8 A;  3HLZ A;  3HNL A;  3HNJ A;  4C3B A;  4YT2 A;  1ZZP A;  2HS5 A;  4M63 A;  3C8G D;  5KYU A;  3WHN A;  4E0I A;  4HFF B;  1BDJ B;  4QI2 A;  1DOW A;  3LEV A;  4MVU A;  1T6U A;  3RQF A;  3DKA A;  3GM2 A;  4XLN F;  2XL6 A;  1LE4 A;  3JYH A;  4AE4 A;  3W8H A;  4BJ6 C;  4CDA A;  4YT8 A;  2IOQ A;  3S27 A;  3DZA A;  3C8G A;  2V26 A;  4DXW A;  3TJ5 A;  1OW6 A;  1ZU5 A;  1N1C A;  3KPH A;  2LQG A;  4PAC A;  4G78 A;  1YAU O;  1H9T A;  3QTH A;  1QPU A;  2KNH A;  2AWY A;  3DI5 A;  1MMA A;  5A69 A;  3RH3 A;  2B0H A;  1CGM E;  2R7S A;  3UMK A;  3V7O A;  1YYX A;  3PCV A;  1MNE A;  1Q0G A;  5A6A A;  1PV3 A;  1K05 A;  3VAY A;  4U5D E;  5F5H A;  1V4A A;  1PD1 A;  3ATP A;  1VTM P;  4PFP A;  3CQZ A;  4MQ9 F;  1CGN A;  5DS6 A;  1GQA A;  5L3V A;  2DYS C;  2OQM A;  1NSG B;  3M4B A;  1G5Z A;  2C04 A;  3S0X A;  2FFH A;  1TWA A;  4I1O B;  1ZYR F;  5T3T A;  4ZLC A;  2EPM X;  2A6H F;  1A7D A;  1D1C A;  2BE5 F;  2P1A A;  2G62 A;  2OG2 A;  2XLD A;  4MVZ A;  4NTA A;  4BJ5 C;  4ANJ A;  3X2Q C;  5JRA A;  2AU5 A;  1FFT C;  3CSK A;  4I44 A;  3GOD A;  4CSA A;  3K6B A;  3T6J A;  2IXM A;  3IQ6 A;  2I15 A;  3EGX A;  4DBR A;  5CI8 A;  4LDK A;  1R4T A;  4JEB A;  4X0R A;  2ICW G;  2IXN A;  3SXY A;  3U9M A;  3DJN B;  1T5O A;  2NG1 A;  3OWT A;  4YL3 A;  2A68 F;  4W8P A;  1LS4 A;  3GM3 A;  3W8I A;  1M2V B;  3RW0 A;  4NC3 A;  4XPW A;  4CIH A;  5A6J A;  2QE9 A;  4BG0 A;  3ZWI A;  3NKE A;  2KC3 A;  4YK5 A;  3UGP A;  1NZE A;  1TFK B;  5IY5 C;  4E18 A;  2WZG A;  4XEF A;  5F28 E;  1L7C A;  1BR1 A;  4CX9 A;  5JS5 A;  1ZW3 A;  4EWC A;  4UDV A;  1LS1 A;  4DOZ A;  4JW1 A;  3MLG A;  4MW3 A;  1E83 A;  1GGQ A;  4MTF A;  1SYQ A;  2Q3T A;  4U5E E;  2D4U A;  3EH2 A;  2L6H A;  1ZHW A;  2LSE A;  5CI9 A;  4JTA B;  3EFO B;  1VK5 A;  2VB6 A;  1HMD A;  2B0J A;  3MFN A;  4PJL A;  1TR2 A;  2WZF A;  2L6F A;  5DLJ A;  1QVX A;  3ITF A;  1OR2 A;  4F4B A;  1SZI A;  2M4E A;  3LNR A;  4R32 A;  4BEJ A;  1ZHY A;  1D1B A;  3H65 A;  2V3C C;  4G7H F;  3R7C A;  4PJN A;  3U3B A;  4G7O F;  1LVK A;  1WAT A;  2OEX A;  3M15 A;  3O10 A;  4XTK A;  1Z23 A;  4A4A A;  4FAP B;  3NMI A;  3OA1 A;  2RSE B;  2LD6 A;  2YEV A;  4MVR A;  2Q9C A;  4ULW A;  4EHP A;  1SR2 A;  3ZQV A;  2KQ9 A;  3F47 A;  3RYL A;  1G8X A;  2P61 A;  3B29 A;  1KNY A;  1Q0K A;  1V74 B;  2J8W A;  2OOC A;  2XLO A;  2ZD9 A;  4YJW A;  3ZC4 A;  4OIO F;  3NYM A;  1C02 A;  4U5H A;  2XLV A;  2KGO A;  3FAP B;  5DVW A;  3QW0 A;  1M57 C;  2CDQ A;  2CGE A;  2J9B A;  2LFD A;  3BRJ A;  1LPE A;  2YWA A;  4IGG A;  3RQE A;  3CEX A;  4W8K A;  2OEV A;  1OQC A;  4XEK A;  4FES A;  2P0N A;  3C18 A;  1H6G A;  4EIY A;  3JZ0 A;  3U3F A;  1GS9 A;  1TFO B;  3ABK C;  3G4X A;  1TWG A;  3RIP A;  2LP4 A;  3GEI A;  2NUT A;  4Q5S F;  2KYH A;  1MMG A;  1VYK A;  2M64 A;  3AOU A;  2R7X A;  3O39 A;  5KYW A;  1A7E A;  1U89 A;  3X1O A;  1LM3 B;  3DM5 A;  3NG1 A;  2VAS A;  1E84 A;  1Z3I X;  3IEE A;  3M4C A;  3L34 A;  5DS4 A;  4C7O A;  1DOV A;  4L6R A;  3WG7 C;  3EZH A;  1I4Y A;  3TD7 A;  1AEP A;  4LDQ A;  2XSE A;  4CJG A;  2C03 A;  5JT4 A;  3B71 A;  3M79 A;  3TQO A;  1RMV A;  1TKN A;  3UMI A;  4NY3 A;  3K33 A;  5COF A;  4PJM A;  2IYL D;  4PR9 A;  2IXO A;  4AL0 A;  2GDC A;  3HTK C;  4C3D A;  2J9U A;  3S90 A;  4EKW A;  1J8Y F;  4U9D A;  4YT5 A;  4HEA J;  2CYD A;  3QVZ A;  4Q4Z F;  1S7Z A;  4NCQ A;  1A7V A;  5D92 A;  1CPQ A;  5KYX B;  3ZIB A;  2VCA A;  5T3W A;  1E86 A;  3RQG A;  2XM0 A;  4MTG A;  3GEE A;  4CS8 C;  1ZHX A;  2L9J A;  2XL8 A;  1FTS A;  2UUH A;  5AC4 A;  3AGT A;  4RDA A;  1GM5 A;  4O6M A;  1UG7 A;  2KSF A;  2L7A A;  2XL4 A;  4U5B E;  1LI5 A;  3AJM A;  4FX5 A;  4IAR A;  3U8V A;  1Q0D A;  4PK4 A;  1ZU4 A;  4CDY A;  5BQH A;  4N4W A;  2VH3 A;  3LEO A;  4GYT A;  1APC A;  4YT4 A;  3EG9 A;  2QUP A;  3NYJ A;  4XPX A;  3SEO A;  2PF4 E;  2PFD A;  2PX0 A;  2R03 A;  2W4M A;  2W45 A;  1OCC C;  4IAO A;  4Z9H A;  2YL7 A;  2KJG A;  3NYL A;  3V5Z A;  2NUP B;  4MW8 A;  1YZA A;  3L8J A;  1IZM A;  3GWN A;  4AK9 A;  4KI2 A;  2JX0 A;  4KNW A;  1K40 A;  2XLE A;  2XS8 A;  3GM1 A;  5DQZ A;  4U9E A;  2X0C A;  4XLP F;  1EKY A;  3KYI A;  1YA9 A;  3A9C A;  3ECS A;  1V54 C;  3AG2 C;  3ZDL A;  2H7V C;  1HE1 A;  4LDR A;  2F22 A;  4LER A;  3FHD A;  3SYN A;  4MVS A;  4K0D A;  4ER9 A;  3C62 A;  3OEO A;  2XXA B;  2R02 A;  3EH1 A;  3U0C A;  1VMA A;  2XM4 A;  5JUA A;  2DI3 A;  3VF0 A;  2AP3 A;  1ZHZ A;  3IHU A;  1RKE A;  3K1I A;  3KYJ A;  3EZI A;  2HJM A;  2R7Q A;  3FAJ A;  4KC9 A;  4MND A;  4AL1 A;  1JR8 A;  4P9F A;  1OW8 A;  1A41 A;  2NSF A;  2WVN A;  4N6C A;  4YL0 A;  3I5Q A;  2A69 F;  2OJE D;  1RXQ A;  4O6Y A;  3EHN A;  2Q4F A;  1E2X A;  1I5N A;  4P6I C;  3SXZ A;  5L0F A;  2J0W A;  4JEA A;  3LLK A;  3LNM B;  1AVO B;  3T4R A;  2AWC A;  1R5I D;  3AG4 C;  5KYU B;  4CSA C;  1RJ9 A;  2W4B A;  2HSB A;  1SF8 A;  2VCB A;  4JJF A;  2VC9 A;  3G4Z A;  4CS7 A;  1FMV A;  2ZPA A;  4JKV A;  4HE8 D;  5B3S C;  4J7T A;  4Z9J A;  4AE4 B;  2IBF A;  1YYJ A;  4E17 A;  3C8G B;  5KYY A;  4E7S A;  2I8B A;  1G4W R;  1QKR A;  4GEH A;  1LI7 A;  1FR0 A;  5JVE A;  2J9W A;  4XWJ A;  2EPO A;  1NU7 D;  2MYS A;  1RKC A;  4OIR F;  3T6G B;  3IQT A;  3C8Z A;  2BL2 A;  4QI0 A;  2LIG A;  256B A;  3C7J A;  3CZ6 A;  3LAY A;  2R7U A;  1JOG A;  2GAQ A;  3BEH A;  1VLT A;  3UGO A;  1F1M A;  3ABM C;  3SNH A;  1T6I A;  2GWW A;  2Q00 A;  3JRM O;  4LLE A;  2X51 A;  4MVO A;  4D4X A;  4PFO A;  3L1M A;  3CAX A;  4NTB A;  3RKO F;  4B6I A;  2YLG A;  2P6V A;  4GQH A;  4JUR I;  4Q7C A;  5AGF A;  4BPM A;  5L0G A;  4JTC B;  2KK1 A;  3I4U A;  5L0H A;  1D0Z A;  2EPN A;  3EHM A;  4DVZ A;  3Q7G A;  2EIK C;  4A2N B;  2NSG A;  3S29 A;  2HFI A;  2BC5 A;  2FAP B;  4O79 A;  4YL1 A;  1T9K A;  2HV7 A;  1NBB A;  2R25 A;  2YKZ A;  4U5G A;  3EGD A;  1LE2 A;  3E9V A;  3EGX B;  3FXH A;  3K7D A;  5EHH A;  2XLH A;  2R7O A;  1Y6D A;  2J46 A;  2IM8 A;  4OD5 A;  3F46 A;  1HY5 A;  2H7O A;  3QZC A;  5DS5 A;  1ORS C;  3LS0 A;  4OIN F;  2YVK A;  3S9O A;  3T9O A;  1VYI A;  2HKV A;  2Z15 A;  3GOR A;  2A0U A;  3RFY A;  3QMK A;  4QDL A;  2J0X A;  1EI7 A;  1KU2 A;  4DJ9 A;  5A6B A;  2OCC C;  4WJ0 A;  4EBB A;  5B1A C;  1BR4 A;  2G3K A;  3JYY A;  1K04 A;  3KMI A;  1IW7 F;  3I5P A;  3TOM A;  1ORY A;  3W2W A;  1KTM A;  3L8I A;  4NTF A;  2R7W A;  2MHR A;  1ZVZ A;  3B0V C;  5JP7 A;  1I4Z A;  3W4Y A;  3W2V A;  1CGO A;  2J7P D;  2R9R B;  5FCL A;  2EPL X;  2ASR A;  2HV6 A;  3EJN A;  3H2V A;  4DRH B;  2DB4 A;  1G4U S;  1Z5Z A;  2ZXP A;  3M1C B;  4CJO A;  1D0Y A;  1UFB A;  4KBL A;  3LS1 A;  1EA8 A;  3VYW A;  4P9T A;  3LLI A;  4JVS A;  1BR2 A;  3NMJ A;  3DD7 A;  4DBQ A;  1WOL A;  4CS9 A;  1XZQ A;  3N2Z B;  1HMO A;  2IXP A;  4H54 A;  1HW2 A;  3T6B A;  3UNG C;  3K1H A;  2UUI A;  2WZL A;  1Y4C A;  2XLW A;  3N24 A;  4LAC B;  4WGY A;  3FOO A;  5L0C A;  2QNL A;  1LKX A;  3JCU Q;  4OIQ F;  4KNV A;  5E2Q A;  3RVY A;  1BZ4 A;  4O7G A;  5T1D B;  3V5Y A;  3EQL F;  4BJ6 A;  1FNT c;  3H2U A;  2HZ8 A;  3HNK A;  3IQC A;  3ZVR A;  3QW1 A;  3IPM O;  5A6K A;  4U5F E;  1M2V A;  3TK0 A;  3POV A;  1OW7 A;  2HMZ A;  3GEH A;  1NFO A;  2EIM C;  4JC7 A;  1C03 A;  3DWW A;  4MS2 A;  5E33 A;  4RBN A;  1FAP B;  2Q7R A;  2VCC A;  3S28 A;  2E87 A;  5DQT A;  4CS9 C;  1O3U A;  2J45 A;  3ZSU A;  2YLD A;  3UMH A;  3SXM A;  5AC5 A;  4G0H A;  1HE9 A;  1QZX A;  2EIN C;  2ETS A;  2L6G A;  2YLI A;  3G50 A;  4LLC A;  1OXK A;  2LCH A;  4XEV A;  5BQG A;  1OCO C;  2LK4 A;  2DYR C;  3JRT A;  4C3E A;  2A6E F;  3U2M A;  5BQI A;  2A0B A;  3NMK A;  4K1O A;  1Z63 A;  4XPY A;  2TMV P;  1ORJ A;  2J9V A;  3MYI A;  4YWQ A;  2NUT B;  3AG1 C;  4IB4 A;  2RD9 A;  4WAB A;  3ZQY A;  2A1D D;  3A11 A;  3WOD F;  3DMD A;  4BJ5 A;  3EFO A;  1PCX A;  1U6H A;  4JCZ A;  4J30 B;  3U8P A;  2JPU A;  2R05 A;  3ZG1 A;  5L0J A;  2Y3G A;  1WN0 A;  3MYF A;  4IRU A;  5TJ5 E;  4FWV A;  4C7O B;  2WVQ A;  3TJ6 A;  2GA0 A;  2OU6 A;  1MND A;  1LIH A;  2QLA A;  1YAR O;  2O9X A;  3AQB A;  4HFK B;  1WAS A;  3R2P A;  4NQF A;  1ZHT A;  5HSW A;  2CCY A;  3DE9 A;  4JTD B;  3HNI A;  3NKD A;  4EBJ A;  2Y3B A;  4O6N A;  5FZT A;  4BJT A;  1HW1 A;  3NRH A;  1QQ3 A;  1TWH A;  3FVY A;  4JIO A;  5CIV A;  2R7R A;  2Q9B A;  5COM A;  4H4K C;  5A6B D;  2YL1 A;  3JTL O;  1H7I A;  2WVO A;  2YL0 A;  2OKU A;  4JZA A;  3GAN A;  1JPN A;  2YZS A;  2LFF A;  3Q6N A;  2ZXW C;  4ULV A;  3B9Q A;  4IAQ A;  2QTV A;  3N0T A;  4BEM J;  1Q0F A;  3O55 A;  1NLX A;  1YA7 O;  2KW3 C;  2W9Y A;  1JMW A;  2YL3 A;  2Y69 C;  3MBG A;  1OKK D;  2XS1 A;  1O5H A;  3AGU A;  4WGZ A;  4JE9 A;  2XRH A;  1FFH A;  2OJQ A;  2PNO A;  3K1I C;  1JPJ A;  2HUJ A;  5GPG B;  3UR3 C;  1Z6A A;  4OIP F;  3FMS A;  3SP1 A;  3O6X A;  1OKK A;  2DGJ A;  3SXK A;  5L3Q A;  1MQV A;  1M2O A;  1MMD A;  5KYW B;  3EG9 B;  3K66 A;  4EBK A;  1EQ1 A;  4J7Y A;  1M56 C;  2G3V A;  1VLS A;  2EIJ C;  1NFN A;  1O87 A;  3PMR A;  3TOL A;  3VM6 A;  3LES A;  2HJ3 A;  4ONS A;  4CIP A;  1TWC A;  4Z9I A;  3FOP A;  3PDM P;  2R7V A;  4DRI B;  1H9G A;  2HMQ A;  4I3M A;  4K7B A;  3LUT B;  1OCR C;  1YZC A;  3B0P A;  2YQY A;  3KKB A;  4RD9 A;  3DJU B;  2Y3H A;  3AG3 C;  4BJ1 A;  3KL4 A;  1S05 A;  2Y3D A;  3Q6M A;  2FGY A;  3U2L A;  4J32 B;  2R7T A;  1ZW2 A;  1Z7Q c;  1ST6 A;  2CW0 F;  4IJJ A;  3QVY A;  1WWP A;  5JSL A;  1OXB A;  2EIL C;  4XQ1 A;  3PHF 2;  3SZR A;  1T6Q A;  1FMW A;  4G7Z F;  1YJG A;  1XZP A;  3U5S A;  3DAF A;  1RKE B;  4N6H A;  4PJJ A;  1U0B B;  1SMY F;  4MVM A;  5E3C A;  5KYX A;  2D5R B;  2Q9A A;  4OD4 A;  1QSP A;  5L0I A;  4U5C E;  4MVQ A;  5K0I A;  1QLE C;  2YHS A;  3DE8 A;  2H7B A;  1E85 A;  5F5F A;  5HV9 A;  3U9J A;  3TUL A;  4D4N A;  3MX3 A;  1BBH A;  3DM9 B;  1B68 A;  3GWL A;  2CNW D;  3RVZ A;  2XLM A;  1JAF A;  4MTO A;  4AX2 A;  1A0B A;  4E0H A;  3L0I A;  1RJ9 B;  1T01 A;  1YLM A;  1M6T A;  1NU9 C;  1XWJ A;  3ASN C;  4JCH A;  4DVY P;  3ABL C;  1Q0M A;  2CNW A;  3Q7L A;  4JJG A;  1WGW A;  1PD0 A;  2H8A A;  3HJC A;  1J8M F;  2P7V A;  4I1M A;  1VOM A;  2MWQ A;  3US6 A;  5KYY B;  2NUP A;  1V55 C;  5B3I A;  3V5X A;  1W2W A;  5B1B C;  1D1A A;  1JRA A;  1RCP A;  1WTY A;  3DXJ F;  5BUO A;  5EGY A;  2ZXO A;  3J06 A;  3WAQ A;  3NDB B;  2YRF A;  1YDI A;  2J7P A;  3HKK A;  5EK0 A;  3EPV A;  3DAG A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 2GWW A;  1L7C A;  4ONS A;  1DOW A;  2X0C A;  4K1O A;  1U89 A;  1ZW3 A;  5L0C A;  4DJ9 A;  3MYI A;  3ZDL A;  4EHP A;  5L0G A;  5L0D A;  3TJ5 A;  1DOV A;  1U6H A;  2LQG A;  1SYQ A;  5L0J A;  5L0H A;  2IBF A;  1T01 A;  2L7A A;  3H2U A;  4E17 A;  1XWJ A;  1ZW2 A;  1ZVZ A;  1ST6 A;  2B0H A;  3TJ6 A;  3VF0 A;  1QKR A;  1TR2 A;  1RKE A;  2HSQ A;  3H2V A;  4IGG A;  4W8P A;  1RKC A;  3RF3 A;  3T6G B;  4P9T A;  4PR9 A;  5L0I A;  1RKE B;  2GDC A;  1H6G A;  3S90 A;  5FZT A;  1YDI A;  5L0F A;  4E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...