4DRHB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
AMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/transferase
total genus 39
structure length 95
sequence length 95
chains with identical sequence E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4drhB00
1AUEA 2GAQA 1NSGB 2RSEB 4DRHB 4DRJB 3FAPB 5GPGB 2FAPB 4FAPB 4DRIB 1FAPB 2NPUA
chains in the Genus database with same CATH superfamily
1OCOC 3S9OA 4GQHA 3PHF2 3IQ6A 2NUTB 4QI2A 2VASA 2XLMA 3DD7A 4LDRA 4ONSA 4U9EA 3SZRA 1ZHYA 4XPWA 3U9MA 3L8IA 4DBQA 3UGPA 1Y6DA 2GFHA 4ZLDA 3FDQA 4LLEA 2VCBA 4BJ6A 5KYWA 2DGJA 2D4UA 1JOGA 4CBEA 2YLGA 3A9CA 4OD5A 3L1MA 3M4BA 4BJ1A 3L8JA 4LLCA 1OQCA 3EHMA 3JYHA 3PMRA 5JSLA 1SZIA 3U2LA 3MYFA 2OJQA 2NUPB 4HFFB 4BG0A 3K66A 4I1OB 2WVQA 3MFNA 3S27A 3O10A 1A7VA 2P1AA 3B9QA 3T9OA 1CGOA 5L0FA 3JZ0A 2PBEA 1LPEA 2WZFA 2X0CA 4E18A 4EHPA 2ZXRA 4IARA 3WODF 5D92A 3JRMO 4EUKB 1JMWA 2Q9BA 2YKZA 3EFOA 1ZHWA 1T6IA 2H7OA 1D1AA 3GORA 3K7DA 3IQCA 3RH3A 3S0XA 1NBBA 4OIQF 1LKXA 2HJMA 5COFA 3C7JA 3Q7GA 2QUPA 3K1IC 4PFOA 1D1CA 4C3BA 5JS5A 1FFHA 4G78A 2XS1A 4MVOA 3VRCA 4JURI 2XLDA 2H7VC 3GEEA 2EIJC 1OCZC 2LP4A 4MQ9F 2R03A 1LS1A 1E83A 3O39A 1VK5A 1SF8A 3DE8A 1WGWA 2GWWA 4XPXA 4PJNA 4KBLA 2H7BA 2EPKX 2W4BA 3R7CA 1W2WA 2HMQA 2UUHA 1QVXA 1EQ1A 2L6GA 1HE1A 2XLOA 2OU6A 3BEHA 4CS8C 3AQCA 3EG9B 5T3WA 2KK1A 2OQMA 1YZCA 3JRTA 3L0IA 1TWAA 4GEHA 1VMAA 1DOWA 3CEXA 4EWCA 4CJGA 3M79A 2PFDA 1NU9C 4CIPA 3O55A 1Z3IX 4P9FA 5AC5A 5L3VA 1LS4A 3OEOA 4JW1A 3N0TA 5JRAA 2XL8A 5CIVA 3ZTZA 4D4XA 2DYRC 1ORYA 3DJNB 5L3QA 1K05A 3O6XA 3SXMA 3TOMA 4J7TA 3ABMC 1GGQA 4BJ5C 4EBBA 3NDBB 3EGXB 3W2VA 2A69F 2HSQA 2XLVA 3X2QC 2ICWG 1UG7A 2PX0A 2J7PD 2QLAA 1OCCC 3LLIA 3CSKA 3C18A 4XLPF 1MMNA 3E70C 4WJ0A 5F5HA 4DVZA 5AGFA 1TWCA 4K1OA 4J7YA 3VAYA 4DOZA 4JRZA 2J9BA 2HJ3A 1RKEA 2AWCA 2XLEA 3HTKC 4JEBA 3RVYA 3TOLA 4CDVA 3UGOA 2CW0F 2RSEB 1QZXA 2VH3A 2ETSA 1Q0DA 4U5HA 1R4TA 3ZVRA 5GPGB 2YLDA 4KI2A 3DWWA 4JKVA 1APCA 3LNMB 4AX2A 2XRHA 1NSGB 5E3CA 3SP1A 2LSEA 4M63A 2EPOA 3LNRA 2YQYA 3RQGA 1C17M 3V5ZA 3SXZA 4XEFA 1EA8A 1BR1A 2LQGA 1ORJA 4U5CE 2A6HF 2IXMA 4YN0B 1BBHA 3E9VA 2UUIA 4DJ9A 5L0HA 3F47A 1GQAA 3X1OA 1T5OA 4YL3A 2D5RB 2C03A 5DS4A 1DOVA 1HE9A 2W4MA 5F28E 1PV3A 2LFFA 4Q5SF 4O79A 3U2MA 2R7UA 4PACA 4AE4B 3H2VA 4IAQA 5B1AC 1YYXA 2BC5A 1OR2A 1N1CA 3QZCA 4IGGA 3MX3A 2I8BA 2XM0A 3EZHA 3FVYA 1MQVA 3ZWIA 4OIPF 2AVKA 4U5DE 1C02A 1TWHA 3H65A 5JUAA 4MVUA 4IWBA 4J32B 4ULVA 1WN0A 2G62A 5A69A 1J8YF 3MYIA 3WHNA 5KYXA 1EI7A 2EPLX 3G4ZA 4CX9A 3U0CA 1ZZPA 2A68F 4MVZA 3HNKA 4IB4A 1ST6A 5L0IA 1V74B 3HKKA 4HEAJ 4J30B 4EKWA 5L0CA 2Z15A 3NKDA 1E86A 4BPMA 4BJ6C 2XLWA 1E84A 2YLIA 3LLKA 5KYUB 1TWGA 3SEOA 3S29A 4FESA 1E2XA 4E7SA 3DXJF 4DRHB 1LE4A 1HY5A 1O5HA 2JPUA 4C3EA 4BEMJ 1CPQA 3CZ6A 1FMWA 2RD9A 3ZQVA 3W2WA 3AGUA 4LACB 3EGDA 4PJMA 4LERA 2Y69C 1Q0MA 3FAJA 1Y4CA 2MWQA 3LEVA 4Z9IA 3FHDA 3QW0A 2AU5A 3L34A 2L6HA 1BR2A 5EK0A 2QE9A 4MTGA 2P0NA 2R7TA 3G50A 3RFYA 2HS5A 1RCPA 4AL1A 2QNLA 2J9WA 5DLJA 2Q00A 1A7EA 3QTHA 4PR9A 2KJGA 2KYHA 3MBGA 2R02A 4JZAA 2WVOA 5T3TA 1F1MA 3ZTMA 5KYYA 1O3UA 4I44A 2GDCA 4N6CA 2L7AA 5A6BA 4DXWA 1G8XA 4XPYA 3KPHA 3U3FA 1FNTc 3FXHA 4YT2A 3R2PA 1VTMP 3TJ6A 2VCCA 3ABLC 4CJOA 5HSWA 3I5PA 1M6TA 1YLMA 1FR0A 2J9UA 2NG1A 1A41A 5DVWA 3TJ5A 5DS6A 2EIKC 2YEVA 4K0DA 1NG1A 3AG2C 3K1HA 3KH2A 4U5FE 1J8MF 4D4NA 2NSFA 2EPNA 1CPRA 1A0BA 2KW3C 1VOMA 3NYJA 4WGZA 1YVIA 3KKBA 1D0YA 1H7IA 3ZSUA 3B71A 1JPNA 2DI3A 1YA7O 3RIPA 4AL0A 4U5GA 4JVSA 5FZTA 2NUTA 5T1DB 3RYLA 3M4CA 1PD1A 3RQEA 1LVKA 4DVYP 2EPMX 2LD6A 3LEOA 4IRUA 1QPUA 1S05A 1VYKA 3N2ZB 2EIMC 1HMDA 1M57C 1M56C 2J0WA 2PP4A 1RXQA 2J45A 2XL6A 1YDIA 2HZ8A 2PX3A 3KL4A 3LUTB 1ZHTA 5BQIA 2XL4A 2OOCA 3B29A 3Q6NA 4O6YA 1Z7Qc 2W45A 2Y3HA 1M2OA 4LDKA 4ULWA 2BE5F 4Z9HA 3LS0A 4B6IA 4L6RA 5A6JA 2NUPA 1T9KA 1VYIA 2ZXPA 4O6MA 2XS8A 1YAUO 2R7VA 5BQHA 3GODA 4AK9A 2LK4A 4PJJA 1Q0FA 3FAPB 2C04A 2KC3A 2O9XA 1FFTC 1MMGA 4PJLA 5A6AA 2FAPB 2XLHA 3SYNA 4X0RA 1AUEA 1I4ZA 2EILC 3LS1A 1RJ9A 2YZSA 2KNHA 3EQLF 3DM5A 5DQZA 4JIOA 2A6EF 2HUJA 4XWJA 1V4AA 2J46A 3T6JA 4JE9A 3A11A 4BEJA 2R7XA 5KYNA 3G4XA 2DB4A 4YT5A 3LJBA 3C8ZA 2IOQA 1MMAA 5KYXB 2Q4FA 3U8PA 3UMIA 3NYMA 1Z5ZA 1AVOB 2A0BA 3GEHA 3SXYA 3ZDLA 3ZG1A 4UDVA 4Q4ZF 2CCYA 2KGOA 3B0UX 1JPJA 3T6GB 2QTVA 4CS8A 2XXAB 3DM9B 1Z63A 1ZVZA 1D0ZA 2MHRA 4G7HF 1ZW2A 3JYYA 4H54A 5TJ5E 1KTMA 3LAYA 2I15A 2CNWA 4DRIB 4OINF 4CSAC 4YL1A 1AEPA 4RBNA 1IW7F 3DJUB 4YJWA 1RMVA 1I4YA 1R5ID 2Y3GA 1QQ3A 3FOOA 4IJJA 5B1BC 4G7OF 4BJ5A 4U5BE 1KU2A 4JTDB 4HFKB 4E7ZA 2R7SA 1M2VA 2IXOA 2WZLA 3ATPA 3RVZA 2R7QA 5KYWB 3I5QA 2IM8A 3VM6A 2QY9A 1TFKB 1SR2A 1MNEA 3AG3C 3T6BA 3US6A 3OWTA 4IAOA 1FTSA 4Q7CA 5JT4A 1WOLA 1H9TA 256BA 5HV9A 1OCRC 4CS7A 2R7RA 3LESA 1XZQA 4XQ1A 4ANJA 3EGXA 2B0HA 3GM1A 3K6BA 1MMDA 4EIYA 3KMIA 5L0GA 4JEAA 2CYDA 1YA9A 1H9GA 5JLIA 1OKKA 4KNWA 5DS5A 4JCHA 2E87A 3W4YA 3GWNA 2P7VA 3DKAA 2ZPAA 2WZGA 3C8GA 2Q7RA 3Q7LA 1ZHXA 1L7CA 1S7ZA 2LIGA 3AG4C 3M1CB 5L0DA 3J06A 4JTAB 3POVA 1U6HA 3B0PA 3EFOB 4W8PA 2B0JA 2A1DD 5COGA 3S84A 3H2UA 2TMVP 3EJNA 3ZQYA 1UFBA 1Q0KA 4MVMA 5E2QA 1IZMA 4MVRA 3C63A 1G4US 4XEVA 4U5EE 4XLNF 1TR2A 2AWYA 2XM4A 3KYIA 2L6FA 5BQGA 2OJED 4E0HA 1VLSA 1GM5A 3DMDA 1YARO 4OIOF 3K33A 1ORSC 2OG2A 2F22A 2IBFA 2KQ9A 2YL3A 3RQFA 5E33A 1SYQA 2L9JA 4I3MA 4WABA 3S28A 3JT1A 4FX5A 3FOPA 2H8AA 3WG7C 2VC9A 2OEXA 3UR3C 2PF4E 4CSAA 4MTOA 4XEKA 4DRJB 1ZU5A 1TFOB 2HFIA 4GYTA 5KYUA 4AE4A 4C3DA 2HSBA 4NTAA 3B0VC 5A6BD 5IY5C 3CQZA 2Q3TA 4CS9A 4F4BA 5JVEA 4PFPA 3UNGC 2BL2A 1Z6AA 3RKOF 2JX0A 2V3CC 1H6GA 1Q0GA 1WWPA 2OKUA 3IPMO 3AGTA 2LFDA 1ZYRF 3NMJA 1XZPA 4MW3A 5K0IA 1NLXA 2WVNA 3AOUA 4WGYA 3SNHA 1ZW3A 4C7OA 1NFOA 1NFNA 5BUOA 2WL8A 1WASA 5EHHA 4NQFA 1MNDA 1RKCA 3HJCA 3UMHA 5D91A 4MVSA 2YL0A 2CDQA 2VCAA 5JP7A 4A4AA 2V26A 4YT8A 5A6KA 1JR8A 1LIHA 1PD0A 4EBJA 1RJ9B 4YL0A 4BJTA 2VB6A 4NC3A 4NY3A 5COMA 2IXNA 4EBKA 1RKEB 2J9VA 1D0XA 2HKVA 3WAQA 2J8WA 4JC7A 3NKEA 2HV7A 5AC4A 2R7WA 3C62A 3JSZA 3U8VA 2LCHA 4XTKA 1U89A 3DAFA 4A2NB 1HMOA 3KYJA 2KSFA 4LDQA 1HW1A 1YYJA 3IQTA 4O6NA 1CGNA 1V55C 1Z23A 2R9RB 3N24A 1E85A 4YT4A 2GAQA 5EGYA 3DE9A 3AG1C 2M4EA 4DBRA 2AP3A 2OCCC 3V5YA 3U5SA 3GEIA 3W8IA 2ZXOA 5CI9A 1T6QA 4FWVA 3MLGA 1YJGA 2R7OA 4MTFA 4RDAA 3EH2A 3HNIA 4P9TA 3PDMP 3K1IA 3Q6MA 2Y39A 1B68A 4YWQA 1D1BA 2X51A 2YVKA 3ZC4A 2EINC 2M64A 3FMSA 2HMZA 1O87A 3NMIA 1C03A 3PCVA 1JRAA 4OIRF 1M2VB 2Q9AA 3TQOA 3ZIBA 4K7BA 4W8KA 1K04A 2Q9CA 3QVYA 5L0JA 3DZAA 4MS2A 1G4WR 1FMVA 1V54C 2YL1A 2NSGA 3EPVA 3QMKA 1SMYF 1T6UA 3V7OA 1I5NA 4MNDA 2ASRA 3F46A 1OW8A 2P61A 2FFHA 2R25A 4U9DA 2J7PA 2WB7A 3SXKA 3ECSA 1BZ4A 4N6HA 5CI8A 5F5FA 3NRHA 1BR4A 3JTLO 2OEVA 4NTBA 1FAPB 2L81A 2CNWD 3C8GB 3U9JA 2Y3DA 3GM2A 4JCZA 4MW8A 2MYSA 1GS9A 5FCLA 3RW0A 2XSEA 3EG9A 2PNOA 1EKYA 1KNYA 1LI5A 4QDLA 2W9YA 3EGDB 3QVZA 1WTYA 3DAGA 1OW7A 4PK4A 3V5XA 4O7GA 3VYWA 3ASOC 4JJFA 5B3SC 4OD4A 1OXBA 2R05A 3HNLA 4HE8D 4ER9A 4MVQA 3GWLA 2ZD9A 1BDJB 1TKNA 4CIHA 3TULA 2FGYA 3HLZA 1PCXA 2YHSA 3HNJA 1QLEC 4RD9A 3U3BA 3W8HA 4FAPB 5B3IA 2YL7A 1ZHZA 3I4UA 4E17A 1L3PA 1LI7A 2DYSC 4QI0A 3TK0A 3NG1A 4CDAA 5DQTA 1NZEA 1YZAA 3ITFA 3BRJA 4CDYA 4R32A 4KC9A 1VLTA 1OR3A 5KYYB 1OXKA 1OKKD 3CAXA 1XWJA 3IEEA 2CGEA 3EHNA 4E0IA 4NTFA 2YWAA 3GM3A 4I1MA 3C8GD 3QW1A 2J0XA 4NCQA 3NYLA 3VF0A 2HV6A 4Z9JA 1OW6A 3UMKA 2G3KA 3EZIA 3AQBA 3GANA 3IHUA 1LE2A 4N4WA 4YK5A 2YRFA 3EH1A 1HW2A 1JAFA 1LM3B 1WATA 4H4KC 2G3VA 3M15A 4P6IC 5E3AA 3ABKC 1G5ZA 3JCUQ 1TQGA 4G0HA 3OA1A 4JJGA 1QSPA 2GA0A 3S90A 2IYLD 1QKRA 2P6VA 1T01A 4CS9C 4C7OB 2XXAA 1A7DA 3DI5A 3TD7A 4KNVA 1VB5A 3JSEO 3T4RA 2NPUA 3RF3A 4ZLCA 1CGME 1ZU4A 2IXPA 1K40A 3ASNC 1U0BB 3NMKA 3AJMA 4G7ZF 2ZXWC 2JD3A 3IQ5A 2Y3BA 4N06A 2A0UA 1NU7D 4JTCB
chains in the Genus database with same CATH topology
1AUEA 2GAQA 1NSGB 2RSEB 4DRHB 4DRJB 3FAPB 5GPGB 2FAPB 4FAPB 4DRIB 1FAPB 2NPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUE A;  2GAQ A;  1NSG B;  2RSE B;  4DRH B;  4DRJ B;  3FAP B;  5GPG B;  2FAP B;  4FAP B;  4DRI B;  1FAP B;  2NPU A; 
#chains in the Genus database with same CATH topology
 1OCO C;  3S9O A;  4GQH A;  3PHF 2;  3IQ6 A;  2NUT B;  4QI2 A;  2VAS A;  2XLM A;  3DD7 A;  4LDR A;  4ONS A;  4U9E A;  3SZR A;  1ZHY A;  4XPW A;  3U9M A;  3L8I A;  4DBQ A;  3UGP A;  1Y6D A;  2GFH A;  4ZLD A;  3FDQ A;  4LLE A;  2VCB A;  4BJ6 A;  5KYW A;  2DGJ A;  2D4U A;  1JOG A;  4CBE A;  2YLG A;  3A9C A;  4OD5 A;  3L1M A;  3M4B A;  4BJ1 A;  3L8J A;  4LLC A;  1OQC A;  3EHM A;  3JYH A;  3PMR A;  5JSL A;  1SZI A;  3U2L A;  3MYF A;  2OJQ A;  2NUP B;  4HFF B;  4BG0 A;  3K66 A;  4I1O B;  2WVQ A;  3MFN A;  3S27 A;  3O10 A;  1A7V A;  2P1A A;  3B9Q A;  3T9O A;  1CGO A;  5L0F A;  3JZ0 A;  2PBE A;  1LPE A;  2WZF A;  2X0C A;  4E18 A;  4EHP A;  2ZXR A;  4IAR A;  3WOD F;  5D92 A;  3JRM O;  4EUK B;  1JMW A;  2Q9B A;  2YKZ A;  3EFO A;  1ZHW A;  1T6I A;  2H7O A;  1D1A A;  3GOR A;  3K7D A;  3IQC A;  3RH3 A;  3S0X A;  1NBB A;  4OIQ F;  1LKX A;  2HJM A;  5COF A;  3C7J A;  3Q7G A;  2QUP A;  3K1I C;  4PFO A;  1D1C A;  4C3B A;  5JS5 A;  1FFH A;  4G78 A;  2XS1 A;  4MVO A;  3VRC A;  4JUR I;  2XLD A;  2H7V C;  3GEE A;  2EIJ C;  1OCZ C;  2LP4 A;  4MQ9 F;  2R03 A;  1LS1 A;  1E83 A;  3O39 A;  1VK5 A;  1SF8 A;  3DE8 A;  1WGW A;  2GWW A;  4XPX A;  4PJN A;  4KBL A;  2H7B A;  2EPK X;  2W4B A;  3R7C A;  1W2W A;  2HMQ A;  2UUH A;  1QVX A;  1EQ1 A;  2L6G A;  1HE1 A;  2XLO A;  2OU6 A;  3BEH A;  4CS8 C;  3AQC A;  3EG9 B;  5T3W A;  2KK1 A;  2OQM A;  1YZC A;  3JRT A;  3L0I A;  1TWA A;  4GEH A;  1VMA A;  1DOW A;  3CEX A;  4EWC A;  4CJG A;  3M79 A;  2PFD A;  1NU9 C;  4CIP A;  3O55 A;  1Z3I X;  4P9F A;  5AC5 A;  5L3V A;  1LS4 A;  3OEO A;  4JW1 A;  3N0T A;  5JRA A;  2XL8 A;  5CIV A;  3ZTZ A;  4D4X A;  2DYR C;  1ORY A;  3DJN B;  5L3Q A;  1K05 A;  3O6X A;  3SXM A;  3TOM A;  4J7T A;  3ABM C;  1GGQ A;  4BJ5 C;  4EBB A;  3NDB B;  3EGX B;  3W2V A;  2A69 F;  2HSQ A;  2XLV A;  3X2Q C;  2ICW G;  1UG7 A;  2PX0 A;  2J7P D;  2QLA A;  1OCC C;  3LLI A;  3CSK A;  3C18 A;  4XLP F;  1MMN A;  3E70 C;  4WJ0 A;  5F5H A;  4DVZ A;  5AGF A;  1TWC A;  4K1O A;  4J7Y A;  3VAY A;  4DOZ A;  4JRZ A;  2J9B A;  2HJ3 A;  1RKE A;  2AWC A;  2XLE A;  3HTK C;  4JEB A;  3RVY A;  3TOL A;  4CDV A;  3UGO A;  2CW0 F;  2RSE B;  1QZX A;  2VH3 A;  2ETS A;  1Q0D A;  4U5H A;  1R4T A;  3ZVR A;  5GPG B;  2YLD A;  4KI2 A;  3DWW A;  4JKV A;  1APC A;  3LNM B;  4AX2 A;  2XRH A;  1NSG B;  5E3C A;  3SP1 A;  2LSE A;  4M63 A;  2EPO A;  3LNR A;  2YQY A;  3RQG A;  1C17 M;  3V5Z A;  3SXZ A;  4XEF A;  1EA8 A;  1BR1 A;  2LQG A;  1ORJ A;  4U5C E;  2A6H F;  2IXM A;  4YN0 B;  1BBH A;  3E9V A;  2UUI A;  4DJ9 A;  5L0H A;  3F47 A;  1GQA A;  3X1O A;  1T5O A;  4YL3 A;  2D5R B;  2C03 A;  5DS4 A;  1DOV A;  1HE9 A;  2W4M A;  5F28 E;  1PV3 A;  2LFF A;  4Q5S F;  4O79 A;  3U2M A;  2R7U A;  4PAC A;  4AE4 B;  3H2V A;  4IAQ A;  5B1A C;  1YYX A;  2BC5 A;  1OR2 A;  1N1C A;  3QZC A;  4IGG A;  3MX3 A;  2I8B A;  2XM0 A;  3EZH A;  3FVY A;  1MQV A;  3ZWI A;  4OIP F;  2AVK A;  4U5D E;  1C02 A;  1TWH A;  3H65 A;  5JUA A;  4MVU A;  4IWB A;  4J32 B;  4ULV A;  1WN0 A;  2G62 A;  5A69 A;  1J8Y F;  3MYI A;  3WHN A;  5KYX A;  1EI7 A;  2EPL X;  3G4Z A;  4CX9 A;  3U0C A;  1ZZP A;  2A68 F;  4MVZ A;  3HNK A;  4IB4 A;  1ST6 A;  5L0I A;  1V74 B;  3HKK A;  4HEA J;  4J30 B;  4EKW A;  5L0C A;  2Z15 A;  3NKD A;  1E86 A;  4BPM A;  4BJ6 C;  2XLW A;  1E84 A;  2YLI A;  3LLK A;  5KYU B;  1TWG A;  3SEO A;  3S29 A;  4FES A;  1E2X A;  4E7S A;  3DXJ F;  4DRH B;  1LE4 A;  1HY5 A;  1O5H A;  2JPU A;  4C3E A;  4BEM J;  1CPQ A;  3CZ6 A;  1FMW A;  2RD9 A;  3ZQV A;  3W2W A;  3AGU A;  4LAC B;  3EGD A;  4PJM A;  4LER A;  2Y69 C;  1Q0M A;  3FAJ A;  1Y4C A;  2MWQ A;  3LEV A;  4Z9I A;  3FHD A;  3QW0 A;  2AU5 A;  3L34 A;  2L6H A;  1BR2 A;  5EK0 A;  2QE9 A;  4MTG A;  2P0N A;  2R7T A;  3G50 A;  3RFY A;  2HS5 A;  1RCP A;  4AL1 A;  2QNL A;  2J9W A;  5DLJ A;  2Q00 A;  1A7E A;  3QTH A;  4PR9 A;  2KJG A;  2KYH A;  3MBG A;  2R02 A;  4JZA A;  2WVO A;  5T3T A;  1F1M A;  3ZTM A;  5KYY A;  1O3U A;  4I44 A;  2GDC A;  4N6C A;  2L7A A;  5A6B A;  4DXW A;  1G8X A;  4XPY A;  3KPH A;  3U3F A;  1FNT c;  3FXH A;  4YT2 A;  3R2P A;  1VTM P;  3TJ6 A;  2VCC A;  3ABL C;  4CJO A;  5HSW A;  3I5P A;  1M6T A;  1YLM A;  1FR0 A;  2J9U A;  2NG1 A;  1A41 A;  5DVW A;  3TJ5 A;  5DS6 A;  2EIK C;  2YEV A;  4K0D A;  1NG1 A;  3AG2 C;  3K1H A;  3KH2 A;  4U5F E;  1J8M F;  4D4N A;  2NSF A;  2EPN A;  1CPR A;  1A0B A;  2KW3 C;  1VOM A;  3NYJ A;  4WGZ A;  1YVI A;  3KKB A;  1D0Y A;  1H7I A;  3ZSU A;  3B71 A;  1JPN A;  2DI3 A;  1YA7 O;  3RIP A;  4AL0 A;  4U5G A;  4JVS A;  5FZT A;  2NUT A;  5T1D B;  3RYL A;  3M4C A;  1PD1 A;  3RQE A;  1LVK A;  4DVY P;  2EPM X;  2LD6 A;  3LEO A;  4IRU A;  1QPU A;  1S05 A;  1VYK A;  3N2Z B;  2EIM C;  1HMD A;  1M57 C;  1M56 C;  2J0W A;  2PP4 A;  1RXQ A;  2J45 A;  2XL6 A;  1YDI A;  2HZ8 A;  2PX3 A;  3KL4 A;  3LUT B;  1ZHT A;  5BQI A;  2XL4 A;  2OOC A;  3B29 A;  3Q6N A;  4O6Y A;  1Z7Q c;  2W45 A;  2Y3H A;  1M2O A;  4LDK A;  4ULW A;  2BE5 F;  4Z9H A;  3LS0 A;  4B6I A;  4L6R A;  5A6J A;  2NUP A;  1T9K A;  1VYI A;  2ZXP A;  4O6M A;  2XS8 A;  1YAU O;  2R7V A;  5BQH A;  3GOD A;  4AK9 A;  2LK4 A;  4PJJ A;  1Q0F A;  3FAP B;  2C04 A;  2KC3 A;  2O9X A;  1FFT C;  1MMG A;  4PJL A;  5A6A A;  2FAP B;  2XLH A;  3SYN A;  4X0R A;  1AUE A;  1I4Z A;  2EIL C;  3LS1 A;  1RJ9 A;  2YZS A;  2KNH A;  3EQL F;  3DM5 A;  5DQZ A;  4JIO A;  2A6E F;  2HUJ A;  4XWJ A;  1V4A A;  2J46 A;  3T6J A;  4JE9 A;  3A11 A;  4BEJ A;  2R7X A;  5KYN A;  3G4X A;  2DB4 A;  4YT5 A;  3LJB A;  3C8Z A;  2IOQ A;  1MMA A;  5KYX B;  2Q4F A;  3U8P A;  3UMI A;  3NYM A;  1Z5Z A;  1AVO B;  2A0B A;  3GEH A;  3SXY A;  3ZDL A;  3ZG1 A;  4UDV A;  4Q4Z F;  2CCY A;  2KGO A;  3B0U X;  1JPJ A;  3T6G B;  2QTV A;  4CS8 A;  2XXA B;  3DM9 B;  1Z63 A;  1ZVZ A;  1D0Z A;  2MHR A;  4G7H F;  1ZW2 A;  3JYY A;  4H54 A;  5TJ5 E;  1KTM A;  3LAY A;  2I15 A;  2CNW A;  4DRI B;  4OIN F;  4CSA C;  4YL1 A;  1AEP A;  4RBN A;  1IW7 F;  3DJU B;  4YJW A;  1RMV A;  1I4Y A;  1R5I D;  2Y3G A;  1QQ3 A;  3FOO A;  4IJJ A;  5B1B C;  4G7O F;  4BJ5 A;  4U5B E;  1KU2 A;  4JTD B;  4HFK B;  4E7Z A;  2R7S A;  1M2V A;  2IXO A;  2WZL A;  3ATP A;  3RVZ A;  2R7Q A;  5KYW B;  3I5Q A;  2IM8 A;  3VM6 A;  2QY9 A;  1TFK B;  1SR2 A;  1MNE A;  3AG3 C;  3T6B A;  3US6 A;  3OWT A;  4IAO A;  1FTS A;  4Q7C A;  5JT4 A;  1WOL A;  1H9T A;  256B A;  5HV9 A;  1OCR C;  4CS7 A;  2R7R A;  3LES A;  1XZQ A;  4XQ1 A;  4ANJ A;  3EGX A;  2B0H A;  3GM1 A;  3K6B A;  1MMD A;  4EIY A;  3KMI A;  5L0G A;  4JEA A;  2CYD A;  1YA9 A;  1H9G A;  5JLI A;  1OKK A;  4KNW A;  5DS5 A;  4JCH A;  2E87 A;  3W4Y A;  3GWN A;  2P7V A;  3DKA A;  2ZPA A;  2WZG A;  3C8G A;  2Q7R A;  3Q7L A;  1ZHX A;  1L7C A;  1S7Z A;  2LIG A;  3AG4 C;  3M1C B;  5L0D A;  3J06 A;  4JTA B;  3POV A;  1U6H A;  3B0P A;  3EFO B;  4W8P A;  2B0J A;  2A1D D;  5COG A;  3S84 A;  3H2U A;  2TMV P;  3EJN A;  3ZQY A;  1UFB A;  1Q0K A;  4MVM A;  5E2Q A;  1IZM A;  4MVR A;  3C63 A;  1G4U S;  4XEV A;  4U5E E;  4XLN F;  1TR2 A;  2AWY A;  2XM4 A;  3KYI A;  2L6F A;  5BQG A;  2OJE D;  4E0H A;  1VLS A;  1GM5 A;  3DMD A;  1YAR O;  4OIO F;  3K33 A;  1ORS C;  2OG2 A;  2F22 A;  2IBF A;  2KQ9 A;  2YL3 A;  3RQF A;  5E33 A;  1SYQ A;  2L9J A;  4I3M A;  4WAB A;  3S28 A;  3JT1 A;  4FX5 A;  3FOP A;  2H8A A;  3WG7 C;  2VC9 A;  2OEX A;  3UR3 C;  2PF4 E;  4CSA A;  4MTO A;  4XEK A;  4DRJ B;  1ZU5 A;  1TFO B;  2HFI A;  4GYT A;  5KYU A;  4AE4 A;  4C3D A;  2HSB A;  4NTA A;  3B0V C;  5A6B D;  5IY5 C;  3CQZ A;  2Q3T A;  4CS9 A;  4F4B A;  5JVE A;  4PFP A;  3UNG C;  2BL2 A;  1Z6A A;  3RKO F;  2JX0 A;  2V3C C;  1H6G A;  1Q0G A;  1WWP A;  2OKU A;  3IPM O;  3AGT A;  2LFD A;  1ZYR F;  3NMJ A;  1XZP A;  4MW3 A;  5K0I A;  1NLX A;  2WVN A;  3AOU A;  4WGY A;  3SNH A;  1ZW3 A;  4C7O A;  1NFO A;  1NFN A;  5BUO A;  2WL8 A;  1WAS A;  5EHH A;  4NQF A;  1MND A;  1RKC A;  3HJC A;  3UMH A;  5D91 A;  4MVS A;  2YL0 A;  2CDQ A;  2VCA A;  5JP7 A;  4A4A A;  2V26 A;  4YT8 A;  5A6K A;  1JR8 A;  1LIH A;  1PD0 A;  4EBJ A;  1RJ9 B;  4YL0 A;  4BJT A;  2VB6 A;  4NC3 A;  4NY3 A;  5COM A;  2IXN A;  4EBK A;  1RKE B;  2J9V A;  1D0X A;  2HKV A;  3WAQ A;  2J8W A;  4JC7 A;  3NKE A;  2HV7 A;  5AC4 A;  2R7W A;  3C62 A;  3JSZ A;  3U8V A;  2LCH A;  4XTK A;  1U89 A;  3DAF A;  4A2N B;  1HMO A;  3KYJ A;  2KSF A;  4LDQ A;  1HW1 A;  1YYJ A;  3IQT A;  4O6N A;  1CGN A;  1V55 C;  1Z23 A;  2R9R B;  3N24 A;  1E85 A;  4YT4 A;  2GAQ A;  5EGY A;  3DE9 A;  3AG1 C;  2M4E A;  4DBR A;  2AP3 A;  2OCC C;  3V5Y A;  3U5S A;  3GEI A;  3W8I A;  2ZXO A;  5CI9 A;  1T6Q A;  4FWV A;  3MLG A;  1YJG A;  2R7O A;  4MTF A;  4RDA A;  3EH2 A;  3HNI A;  4P9T A;  3PDM P;  3K1I A;  3Q6M A;  2Y39 A;  1B68 A;  4YWQ A;  1D1B A;  2X51 A;  2YVK A;  3ZC4 A;  2EIN C;  2M64 A;  3FMS A;  2HMZ A;  1O87 A;  3NMI A;  1C03 A;  3PCV A;  1JRA A;  4OIR F;  1M2V B;  2Q9A A;  3TQO A;  3ZIB A;  4K7B A;  4W8K A;  1K04 A;  2Q9C A;  3QVY A;  5L0J A;  3DZA A;  4MS2 A;  1G4W R;  1FMV A;  1V54 C;  2YL1 A;  2NSG A;  3EPV A;  3QMK A;  1SMY F;  1T6U A;  3V7O A;  1I5N A;  4MND A;  2ASR A;  3F46 A;  1OW8 A;  2P61 A;  2FFH A;  2R25 A;  4U9D A;  2J7P A;  2WB7 A;  3SXK A;  3ECS A;  1BZ4 A;  4N6H A;  5CI8 A;  5F5F A;  3NRH A;  1BR4 A;  3JTL O;  2OEV A;  4NTB A;  1FAP B;  2L81 A;  2CNW D;  3C8G B;  3U9J A;  2Y3D A;  3GM2 A;  4JCZ A;  4MW8 A;  2MYS A;  1GS9 A;  5FCL A;  3RW0 A;  2XSE A;  3EG9 A;  2PNO A;  1EKY A;  1KNY A;  1LI5 A;  4QDL A;  2W9Y A;  3EGD B;  3QVZ A;  1WTY A;  3DAG A;  1OW7 A;  4PK4 A;  3V5X A;  4O7G A;  3VYW A;  3ASO C;  4JJF A;  5B3S C;  4OD4 A;  1OXB A;  2R05 A;  3HNL A;  4HE8 D;  4ER9 A;  4MVQ A;  3GWL A;  2ZD9 A;  1BDJ B;  1TKN A;  4CIH A;  3TUL A;  2FGY A;  3HLZ A;  1PCX A;  2YHS A;  3HNJ A;  1QLE C;  4RD9 A;  3U3B A;  3W8H A;  4FAP B;  5B3I A;  2YL7 A;  1ZHZ A;  3I4U A;  4E17 A;  1L3P A;  1LI7 A;  2DYS C;  4QI0 A;  3TK0 A;  3NG1 A;  4CDA A;  5DQT A;  1NZE A;  1YZA A;  3ITF A;  3BRJ A;  4CDY A;  4R32 A;  4KC9 A;  1VLT A;  1OR3 A;  5KYY B;  1OXK A;  1OKK D;  3CAX A;  1XWJ A;  3IEE A;  2CGE A;  3EHN A;  4E0I A;  4NTF A;  2YWA A;  3GM3 A;  4I1M A;  3C8G D;  3QW1 A;  2J0X A;  4NCQ A;  3NYL A;  3VF0 A;  2HV6 A;  4Z9J A;  1OW6 A;  3UMK A;  2G3K A;  3EZI A;  3AQB A;  3GAN A;  3IHU A;  1LE2 A;  4N4W A;  4YK5 A;  2YRF A;  3EH1 A;  1HW2 A;  1JAF A;  1LM3 B;  1WAT A;  4H4K C;  2G3V A;  3M15 A;  4P6I C;  5E3A A;  3ABK C;  1G5Z A;  3JCU Q;  1TQG A;  4G0H A;  3OA1 A;  4JJG A;  1QSP A;  2GA0 A;  3S90 A;  2IYL D;  1QKR A;  2P6V A;  1T01 A;  4CS9 C;  4C7O B;  2XXA A;  1A7D A;  3DI5 A;  3TD7 A;  4KNV A;  1VB5 A;  3JSE O;  3T4R A;  2NPU A;  3RF3 A;  4ZLC A;  1CGM E;  1ZU4 A;  2IXP A;  1K40 A;  3ASN C;  1U0B B;  3NMK A;  3AJM A;  4G7Z F;  2ZXW C;  2JD3 A;  3IQ5 A;  2Y3B A;  4N06 A;  2A0U A;  1NU7 D;  4JTC B; 
#chains in the Genus database with same CATH homology
 1AUE A;  2GAQ A;  1NSG B;  2RSE B;  4DRH B;  4DRJ B;  3FAP B;  5GPG B;  2FAP B;  4FAP B;  4DRI B;  1FAP B;  2NPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...