2D5RB

Crystal structure of a tob-hcaf1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CCR4-NOT transcription complex subunit 7
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2d5rB00
3E9VA 5CI8A 2Z15A 2D5RB 5CI9A 3DJUB 3DJNB
chains in the Genus database with same CATH superfamily
5D91A 4G7ZF 4U9DA 3GANA 3AG4C 3CAXA 3A11A 4CS9C 3HTKC 4KBLA 1QSPA 1RKEA 3CZ6A 4IRUA 3FHDA 2YHSA 4ER9A 1KNYA 3GEIA 3WAQA 1ZW2A 3NYMA 5A6AA 2J45A 2YVKA 5JLIA 1CGOA 3O39A 1K40A 1JMWA 1AUEA 3S28A 2J46A 1CPRA 3ZSUA 3IQTA 5GPGB 3U9MA 3FAPB 2C04A 3AGTA 5A6BA 4Z9HA 4KC9A 2OCCC 4U5BE 2F22A 3EH1A 4AK9A 4EHPA 3ZWIA 4N4WA 2QLAA 3SEOA 4OIPF 2EIKC 2XLWA 3B9QA 3TULA 1NU9C 1VB5A 4Z9JA 3K1IA 1ZU4A 2VASA 4RDAA 4BJTA 3C8GA 1ST6A 4G0HA 1OCZC 2R9RB 4IB4A 4BPMA 5EK0A 1TWHA 4JTAB 1HY5A 2L9JA 4X0RA 3DI5A 5F28E 5JUAA 4XPYA 2FAPB 2JX0A 4U5DE 4O7GA 5KYXB 4FAPB 3H2UA 5DVWA 1NSGB 4L6RA 5CI8A 4KNWA 4CS8A 4DRHB 3RVZA 2ETSA 4DVYP 1WGWA 2KC3A 5T3WA 1ZVZA 3GM3A 2NG1A 3DAGA 3V5YA 2XS1A 2KSFA 1NFOA 4O79A 4MVMA 4JTDB 3RF3A 5B1BC 5B1AC 3U8VA 2Q00A 2XL8A 4HEAJ 3LEOA 1APCA 2KQ9A 2W4BA 3O6XA 3O55A 2O9XA 1H6GA 2BC5A 3ECSA 3QW0A 4CIHA 2H7BA 3DKAA 2HZ8A 3SXMA 2J7PD 3K1HA 2KGOA 4MTFA 5AC4A 1K04A 1ZZPA 2ZPAA 4JTCB 2YRFA 4AE4B 4EBKA 5CIVA 2YEVA 2XM0A 3HNLA 3HNJA 1RJ9A 2LIGA 4JKVA 4YT4A 4GQHA 3U5SA 3HJCA 3X2QC 3EG9A 1M2VB 1PD0A 3JT1A 2P61A 5CI9A 3TOLA 3CEXA 2LSEA 3JSZA 4DRIB 2IBFA 4XEVA 3ZQVA 1JOGA 3HLZA 1U6HA 4PJLA 4P6IC 4YT5A 3WG7C 2GA0A 3L8JA 1FMVA 3AQCA 3DM5A 2NPUA 3NDBB 3I4UA 4DJ9A 1S05A 2EPNA 4CDAA 2QTVA 4KI2A 3LJBA 4H54A 4ULVA 1ZHZA 3RKOF 5L0JA 3S84A 1W2WA 1Z23A 3FAJA 2KYHA 5HV9A 4J7TA 4NQFA 2LD6A 4U9EA 1EKYA 3X1OA 2H7OA 3BRJA 1XWJA 3NKEA 4FWVA 1YDIA 2DYSC 4LDRA 1OW7A 2J0WA 3QVZA 4U5CE 4M63A 3C18A 1PD1A 2DI3A 2PF4E 4C3EA 3TQOA 4RD9A 1WASA 1LM3B 4JEBA 3ATPA 2XXAB 3GM1A 5TJ5E 1ORJA 4JURI 3JYHA 1YARO 1O5HA 3ABMC 1NZEA 2AWCA 2L6GA 4PACA 4ZLCA 4JVSA 4MS2A 3RQGA 3RW0A 3GM2A 1A7DA 1NBBA 1YAUO 2PX0A 3GWNA 4JRZA 5E3CA 2R7TA 1R5ID 3JSEO 2V26A 1D0XA 1SF8A 3EH2A 4WJ0A 3EPVA 3EHMA 1A7VA 1SMYF 3NYJA 3AOUA 1LVKA 2A6EF 2IOQA 1ZHWA 4RBNA 2EINC 2HUJA 1KU2A 1GS9A 5D92A 3TJ6A 2CCYA 3KL4A 4F4BA 3FMSA 4XLPF 1OCRC 2A0UA 2W4MA 1D1BA 3K7DA 2NUPB 3TJ5A 4EKWA 1V4AA 2HS5A 2R7UA 1LE4A 2OG2A 4J32B 4E17A 4XPWA 4AX2A 1JAFA 2CGEA 3NMKA 4CS8C 5DS6A 5F5FA 2PBEA 4P9FA 2OEXA 2LK4A 1Q0KA 2A68F 3SXYA 2XLMA 3S27A 3L34A 1T6UA 3UGPA 5EGYA 3HKKA 4C3DA 2OU6A 1BR2A 1N1CA 2QUPA 3E9VA 1YZCA 3KKBA 4QI0A 4W8PA 1C17M 4FX5A 4IARA 2G3KA 2LCHA 1Z5ZA 5A69A 3PDMP 1T5OA 1YA9A 2VCBA 3DJNB 1Q0FA 4JW1A 4Q4ZF 4E7SA 1ORYA 4OIOF 4AE4A 1OW6A 1J8MF 4XLNF 2IXPA 2ZXRA 2KK1A 2A0BA 3SP1A 1OQCA 3U3FA 3GWLA 2A6HF 1M2VA 2J7PA 4LLEA 3TD7A 3QW1A 3V7OA 3ZTZA 2YKZA 3ASOC 2NSGA 4Z9IA 1LE2A 2Q9CA 1VMAA 2FFHA 2XSEA 3WHNA 3Q7GA 4D4NA 1E84A 3G4XA 1NU7D 1MMAA 1TKNA 2NSFA 2XL6A 3DAFA 4OIRF 1XZQA 2I8BA 2OEVA 2IXNA 1V55C 2MYSA 4MNDA 5DS4A 1BR4A 1TFKB 3EFOB 1M2OA 4XEFA 3IPMO 3T6GB 3DJUB 3UMHA 1GM5A 1ZHXA 1OKKA 3HNKA 3JRMO 4XEKA 4BG0A 4NTBA 3C7JA 5JRAA 2KJGA 3V5ZA 5JSLA 1Z3IX 2P0NA 5EHHA 4ULWA 4W8KA 4CS7A 3LS1A 2H8AA 1HW2A 1LS4A 1Z6AA 2CDQA 2G62A 2R25A 1KTMA 1JR8A 3F46A 2J8WA 3Q6NA 2GFHA 1FNTc 1A0BA 1JRAA 2DGJA 3M4BA 3OEOA 4YL0A 5AGFA 3J06A 4E18A 1J8YF 5FCLA 3I5PA 1SR2A 2Q9AA 3R2PA 4P9TA 1I4YA 2GAQA 1ZHYA 2XXAA 2D5RB 2GWWA 2VH3A 4XPXA 3QTHA 1M57C 1C03A 2A1DD 2P6VA 3EGDB 4CSAC 4BJ5A 3U9JA 4Q5SF 3ZIBA 1RMVA 1WN0A 2YWAA 3CSKA 5E2QA 2PFDA 2R05A 1VYKA 3ITFA 2EPOA 1TWAA 4NTFA 3W8HA 4U5HA 2VC9A 2PP4A 5DQTA 1CPQA 1LKXA 2IXOA 2YLIA 3IQ5A 2JD3A 1LIHA 4U5EE 3RVYA 1MNDA 2HJ3A 2WZGA 2ICWG 4ANJA 2B0JA 4DVZA 3K66A 3U3BA 2J9WA 3W8IA 2M64A 1OR3A 1MMNA 1CGME 3H65A 3K33A 2EPMX 5KYWB 5HSWA 2P7VA 4CBEA 1GQAA 5KYNA 3VF0A 1LI7A 5IY5C 1OKKD 4U5FE 1WTYA 1VLSA 2JPUA 2ZXOA 3MFNA 3LNMB 5L0IA 2TMVP 5KYUB 1MMDA 2J9VA 2OKUA 1G5ZA 2B0HA 2XLDA 1UFBA 1T01A 3NG1A 1Q0DA 1MNEA 4MW3A 1FMWA 3ZTMA 3NYLA 4R32A 1Y4CA 2P1AA 2Q4FA 2ZXPA 4KNVA 1VOMA 3ASNC 4CS9A 4MW8A 5COFA 3GODA 1DOVA 3QVYA 1I4ZA 2ASRA 4PK4A 2AP3A 1U89A 2J0XA 3KPHA 3U2MA 2KNHA 3LUTB 3KH2A 3RYLA 4GYTA 1Q0MA 1T6IA 2Y3DA 1V54C 3RQFA 1EA8A 1YJGA 3ABKC 2L7AA 1VK5A 4YT2A 4E7ZA 4PR9A 2FGYA 4MVZA 1ZYRF 2Z15A 2LP4A 3EZHA 4JJGA 1CGNA 3L0IA 1M6TA 1OW8A 1YYJA 2OOCA 4HFFB 5DLJA 4NTAA 2XRHA 4MTOA 2R7QA 3L8IA 3W2WA 3MBGA 2RSEB 4EUKB 3Q6MA 2BL2A 3S90A 3K1IC 4I44A 1YVIA 3S9OA 3WODF 4G78A 1D1AA 1HMOA 4DOZA 1PV3A 3EZIA 3NKDA 4LACB 3TK0A 3ZVRA 4CDYA 4MVUA 5L3VA 4QDLA 1RKCA 3N0TA 3IQCA 2RD9A 4JJFA 5KYYB 1A41A 3QMKA 5L0GA 5L0DA 4A2NB 1GGQA 5KYXA 3DMDA 4N06A 1OR2A 3HNIA 3NMIA 4WGYA 3RFYA 3EGDA 1NLXA 1SZIA 3FXHA 2OJQA 2W9YA 4DBQA 4BJ5C 3IHUA 2L6FA 1HE1A 1ZHTA 3POVA 4E0IA 1D1CA 4MVOA 1QKRA 1LPEA 1EQ1A 1IW7F 1RJ9B 2L81A 1ORSC 2G3VA 3EG9B 3T6BA 1TWCA 3C8ZA 3LAYA 1BBHA 2BE5F 3SZRA 2WVNA 4JIOA 4ZLDA 1WATA 1F1MA 3O10A 3U2LA 3OA1A 4JEAA 5A6KA 5L0CA 5L0FA 2YL7A 4N6CA 3NMJA 5JVEA 3SYNA 2EPKX 1ZW3A 3C63A 3W2VA 3KMIA 3ZQYA 4JCHA 4NCQA 3T6JA 4G7OF 4MVSA 2CNWA 1DOWA 5KYWA 5E3AA 1H9TA 2HSQA 3EGXB 3Q7LA 4XWJA 3US6A 2XLOA 4ONSA 1MQVA 2HKVA 4UDVA 1BZ4A 3FVYA 4OINF 5JS5A 2XLHA 3UMKA 2DYRC 5BQGA 3UGOA 3K6BA 4PFOA 3B0UX 5KYUA 1EI7A 4Q7CA 3DD7A 4AL0A 2PNOA 3M1CB 5BUOA 1YYXA 3AG2C 2Y3HA 5COMA 3GEEA 3RH3A 4BEMJ 3JCUQ 1E83A 1FFTC 2AVKA 1V74B 1H7IA 2MHRA 1H9GA 4N6HA 3PHF2 1VYIA 1BDJB 2W45A 2I15A 5DS5A 2LFFA 4WGZA 4E0HA 2R7SA 1T6QA 3AQBA 2NUTB 4GEHA 4BEJA 4MVQA 4YWQA 2VB6A 4YK5A 1OXKA 3I5QA 2OJED 2HMZA 1FAPB 4DBRA 1NFNA 2H7VC 3ABLC 3LLIA 4EWCA 4AL1A 4A4AA 1QQ3A 2QY9A 1PCXA 4PJNA 1U0BB 3EJNA 4MTGA 2YL1A 1VLTA 3LLKA 4PJMA 3DZAA 4J7YA 1QVXA 2LQGA 3LEVA 4EBJA 2VCAA 2HMQA 1A7EA 2HSBA 1G8XA 2WB7A 3OWTA 2CNWD 2HFIA 3AJMA 1LI5A 3VRCA 4CJOA 1RXQA 1WWPA 4OD5A 1LS1A 2VCCA 3M15A 5T3TA 3LESA 2YLGA 4LERA 2MWQA 2EIMC 2X51A 2HV7A 4XTKA 4BJ6A 5F5HA 5BQIA 3M4CA 4O6YA 2Y3BA 3G4ZA 3SNHA 2Q3TA 3SXZA 3ZG1A 4D4XA 5KYYA 2Y39A 4OIQF 1G4US 1B68A 3L1MA 4HE8D 1RCPA 2NUPA 4IAQA 1O87A 4MQ9F 1C02A 1UG7A 3G50A 2V3CC 4JE9A 4HFKB 3SXKA 4EIYA 3UNGC 3UR3C 1TQGA 1E2XA 4I1OB 4C7OB 1XZPA 2R7OA 3AG3C 1L3PA 2Q7RA 2QNLA 3E70C 4K0DA 5FZTA 1WOLA 2J9UA 1QPUA 4YL3A 3TOMA 5A6JA 3UMIA 1L7CA 2IXMA 3MYIA 3JRTA 3VYWA 1TR2A 2YL3A 2R7RA 3AG1C 2CW0F 2Q9BA 3T4RA 3H2VA 1TFOB 1RKEB 3T9OA 4XQ1A 5A6BD 2A69F 1QZXA 3A9CA 5T1DB 3F47A 3MLGA 5AC5A 3B29A 2R7XA 1FFHA 3JZ0A 3B0PA 1D0ZA 3VM6A 1E86A 3DE9A 1AEPA 3C62A 3C8GD 5E33A 4K7BA 4OD4A 2YZSA 3EGXA 4JC7A 3ZDLA 3N24A 4YJWA 3QZCA 2PX3A 4IAOA 2Y3GA 1YA7O 2OQMA 4J30B 2ZD9A 3S0XA 1Z63A 2R02A 3MYFA 2YL0A 3C8GB 3DE8A 1Z7Qc 2X0CA 5JT4A 5DQZA 3EHNA 3EFOA 1R4TA 4K1OA 4FESA 4O6NA 4EBBA 3FOPA 3RQEA 3U8PA 4JCZA 4O6MA 2XLVA 2YQYA 3CQZA 3LS0A 2IYLD 3GORA 1HMDA 3MX3A 1OCCC 3JTLO 1AVOB 3B0VC 4I1MA 1QLEC 5L3QA 3AGUA 4CSAA 1FR0A 2GDCA 1HW1A 2J9BA 2C03A 1I5NA 2M4EA 2XS8A 3R7CA 1IZMA 2NUTA 3ZC4A 4PFPA 4DRJB 2LFDA 4IJJA 3KYIA 2R7WA 2AWYA 1BR1A 2KW3C 2DB4A 256BA 1JPNA 1Q0GA 2WZFA 1Y6DA 4IWBA 4NC3A 2D4UA 2EILC 5B3SC 4IGGA 1SYQA 2YLDA 3IQ6A 3M79A 4B6IA 5BQHA 4G7HF 3DXJF 1K05A 1S7ZA 5K0IA 1E85A 2HJMA 3B71A 3DWWA 4YL1A 3V5XA 2IM8A 3PMRA 4CIPA 3PCVA 4CX9A 4QI2A 5B3IA 4CJGA 4H4KC 1G4WR 2WVOA 3S29A 4WABA 1OXBA 4CDVA 1VTMP 3U0CA 2UUHA 3NRHA 2R7VA 3DM9B 4PJJA 3BEHA 2WL8A 2UUIA 2XLEA 2WVQA 1TWGA 1M56C 4MVRA 3FDQA 1ZU5A 2E87A 3JYYA 4LDKA 4JZAA 3VAYA 4U5GA 4C3BA 1HE9A 4BJ6C 2EPLX 1D0YA 2QE9A 4LLCA 4LDQA 3KYJA 3FOOA 2XL4A 3LNRA 4I3MA 1OCOC 3N2ZB 4DXWA 3W4YA 1YLMA 1O3UA 2CYDA 2HV6A 4YN0B 1T9KA 5COGA 1NG1A 4NY3A 4BJ1A 5L0HA 1MMGA 4C7OA 2R03A 3IEEA 1JPJA 1YZAA 2AU5A 2L6HA 4YT8A 2XM4A 2WZLA 2EIJC 3RIPA 5JP7A 3EQLF 2ZXWC 1FTSA 3GEHA 2Y69C
chains in the Genus database with same CATH topology
5D91A 4G7ZF 3GANA 3AG4C 4CS9C 3HTKC 4KBLA 3CZ6A 4IRUA 3FHDA 2YHSA 3NYMA 2J45A 3O39A 3S28A 2J46A 3ZSUA 2C04A 4AK9A 4KC9A 2OCCC 4U5BE 3EH1A 3SEOA 4OIPF 2EIKC 3B9QA 1NU9C 1ZU4A 2VASA 4RDAA 4BJTA 1ST6A 4G0HA 1OCZC 1TWHA 2L9JA 4X0RA 4U5DE 4O7GA 5KYXB 5DVWA 5CI8A 4CS8A 4KNWA 4DVYP 1WGWA 5T3WA 2NG1A 3DAGA 4O79A 5B1BC 5B1AC 4HEAJ 2W4BA 2KQ9A 3O6XA 2O9XA 3ECSA 4CIHA 2H7BA 2J7PD 3K1HA 2KGOA 2ZPAA 4AE4B 2YEVA 1RJ9A 4YT4A 3HJCA 3X2QC 3EG9A 1M2VB 1PD0A 3JT1A 5CI9A 2LSEA 3JSZA 3HLZA 4PJLA 4P6IC 4YT5A 3WG7C 1FMVA 3AQCA 3DM5A 3NDBB 3I4UA 4KI2A 2QTVA 3LJBA 1ZHZA 3RKOF 1W2WA 1Z23A 3FAJA 3X1OA 2H7OA 3NKEA 4FWVA 2DYSC 2J0WA 4U5CE 4M63A 1PD1A 2PF4E 4C3EA 4RD9A 2XXAB 4JURI 3JYHA 1O5HA 3ABMC 1NZEA 4ZLCA 4JVSA 2PX0A 5E3CA 2R7TA 2V26A 1D0XA 1SF8A 3EH2A 4WJ0A 3EPVA 3EHMA 3NYJA 1SMYF 1LVKA 2A6EF 2IOQA 1ZHWA 4RBNA 2EINC 1KU2A 5D92A 4F4BA 3KL4A 4XLPF 1OCRC 2W4MA 1D1BA 3K7DA 2NUPB 2R7UA 2OG2A 4J32B 4AX2A 2CGEA 4CS8C 5DS6A 5F5FA 2A68F 3S27A 3L34A 3UGPA 5EGYA 4C3DA 1BR2A 1N1CA 3E9VA 3KKBA 4QI0A 4FX5A 2G3KA 1Z5ZA 3DJNB 4JW1A 4Q4ZF 4E7SA 4OIOF 4AE4A 1J8MF 4XLNF 2IXPA 2ZXRA 3SP1A 2A6HF 1M2VA 2J7PA 4LLEA 3TD7A 3V7OA 3ASOC 2Q9CA 1VMAA 2FFHA 2XSEA 3Q7GA 1NU7D 1MMAA 1TKNA 3DAFA 4OIRF 2I8BA 2IXNA 1V55C 2MYSA 4MNDA 5DS4A 1BR4A 3EFOB 1M2OA 3UMHA 3DJUB 1ZHXA 1OKKA 4BG0A 2KJGA 1Z3IX 5EHHA 4ULWA 4W8KA 4CS7A 3LS1A 1Z6AA 2CDQA 2G62A 3F46A 3Q6NA 2GFHA 2DGJA 3OEOA 5FCLA 1J8YF 3I5PA 2Q9AA 1ZHYA 2XXAA 2D5RB 2VH3A 1M57C 3EGDB 2A1DD 2P6VA 4Q5SF 4CSAC 4BJ5A 3ZIBA 3CSKA 5E2QA 2PFDA 1VYKA 3ITFA 3W8HA 1TWAA 4U5HA 2PP4A 5DQTA 1LKXA 2IXOA 2JD3A 4U5EE 1MNDA 2WZGA 4ANJA 2B0JA 3K66A 2J9WA 3W8IA 1MMNA 3H65A 3K33A 5KYWB 5HSWA 2P7VA 4CBEA 5KYNA 5IY5C 1OKKD 4U5FE 2ZXOA 5KYUB 1MMDA 2J9VA 3NG1A 1MNEA 1FMWA 3NYLA 2ZXPA 4KNVA 1VOMA 3ASNC 4CS9A 3GODA 4PK4A 2J0XA 2KNHA 3KH2A 3RYLA 4GYTA 2Y3DA 1V54C 3ABKC 4YT2A 1VK5A 4E7ZA 2FGYA 1ZYRF 2Z15A 3EZHA 4JJGA 5DLJA 4HFFB 3L0IA 2XRHA 2R7QA 3W2WA 3Q6MA 3K1IC 4I44A 3WODF 1D1AA 4DOZA 3EZIA 5L3VA 3NKDA 4LACB 3ZVRA 4QDLA 3N0TA 5KYYB 4JJFA 3QMKA 4A2NB 5KYXA 3DMDA 4N06A 3RFYA 3EGDA 1SZIA 2W9YA 4DBQA 4BJ5C 3POVA 1ZHTA 1D1CA 1IW7F 1RJ9B 2L81A 2G3VA 3EG9B 3T6BA 1TWCA 3LAYA 2BE5F 3SZRA 2WVNA 4ZLDA 3OA1A 3SYNA 3W2VA 3KMIA 4G7OF 4JCHA 3T6JA 2CNWA 5KYWA 5E3AA 3EGXB 3Q7LA 4XWJA 3FVYA 4OINF 3UMKA 2DYRC 3UGOA 3K6BA 4PFOA 3B0UX 5KYUA 4Q7CA 3DD7A 3M1CB 5BUOA 3AG2C 2Y3HA 3RH3A 3JCUQ 1FFTC 3PHF2 1VYIA 2W45A 5DS5A 2R7SA 3AQBA 2NUTB 4GEHA 4BEJA 4YWQA 2VB6A 3I5QA 4DBRA 2H7VC 3ABLC 3LLIA 4EWCA 2QY9A 1PCXA 4PJNA 3EJNA 3LLKA 4PJMA 3DZAA 3LEVA 1G8XA 2WB7A 3OWTA 2CNWD 4OD5A 1LS1A 5T3TA 3LESA 4LERA 2MWQA 2EIMC 2X51A 2HV7A 4XTKA 4BJ6A 5F5HA 4O6YA 2Y3BA 3SNHA 2Q3TA 3ZG1A 5KYYA 2Y39A 4OIQF 4HE8D 4MQ9F 4DVZA 2NUPA 1O87A 2V3CC 4HFKB 3UNGC 3UR3C 4I1OB 4C7OB 2R7OA 3AG3C 3E70C 4K0DA 2J9UA 3UMIA 2IXMA 3VYWA 3JRTA 1TR2A 2R7RA 3AG1C 2CW0F 2Q9BA 3T4RA 2A69F 1QZXA 5T1DB 3F47A 3MLGA 2R7XA 1FFHA 3B0PA 1D0ZA 5E33A 4K7BA 4OD4A 2YZSA 3EGXA 3N24A 4YJWA 3QZCA 2PX3A 4IAOA 2Y3GA 4J30B 3S0XA 1Z63A 5DQZA 3EHNA 3EFOA 4FESA 4O6NA 4EBBA 4O6MA 3LS0A 3CQZA 3MX3A 2IYLD 1OCCC 3B0VC 4I1MA 1QLEC 5L3QA 4CSAA 2M4EA 2C03A 1IZMA 2NUTA 3ZC4A 4PFPA 4IJJA 2R7WA 1BR1A 2KW3C 1JPNA 4IWBA 2WZFA 2EILC 5B3SC 4B6IA 4G7HF 3DXJF 1S7ZA 3PMRA 4QI2A 4H4KC 2WVOA 3S29A 2R7VA 3NRHA 3DM9B 4PJJA 2WL8A 2WVQA 1TWGA 1M56C 3FDQA 1ZU5A 2E87A 4JZAA 3VAYA 4U5GA 4C3BA 4BJ6C 1D0YA 4LLCA 3LNRA 2XL4A 4I3MA 1OCOC 3N2ZB 2HV6A 4YN0B 1NG1A 4NY3A 4BJ1A 1MMGA 4C7OA 3IEEA 1JPJA 4YT8A 2WZLA 2EIJC 3RIPA 3EQLF 2ZXWC 1FTSA 2Y69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9V A;  5CI8 A;  2Z15 A;  2D5R B;  5CI9 A;  3DJU B;  3DJN B; 
#chains in the Genus database with same CATH topology
 5D91 A;  4G7Z F;  4U9D A;  3GAN A;  3AG4 C;  3CAX A;  3A11 A;  4CS9 C;  3HTK C;  4KBL A;  1QSP A;  1RKE A;  3CZ6 A;  4IRU A;  3FHD A;  2YHS A;  4ER9 A;  1KNY A;  3GEI A;  3WAQ A;  1ZW2 A;  3NYM A;  5A6A A;  2J45 A;  2YVK A;  5JLI A;  1CGO A;  3O39 A;  1K40 A;  1JMW A;  1AUE A;  3S28 A;  2J46 A;  1CPR A;  3ZSU A;  3IQT A;  5GPG B;  3U9M A;  3FAP B;  2C04 A;  3AGT A;  5A6B A;  4Z9H A;  4KC9 A;  2OCC C;  4U5B E;  2F22 A;  3EH1 A;  4AK9 A;  4EHP A;  3ZWI A;  4N4W A;  2QLA A;  3SEO A;  4OIP F;  2EIK C;  2XLW A;  3B9Q A;  3TUL A;  1NU9 C;  1VB5 A;  4Z9J A;  3K1I A;  1ZU4 A;  2VAS A;  4RDA A;  4BJT A;  3C8G A;  1ST6 A;  4G0H A;  1OCZ C;  2R9R B;  4IB4 A;  4BPM A;  5EK0 A;  1TWH A;  4JTA B;  1HY5 A;  2L9J A;  4X0R A;  3DI5 A;  5F28 E;  5JUA A;  4XPY A;  2FAP B;  2JX0 A;  4U5D E;  4O7G A;  5KYX B;  4FAP B;  3H2U A;  5DVW A;  1NSG B;  4L6R A;  5CI8 A;  4KNW A;  4CS8 A;  4DRH B;  3RVZ A;  2ETS A;  4DVY P;  1WGW A;  2KC3 A;  5T3W A;  1ZVZ A;  3GM3 A;  2NG1 A;  3DAG A;  3V5Y A;  2XS1 A;  2KSF A;  1NFO A;  4O79 A;  4MVM A;  4JTD B;  3RF3 A;  5B1B C;  5B1A C;  3U8V A;  2Q00 A;  2XL8 A;  4HEA J;  3LEO A;  1APC A;  2KQ9 A;  2W4B A;  3O6X A;  3O55 A;  2O9X A;  1H6G A;  2BC5 A;  3ECS A;  3QW0 A;  4CIH A;  2H7B A;  3DKA A;  2HZ8 A;  3SXM A;  2J7P D;  3K1H A;  2KGO A;  4MTF A;  5AC4 A;  1K04 A;  1ZZP A;  2ZPA A;  4JTC B;  2YRF A;  4AE4 B;  4EBK A;  5CIV A;  2YEV A;  2XM0 A;  3HNL A;  3HNJ A;  1RJ9 A;  2LIG A;  4JKV A;  4YT4 A;  4GQH A;  3U5S A;  3HJC A;  3X2Q C;  3EG9 A;  1M2V B;  1PD0 A;  3JT1 A;  2P61 A;  5CI9 A;  3TOL A;  3CEX A;  2LSE A;  3JSZ A;  4DRI B;  2IBF A;  4XEV A;  3ZQV A;  1JOG A;  3HLZ A;  1U6H A;  4PJL A;  4P6I C;  4YT5 A;  3WG7 C;  2GA0 A;  3L8J A;  1FMV A;  3AQC A;  3DM5 A;  2NPU A;  3NDB B;  3I4U A;  4DJ9 A;  1S05 A;  2EPN A;  4CDA A;  2QTV A;  4KI2 A;  3LJB A;  4H54 A;  4ULV A;  1ZHZ A;  3RKO F;  5L0J A;  3S84 A;  1W2W A;  1Z23 A;  3FAJ A;  2KYH A;  5HV9 A;  4J7T A;  4NQF A;  2LD6 A;  4U9E A;  1EKY A;  3X1O A;  2H7O A;  3BRJ A;  1XWJ A;  3NKE A;  4FWV A;  1YDI A;  2DYS C;  4LDR A;  1OW7 A;  2J0W A;  3QVZ A;  4U5C E;  4M63 A;  3C18 A;  1PD1 A;  2DI3 A;  2PF4 E;  4C3E A;  3TQO A;  4RD9 A;  1WAS A;  1LM3 B;  4JEB A;  3ATP A;  2XXA B;  3GM1 A;  5TJ5 E;  1ORJ A;  4JUR I;  3JYH A;  1YAR O;  1O5H A;  3ABM C;  1NZE A;  2AWC A;  2L6G A;  4PAC A;  4ZLC A;  4JVS A;  4MS2 A;  3RQG A;  3RW0 A;  3GM2 A;  1A7D A;  1NBB A;  1YAU O;  2PX0 A;  3GWN A;  4JRZ A;  5E3C A;  2R7T A;  1R5I D;  3JSE O;  2V26 A;  1D0X A;  1SF8 A;  3EH2 A;  4WJ0 A;  3EPV A;  3EHM A;  1A7V A;  1SMY F;  3NYJ A;  3AOU A;  1LVK A;  2A6E F;  2IOQ A;  1ZHW A;  4RBN A;  2EIN C;  2HUJ A;  1KU2 A;  1GS9 A;  5D92 A;  3TJ6 A;  2CCY A;  3KL4 A;  4F4B A;  3FMS A;  4XLP F;  1OCR C;  2A0U A;  2W4M A;  1D1B A;  3K7D A;  2NUP B;  3TJ5 A;  4EKW A;  1V4A A;  2HS5 A;  2R7U A;  1LE4 A;  2OG2 A;  4J32 B;  4E17 A;  4XPW A;  4AX2 A;  1JAF A;  2CGE A;  3NMK A;  4CS8 C;  5DS6 A;  5F5F A;  2PBE A;  4P9F A;  2OEX A;  2LK4 A;  1Q0K A;  2A68 F;  3SXY A;  2XLM A;  3S27 A;  3L34 A;  1T6U A;  3UGP A;  5EGY A;  3HKK A;  4C3D A;  2OU6 A;  1BR2 A;  1N1C A;  2QUP A;  3E9V A;  1YZC A;  3KKB A;  4QI0 A;  4W8P A;  1C17 M;  4FX5 A;  4IAR A;  2G3K A;  2LCH A;  1Z5Z A;  5A69 A;  3PDM P;  1T5O A;  1YA9 A;  2VCB A;  3DJN B;  1Q0F A;  4JW1 A;  4Q4Z F;  4E7S A;  1ORY A;  4OIO F;  4AE4 A;  1OW6 A;  1J8M F;  4XLN F;  2IXP A;  2ZXR A;  2KK1 A;  2A0B A;  3SP1 A;  1OQC A;  3U3F A;  3GWL A;  2A6H F;  1M2V A;  2J7P A;  4LLE A;  3TD7 A;  3QW1 A;  3V7O A;  3ZTZ A;  2YKZ A;  3ASO C;  2NSG A;  4Z9I A;  1LE2 A;  2Q9C A;  1VMA A;  2FFH A;  2XSE A;  3WHN A;  3Q7G A;  4D4N A;  1E84 A;  3G4X A;  1NU7 D;  1MMA A;  1TKN A;  2NSF A;  2XL6 A;  3DAF A;  4OIR F;  1XZQ A;  2I8B A;  2OEV A;  2IXN A;  1V55 C;  2MYS A;  4MND A;  5DS4 A;  1BR4 A;  1TFK B;  3EFO B;  1M2O A;  4XEF A;  3IPM O;  3T6G B;  3DJU B;  3UMH A;  1GM5 A;  1ZHX A;  1OKK A;  3HNK A;  3JRM O;  4XEK A;  4BG0 A;  4NTB A;  3C7J A;  5JRA A;  2KJG A;  3V5Z A;  5JSL A;  1Z3I X;  2P0N A;  5EHH A;  4ULW A;  4W8K A;  4CS7 A;  3LS1 A;  2H8A A;  1HW2 A;  1LS4 A;  1Z6A A;  2CDQ A;  2G62 A;  2R25 A;  1KTM A;  1JR8 A;  3F46 A;  2J8W A;  3Q6N A;  2GFH A;  1FNT c;  1A0B A;  1JRA A;  2DGJ A;  3M4B A;  3OEO A;  4YL0 A;  5AGF A;  3J06 A;  4E18 A;  1J8Y F;  5FCL A;  3I5P A;  1SR2 A;  2Q9A A;  3R2P A;  4P9T A;  1I4Y A;  2GAQ A;  1ZHY A;  2XXA A;  2D5R B;  2GWW A;  2VH3 A;  4XPX A;  3QTH A;  1M57 C;  1C03 A;  2A1D D;  2P6V A;  3EGD B;  4CSA C;  4BJ5 A;  3U9J A;  4Q5S F;  3ZIB A;  1RMV A;  1WN0 A;  2YWA A;  3CSK A;  5E2Q A;  2PFD A;  2R05 A;  1VYK A;  3ITF A;  2EPO A;  1TWA A;  4NTF A;  3W8H A;  4U5H A;  2VC9 A;  2PP4 A;  5DQT A;  1CPQ A;  1LKX A;  2IXO A;  2YLI A;  3IQ5 A;  2JD3 A;  1LIH A;  4U5E E;  3RVY A;  1MND A;  2HJ3 A;  2WZG A;  2ICW G;  4ANJ A;  2B0J A;  4DVZ A;  3K66 A;  3U3B A;  2J9W A;  3W8I A;  2M64 A;  1OR3 A;  1MMN A;  1CGM E;  3H65 A;  3K33 A;  2EPM X;  5KYW B;  5HSW A;  2P7V A;  4CBE A;  1GQA A;  5KYN A;  3VF0 A;  1LI7 A;  5IY5 C;  1OKK D;  4U5F E;  1WTY A;  1VLS A;  2JPU A;  2ZXO A;  3MFN A;  3LNM B;  5L0I A;  2TMV P;  5KYU B;  1MMD A;  2J9V A;  2OKU A;  1G5Z A;  2B0H A;  2XLD A;  1UFB A;  1T01 A;  3NG1 A;  1Q0D A;  1MNE A;  4MW3 A;  1FMW A;  3ZTM A;  3NYL A;  4R32 A;  1Y4C A;  2P1A A;  2Q4F A;  2ZXP A;  4KNV A;  1VOM A;  3ASN C;  4CS9 A;  4MW8 A;  5COF A;  3GOD A;  1DOV A;  3QVY A;  1I4Z A;  2ASR A;  4PK4 A;  2AP3 A;  1U89 A;  2J0X A;  3KPH A;  3U2M A;  2KNH A;  3LUT B;  3KH2 A;  3RYL A;  4GYT A;  1Q0M A;  1T6I A;  2Y3D A;  1V54 C;  3RQF A;  1EA8 A;  1YJG A;  3ABK C;  2L7A A;  1VK5 A;  4YT2 A;  4E7Z A;  4PR9 A;  2FGY A;  4MVZ A;  1ZYR F;  2Z15 A;  2LP4 A;  3EZH A;  4JJG A;  1CGN A;  3L0I A;  1M6T A;  1OW8 A;  1YYJ A;  2OOC A;  4HFF B;  5DLJ A;  4NTA A;  2XRH A;  4MTO A;  2R7Q A;  3L8I A;  3W2W A;  3MBG A;  2RSE B;  4EUK B;  3Q6M A;  2BL2 A;  3S90 A;  3K1I C;  4I44 A;  1YVI A;  3S9O A;  3WOD F;  4G78 A;  1D1A A;  1HMO A;  4DOZ A;  1PV3 A;  3EZI A;  3NKD A;  4LAC B;  3TK0 A;  3ZVR A;  4CDY A;  4MVU A;  5L3V A;  4QDL A;  1RKC A;  3N0T A;  3IQC A;  2RD9 A;  4JJF A;  5KYY B;  1A41 A;  3QMK A;  5L0G A;  5L0D A;  4A2N B;  1GGQ A;  5KYX A;  3DMD A;  4N06 A;  1OR2 A;  3HNI A;  3NMI A;  4WGY A;  3RFY A;  3EGD A;  1NLX A;  1SZI A;  3FXH A;  2OJQ A;  2W9Y A;  4DBQ A;  4BJ5 C;  3IHU A;  2L6F A;  1HE1 A;  1ZHT A;  3POV A;  4E0I A;  1D1C A;  4MVO A;  1QKR A;  1LPE A;  1EQ1 A;  1IW7 F;  1RJ9 B;  2L81 A;  1ORS C;  2G3V A;  3EG9 B;  3T6B A;  1TWC A;  3C8Z A;  3LAY A;  1BBH A;  2BE5 F;  3SZR A;  2WVN A;  4JIO A;  4ZLD A;  1WAT A;  1F1M A;  3O10 A;  3U2L A;  3OA1 A;  4JEA A;  5A6K A;  5L0C A;  5L0F A;  2YL7 A;  4N6C A;  3NMJ A;  5JVE A;  3SYN A;  2EPK X;  1ZW3 A;  3C63 A;  3W2V A;  3KMI A;  3ZQY A;  4JCH A;  4NCQ A;  3T6J A;  4G7O F;  4MVS A;  2CNW A;  1DOW A;  5KYW A;  5E3A A;  1H9T A;  2HSQ A;  3EGX B;  3Q7L A;  4XWJ A;  3US6 A;  2XLO A;  4ONS A;  1MQV A;  2HKV A;  4UDV A;  1BZ4 A;  3FVY A;  4OIN F;  5JS5 A;  2XLH A;  3UMK A;  2DYR C;  5BQG A;  3UGO A;  3K6B A;  4PFO A;  3B0U X;  5KYU A;  1EI7 A;  4Q7C A;  3DD7 A;  4AL0 A;  2PNO A;  3M1C B;  5BUO A;  1YYX A;  3AG2 C;  2Y3H A;  5COM A;  3GEE A;  3RH3 A;  4BEM J;  3JCU Q;  1E83 A;  1FFT C;  2AVK A;  1V74 B;  1H7I A;  2MHR A;  1H9G A;  4N6H A;  3PHF 2;  1VYI A;  1BDJ B;  2W45 A;  2I15 A;  5DS5 A;  2LFF A;  4WGZ A;  4E0H A;  2R7S A;  1T6Q A;  3AQB A;  2NUT B;  4GEH A;  4BEJ A;  4MVQ A;  4YWQ A;  2VB6 A;  4YK5 A;  1OXK A;  3I5Q A;  2OJE D;  2HMZ A;  1FAP B;  4DBR A;  1NFN A;  2H7V C;  3ABL C;  3LLI A;  4EWC A;  4AL1 A;  4A4A A;  1QQ3 A;  2QY9 A;  1PCX A;  4PJN A;  1U0B B;  3EJN A;  4MTG A;  2YL1 A;  1VLT A;  3LLK A;  4PJM A;  3DZA A;  4J7Y A;  1QVX A;  2LQG A;  3LEV A;  4EBJ A;  2VCA A;  2HMQ A;  1A7E A;  2HSB A;  1G8X A;  2WB7 A;  3OWT A;  2CNW D;  2HFI A;  3AJM A;  1LI5 A;  3VRC A;  4CJO A;  1RXQ A;  1WWP A;  4OD5 A;  1LS1 A;  2VCC A;  3M15 A;  5T3T A;  3LES A;  2YLG A;  4LER A;  2MWQ A;  2EIM C;  2X51 A;  2HV7 A;  4XTK A;  4BJ6 A;  5F5H A;  5BQI A;  3M4C A;  4O6Y A;  2Y3B A;  3G4Z A;  3SNH A;  2Q3T A;  3SXZ A;  3ZG1 A;  4D4X A;  5KYY A;  2Y39 A;  4OIQ F;  1G4U S;  1B68 A;  3L1M A;  4HE8 D;  1RCP A;  2NUP A;  4IAQ A;  1O87 A;  4MQ9 F;  1C02 A;  1UG7 A;  3G50 A;  2V3C C;  4JE9 A;  4HFK B;  3SXK A;  4EIY A;  3UNG C;  3UR3 C;  1TQG A;  1E2X A;  4I1O B;  4C7O B;  1XZP A;  2R7O A;  3AG3 C;  1L3P A;  2Q7R A;  2QNL A;  3E70 C;  4K0D A;  5FZT A;  1WOL A;  2J9U A;  1QPU A;  4YL3 A;  3TOM A;  5A6J A;  3UMI A;  1L7C A;  2IXM A;  3MYI A;  3JRT A;  3VYW A;  1TR2 A;  2YL3 A;  2R7R A;  3AG1 C;  2CW0 F;  2Q9B A;  3T4R A;  3H2V A;  1TFO B;  1RKE B;  3T9O A;  4XQ1 A;  5A6B D;  2A69 F;  1QZX A;  3A9C A;  5T1D B;  3F47 A;  3MLG A;  5AC5 A;  3B29 A;  2R7X A;  1FFH A;  3JZ0 A;  3B0P A;  1D0Z A;  3VM6 A;  1E86 A;  3DE9 A;  1AEP A;  3C62 A;  3C8G D;  5E33 A;  4K7B A;  4OD4 A;  2YZS A;  3EGX A;  4JC7 A;  3ZDL A;  3N24 A;  4YJW A;  3QZC A;  2PX3 A;  4IAO A;  2Y3G A;  1YA7 O;  2OQM A;  4J30 B;  2ZD9 A;  3S0X A;  1Z63 A;  2R02 A;  3MYF A;  2YL0 A;  3C8G B;  3DE8 A;  1Z7Q c;  2X0C A;  5JT4 A;  5DQZ A;  3EHN A;  3EFO A;  1R4T A;  4K1O A;  4FES A;  4O6N A;  4EBB A;  3FOP A;  3RQE A;  3U8P A;  4JCZ A;  4O6M A;  2XLV A;  2YQY A;  3CQZ A;  3LS0 A;  2IYL D;  3GOR A;  1HMD A;  3MX3 A;  1OCC C;  3JTL O;  1AVO B;  3B0V C;  4I1M A;  1QLE C;  5L3Q A;  3AGU A;  4CSA A;  1FR0 A;  2GDC A;  1HW1 A;  2J9B A;  2C03 A;  1I5N A;  2M4E A;  2XS8 A;  3R7C A;  1IZM A;  2NUT A;  3ZC4 A;  4PFP A;  4DRJ B;  2LFD A;  4IJJ A;  3KYI A;  2R7W A;  2AWY A;  1BR1 A;  2KW3 C;  2DB4 A;  256B A;  1JPN A;  1Q0G A;  2WZF A;  1Y6D A;  4IWB A;  4NC3 A;  2D4U A;  2EIL C;  5B3S C;  4IGG A;  1SYQ A;  2YLD A;  3IQ6 A;  3M79 A;  4B6I A;  5BQH A;  4G7H F;  3DXJ F;  1K05 A;  1S7Z A;  5K0I A;  1E85 A;  2HJM A;  3B71 A;  3DWW A;  4YL1 A;  3V5X A;  2IM8 A;  3PMR A;  4CIP A;  3PCV A;  4CX9 A;  4QI2 A;  5B3I A;  4CJG A;  4H4K C;  1G4W R;  2WVO A;  3S29 A;  4WAB A;  1OXB A;  4CDV A;  1VTM P;  3U0C A;  2UUH A;  3NRH A;  2R7V A;  3DM9 B;  4PJJ A;  3BEH A;  2WL8 A;  2UUI A;  2XLE A;  2WVQ A;  1TWG A;  1M56 C;  4MVR A;  3FDQ A;  1ZU5 A;  2E87 A;  3JYY A;  4LDK A;  4JZA A;  3VAY A;  4U5G A;  4C3B A;  1HE9 A;  4BJ6 C;  2EPL X;  1D0Y A;  2QE9 A;  4LLC A;  4LDQ A;  3KYJ A;  3FOO A;  2XL4 A;  3LNR A;  4I3M A;  1OCO C;  3N2Z B;  4DXW A;  3W4Y A;  1YLM A;  1O3U A;  2CYD A;  2HV6 A;  4YN0 B;  1T9K A;  5COG A;  1NG1 A;  4NY3 A;  4BJ1 A;  5L0H A;  1MMG A;  4C7O A;  2R03 A;  3IEE A;  1JPJ A;  1YZA A;  2AU5 A;  2L6H A;  4YT8 A;  2XM4 A;  2WZL A;  2EIJ C;  3RIP A;  5JP7 A;  3EQL F;  2ZXW C;  1FTS A;  3GEH A;  2Y69 C; 
#chains in the Genus database with same CATH homology
 5D91 A;  4G7Z F;  3GAN A;  3AG4 C;  4CS9 C;  3HTK C;  4KBL A;  3CZ6 A;  4IRU A;  3FHD A;  2YHS A;  3NYM A;  2J45 A;  3O39 A;  3S28 A;  2J46 A;  3ZSU A;  2C04 A;  4AK9 A;  4KC9 A;  2OCC C;  4U5B E;  3EH1 A;  3SEO A;  4OIP F;  2EIK C;  3B9Q A;  1NU9 C;  1ZU4 A;  2VAS A;  4RDA A;  4BJT A;  1ST6 A;  4G0H A;  1OCZ C;  1TWH A;  2L9J A;  4X0R A;  4U5D E;  4O7G A;  5KYX B;  5DVW A;  5CI8 A;  4CS8 A;  4KNW A;  4DVY P;  1WGW A;  5T3W A;  2NG1 A;  3DAG A;  4O79 A;  5B1B C;  5B1A C;  4HEA J;  2W4B A;  2KQ9 A;  3O6X A;  2O9X A;  3ECS A;  4CIH A;  2H7B A;  2J7P D;  3K1H A;  2KGO A;  2ZPA A;  4AE4 B;  2YEV A;  1RJ9 A;  4YT4 A;  3HJC A;  3X2Q C;  3EG9 A;  1M2V B;  1PD0 A;  3JT1 A;  5CI9 A;  2LSE A;  3JSZ A;  3HLZ A;  4PJL A;  4P6I C;  4YT5 A;  3WG7 C;  1FMV A;  3AQC A;  3DM5 A;  3NDB B;  3I4U A;  4KI2 A;  2QTV A;  3LJB A;  1ZHZ A;  3RKO F;  1W2W A;  1Z23 A;  3FAJ A;  3X1O A;  2H7O A;  3NKE A;  4FWV A;  2DYS C;  2J0W A;  4U5C E;  4M63 A;  1PD1 A;  2PF4 E;  4C3E A;  4RD9 A;  2XXA B;  4JUR I;  3JYH A;  1O5H A;  3ABM C;  1NZE A;  4ZLC A;  4JVS A;  2PX0 A;  5E3C A;  2R7T A;  2V26 A;  1D0X A;  1SF8 A;  3EH2 A;  4WJ0 A;  3EPV A;  3EHM A;  3NYJ A;  1SMY F;  1LVK A;  2A6E F;  2IOQ A;  1ZHW A;  4RBN A;  2EIN C;  1KU2 A;  5D92 A;  4F4B A;  3KL4 A;  4XLP F;  1OCR C;  2W4M A;  1D1B A;  3K7D A;  2NUP B;  2R7U A;  2OG2 A;  4J32 B;  4AX2 A;  2CGE A;  4CS8 C;  5DS6 A;  5F5F A;  2A68 F;  3S27 A;  3L34 A;  3UGP A;  5EGY A;  4C3D A;  1BR2 A;  1N1C A;  3E9V A;  3KKB A;  4QI0 A;  4FX5 A;  2G3K A;  1Z5Z A;  3DJN B;  4JW1 A;  4Q4Z F;  4E7S A;  4OIO F;  4AE4 A;  1J8M F;  4XLN F;  2IXP A;  2ZXR A;  3SP1 A;  2A6H F;  1M2V A;  2J7P A;  4LLE A;  3TD7 A;  3V7O A;  3ASO C;  2Q9C A;  1VMA A;  2FFH A;  2XSE A;  3Q7G A;  1NU7 D;  1MMA A;  1TKN A;  3DAF A;  4OIR F;  2I8B A;  2IXN A;  1V55 C;  2MYS A;  4MND A;  5DS4 A;  1BR4 A;  3EFO B;  1M2O A;  3UMH A;  3DJU B;  1ZHX A;  1OKK A;  4BG0 A;  2KJG A;  1Z3I X;  5EHH A;  4ULW A;  4W8K A;  4CS7 A;  3LS1 A;  1Z6A A;  2CDQ A;  2G62 A;  3F46 A;  3Q6N A;  2GFH A;  2DGJ A;  3OEO A;  5FCL A;  1J8Y F;  3I5P A;  2Q9A A;  1ZHY A;  2XXA A;  2D5R B;  2VH3 A;  1M57 C;  3EGD B;  2A1D D;  2P6V A;  4Q5S F;  4CSA C;  4BJ5 A;  3ZIB A;  3CSK A;  5E2Q A;  2PFD A;  1VYK A;  3ITF A;  3W8H A;  1TWA A;  4U5H A;  2PP4 A;  5DQT A;  1LKX A;  2IXO A;  2JD3 A;  4U5E E;  1MND A;  2WZG A;  4ANJ A;  2B0J A;  3K66 A;  2J9W A;  3W8I A;  1MMN A;  3H65 A;  3K33 A;  5KYW B;  5HSW A;  2P7V A;  4CBE A;  5KYN A;  5IY5 C;  1OKK D;  4U5F E;  2ZXO A;  5KYU B;  1MMD A;  2J9V A;  3NG1 A;  1MNE A;  1FMW A;  3NYL A;  2ZXP A;  4KNV A;  1VOM A;  3ASN C;  4CS9 A;  3GOD A;  4PK4 A;  2J0X A;  2KNH A;  3KH2 A;  3RYL A;  4GYT A;  2Y3D A;  1V54 C;  3ABK C;  4YT2 A;  1VK5 A;  4E7Z A;  2FGY A;  1ZYR F;  2Z15 A;  3EZH A;  4JJG A;  5DLJ A;  4HFF B;  3L0I A;  2XRH A;  2R7Q A;  3W2W A;  3Q6M A;  3K1I C;  4I44 A;  3WOD F;  1D1A A;  4DOZ A;  3EZI A;  5L3V A;  3NKD A;  4LAC B;  3ZVR A;  4QDL A;  3N0T A;  5KYY B;  4JJF A;  3QMK A;  4A2N B;  5KYX A;  3DMD A;  4N06 A;  3RFY A;  3EGD A;  1SZI A;  2W9Y A;  4DBQ A;  4BJ5 C;  3POV A;  1ZHT A;  1D1C A;  1IW7 F;  1RJ9 B;  2L81 A;  2G3V A;  3EG9 B;  3T6B A;  1TWC A;  3LAY A;  2BE5 F;  3SZR A;  2WVN A;  4ZLD A;  3OA1 A;  3SYN A;  3W2V A;  3KMI A;  4G7O F;  4JCH A;  3T6J A;  2CNW A;  5KYW A;  5E3A A;  3EGX B;  3Q7L A;  4XWJ A;  3FVY A;  4OIN F;  3UMK A;  2DYR C;  3UGO A;  3K6B A;  4PFO A;  3B0U X;  5KYU A;  4Q7C A;  3DD7 A;  3M1C B;  5BUO A;  3AG2 C;  2Y3H A;  3RH3 A;  3JCU Q;  1FFT C;  3PHF 2;  1VYI A;  2W45 A;  5DS5 A;  2R7S A;  3AQB A;  2NUT B;  4GEH A;  4BEJ A;  4YWQ A;  2VB6 A;  3I5Q A;  4DBR A;  2H7V C;  3ABL C;  3LLI A;  4EWC A;  2QY9 A;  1PCX A;  4PJN A;  3EJN A;  3LLK A;  4PJM A;  3DZA A;  3LEV A;  1G8X A;  2WB7 A;  3OWT A;  2CNW D;  4OD5 A;  1LS1 A;  5T3T A;  3LES A;  4LER A;  2MWQ A;  2EIM C;  2X51 A;  2HV7 A;  4XTK A;  4BJ6 A;  5F5H A;  4O6Y A;  2Y3B A;  3SNH A;  2Q3T A;  3ZG1 A;  5KYY A;  2Y39 A;  4OIQ F;  4HE8 D;  4MQ9 F;  4DVZ A;  2NUP A;  1O87 A;  2V3C C;  4HFK B;  3UNG C;  3UR3 C;  4I1O B;  4C7O B;  2R7O A;  3AG3 C;  3E70 C;  4K0D A;  2J9U A;  3UMI A;  2IXM A;  3VYW A;  3JRT A;  1TR2 A;  2R7R A;  3AG1 C;  2CW0 F;  2Q9B A;  3T4R A;  2A69 F;  1QZX A;  5T1D B;  3F47 A;  3MLG A;  2R7X A;  1FFH A;  3B0P A;  1D0Z A;  5E33 A;  4K7B A;  4OD4 A;  2YZS A;  3EGX A;  3N24 A;  4YJW A;  3QZC A;  2PX3 A;  4IAO A;  2Y3G A;  4J30 B;  3S0X A;  1Z63 A;  5DQZ A;  3EHN A;  3EFO A;  4FES A;  4O6N A;  4EBB A;  4O6M A;  3LS0 A;  3CQZ A;  3MX3 A;  2IYL D;  1OCC C;  3B0V C;  4I1M A;  1QLE C;  5L3Q A;  4CSA A;  2M4E A;  2C03 A;  1IZM A;  2NUT A;  3ZC4 A;  4PFP A;  4IJJ A;  2R7W A;  1BR1 A;  2KW3 C;  1JPN A;  4IWB A;  2WZF A;  2EIL C;  5B3S C;  4B6I A;  4G7H F;  3DXJ F;  1S7Z A;  3PMR A;  4QI2 A;  4H4K C;  2WVO A;  3S29 A;  2R7V A;  3NRH A;  3DM9 B;  4PJJ A;  2WL8 A;  2WVQ A;  1TWG A;  1M56 C;  3FDQ A;  1ZU5 A;  2E87 A;  4JZA A;  3VAY A;  4U5G A;  4C3B A;  4BJ6 C;  1D0Y A;  4LLC A;  3LNR A;  2XL4 A;  4I3M A;  1OCO C;  3N2Z B;  2HV6 A;  4YN0 B;  1NG1 A;  4NY3 A;  4BJ1 A;  1MMG A;  4C7O A;  3IEE A;  1JPJ A;  4YT8 A;  2WZL A;  2EIJ C;  3RIP A;  3EQL F;  2ZXW C;  1FTS A;  2Y69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...