4DRHB

Co-crystal structure of the ppiase domain of fkbp51, rapamycin and the frb fragment of mtor at low ph
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
95
structure length
95
Chain Sequence
AMDPEFMEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase/transferase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Large FK506-Binding Proteins Shape the Pharmacology of Rapamycin.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 95
sequence length 95
chains with identical sequence E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4drhB00
3FAPB 1NSGB 4FAPB 2GAQA 2RSEB 2FAPB 4DRJB 4DRIB 4DRHB 5GPGB 2NPUA 1FAPB 1AUEA
chains in the Genus database with same CATH superfamily
2E87A 1LS1A 4I44A 4HEAJ 4XQ1A 1BR4A 2L81A 2YL1A 1HW1A 2JPUA 2Q7RA 4JC7A 3U9JA 3RQGA 1E86A 1D0YA 1H9TA 3DKAA 1G8XA 3GODA 4MVSA 2I15A 4NCQA 1NG1A 3W8IA 1EQ1A 1QQ3A 5L0GA 4LLCA 2WVNA 3POVA 1LE4A 1PCXA 3EGXA 4CSAA 4LACB 4JKVA 2QY9A 4LERA 1RKCA 2V26A 1G4WR 5BQIA 3N0TA 2R7RA 3FDQA 3TJ5A 2PFDA 4DVZA 3EFOB 2PF4E 1A41A 1G4US 2HUJA 3ASNC 4PFOA 2VCAA 4CDAA 1FR0A 2KQ9A 4OIRF 4M63A 4BPMA 3Q6NA 3UMIA 5DLJA 5JLIA 3M4CA 5T3TA 2IBFA 2Z15A 1I4ZA 1SR2A 2G3KA 2PX0A 1ZU4A 1ORSC 1TWHA 3CAXA 3JSEO 4JJFA 3W2WA 3JRTA 1V74B 1Y6DA 2OJED 3C7JA 2Q4FA 3K1HA 1HW2A 4U9EA 2A69F 3KYIA 2D5RB 3AG2C 4LDKA 3S9OA 1OR2A 2AU5A 3GANA 2J7PD 5A69A 1C03A 2JX0A 4FAPB 3S29A 4ZLDA 2GDCA 1DOWA 1H9GA 3K6BA 3TULA 4AE4B 3QW1A 3ZVRA 1MMAA 2H7VC 2NPUA 2P7VA 2VB6A 4N6HA 1O3UA 1LS4A 3N2ZB 3L8JA 4DXWA 1V55C 4PJMA 3E70C 4DJ9A 2QTVA 2CNWD 1VOMA 1WATA 3ASOC 1APCA 3JYYA 4WABA 2HJMA 2IM8A 3WHNA 3KMIA 4E0IA 4BJTA 4LDRA 5HSWA 2A6HF 4P6IC 4RDAA 4RD9A 5L3QA 1RKEA 3VRCA 2EPLX 1A0BA 2R9RB 3QZCA 2PNOA 3WG7C 1I4YA 2L6HA 1YZCA 4FWVA 1M57C 5KYXB 1Q0GA 2XXAB 2YEVA 3M4BA 3B29A 2NUPB 1T5OA 3R2PA 4MQ9F 1YVIA 1SMYF 3QMKA 5B3IA 2R7OA 3T6GB 4B6IA 2CGEA 3HKKA 4W8KA 1MMNA 3VF0A 2NG1A 1OCRC 1RJ9B 1BBHA 2W9YA 4NTFA 3UMHA 1QVXA 2IOQA 5DS5A 3RQFA 1M2OA 2Q9BA 3EPVA 2VH3A 2X51A 4IARA 3WAQA 4QI2A 4DBRA 1FMWA 1JRAA 4NC3A 4JCHA 4PACA 2LFFA 2YLGA 1WASA 1WN0A 2Q00A 4U5GA 3O10A 2DI3A 2OU6A 1K04A 3SXYA 4CJOA 2Y3BA 5JSLA 1D1CA 1OKKD 2KJGA 1Z3IX 2QNLA 4MVZA 1FNTc 4Q5SF 4LLEA 1DOVA 1KTMA 1Q0MA 4CX9A 3RKOF 3S27A 4E18A 4C7OB 3FHDA 3RVYA 4YK5A 1TKNA 2YKZA 3V5XA 1E85A 4ANJA 2ZXWC 3MX3A 2A0UA 4OD4A 3JZ0A 4E17A 2JD3A 3EJNA 3ZSUA 3TD7A 2RD9A 1A7DA 2R7SA 1XZQA 5T1DB 3SXZA 5A6BA 1T6UA 4KC9A 4KNVA 5CI9A 1NBBA 1G5ZA 2C04A 3EG9A 3F47A 3S0XA 4DOZA 4G78A 1O87A 4G0HA 5E33A 3DE9A 4ONSA 3GM2A 4MNDA 4NQFA 3H2VA 3KYJA 1TQGA 1HE1A 3U2MA 4BJ5A 2XM0A 1QSPA 2XL8A 4Q4ZF 1CGNA 5E3AA 3EGXB 1OCOC 2B0JA 1AEPA 2RSEB 2XL4A 3EZIA 3HNJA 3Q7GA 3GEEA 1LIHA 1CGME 5DS6A 2YLIA 1A7VA 3JT1A 1HMDA 1GS9A 2GFHA 4JTDB 3ATPA 1JR8A 3DJNB 4U5FE 4N06A 4XEVA 4AK9A 1XWJA 2W45A 3US6A 3K33A 5L0CA 3Q6MA 3DZAA 2IXOA 2R05A 3EHMA 1JOGA 2Y39A 4PJLA 1LPEA 4MTOA 5IY5C 5BQGA 1OW6A 5E3CA 5L0FA 1JPNA 5L0HA 2I8BA 3RVZA 4IAOA 5EHHA 1BDJB 1U6HA 1MQVA 5JP7A 4LDQA 4N6CA 4CIHA 2GA0A 1M2VA 1QZXA 5A6KA 2IYLD 3GEIA 3NRHA 1NU9C 2YQYA 2EPMX 1NZEA 3L1MA 3F46A 4CDVA 3ZQYA 2NUTA 3EHNA 2OOCA 4HFKB 1Q0DA 3R7CA 2F22A 2LFDA 2UUIA 3IQCA 1RXQA 1J8MF 2R7XA 3O39A 3V5ZA 3B0UX 1EKYA 2A1DD 3QVYA 1ORJA 3EGDA 5AC5A 3HNIA 1NU7D 2DYRC 2YRFA 4Z9IA 3AJMA 3E9VA 4O6YA 5KYWB 3PCVA 4IJJA 2HKVA 2P1AA 4CS7A 1EI7A 2VC9A 3M15A 3KPHA 4IWBA 2BL2A 4BJ6A 3M1CB 1MMDA 2TMVP 1UG7A 4DRJB 5BQHA 4XTKA 2EPKX 4OIPF 3ABLC 3MFNA 1AVOB 2LCHA 2HFIA 4G7OF 1CGOA 2DYSC 1WGWA 1VMAA 1UFBA 2A0BA 3QW0A 4QDLA 5EGYA 1MNEA 2HMQA 3HLZA 4JURI 2BC5A 3KKBA 3LNRA 5AC4A 4ULVA 3PMRA 2A6EF 3VM6A 4E0HA 2HSQA 3TK0A 2M64A 4E7SA 3UR3C 3OWTA 1D1BA 1VB5A 3DM9B 3ECSA 3C8GD 4WGYA 3JRMO 4KBLA 4YT5A 3U2LA 2QUPA 3KL4A 1BZ4A 4C3BA 5L3VA 3AQCA 1H6GA 4HE8D 5B1BC 3V5YA 4UDVA 2WVOA 1CPRA 2WB7A 4OINF 3ZTZA 4CS9A 5KYYA 3RH3A 1LKXA 3AQBA 4XLPF 2Q9CA 3DAFA 3LS0A 1HY5A 1ST6A 3T9OA 5F5HA 1L7CA 3G50A 1VLTA 1YA9A 2CW0F 3ZIBA 4CS8C 3C63A 4Z9JA 4JW1A 1YZAA 1LI5A 1Z6AA 4MS2A 4CBEA 4K1OA 1E83A 1ZHXA 3JYHA 2R7QA 3U5SA 1R5ID 1PD1A 3QVZA 3C62A 1JMWA 3C8GB 2D4UA 3ZQVA 1ZHYA 3J06A 2KNHA 2FAPB 2J9UA 3IPMO 4KNWA 1YYXA 1ZYRF 2Y3HA 4EWCA 4U5EE 3NDBB 2CYDA 2QE9A 2LSEA 1LE2A 4E7ZA 3RF3A 1HE9A 2AWCA 3CEXA 4IB4A 4JCZA 4XPYA 1FFTC 5CI8A 1FMVA 1R4TA 3QTHA 4BG0A 1C02A 2LIGA 4W8PA 5KYUA 3U0CA 3EFOA 4KI2A 2HS5A 4J30B 4PR9A 3X1OA 2ASRA 3MBGA 3GWLA 1T6IA 3SXKA 4A2NB 1OXBA 3MYFA 2XLDA 2Y3GA 3GM1A 2P0NA 4P9TA 3AGTA 4ULWA 3JCUQ 4C3DA 1A7EA 5E2QA 3KH2A 4FX5A 1LI7A 3OA1A 5EK0A 4D4NA 4A4AA 3M79A 2VASA 2ZXPA 4EBJA 3W4YA 1ZHZA 3FXHA 3T4RA 3LAYA 3IQTA 3W8HA 4AL0A 1SF8A 1C17M 2KGOA 4PJJA 1ZVZA 1KNYA 4ZLCA 3ZTMA 2XLEA 3DI5A 4R32A 3Q7LA 2LK4A 2OEXA 2XLMA 5COFA 2OQMA 4NTAA 4O79A 4Q7CA 1L3PA 4XPXA 2C03A 3B0PA 1YA7O 1ZHTA 2B0HA 2ZPAA 4O6MA 2YL7A 1ZHWA 4AE4A 5T3WA 4AL1A 5GPGB 4JRZA 2A68F 3PHF2 2WL8A 3VAYA 2HJ3A 3UMKA 2XS1A 4YL0A 5CIVA 4MVOA 3NKEA 2H7OA 3K1IC 3MLGA 4YL3A 5L0JA 4G7HF 1LVKA 3AG3C 3GM3A 2WZLA 3FAPB 4IGGA 3DXJF 4N4WA 5KYNA 3RW0A 4JEBA 1JAFA 1O5HA 3LUTB 4QI0A 3VYWA 4EHPA 3UNGC 2R7VA 1ORYA 1H7IA 1EA8A 5A6JA 5KYXA 2R25A 2XXAA 1NFNA 2EIJC 3MYIA 2NUPA 1Q0KA 1NLXA 1J8YF 2L7AA 2ZD9A 2IXMA 2P6VA 5K0IA 1WWPA 3NKDA 4FESA 5DQZA 1LM3B 1RJ9A 4YN0B 4G7ZF 1QPUA 3CZ6A 5JRAA 4YT2A 1ZZPA 3IQ6A 2PP4A 1BR1A 1K40A 2YLDA 4GEHA 4U5CE 4RBNA 3K7DA 1VYIA 4U5DE 4C3EA 2HMZA 3LEVA 4PFPA 2J8WA 1T01A 2CNWA 2ETSA 3DMDA 1YYJA 2EIMC 1QLEC 2LQGA 3NMIA 5JUAA 5F5FA 3ITFA 1Q0FA 3FOOA 5JT4A 1Z23A 2HV7A 1QKRA 2HV6A 3WODF 3X2QC 2IXPA 2WZFA 1SZIA 2WVQA 4JTAB 1V54C 1OCCC 4C7OA 2W4MA 2Q9AA 2PBEA 2OEVA 1FFHA 4JE9A 3S28A 5HV9A 2XRHA 3DE8A 1TFOB 2EPOA 3DM5A 3LLKA 3NYJA 4GQHA 3S84A 1VYKA 2J45A 2KSFA 1ZW2A 1T9KA 1RKEB 1VLSA 2LD6A 2Y3DA 3DWWA 2J0XA 1U89A 4PJNA 4X0RA 4XEFA 2MWQA 4DRIB 1VTMP 3GEHA 2LP4A 3BEHA 3V7OA 4JEAA 5D91A 2ZXOA 5TJ5E 3NMKA 3DD7A 4YWQA 4NY3A 3L0IA 1BR2A 1OKKA 3LLIA 3NYLA 3SYNA 4JVSA 2ICWG 3LESA 3JTLO 1OR3A 1W2WA 2H8AA 2R7TA 5A6BD 1GGQA 3UGPA 1WOLA 3GWNA 2DB4A 3EZHA 3U3BA 3ZC4A 1ZW3A 3AG4C 4BJ5C 4EKWA 1NSGB 5FZTA 3LS1A 1TWGA 2YL0A 1XZPA 2YZSA 3EH1A 1OCZC 1T6QA 2QLAA 1F1MA 4MVQA 5KYUB 2NSFA 4P9FA 1E2XA 3CQZA 2OKUA 3K66A 3LEOA 3ZG1A 4IAQA 3LJBA 1Z7Qc 1IW7F 2XSEA 1YDIA 4EBBA 4EUKB 3T6JA 3G4XA 4NTBA 1I5NA 1GM5A 3LNMB 5DVWA 4CJGA 2MYSA 5JS5A 1OW7A 4O7GA 4J7TA 4MVRA 3U8PA 2WZGA 5L0IA 4EBKA 1WTYA 3JSZA 3DAGA 1VK5A 2R7UA 2YWAA 1Y4CA 3H2UA 3HNLA 4U9DA 3L8IA 2HZ8A 3EG9B 3SP1A 4H54A 4WGZA 1N1CA 1TR2A 2KYHA 2ZXRA 3SZRA 4XLNF 2YVKA 3O55A 5BUOA 5B1AC 3K1IA 5F28E 4BEJA 1JPJA 2KW3C 2Y69C 4MTGA 5KYWA 2P61A 2IXNA 1GQAA 1OQCA 2BE5F 5COMA 2OG2A 3C18A 1B68A 2FGYA 3AG1C 2M4EA 3SXMA 5JVEA 2J9BA 1D1AA 4U5HA 4K0DA 3CSKA 3HNKA 3O6XA 4WJ0A 4ER9A 2W4BA 4CSAC 1HMOA 2VCCA 2PX3A 4D4XA 2KC3A 4K7BA 3TOMA 1YLMA 4HFFB 3TOLA 4BJ6C 4OIOF 2L9JA 2XM4A 4OD5A 1FAPB 3FVYA 5COGA 4YT4A 2KK1A 3FOPA 3TQOA 4MW3A 4YJWA 2J9WA 4JTCB 2VCBA 3AGUA 3AOUA 3IQ5A 1RMVA 1IZMA 4MW8A 1M2VB 4H4KC 4IRUA 5FCLA 1M6TA 2R03A 3IEEA 3I5QA 1SYQA 2XLVA 4I1OB 2OCCC 2NUTB 2XS8A 4MVMA 2XLHA 3ABMC 2XL6A 4JJGA 2Q3TA 3U3FA 1V4AA 3EGDB 3FAJA 4MTFA 2EILC 2V3CC 2EIKC 3HJCA 1U0BB 3ABKC 4JIOA 1E84A 5AGFA 4CS9C 5L0DA 3H65A 2L6GA 4L6RA 3DJUB 4EIYA 3I5PA 1D0ZA 3EQLF 3U9MA 3L34A 3RYLA 3A9CA 3RFYA 5DQTA 3B0VC 2R7WA 4MVUA 1M56C 3W2VA 1MMGA 1NFOA 2G62A 2R02A 3C8GA 4I1MA 4Z9HA 3T6BA 3U8VA 3OEOA 3PDMP 2AVKA 2CDQA 2NSGA 4JZAA 3SNHA 2J7PA 3BRJA 3NYMA 1YJGA 3EH2A 3GORA 4BJ1A 2J46A 256BA 4CIPA 1S05A 4OIQF 1MNDA 2GAQA 2EPNA 2J9VA 5D92A 1Z63A 4XPWA 1TWCA 3B9QA 1D0XA 2H7BA 4XEKA 1CPQA 2DGJA 3S90A 3I4UA 3ZWIA 4GYTA 1K05A 3HTKC 3B71A 4O6NA 5B3SC 3TJ6A 1RCPA 1OXKA 3N24A 2L6FA 1YARO 4BEMJ 1AUEA 2MHRA 2YHSA 4YL1A 1KU2A 4I3MA 4CS8A 4DVYP 4F4BA 2AWYA 1PV3A 5A6AA 3FMSA 3NMJA 4DRHB 5KYYB 4J32B 1S7ZA 2HSBA 3IHUA 1PD0A 2GWWA 2J0WA 3C8ZA 3G4ZA 4J7YA 3RIPA 1TWAA 2XLWA 3ZDLA 1TFKB 2UUHA 4AX2A 2CCYA 4U5BE 4XWJA 2AP3A 3RQEA 4CDYA 2O9XA 3A11A 1Z5ZA 2X0CA 3NG1A 4DBQA 3SEOA 2FFHA 1OW8A 1YAUO 2OJQA 4PK4A 2EINC 5DS4A 3UGOA 2YL3A 2G3VA 1FTSA 4YT8A 2XLOA 1ZU5A
chains in the Genus database with same CATH topology
3FAPB 1NSGB 4FAPB 2GAQA 2RSEB 2FAPB 4DRJB 4DRIB 4DRHB 5GPGB 2NPUA 1FAPB 1AUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FAP B;  1NSG B;  4FAP B;  2GAQ A;  2RSE B;  2FAP B;  4DRJ B;  4DRI B;  4DRH B;  5GPG B;  2NPU A;  1FAP B;  1AUE A; 
#chains in the Genus database with same CATH topology
 2E87 A;  1LS1 A;  4I44 A;  4HEA J;  4XQ1 A;  1BR4 A;  2L81 A;  2YL1 A;  1HW1 A;  2JPU A;  2Q7R A;  4JC7 A;  3U9J A;  3RQG A;  1E86 A;  1D0Y A;  1H9T A;  3DKA A;  1G8X A;  3GOD A;  4MVS A;  2I15 A;  4NCQ A;  1NG1 A;  3W8I A;  1EQ1 A;  1QQ3 A;  5L0G A;  4LLC A;  2WVN A;  3POV A;  1LE4 A;  1PCX A;  3EGX A;  4CSA A;  4LAC B;  4JKV A;  2QY9 A;  4LER A;  1RKC A;  2V26 A;  1G4W R;  5BQI A;  3N0T A;  2R7R A;  3FDQ A;  3TJ5 A;  2PFD A;  4DVZ A;  3EFO B;  2PF4 E;  1A41 A;  1G4U S;  2HUJ A;  3ASN C;  4PFO A;  2VCA A;  4CDA A;  1FR0 A;  2KQ9 A;  4OIR F;  4M63 A;  4BPM A;  3Q6N A;  3UMI A;  5DLJ A;  5JLI A;  3M4C A;  5T3T A;  2IBF A;  2Z15 A;  1I4Z A;  1SR2 A;  2G3K A;  2PX0 A;  1ZU4 A;  1ORS C;  1TWH A;  3CAX A;  3JSE O;  4JJF A;  3W2W A;  3JRT A;  1V74 B;  1Y6D A;  2OJE D;  3C7J A;  2Q4F A;  3K1H A;  1HW2 A;  4U9E A;  2A69 F;  3KYI A;  2D5R B;  3AG2 C;  4LDK A;  3S9O A;  1OR2 A;  2AU5 A;  3GAN A;  2J7P D;  5A69 A;  1C03 A;  2JX0 A;  4FAP B;  3S29 A;  4ZLD A;  2GDC A;  1DOW A;  1H9G A;  3K6B A;  3TUL A;  4AE4 B;  3QW1 A;  3ZVR A;  1MMA A;  2H7V C;  2NPU A;  2P7V A;  2VB6 A;  4N6H A;  1O3U A;  1LS4 A;  3N2Z B;  3L8J A;  4DXW A;  1V55 C;  4PJM A;  3E70 C;  4DJ9 A;  2QTV A;  2CNW D;  1VOM A;  1WAT A;  3ASO C;  1APC A;  3JYY A;  4WAB A;  2HJM A;  2IM8 A;  3WHN A;  3KMI A;  4E0I A;  4BJT A;  4LDR A;  5HSW A;  2A6H F;  4P6I C;  4RDA A;  4RD9 A;  5L3Q A;  1RKE A;  3VRC A;  2EPL X;  1A0B A;  2R9R B;  3QZC A;  2PNO A;  3WG7 C;  1I4Y A;  2L6H A;  1YZC A;  4FWV A;  1M57 C;  5KYX B;  1Q0G A;  2XXA B;  2YEV A;  3M4B A;  3B29 A;  2NUP B;  1T5O A;  3R2P A;  4MQ9 F;  1YVI A;  1SMY F;  3QMK A;  5B3I A;  2R7O A;  3T6G B;  4B6I A;  2CGE A;  3HKK A;  4W8K A;  1MMN A;  3VF0 A;  2NG1 A;  1OCR C;  1RJ9 B;  1BBH A;  2W9Y A;  4NTF A;  3UMH A;  1QVX A;  2IOQ A;  5DS5 A;  3RQF A;  1M2O A;  2Q9B A;  3EPV A;  2VH3 A;  2X51 A;  4IAR A;  3WAQ A;  4QI2 A;  4DBR A;  1FMW A;  1JRA A;  4NC3 A;  4JCH A;  4PAC A;  2LFF A;  2YLG A;  1WAS A;  1WN0 A;  2Q00 A;  4U5G A;  3O10 A;  2DI3 A;  2OU6 A;  1K04 A;  3SXY A;  4CJO A;  2Y3B A;  5JSL A;  1D1C A;  1OKK D;  2KJG A;  1Z3I X;  2QNL A;  4MVZ A;  1FNT c;  4Q5S F;  4LLE A;  1DOV A;  1KTM A;  1Q0M A;  4CX9 A;  3RKO F;  3S27 A;  4E18 A;  4C7O B;  3FHD A;  3RVY A;  4YK5 A;  1TKN A;  2YKZ A;  3V5X A;  1E85 A;  4ANJ A;  2ZXW C;  3MX3 A;  2A0U A;  4OD4 A;  3JZ0 A;  4E17 A;  2JD3 A;  3EJN A;  3ZSU A;  3TD7 A;  2RD9 A;  1A7D A;  2R7S A;  1XZQ A;  5T1D B;  3SXZ A;  5A6B A;  1T6U A;  4KC9 A;  4KNV A;  5CI9 A;  1NBB A;  1G5Z A;  2C04 A;  3EG9 A;  3F47 A;  3S0X A;  4DOZ A;  4G78 A;  1O87 A;  4G0H A;  5E33 A;  3DE9 A;  4ONS A;  3GM2 A;  4MND A;  4NQF A;  3H2V A;  3KYJ A;  1TQG A;  1HE1 A;  3U2M A;  4BJ5 A;  2XM0 A;  1QSP A;  2XL8 A;  4Q4Z F;  1CGN A;  5E3A A;  3EGX B;  1OCO C;  2B0J A;  1AEP A;  2RSE B;  2XL4 A;  3EZI A;  3HNJ A;  3Q7G A;  3GEE A;  1LIH A;  1CGM E;  5DS6 A;  2YLI A;  1A7V A;  3JT1 A;  1HMD A;  1GS9 A;  2GFH A;  4JTD B;  3ATP A;  1JR8 A;  3DJN B;  4U5F E;  4N06 A;  4XEV A;  4AK9 A;  1XWJ A;  2W45 A;  3US6 A;  3K33 A;  5L0C A;  3Q6M A;  3DZA A;  2IXO A;  2R05 A;  3EHM A;  1JOG A;  2Y39 A;  4PJL A;  1LPE A;  4MTO A;  5IY5 C;  5BQG A;  1OW6 A;  5E3C A;  5L0F A;  1JPN A;  5L0H A;  2I8B A;  3RVZ A;  4IAO A;  5EHH A;  1BDJ B;  1U6H A;  1MQV A;  5JP7 A;  4LDQ A;  4N6C A;  4CIH A;  2GA0 A;  1M2V A;  1QZX A;  5A6K A;  2IYL D;  3GEI A;  3NRH A;  1NU9 C;  2YQY A;  2EPM X;  1NZE A;  3L1M A;  3F46 A;  4CDV A;  3ZQY A;  2NUT A;  3EHN A;  2OOC A;  4HFK B;  1Q0D A;  3R7C A;  2F22 A;  2LFD A;  2UUI A;  3IQC A;  1RXQ A;  1J8M F;  2R7X A;  3O39 A;  3V5Z A;  3B0U X;  1EKY A;  2A1D D;  3QVY A;  1ORJ A;  3EGD A;  5AC5 A;  3HNI A;  1NU7 D;  2DYR C;  2YRF A;  4Z9I A;  3AJM A;  3E9V A;  4O6Y A;  5KYW B;  3PCV A;  4IJJ A;  2HKV A;  2P1A A;  4CS7 A;  1EI7 A;  2VC9 A;  3M15 A;  3KPH A;  4IWB A;  2BL2 A;  4BJ6 A;  3M1C B;  1MMD A;  2TMV P;  1UG7 A;  4DRJ B;  5BQH A;  4XTK A;  2EPK X;  4OIP F;  3ABL C;  3MFN A;  1AVO B;  2LCH A;  2HFI A;  4G7O F;  1CGO A;  2DYS C;  1WGW A;  1VMA A;  1UFB A;  2A0B A;  3QW0 A;  4QDL A;  5EGY A;  1MNE A;  2HMQ A;  3HLZ A;  4JUR I;  2BC5 A;  3KKB A;  3LNR A;  5AC4 A;  4ULV A;  3PMR A;  2A6E F;  3VM6 A;  4E0H A;  2HSQ A;  3TK0 A;  2M64 A;  4E7S A;  3UR3 C;  3OWT A;  1D1B A;  1VB5 A;  3DM9 B;  3ECS A;  3C8G D;  4WGY A;  3JRM O;  4KBL A;  4YT5 A;  3U2L A;  2QUP A;  3KL4 A;  1BZ4 A;  4C3B A;  5L3V A;  3AQC A;  1H6G A;  4HE8 D;  5B1B C;  3V5Y A;  4UDV A;  2WVO A;  1CPR A;  2WB7 A;  4OIN F;  3ZTZ A;  4CS9 A;  5KYY A;  3RH3 A;  1LKX A;  3AQB A;  4XLP F;  2Q9C A;  3DAF A;  3LS0 A;  1HY5 A;  1ST6 A;  3T9O A;  5F5H A;  1L7C A;  3G50 A;  1VLT A;  1YA9 A;  2CW0 F;  3ZIB A;  4CS8 C;  3C63 A;  4Z9J A;  4JW1 A;  1YZA A;  1LI5 A;  1Z6A A;  4MS2 A;  4CBE A;  4K1O A;  1E83 A;  1ZHX A;  3JYH A;  2R7Q A;  3U5S A;  1R5I D;  1PD1 A;  3QVZ A;  3C62 A;  1JMW A;  3C8G B;  2D4U A;  3ZQV A;  1ZHY A;  3J06 A;  2KNH A;  2FAP B;  2J9U A;  3IPM O;  4KNW A;  1YYX A;  1ZYR F;  2Y3H A;  4EWC A;  4U5E E;  3NDB B;  2CYD A;  2QE9 A;  2LSE A;  1LE2 A;  4E7Z A;  3RF3 A;  1HE9 A;  2AWC A;  3CEX A;  4IB4 A;  4JCZ A;  4XPY A;  1FFT C;  5CI8 A;  1FMV A;  1R4T A;  3QTH A;  4BG0 A;  1C02 A;  2LIG A;  4W8P A;  5KYU A;  3U0C A;  3EFO A;  4KI2 A;  2HS5 A;  4J30 B;  4PR9 A;  3X1O A;  2ASR A;  3MBG A;  3GWL A;  1T6I A;  3SXK A;  4A2N B;  1OXB A;  3MYF A;  2XLD A;  2Y3G A;  3GM1 A;  2P0N A;  4P9T A;  3AGT A;  4ULW A;  3JCU Q;  4C3D A;  1A7E A;  5E2Q A;  3KH2 A;  4FX5 A;  1LI7 A;  3OA1 A;  5EK0 A;  4D4N A;  4A4A A;  3M79 A;  2VAS A;  2ZXP A;  4EBJ A;  3W4Y A;  1ZHZ A;  3FXH A;  3T4R A;  3LAY A;  3IQT A;  3W8H A;  4AL0 A;  1SF8 A;  1C17 M;  2KGO A;  4PJJ A;  1ZVZ A;  1KNY A;  4ZLC A;  3ZTM A;  2XLE A;  3DI5 A;  4R32 A;  3Q7L A;  2LK4 A;  2OEX A;  2XLM A;  5COF A;  2OQM A;  4NTA A;  4O79 A;  4Q7C A;  1L3P A;  4XPX A;  2C03 A;  3B0P A;  1YA7 O;  1ZHT A;  2B0H A;  2ZPA A;  4O6M A;  2YL7 A;  1ZHW A;  4AE4 A;  5T3W A;  4AL1 A;  5GPG B;  4JRZ A;  2A68 F;  3PHF 2;  2WL8 A;  3VAY A;  2HJ3 A;  3UMK A;  2XS1 A;  4YL0 A;  5CIV A;  4MVO A;  3NKE A;  2H7O A;  3K1I C;  3MLG A;  4YL3 A;  5L0J A;  4G7H F;  1LVK A;  3AG3 C;  3GM3 A;  2WZL A;  3FAP B;  4IGG A;  3DXJ F;  4N4W A;  5KYN A;  3RW0 A;  4JEB A;  1JAF A;  1O5H A;  3LUT B;  4QI0 A;  3VYW A;  4EHP A;  3UNG C;  2R7V A;  1ORY A;  1H7I A;  1EA8 A;  5A6J A;  5KYX A;  2R25 A;  2XXA A;  1NFN A;  2EIJ C;  3MYI A;  2NUP A;  1Q0K A;  1NLX A;  1J8Y F;  2L7A A;  2ZD9 A;  2IXM A;  2P6V A;  5K0I A;  1WWP A;  3NKD A;  4FES A;  5DQZ A;  1LM3 B;  1RJ9 A;  4YN0 B;  4G7Z F;  1QPU A;  3CZ6 A;  5JRA A;  4YT2 A;  1ZZP A;  3IQ6 A;  2PP4 A;  1BR1 A;  1K40 A;  2YLD A;  4GEH A;  4U5C E;  4RBN A;  3K7D A;  1VYI A;  4U5D E;  4C3E A;  2HMZ A;  3LEV A;  4PFP A;  2J8W A;  1T01 A;  2CNW A;  2ETS A;  3DMD A;  1YYJ A;  2EIM C;  1QLE C;  2LQG A;  3NMI A;  5JUA A;  5F5F A;  3ITF A;  1Q0F A;  3FOO A;  5JT4 A;  1Z23 A;  2HV7 A;  1QKR A;  2HV6 A;  3WOD F;  3X2Q C;  2IXP A;  2WZF A;  1SZI A;  2WVQ A;  4JTA B;  1V54 C;  1OCC C;  4C7O A;  2W4M A;  2Q9A A;  2PBE A;  2OEV A;  1FFH A;  4JE9 A;  3S28 A;  5HV9 A;  2XRH A;  3DE8 A;  1TFO B;  2EPO A;  3DM5 A;  3LLK A;  3NYJ A;  4GQH A;  3S84 A;  1VYK A;  2J45 A;  2KSF A;  1ZW2 A;  1T9K A;  1RKE B;  1VLS A;  2LD6 A;  2Y3D A;  3DWW A;  2J0X A;  1U89 A;  4PJN A;  4X0R A;  4XEF A;  2MWQ A;  4DRI B;  1VTM P;  3GEH A;  2LP4 A;  3BEH A;  3V7O A;  4JEA A;  5D91 A;  2ZXO A;  5TJ5 E;  3NMK A;  3DD7 A;  4YWQ A;  4NY3 A;  3L0I A;  1BR2 A;  1OKK A;  3LLI A;  3NYL A;  3SYN A;  4JVS A;  2ICW G;  3LES A;  3JTL O;  1OR3 A;  1W2W A;  2H8A A;  2R7T A;  5A6B D;  1GGQ A;  3UGP A;  1WOL A;  3GWN A;  2DB4 A;  3EZH A;  3U3B A;  3ZC4 A;  1ZW3 A;  3AG4 C;  4BJ5 C;  4EKW A;  1NSG B;  5FZT A;  3LS1 A;  1TWG A;  2YL0 A;  1XZP A;  2YZS A;  3EH1 A;  1OCZ C;  1T6Q A;  2QLA A;  1F1M A;  4MVQ A;  5KYU B;  2NSF A;  4P9F A;  1E2X A;  3CQZ A;  2OKU A;  3K66 A;  3LEO A;  3ZG1 A;  4IAQ A;  3LJB A;  1Z7Q c;  1IW7 F;  2XSE A;  1YDI A;  4EBB A;  4EUK B;  3T6J A;  3G4X A;  4NTB A;  1I5N A;  1GM5 A;  3LNM B;  5DVW A;  4CJG A;  2MYS A;  5JS5 A;  1OW7 A;  4O7G A;  4J7T A;  4MVR A;  3U8P A;  2WZG A;  5L0I A;  4EBK A;  1WTY A;  3JSZ A;  3DAG A;  1VK5 A;  2R7U A;  2YWA A;  1Y4C A;  3H2U A;  3HNL A;  4U9D A;  3L8I A;  2HZ8 A;  3EG9 B;  3SP1 A;  4H54 A;  4WGZ A;  1N1C A;  1TR2 A;  2KYH A;  2ZXR A;  3SZR A;  4XLN F;  2YVK A;  3O55 A;  5BUO A;  5B1A C;  3K1I A;  5F28 E;  4BEJ A;  1JPJ A;  2KW3 C;  2Y69 C;  4MTG A;  5KYW A;  2P61 A;  2IXN A;  1GQA A;  1OQC A;  2BE5 F;  5COM A;  2OG2 A;  3C18 A;  1B68 A;  2FGY A;  3AG1 C;  2M4E A;  3SXM A;  5JVE A;  2J9B A;  1D1A A;  4U5H A;  4K0D A;  3CSK A;  3HNK A;  3O6X A;  4WJ0 A;  4ER9 A;  2W4B A;  4CSA C;  1HMO A;  2VCC A;  2PX3 A;  4D4X A;  2KC3 A;  4K7B A;  3TOM A;  1YLM A;  4HFF B;  3TOL A;  4BJ6 C;  4OIO F;  2L9J A;  2XM4 A;  4OD5 A;  1FAP B;  3FVY A;  5COG A;  4YT4 A;  2KK1 A;  3FOP A;  3TQO A;  4MW3 A;  4YJW A;  2J9W A;  4JTC B;  2VCB A;  3AGU A;  3AOU A;  3IQ5 A;  1RMV A;  1IZM A;  4MW8 A;  1M2V B;  4H4K C;  4IRU A;  5FCL A;  1M6T A;  2R03 A;  3IEE A;  3I5Q A;  1SYQ A;  2XLV A;  4I1O B;  2OCC C;  2NUT B;  2XS8 A;  4MVM A;  2XLH A;  3ABM C;  2XL6 A;  4JJG A;  2Q3T A;  3U3F A;  1V4A A;  3EGD B;  3FAJ A;  4MTF A;  2EIL C;  2V3C C;  2EIK C;  3HJC A;  1U0B B;  3ABK C;  4JIO A;  1E84 A;  5AGF A;  4CS9 C;  5L0D A;  3H65 A;  2L6G A;  4L6R A;  3DJU B;  4EIY A;  3I5P A;  1D0Z A;  3EQL F;  3U9M A;  3L34 A;  3RYL A;  3A9C A;  3RFY A;  5DQT A;  3B0V C;  2R7W A;  4MVU A;  1M56 C;  3W2V A;  1MMG A;  1NFO A;  2G62 A;  2R02 A;  3C8G A;  4I1M A;  4Z9H A;  3T6B A;  3U8V A;  3OEO A;  3PDM P;  2AVK A;  2CDQ A;  2NSG A;  4JZA A;  3SNH A;  2J7P A;  3BRJ A;  3NYM A;  1YJG A;  3EH2 A;  3GOR A;  4BJ1 A;  2J46 A;  256B A;  4CIP A;  1S05 A;  4OIQ F;  1MND A;  2GAQ A;  2EPN A;  2J9V A;  5D92 A;  1Z63 A;  4XPW A;  1TWC A;  3B9Q A;  1D0X A;  2H7B A;  4XEK A;  1CPQ A;  2DGJ A;  3S90 A;  3I4U A;  3ZWI A;  4GYT A;  1K05 A;  3HTK C;  3B71 A;  4O6N A;  5B3S C;  3TJ6 A;  1RCP A;  1OXK A;  3N24 A;  2L6F A;  1YAR O;  4BEM J;  1AUE A;  2MHR A;  2YHS A;  4YL1 A;  1KU2 A;  4I3M A;  4CS8 A;  4DVY P;  4F4B A;  2AWY A;  1PV3 A;  5A6A A;  3FMS A;  3NMJ A;  4DRH B;  5KYY B;  4J32 B;  1S7Z A;  2HSB A;  3IHU A;  1PD0 A;  2GWW A;  2J0W A;  3C8Z A;  3G4Z A;  4J7Y A;  3RIP A;  1TWA A;  2XLW A;  3ZDL A;  1TFK B;  2UUH A;  4AX2 A;  2CCY A;  4U5B E;  4XWJ A;  2AP3 A;  3RQE A;  4CDY A;  2O9X A;  3A11 A;  1Z5Z A;  2X0C A;  3NG1 A;  4DBQ A;  3SEO A;  2FFH A;  1OW8 A;  1YAU O;  2OJQ A;  4PK4 A;  2EIN C;  5DS4 A;  3UGO A;  2YL3 A;  2G3V A;  1FTS A;  4YT8 A;  2XLO A;  1ZU5 A; 
#chains in the Genus database with same CATH homology
 3FAP B;  1NSG B;  4FAP B;  2GAQ A;  2RSE B;  2FAP B;  4DRJ B;  4DRI B;  4DRH B;  5GPG B;  2NPU A;  1FAP B;  1AUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...