2D5RB

Crystal structure of a tob-hcaf1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 7
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 33
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2d5rB00
5CI9A 3DJUB 3DJNB 3E9VA 5CI8A 2D5RB 2Z15A
chains in the Genus database with same CATH superfamily
4MTOA 1MMGA 5A69A 2NSFA 2R9RB 3US6A 4A4AA 3EJNA 4PK4A 4XEFA 2FAPB 4XPWA 3CZ6A 3O55A 5DS4A 1I4YA 3S9OA 2GAQA 3DM5A 3E70C 3K6BA 1VB5A 2XLOA 3L8IA 1V4AA 4YK5A 3TJ6A 1T6UA 4YWQA 2JX0A 3LNRA 1T9KA 3MX3A 4JW1A 3LS1A 3RQFA 1VMAA 2LP4A 3DKAA 1ZZPA 4FX5A 5E2QA 2IYLD 3LEVA 3TQOA 4JCZA 2UUIA 1YJGA 2AWCA 3FMSA 4MVUA 2XM4A 4P6IC 5KYUA 3RFYA 4EUKB 5JVEA 1VK5A 3K66A 4GQHA 2XLVA 1BDJB 1LE4A 3VM6A 3DAGA 3UNGC 3RKOF 3MFNA 1MNEA 2QUPA 1J8MF 3KKBA 3N24A 1D0YA 1ORSC 3QW1A 2DYRC 1LI5A 2LFFA 1TKNA 2XLEA 5E3CA 4PFPA 5JUAA 3MYIA 4I1MA 1NBBA 1RKCA 3UMKA 1MMNA 2KYHA 2W4MA 2R7XA 1MNDA 2KGOA 1Z3IX 2AWYA 4JRZA 3CEXA 2KK1A 3UMIA 4W8KA 2B0HA 4YT4A 5AGFA 4LACB 1Y6DA 4BEJA 2J9UA 1PD0A 1WGWA 2YRFA 3JSEO 3EGDB 5A6JA 5B3SC 4RBNA 5KYNA 3DMDA 2UUHA 3C8GD 1SYQA 4MW3A 2HJ3A 3M15A 4JVSA 4MS2A 2XLMA 1EA8A 2EIJC 3MBGA 1QSPA 2XL8A 5JSLA 2G62A 3DXJF 3EG9A 4BJ6C 4J30B 4LERA 5KYXB 2R7RA 1M6TA 2XLWA 2XM0A 3N0TA 3T6GB 3H65A 3TOLA 3FVYA 3EH2A 3EPVA 4XWJA 1T5OA 3GORA 2P61A 3UGOA 2ZXRA 1WWPA 3EHNA 2LIGA 1IW7F 3AG2C 1PV3A 2CNWD 3HJCA 3RVZA 2LSEA 4MNDA 5CI9A 4ZLDA 3DM9B 1D1CA 3TK0A 3DD7A 4A2NB 3U0CA 3GEHA 3JCUQ 3K33A 3RYLA 3T4RA 2EINC 3VF0A 1YARO 4HFFB 2MHRA 1CGOA 2QY9A 5K0IA 3RF3A 3ZWIA 2JPUA 1J8YF 1ZHXA 3LLKA 2OEXA 1UG7A 2BC5A 2J0XA 4H54A 1Q0GA 4DRIB 1B68A 4ANJA 2YQYA 3EHMA 4E7ZA 2M64A 3I5PA 2C04A 5JS5A 3PHF2 4CJOA 1JPNA 4OIRF 2HV7A 5DLJA 2HV6A 3RH3A 4IAOA 2QLAA 3IQTA 4LLEA 2ETSA 5BUOA 2XL4A 2V3CC 2IXPA 5KYWB 1UFBA 2GWWA 1U0BB 2J7PD 2Q3TA 1FAPB 1LS4A 5L0FA 4EKWA 1O3UA 4LDKA 1A7DA 2NUPA 1GS9A 3JSZA 4BEMJ 1OCCC 2TMVP 1E84A 1QPUA 3MLGA 3NG1A 1FTSA 2WVOA 1RXQA 3TOMA 3EH1A 4G7HF 3E9VA 3ABMC 3A11A 2ICWG 3IQ6A 2EPKX 1V54C 4MTGA 3MYFA 2H7OA 2VASA 4X0RA 5D92A 3NDBB 3KL4A 4O6MA 1OXKA 3QZCA 1D1AA 3NRHA 3JTLO 4P9FA 2YL7A 4AE4B 3QVYA 1BR2A 1ZU4A 1ZHZA 2PFDA 4NTBA 1TWAA 3O6XA 2OOCA 4JEBA 2LQGA 5L0JA 5L3VA 4C3BA 1RKEB 1RJ9B 2J45A 5AC4A 3IEEA 4CS9A 5EGYA 1QVXA 5TJ5E 4JZAA 3ZVRA 4DBRA 3AQCA 5JT4A 2HUJA 3SP1A 3BEHA 3NYMA 4BJ5A 2I8BA 1FMVA 2E87A 1BR4A 2IOQA 2ZPAA 2HZ8A 4C3DA 3B9QA 2G3KA 4O7GA 2D5RB 3U2MA 1Y4CA 4EBJA 2GDCA 4O6NA 2HJMA 3R7CA 4CS9C 1T01A 1YYJA 3LEOA 4GYTA 3UGPA 2OKUA 4RDAA 5CI8A 3Q6MA 4XPXA 1V74B 2H8AA 2OG2A 4CBEA 4CSAC 3S28A 2R25A 1TQGA 1GQAA 4U5HA 2HSQA 3ABLC 1MMAA 1Q0KA 2Q9CA 1I4ZA 3JZ0A 4IB4A 5BQGA 1RCPA 1NFOA 2L6GA 2BE5F 3C62A 1BZ4A 2J9VA 3G4ZA 4MVSA 3ITFA 2J8WA 4PJLA 1PCXA 5DQZA 1S05A 1LI7A 1NG1A 4QDLA 4B6IA 1YA7O 3Q7LA 4R32A 4JTCB 1U89A 1YZAA 2EILC 3FOOA 3B71A 1K40A 1NU9C 2MYSA 5L3QA 2YEVA 1YDIA 2VH3A 3EGXA 4C7OA 2WL8A 1H9GA 2YL3A 2W45A 5L0GA 3SZRA 2JD3A 2IXNA 3FAPB 3ZQVA 3IQ5A 4U5BE 2L81A 3GEIA 2B0JA 4HEAJ 3ZTMA 2FGYA 5B1AC 4CDYA 3M4CA 4DJ9A 4CIHA 1NFNA 3LJBA 3FXHA 2CYDA 4XLPF 4AK9A 3K1HA 3V5ZA 1VYKA 2R05A 5KYYA 3X2QC 4O6YA 1FR0A 2PBEA 5COFA 4JE9A 2QNLA 2Q00A 1Q0FA 2IM8A 1E2XA 2IXOA 1R4TA 3NMKA 1YLMA 2KQ9A 3EG9B 1PD1A 4DRJB 2A1DD 3NMJA 1ZHWA 1OXBA 3V7OA 1NSGB 2L6HA 4WJ0A 1VYIA 1YA9A 2KC3A 2W4BA 3AG4C 4K1OA 5HV9A 3AG1C 3U3FA 1OQCA 3T6JA 1ST6A 2EPLX 3EZIA 3DE8A 3HTKC 4N06A 3S0XA 3B0VC 4U5EE 3WODF 2HSBA 3DZAA 2WVQA 4CS7A 4BPMA 4Q4ZF 5IY5C 4K7BA 4N6HA 4J7TA 3S84A 1E83A 1TWGA 5L0IA 3O10A 3U5SA 2I15A 3GODA 2R7SA 3I4UA 1YVIA 1SF8A 4WGZA 1JAFA 4D4NA 5CIVA 2ZXOA 4AX2A 2EPOA 3T6BA 2WZFA 4E17A 2XSEA 4JC7A 2WZLA 4P9TA 2HMZA 1TWCA 3O39A 1A7EA 3OWTA 2X51A 1O87A 3ZIBA 3ZTZA 4EBKA 2OCCC 1HE1A 2DYSC 1OR3A 1G4WR 1BBHA 2P1AA 5A6KA 3U8PA 4AE4A 4IARA 2WVNA 5L0HA 4YN0B 4WGYA 5L0DA 1ORJA 3AG3C 3C8GB 1WOLA 4YT5A 4OIQF 4EHPA 1E85A 3L8JA 3GWNA 4OIPF 3GWLA 1ZW3A 2NUPB 4GEHA 5DVWA 2XLDA 4DRHB 2Q4FA 2XXAB 3EGDA 1BR1A 3IPMO 5B3IA 1D0ZA 4CDVA 2J46A 2P7VA 3SXZA 1AUEA 1MMDA 4AL1A 4WABA 2PX0A 4K0DA 3SYNA 2RD9A 2YWAA 3K1IA 5KYXA 1WTYA 2EPNA 3NYLA 2R7OA 3KPHA 4XEVA 5COMA 5AC5A 2PF4E 4KC9A 4OINF 1LE2A 2VB6A 4I3MA 3JYYA 4ULWA 2NUTA 3TULA 1ZW2A 2LK4A 4DBQA 3UR3C 3QTHA 3Q7GA 1N1CA 4N6CA 2PX3A 4CX9A 4YT2A 4ZLCA 5A6AA 1XZPA 2J9WA 3GM2A 1OCOC 3W2WA 1WN0A 2OJED 3IHUA 1WATA 4NY3A 4CIPA 4LDRA 1QLEC 2Y3DA 2Y39A 4YJWA 4QI2A 4MVZA 4PJJA 1M2VB 4Z9IA 3NKEA 2VCAA 4PR9A 4EWCA 1K05A 2D4UA 2HKVA 5E33A 4Z9JA 2ZXWC 1JR8A 5JP7A 2BL2A 1ZU5A 1Z63A 4E0HA 1ZYRF 3DJNB 4JTDB 2M4EA 1M57C 4IAQA 4PFOA 3TD7A 3DE9A 4NTAA 2R03A 3V5XA 1C17M 5F5HA 2YLDA 2J0WA 2A0UA 3M79A 2NPUA 4DOZA 4M63A 1AEPA 3VRCA 1FNTc 2Z15A 4BJ5C 5L0CA 1M2OA 2NG1A 3CAXA 3JYHA 1I5NA 3LLIA 3M4BA 4U5GA 3EGXB 4E0IA 3L34A 1G8XA 2C03A 3VAYA 1LS1A 1GM5A 1ZHTA 5KYUB 3C7JA 4J7YA 4U9DA 3SXKA 1LVKA 3EFOA 3RVYA 3HKKA 3V5YA 4BJTA 5FCLA 2KNHA 4JCHA 1SR2A 4XTKA 3AQBA 1CPQA 4DVYP 1U6HA 1C03A 2CGEA 2G3VA 3C8ZA 1LIHA 3I5QA 3W2VA 1RKEA 1RJ9A 4FAPB 4G7ZF 2GA0A 1YYXA 2FFHA 2O9XA 5A6BA 3A9CA 1V55C 3GANA 1HW2A 2DI3A 3LAYA 1HMDA 4IRUA 2KSFA 3AJMA 3U9MA 5JLIA 4RD9A 1GGQA 2R7QA 3SEOA 1HY5A 3GM1A 1EKYA 4PACA 4JIOA 1DOVA 2XLHA 4YL3A 4E7SA 2ZXPA 4IWBA 4OD5A 4LDQA 1FFTC 1OR2A 1SZIA 2IBFA 3B0PA 3Q6NA 4I44A 2Q7RA 4G7OF 5DQTA 2DGJA 3R2PA 3U2LA 2V26A 3C63A 3HNKA 5FZTA 4KBLA 3DJUB 3TJ5A 2PP4A 4MVQA 3RQEA 3X1OA 3K7DA 2PNOA 1OW6A 2R02A 4LLCA 4MVRA 3W8IA 4DXWA 2A68F 3C18A 1NZEA 3JRTA 3L0IA 4U5DE 2AVKA 3KH2A 3U3BA 2A6HF 4AL0A 2YKZA 2HMQA 2OU6A 3N2ZB 1A7VA 4UDVA 2QTVA 2NSGA 3LUTB 5T3TA 3KYJA 1Z5ZA 3PMRA 3ASNC 2AP3A 1K04A 2OJQA 2W9YA 4MQ9F 2R7UA 1EQ1A 2A69F 4G0HA 2Q9AA 2MWQA 3NMIA 2DB4A 4XLNF 1OCRC 4MTFA 5B1BC 3G50A 3ZDLA 3ZC4A 2Q9BA 4MVOA 1YAUO 4EBBA 3AGUA 2L6FA 4FWVA 3W8HA 1LKXA 3W4YA 4BJ6A 3H2VA 3DI5A 3T9OA 5DS6A 4I1OB 4JURI 2R7TA 4DVZA 2YZSA 1AVOB 4BG0A 2KJGA 1S7ZA 2LFDA 4N4WA 4U5FE 4EIYA 3WG7C 1D0XA 3FDQA 4KNVA 1R5ID 3GM3A 4IJJA 1A0BA 3FAJA 2HFIA 1G5ZA 2A0BA 2CCYA 2WZGA 3QW0A 2YVKA 2ZD9A 4FESA 4OD4A 1XZQA 2A6EF 1TFKB 1H7IA 2YLIA 1Q0MA 2EPMX 1L3PA 1KTMA 3OA1A 4CS8A 4F4BA 2KW3C 4L6RA 256BA 1QKRA 1JOGA 1OW7A 1Z6AA 1HMOA 1G4US 1VOMA 3HNIA 3KMIA 3LS0A 5F28E 4HFKB 1HW1A 2F22A 2P0NA 3ZQYA 4CDAA 4OIOF 1EI7A 2NUTB 1DOWA 4IGGA 3RQGA 1T6QA 3CQZA 4JKVA 4XEKA 1LM3B 1VTMP 3ZSUA 3M1CB 1Z23A 3IQCA 4C3EA 5HSWA 3SXYA 2VCCA 3ASOC 3S27A 5F5FA 1W2WA 4CS8C 1APCA 2J9BA 4JJFA 2H7VC 2Y69C 1VLSA 3H2UA 4H4KC 3AGTA 5GPGB 1ORYA 2XRHA 3LNMB 4NCQA 3WAQA 5JRAA 3J06A 3DAFA 2OQMA 2QE9A 1HE9A 2VC9A 2EIKC 4XPYA 2GFHA 3RW0A 2OEVA 1OKKD 3JT1A 4MVMA 3RIPA 3GEEA 2R7WA 4O79A 3K1IC 3U9JA 1XWJA 2XS8A 4Z9HA 2YHSA 2VCBA 3EZHA 4CJGA 2XL6A 1Q0DA 4YL0A 5DS5A 3AOUA 2H7BA 3QVZA 3BRJA 1SMYF 1RMVA 3C8GA 3L1MA 4YL1A 5COGA 3OEOA 4E18A 1TWHA 1O5HA 3G4XA 1JRAA 4YT8A 5A6BD 3QMKA 4HE8D 1H9TA 1A41A 5EK0A 5BQHA 4KI2A 2CDQA 1JMWA 3ECSA 3HLZA 4W8PA 4XQ1A 5BQIA 2XXAA 3JRMO 2ASRA 4QI0A 4NC3A 2LD6A 4ULVA 3F47A 2RSEB 4J32B 2AU5A 1FFHA 1JPJA 1FMWA 3HNLA 2Y3BA 4U5CE 5KYWA 1L7CA 1M56C 2CNWA 1D1BA 4NQFA 3VYWA 4BJ1A 3S90A 1TFOB 3KYIA 2Y3GA 4G78A 2L7AA 3FOPA 3UMHA 1MQVA 3ATPA 4PJNA 3EFOB 5T3WA 1YZCA 3S29A 4ONSA 2EIMC 1CPRA 3ABKC 3HNJA 1ZHYA 3LESA 4U9EA 2R7VA 5E3AA 3SXMA 1F1MA 2YL0A 3POVA 1IZMA 3FHDA 4MW8A 1C02A 2YL1A 2Y3HA 4C7OB 4Q5SF 1NLXA 1VLTA 1LPEA 1OKKA 3CSKA 2X0CA 1E86A 2YLGA 3NKDA 1KNYA 2CW0F 4CSAA 4JEAA 4PJMA 3ZG1A 1OW8A 2P6VA 1NU7D 2LCHA 1ZVZA 3B0UX 1QZXA 3DWWA 3U8VA 3NYJA 5T1DB 3SNHA 5KYYB 2HS5A 5D91A 1CGNA 2XS1A 1T6IA 1TR2A 1Z7Qc 2J7PA 3EQLF 4Q7CA 1CGME 4NTFA 1KU2A 1M2VA 1QQ3A 3WHNA 4KNWA 5EHHA 2IXMA 3B29A 2WB7A 3PCVA 1H6GA 4JTAB 4JJGA 3F46A 3PDMP 1OCZC 4ER9A 1WASA 2L9JA 4D4XA
chains in the Genus database with same CATH topology
1MMGA 3EJNA 4PK4A 3CZ6A 5DS4A 3DM5A 3E70C 3K6BA 4YWQA 3LNRA 3MX3A 4JW1A 3LS1A 1VMAA 5E2QA 4FX5A 2IYLD 3LEVA 4P6IC 5KYUA 3RFYA 1VK5A 3K66A 3DAGA 3UNGC 3RKOF 1MNEA 3KKBA 1J8MF 3N24A 4AE4B 1D0YA 2DYRC 5E3CA 1TKNA 4PFPA 4I1MA 3UMKA 2R7XA 1MMNA 2W4MA 1MNDA 2KGOA 1Z3IX 3UMIA 4W8KA 4YT4A 4LACB 4BEJA 2J9UA 1PD0A 1WGWA 3EGDB 5B3SC 4RBNA 5KYNA 3DMDA 4JVSA 2EIJC 2R7RA 2G62A 3DXJF 3EG9A 4BJ6C 4J30B 4LERA 5KYXB 3N0TA 3H65A 3FVYA 3EH2A 3EPVA 4XWJA 3UGOA 2ZXRA 3EHNA 1IW7F 3AG2C 2CNWD 3HJCA 2LSEA 4MNDA 5CI9A 4ZLDA 3DM9B 1D1CA 3DD7A 4A2NB 3JCUQ 3K33A 3RYLA 3T4RA 2EINC 4HFFB 2QY9A 1J8YF 1ZHXA 3LLKA 2J0XA 4E7ZA 4ANJA 3EHMA 3I5PA 2C04A 3PHF2 1JPNA 4OIRF 2HV7A 5DLJA 2HV6A 3RH3A 4IAOA 4LLEA 5BUOA 2XL4A 2V3CC 2IXPA 5KYWB 2J7PD 2Q3TA 2NUPA 3JSZA 1OCCC 3MLGA 3NG1A 1FTSA 2WVOA 3EH1A 4G7HF 3E9VA 3ABMC 1V54C 2H7OA 2VASA 4X0RA 5D92A 3NDBB 3KL4A 4O6MA 3QZCA 1D1AA 3NRHA 1BR2A 1ZU4A 1ZHZA 2PFDA 1TWAA 3O6XA 5L3VA 4C3BA 1RJ9B 2J45A 3IEEA 4CS9A 5EGYA 4JZAA 3ZVRA 4DBRA 3AQCA 3SP1A 3NYMA 4BJ5A 2I8BA 1FMVA 2E87A 1BR4A 2IOQA 2ZPAA 4C3DA 3B9QA 2G3KA 4O7GA 2D5RB 4O6NA 4CS9C 3UGPA 4GYTA 4RDAA 5CI8A 3Q6MA 2OG2A 4CBEA 4CSAC 3S28A 4U5HA 4G7ZF 3ABLC 1MMAA 2Q9CA 2BE5F 2J9VA 3ITFA 4PJLA 5DQZA 1PCXA 1NG1A 4QDLA 4B6IA 3Q7LA 2EILC 1NU9C 2MYSA 5L3QA 2YEVA 2VH3A 3EGXA 4C7OA 2WL8A 2W45A 3SZRA 2JD3A 2IXNA 4U5BE 2L81A 2B0JA 4HEAJ 2FGYA 5B1AC 4CIHA 3LJBA 4XLPF 4AK9A 3K1HA 1VYKA 5KYYA 3X2QC 4O6YA 2IXOA 2KQ9A 3EG9B 1PD1A 2A1DD 1ZHWA 3V7OA 4WJ0A 1VYIA 2W4BA 3AG4C 3AG1C 3T6JA 1ST6A 3HTKC 3EZIA 3S0XA 4N06A 3B0VC 4U5EE 3WODF 4CS7A 3DZAA 2WVQA 4Q4ZF 5IY5C 4K7BA 1TWGA 2R7SA 3GODA 3I4UA 1SF8A 2ZXOA 4AX2A 3T6BA 2WZFA 2XSEA 2WZLA 3ZIBA 1TWCA 3O39A 3OWTA 2X51A 1O87A 2OCCC 2DYSC 4AE4A 2WVNA 4YN0B 3AG3C 4YT5A 4OIQF 4OIPF 4GEHA 2NUPB 5DVWA 2XXAB 3EGDA 1BR1A 1D0ZA 2J46A 2P7VA 1MMDA 2PX0A 4K0DA 3SYNA 5KYXA 3NYLA 2R7OA 2PF4E 4KC9A 4OINF 2VB6A 4I3MA 4ULWA 2NUTA 4DBQA 3UR3C 3Q7GA 1N1CA 2PX3A 4YT2A 4ZLCA 2J9WA 1OCOC 3W2WA 4NY3A 1QLEC 2Y3DA 2Y39A 4YJWA 4QI2A 4PJJA 1M2VB 3NKEA 4EWCA 5E33A 2ZXWC 1Z63A 1ZU5A 1ZYRF 3DJNB 2M4EA 1M57C 4PFOA 3TD7A 5F5HA 2J0WA 4DOZA 4M63A 2Z15A 4BJ5C 1M2OA 2NG1A 3JYHA 4U5GA 3LLIA 3EGXB 3L34A 1G8XA 2C03A 3VAYA 1LS1A 1ZHTA 5KYUB 1LVKA 3EFOA 4BJTA 5FCLA 2KNHA 4JCHA 4XTKA 3AQBA 4DVYP 3W2VA 2CGEA 2G3VA 3I5QA 1RJ9A 2FFHA 2O9XA 1V55C 3GANA 3LAYA 4IRUA 4RD9A 2R7QA 3SEOA 4E7SA 2ZXPA 4IWBA 4OD5A 1FFTC 1SZIA 3B0PA 3Q6NA 4I44A 4G7OF 5DQTA 2DGJA 2V26A 4KBLA 3DJUB 2PP4A 3X1OA 3K7DA 4LLCA 3W8IA 2A68F 1NZEA 3JRTA 3L0IA 4U5DE 3KH2A 2A6HF 3N2ZB 2QTVA 5T3TA 1Z5ZA 3PMRA 3ASNC 4MQ9F 2W9YA 2R7UA 2A69F 4G0HA 2Q9AA 2MWQA 4XLNF 1OCRC 5B1BC 3ZC4A 2Q9BA 4EBBA 4FWVA 3W8HA 1LKXA 4BJ6A 5DS6A 4I1OB 4JURI 2R7TA 4DVZA 2YZSA 4BG0A 2KJGA 1S7ZA 3FDQA 4U5FE 3WG7C 1D0XA 4KNVA 4IJJA 3FAJA 2WZGA 4FESA 4OD4A 2A6EF 3OA1A 4CS8A 4F4BA 2KW3C 1Z6AA 1VOMA 3KMIA 3LS0A 4HFKB 4OIOF 2NUTB 3CQZA 3ZSUA 3M1CB 1Z23A 5HSWA 4C3EA 3ASOC 3S27A 5F5FA 1W2WA 4CS8C 4JJFA 2H7VC 2Y69C 4H4KC 2XRHA 3DAFA 2EIKC 2GFHA 1OKKD 3JT1A 3RIPA 2R7WA 4O79A 3K1IC 2YHSA 3EZHA 5DS5A 2H7BA 1SMYF 3OEOA 1TWHA 1O5HA 4YT8A 3QMKA 4HE8D 4KI2A 2CDQA 3ECSA 2XXAA 3HLZA 4QI0A 3F47A 4J32B 1FFHA 1JPJA 1FMWA 5KYWA 2Y3BA 4U5CE 1M56C 2CNWA 1D1BA 4BJ1A 3VYWA 2Y3GA 3UMHA 4PJNA 3S29A 3EFOB 5T3WA 2EIMC 3ABKC 1ZHYA 3LESA 2R7VA 5E3AA 3POVA 1IZMA 3FHDA 4Q5SF 2Y3HA 4C7OB 1OKKA 3CSKA 3NKDA 2CW0F 4CSAA 4PJMA 3ZG1A 2P6VA 1NU7D 3B0UX 1QZXA 3NYJA 5T1DB 3SNHA 5KYYB 5D91A 1TR2A 2J7PA 3EQLF 4Q7CA 1KU2A 1M2VA 4KNWA 5EHHA 2IXMA 2WB7A 4JJGA 3F46A 1OCZC 2L9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI9 A;  3DJU B;  3DJN B;  3E9V A;  5CI8 A;  2D5R B;  2Z15 A; 
#chains in the Genus database with same CATH topology
 4MTO A;  1MMG A;  5A69 A;  2NSF A;  2R9R B;  3US6 A;  4A4A A;  3EJN A;  4PK4 A;  4XEF A;  2FAP B;  4XPW A;  3CZ6 A;  3O55 A;  5DS4 A;  1I4Y A;  3S9O A;  2GAQ A;  3DM5 A;  3E70 C;  3K6B A;  1VB5 A;  2XLO A;  3L8I A;  1V4A A;  4YK5 A;  3TJ6 A;  1T6U A;  4YWQ A;  2JX0 A;  3LNR A;  1T9K A;  3MX3 A;  4JW1 A;  3LS1 A;  3RQF A;  1VMA A;  2LP4 A;  3DKA A;  1ZZP A;  4FX5 A;  5E2Q A;  2IYL D;  3LEV A;  3TQO A;  4JCZ A;  2UUI A;  1YJG A;  2AWC A;  3FMS A;  4MVU A;  2XM4 A;  4P6I C;  5KYU A;  3RFY A;  4EUK B;  5JVE A;  1VK5 A;  3K66 A;  4GQH A;  2XLV A;  1BDJ B;  1LE4 A;  3VM6 A;  3DAG A;  3UNG C;  3RKO F;  3MFN A;  1MNE A;  2QUP A;  1J8M F;  3KKB A;  3N24 A;  1D0Y A;  1ORS C;  3QW1 A;  2DYR C;  1LI5 A;  2LFF A;  1TKN A;  2XLE A;  5E3C A;  4PFP A;  5JUA A;  3MYI A;  4I1M A;  1NBB A;  1RKC A;  3UMK A;  1MMN A;  2KYH A;  2W4M A;  2R7X A;  1MND A;  2KGO A;  1Z3I X;  2AWY A;  4JRZ A;  3CEX A;  2KK1 A;  3UMI A;  4W8K A;  2B0H A;  4YT4 A;  5AGF A;  4LAC B;  1Y6D A;  4BEJ A;  2J9U A;  1PD0 A;  1WGW A;  2YRF A;  3JSE O;  3EGD B;  5A6J A;  5B3S C;  4RBN A;  5KYN A;  3DMD A;  2UUH A;  3C8G D;  1SYQ A;  4MW3 A;  2HJ3 A;  3M15 A;  4JVS A;  4MS2 A;  2XLM A;  1EA8 A;  2EIJ C;  3MBG A;  1QSP A;  2XL8 A;  5JSL A;  2G62 A;  3DXJ F;  3EG9 A;  4BJ6 C;  4J30 B;  4LER A;  5KYX B;  2R7R A;  1M6T A;  2XLW A;  2XM0 A;  3N0T A;  3T6G B;  3H65 A;  3TOL A;  3FVY A;  3EH2 A;  3EPV A;  4XWJ A;  1T5O A;  3GOR A;  2P61 A;  3UGO A;  2ZXR A;  1WWP A;  3EHN A;  2LIG A;  1IW7 F;  3AG2 C;  1PV3 A;  2CNW D;  3HJC A;  3RVZ A;  2LSE A;  4MND A;  5CI9 A;  4ZLD A;  3DM9 B;  1D1C A;  3TK0 A;  3DD7 A;  4A2N B;  3U0C A;  3GEH A;  3JCU Q;  3K33 A;  3RYL A;  3T4R A;  2EIN C;  3VF0 A;  1YAR O;  4HFF B;  2MHR A;  1CGO A;  2QY9 A;  5K0I A;  3RF3 A;  3ZWI A;  2JPU A;  1J8Y F;  1ZHX A;  3LLK A;  2OEX A;  1UG7 A;  2BC5 A;  2J0X A;  4H54 A;  1Q0G A;  4DRI B;  1B68 A;  4ANJ A;  2YQY A;  3EHM A;  4E7Z A;  2M64 A;  3I5P A;  2C04 A;  5JS5 A;  3PHF 2;  4CJO A;  1JPN A;  4OIR F;  2HV7 A;  5DLJ A;  2HV6 A;  3RH3 A;  4IAO A;  2QLA A;  3IQT A;  4LLE A;  2ETS A;  5BUO A;  2XL4 A;  2V3C C;  2IXP A;  5KYW B;  1UFB A;  2GWW A;  1U0B B;  2J7P D;  2Q3T A;  1FAP B;  1LS4 A;  5L0F A;  4EKW A;  1O3U A;  4LDK A;  1A7D A;  2NUP A;  1GS9 A;  3JSZ A;  4BEM J;  1OCC C;  2TMV P;  1E84 A;  1QPU A;  3MLG A;  3NG1 A;  1FTS A;  2WVO A;  1RXQ A;  3TOM A;  3EH1 A;  4G7H F;  3E9V A;  3ABM C;  3A11 A;  2ICW G;  3IQ6 A;  2EPK X;  1V54 C;  4MTG A;  3MYF A;  2H7O A;  2VAS A;  4X0R A;  5D92 A;  3NDB B;  3KL4 A;  4O6M A;  1OXK A;  3QZC A;  1D1A A;  3NRH A;  3JTL O;  4P9F A;  2YL7 A;  4AE4 B;  3QVY A;  1BR2 A;  1ZU4 A;  1ZHZ A;  2PFD A;  4NTB A;  1TWA A;  3O6X A;  2OOC A;  4JEB A;  2LQG A;  5L0J A;  5L3V A;  4C3B A;  1RKE B;  1RJ9 B;  2J45 A;  5AC4 A;  3IEE A;  4CS9 A;  5EGY A;  1QVX A;  5TJ5 E;  4JZA A;  3ZVR A;  4DBR A;  3AQC A;  5JT4 A;  2HUJ A;  3SP1 A;  3BEH A;  3NYM A;  4BJ5 A;  2I8B A;  1FMV A;  2E87 A;  1BR4 A;  2IOQ A;  2ZPA A;  2HZ8 A;  4C3D A;  3B9Q A;  2G3K A;  4O7G A;  2D5R B;  3U2M A;  1Y4C A;  4EBJ A;  2GDC A;  4O6N A;  2HJM A;  3R7C A;  4CS9 C;  1T01 A;  1YYJ A;  3LEO A;  4GYT A;  3UGP A;  2OKU A;  4RDA A;  5CI8 A;  3Q6M A;  4XPX A;  1V74 B;  2H8A A;  2OG2 A;  4CBE A;  4CSA C;  3S28 A;  2R25 A;  1TQG A;  1GQA A;  4U5H A;  2HSQ A;  3ABL C;  1MMA A;  1Q0K A;  2Q9C A;  1I4Z A;  3JZ0 A;  4IB4 A;  5BQG A;  1RCP A;  1NFO A;  2L6G A;  2BE5 F;  3C62 A;  1BZ4 A;  2J9V A;  3G4Z A;  4MVS A;  3ITF A;  2J8W A;  4PJL A;  1PCX A;  5DQZ A;  1S05 A;  1LI7 A;  1NG1 A;  4QDL A;  4B6I A;  1YA7 O;  3Q7L A;  4R32 A;  4JTC B;  1U89 A;  1YZA A;  2EIL C;  3FOO A;  3B71 A;  1K40 A;  1NU9 C;  2MYS A;  5L3Q A;  2YEV A;  1YDI A;  2VH3 A;  3EGX A;  4C7O A;  2WL8 A;  1H9G A;  2YL3 A;  2W45 A;  5L0G A;  3SZR A;  2JD3 A;  2IXN A;  3FAP B;  3ZQV A;  3IQ5 A;  4U5B E;  2L81 A;  3GEI A;  2B0J A;  4HEA J;  3ZTM A;  2FGY A;  5B1A C;  4CDY A;  3M4C A;  4DJ9 A;  4CIH A;  1NFN A;  3LJB A;  3FXH A;  2CYD A;  4XLP F;  4AK9 A;  3K1H A;  3V5Z A;  1VYK A;  2R05 A;  5KYY A;  3X2Q C;  4O6Y A;  1FR0 A;  2PBE A;  5COF A;  4JE9 A;  2QNL A;  2Q00 A;  1Q0F A;  2IM8 A;  1E2X A;  2IXO A;  1R4T A;  3NMK A;  1YLM A;  2KQ9 A;  3EG9 B;  1PD1 A;  4DRJ B;  2A1D D;  3NMJ A;  1ZHW A;  1OXB A;  3V7O A;  1NSG B;  2L6H A;  4WJ0 A;  1VYI A;  1YA9 A;  2KC3 A;  2W4B A;  3AG4 C;  4K1O A;  5HV9 A;  3AG1 C;  3U3F A;  1OQC A;  3T6J A;  1ST6 A;  2EPL X;  3EZI A;  3DE8 A;  3HTK C;  4N06 A;  3S0X A;  3B0V C;  4U5E E;  3WOD F;  2HSB A;  3DZA A;  2WVQ A;  4CS7 A;  4BPM A;  4Q4Z F;  5IY5 C;  4K7B A;  4N6H A;  4J7T A;  3S84 A;  1E83 A;  1TWG A;  5L0I A;  3O10 A;  3U5S A;  2I15 A;  3GOD A;  2R7S A;  3I4U A;  1YVI A;  1SF8 A;  4WGZ A;  1JAF A;  4D4N A;  5CIV A;  2ZXO A;  4AX2 A;  2EPO A;  3T6B A;  2WZF A;  4E17 A;  2XSE A;  4JC7 A;  2WZL A;  4P9T A;  2HMZ A;  1TWC A;  3O39 A;  1A7E A;  3OWT A;  2X51 A;  1O87 A;  3ZIB A;  3ZTZ A;  4EBK A;  2OCC C;  1HE1 A;  2DYS C;  1OR3 A;  1G4W R;  1BBH A;  2P1A A;  5A6K A;  3U8P A;  4AE4 A;  4IAR A;  2WVN A;  5L0H A;  4YN0 B;  4WGY A;  5L0D A;  1ORJ A;  3AG3 C;  3C8G B;  1WOL A;  4YT5 A;  4OIQ F;  4EHP A;  1E85 A;  3L8J A;  3GWN A;  4OIP F;  3GWL A;  1ZW3 A;  2NUP B;  4GEH A;  5DVW A;  2XLD A;  4DRH B;  2Q4F A;  2XXA B;  3EGD A;  1BR1 A;  3IPM O;  5B3I A;  1D0Z A;  4CDV A;  2J46 A;  2P7V A;  3SXZ A;  1AUE A;  1MMD A;  4AL1 A;  4WAB A;  2PX0 A;  4K0D A;  3SYN A;  2RD9 A;  2YWA A;  3K1I A;  5KYX A;  1WTY A;  2EPN A;  3NYL A;  2R7O A;  3KPH A;  4XEV A;  5COM A;  5AC5 A;  2PF4 E;  4KC9 A;  4OIN F;  1LE2 A;  2VB6 A;  4I3M A;  3JYY A;  4ULW A;  2NUT A;  3TUL A;  1ZW2 A;  2LK4 A;  4DBQ A;  3UR3 C;  3QTH A;  3Q7G A;  1N1C A;  4N6C A;  2PX3 A;  4CX9 A;  4YT2 A;  4ZLC A;  5A6A A;  1XZP A;  2J9W A;  3GM2 A;  1OCO C;  3W2W A;  1WN0 A;  2OJE D;  3IHU A;  1WAT A;  4NY3 A;  4CIP A;  4LDR A;  1QLE C;  2Y3D A;  2Y39 A;  4YJW A;  4QI2 A;  4MVZ A;  4PJJ A;  1M2V B;  4Z9I A;  3NKE A;  2VCA A;  4PR9 A;  4EWC A;  1K05 A;  2D4U A;  2HKV A;  5E33 A;  4Z9J A;  2ZXW C;  1JR8 A;  5JP7 A;  2BL2 A;  1ZU5 A;  1Z63 A;  4E0H A;  1ZYR F;  3DJN B;  4JTD B;  2M4E A;  1M57 C;  4IAQ A;  4PFO A;  3TD7 A;  3DE9 A;  4NTA A;  2R03 A;  3V5X A;  1C17 M;  5F5H A;  2YLD A;  2J0W A;  2A0U A;  3M79 A;  2NPU A;  4DOZ A;  4M63 A;  1AEP A;  3VRC A;  1FNT c;  2Z15 A;  4BJ5 C;  5L0C A;  1M2O A;  2NG1 A;  3CAX A;  3JYH A;  1I5N A;  3LLI A;  3M4B A;  4U5G A;  3EGX B;  4E0I A;  3L34 A;  1G8X A;  2C03 A;  3VAY A;  1LS1 A;  1GM5 A;  1ZHT A;  5KYU B;  3C7J A;  4J7Y A;  4U9D A;  3SXK A;  1LVK A;  3EFO A;  3RVY A;  3HKK A;  3V5Y A;  4BJT A;  5FCL A;  2KNH A;  4JCH A;  1SR2 A;  4XTK A;  3AQB A;  1CPQ A;  4DVY P;  1U6H A;  1C03 A;  2CGE A;  2G3V A;  3C8Z A;  1LIH A;  3I5Q A;  3W2V A;  1RKE A;  1RJ9 A;  4FAP B;  4G7Z F;  2GA0 A;  1YYX A;  2FFH A;  2O9X A;  5A6B A;  3A9C A;  1V55 C;  3GAN A;  1HW2 A;  2DI3 A;  3LAY A;  1HMD A;  4IRU A;  2KSF A;  3AJM A;  3U9M A;  5JLI A;  4RD9 A;  1GGQ A;  2R7Q A;  3SEO A;  1HY5 A;  3GM1 A;  1EKY A;  4PAC A;  4JIO A;  1DOV A;  2XLH A;  4YL3 A;  4E7S A;  2ZXP A;  4IWB A;  4OD5 A;  4LDQ A;  1FFT C;  1OR2 A;  1SZI A;  2IBF A;  3B0P A;  3Q6N A;  4I44 A;  2Q7R A;  4G7O F;  5DQT A;  2DGJ A;  3R2P A;  3U2L A;  2V26 A;  3C63 A;  3HNK A;  5FZT A;  4KBL A;  3DJU B;  3TJ5 A;  2PP4 A;  4MVQ A;  3RQE A;  3X1O A;  3K7D A;  2PNO A;  1OW6 A;  2R02 A;  4LLC A;  4MVR A;  3W8I A;  4DXW A;  2A68 F;  3C18 A;  1NZE A;  3JRT A;  3L0I A;  4U5D E;  2AVK A;  3KH2 A;  3U3B A;  2A6H F;  4AL0 A;  2YKZ A;  2HMQ A;  2OU6 A;  3N2Z B;  1A7V A;  4UDV A;  2QTV A;  2NSG A;  3LUT B;  5T3T A;  3KYJ A;  1Z5Z A;  3PMR A;  3ASN C;  2AP3 A;  1K04 A;  2OJQ A;  2W9Y A;  4MQ9 F;  2R7U A;  1EQ1 A;  2A69 F;  4G0H A;  2Q9A A;  2MWQ A;  3NMI A;  2DB4 A;  4XLN F;  1OCR C;  4MTF A;  5B1B C;  3G50 A;  3ZDL A;  3ZC4 A;  2Q9B A;  4MVO A;  1YAU O;  4EBB A;  3AGU A;  2L6F A;  4FWV A;  3W8H A;  1LKX A;  3W4Y A;  4BJ6 A;  3H2V A;  3DI5 A;  3T9O A;  5DS6 A;  4I1O B;  4JUR I;  2R7T A;  4DVZ A;  2YZS A;  1AVO B;  4BG0 A;  2KJG A;  1S7Z A;  2LFD A;  4N4W A;  4U5F E;  4EIY A;  3WG7 C;  1D0X A;  3FDQ A;  4KNV A;  1R5I D;  3GM3 A;  4IJJ A;  1A0B A;  3FAJ A;  2HFI A;  1G5Z A;  2A0B A;  2CCY A;  2WZG A;  3QW0 A;  2YVK A;  2ZD9 A;  4FES A;  4OD4 A;  1XZQ A;  2A6E F;  1TFK B;  1H7I A;  2YLI A;  1Q0M A;  2EPM X;  1L3P A;  1KTM A;  3OA1 A;  4CS8 A;  4F4B A;  2KW3 C;  4L6R A;  256B A;  1QKR A;  1JOG A;  1OW7 A;  1Z6A A;  1HMO A;  1G4U S;  1VOM A;  3HNI A;  3KMI A;  3LS0 A;  5F28 E;  4HFK B;  1HW1 A;  2F22 A;  2P0N A;  3ZQY A;  4CDA A;  4OIO F;  1EI7 A;  2NUT B;  1DOW A;  4IGG A;  3RQG A;  1T6Q A;  3CQZ A;  4JKV A;  4XEK A;  1LM3 B;  1VTM P;  3ZSU A;  3M1C B;  1Z23 A;  3IQC A;  4C3E A;  5HSW A;  3SXY A;  2VCC A;  3ASO C;  3S27 A;  5F5F A;  1W2W A;  4CS8 C;  1APC A;  2J9B A;  4JJF A;  2H7V C;  2Y69 C;  1VLS A;  3H2U A;  4H4K C;  3AGT A;  5GPG B;  1ORY A;  2XRH A;  3LNM B;  4NCQ A;  3WAQ A;  5JRA A;  3J06 A;  3DAF A;  2OQM A;  2QE9 A;  1HE9 A;  2VC9 A;  2EIK C;  4XPY A;  2GFH A;  3RW0 A;  2OEV A;  1OKK D;  3JT1 A;  4MVM A;  3RIP A;  3GEE A;  2R7W A;  4O79 A;  3K1I C;  3U9J A;  1XWJ A;  2XS8 A;  4Z9H A;  2YHS A;  2VCB A;  3EZH A;  4CJG A;  2XL6 A;  1Q0D A;  4YL0 A;  5DS5 A;  3AOU A;  2H7B A;  3QVZ A;  3BRJ A;  1SMY F;  1RMV A;  3C8G A;  3L1M A;  4YL1 A;  5COG A;  3OEO A;  4E18 A;  1TWH A;  1O5H A;  3G4X A;  1JRA A;  4YT8 A;  5A6B D;  3QMK A;  4HE8 D;  1H9T A;  1A41 A;  5EK0 A;  5BQH A;  4KI2 A;  2CDQ A;  1JMW A;  3ECS A;  3HLZ A;  4W8P A;  4XQ1 A;  5BQI A;  2XXA A;  3JRM O;  2ASR A;  4QI0 A;  4NC3 A;  2LD6 A;  4ULV A;  3F47 A;  2RSE B;  4J32 B;  2AU5 A;  1FFH A;  1JPJ A;  1FMW A;  3HNL A;  2Y3B A;  4U5C E;  5KYW A;  1L7C A;  1M56 C;  2CNW A;  1D1B A;  4NQF A;  3VYW A;  4BJ1 A;  3S90 A;  1TFO B;  3KYI A;  2Y3G A;  4G78 A;  2L7A A;  3FOP A;  3UMH A;  1MQV A;  3ATP A;  4PJN A;  3EFO B;  5T3W A;  1YZC A;  3S29 A;  4ONS A;  2EIM C;  1CPR A;  3ABK C;  3HNJ A;  1ZHY A;  3LES A;  4U9E A;  2R7V A;  5E3A A;  3SXM A;  1F1M A;  2YL0 A;  3POV A;  1IZM A;  3FHD A;  4MW8 A;  1C02 A;  2YL1 A;  2Y3H A;  4C7O B;  4Q5S F;  1NLX A;  1VLT A;  1LPE A;  1OKK A;  3CSK A;  2X0C A;  1E86 A;  2YLG A;  3NKD A;  1KNY A;  2CW0 F;  4CSA A;  4JEA A;  4PJM A;  3ZG1 A;  1OW8 A;  2P6V A;  1NU7 D;  2LCH A;  1ZVZ A;  3B0U X;  1QZX A;  3DWW A;  3U8V A;  3NYJ A;  5T1D B;  3SNH A;  5KYY B;  2HS5 A;  5D91 A;  1CGN A;  2XS1 A;  1T6I A;  1TR2 A;  1Z7Q c;  2J7P A;  3EQL F;  4Q7C A;  1CGM E;  4NTF A;  1KU2 A;  1M2V A;  1QQ3 A;  3WHN A;  4KNW A;  5EHH A;  2IXM A;  3B29 A;  2WB7 A;  3PCV A;  1H6G A;  4JTA B;  4JJG A;  3F46 A;  3PDM P;  1OCZ C;  4ER9 A;  1WAS A;  2L9J A;  4D4X A; 
#chains in the Genus database with same CATH homology
 1MMG A;  3EJN A;  4PK4 A;  3CZ6 A;  5DS4 A;  3DM5 A;  3E70 C;  3K6B A;  4YWQ A;  3LNR A;  3MX3 A;  4JW1 A;  3LS1 A;  1VMA A;  5E2Q A;  4FX5 A;  2IYL D;  3LEV A;  4P6I C;  5KYU A;  3RFY A;  1VK5 A;  3K66 A;  3DAG A;  3UNG C;  3RKO F;  1MNE A;  3KKB A;  1J8M F;  3N24 A;  4AE4 B;  1D0Y A;  2DYR C;  5E3C A;  1TKN A;  4PFP A;  4I1M A;  3UMK A;  2R7X A;  1MMN A;  2W4M A;  1MND A;  2KGO A;  1Z3I X;  3UMI A;  4W8K A;  4YT4 A;  4LAC B;  4BEJ A;  2J9U A;  1PD0 A;  1WGW A;  3EGD B;  5B3S C;  4RBN A;  5KYN A;  3DMD A;  4JVS A;  2EIJ C;  2R7R A;  2G62 A;  3DXJ F;  3EG9 A;  4BJ6 C;  4J30 B;  4LER A;  5KYX B;  3N0T A;  3H65 A;  3FVY A;  3EH2 A;  3EPV A;  4XWJ A;  3UGO A;  2ZXR A;  3EHN A;  1IW7 F;  3AG2 C;  2CNW D;  3HJC A;  2LSE A;  4MND A;  5CI9 A;  4ZLD A;  3DM9 B;  1D1C A;  3DD7 A;  4A2N B;  3JCU Q;  3K33 A;  3RYL A;  3T4R A;  2EIN C;  4HFF B;  2QY9 A;  1J8Y F;  1ZHX A;  3LLK A;  2J0X A;  4E7Z A;  4ANJ A;  3EHM A;  3I5P A;  2C04 A;  3PHF 2;  1JPN A;  4OIR F;  2HV7 A;  5DLJ A;  2HV6 A;  3RH3 A;  4IAO A;  4LLE A;  5BUO A;  2XL4 A;  2V3C C;  2IXP A;  5KYW B;  2J7P D;  2Q3T A;  2NUP A;  3JSZ A;  1OCC C;  3MLG A;  3NG1 A;  1FTS A;  2WVO A;  3EH1 A;  4G7H F;  3E9V A;  3ABM C;  1V54 C;  2H7O A;  2VAS A;  4X0R A;  5D92 A;  3NDB B;  3KL4 A;  4O6M A;  3QZC A;  1D1A A;  3NRH A;  1BR2 A;  1ZU4 A;  1ZHZ A;  2PFD A;  1TWA A;  3O6X A;  5L3V A;  4C3B A;  1RJ9 B;  2J45 A;  3IEE A;  4CS9 A;  5EGY A;  4JZA A;  3ZVR A;  4DBR A;  3AQC A;  3SP1 A;  3NYM A;  4BJ5 A;  2I8B A;  1FMV A;  2E87 A;  1BR4 A;  2IOQ A;  2ZPA A;  4C3D A;  3B9Q A;  2G3K A;  4O7G A;  2D5R B;  4O6N A;  4CS9 C;  3UGP A;  4GYT A;  4RDA A;  5CI8 A;  3Q6M A;  2OG2 A;  4CBE A;  4CSA C;  3S28 A;  4U5H A;  4G7Z F;  3ABL C;  1MMA A;  2Q9C A;  2BE5 F;  2J9V A;  3ITF A;  4PJL A;  5DQZ A;  1PCX A;  1NG1 A;  4QDL A;  4B6I A;  3Q7L A;  2EIL C;  1NU9 C;  2MYS A;  5L3Q A;  2YEV A;  2VH3 A;  3EGX A;  4C7O A;  2WL8 A;  2W45 A;  3SZR A;  2JD3 A;  2IXN A;  4U5B E;  2L81 A;  2B0J A;  4HEA J;  2FGY A;  5B1A C;  4CIH A;  3LJB A;  4XLP F;  4AK9 A;  3K1H A;  1VYK A;  5KYY A;  3X2Q C;  4O6Y A;  2IXO A;  2KQ9 A;  3EG9 B;  1PD1 A;  2A1D D;  1ZHW A;  3V7O A;  4WJ0 A;  1VYI A;  2W4B A;  3AG4 C;  3AG1 C;  3T6J A;  1ST6 A;  3HTK C;  3EZI A;  3S0X A;  4N06 A;  3B0V C;  4U5E E;  3WOD F;  4CS7 A;  3DZA A;  2WVQ A;  4Q4Z F;  5IY5 C;  4K7B A;  1TWG A;  2R7S A;  3GOD A;  3I4U A;  1SF8 A;  2ZXO A;  4AX2 A;  3T6B A;  2WZF A;  2XSE A;  2WZL A;  3ZIB A;  1TWC A;  3O39 A;  3OWT A;  2X51 A;  1O87 A;  2OCC C;  2DYS C;  4AE4 A;  2WVN A;  4YN0 B;  3AG3 C;  4YT5 A;  4OIQ F;  4OIP F;  4GEH A;  2NUP B;  5DVW A;  2XXA B;  3EGD A;  1BR1 A;  1D0Z A;  2J46 A;  2P7V A;  1MMD A;  2PX0 A;  4K0D A;  3SYN A;  5KYX A;  3NYL A;  2R7O A;  2PF4 E;  4KC9 A;  4OIN F;  2VB6 A;  4I3M A;  4ULW A;  2NUT A;  4DBQ A;  3UR3 C;  3Q7G A;  1N1C A;  2PX3 A;  4YT2 A;  4ZLC A;  2J9W A;  1OCO C;  3W2W A;  4NY3 A;  1QLE C;  2Y3D A;  2Y39 A;  4YJW A;  4QI2 A;  4PJJ A;  1M2V B;  3NKE A;  4EWC A;  5E33 A;  2ZXW C;  1Z63 A;  1ZU5 A;  1ZYR F;  3DJN B;  2M4E A;  1M57 C;  4PFO A;  3TD7 A;  5F5H A;  2J0W A;  4DOZ A;  4M63 A;  2Z15 A;  4BJ5 C;  1M2O A;  2NG1 A;  3JYH A;  4U5G A;  3LLI A;  3EGX B;  3L34 A;  1G8X A;  2C03 A;  3VAY A;  1LS1 A;  1ZHT A;  5KYU B;  1LVK A;  3EFO A;  4BJT A;  5FCL A;  2KNH A;  4JCH A;  4XTK A;  3AQB A;  4DVY P;  3W2V A;  2CGE A;  2G3V A;  3I5Q A;  1RJ9 A;  2FFH A;  2O9X A;  1V55 C;  3GAN A;  3LAY A;  4IRU A;  4RD9 A;  2R7Q A;  3SEO A;  4E7S A;  2ZXP A;  4IWB A;  4OD5 A;  1FFT C;  1SZI A;  3B0P A;  3Q6N A;  4I44 A;  4G7O F;  5DQT A;  2DGJ A;  2V26 A;  4KBL A;  3DJU B;  2PP4 A;  3X1O A;  3K7D A;  4LLC A;  3W8I A;  2A68 F;  1NZE A;  3JRT A;  3L0I A;  4U5D E;  3KH2 A;  2A6H F;  3N2Z B;  2QTV A;  5T3T A;  1Z5Z A;  3PMR A;  3ASN C;  4MQ9 F;  2W9Y A;  2R7U A;  2A69 F;  4G0H A;  2Q9A A;  2MWQ A;  4XLN F;  1OCR C;  5B1B C;  3ZC4 A;  2Q9B A;  4EBB A;  4FWV A;  3W8H A;  1LKX A;  4BJ6 A;  5DS6 A;  4I1O B;  4JUR I;  2R7T A;  4DVZ A;  2YZS A;  4BG0 A;  2KJG A;  1S7Z A;  3FDQ A;  4U5F E;  3WG7 C;  1D0X A;  4KNV A;  4IJJ A;  3FAJ A;  2WZG A;  4FES A;  4OD4 A;  2A6E F;  3OA1 A;  4CS8 A;  4F4B A;  2KW3 C;  1Z6A A;  1VOM A;  3KMI A;  3LS0 A;  4HFK B;  4OIO F;  2NUT B;  3CQZ A;  3ZSU A;  3M1C B;  1Z23 A;  5HSW A;  4C3E A;  3ASO C;  3S27 A;  5F5F A;  1W2W A;  4CS8 C;  4JJF A;  2H7V C;  2Y69 C;  4H4K C;  2XRH A;  3DAF A;  2EIK C;  2GFH A;  1OKK D;  3JT1 A;  3RIP A;  2R7W A;  4O79 A;  3K1I C;  2YHS A;  3EZH A;  5DS5 A;  2H7B A;  1SMY F;  3OEO A;  1TWH A;  1O5H A;  4YT8 A;  3QMK A;  4HE8 D;  4KI2 A;  2CDQ A;  3ECS A;  2XXA A;  3HLZ A;  4QI0 A;  3F47 A;  4J32 B;  1FFH A;  1JPJ A;  1FMW A;  5KYW A;  2Y3B A;  4U5C E;  1M56 C;  2CNW A;  1D1B A;  4BJ1 A;  3VYW A;  2Y3G A;  3UMH A;  4PJN A;  3S29 A;  3EFO B;  5T3W A;  2EIM C;  3ABK C;  1ZHY A;  3LES A;  2R7V A;  5E3A A;  3POV A;  1IZM A;  3FHD A;  4Q5S F;  2Y3H A;  4C7O B;  1OKK A;  3CSK A;  3NKD A;  2CW0 F;  4CSA A;  4PJM A;  3ZG1 A;  2P6V A;  1NU7 D;  3B0U X;  1QZX A;  3NYJ A;  5T1D B;  3SNH A;  5KYY B;  5D91 A;  1TR2 A;  2J7P A;  3EQL F;  4Q7C A;  1KU2 A;  1M2V A;  4KNW A;  5EHH A;  2IXM A;  2WB7 A;  4JJG A;  3F46 A;  1OCZ C;  2L9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...