4DRHB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
AMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 39
structure length 95
sequence length 95
chains with identical sequence E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4drhB00
3FAPB 1FAPB 2RSEB 2GAQA 2FAPB 5GPGB 4DRIB 1AUEA 4FAPB 4DRJB 2NPUA 1NSGB 4DRHB
chains in the Genus database with same CATH superfamily
4J32B 4E17A 1Z5ZA 3IQ6A 3QTHA 2EPNA 3CSKA 3H2UA 4BJ5C 1RJ9A 1M56C 4Z9IA 1MMNA 1VYIA 2YKZA 4BJ1A 1JAFA 1NU9C 2LK4A 4CS9A 1BR1A 1E86A 2PX3A 3IQCA 1AUEA 3HNJA 4U5HA 4MVSA 5AC4A 3KPHA 1FR0A 1JPJA 1NSGB 4BEJA 1SF8A 3S27A 4XLPF 2KJGA 3FMSA 5KYXA 3GM1A 3V7OA 1RKEB 4A2NB 2VASA 3EZIA 5DVWA 5L0DA 1PCXA 3IEEA 3LEVA 2EILC 2TMVP 2Q9BA 3OWTA 4O6NA 2L9JA 2P0NA 2MYSA 4YT5A 2O9XA 3C7JA 2WL8A 1C02A 2IM8A 2XLMA 2XS8A 4AK9A 4PACA 5DQZA 3EGXA 5B3SC 3GM3A 3DE9A 3N2ZB 2Y3BA 2YWAA 2AVKA 3HLZA 5AGFA 2YZSA 2X0CA 3TK0A 3V5XA 3C8GB 5AC5A 1PD0A 1H9TA 1YZCA 1ZHWA 3AQBA 3LUTB 4NTBA 1I5NA 3U8PA 4JEBA 1HW1A 3DE8A 3K7DA 5CI9A 5HSWA 4LDKA 5EGYA 4DRHB 1NU7D 1TWGA 4Q7CA 4AL0A 3SYNA 2FAPB 3SXKA 4DRIB 3X2QC 1F1MA 1J8MF 1FTSA 2A6EF 3X1OA 4P9TA 1LPEA 4EUKB 1OCRC 5KYYA 3QW0A 5T3TA 1RXQA 1WN0A 3HKKA 3RYLA 1VB5A 4AX2A 3K1IA 2P7VA 2R7VA 2HKVA 4JE9A 4O7GA 3ZQYA 1DOVA 1LS1A 1NFOA 1TWCA 2HMQA 4CDYA 1HW2A 2IXPA 1S05A 2WB7A 2J9UA 1G4WR 1Z3IX 1A7VA 1EI7A 3U0CA 1C17M 1YLMA 1ZW3A 4U5DE 3V5ZA 4IB4A 4D4XA 4DOZA 3ASNC 3AG2C 1Q0FA 4YK5A 4PJJA 3ZVRA 4EIYA 1RJ9B 4EKWA 1APCA 3LNMB 5FCLA 3PDMP 2GFHA 4E7ZA 3SXYA 2CW0F 2W9YA 2R05A 1D0ZA 3QMKA 5JRAA 4XLNF 4NY3A 1LIHA 3K1HA 4G7ZF 1LS4A 4CS8A 1GM5A 2XRHA 3NDBB 3G50A 1TKNA 2HJMA 4YT8A 3E70C 4J7TA 4EBJA 2ZPAA 3ZC4A 2QY9A 3C8ZA 4KNVA 3ZG1A 4QI2A 2ETSA 2LFFA 1CGNA 2R03A 2G3VA 2IXMA 1M2VA 2HSBA 3M15A 2OQMA 3DJNB 2CYDA 3EGXB 1OQCA 1OR2A 2PNOA 4WGZA 1O3UA 5COMA 4CSAC 3DZAA 3GODA 4JKVA 5L0HA 2LSEA 2XS1A 3ABMC 3VAYA 1KTMA 5CIVA 3NMIA 4HFKB 4JW1A 4XPWA 1E83A 2WVNA 3EGDA 3IHUA 4P6IC 3M4CA 1SMYF 4WGYA 3SNHA 4FAPB 1LI5A 3LESA 2AWYA 3DJUB 3E9VA 1Q0MA 5KYNA 3HJCA 2YL3A 1CPQA 4OD4A 5B1AC 3GEEA 1AEPA 2L81A 3DAFA 5KYYB 2NSFA 3PCVA 2IYLD 1NG1A 3LLIA 4NTAA 1JR8A 1XZQA 1J8YF 3BRJA 2VB6A 3T6JA 1OXKA 3AOUA 2DI3A 3EHNA 3CAXA 1FNTc 2R7XA 2A69F 3EFOA 3RF3A 2OJQA 3POVA 2Q00A 3ABKC 4DJ9A 3KL4A 2OG2A 3UNGC 2DB4A 2Y3DA 1GS9A 3OA1A 3U2LA 2Q4FA 3DM9B 4YL3A 3T6GB 3ZDLA 4U5EE 3RQGA 1Q0DA 4JJFA 3ZQVA 3S0XA 3S84A 1RMVA 4KNWA 1K05A 4DBQA 2BE5F 4DVZA 2W45A 2V3CC 1YYXA 2VCBA 2XM0A 4J7YA 4IARA 2EIJC 2JX0A 3MYIA 4JTAB 5EHHA 2NUPA 2VC9A 3KH2A 2H8AA 3NMJA 3NMKA 3Q7LA 1QQ3A 3VM6A 3W8HA 2ZXWC 3WG7C 3L1MA 3V5YA 4RD9A 2J0XA 1L7CA 3B0UX 2R25A 3S9OA 3TJ6A 1SYQA 2OEVA 4NC3A 2DYSC 1JMWA 1M2VB 2RSEB 5HV9A 3LJBA 3TJ5A 1PD1A 2LIGA 1S7ZA 2ZXRA 2UUHA 3CQZA 4U5BE 4W8PA 4AL1A 5F28E 1A7EA 2I8BA 2R7UA 1I4YA 2EPLX 5JVEA 2LP4A 4EWCA 3EGDB 4FESA 1YARO 4XEKA 4UDVA 2A1DD 3RQFA 3ABLC 4LLCA 3JYYA 5BQIA 4I44A 5BQGA 3JRMO 1MMDA 3HNKA 2KK1A 2R7WA 3H65A 2Q3TA 2Y39A 1T01A 3DKAA 1MQVA 3K1IC 3US6A 4MTGA 1U6HA 5L0GA 2YL0A 3AGTA 1BBHA 3PMRA 4XWJA 1EKYA 4U9DA 2YLDA 4L6RA 1QKRA 2J0WA 2XXAB 5KYUA 2IOQA 3C62A 3EFOB 4KI2A 1VK5A 2XLDA 1TWHA 5EK0A 2QE9A 4RDAA 2YQYA 4K0DA 1D0YA 1QLEC 1SR2A 3T6BA 3GWLA 4CIHA 4XEVA 2XM4A 4LLEA 4FWVA 4HFFB 2VCCA 4ONSA 4CS8C 1Q0KA 4OIQF 3I5PA 1ZZPA 5B3IA 2P6VA 1HE1A 5DS4A 3F46A 2NG1A 1V74B 4Z9JA 3HNLA 2R7TA 2NUPB 1G5ZA 3NYJA 4ULWA 3UR3C 4YL1A 2LFDA 1YVIA 2F22A 2PP4A 4JCHA 2W4BA 5JS5A 1JPNA 4CBEA 3DD7A 2YEVA 3O39A 2HJ3A 5L0FA 3L8IA 3RVZA 3TOLA 5JSLA 1M57C 3EJNA 2EPMX 3I5QA 3LNRA 3NYMA 4MTFA 4PJNA 1YDIA 2Q9AA 1Q0GA 2J9VA 4ANJA 2Q7RA 3L0IA 4PFPA 4BJ6A 5JT4A 5D91A 1IZMA 2QLAA 4BJ5A 4ULVA 4G7HF 2GDCA 4I1MA 2GA0A 4PK4A 2OJED 3FOPA 1ORSC 1G8XA 1WTYA 3DI5A 3FXHA 3RW0A 2XL4A 4JRZA 3SP1A 2R7SA 2G3KA 5T3WA 1EQ1A 2EIMC 3EG9B 5A69A 4G7OF 1ORYA 1E84A 3LEOA 1QSPA 2GWWA 5L0IA 2YLGA 2KGOA 2QNLA 3MYFA 1QPUA 4NQFA 2IBFA 3G4ZA 4O6MA 3Q6MA 5KYUB 3AG4C 4E18A 2A6HF 3G4XA 5COGA 3S90A 3OEOA 4CDVA 2WZFA 3KYIA 2R9RB 2B0JA 2L6FA 2XLWA 1CPRA 2HMZA 4KBLA 5F5HA 3U2MA 2LQGA 3W2VA 1WGWA 4IJJA 5FZTA 1VLTA 3A11A 4YN0B 3VYWA 2JPUA 3WODF 4D4NA 5IY5C 3RIPA 3GORA 1ORJA 3DXJF 5A6JA 3RVYA 1H6GA 3IPMO 2EINC 1Z6AA 256BA 4BJTA 1ST6A 5L3VA 1LKXA 5TJ5E 1TR2A 2ZXOA 3K66A 1OCOC 1R5ID 2XLHA 1HMOA 4U9EA 4XTKA 1VLSA 4IRUA 1T6IA 2D4UA 3ASOC 4OD5A 4CX9A 1ZHZA 2XXAA 3LAYA 2EPKX 5A6BD 1TFKB 4A4AA 3B9QA 2R7OA 3N24A 1VOMA 3B0PA 3T9OA 2UUIA 3I4UA 1ZW2A 2ZD9A 4I3MA 2HS5A 4CS9C 3J06A 5E3CA 3CEXA 4CS7A 3GM2A 4MVZA 3FDQA 4LERA 2EIKC 2BC5A 1QVXA 3ZIBA 4AE4A 1BR2A 2DGJA 3A9CA 3ATPA 2J45A 5KYXB 3BEHA 4QI0A 1LE4A 2AP3A 1FAPB 2W4MA 5B1BC 3KKBA 2E87A 3B0VC 1UG7A 1WATA 1E2XA 3W4YA 1YZAA 1CGOA 4PJLA 2CGEA 1ZHXA 3LS1A 4YWQA 2J8WA 3SXMA 1WOLA 1ZU5A 4JTCB 3IQTA 1E85A 3W8IA 1KU2A 3NYLA 3O6XA 4BPMA 1FMWA 3FAPB 5A6KA 3N0TA 4G0HA 4MW3A 4MVQA 4B6IA 2WZLA 4C3EA 3JZ0A 1ZHYA 2MWQA 2EPOA 2L7AA 1O87A 1I4ZA 1UFBA 3GEHA 4LACB 2OCCC 5A6AA 1MNEA 1NZEA 3B71A 1JRAA 4IGGA 2NUTA 2KNHA 1K40A 4CDAA 3FHDA 5E2QA 5JP7A 5D92A 4O79A 3FVYA 2Y69C 3EZHA 1B68A 2Q9CA 3U8VA 1ZYRF 1BDJB 2VH3A 1Z7Qc 3SZRA 4YT4A 3C8GD 5BQHA 2HUJA 2PBEA 5KYWA 3ITFA 1WWPA 3ECSA 3EG9A 3RH3A 3TULA 4GQHA 1G4US 1A0BA 4NCQA 2KW3C 4U5FE 3C18A 1OW7A 1RCPA 3VF0A 5JLIA 4HEAJ 2A0BA 4WABA 2KYHA 4R32A 2WVOA 4YJWA 4BJ6C 5DS6A 1D1BA 3IQ5A 3JSEO 2XLVA 3HNIA 3MBGA 4KC9A 4PJMA 3UGOA 2L6GA 2WVQA 3EPVA 4JURI 2H7VC 3JT1A 3QVYA 4EBKA 4C7OA 1H7IA 4IAQA 1OKKA 4JJGA 3AJMA 2G62A 3TD7A 3KYJA 4YT2A 5L3QA 2GAQA 1ZU4A 3U9MA 1NBBA 4AE4B 3H2VA 4JVSA 1YYJA 3GEIA 4F4BA 3Q6NA 2PX0A 1MMAA 3NRHA 3U3FA 1MNDA 1OXBA 4HE8D 2J9WA 1M2OA 4O6YA 3QZCA 5JUAA 4EHPA 4IWBA 1YJGA 1NLXA 1HE9A 1QZXA 2KC3A 2IXOA 1V54C 3SXZA 2DYRC 2H7BA 4JZAA 4X0RA 2QTVA 1OCZC 2L6HA 1V55C 5COFA 4E0HA 1OKKD 4MTOA 3HTKC 3Q7GA 2HFIA 3R2PA 4N4WA 1N1CA 4J30B 4MVMA 1H9GA 1U89A 3EH2A 3MFNA 2VCAA 2YLIA 4K7BA 2HV7A 4NTFA 4JEAA 2AWCA 3JSZA 1W2WA 1PV3A 4FX5A 1Y4CA 3DWWA 4PR9A 1FFHA 1NFNA 1A7DA 1VMAA 4IAOA 4GYTA 2HV6A 4Z9HA 3U9JA 2NUTB 2ASRA 5GPGB 1GQAA 2A68F 3L34A 1JOGA 3M79A 2CCYA 3UMIA 2C03A 4Q4ZF 4RBNA 2CNWA 5L0CA 1FMVA 2JD3A 3EHMA 3QW1A 3WAQA 4MW8A 4EBBA 1OW8A 3S29A 3TQOA 1AVOB 2YHSA 2FGYA 3K6BA 4W8KA 4MS2A 5KYWB 1ZVZA 3R7CA 4DRJB 4BEMJ 3AGUA 2LD6A 2YL7A 4N6HA 1SZIA 2YRFA 4E7SA 4JC7A 2CDQA 4XQ1A 1O5HA 3FAJA 3EH1A 1LVKA 3WHNA 2CNWD 2J46A 2M4EA 4K1OA 1Y6DA 2OOCA 3JRTA 1OCCC 4P9FA 3DMDA 1EA8A 2I15A 2PF4E 2XSEA 5BUOA 4CIPA 2YVKA 4C7OB 3AQCA 4JIOA 4XPXA 1DOWA 1OW6A 3AG1C 3GANA 3T4RA 2KQ9A 2Z15A 3RFYA 4CJOA 5A6BA 3AG3C 1GGQA 2J9BA 1A41A 1LE2A 3NKDA 3NG1A 4U5GA 1CGME 2WZGA 2R7RA 3LLKA 4ZLCA 3UGPA 4ZLDA 1FFTC 1TFOB 1XWJA 1OR3A 3LS0A 4N6CA 2HSQA 5T1DB 2H7OA 4OIRF 4OIOF 1TWAA 4ER9A 2LCHA 3ZTZA 2FFHA 3UMKA 1HY5A 1V4AA 2V26A 3O10A 1VYKA 1K04A 1T6QA 1Z63A 4LDRA 2NPUA 4C3DA 2ZXPA 4DBRA 3DAGA 3M1CB 2BL2A 4XEFA 4I1OB 4U5CE 4GEHA 2PFDA 3RKOF 2J7PA 4JCZA 4JTDB 2MHRA 3CZ6A 2Y3GA 2XLEA 4PFOA 2R02A 3GWNA 3JTLO 5CI8A 3L8JA 4BG0A 3VRCA 3EQLF 1M6TA 3DM5A 3MX3A 5DS5A 2Y3HA 2OEXA 4G78A 4MNDA 4MVRA 1LM3B 3W2WA 4CJGA 2OU6A 4DVYP 4Q5SF 4MQ9F 1VTMP 1HMDA 1RKCA 2RD9A 1XZPA 3U5SA 1C03A 1T6UA 4XPYA 1BZ4A 1RKEA 5E3AA 3O55A 3FOOA 4M63A 4H4KC 1WASA 2P1AA 1YAUO 2ICWG 2A0UA 2J7PD 3U3BA 3PHF2 1BR4A 5DLJA 1KNYA 3F47A 1IW7F 1T9KA 4YL0A 1LI7A 1D1AA 2OKUA 2R7QA 2XLOA 3C8GA 4H54A 4OINF 4E0IA 2YL1A 4C3BA 5L0JA 3ZSUA 4CSAA 4OIPF 3B29A 3JCUQ 1L3PA 1R4TA 2QUPA 3QVZA 2B0HA 2M64A 1TQGA 3S28A 1YA7O 1D1CA 1ZHTA 2C04A 3UMHA 3TOMA 2X51A 2NSGA 1U0BB 4DXWA 2XL8A 3JYHA 2D5RB 3M4BA 3MLGA 3ZTMA 4WJ0A 4LDQA 4QDLA 3K33A 5DQTA 2KSFA 5K0IA 5F5FA 3KMIA 1D0XA 1T5OA 3NKEA 3C63A 2AU5A 4N06A 3SEOA 2XL6A 1Z23A 1MMGA 2IXNA 3RQEA 1YA9A 2HZ8A 4MVUA 4MVOA 3ZWIA 2P61A 5E33A
chains in the Genus database with same CATH topology
3FAPB 1FAPB 2RSEB 2GAQA 2FAPB 5GPGB 4DRIB 1AUEA 4FAPB 4DRJB 2NPUA 1NSGB 4DRHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP B;  1FAP B;  2RSE B;  2GAQ A;  2FAP B;  5GPG B;  4DRI B;  1AUE A;  4FAP B;  4DRJ B;  2NPU A;  1NSG B;  4DRH B; 
#chains in the Genus database with same CATH topology
 4J32 B;  4E17 A;  1Z5Z A;  3IQ6 A;  3QTH A;  2EPN A;  3CSK A;  3H2U A;  4BJ5 C;  1RJ9 A;  1M56 C;  4Z9I A;  1MMN A;  1VYI A;  2YKZ A;  4BJ1 A;  1JAF A;  1NU9 C;  2LK4 A;  4CS9 A;  1BR1 A;  1E86 A;  2PX3 A;  3IQC A;  1AUE A;  3HNJ A;  4U5H A;  4MVS A;  5AC4 A;  3KPH A;  1FR0 A;  1JPJ A;  1NSG B;  4BEJ A;  1SF8 A;  3S27 A;  4XLP F;  2KJG A;  3FMS A;  5KYX A;  3GM1 A;  3V7O A;  1RKE B;  4A2N B;  2VAS A;  3EZI A;  5DVW A;  5L0D A;  1PCX A;  3IEE A;  3LEV A;  2EIL C;  2TMV P;  2Q9B A;  3OWT A;  4O6N A;  2L9J A;  2P0N A;  2MYS A;  4YT5 A;  2O9X A;  3C7J A;  2WL8 A;  1C02 A;  2IM8 A;  2XLM A;  2XS8 A;  4AK9 A;  4PAC A;  5DQZ A;  3EGX A;  5B3S C;  3GM3 A;  3DE9 A;  3N2Z B;  2Y3B A;  2YWA A;  2AVK A;  3HLZ A;  5AGF A;  2YZS A;  2X0C A;  3TK0 A;  3V5X A;  3C8G B;  5AC5 A;  1PD0 A;  1H9T A;  1YZC A;  1ZHW A;  3AQB A;  3LUT B;  4NTB A;  1I5N A;  3U8P A;  4JEB A;  1HW1 A;  3DE8 A;  3K7D A;  5CI9 A;  5HSW A;  4LDK A;  5EGY A;  4DRH B;  1NU7 D;  1TWG A;  4Q7C A;  4AL0 A;  3SYN A;  2FAP B;  3SXK A;  4DRI B;  3X2Q C;  1F1M A;  1J8M F;  1FTS A;  2A6E F;  3X1O A;  4P9T A;  1LPE A;  4EUK B;  1OCR C;  5KYY A;  3QW0 A;  5T3T A;  1RXQ A;  1WN0 A;  3HKK A;  3RYL A;  1VB5 A;  4AX2 A;  3K1I A;  2P7V A;  2R7V A;  2HKV A;  4JE9 A;  4O7G A;  3ZQY A;  1DOV A;  1LS1 A;  1NFO A;  1TWC A;  2HMQ A;  4CDY A;  1HW2 A;  2IXP A;  1S05 A;  2WB7 A;  2J9U A;  1G4W R;  1Z3I X;  1A7V A;  1EI7 A;  3U0C A;  1C17 M;  1YLM A;  1ZW3 A;  4U5D E;  3V5Z A;  4IB4 A;  4D4X A;  4DOZ A;  3ASN C;  3AG2 C;  1Q0F A;  4YK5 A;  4PJJ A;  3ZVR A;  4EIY A;  1RJ9 B;  4EKW A;  1APC A;  3LNM B;  5FCL A;  3PDM P;  2GFH A;  4E7Z A;  3SXY A;  2CW0 F;  2W9Y A;  2R05 A;  1D0Z A;  3QMK A;  5JRA A;  4XLN F;  4NY3 A;  1LIH A;  3K1H A;  4G7Z F;  1LS4 A;  4CS8 A;  1GM5 A;  2XRH A;  3NDB B;  3G50 A;  1TKN A;  2HJM A;  4YT8 A;  3E70 C;  4J7T A;  4EBJ A;  2ZPA A;  3ZC4 A;  2QY9 A;  3C8Z A;  4KNV A;  3ZG1 A;  4QI2 A;  2ETS A;  2LFF A;  1CGN A;  2R03 A;  2G3V A;  2IXM A;  1M2V A;  2HSB A;  3M15 A;  2OQM A;  3DJN B;  2CYD A;  3EGX B;  1OQC A;  1OR2 A;  2PNO A;  4WGZ A;  1O3U A;  5COM A;  4CSA C;  3DZA A;  3GOD A;  4JKV A;  5L0H A;  2LSE A;  2XS1 A;  3ABM C;  3VAY A;  1KTM A;  5CIV A;  3NMI A;  4HFK B;  4JW1 A;  4XPW A;  1E83 A;  2WVN A;  3EGD A;  3IHU A;  4P6I C;  3M4C A;  1SMY F;  4WGY A;  3SNH A;  4FAP B;  1LI5 A;  3LES A;  2AWY A;  3DJU B;  3E9V A;  1Q0M A;  5KYN A;  3HJC A;  2YL3 A;  1CPQ A;  4OD4 A;  5B1A C;  3GEE A;  1AEP A;  2L81 A;  3DAF A;  5KYY B;  2NSF A;  3PCV A;  2IYL D;  1NG1 A;  3LLI A;  4NTA A;  1JR8 A;  1XZQ A;  1J8Y F;  3BRJ A;  2VB6 A;  3T6J A;  1OXK A;  3AOU A;  2DI3 A;  3EHN A;  3CAX A;  1FNT c;  2R7X A;  2A69 F;  3EFO A;  3RF3 A;  2OJQ A;  3POV A;  2Q00 A;  3ABK C;  4DJ9 A;  3KL4 A;  2OG2 A;  3UNG C;  2DB4 A;  2Y3D A;  1GS9 A;  3OA1 A;  3U2L A;  2Q4F A;  3DM9 B;  4YL3 A;  3T6G B;  3ZDL A;  4U5E E;  3RQG A;  1Q0D A;  4JJF A;  3ZQV A;  3S0X A;  3S84 A;  1RMV A;  4KNW A;  1K05 A;  4DBQ A;  2BE5 F;  4DVZ A;  2W45 A;  2V3C C;  1YYX A;  2VCB A;  2XM0 A;  4J7Y A;  4IAR A;  2EIJ C;  2JX0 A;  3MYI A;  4JTA B;  5EHH A;  2NUP A;  2VC9 A;  3KH2 A;  2H8A A;  3NMJ A;  3NMK A;  3Q7L A;  1QQ3 A;  3VM6 A;  3W8H A;  2ZXW C;  3WG7 C;  3L1M A;  3V5Y A;  4RD9 A;  2J0X A;  1L7C A;  3B0U X;  2R25 A;  3S9O A;  3TJ6 A;  1SYQ A;  2OEV A;  4NC3 A;  2DYS C;  1JMW A;  1M2V B;  2RSE B;  5HV9 A;  3LJB A;  3TJ5 A;  1PD1 A;  2LIG A;  1S7Z A;  2ZXR A;  2UUH A;  3CQZ A;  4U5B E;  4W8P A;  4AL1 A;  5F28 E;  1A7E A;  2I8B A;  2R7U A;  1I4Y A;  2EPL X;  5JVE A;  2LP4 A;  4EWC A;  3EGD B;  4FES A;  1YAR O;  4XEK A;  4UDV A;  2A1D D;  3RQF A;  3ABL C;  4LLC A;  3JYY A;  5BQI A;  4I44 A;  5BQG A;  3JRM O;  1MMD A;  3HNK A;  2KK1 A;  2R7W A;  3H65 A;  2Q3T A;  2Y39 A;  1T01 A;  3DKA A;  1MQV A;  3K1I C;  3US6 A;  4MTG A;  1U6H A;  5L0G A;  2YL0 A;  3AGT A;  1BBH A;  3PMR A;  4XWJ A;  1EKY A;  4U9D A;  2YLD A;  4L6R A;  1QKR A;  2J0W A;  2XXA B;  5KYU A;  2IOQ A;  3C62 A;  3EFO B;  4KI2 A;  1VK5 A;  2XLD A;  1TWH A;  5EK0 A;  2QE9 A;  4RDA A;  2YQY A;  4K0D A;  1D0Y A;  1QLE C;  1SR2 A;  3T6B A;  3GWL A;  4CIH A;  4XEV A;  2XM4 A;  4LLE A;  4FWV A;  4HFF B;  2VCC A;  4ONS A;  4CS8 C;  1Q0K A;  4OIQ F;  3I5P A;  1ZZP A;  5B3I A;  2P6V A;  1HE1 A;  5DS4 A;  3F46 A;  2NG1 A;  1V74 B;  4Z9J A;  3HNL A;  2R7T A;  2NUP B;  1G5Z A;  3NYJ A;  4ULW A;  3UR3 C;  4YL1 A;  2LFD A;  1YVI A;  2F22 A;  2PP4 A;  4JCH A;  2W4B A;  5JS5 A;  1JPN A;  4CBE A;  3DD7 A;  2YEV A;  3O39 A;  2HJ3 A;  5L0F A;  3L8I A;  3RVZ A;  3TOL A;  5JSL A;  1M57 C;  3EJN A;  2EPM X;  3I5Q A;  3LNR A;  3NYM A;  4MTF A;  4PJN A;  1YDI A;  2Q9A A;  1Q0G A;  2J9V A;  4ANJ A;  2Q7R A;  3L0I A;  4PFP A;  4BJ6 A;  5JT4 A;  5D91 A;  1IZM A;  2QLA A;  4BJ5 A;  4ULV A;  4G7H F;  2GDC A;  4I1M A;  2GA0 A;  4PK4 A;  2OJE D;  3FOP A;  1ORS C;  1G8X A;  1WTY A;  3DI5 A;  3FXH A;  3RW0 A;  2XL4 A;  4JRZ A;  3SP1 A;  2R7S A;  2G3K A;  5T3W A;  1EQ1 A;  2EIM C;  3EG9 B;  5A69 A;  4G7O F;  1ORY A;  1E84 A;  3LEO A;  1QSP A;  2GWW A;  5L0I A;  2YLG A;  2KGO A;  2QNL A;  3MYF A;  1QPU A;  4NQF A;  2IBF A;  3G4Z A;  4O6M A;  3Q6M A;  5KYU B;  3AG4 C;  4E18 A;  2A6H F;  3G4X A;  5COG A;  3S90 A;  3OEO A;  4CDV A;  2WZF A;  3KYI A;  2R9R B;  2B0J A;  2L6F A;  2XLW A;  1CPR A;  2HMZ A;  4KBL A;  5F5H A;  3U2M A;  2LQG A;  3W2V A;  1WGW A;  4IJJ A;  5FZT A;  1VLT A;  3A11 A;  4YN0 B;  3VYW A;  2JPU A;  3WOD F;  4D4N A;  5IY5 C;  3RIP A;  3GOR A;  1ORJ A;  3DXJ F;  5A6J A;  3RVY A;  1H6G A;  3IPM O;  2EIN C;  1Z6A A;  256B A;  4BJT A;  1ST6 A;  5L3V A;  1LKX A;  5TJ5 E;  1TR2 A;  2ZXO A;  3K66 A;  1OCO C;  1R5I D;  2XLH A;  1HMO A;  4U9E A;  4XTK A;  1VLS A;  4IRU A;  1T6I A;  2D4U A;  3ASO C;  4OD5 A;  4CX9 A;  1ZHZ A;  2XXA A;  3LAY A;  2EPK X;  5A6B D;  1TFK B;  4A4A A;  3B9Q A;  2R7O A;  3N24 A;  1VOM A;  3B0P A;  3T9O A;  2UUI A;  3I4U A;  1ZW2 A;  2ZD9 A;  4I3M A;  2HS5 A;  4CS9 C;  3J06 A;  5E3C A;  3CEX A;  4CS7 A;  3GM2 A;  4MVZ A;  3FDQ A;  4LER A;  2EIK C;  2BC5 A;  1QVX A;  3ZIB A;  4AE4 A;  1BR2 A;  2DGJ A;  3A9C A;  3ATP A;  2J45 A;  5KYX B;  3BEH A;  4QI0 A;  1LE4 A;  2AP3 A;  1FAP B;  2W4M A;  5B1B C;  3KKB A;  2E87 A;  3B0V C;  1UG7 A;  1WAT A;  1E2X A;  3W4Y A;  1YZA A;  1CGO A;  4PJL A;  2CGE A;  1ZHX A;  3LS1 A;  4YWQ A;  2J8W A;  3SXM A;  1WOL A;  1ZU5 A;  4JTC B;  3IQT A;  1E85 A;  3W8I A;  1KU2 A;  3NYL A;  3O6X A;  4BPM A;  1FMW A;  3FAP B;  5A6K A;  3N0T A;  4G0H A;  4MW3 A;  4MVQ A;  4B6I A;  2WZL A;  4C3E A;  3JZ0 A;  1ZHY A;  2MWQ A;  2EPO A;  2L7A A;  1O87 A;  1I4Z A;  1UFB A;  3GEH A;  4LAC B;  2OCC C;  5A6A A;  1MNE A;  1NZE A;  3B71 A;  1JRA A;  4IGG A;  2NUT A;  2KNH A;  1K40 A;  4CDA A;  3FHD A;  5E2Q A;  5JP7 A;  5D92 A;  4O79 A;  3FVY A;  2Y69 C;  3EZH A;  1B68 A;  2Q9C A;  3U8V A;  1ZYR F;  1BDJ B;  2VH3 A;  1Z7Q c;  3SZR A;  4YT4 A;  3C8G D;  5BQH A;  2HUJ A;  2PBE A;  5KYW A;  3ITF A;  1WWP A;  3ECS A;  3EG9 A;  3RH3 A;  3TUL A;  4GQH A;  1G4U S;  1A0B A;  4NCQ A;  2KW3 C;  4U5F E;  3C18 A;  1OW7 A;  1RCP A;  3VF0 A;  5JLI A;  4HEA J;  2A0B A;  4WAB A;  2KYH A;  4R32 A;  2WVO A;  4YJW A;  4BJ6 C;  5DS6 A;  1D1B A;  3IQ5 A;  3JSE O;  2XLV A;  3HNI A;  3MBG A;  4KC9 A;  4PJM A;  3UGO A;  2L6G A;  2WVQ A;  3EPV A;  4JUR I;  2H7V C;  3JT1 A;  3QVY A;  4EBK A;  4C7O A;  1H7I A;  4IAQ A;  1OKK A;  4JJG A;  3AJM A;  2G62 A;  3TD7 A;  3KYJ A;  4YT2 A;  5L3Q A;  2GAQ A;  1ZU4 A;  3U9M A;  1NBB A;  4AE4 B;  3H2V A;  4JVS A;  1YYJ A;  3GEI A;  4F4B A;  3Q6N A;  2PX0 A;  1MMA A;  3NRH A;  3U3F A;  1MND A;  1OXB A;  4HE8 D;  2J9W A;  1M2O A;  4O6Y A;  3QZC A;  5JUA A;  4EHP A;  4IWB A;  1YJG A;  1NLX A;  1HE9 A;  1QZX A;  2KC3 A;  2IXO A;  1V54 C;  3SXZ A;  2DYR C;  2H7B A;  4JZA A;  4X0R A;  2QTV A;  1OCZ C;  2L6H A;  1V55 C;  5COF A;  4E0H A;  1OKK D;  4MTO A;  3HTK C;  3Q7G A;  2HFI A;  3R2P A;  4N4W A;  1N1C A;  4J30 B;  4MVM A;  1H9G A;  1U89 A;  3EH2 A;  3MFN A;  2VCA A;  2YLI A;  4K7B A;  2HV7 A;  4NTF A;  4JEA A;  2AWC A;  3JSZ A;  1W2W A;  1PV3 A;  4FX5 A;  1Y4C A;  3DWW A;  4PR9 A;  1FFH A;  1NFN A;  1A7D A;  1VMA A;  4IAO A;  4GYT A;  2HV6 A;  4Z9H A;  3U9J A;  2NUT B;  2ASR A;  5GPG B;  1GQA A;  2A68 F;  3L34 A;  1JOG A;  3M79 A;  2CCY A;  3UMI A;  2C03 A;  4Q4Z F;  4RBN A;  2CNW A;  5L0C A;  1FMV A;  2JD3 A;  3EHM A;  3QW1 A;  3WAQ A;  4MW8 A;  4EBB A;  1OW8 A;  3S29 A;  3TQO A;  1AVO B;  2YHS A;  2FGY A;  3K6B A;  4W8K A;  4MS2 A;  5KYW B;  1ZVZ A;  3R7C A;  4DRJ B;  4BEM J;  3AGU A;  2LD6 A;  2YL7 A;  4N6H A;  1SZI A;  2YRF A;  4E7S A;  4JC7 A;  2CDQ A;  4XQ1 A;  1O5H A;  3FAJ A;  3EH1 A;  1LVK A;  3WHN A;  2CNW D;  2J46 A;  2M4E A;  4K1O A;  1Y6D A;  2OOC A;  3JRT A;  1OCC C;  4P9F A;  3DMD A;  1EA8 A;  2I15 A;  2PF4 E;  2XSE A;  5BUO A;  4CIP A;  2YVK A;  4C7O B;  3AQC A;  4JIO A;  4XPX A;  1DOW A;  1OW6 A;  3AG1 C;  3GAN A;  3T4R A;  2KQ9 A;  2Z15 A;  3RFY A;  4CJO A;  5A6B A;  3AG3 C;  1GGQ A;  2J9B A;  1A41 A;  1LE2 A;  3NKD A;  3NG1 A;  4U5G A;  1CGM E;  2WZG A;  2R7R A;  3LLK A;  4ZLC A;  3UGP A;  4ZLD A;  1FFT C;  1TFO B;  1XWJ A;  1OR3 A;  3LS0 A;  4N6C A;  2HSQ A;  5T1D B;  2H7O A;  4OIR F;  4OIO F;  1TWA A;  4ER9 A;  2LCH A;  3ZTZ A;  2FFH A;  3UMK A;  1HY5 A;  1V4A A;  2V26 A;  3O10 A;  1VYK A;  1K04 A;  1T6Q A;  1Z63 A;  4LDR A;  2NPU A;  4C3D A;  2ZXP A;  4DBR A;  3DAG A;  3M1C B;  2BL2 A;  4XEF A;  4I1O B;  4U5C E;  4GEH A;  2PFD A;  3RKO F;  2J7P A;  4JCZ A;  4JTD B;  2MHR A;  3CZ6 A;  2Y3G A;  2XLE A;  4PFO A;  2R02 A;  3GWN A;  3JTL O;  5CI8 A;  3L8J A;  4BG0 A;  3VRC A;  3EQL F;  1M6T A;  3DM5 A;  3MX3 A;  5DS5 A;  2Y3H A;  2OEX A;  4G78 A;  4MND A;  4MVR A;  1LM3 B;  3W2W A;  4CJG A;  2OU6 A;  4DVY P;  4Q5S F;  4MQ9 F;  1VTM P;  1HMD A;  1RKC A;  2RD9 A;  1XZP A;  3U5S A;  1C03 A;  1T6U A;  4XPY A;  1BZ4 A;  1RKE A;  5E3A A;  3O55 A;  3FOO A;  4M63 A;  4H4K C;  1WAS A;  2P1A A;  1YAU O;  2ICW G;  2A0U A;  2J7P D;  3U3B A;  3PHF 2;  1BR4 A;  5DLJ A;  1KNY A;  3F47 A;  1IW7 F;  1T9K A;  4YL0 A;  1LI7 A;  1D1A A;  2OKU A;  2R7Q A;  2XLO A;  3C8G A;  4H54 A;  4OIN F;  4E0I A;  2YL1 A;  4C3B A;  5L0J A;  3ZSU A;  4CSA A;  4OIP F;  3B29 A;  3JCU Q;  1L3P A;  1R4T A;  2QUP A;  3QVZ A;  2B0H A;  2M64 A;  1TQG A;  3S28 A;  1YA7 O;  1D1C A;  1ZHT A;  2C04 A;  3UMH A;  3TOM A;  2X51 A;  2NSG A;  1U0B B;  4DXW A;  2XL8 A;  3JYH A;  2D5R B;  3M4B A;  3MLG A;  3ZTM A;  4WJ0 A;  4LDQ A;  4QDL A;  3K33 A;  5DQT A;  2KSF A;  5K0I A;  5F5F A;  3KMI A;  1D0X A;  1T5O A;  3NKE A;  3C63 A;  2AU5 A;  4N06 A;  3SEO A;  2XL6 A;  1Z23 A;  1MMG A;  2IXN A;  3RQE A;  1YA9 A;  2HZ8 A;  4MVU A;  4MVO A;  3ZWI A;  2P61 A;  5E33 A; 
#chains in the Genus database with same CATH homology
 3FAP B;  1FAP B;  2RSE B;  2GAQ A;  2FAP B;  5GPG B;  4DRI B;  1AUE A;  4FAP B;  4DRJ B;  2NPU A;  1NSG B;  4DRH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...