3LLKA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
241
Chain Sequence
LADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfhydryl oxidase 1
publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 84
structure length 241
sequence length 250
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3llkA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3llkA01
3U2LA 4E0HA 2HJ3A 1JR8A 3O55A 3R7CA 3U2MA 3U5SA 1OQCA 3W4YA 3GWNA 3LLIA 3TD7A 3MBGA 4LDKA 1JRAA 3LLKA 3GWLA 3TK0A 4E0IA
chains in the Genus database with same CATH superfamily
2OKUA 2XL6A 3QW0A 4H54A 4XEKA 1WN0A 4E0HA 3K33A 1N1CA 4PJNA 2AWCA 4BEJA 2QE9A 3QW1A 4OIQF 2EPNA 2YWAA 4JC7A 5TJ5E 1Q0MA 1MMGA 2RD9A 4KC9A 3JSEO 4DBQA 1NU7D 2IBFA 2Q7RA 2AWYA 1VLSA 3U8VA 3G4ZA 3UMHA 2R7VA 3M4BA 3LLIA 4JIOA 1DOVA 1OCRC 1ZHWA 2CGEA 3DZAA 4MW8A 1G5ZA 4EBBA 5A69A 3RF3A 4N06A 4U5CE 3SXYA 3OEOA 2FFHA 1OR3A 2M64A 3S29A 2XL4A 4RD9A 3LUTB 2XS1A 2Y3GA 3T4RA 3EG9A 1LE4A 4MVRA 2NUTB 1QPUA 2ETSA 2G3KA 1D0ZA 1D0YA 1OW6A 3GEHA 3T6JA 3U8PA 3U9MA 2R7QA 2WZFA 2XLEA 2HJ3A 2EIKC 4CS9C 1JR8A 4YT4A 2ICWG 3HJCA 3T6BA 1BR1A 3AOUA 3B29A 2OQMA 4IJJA 4N6HA 1EA8A 3TQOA 3WHNA 4YK5A 3I5QA 2VCBA 5E3CA 1H9TA 4D4NA 1LS1A 1MNDA 4HFKB 1E83A 2A69F 2YL1A 3SXKA 2PP4A 2Y69C 1M2VA 3RVZA 5JVEA 1QLEC 1BR2A 1NBBA 1F1MA 2IM8A 3ZG1A 4JEAA 4LDRA 3ZSUA 3AG3C 4U9EA 4CDVA 3POVA 4Q5SF 4KNVA 1Z63A 1T9KA 2XM4A 4CS9A 4MVZA 5B3SC 3RKOF 4BJ1A 5L0GA 5DQZA 4DVYP 3O39A 2VC9A 3B0PA 1ZYRF 2WVNA 1TQGA 2J8WA 4XQ1A 1C03A 1IZMA 2W4BA 1OW8A 1NZEA 2KYHA 4XLPF 3AG1C 4XTKA 3SYNA 3IQTA 3EFOA 2R7SA 1FMVA 4MVOA 4NTBA 1OR2A 1ORSC 4OIPF 4YWQA 2JD3A 3U2MA 2OOCA 2KJGA 1QZXA 3FAPB 4G78A 3RQEA 1RJ9A 4I1MA 5K0IA 3FXHA 3V5ZA 1T01A 2DYSC 4PFPA 1HMDA 2GA0A 3B71A 3DE9A 1O87A 4N6CA 2NUPB 3J06A 1MNEA 1I5NA 3N2ZB 3VM6A 4CDAA 4DRHB 4CIPA 4QI0A 4AX2A 1YYXA 3EHNA 4E7SA 5COFA 2G3VA 4F4BA 1RKEA 1ZZPA 2VCAA 4A4AA 4IWBA 1PV3A 4LACB 3HNKA 4EBKA 5JRAA 1HW1A 2ZXPA 4JTDB 1T6UA 2HUJA 3W2WA 1MQVA 3G50A 1NLXA 3K1IC 1VYIA 4AK9A 1FNTc 4IARA 2LK4A 3C63A 3O6XA 5FCLA 3MFNA 4LDQA 2L81A 3LNRA 4RDAA 3ZQVA 3A11A 3AJMA 1PD0A 2HKVA 3MYIA 4R32A 4CS7A 3L34A 2IXMA 4ULWA 1L7CA 1S05A 3IEEA 3F46A 1H7IA 5KYXA 4BG0A 4PJLA 3S84A 4FWVA 1QKRA 3I5PA 3RFYA 3VRCA 4YT8A 3N0TA 2BL2A 3Q7LA 3ASOC 3T9OA 2X51A 1FTSA 3M1CB 4U5FE 4PJMA 2LP4A 2R7XA 3K1IA 4J7TA 4CIHA 4C3EA 2VB6A 5CI9A 1G4US 4XLNF 4BEMJ 1RCPA 1VOMA 1VLTA 2PNOA 2ZXOA 3C18A 3GANA 2GFHA 5DVWA 4OINF 1YA7O 5KYUB 2XXAB 3UGPA 4EWCA 1NSGB 3SNHA 3C8GA 5GPGB 1RMVA 4JE9A 3NMJA 2Q9BA 3NKEA 5DLJA 3TJ5A 3S90A 4ONSA 4IAOA 4JKVA 1LIHA 4KNWA 4DOZA 1AVOB 1QSPA 5BUOA 2KW3C 3KMIA 2DB4A 3HLZA 3UMIA 2KC3A 3MBGA 3AG2C 4NC3A 5L0DA 1GM5A 5HSWA 2HSQA 3GM3A 5E3AA 1SMYF 3IQCA 1TFOB 2ASRA 2O9XA 4CX9A 3QMKA 3V5XA 1SR2A 2C04A 2PX0A 2YL3A 4L6RA 3IHUA 5T3WA 1CPQA 2LIGA 2WVQA 2I8BA 1VMAA 1KTMA 4MVQA 2L6GA 3JT1A 3FAJA 1OXKA 3L1MA 4U5BE 5E2QA 3ECSA 2P6VA 3ZWIA 4BJTA 5IY5C 2EILC 4DRIB 1V4AA 2MYSA 3IPMO 5JSLA 1TKNA 4PFOA 2XLDA 2VASA 4HE8D 4YL0A 2R7RA 1U6HA 4Z9JA 3AGTA 3CEXA 1L3PA 4J7YA 4E7ZA 1UG7A 5DQTA 2ZPAA 2NUTA 2XS8A 2UUHA 1AUEA 1R5ID 1A7DA 3DXJF 1IW7F 3EGXB 5EGYA 4W8PA 1A7EA 3M4CA 3UNGC 4WABA 4WGZA 2R7OA 5EK0A 3VYWA 4FAPB 4YT2A 5COMA 2P1AA 1DOWA 1M56C 3EH2A 2WL8A 1YA9A 4MTFA 1RKCA 4MVUA 5DS6A 4YJWA 1J8YF 1E85A 2CCYA 5L0HA 4NTFA 3NG1A 3FDQA 2J0WA 2J0XA 4JURI 3DAGA 2ZD9A 3GM1A 1C02A 3RYLA 4EBJA 2A0BA 1G8XA 2CNWD 2GAQA 2NSGA 2OG2A 4CBEA 3SXZA 4UDVA 2F22A 3FHDA 1YARO 3LEVA 4IAQA 4MQ9F 1T6QA 2HV6A 4YT5A 2Q4FA 2HMQA 1XZPA 3AGUA 2CNWA 1LPEA 4W8KA 1AEPA 5D92A 4J32B 1MMNA 4N4WA 2Y3BA 3HNLA 4LLCA 3EZHA 5DS4A 2YVKA 1T5OA 4MW3A 2XSEA 4JRZA 1TWGA 2HS5A 4O6YA 2X0CA 4AE4A 3K1HA 1LKXA 5KYWA 5KYYA 1UFBA 3MX3A 3NMIA 3NYJA 3S9OA 3V7OA 2P61A 3HTKC 4JTAB 3MYFA 4LLEA 2VH3A 2HV7A 4ER9A 2J7PD 4KBLA 1Q0DA 3DJNB 4I3MA 3L0IA 1V55C 1SZIA 1WATA 5CIVA 3QVYA 1OKKD 4ANJA 2XM0A 4HEAJ 2I15A 2B0JA 4FESA 2H7BA 3X1OA 5A6KA 2YL7A 3KYIA 3FVYA 3DM9B 4U5HA 2OJED 3EGDB 2NUPA 5L0FA 1JMWA 3LS1A 1SYQA 3UGOA 3H2UA 3DKAA 1I4YA 1YZAA 3U3BA 5JP7A 1JOGA 3TD7A 3BRJA 1QVXA 1OCCC 1OCOC 1ZHXA 2YL0A 2QTVA 2A6HF 4LDKA 4XEFA 4GEHA 2R7TA 2JX0A 1LM3B 3Q7GA 2R03A 4MVMA 4DVZA 2NSFA 4WJ0A 1T6IA 3DJUB 3FOOA 3A9CA 3HNJA 3WG7C 4EUKB 2H7OA 1ZHTA 1RXQA 4YN0B 1Q0FA 5JS5A 1VTMP 2YQYA 2A68F 4P6IC 4O79A 4Z9HA 1TWHA 3CAXA 1KNYA 4OD5A 2IXPA 3CZ6A 2KGOA 3R2PA 2J45A 3BEHA 1EI7A 4MNDA 1O5HA 1VK5A 3R7CA 1KU2A 3EFOB 3ZQYA 4JEBA 1GGQA 3QTHA 3PCVA 5CI8A 2XRHA 2YLDA 1LI5A 2EPMX 2Q3TA 3GWNA 5T3TA 3ZVRA 2C03A 3W8HA 1D1CA 4CS8C 1OCZC 1RJ9B 1J8MF 1D1BA 2HZ8A 4H4KC 2LSEA 5L3QA 3AG4C 4PR9A 4ULVA 3AQCA 5KYNA 2L9JA 1GS9A 2XL8A 4QDLA 2P7VA 1BBHA 2WZGA 2KSFA 2IXNA 3LJBA 3RIPA 5A6JA 1I4ZA 4A2NB 2R05A 2R7WA 2E87A 1H9GA 5KYUA 4ZLCA 2G62A 3NKDA 4C7OA 1YAUO 3EHMA 3DM5A 2H8AA 4PACA 3E9VA 5BQIA 3M15A 1ZW2A 2BE5F 1ZHYA 3JZ0A 3JRMO 5HV9A 4U5DE 4NQFA 2J9BA 2AU5A 4XPYA 5AGFA 2LCHA 2QNLA 5E33A 1WWPA 1BR4A 4G0HA 4OIRF 1S7ZA 2RSEB 2ZXRA 3JCUQ 2Q00A 3JYHA 1ZHZA 1O3UA 2KQ9A 2TMVP 3DWWA 3NMKA 3MLGA 1TWCA 5KYXB 2BC5A 1OW7A 1ZU5A 3EZIA 4M63A 2GWWA 3ZTZA 2ZXWC 4OD4A 5JLIA 3K6BA 3VF0A 3US6A 5L3VA 4BJ6C 5A6BD 2UUIA 4NY3A 1M57C 3K66A 3NDBB 3B9QA 3DE8A 1A0BA 1EKYA 2DI3A 1K04A 4FX5A 5JUAA 3EQLF 3O55A 3K7DA 5COGA 3TJ6A 2YRFA 3DD7A 1M2OA 2OCCC 4MTOA 1Z6AA 4O7GA 2WB7A 4AL1A 3C8GB 3NRHA 2H7VC 3X2QC 2LFDA 1E2XA 3HNIA 3JYYA 4EIYA 3KKBA 3S0XA 5FZTA 3IQ5A 5BQHA 3LNMB 3JSZA 3EGXA 4P9TA 4CJGA 1OXBA 1YVIA 3RQFA 1WGWA 3QZCA 1ORJA 1ZU4A 2J9UA 4OIOF 2QUPA 2OU6A 4MVSA 1XZQA 4G7HF 1HE9A 1TFKB 2CDQA 4JJFA 2J9WA 256BA 3T6GB 3ABKC 3C7JA 1JPJA 3RQGA 3U0CA 4I44A 4IRUA 4PJJA 2YZSA 2GDCA 4YL3A 5A6BA 2XLHA 2MHRA 1BDJB 2L6FA 3AQBA 4P9FA 1JPNA 1V74B 2YKZA 4CJOA 4CSAC 1FMWA 1CGNA 1NU9C 2P0NA 2LFFA 3GORA 2EPOA 4Q4ZF 1C17M 2IXOA 2R9RB 2YEVA 2Q9AA 3GEEA 3QVZA 4HFFB 3EH1A 3OWTA 4JJGA 3ABMC 1VB5A 5EHHA 2Z15A 2EINC 4IB4A 2B0HA 2Y3HA 2M4EA 1H6GA 3V5YA 1YYJA 1M6TA 2V26A 4K0DA 1HY5A 1JAFA 3LS0A 4XWJA 1Q0KA 3LLKA 3KPHA 4K1OA 3S27A 1D0XA 3DAFA 5B1BC 3VAYA 2W4MA 1XWJA 4CSAA 1CGOA 1D1AA 3C8ZA 4E0IA 3LESA 3EG9B 3L8JA 4AL0A 1U0BB 4GQHA 1BZ4A 1V54C 1YLMA 3E70C 4U9DA 3H65A 2AP3A 2OEVA 4EHPA 2PBEA 2WZLA 1E86A 3WODF 3EGDA 4NCQA 3UR3C 2J7PA 5A6AA 4IGGA 2Y3DA 2XLVA 4DJ9A 1YDIA 3FMSA 4EKWA 2XLMA 1OKKA 1Z3IX 1MMAA 3RH3A 2EPKX 2W45A 3PHF2 1M2VB 1SF8A 5T1DB 4E17A 1E84A 3PDMP 1HE1A 4Q7CA 4G7ZF 3N24A 3CSKA 1ORYA 2WVOA 1LI7A 2J46A 4JW1A 1LS4A 2EPLX 3ZDLA 1Y6DA 1Z23A 1YJGA 1Z5ZA 3GWLA 4AE4B 5KYWB 3OA1A 5KYYB 3TULA 3CQZA 1CGME 1LVKA 2LQGA 2DGJA 1PD1A 2IOQA 3U2LA 3UMKA 4DXWA 3DI5A 2NPUA 4JTCB 4G7OF 4ZLDA 1GQAA 3TOLA 3FOPA 5B3IA 1W2WA 2LD6A 4JCHA 4NTAA 1QQ3A 3SZRA 4DRJB 5AC5A 2W9YA 2KK1A 4O6NA 3M79A 3L8IA 1APCA 2J9VA 2EIMC 3GM2A 5B1AC 3U5SA 4C3BA 5DS5A 4QI2A 2JPUA 2PFDA 3DMDA 2EIJC 2FGYA 1FFTC 1NG1A 1Y4CA 4MS2A 2IYLD 3S28A 1WOLA 1A7VA 5F5HA 2CW0F 1A41A 1ST6A 4J30B 2Y39A 1ZW3A 4PK4A 1YZCA 2VCCA 4X0RA 3U3FA 2D4UA 3EPVA 3GEIA 3TOMA 3SP1A 3ZC4A 2FAPB 3Q6NA 2R02A 2QY9A 2D5RB 2YLIA 2DYRC 4MTGA 3TK0A 4Z9IA 1RKEB 3U9JA 1HW2A 2XXAA 5L0IA 3SXMA 3W8IA 4U5EE 1G4WR 3W2VA 2L6HA 1Q0GA 4XPXA 2MWQA 3SEOA 4JZAA 2YHSA 3NYLA 4I1OB 2HSBA 3B0VC 1TR2A 3GODA 3WAQA 4CS8A 3RVYA 2R25A 3IQ6A 4JCZA 1K40A 1U89A 4XPWA 1OQCA 2CYDA 2QLAA 3F47A 3ITFA 3KL4A 4GYTA 2V3CC 2KNHA 1NFOA 3LEOA 5L0CA 3KYJA 1FFHA 3ASNC 2XLOA 3NYMA 4JVSA 4WGYA 3ZTMA 4BPMA 3Q6MA 4XEVA 3HKKA 3ZIBA 1JRAA 2L7AA 3KH2A 3I4UA 4O6MA 1R4TA 4LERA 1WTYA 3ABLC 4BJ5C 5F5FA 2YLGA 1TWAA 1PCXA 3C8GD 1VYKA 3H2VA 2HMZA 4K7BA 3W4YA 3ATPA 3JRTA 1WASA 2OJQA 5JT4A 4C7OB 3PMRA 5AC4A 4D4XA 2A0UA 3G4XA 4DBRA 5L0JA 2AVKA 1FR0A 4C3DA 3C62A 3O10A 2PX3A 4B6IA 2Q9CA 4U5GA 3B0UX 2NG1A 2R7UA 2HFIA 1K05A 1CPRA 2XLWA 3EJNA 3LAYA 2A1DD 4RBNA 5D91A 5F28E 2A6EF 1Z7Qc 3JTLO 4BJ5A 4CDYA 3RW0A 2HJMA 4YL1A 4E18A 4BJ6A 1EQ1A 2PF4E 1B68A 1NFNA 1HMOA 5BQGA 2OEXA 1ZVZA 4KI2A 1LE2A 1MMDA 1FAPB
chains in the Genus database with same CATH topology
4E0HA 3K33A 1N1CA 4PJNA 4BEJA 4OIQF 1MMGA 4KC9A 4DBQA 1NU7D 3UMHA 2R7VA 3LLIA 1OCRC 1ZHWA 2CGEA 3DZAA 4EBBA 4N06A 4U5CE 3OEOA 2FFHA 3S29A 2XL4A 4RD9A 2Y3GA 3T4RA 3EG9A 2NUTB 3T6JA 2G3KA 1D0ZA 1D0YA 2R7QA 2WZFA 2HJ3A 2EIKC 4CS9C 1JR8A 4YT4A 3HJCA 3T6BA 1BR1A 4IJJA 3I5QA 5E3CA 1LS1A 1MNDA 4HFKB 2A69F 2PP4A 2Y69C 1M2VA 1QLEC 1BR2A 3ZG1A 3ZSUA 3AG3C 3POVA 4Q5SF 4KNVA 1Z63A 4CS9A 5B3SC 3RKOF 4BJ1A 5DQZA 4DVYP 3O39A 3B0PA 1ZYRF 2WVNA 1IZMA 2W4BA 1NZEA 4XLPF 3AG1C 4XTKA 3SYNA 2R7SA 3EFOA 1FMVA 4OIPF 4YWQA 2JD3A 3U2MA 2KJGA 1QZXA 1RJ9A 4I1MA 2DYSC 4PFPA 1O87A 2NUPB 1MNEA 3N2ZB 4QI0A 4AX2A 3EHNA 4E7SA 2G3VA 4F4BA 4IWBA 4LACB 2ZXPA 3W2WA 3K1IC 1VYIA 4AK9A 3O6XA 5FCLA 2L81A 3LNRA 4RDAA 1PD0A 4CS7A 3L34A 2IXMA 4ULWA 3IEEA 3F46A 5KYXA 4BG0A 4PJLA 4FWVA 3I5PA 3RFYA 4YT8A 3N0TA 3Q7LA 3ASOC 2X51A 1FTSA 3M1CB 4U5FE 4PJMA 2R7XA 4CIHA 4C3EA 2VB6A 5CI9A 4XLNF 2ZXOA 1VOMA 5DVWA 3GANA 2GFHA 4OINF 5KYUB 2XXAB 3UGPA 4EWCA 3SNHA 2Q9BA 3NKEA 5DLJA 4IAOA 4KNWA 4DOZA 5BUOA 2KW3C 3KMIA 3HLZA 3UMIA 3MBGA 3AG2C 5HSWA 5E3AA 1SMYF 2O9XA 3QMKA 2C04A 2PX0A 5T3WA 2WVQA 2I8BA 1VMAA 3JT1A 3FAJA 4U5BE 5E2QA 3ECSA 2P6VA 4BJTA 5IY5C 2EILC 2MYSA 1TKNA 4PFOA 2VASA 4HE8D 2R7RA 4E7ZA 5DQTA 2ZPAA 2NUTA 3DXJF 1IW7F 3EGXB 5EGYA 4G7HF 4QI2A 3UNGC 3VYWA 2R7OA 4YT2A 3EH2A 1M56C 2WL8A 5DS6A 4YJWA 1J8YF 3NG1A 3FDQA 2J0WA 2J0XA 4JURI 3DAGA 3RYLA 2OG2A 1G8XA 2CNWD 4CBEA 3FHDA 3LEVA 4MQ9F 2HV6A 4YT5A 4W8KA 2CNWA 5D92A 4J32B 1MMNA 2Y3BA 4LLCA 3EZHA 5DS4A 2XSEA 1TWGA 4AE4A 4O6YA 5KYWA 3K1HA 1LKXA 5KYYA 3MX3A 3NYJA 3V7OA 3HTKC 4LLEA 2VH3A 2HV7A 2J7PD 4KBLA 3DJNB 4I3MA 3L0IA 1V55C 1SZIA 1OKKD 4ANJA 4HEAJ 2B0JA 4FESA 2H7BA 3X1OA 3FVYA 3DM9B 4U5HA 3EGDB 2NUPA 3LS1A 3UGOA 3TD7A 5B1AC 1OCCC 1OCOC 1ZHXA 2R7TA 2QTVA 2A6HF 4LDKA 4GEHA 3Q7GA 4DVZA 4WJ0A 3DJUB 3WG7C 2H7OA 1ZHTA 4YN0B 2A68F 4P6IC 4O79A 1TWHA 4OD5A 2IXPA 3CZ6A 2KGOA 2J45A 4MNDA 1O5HA 1VK5A 3R7CA 1KU2A 3EFOB 5CI8A 2XRHA 2Q3TA 3GWNA 5T3TA 3ZVRA 2C03A 3W8HA 1D1CA 4CS8C 1OCZC 1RJ9B 1J8MF 1D1BA 4H4KC 2LSEA 5L3QA 3AG4C 3AQCA 5KYNA 2L9JA 4QDLA 2P7VA 2WZGA 3RIPA 2IXNA 3LJBA 4A2NB 2R7WA 2E87A 5KYUA 4ZLCA 2G62A 3NKDA 4C7OA 3EHMA 3DM5A 3E9VA 2BE5F 1ZHYA 4U5DE 5E33A 1BR4A 4G0HA 4OIRF 1S7ZA 2ZXRA 3JCUQ 3JYHA 1ZHZA 2KQ9A 3MLGA 1TWCA 5KYXB 1ZU5A 3EZIA 4M63A 2ZXWC 4OD4A 3K6BA 5L3VA 4BJ6C 4NY3A 1M57C 3K66A 3NDBB 3B9QA 4FX5A 3EQLF 3O55A 3K7DA 3DD7A 1M2OA 2OCCC 1Z6AA 4O7GA 2WB7A 3NRHA 2H7VC 3X2QC 3KKBA 3S0XA 3JSZA 3EGXA 1WGWA 3QZCA 2J9UA 1ZU4A 4OIOF 2CDQA 4JJFA 2J9WA 3ABKC 1JPJA 4I44A 4IRUA 4PJJA 2YZSA 3AQBA 1JPNA 4CSAC 1FMWA 1NU9C 4Q4ZF 2YEVA 2IXOA 2Q9AA 4HFFB 3EH1A 3OWTA 4JJGA 3ABMC 5EHHA 2Z15A 2EINC 2Y3HA 2M4EA 2V26A 4K0DA 3LS0A 4XWJA 3LLKA 3S27A 1D0XA 3DAFA 5B1BC 3VAYA 2W4MA 4CSAA 1D1AA 4E0IA 3LESA 3EG9B 1V54C 3E70C 3H65A 2WZLA 3WODF 3EGDA 3UR3C 2J7PA 2Y3DA 1OKKA 1Z3IX 1MMAA 3RH3A 2W45A 3PHF2 1M2VB 1SF8A 5T1DB 4Q7CA 4G7ZF 3N24A 3CSKA 2WVOA 2J46A 4JW1A 1Z23A 1Z5ZA 3GWLA 4AE4B 5KYWB 3OA1A 5KYYB 3CQZA 1LVKA 2DGJA 3U2LA 1PD1A 2IOQA 3UMKA 4G7OF 4ZLDA 1W2WA 4JCHA 3SZRA 2W9YA 4O6NA 4C3BA 3U5SA 2EIMC 2J9VA 5DS5A 2PFDA 3DMDA 2EIJC 2FGYA 1FFTC 1NG1A 2IYLD 3S28A 5F5HA 2CW0F 4J30B 1ST6A 4PK4A 2Y39A 4X0RA 3EPVA 3SP1A 3ZC4A 3Q6NA 3TK0A 2QY9A 2D5RB 2DYRC 2XXAA 3W8IA 4U5EE 3W2VA 2MWQA 3SEOA 4JZAA 2YHSA 3NYLA 4I1OB 3B0VC 1TR2A 3GODA 4CS8A 1OQCA 3ITFA 3F47A 3KL4A 4GYTA 2V3CC 2KNHA 1FFHA 3ASNC 3NYMA 4JVSA 3Q6MA 3ZIBA 1JRAA 3KH2A 3I4UA 4O6MA 4LERA 3ABLC 4BJ5C 5F5FA 1TWAA 1PCXA 1VYKA 4K7BA 3W4YA 3JRTA 4C7OB 3PMRA 4DBRA 4C3DA 2PX3A 4B6IA 2Q9CA 4U5GA 3B0UX 2NG1A 2R7UA 3EJNA 3LAYA 2A1DD 4RBNA 5D91A 2A6EF 4BJ5A 4BJ6A 2PF4E 4KI2A 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2L A;  4E0H A;  2HJ3 A;  1JR8 A;  3O55 A;  3R7C A;  3U2M A;  3U5S A;  1OQC A;  3W4Y A;  3GWN A;  3LLI A;  3TD7 A;  3MBG A;  4LDK A;  1JRA A;  3LLK A;  3GWL A;  3TK0 A;  4E0I A; 
#chains in the Genus database with same CATH topology
 2OKU A;  2XL6 A;  3QW0 A;  4H54 A;  4XEK A;  1WN0 A;  4E0H A;  3K33 A;  1N1C A;  4PJN A;  2AWC A;  4BEJ A;  2QE9 A;  3QW1 A;  4OIQ F;  2EPN A;  2YWA A;  4JC7 A;  5TJ5 E;  1Q0M A;  1MMG A;  2RD9 A;  4KC9 A;  3JSE O;  4DBQ A;  1NU7 D;  2IBF A;  2Q7R A;  2AWY A;  1VLS A;  3U8V A;  3G4Z A;  3UMH A;  2R7V A;  3M4B A;  3LLI A;  4JIO A;  1DOV A;  1OCR C;  1ZHW A;  2CGE A;  3DZA A;  4MW8 A;  1G5Z A;  4EBB A;  5A69 A;  3RF3 A;  4N06 A;  4U5C E;  3SXY A;  3OEO A;  2FFH A;  1OR3 A;  2M64 A;  3S29 A;  2XL4 A;  4RD9 A;  3LUT B;  2XS1 A;  2Y3G A;  3T4R A;  3EG9 A;  1LE4 A;  4MVR A;  2NUT B;  1QPU A;  2ETS A;  2G3K A;  1D0Z A;  1D0Y A;  1OW6 A;  3GEH A;  3T6J A;  3U8P A;  3U9M A;  2R7Q A;  2WZF A;  2XLE A;  2HJ3 A;  2EIK C;  4CS9 C;  1JR8 A;  4YT4 A;  2ICW G;  3HJC A;  3T6B A;  1BR1 A;  3AOU A;  3B29 A;  2OQM A;  4IJJ A;  4N6H A;  1EA8 A;  3TQO A;  3WHN A;  4YK5 A;  3I5Q A;  2VCB A;  5E3C A;  1H9T A;  4D4N A;  1LS1 A;  1MND A;  4HFK B;  1E83 A;  2A69 F;  2YL1 A;  3SXK A;  2PP4 A;  2Y69 C;  1M2V A;  3RVZ A;  5JVE A;  1QLE C;  1BR2 A;  1NBB A;  1F1M A;  2IM8 A;  3ZG1 A;  4JEA A;  4LDR A;  3ZSU A;  3AG3 C;  4U9E A;  4CDV A;  3POV A;  4Q5S F;  4KNV A;  1Z63 A;  1T9K A;  2XM4 A;  4CS9 A;  4MVZ A;  5B3S C;  3RKO F;  4BJ1 A;  5L0G A;  5DQZ A;  4DVY P;  3O39 A;  2VC9 A;  3B0P A;  1ZYR F;  2WVN A;  1TQG A;  2J8W A;  4XQ1 A;  1C03 A;  1IZM A;  2W4B A;  1OW8 A;  1NZE A;  2KYH A;  4XLP F;  3AG1 C;  4XTK A;  3SYN A;  3IQT A;  3EFO A;  2R7S A;  1FMV A;  4MVO A;  4NTB A;  1OR2 A;  1ORS C;  4OIP F;  4YWQ A;  2JD3 A;  3U2M A;  2OOC A;  2KJG A;  1QZX A;  3FAP B;  4G78 A;  3RQE A;  1RJ9 A;  4I1M A;  5K0I A;  3FXH A;  3V5Z A;  1T01 A;  2DYS C;  4PFP A;  1HMD A;  2GA0 A;  3B71 A;  3DE9 A;  1O87 A;  4N6C A;  2NUP B;  3J06 A;  1MNE A;  1I5N A;  3N2Z B;  3VM6 A;  4CDA A;  4DRH B;  4CIP A;  4QI0 A;  4AX2 A;  1YYX A;  3EHN A;  4E7S A;  5COF A;  2G3V A;  4F4B A;  1RKE A;  1ZZP A;  2VCA A;  4A4A A;  4IWB A;  1PV3 A;  4LAC B;  3HNK A;  4EBK A;  5JRA A;  1HW1 A;  2ZXP A;  4JTD B;  1T6U A;  2HUJ A;  3W2W A;  1MQV A;  3G50 A;  1NLX A;  3K1I C;  1VYI A;  4AK9 A;  1FNT c;  4IAR A;  2LK4 A;  3C63 A;  3O6X A;  5FCL A;  3MFN A;  4LDQ A;  2L81 A;  3LNR A;  4RDA A;  3ZQV A;  3A11 A;  3AJM A;  1PD0 A;  2HKV A;  3MYI A;  4R32 A;  4CS7 A;  3L34 A;  2IXM A;  4ULW A;  1L7C A;  1S05 A;  3IEE A;  3F46 A;  1H7I A;  5KYX A;  4BG0 A;  4PJL A;  3S84 A;  4FWV A;  1QKR A;  3I5P A;  3RFY A;  3VRC A;  4YT8 A;  3N0T A;  2BL2 A;  3Q7L A;  3ASO C;  3T9O A;  2X51 A;  1FTS A;  3M1C B;  4U5F E;  4PJM A;  2LP4 A;  2R7X A;  3K1I A;  4J7T A;  4CIH A;  4C3E A;  2VB6 A;  5CI9 A;  1G4U S;  4XLN F;  4BEM J;  1RCP A;  1VOM A;  1VLT A;  2PNO A;  2ZXO A;  3C18 A;  3GAN A;  2GFH A;  5DVW A;  4OIN F;  1YA7 O;  5KYU B;  2XXA B;  3UGP A;  4EWC A;  1NSG B;  3SNH A;  3C8G A;  5GPG B;  1RMV A;  4JE9 A;  3NMJ A;  2Q9B A;  3NKE A;  5DLJ A;  3TJ5 A;  3S90 A;  4ONS A;  4IAO A;  4JKV A;  1LIH A;  4KNW A;  4DOZ A;  1AVO B;  1QSP A;  5BUO A;  2KW3 C;  3KMI A;  2DB4 A;  3HLZ A;  3UMI A;  2KC3 A;  3MBG A;  3AG2 C;  4NC3 A;  5L0D A;  1GM5 A;  5HSW A;  2HSQ A;  3GM3 A;  5E3A A;  1SMY F;  3IQC A;  1TFO B;  2ASR A;  2O9X A;  4CX9 A;  3QMK A;  3V5X A;  1SR2 A;  2C04 A;  2PX0 A;  2YL3 A;  4L6R A;  3IHU A;  5T3W A;  1CPQ A;  2LIG A;  2WVQ A;  2I8B A;  1VMA A;  1KTM A;  4MVQ A;  2L6G A;  3JT1 A;  3FAJ A;  1OXK A;  3L1M A;  4U5B E;  5E2Q A;  3ECS A;  2P6V A;  3ZWI A;  4BJT A;  5IY5 C;  2EIL C;  4DRI B;  1V4A A;  2MYS A;  3IPM O;  5JSL A;  1TKN A;  4PFO A;  2XLD A;  2VAS A;  4HE8 D;  4YL0 A;  2R7R A;  1U6H A;  4Z9J A;  3AGT A;  3CEX A;  1L3P A;  4J7Y A;  4E7Z A;  1UG7 A;  5DQT A;  2ZPA A;  2NUT A;  2XS8 A;  2UUH A;  1AUE A;  1R5I D;  1A7D A;  3DXJ F;  1IW7 F;  3EGX B;  5EGY A;  4W8P A;  1A7E A;  3M4C A;  3UNG C;  4WAB A;  4WGZ A;  2R7O A;  5EK0 A;  3VYW A;  4FAP B;  4YT2 A;  5COM A;  2P1A A;  1DOW A;  1M56 C;  3EH2 A;  2WL8 A;  1YA9 A;  4MTF A;  1RKC A;  4MVU A;  5DS6 A;  4YJW A;  1J8Y F;  1E85 A;  2CCY A;  5L0H A;  4NTF A;  3NG1 A;  3FDQ A;  2J0W A;  2J0X A;  4JUR I;  3DAG A;  2ZD9 A;  3GM1 A;  1C02 A;  3RYL A;  4EBJ A;  2A0B A;  1G8X A;  2CNW D;  2GAQ A;  2NSG A;  2OG2 A;  4CBE A;  3SXZ A;  4UDV A;  2F22 A;  3FHD A;  1YAR O;  3LEV A;  4IAQ A;  4MQ9 F;  1T6Q A;  2HV6 A;  4YT5 A;  2Q4F A;  2HMQ A;  1XZP A;  3AGU A;  2CNW A;  1LPE A;  4W8K A;  1AEP A;  5D92 A;  4J32 B;  1MMN A;  4N4W A;  2Y3B A;  3HNL A;  4LLC A;  3EZH A;  5DS4 A;  2YVK A;  1T5O A;  4MW3 A;  2XSE A;  4JRZ A;  1TWG A;  2HS5 A;  4O6Y A;  2X0C A;  4AE4 A;  3K1H A;  1LKX A;  5KYW A;  5KYY A;  1UFB A;  3MX3 A;  3NMI A;  3NYJ A;  3S9O A;  3V7O A;  2P61 A;  3HTK C;  4JTA B;  3MYF A;  4LLE A;  2VH3 A;  2HV7 A;  4ER9 A;  2J7P D;  4KBL A;  1Q0D A;  3DJN B;  4I3M A;  3L0I A;  1V55 C;  1SZI A;  1WAT A;  5CIV A;  3QVY A;  1OKK D;  4ANJ A;  2XM0 A;  4HEA J;  2I15 A;  2B0J A;  4FES A;  2H7B A;  3X1O A;  5A6K A;  2YL7 A;  3KYI A;  3FVY A;  3DM9 B;  4U5H A;  2OJE D;  3EGD B;  2NUP A;  5L0F A;  1JMW A;  3LS1 A;  1SYQ A;  3UGO A;  3H2U A;  3DKA A;  1I4Y A;  1YZA A;  3U3B A;  5JP7 A;  1JOG A;  3TD7 A;  3BRJ A;  1QVX A;  1OCC C;  1OCO C;  1ZHX A;  2YL0 A;  2QTV A;  2A6H F;  4LDK A;  4XEF A;  4GEH A;  2R7T A;  2JX0 A;  1LM3 B;  3Q7G A;  2R03 A;  4MVM A;  4DVZ A;  2NSF A;  4WJ0 A;  1T6I A;  3DJU B;  3FOO A;  3A9C A;  3HNJ A;  3WG7 C;  4EUK B;  2H7O A;  1ZHT A;  1RXQ A;  4YN0 B;  1Q0F A;  5JS5 A;  1VTM P;  2YQY A;  2A68 F;  4P6I C;  4O79 A;  4Z9H A;  1TWH A;  3CAX A;  1KNY A;  4OD5 A;  2IXP A;  3CZ6 A;  2KGO A;  3R2P A;  2J45 A;  3BEH A;  1EI7 A;  4MND A;  1O5H A;  1VK5 A;  3R7C A;  1KU2 A;  3EFO B;  3ZQY A;  4JEB A;  1GGQ A;  3QTH A;  3PCV A;  5CI8 A;  2XRH A;  2YLD A;  1LI5 A;  2EPM X;  2Q3T A;  3GWN A;  5T3T A;  3ZVR A;  2C03 A;  3W8H A;  1D1C A;  4CS8 C;  1OCZ C;  1RJ9 B;  1J8M F;  1D1B A;  2HZ8 A;  4H4K C;  2LSE A;  5L3Q A;  3AG4 C;  4PR9 A;  4ULV A;  3AQC A;  5KYN A;  2L9J A;  1GS9 A;  2XL8 A;  4QDL A;  2P7V A;  1BBH A;  2WZG A;  2KSF A;  2IXN A;  3LJB A;  3RIP A;  5A6J A;  1I4Z A;  4A2N B;  2R05 A;  2R7W A;  2E87 A;  1H9G A;  5KYU A;  4ZLC A;  2G62 A;  3NKD A;  4C7O A;  1YAU O;  3EHM A;  3DM5 A;  2H8A A;  4PAC A;  3E9V A;  5BQI A;  3M15 A;  1ZW2 A;  2BE5 F;  1ZHY A;  3JZ0 A;  3JRM O;  5HV9 A;  4U5D E;  4NQF A;  2J9B A;  2AU5 A;  4XPY A;  5AGF A;  2LCH A;  2QNL A;  5E33 A;  1WWP A;  1BR4 A;  4G0H A;  4OIR F;  1S7Z A;  2RSE B;  2ZXR A;  3JCU Q;  2Q00 A;  3JYH A;  1ZHZ A;  1O3U A;  2KQ9 A;  2TMV P;  3DWW A;  3NMK A;  3MLG A;  1TWC A;  5KYX B;  2BC5 A;  1OW7 A;  1ZU5 A;  3EZI A;  4M63 A;  2GWW A;  3ZTZ A;  2ZXW C;  4OD4 A;  5JLI A;  3K6B A;  3VF0 A;  3US6 A;  5L3V A;  4BJ6 C;  5A6B D;  2UUI A;  4NY3 A;  1M57 C;  3K66 A;  3NDB B;  3B9Q A;  3DE8 A;  1A0B A;  1EKY A;  2DI3 A;  1K04 A;  4FX5 A;  5JUA A;  3EQL F;  3O55 A;  3K7D A;  5COG A;  3TJ6 A;  2YRF A;  3DD7 A;  1M2O A;  2OCC C;  4MTO A;  1Z6A A;  4O7G A;  2WB7 A;  4AL1 A;  3C8G B;  3NRH A;  2H7V C;  3X2Q C;  2LFD A;  1E2X A;  3HNI A;  3JYY A;  4EIY A;  3KKB A;  3S0X A;  5FZT A;  3IQ5 A;  5BQH A;  3LNM B;  3JSZ A;  3EGX A;  4P9T A;  4CJG A;  1OXB A;  1YVI A;  3RQF A;  1WGW A;  3QZC A;  1ORJ A;  1ZU4 A;  2J9U A;  4OIO F;  2QUP A;  2OU6 A;  4MVS A;  1XZQ A;  4G7H F;  1HE9 A;  1TFK B;  2CDQ A;  4JJF A;  2J9W A;  256B A;  3T6G B;  3ABK C;  3C7J A;  1JPJ A;  3RQG A;  3U0C A;  4I44 A;  4IRU A;  4PJJ A;  2YZS A;  2GDC A;  4YL3 A;  5A6B A;  2XLH A;  2MHR A;  1BDJ B;  2L6F A;  3AQB A;  4P9F A;  1JPN A;  1V74 B;  2YKZ A;  4CJO A;  4CSA C;  1FMW A;  1CGN A;  1NU9 C;  2P0N A;  2LFF A;  3GOR A;  2EPO A;  4Q4Z F;  1C17 M;  2IXO A;  2R9R B;  2YEV A;  2Q9A A;  3GEE A;  3QVZ A;  4HFF B;  3EH1 A;  3OWT A;  4JJG A;  3ABM C;  1VB5 A;  5EHH A;  2Z15 A;  2EIN C;  4IB4 A;  2B0H A;  2Y3H A;  2M4E A;  1H6G A;  3V5Y A;  1YYJ A;  1M6T A;  2V26 A;  4K0D A;  1HY5 A;  1JAF A;  3LS0 A;  4XWJ A;  1Q0K A;  3LLK A;  3KPH A;  4K1O A;  3S27 A;  1D0X A;  3DAF A;  5B1B C;  3VAY A;  2W4M A;  1XWJ A;  4CSA A;  1CGO A;  1D1A A;  3C8Z A;  4E0I A;  3LES A;  3EG9 B;  3L8J A;  4AL0 A;  1U0B B;  4GQH A;  1BZ4 A;  1V54 C;  1YLM A;  3E70 C;  4U9D A;  3H65 A;  2AP3 A;  2OEV A;  4EHP A;  2PBE A;  2WZL A;  1E86 A;  3WOD F;  3EGD A;  4NCQ A;  3UR3 C;  2J7P A;  5A6A A;  4IGG A;  2Y3D A;  2XLV A;  4DJ9 A;  1YDI A;  3FMS A;  4EKW A;  2XLM A;  1OKK A;  1Z3I X;  1MMA A;  3RH3 A;  2EPK X;  2W45 A;  3PHF 2;  1M2V B;  1SF8 A;  5T1D B;  4E17 A;  1E84 A;  3PDM P;  1HE1 A;  4Q7C A;  4G7Z F;  3N24 A;  3CSK A;  1ORY A;  2WVO A;  1LI7 A;  2J46 A;  4JW1 A;  1LS4 A;  2EPL X;  3ZDL A;  1Y6D A;  1Z23 A;  1YJG A;  1Z5Z A;  3GWL A;  4AE4 B;  5KYW B;  3OA1 A;  5KYY B;  3TUL A;  3CQZ A;  1CGM E;  1LVK A;  2LQG A;  2DGJ A;  1PD1 A;  2IOQ A;  3U2L A;  3UMK A;  4DXW A;  3DI5 A;  2NPU A;  4JTC B;  4G7O F;  4ZLD A;  1GQA A;  3TOL A;  3FOP A;  5B3I A;  1W2W A;  2LD6 A;  4JCH A;  4NTA A;  1QQ3 A;  3SZR A;  4DRJ B;  5AC5 A;  2W9Y A;  2KK1 A;  4O6N A;  3M79 A;  3L8I A;  1APC A;  2J9V A;  2EIM C;  3GM2 A;  5B1A C;  3U5S A;  4C3B A;  5DS5 A;  4QI2 A;  2JPU A;  2PFD A;  3DMD A;  2EIJ C;  2FGY A;  1FFT C;  1NG1 A;  1Y4C A;  4MS2 A;  2IYL D;  3S28 A;  1WOL A;  1A7V A;  5F5H A;  2CW0 F;  1A41 A;  1ST6 A;  4J30 B;  2Y39 A;  1ZW3 A;  4PK4 A;  1YZC A;  2VCC A;  4X0R A;  3U3F A;  2D4U A;  3EPV A;  3GEI A;  3TOM A;  3SP1 A;  3ZC4 A;  2FAP B;  3Q6N A;  2R02 A;  2QY9 A;  2D5R B;  2YLI A;  2DYR C;  4MTG A;  3TK0 A;  4Z9I A;  1RKE B;  3U9J A;  1HW2 A;  2XXA A;  5L0I A;  3SXM A;  3W8I A;  4U5E E;  1G4W R;  3W2V A;  2L6H A;  1Q0G A;  4XPX A;  2MWQ A;  3SEO A;  4JZA A;  2YHS A;  3NYL A;  4I1O B;  2HSB A;  3B0V C;  1TR2 A;  3GOD A;  3WAQ A;  4CS8 A;  3RVY A;  2R25 A;  3IQ6 A;  4JCZ A;  1K40 A;  1U89 A;  4XPW A;  1OQC A;  2CYD A;  2QLA A;  3F47 A;  3ITF A;  3KL4 A;  4GYT A;  2V3C C;  2KNH A;  1NFO A;  3LEO A;  5L0C A;  3KYJ A;  1FFH A;  3ASN C;  2XLO A;  3NYM A;  4JVS A;  4WGY A;  3ZTM A;  4BPM A;  3Q6M A;  4XEV A;  3HKK A;  3ZIB A;  1JRA A;  2L7A A;  3KH2 A;  3I4U A;  4O6M A;  1R4T A;  4LER A;  1WTY A;  3ABL C;  4BJ5 C;  5F5F A;  2YLG A;  1TWA A;  1PCX A;  3C8G D;  1VYK A;  3H2V A;  2HMZ A;  4K7B A;  3W4Y A;  3ATP A;  3JRT A;  1WAS A;  2OJQ A;  5JT4 A;  4C7O B;  3PMR A;  5AC4 A;  4D4X A;  2A0U A;  3G4X A;  4DBR A;  5L0J A;  2AVK A;  1FR0 A;  4C3D A;  3C62 A;  3O10 A;  2PX3 A;  4B6I A;  2Q9C A;  4U5G A;  3B0U X;  2NG1 A;  2R7U A;  2HFI A;  1K05 A;  1CPR A;  2XLW A;  3EJN A;  3LAY A;  2A1D D;  4RBN A;  5D91 A;  5F28 E;  2A6E F;  1Z7Q c;  3JTL O;  4BJ5 A;  4CDY A;  3RW0 A;  2HJM A;  4YL1 A;  4E18 A;  4BJ6 A;  1EQ1 A;  2PF4 E;  1B68 A;  1NFN A;  1HMO A;  5BQG A;  2OEX A;  1ZVZ A;  4KI2 A;  1LE2 A;  1MMD A;  1FAP B; 
#chains in the Genus database with same CATH homology
 4E0H A;  3K33 A;  1N1C A;  4PJN A;  4BEJ A;  4OIQ F;  1MMG A;  4KC9 A;  4DBQ A;  1NU7 D;  3UMH A;  2R7V A;  3LLI A;  1OCR C;  1ZHW A;  2CGE A;  3DZA A;  4EBB A;  4N06 A;  4U5C E;  3OEO A;  2FFH A;  3S29 A;  2XL4 A;  4RD9 A;  2Y3G A;  3T4R A;  3EG9 A;  2NUT B;  3T6J A;  2G3K A;  1D0Z A;  1D0Y A;  2R7Q A;  2WZF A;  2HJ3 A;  2EIK C;  4CS9 C;  1JR8 A;  4YT4 A;  3HJC A;  3T6B A;  1BR1 A;  4IJJ A;  3I5Q A;  5E3C A;  1LS1 A;  1MND A;  4HFK B;  2A69 F;  2PP4 A;  2Y69 C;  1M2V A;  1QLE C;  1BR2 A;  3ZG1 A;  3ZSU A;  3AG3 C;  3POV A;  4Q5S F;  4KNV A;  1Z63 A;  4CS9 A;  5B3S C;  3RKO F;  4BJ1 A;  5DQZ A;  4DVY P;  3O39 A;  3B0P A;  1ZYR F;  2WVN A;  1IZM A;  2W4B A;  1NZE A;  4XLP F;  3AG1 C;  4XTK A;  3SYN A;  2R7S A;  3EFO A;  1FMV A;  4OIP F;  4YWQ A;  2JD3 A;  3U2M A;  2KJG A;  1QZX A;  1RJ9 A;  4I1M A;  2DYS C;  4PFP A;  1O87 A;  2NUP B;  1MNE A;  3N2Z B;  4QI0 A;  4AX2 A;  3EHN A;  4E7S A;  2G3V A;  4F4B A;  4IWB A;  4LAC B;  2ZXP A;  3W2W A;  3K1I C;  1VYI A;  4AK9 A;  3O6X A;  5FCL A;  2L81 A;  3LNR A;  4RDA A;  1PD0 A;  4CS7 A;  3L34 A;  2IXM A;  4ULW A;  3IEE A;  3F46 A;  5KYX A;  4BG0 A;  4PJL A;  4FWV A;  3I5P A;  3RFY A;  4YT8 A;  3N0T A;  3Q7L A;  3ASO C;  2X51 A;  1FTS A;  3M1C B;  4U5F E;  4PJM A;  2R7X A;  4CIH A;  4C3E A;  2VB6 A;  5CI9 A;  4XLN F;  2ZXO A;  1VOM A;  5DVW A;  3GAN A;  2GFH A;  4OIN F;  5KYU B;  2XXA B;  3UGP A;  4EWC A;  3SNH A;  2Q9B A;  3NKE A;  5DLJ A;  4IAO A;  4KNW A;  4DOZ A;  5BUO A;  2KW3 C;  3KMI A;  3HLZ A;  3UMI A;  3MBG A;  3AG2 C;  5HSW A;  5E3A A;  1SMY F;  2O9X A;  3QMK A;  2C04 A;  2PX0 A;  5T3W A;  2WVQ A;  2I8B A;  1VMA A;  3JT1 A;  3FAJ A;  4U5B E;  5E2Q A;  3ECS A;  2P6V A;  4BJT A;  5IY5 C;  2EIL C;  2MYS A;  1TKN A;  4PFO A;  2VAS A;  4HE8 D;  2R7R A;  4E7Z A;  5DQT A;  2ZPA A;  2NUT A;  3DXJ F;  1IW7 F;  3EGX B;  5EGY A;  4G7H F;  4QI2 A;  3UNG C;  3VYW A;  2R7O A;  4YT2 A;  3EH2 A;  1M56 C;  2WL8 A;  5DS6 A;  4YJW A;  1J8Y F;  3NG1 A;  3FDQ A;  2J0W A;  2J0X A;  4JUR I;  3DAG A;  3RYL A;  2OG2 A;  1G8X A;  2CNW D;  4CBE A;  3FHD A;  3LEV A;  4MQ9 F;  2HV6 A;  4YT5 A;  4W8K A;  2CNW A;  5D92 A;  4J32 B;  1MMN A;  2Y3B A;  4LLC A;  3EZH A;  5DS4 A;  2XSE A;  1TWG A;  4AE4 A;  4O6Y A;  5KYW A;  3K1H A;  1LKX A;  5KYY A;  3MX3 A;  3NYJ A;  3V7O A;  3HTK C;  4LLE A;  2VH3 A;  2HV7 A;  2J7P D;  4KBL A;  3DJN B;  4I3M A;  3L0I A;  1V55 C;  1SZI A;  1OKK D;  4ANJ A;  4HEA J;  2B0J A;  4FES A;  2H7B A;  3X1O A;  3FVY A;  3DM9 B;  4U5H A;  3EGD B;  2NUP A;  3LS1 A;  3UGO A;  3TD7 A;  5B1A C;  1OCC C;  1OCO C;  1ZHX A;  2R7T A;  2QTV A;  2A6H F;  4LDK A;  4GEH A;  3Q7G A;  4DVZ A;  4WJ0 A;  3DJU B;  3WG7 C;  2H7O A;  1ZHT A;  4YN0 B;  2A68 F;  4P6I C;  4O79 A;  1TWH A;  4OD5 A;  2IXP A;  3CZ6 A;  2KGO A;  2J45 A;  4MND A;  1O5H A;  1VK5 A;  3R7C A;  1KU2 A;  3EFO B;  5CI8 A;  2XRH A;  2Q3T A;  3GWN A;  5T3T A;  3ZVR A;  2C03 A;  3W8H A;  1D1C A;  4CS8 C;  1OCZ C;  1RJ9 B;  1J8M F;  1D1B A;  4H4K C;  2LSE A;  5L3Q A;  3AG4 C;  3AQC A;  5KYN A;  2L9J A;  4QDL A;  2P7V A;  2WZG A;  3RIP A;  2IXN A;  3LJB A;  4A2N B;  2R7W A;  2E87 A;  5KYU A;  4ZLC A;  2G62 A;  3NKD A;  4C7O A;  3EHM A;  3DM5 A;  3E9V A;  2BE5 F;  1ZHY A;  4U5D E;  5E33 A;  1BR4 A;  4G0H A;  4OIR F;  1S7Z A;  2ZXR A;  3JCU Q;  3JYH A;  1ZHZ A;  2KQ9 A;  3MLG A;  1TWC A;  5KYX B;  1ZU5 A;  3EZI A;  4M63 A;  2ZXW C;  4OD4 A;  3K6B A;  5L3V A;  4BJ6 C;  4NY3 A;  1M57 C;  3K66 A;  3NDB B;  3B9Q A;  4FX5 A;  3EQL F;  3O55 A;  3K7D A;  3DD7 A;  1M2O A;  2OCC C;  1Z6A A;  4O7G A;  2WB7 A;  3NRH A;  2H7V C;  3X2Q C;  3KKB A;  3S0X A;  3JSZ A;  3EGX A;  1WGW A;  3QZC A;  2J9U A;  1ZU4 A;  4OIO F;  2CDQ A;  4JJF A;  2J9W A;  3ABK C;  1JPJ A;  4I44 A;  4IRU A;  4PJJ A;  2YZS A;  3AQB A;  1JPN A;  4CSA C;  1FMW A;  1NU9 C;  4Q4Z F;  2YEV A;  2IXO A;  2Q9A A;  4HFF B;  3EH1 A;  3OWT A;  4JJG A;  3ABM C;  5EHH A;  2Z15 A;  2EIN C;  2Y3H A;  2M4E A;  2V26 A;  4K0D A;  3LS0 A;  4XWJ A;  3LLK A;  3S27 A;  1D0X A;  3DAF A;  5B1B C;  3VAY A;  2W4M A;  4CSA A;  1D1A A;  4E0I A;  3LES A;  3EG9 B;  1V54 C;  3E70 C;  3H65 A;  2WZL A;  3WOD F;  3EGD A;  3UR3 C;  2J7P A;  2Y3D A;  1OKK A;  1Z3I X;  1MMA A;  3RH3 A;  2W45 A;  3PHF 2;  1M2V B;  1SF8 A;  5T1D B;  4Q7C A;  4G7Z F;  3N24 A;  3CSK A;  2WVO A;  2J46 A;  4JW1 A;  1Z23 A;  1Z5Z A;  3GWL A;  4AE4 B;  5KYW B;  3OA1 A;  5KYY B;  3CQZ A;  1LVK A;  2DGJ A;  3U2L A;  1PD1 A;  2IOQ A;  3UMK A;  4G7O F;  4ZLD A;  1W2W A;  4JCH A;  3SZR A;  2W9Y A;  4O6N A;  4C3B A;  3U5S A;  2EIM C;  2J9V A;  5DS5 A;  2PFD A;  3DMD A;  2EIJ C;  2FGY A;  1FFT C;  1NG1 A;  2IYL D;  3S28 A;  5F5H A;  2CW0 F;  4J30 B;  1ST6 A;  4PK4 A;  2Y39 A;  4X0R A;  3EPV A;  3SP1 A;  3ZC4 A;  3Q6N A;  3TK0 A;  2QY9 A;  2D5R B;  2DYR C;  2XXA A;  3W8I A;  4U5E E;  3W2V A;  2MWQ A;  3SEO A;  4JZA A;  2YHS A;  3NYL A;  4I1O B;  3B0V C;  1TR2 A;  3GOD A;  4CS8 A;  1OQC A;  3ITF A;  3F47 A;  3KL4 A;  4GYT A;  2V3C C;  2KNH A;  1FFH A;  3ASN C;  3NYM A;  4JVS A;  3Q6M A;  3ZIB A;  1JRA A;  3KH2 A;  3I4U A;  4O6M A;  4LER A;  3ABL C;  4BJ5 C;  5F5F A;  1TWA A;  1PCX A;  1VYK A;  4K7B A;  3W4Y A;  3JRT A;  4C7O B;  3PMR A;  4DBR A;  4C3D A;  2PX3 A;  4B6I A;  2Q9C A;  4U5G A;  3B0U X;  2NG1 A;  2R7U A;  3EJN A;  3LAY A;  2A1D D;  4RBN A;  5D91 A;  2A6E F;  4BJ5 A;  4BJ6 A;  2PF4 E;  4KI2 A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...