2D5RB

Crystal structure of a tob-hcaf1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
116
structure length
116
Chain Sequence
HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 7
publication title Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 33
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2d5rB00
2D5RB 5CI9A 3DJUB 3DJNB 5CI8A 3E9VA 2Z15A
chains in the Genus database with same CATH superfamily
5F5FA 1BBHA 2EPKX 3H2VA 3O10A 4BJ1A 5A6BA 1DOWA 2OEXA 5L3VA 1GGQA 1WATA 2OJQA 1WN0A 2NSFA 2AWYA 1BR1A 1OCZC 1SMYF 4ZLDA 4E0HA 4WGZA 1XWJA 5DS6A 3K1IA 2H7OA 4GYTA 1VLTA 4CX9A 1T6QA 2XXAB 4MVMA 2OG2A 4YT8A 2P61A 3U2LA 2BC5A 4HFFB 256BA 2YHSA 3Q7GA 1G4WR 2YLDA 4IARA 3U5SA 2PX0A 1CGME 4E17A 2ZXRA 3OWTA 4ZLCA 3G50A 1UG7A 2R7VA 3NMJA 1Z7Qc 4DOZA 1D1BA 1NLXA 1NU9C 1Z23A 4DJ9A 2PFDA 2RSEB 4N6CA 3V5YA 4C3EA 2Y3HA 5DLJA 4AX2A 3MLGA 1B68A 3K1HA 3IQ6A 3I4UA 2XLWA 1OXKA 2XRHA 2J9BA 4P9TA 4LDQA 1OW8A 3R7CA 2L6GA 4FX5A 4JEBA 3W2VA 5CIVA 5L0IA 1D1CA 1ST6A 3AG4C 3KMIA 1O3UA 3X2QC 3POVA 1WOLA 1TWHA 2J45A 1M2OA 3OA1A 2WVOA 4K0DA 4MVOA 4U5DE 4ULWA 1YARO 5BQGA 3U3FA 4P6IC 4EIYA 3UMIA 1TQGA 2NSGA 3EJNA 2LQGA 3LS0A 3QVZA 3WHNA 1G5ZA 4LDKA 3LNRA 2AVKA 3Q6MA 3RW0A 1V55C 5FZTA 3T6GB 4I1MA 2EPLX 2KNHA 3M15A 4LDRA 1FNTc 1ZZPA 4K1OA 1RXQA 5DVWA 5AGFA 4MW3A 1JPJA 2Q9CA 3L8IA 1M2VB 4JCHA 4FESA 3U0CA 4RD9A 2HV6A 3CZ6A 2XL4A 4CS8A 3DZAA 2XLOA 3ZG1A 3CEXA 1JOGA 2IXNA 4XTKA 4OIOF 2L7AA 3ASNC 4JE9A 4JURI 2PF4E 3C8ZA 4PJNA 3FOOA 4QI0A 1T01A 2P0NA 1KTMA 1PV3A 1L3PA 2QTVA 2R7WA 2R7QA 1E84A 1LIHA 3VF0A 4E18A 4EHPA 2GFHA 2R9RB 1Q0DA 4BJ5C 1TR2A 3WODF 3B0PA 1PD1A 2A69F 3KYIA 4O79A 1BR2A 4G7HF 1YYXA 2L6HA 3GODA 2VB6A 3CSKA 3EZIA 1A41A 3HKKA 4RDAA 5KYWA 5DQTA 4B6IA 1VK5A 5A69A 4OIQF 3NMIA 5DQZA 5HSWA 1QKRA 3RIPA 5JS5A 3S84A 2Z15A 3RH3A 3TJ6A 4DRIB 3LLIA 2QNLA 4RBNA 3LEVA 1HE9A 2YL1A 3AGTA 2L81A 3DKAA 1EKYA 4U5BE 3M79A 2G3VA 3LLKA 4J30B 4CBEA 1OXBA 5A6BD 1ZHYA 4AL1A 1ZYRF 4DBQA 3PDMP 4Q5SF 3O55A 1U0BB 2A6HF 2YL7A 3C7JA 1A7VA 2A0UA 3LS1A 3SYNA 1VYKA 2ZD9A 2JPUA 2AU5A 1A7EA 1HMDA 3JZ0A 3KPHA 1G4US 4JIOA 4JJGA 4MQ9F 5CI9A 4F4BA 3DJNB 1W2WA 1WASA 3OEOA 2XLMA 3AQCA 3SXZA 2YL0A 5A6JA 5KYYB 3U9MA 2A0BA 3GEIA 3CQZA 4J7TA 3UGPA 3ECSA 1RCPA 4U5GA 3ZC4A 4XPXA 2KK1A 3TK0A 2Q9BA 3K6BA 2CYDA 3JCUQ 3DM5A 2XS8A 3L34A 2HV7A 2J9UA 3DAFA 4LLEA 2IXMA 3VRCA 2R7OA 1MMNA 4CS9C 3IHUA 4MVZA 3NKDA 2LK4A 3W8IA 4BG0A 4CJOA 2OCCC 4U5HA 2VC9A 5COFA 5B3IA 4YT4A 4CSAC 1XZPA 5AC4A 1YDIA 4Z9JA 3EH2A 1M6TA 4U5EE 2IYLD 3E9VA 2LCHA 3MBGA 1TFKB 1CGNA 4PR9A 1KU2A 5T3WA 1APCA 1ORJA 3RYLA 2ICWG 1AUEA 1MMDA 4PJMA 4YWQA 2VH3A 2CDQA 2ASRA 3W2WA 5A6KA 4M63A 3K7DA 5D92A 1ZW2A 3G4XA 2XL8A 4MTGA 4C3DA 3FHDA 1JMWA 3BRJA 4HEAJ 3H65A 4J7YA 4GQHA 3S28A 4PFOA 1Z63A 3IEEA 3SXKA 2R7TA 3RQEA 1M57C 5L0JA 4KI2A 2IM8A 2YL3A 3DJUB 4JJFA 5K0IA 4Q4ZF 1FMVA 4ANJA 1C03A 1TWGA 2HFIA 4YL0A 3B71A 2R7XA 1OKKA 2EPOA 1NSGB 1OQCA 4XEFA 4C7OA 3A11A 2I15A 3VM6A 4QI2A 1FTSA 3ITFA 1J8YF 1ZU5A 1L7CA 3FMSA 2ZXPA 4XEKA 2VCAA 3DWWA 3JYHA 5KYWB 1U6HA 1QQ3A 2NPUA 2R03A 4EBBA 1VTMP 4NQFA 3US6A 1JR8A 3EQLF 1BZ4A 1WGWA 4PJLA 2R02A 2AWCA 4IAOA 4Z9HA 1DOVA 3EHMA 5JRAA 5COGA 4JW1A 4LERA 3TJ5A 2YLIA 3LESA 1A0BA 4G7ZF 5FCLA 1Q0MA 3K66A 1NU7D 3TD7A 1ZU4A 3ZIBA 1S7ZA 1BR4A 2GAQA 4CDVA 1VYIA 2LSEA 4XWJA 2PBEA 1Y4CA 1LS4A 1R4TA 5JUAA 3J06A 1Y6DA 2YVKA 3UMKA 4OD5A 2J9WA 2NUTA 4E7SA 4MW8A 5IY5C 4A4AA 3C8GA 2R25A 3Q6NA 1O87A 3NYLA 1TKNA 2P1AA 1FR0A 4JTAB 2JX0A 3ZQYA 1I5NA 2FFHA 2YEVA 3EFOA 1K05A 2Q3TA 4H4KC 3ZWIA 1IZMA 3F46A 5BQIA 1HW2A 3EGDA 4BJ6C 3M1CB 1RMVA 1VOMA 2WB7A 2Y3BA 1E86A 3SNHA 2NG1A 2LIGA 2XLEA 2UUIA 4A2NB 1QVXA 1D0ZA 1LE2A 4XQ1A 1NFOA 3IQ5A 4YK5A 5E2QA 3I5QA 3SP1A 4NCQA 4DVZA 4WJ0A 2LFDA 3T9OA 3UR3C 3S29A 1ORSC 1ZVZA 3ABMC 1H9GA 1YLMA 1XZQA 2R05A 3Q7LA 1VMAA 4KNVA 4O6YA 2AP3A 3T6JA 3S9OA 2FGYA 3IPMO 5B1BC 4JC7A 3HTKC 3QW0A 4BJTA 1KNYA 1G8XA 4DRHB 2XL6A 4G0HA 3EPVA 5A6AA 2HZ8A 1RKEA 1LI5A 2YLGA 2QUPA 5F5HA 2J9VA 3X1OA 2OJED 2XM0A 2DGJA 3B0VC 3C18A 4XEVA 3MYFA 2XM4A 1LE4A 4O6NA 3RVYA 3FXHA 3TOMA 4CS7A 5AC5A 2MYSA 4GEHA 3MX3A 4G7OF 1LI7A 5L0FA 1T5OA 3K1IC 1OR3A 3HNJA 1Z3IX 4JCZA 3V5XA 4C7OB 2IXPA 1WWPA 3AG2C 2KC3A 3DE9A 4U9DA 4XLNF 3U9JA 3G4ZA 1E83A 1EI7A 1ZHZA 2W4MA 3CAXA 3QTHA 1SYQA 1OKKD 2OEVA 2HJMA 1T6IA 1RKCA 4X0RA 2CW0F 1OR2A 4U5CE 4EUKB 3ZSUA 1Q0KA 2M4EA 1BDJB 3FAPB 3V5ZA 4E0IA 3KYJA 1LPEA 1Q0FA 3NG1A 2Q9AA 3L0IA 5JVEA 3GM3A 4U9EA 4Q7CA 3HNLA 3N24A 1ZHWA 1C17M 3S90A 2HKVA 5E33A 4OIRF 2KW3C 2CGEA 3GEEA 3RFYA 4PK4A 1HY5A 3EZHA 4N6HA 1V54C 1NBBA 4NTFA 4WABA 2J0XA 2CCYA 3SEOA 3IQCA 3GM1A 2J7PA 2YKZA 3NKEA 1JAFA 4JVSA 1OW7A 1Z5ZA 2IOQA 2H7BA 3L8JA 4L6RA 3ZQVA 1AEPA 1IW7F 2NUTB 2PNOA 4KBLA 1ZHXA 2A1DD 4MTFA 2H8AA 4XPWA 3S0XA 3U3BA 1K40A 2VASA 1YZCA 2WVQA 4PJJA 2KQ9A 3C8GB 1Q0GA 1TFOB 1FAPB 3JYYA 4O7GA 1CPRA 4ULVA 5JP7A 4ER9A 1PCXA 3JT1A 5KYXA 3NYMA 2M64A 3PMRA 1CPQA 1FFHA 5EGYA 1H7IA 2CNWD 1LM3B 2V26A 3EFOB 2PX3A 5B3SC 4R32A 4IJJA 4W8KA 3EGDB 3NDBB 2BL2A 3EH1A 2HSQA 2F22A 3C8GD 2GA0A 3HLZA 3FAJA 1EA8A 4ONSA 4CIHA 4BJ6A 5HV9A 2NUPA 4CS8C 2QE9A 3ABLC 3C63A 5D91A 1O5HA 2W9YA 2ETSA 1A7DA 2LFFA 2RD9A 3EGXA 4CDAA 5E3CA 1LKXA 2XLHA 2G62A 2IXOA 1QSPA 2W4BA 3AGUA 1K04A 1FFTC 1YYJA 2OQMA 3KH2A 4N06A 5TJ5E 3A9CA 4NY3A 3DD7A 4YT5A 3RVZA 2L6FA 3BEHA 4YJWA 2KGOA 2J8WA 2HMZA 4EWCA 3LUTB 3RKOF 3RF3A 3DXJF 3TOLA 1OCRC 3IQTA 2EINC 4AE4A 1FMWA 1OCCC 1RKEB 3SXYA 1QPUA 3VAYA 3TQOA 3UNGC 3GWLA 4BJ5A 1PD0A 1YAUO 3TULA 2VCCA 3KKBA 2WVNA 2ZPAA 4C3BA 2V3CC 1LVKA 2BE5F 1SR2A 4K7BA 1AVOB 4PFPA 2D4UA 2Q4FA 3SZRA 3T4RA 4BEMJ 3UGOA 4I1OB 2Y39A 3ZTMA 2HSBA 4G78A 3W8HA 5DS4A 2R7SA 2YWAA 4AL0A 3L1MA 3RQGA 1UFBA 3DI5A 2DYRC 2LD6A 3GM2A 4PACA 3FVYA 2EIMC 4NTBA 2WZFA 3NRHA 3SXMA 1GS9A 1NFNA 4EBKA 4IGGA 2Q00A 2CNWA 4JZAA 3S27A 1NZEA 3DMDA 2YZSA 1RJ9A 2IBFA 3DM9B 1JPNA 3JSZA 4DRJB 3RQFA 5L0CA 2OOCA 2EILC 1T9KA 5EHHA 4IWBA 3FOPA 4KC9A 2OU6A 2DI3A 5BQHA 5EK0A 1MNEA 3QZCA 4OINF 5KYYA 2HS5A 3ASOC 1YZAA 4YT2A 4E7ZA 2MWQA 3DAGA 5E3AA 1T6UA 4U5FE 4DXWA 2XLDA 2EPMX 4XLPF 5KYNA 4J32B 3LEOA 2O9XA 4XPYA 1I4YA 2J7PD 1C02A 3ABKC 3EG9A 4MTOA 4CS9A 1YJGA 5KYXB 2R7UA 2R7RA 2ZXOA 3U8PA 5JLIA 1S05A 2J0WA 2L9JA 2VCBA 2XS1A 3JTLO 3MFNA 5JT4A 3PHF2 4CSAA 3AJMA 1TWCA 1VLSA 1D0XA 1N1CA 3GEHA 4HFKB 2WZLA 4WGYA 3W4YA 5KYUA 2X51A 1YA7O 2GDCA 1JRAA 3M4BA 2NUPB 3V7OA 2EIKC 4OD4A 4FAPB 2P6VA 4KNWA 4MNDA 3AG1C 3M4CA 2JD3A 3AOUA 1J8MF 3EGXB 4YL1A 3N0TA 3B29A 2A6EF 3QVYA 4YN0B 2I8BA 1NG1A 4HE8D 3ZTZA 4MVSA 4O6MA 2OKUA 5L0DA 4JKVA 2FAPB 2B0JA 2YRFA 2E87A 3NMKA 1CGOA 1V4AA 2D5RB 2HUJA 3O6XA 4MVRA 4QDLA 2GWWA 2G3KA 2J46A 2Y3GA 3C62A 5BUOA 5B1AC 3JRMO 4AE4B 4IAQA 4N4WA 1LS1A 1HMOA 2XXAA 2KYHA 4DVYP 4EKWA 3HJCA 1OCOC 2XSEA 3UMHA 1ZHTA 3U2MA 3EHNA 4OIPF 2WZGA 1Z6AA 4AK9A 3DE8A 4MVQA 1OW6A 1EQ1A 4P9FA 1HE1A 1HW1A 2HMQA 1YVIA 3ATPA 3LAYA 3WAQA 1VB5A 1D0YA 5L0GA 3F47A 3GORA 1H9TA 1QZXA 2MHRA 3MYIA 5JSLA 4H54A 2Y3DA 2EPNA 4NTAA 2Q7RA 4UDVA 1GM5A 2C03A 3B9QA 3GANA 4MS2A 4CIPA 1MMGA 2DB4A 3ZDLA 2P7VA 4LACB 3N2ZB 4FWVA 2TMVP 1RJ9B 1TWAA 3QW1A 3R2PA 1ORYA 3PCVA 1V74B 4BEJA 3HNIA 2A68F 3JSEO 5L0HA 3T6BA 2YQYA 3K33A 1R5ID 4JTDB 3B0UX 3I5PA 2H7VC 3E70C 2C04A 2KJGA 5T1DB 1SZIA 1U89A 4YL3A 1ZW3A 5T3TA 1GQAA 1H6GA 4CJGA 1MMAA 2EIJC 2UUHA 2Y69C 4D4XA 4W8PA 3VYWA 1WTYA 4LLCA 3QMKA 2PP4A 3WG7C 5L3QA 3NYJA 5DS5A 5GPGB 1M56C 4D4NA 2QY9A 4I3MA 4JRZA 1M2VA 2DYSC 3JRTA 4NC3A 3O39A 4JEAA 3EG9B 1F1MA 1MNDA 2HJ3A 1D1AA 2X0CA 3H2UA 3AG3C 2KSFA 3LJBA 5COMA 1I4ZA 1YA9A 2WL8A 2W45A 4I44A 3ZVRA 4DBRA 4JTCB 1QLEC 2LP4A 5CI8A 4Z9IA 1SF8A 4CDYA 1MQVA 3HNKA 3KL4A 3AQBA 4IB4A 5KYUB 1E85A 2XLVA 3U8VA 3LNMB 4BPMA 5F28E 2QLAA 4EBJA 3FDQA 3GWNA 4IRUA 2ZXWC 4MVUA 1E2XA 2B0HA
chains in the Genus database with same CATH topology
5F5FA 4BJ1A 5L3VA 1BR1A 1OCZC 1SMYF 4ZLDA 5DS6A 2H7OA 4GYTA 2XXAB 2OG2A 4YT8A 4HFFB 2YHSA 3Q7GA 2PX0A 2ZXRA 3OWTA 4ZLCA 2R7VA 4DOZA 1D1BA 1NU9C 1Z23A 2PFDA 4C3EA 2Y3HA 5DLJA 4AX2A 3MLGA 3K1HA 3I4UA 2XRHA 3W2VA 4FX5A 1D1CA 1ST6A 3AG4C 3KMIA 3POVA 3X2QC 1TWHA 4U5DE 2J45A 1M2OA 3OA1A 2WVOA 4K0DA 4ULWA 4P6IC 3UMIA 3EJNA 3LS0A 3LNRA 3Q6MA 1V55C 4I1MA 2KNHA 5DVWA 1JPJA 2Q9CA 4JCHA 1M2VB 4FESA 4RD9A 2HV6A 3CZ6A 2XL4A 4CS8A 3DZAA 3ZG1A 2IXNA 4XTKA 4OIOF 3ASNC 4JURI 2PF4E 4PJNA 4QI0A 2R7WA 2QTVA 2R7QA 2GFHA 4BJ5C 1TR2A 3WODF 3B0PA 1PD1A 2A69F 4O79A 1BR2A 4G7HF 3GODA 4RDAA 2VB6A 3CSKA 3EZIA 5KYWA 5DQTA 4B6IA 1VK5A 4OIQF 5DQZA 5HSWA 3RIPA 2Z15A 3RH3A 3LLIA 4RBNA 3LEVA 2L81A 4U5BE 2G3VA 3LLKA 4J30B 4CBEA 1ZHYA 1ZYRF 4DBQA 4Q5SF 2A6HF 3SYNA 3LS1A 1VYKA 2R7XA 4MQ9F 4JJGA 5CI9A 4F4BA 3DJNB 1W2WA 3OEOA 3AQCA 5KYYB 3CQZA 3UGPA 3ECSA 4U5GA 3ZC4A 2Q9BA 3K6BA 3JCUQ 3DM5A 3L34A 2HV7A 2J9UA 3DAFA 4LLEA 2IXMA 2R7OA 1MMNA 4CS9C 4BG0A 3NKDA 3W8IA 2OCCC 4U5HA 4YT4A 4CSAC 3EH2A 4U5EE 2IYLD 3E9VA 5T3WA 1KU2A 3RYLA 1MMDA 4PJMA 4YWQA 2VH3A 2CDQA 3W2WA 4M63A 3K7DA 5D92A 4C3DA 3FHDA 4HEAJ 3H65A 3S28A 1Z63A 4PFOA 2R7TA 3IEEA 1M57C 4KI2A 3DJUB 4JJFA 4Q4ZF 1FMVA 4ANJA 1TWGA 1OKKA 4C7OA 4QI2A 1FTSA 3ITFA 1J8YF 1ZU5A 2ZXPA 3JYHA 5KYWB 4EBBA 3EQLF 1WGWA 4PJLA 4IAOA 3EHMA 4JW1A 4LERA 3LESA 4G7ZF 5FCLA 3K66A 1NU7D 3TD7A 1ZU4A 3ZIBA 1S7ZA 1BR4A 1VYIA 2LSEA 4XWJA 3UMKA 4OD5A 2J9WA 2NUTA 4E7SA 5IY5C 3Q6NA 1O87A 3NYLA 1TKNA 2FFHA 2YEVA 3EFOA 2Q3TA 4H4KC 1IZMA 3F46A 3EGDA 4BJ6C 3M1CB 1VOMA 2WB7A 2Y3BA 3SNHA 2NG1A 4A2NB 3SP1A 1D0ZA 5E2QA 4DVZA 3I5QA 4WJ0A 3UR3C 3S29A 3ABMC 3Q7LA 1VMAA 4KNVA 4O6YA 3T6JA 2FGYA 5B1BC 4BJTA 3HTKC 1G8XA 4G0HA 3EPVA 5F5HA 2J9VA 3X1OA 3B0VC 2DGJA 4O6NA 4CS7A 2MYSA 4GEHA 3MX3A 4G7OF 3K1IC 4C7OB 1Z3IX 2IXPA 3AG2C 4XLNF 1ZHZA 2W4MA 1OKKD 4X0RA 2CW0F 4U5CE 3ZSUA 2M4EA 3NG1A 2Q9AA 3L0IA 4Q7CA 3N24A 1ZHWA 5E33A 4OIRF 2KW3C 2CGEA 3RFYA 4PK4A 3EZHA 1V54C 2J0XA 3SEOA 2J7PA 3NKEA 4JVSA 1Z5ZA 2IOQA 2H7BA 4KBLA 1IW7F 2NUTB 3S0XA 1ZHXA 2A1DD 2VASA 2WVQA 4PJJA 2KQ9A 4O7GA 1PCXA 3JT1A 5KYXA 3NYMA 3PMRA 1FFHA 5EGYA 2CNWD 2V26A 3EFOB 2PX3A 5B3SC 4IJJA 4W8KA 3EGDB 3NDBB 3EH1A 3HLZA 3FAJA 4CIHA 2NUPA 4CS8C 3ABLC 5D91A 1O5HA 2W9YA 3EGXA 5E3CA 1LKXA 2G62A 2IXOA 3KH2A 2W4BA 1FFTC 4N06A 4NY3A 3DD7A 4YT5A 4YJWA 2KGOA 4EWCA 3RKOF 3DXJF 1OCRC 2EINC 4AE4A 1FMWA 1OCCC 3VAYA 3UNGC 4BJ5A 1PD0A 3KKBA 2WVNA 2ZPAA 4C3BA 2V3CC 1LVKA 2BE5F 4K7BA 4PFPA 3T4RA 3UGOA 3SZRA 2R7SA 4I1OB 2Y39A 3W8HA 5DS4A 2DYRC 3FVYA 2EIMC 2WZFA 3NRHA 2CNWA 4JZAA 3S27A 1NZEA 3DMDA 2YZSA 1RJ9A 3DM9B 1JPNA 3JSZA 2EILC 5EHHA 4IWBA 4KC9A 1MNEA 3QZCA 4OINF 5KYYA 3ASOC 4YT2A 4E7ZA 2MWQA 3DAGA 5E3AA 4U5FE 4XLPF 5KYNA 4J32B 2O9XA 3EG9A 2J7PD 3ABKC 4CS9A 5KYXB 2R7UA 2R7RA 2ZXOA 3PHF2 2J0WA 2L9JA 4CSAA 4HFKB 1TWCA 1D0XA 1N1CA 2WZLA 5KYUA 2X51A 3V7OA 2NUPB 2EIKC 4OD4A 2P6VA 4KNWA 4MNDA 3AG1C 2JD3A 1J8MF 3EGXB 3N0TA 2A6EF 4YN0B 2I8BA 1NG1A 4HE8D 4O6MA 2B0JA 2E87A 3O6XA 2D5RB 4QDLA 2G3KA 2J46A 2Y3GA 5BUOA 5B1AC 4AE4B 1LS1A 2XXAA 4DVYP 3HJCA 1OCOC 2XSEA 3UMHA 1ZHTA 3EHNA 4OIPF 2WZGA 1Z6AA 4AK9A 3LAYA 1D0YA 3F47A 1QZXA 2Y3DA 2C03A 3B9QA 3GANA 1MMGA 2P7VA 4LACB 3N2ZB 4FWVA 1RJ9B 1TWAA 4BEJA 2A68F 3T6BA 3K33A 3B0UX 3I5PA 2H7VC 3E70C 2C04A 2KJGA 5T1DB 1SZIA 5T3TA 1MMAA 2EIJC 2Y69C 3VYWA 4LLCA 3QMKA 2PP4A 3WG7C 5L3QA 3NYJA 5DS5A 1M56C 2QY9A 4I3MA 4BJ6A 1M2VA 2DYSC 3JRTA 3O39A 3EG9B 1MNDA 1D1AA 3AG3C 3LJBA 3ZVRA 2WL8A 2W45A 4I44A 4DBRA 1QLEC 5CI8A 1SF8A 3KL4A 3AQBA 5KYUB 3FDQA 4IRUA 2ZXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5R B;  5CI9 A;  3DJU B;  3DJN B;  5CI8 A;  3E9V A;  2Z15 A; 
#chains in the Genus database with same CATH topology
 5F5F A;  1BBH A;  2EPK X;  3H2V A;  3O10 A;  4BJ1 A;  5A6B A;  1DOW A;  2OEX A;  5L3V A;  1GGQ A;  1WAT A;  2OJQ A;  1WN0 A;  2NSF A;  2AWY A;  1BR1 A;  1OCZ C;  1SMY F;  4ZLD A;  4E0H A;  4WGZ A;  1XWJ A;  5DS6 A;  3K1I A;  2H7O A;  4GYT A;  1VLT A;  4CX9 A;  1T6Q A;  2XXA B;  4MVM A;  2OG2 A;  4YT8 A;  2P61 A;  3U2L A;  2BC5 A;  4HFF B;  256B A;  2YHS A;  3Q7G A;  1G4W R;  2YLD A;  4IAR A;  3U5S A;  2PX0 A;  1CGM E;  4E17 A;  2ZXR A;  3OWT A;  4ZLC A;  3G50 A;  1UG7 A;  2R7V A;  3NMJ A;  1Z7Q c;  4DOZ A;  1D1B A;  1NLX A;  1NU9 C;  1Z23 A;  4DJ9 A;  2PFD A;  2RSE B;  4N6C A;  3V5Y A;  4C3E A;  2Y3H A;  5DLJ A;  4AX2 A;  3MLG A;  1B68 A;  3K1H A;  3IQ6 A;  3I4U A;  2XLW A;  1OXK A;  2XRH A;  2J9B A;  4P9T A;  4LDQ A;  1OW8 A;  3R7C A;  2L6G A;  4FX5 A;  4JEB A;  3W2V A;  5CIV A;  5L0I A;  1D1C A;  1ST6 A;  3AG4 C;  3KMI A;  1O3U A;  3X2Q C;  3POV A;  1WOL A;  1TWH A;  2J45 A;  1M2O A;  3OA1 A;  2WVO A;  4K0D A;  4MVO A;  4U5D E;  4ULW A;  1YAR O;  5BQG A;  3U3F A;  4P6I C;  4EIY A;  3UMI A;  1TQG A;  2NSG A;  3EJN A;  2LQG A;  3LS0 A;  3QVZ A;  3WHN A;  1G5Z A;  4LDK A;  3LNR A;  2AVK A;  3Q6M A;  3RW0 A;  1V55 C;  5FZT A;  3T6G B;  4I1M A;  2EPL X;  2KNH A;  3M15 A;  4LDR A;  1FNT c;  1ZZP A;  4K1O A;  1RXQ A;  5DVW A;  5AGF A;  4MW3 A;  1JPJ A;  2Q9C A;  3L8I A;  1M2V B;  4JCH A;  4FES A;  3U0C A;  4RD9 A;  2HV6 A;  3CZ6 A;  2XL4 A;  4CS8 A;  3DZA A;  2XLO A;  3ZG1 A;  3CEX A;  1JOG A;  2IXN A;  4XTK A;  4OIO F;  2L7A A;  3ASN C;  4JE9 A;  4JUR I;  2PF4 E;  3C8Z A;  4PJN A;  3FOO A;  4QI0 A;  1T01 A;  2P0N A;  1KTM A;  1PV3 A;  1L3P A;  2QTV A;  2R7W A;  2R7Q A;  1E84 A;  1LIH A;  3VF0 A;  4E18 A;  4EHP A;  2GFH A;  2R9R B;  1Q0D A;  4BJ5 C;  1TR2 A;  3WOD F;  3B0P A;  1PD1 A;  2A69 F;  3KYI A;  4O79 A;  1BR2 A;  4G7H F;  1YYX A;  2L6H A;  3GOD A;  2VB6 A;  3CSK A;  3EZI A;  1A41 A;  3HKK A;  4RDA A;  5KYW A;  5DQT A;  4B6I A;  1VK5 A;  5A69 A;  4OIQ F;  3NMI A;  5DQZ A;  5HSW A;  1QKR A;  3RIP A;  5JS5 A;  3S84 A;  2Z15 A;  3RH3 A;  3TJ6 A;  4DRI B;  3LLI A;  2QNL A;  4RBN A;  3LEV A;  1HE9 A;  2YL1 A;  3AGT A;  2L81 A;  3DKA A;  1EKY A;  4U5B E;  3M79 A;  2G3V A;  3LLK A;  4J30 B;  4CBE A;  1OXB A;  5A6B D;  1ZHY A;  4AL1 A;  1ZYR F;  4DBQ A;  3PDM P;  4Q5S F;  3O55 A;  1U0B B;  2A6H F;  2YL7 A;  3C7J A;  1A7V A;  2A0U A;  3LS1 A;  3SYN A;  1VYK A;  2ZD9 A;  2JPU A;  2AU5 A;  1A7E A;  1HMD A;  3JZ0 A;  3KPH A;  1G4U S;  4JIO A;  4JJG A;  4MQ9 F;  5CI9 A;  4F4B A;  3DJN B;  1W2W A;  1WAS A;  3OEO A;  2XLM A;  3AQC A;  3SXZ A;  2YL0 A;  5A6J A;  5KYY B;  3U9M A;  2A0B A;  3GEI A;  3CQZ A;  4J7T A;  3UGP A;  3ECS A;  1RCP A;  4U5G A;  3ZC4 A;  4XPX A;  2KK1 A;  3TK0 A;  2Q9B A;  3K6B A;  2CYD A;  3JCU Q;  3DM5 A;  2XS8 A;  3L34 A;  2HV7 A;  2J9U A;  3DAF A;  4LLE A;  2IXM A;  3VRC A;  2R7O A;  1MMN A;  4CS9 C;  3IHU A;  4MVZ A;  3NKD A;  2LK4 A;  3W8I A;  4BG0 A;  4CJO A;  2OCC C;  4U5H A;  2VC9 A;  5COF A;  5B3I A;  4YT4 A;  4CSA C;  1XZP A;  5AC4 A;  1YDI A;  4Z9J A;  3EH2 A;  1M6T A;  4U5E E;  2IYL D;  3E9V A;  2LCH A;  3MBG A;  1TFK B;  1CGN A;  4PR9 A;  1KU2 A;  5T3W A;  1APC A;  1ORJ A;  3RYL A;  2ICW G;  1AUE A;  1MMD A;  4PJM A;  4YWQ A;  2VH3 A;  2CDQ A;  2ASR A;  3W2W A;  5A6K A;  4M63 A;  3K7D A;  5D92 A;  1ZW2 A;  3G4X A;  2XL8 A;  4MTG A;  4C3D A;  3FHD A;  1JMW A;  3BRJ A;  4HEA J;  3H65 A;  4J7Y A;  4GQH A;  3S28 A;  4PFO A;  1Z63 A;  3IEE A;  3SXK A;  2R7T A;  3RQE A;  1M57 C;  5L0J A;  4KI2 A;  2IM8 A;  2YL3 A;  3DJU B;  4JJF A;  5K0I A;  4Q4Z F;  1FMV A;  4ANJ A;  1C03 A;  1TWG A;  2HFI A;  4YL0 A;  3B71 A;  2R7X A;  1OKK A;  2EPO A;  1NSG B;  1OQC A;  4XEF A;  4C7O A;  3A11 A;  2I15 A;  3VM6 A;  4QI2 A;  1FTS A;  3ITF A;  1J8Y F;  1ZU5 A;  1L7C A;  3FMS A;  2ZXP A;  4XEK A;  2VCA A;  3DWW A;  3JYH A;  5KYW B;  1U6H A;  1QQ3 A;  2NPU A;  2R03 A;  4EBB A;  1VTM P;  4NQF A;  3US6 A;  1JR8 A;  3EQL F;  1BZ4 A;  1WGW A;  4PJL A;  2R02 A;  2AWC A;  4IAO A;  4Z9H A;  1DOV A;  3EHM A;  5JRA A;  5COG A;  4JW1 A;  4LER A;  3TJ5 A;  2YLI A;  3LES A;  1A0B A;  4G7Z F;  5FCL A;  1Q0M A;  3K66 A;  1NU7 D;  3TD7 A;  1ZU4 A;  3ZIB A;  1S7Z A;  1BR4 A;  2GAQ A;  4CDV A;  1VYI A;  2LSE A;  4XWJ A;  2PBE A;  1Y4C A;  1LS4 A;  1R4T A;  5JUA A;  3J06 A;  1Y6D A;  2YVK A;  3UMK A;  4OD5 A;  2J9W A;  2NUT A;  4E7S A;  4MW8 A;  5IY5 C;  4A4A A;  3C8G A;  2R25 A;  3Q6N A;  1O87 A;  3NYL A;  1TKN A;  2P1A A;  1FR0 A;  4JTA B;  2JX0 A;  3ZQY A;  1I5N A;  2FFH A;  2YEV A;  3EFO A;  1K05 A;  2Q3T A;  4H4K C;  3ZWI A;  1IZM A;  3F46 A;  5BQI A;  1HW2 A;  3EGD A;  4BJ6 C;  3M1C B;  1RMV A;  1VOM A;  2WB7 A;  2Y3B A;  1E86 A;  3SNH A;  2NG1 A;  2LIG A;  2XLE A;  2UUI A;  4A2N B;  1QVX A;  1D0Z A;  1LE2 A;  4XQ1 A;  1NFO A;  3IQ5 A;  4YK5 A;  5E2Q A;  3I5Q A;  3SP1 A;  4NCQ A;  4DVZ A;  4WJ0 A;  2LFD A;  3T9O A;  3UR3 C;  3S29 A;  1ORS C;  1ZVZ A;  3ABM C;  1H9G A;  1YLM A;  1XZQ A;  2R05 A;  3Q7L A;  1VMA A;  4KNV A;  4O6Y A;  2AP3 A;  3T6J A;  3S9O A;  2FGY A;  3IPM O;  5B1B C;  4JC7 A;  3HTK C;  3QW0 A;  4BJT A;  1KNY A;  1G8X A;  4DRH B;  2XL6 A;  4G0H A;  3EPV A;  5A6A A;  2HZ8 A;  1RKE A;  1LI5 A;  2YLG A;  2QUP A;  5F5H A;  2J9V A;  3X1O A;  2OJE D;  2XM0 A;  2DGJ A;  3B0V C;  3C18 A;  4XEV A;  3MYF A;  2XM4 A;  1LE4 A;  4O6N A;  3RVY A;  3FXH A;  3TOM A;  4CS7 A;  5AC5 A;  2MYS A;  4GEH A;  3MX3 A;  4G7O F;  1LI7 A;  5L0F A;  1T5O A;  3K1I C;  1OR3 A;  3HNJ A;  1Z3I X;  4JCZ A;  3V5X A;  4C7O B;  2IXP A;  1WWP A;  3AG2 C;  2KC3 A;  3DE9 A;  4U9D A;  4XLN F;  3U9J A;  3G4Z A;  1E83 A;  1EI7 A;  1ZHZ A;  2W4M A;  3CAX A;  3QTH A;  1SYQ A;  1OKK D;  2OEV A;  2HJM A;  1T6I A;  1RKC A;  4X0R A;  2CW0 F;  1OR2 A;  4U5C E;  4EUK B;  3ZSU A;  1Q0K A;  2M4E A;  1BDJ B;  3FAP B;  3V5Z A;  4E0I A;  3KYJ A;  1LPE A;  1Q0F A;  3NG1 A;  2Q9A A;  3L0I A;  5JVE A;  3GM3 A;  4U9E A;  4Q7C A;  3HNL A;  3N24 A;  1ZHW A;  1C17 M;  3S90 A;  2HKV A;  5E33 A;  4OIR F;  2KW3 C;  2CGE A;  3GEE A;  3RFY A;  4PK4 A;  1HY5 A;  3EZH A;  4N6H A;  1V54 C;  1NBB A;  4NTF A;  4WAB A;  2J0X A;  2CCY A;  3SEO A;  3IQC A;  3GM1 A;  2J7P A;  2YKZ A;  3NKE A;  1JAF A;  4JVS A;  1OW7 A;  1Z5Z A;  2IOQ A;  2H7B A;  3L8J A;  4L6R A;  3ZQV A;  1AEP A;  1IW7 F;  2NUT B;  2PNO A;  4KBL A;  1ZHX A;  2A1D D;  4MTF A;  2H8A A;  4XPW A;  3S0X A;  3U3B A;  1K40 A;  2VAS A;  1YZC A;  2WVQ A;  4PJJ A;  2KQ9 A;  3C8G B;  1Q0G A;  1TFO B;  1FAP B;  3JYY A;  4O7G A;  1CPR A;  4ULV A;  5JP7 A;  4ER9 A;  1PCX A;  3JT1 A;  5KYX A;  3NYM A;  2M64 A;  3PMR A;  1CPQ A;  1FFH A;  5EGY A;  1H7I A;  2CNW D;  1LM3 B;  2V26 A;  3EFO B;  2PX3 A;  5B3S C;  4R32 A;  4IJJ A;  4W8K A;  3EGD B;  3NDB B;  2BL2 A;  3EH1 A;  2HSQ A;  2F22 A;  3C8G D;  2GA0 A;  3HLZ A;  3FAJ A;  1EA8 A;  4ONS A;  4CIH A;  4BJ6 A;  5HV9 A;  2NUP A;  4CS8 C;  2QE9 A;  3ABL C;  3C63 A;  5D91 A;  1O5H A;  2W9Y A;  2ETS A;  1A7D A;  2LFF A;  2RD9 A;  3EGX A;  4CDA A;  5E3C A;  1LKX A;  2XLH A;  2G62 A;  2IXO A;  1QSP A;  2W4B A;  3AGU A;  1K04 A;  1FFT C;  1YYJ A;  2OQM A;  3KH2 A;  4N06 A;  5TJ5 E;  3A9C A;  4NY3 A;  3DD7 A;  4YT5 A;  3RVZ A;  2L6F A;  3BEH A;  4YJW A;  2KGO A;  2J8W A;  2HMZ A;  4EWC A;  3LUT B;  3RKO F;  3RF3 A;  3DXJ F;  3TOL A;  1OCR C;  3IQT A;  2EIN C;  4AE4 A;  1FMW A;  1OCC C;  1RKE B;  3SXY A;  1QPU A;  3VAY A;  3TQO A;  3UNG C;  3GWL A;  4BJ5 A;  1PD0 A;  1YAU O;  3TUL A;  2VCC A;  3KKB A;  2WVN A;  2ZPA A;  4C3B A;  2V3C C;  1LVK A;  2BE5 F;  1SR2 A;  4K7B A;  1AVO B;  4PFP A;  2D4U A;  2Q4F A;  3SZR A;  3T4R A;  4BEM J;  3UGO A;  4I1O B;  2Y39 A;  3ZTM A;  2HSB A;  4G78 A;  3W8H A;  5DS4 A;  2R7S A;  2YWA A;  4AL0 A;  3L1M A;  3RQG A;  1UFB A;  3DI5 A;  2DYR C;  2LD6 A;  3GM2 A;  4PAC A;  3FVY A;  2EIM C;  4NTB A;  2WZF A;  3NRH A;  3SXM A;  1GS9 A;  1NFN A;  4EBK A;  4IGG A;  2Q00 A;  2CNW A;  4JZA A;  3S27 A;  1NZE A;  3DMD A;  2YZS A;  1RJ9 A;  2IBF A;  3DM9 B;  1JPN A;  3JSZ A;  4DRJ B;  3RQF A;  5L0C A;  2OOC A;  2EIL C;  1T9K A;  5EHH A;  4IWB A;  3FOP A;  4KC9 A;  2OU6 A;  2DI3 A;  5BQH A;  5EK0 A;  1MNE A;  3QZC A;  4OIN F;  5KYY A;  2HS5 A;  3ASO C;  1YZA A;  4YT2 A;  4E7Z A;  2MWQ A;  3DAG A;  5E3A A;  1T6U A;  4U5F E;  4DXW A;  2XLD A;  2EPM X;  4XLP F;  5KYN A;  4J32 B;  3LEO A;  2O9X A;  4XPY A;  1I4Y A;  2J7P D;  1C02 A;  3ABK C;  3EG9 A;  4MTO A;  4CS9 A;  1YJG A;  5KYX B;  2R7U A;  2R7R A;  2ZXO A;  3U8P A;  5JLI A;  1S05 A;  2J0W A;  2L9J A;  2VCB A;  2XS1 A;  3JTL O;  3MFN A;  5JT4 A;  3PHF 2;  4CSA A;  3AJM A;  1TWC A;  1VLS A;  1D0X A;  1N1C A;  3GEH A;  4HFK B;  2WZL A;  4WGY A;  3W4Y A;  5KYU A;  2X51 A;  1YA7 O;  2GDC A;  1JRA A;  3M4B A;  2NUP B;  3V7O A;  2EIK C;  4OD4 A;  4FAP B;  2P6V A;  4KNW A;  4MND A;  3AG1 C;  3M4C A;  2JD3 A;  3AOU A;  1J8M F;  3EGX B;  4YL1 A;  3N0T A;  3B29 A;  2A6E F;  3QVY A;  4YN0 B;  2I8B A;  1NG1 A;  4HE8 D;  3ZTZ A;  4MVS A;  4O6M A;  2OKU A;  5L0D A;  4JKV A;  2FAP B;  2B0J A;  2YRF A;  2E87 A;  3NMK A;  1CGO A;  1V4A A;  2D5R B;  2HUJ A;  3O6X A;  4MVR A;  4QDL A;  2GWW A;  2G3K A;  2J46 A;  2Y3G A;  3C62 A;  5BUO A;  5B1A C;  3JRM O;  4AE4 B;  4IAQ A;  4N4W A;  1LS1 A;  1HMO A;  2XXA A;  2KYH A;  4DVY P;  4EKW A;  3HJC A;  1OCO C;  2XSE A;  3UMH A;  1ZHT A;  3U2M A;  3EHN A;  4OIP F;  2WZG A;  1Z6A A;  4AK9 A;  3DE8 A;  4MVQ A;  1OW6 A;  1EQ1 A;  4P9F A;  1HE1 A;  1HW1 A;  2HMQ A;  1YVI A;  3ATP A;  3LAY A;  3WAQ A;  1VB5 A;  1D0Y A;  5L0G A;  3F47 A;  3GOR A;  1H9T A;  1QZX A;  2MHR A;  3MYI A;  5JSL A;  4H54 A;  2Y3D A;  2EPN A;  4NTA A;  2Q7R A;  4UDV A;  1GM5 A;  2C03 A;  3B9Q A;  3GAN A;  4MS2 A;  4CIP A;  1MMG A;  2DB4 A;  3ZDL A;  2P7V A;  4LAC B;  3N2Z B;  4FWV A;  2TMV P;  1RJ9 B;  1TWA A;  3QW1 A;  3R2P A;  1ORY A;  3PCV A;  1V74 B;  4BEJ A;  3HNI A;  2A68 F;  3JSE O;  5L0H A;  3T6B A;  2YQY A;  3K33 A;  1R5I D;  4JTD B;  3B0U X;  3I5P A;  2H7V C;  3E70 C;  2C04 A;  2KJG A;  5T1D B;  1SZI A;  1U89 A;  4YL3 A;  1ZW3 A;  5T3T A;  1GQA A;  1H6G A;  4CJG A;  1MMA A;  2EIJ C;  2UUH A;  2Y69 C;  4D4X A;  4W8P A;  3VYW A;  1WTY A;  4LLC A;  3QMK A;  2PP4 A;  3WG7 C;  5L3Q A;  3NYJ A;  5DS5 A;  5GPG B;  1M56 C;  4D4N A;  2QY9 A;  4I3M A;  4JRZ A;  1M2V A;  2DYS C;  3JRT A;  4NC3 A;  3O39 A;  4JEA A;  3EG9 B;  1F1M A;  1MND A;  2HJ3 A;  1D1A A;  2X0C A;  3H2U A;  3AG3 C;  2KSF A;  3LJB A;  5COM A;  1I4Z A;  1YA9 A;  2WL8 A;  2W45 A;  4I44 A;  3ZVR A;  4DBR A;  4JTC B;  1QLE C;  2LP4 A;  5CI8 A;  4Z9I A;  1SF8 A;  4CDY A;  1MQV A;  3HNK A;  3KL4 A;  3AQB A;  4IB4 A;  5KYU B;  1E85 A;  2XLV A;  3U8V A;  3LNM B;  4BPM A;  5F28 E;  2QLA A;  4EBJ A;  3FDQ A;  3GWN A;  4IRU A;  2ZXW C;  4MVU A;  1E2X A;  2B0H A; 
#chains in the Genus database with same CATH homology
 5F5F A;  4BJ1 A;  5L3V A;  1BR1 A;  1OCZ C;  1SMY F;  4ZLD A;  5DS6 A;  2H7O A;  4GYT A;  2XXA B;  2OG2 A;  4YT8 A;  4HFF B;  2YHS A;  3Q7G A;  2PX0 A;  2ZXR A;  3OWT A;  4ZLC A;  2R7V A;  4DOZ A;  1D1B A;  1NU9 C;  1Z23 A;  2PFD A;  4C3E A;  2Y3H A;  5DLJ A;  4AX2 A;  3MLG A;  3K1H A;  3I4U A;  2XRH A;  3W2V A;  4FX5 A;  1D1C A;  1ST6 A;  3AG4 C;  3KMI A;  3POV A;  3X2Q C;  1TWH A;  4U5D E;  2J45 A;  1M2O A;  3OA1 A;  2WVO A;  4K0D A;  4ULW A;  4P6I C;  3UMI A;  3EJN A;  3LS0 A;  3LNR A;  3Q6M A;  1V55 C;  4I1M A;  2KNH A;  5DVW A;  1JPJ A;  2Q9C A;  4JCH A;  1M2V B;  4FES A;  4RD9 A;  2HV6 A;  3CZ6 A;  2XL4 A;  4CS8 A;  3DZA A;  3ZG1 A;  2IXN A;  4XTK A;  4OIO F;  3ASN C;  4JUR I;  2PF4 E;  4PJN A;  4QI0 A;  2R7W A;  2QTV A;  2R7Q A;  2GFH A;  4BJ5 C;  1TR2 A;  3WOD F;  3B0P A;  1PD1 A;  2A69 F;  4O79 A;  1BR2 A;  4G7H F;  3GOD A;  4RDA A;  2VB6 A;  3CSK A;  3EZI A;  5KYW A;  5DQT A;  4B6I A;  1VK5 A;  4OIQ F;  5DQZ A;  5HSW A;  3RIP A;  2Z15 A;  3RH3 A;  3LLI A;  4RBN A;  3LEV A;  2L81 A;  4U5B E;  2G3V A;  3LLK A;  4J30 B;  4CBE A;  1ZHY A;  1ZYR F;  4DBQ A;  4Q5S F;  2A6H F;  3SYN A;  3LS1 A;  1VYK A;  2R7X A;  4MQ9 F;  4JJG A;  5CI9 A;  4F4B A;  3DJN B;  1W2W A;  3OEO A;  3AQC A;  5KYY B;  3CQZ A;  3UGP A;  3ECS A;  4U5G A;  3ZC4 A;  2Q9B A;  3K6B A;  3JCU Q;  3DM5 A;  3L34 A;  2HV7 A;  2J9U A;  3DAF A;  4LLE A;  2IXM A;  2R7O A;  1MMN A;  4CS9 C;  4BG0 A;  3NKD A;  3W8I A;  2OCC C;  4U5H A;  4YT4 A;  4CSA C;  3EH2 A;  4U5E E;  2IYL D;  3E9V A;  5T3W A;  1KU2 A;  3RYL A;  1MMD A;  4PJM A;  4YWQ A;  2VH3 A;  2CDQ A;  3W2W A;  4M63 A;  3K7D A;  5D92 A;  4C3D A;  3FHD A;  4HEA J;  3H65 A;  3S28 A;  1Z63 A;  4PFO A;  2R7T A;  3IEE A;  1M57 C;  4KI2 A;  3DJU B;  4JJF A;  4Q4Z F;  1FMV A;  4ANJ A;  1TWG A;  1OKK A;  4C7O A;  4QI2 A;  1FTS A;  3ITF A;  1J8Y F;  1ZU5 A;  2ZXP A;  3JYH A;  5KYW B;  4EBB A;  3EQL F;  1WGW A;  4PJL A;  4IAO A;  3EHM A;  4JW1 A;  4LER A;  3LES A;  4G7Z F;  5FCL A;  3K66 A;  1NU7 D;  3TD7 A;  1ZU4 A;  3ZIB A;  1S7Z A;  1BR4 A;  1VYI A;  2LSE A;  4XWJ A;  3UMK A;  4OD5 A;  2J9W A;  2NUT A;  4E7S A;  5IY5 C;  3Q6N A;  1O87 A;  3NYL A;  1TKN A;  2FFH A;  2YEV A;  3EFO A;  2Q3T A;  4H4K C;  1IZM A;  3F46 A;  3EGD A;  4BJ6 C;  3M1C B;  1VOM A;  2WB7 A;  2Y3B A;  3SNH A;  2NG1 A;  4A2N B;  3SP1 A;  1D0Z A;  5E2Q A;  4DVZ A;  3I5Q A;  4WJ0 A;  3UR3 C;  3S29 A;  3ABM C;  3Q7L A;  1VMA A;  4KNV A;  4O6Y A;  3T6J A;  2FGY A;  5B1B C;  4BJT A;  3HTK C;  1G8X A;  4G0H A;  3EPV A;  5F5H A;  2J9V A;  3X1O A;  3B0V C;  2DGJ A;  4O6N A;  4CS7 A;  2MYS A;  4GEH A;  3MX3 A;  4G7O F;  3K1I C;  4C7O B;  1Z3I X;  2IXP A;  3AG2 C;  4XLN F;  1ZHZ A;  2W4M A;  1OKK D;  4X0R A;  2CW0 F;  4U5C E;  3ZSU A;  2M4E A;  3NG1 A;  2Q9A A;  3L0I A;  4Q7C A;  3N24 A;  1ZHW A;  5E33 A;  4OIR F;  2KW3 C;  2CGE A;  3RFY A;  4PK4 A;  3EZH A;  1V54 C;  2J0X A;  3SEO A;  2J7P A;  3NKE A;  4JVS A;  1Z5Z A;  2IOQ A;  2H7B A;  4KBL A;  1IW7 F;  2NUT B;  3S0X A;  1ZHX A;  2A1D D;  2VAS A;  2WVQ A;  4PJJ A;  2KQ9 A;  4O7G A;  1PCX A;  3JT1 A;  5KYX A;  3NYM A;  3PMR A;  1FFH A;  5EGY A;  2CNW D;  2V26 A;  3EFO B;  2PX3 A;  5B3S C;  4IJJ A;  4W8K A;  3EGD B;  3NDB B;  3EH1 A;  3HLZ A;  3FAJ A;  4CIH A;  2NUP A;  4CS8 C;  3ABL C;  5D91 A;  1O5H A;  2W9Y A;  3EGX A;  5E3C A;  1LKX A;  2G62 A;  2IXO A;  3KH2 A;  2W4B A;  1FFT C;  4N06 A;  4NY3 A;  3DD7 A;  4YT5 A;  4YJW A;  2KGO A;  4EWC A;  3RKO F;  3DXJ F;  1OCR C;  2EIN C;  4AE4 A;  1FMW A;  1OCC C;  3VAY A;  3UNG C;  4BJ5 A;  1PD0 A;  3KKB A;  2WVN A;  2ZPA A;  4C3B A;  2V3C C;  1LVK A;  2BE5 F;  4K7B A;  4PFP A;  3T4R A;  3UGO A;  3SZR A;  2R7S A;  4I1O B;  2Y39 A;  3W8H A;  5DS4 A;  2DYR C;  3FVY A;  2EIM C;  2WZF A;  3NRH A;  2CNW A;  4JZA A;  3S27 A;  1NZE A;  3DMD A;  2YZS A;  1RJ9 A;  3DM9 B;  1JPN A;  3JSZ A;  2EIL C;  5EHH A;  4IWB A;  4KC9 A;  1MNE A;  3QZC A;  4OIN F;  5KYY A;  3ASO C;  4YT2 A;  4E7Z A;  2MWQ A;  3DAG A;  5E3A A;  4U5F E;  4XLP F;  5KYN A;  4J32 B;  2O9X A;  3EG9 A;  2J7P D;  3ABK C;  4CS9 A;  5KYX B;  2R7U A;  2R7R A;  2ZXO A;  3PHF 2;  2J0W A;  2L9J A;  4CSA A;  4HFK B;  1TWC A;  1D0X A;  1N1C A;  2WZL A;  5KYU A;  2X51 A;  3V7O A;  2NUP B;  2EIK C;  4OD4 A;  2P6V A;  4KNW A;  4MND A;  3AG1 C;  2JD3 A;  1J8M F;  3EGX B;  3N0T A;  2A6E F;  4YN0 B;  2I8B A;  1NG1 A;  4HE8 D;  4O6M A;  2B0J A;  2E87 A;  3O6X A;  2D5R B;  4QDL A;  2G3K A;  2J46 A;  2Y3G A;  5BUO A;  5B1A C;  4AE4 B;  1LS1 A;  2XXA A;  4DVY P;  3HJC A;  1OCO C;  2XSE A;  3UMH A;  1ZHT A;  3EHN A;  4OIP F;  2WZG A;  1Z6A A;  4AK9 A;  3LAY A;  1D0Y A;  3F47 A;  1QZX A;  2Y3D A;  2C03 A;  3B9Q A;  3GAN A;  1MMG A;  2P7V A;  4LAC B;  3N2Z B;  4FWV A;  1RJ9 B;  1TWA A;  4BEJ A;  2A68 F;  3T6B A;  3K33 A;  3B0U X;  3I5P A;  2H7V C;  3E70 C;  2C04 A;  2KJG A;  5T1D B;  1SZI A;  5T3T A;  1MMA A;  2EIJ C;  2Y69 C;  3VYW A;  4LLC A;  3QMK A;  2PP4 A;  3WG7 C;  5L3Q A;  3NYJ A;  5DS5 A;  1M56 C;  2QY9 A;  4I3M A;  4BJ6 A;  1M2V A;  2DYS C;  3JRT A;  3O39 A;  3EG9 B;  1MND A;  1D1A A;  3AG3 C;  3LJB A;  3ZVR A;  2WL8 A;  2W45 A;  4I44 A;  4DBR A;  1QLE C;  5CI8 A;  1SF8 A;  3KL4 A;  3AQB A;  5KYU B;  3FDQ A;  4IRU A;  2ZXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...