3LLKA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
241
Chain Sequence
b'LADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfhydryl oxidase 1
publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 84
structure length 241
sequence length 250
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3llkA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3llkA01
3TK0A 1JRAA 3GWLA 4E0HA 3U2LA 4LDKA 3LLIA 1OQCA 4E0IA 3GWNA 3U5SA 2HJ3A 3R7CA 3O55A 3W4YA 1JR8A 3LLKA 3U2MA 3MBGA 3TD7A
chains in the Genus database with same CATH superfamily
2W9YA 2Y69C 1YAUO 3DXJF 1VOMA 1BR4A 2NUPB 4JKVA 5BQGA 2ZXOA 3ITFA 5T3TA 2HS5A 5DVWA 3HNJA 1A7DA 1WASA 2VCCA 3QVYA 5E3CA 1V54C 2Y3DA 3WAQA 1ZU4A 3HNKA 1Q0DA 1UG7A 4JCZA 3W2WA 4C3DA 5L0DA 3EPVA 3X1OA 2R7UA 2R7QA 1BDJB 5F28E 4D4XA 5AC4A 5DQTA 5L0FA 1LE2A 2XM4A 4CX9A 5KYYA 5DS5A 2DYRC 4X0RA 3AG1C 1S05A 1I4YA 2YLDA 3TJ5A 5KYYB 1HY5A 2YEVA 3ZDLA 4DVZA 2A0UA 3FOOA 3W4YA 2OEXA 3U2MA 3CZ6A 3O6XA 4RDAA 4YL1A 1RCPA 1D1CA 5KYUB 3A9CA 5JRAA 2H7BA 2YQYA 1I4ZA 3O39A 1VLTA 5CI8A 1Q0KA 2PX3A 1JRAA 3N24A 5KYWA 1V55C 2GA0A 4N06A 2A69F 3EG9B 4PJNA 4I1OB 1OKKA 1CGME 1VLSA 2LFDA 4E17A 3GM3A 2VCAA 2LFFA 4Z9HA 1H9GA 2A1DD 3RQFA 1TWCA 2R7TA 4NTBA 4KI2A 4MVRA 1ZHYA 2YL1A 1FMWA 1BR2A 2E87A 2XLVA 4U9DA 4H4KC 3C8GD 4W8PA 2UUHA 4XTKA 5A6JA 1MNEA 2CDQA 1K04A 1Z5ZA 3WG7C 3MYIA 3N0TA 3UMHA 2JPUA 4W8KA 4BJTA 2FFHA 3TD7A 4MW3A 1H6GA 3V5XA 4QI0A 2JX0A 2XRHA 3B71A 3I5QA 3SYNA 2R03A 1WWPA 4AK9A 2XLOA 1Z7Qc 3UGPA 2KQ9A 4XEKA 4J7TA 3LNRA 4WJ0A 3UNGC 3ZVRA 4HEAJ 2R7VA 1CGNA 4PFOA 3VF0A 4A2NB 2QUPA 3B0PA 4JJGA 1ZZPA 4EBJA 1HMDA 2IOQA 5KYNA 2OOCA 2DYSC 3RVZA 1E85A 4EUKB 5K0IA 1YARO 3F47A 1O3UA 3JSEO 5HSWA 1CPQA 4YT5A 3W2VA 2FAPB 1V4AA 4JE9A 2R25A 4NQFA 1C03A 1OXBA 3E70C 3AOUA 2Y3HA 2H8AA 4CS8C 3EHMA 2EIKC 3QW1A 3R7CA 1MQVA 4WGYA 3K66A 4JW1A 3M4CA 2XLHA 4N6HA 4CDYA 4JTCB 4DRJB 5DS6A 3NMIA 3TK0A 4J30B 2X51A 2EPLX 1R4TA 2J7PA 2NPUA 4XQ1A 4IGGA 2G3KA 3K33A 2OU6A 3E9VA 4ULVA 2WB7A 3FVYA 4G78A 1KTMA 1L3PA 3L8IA 2EINC 5JUAA 2A6HF 2CYDA 4MVMA 3VRCA 1NZEA 1GS9A 3OEOA 4P9TA 1YLMA 2ZXWC 2R9RB 5A6KA 3C8GB 5L0JA 5EGYA 1WOLA 3CSKA 4LERA 3SXYA 2GFHA 2GAQA 3RFYA 3ASNC 1A0BA 3O55A 4BPMA 4Q4ZF 2XSEA 2B0HA 1T6QA 3JT1A 1JPJA 4FWVA 4AL0A 4I44A 2PP4A 4XPWA 1ZHTA 1XWJA 2L9JA 3A11A 2VH3A 3OWTA 3PCVA 4O6MA 3DJNB 4IWBA 2KK1A 3ZIBA 1RMVA 4YK5A 1U0BB 4E0HA 1OCOC 2AP3A 1DOWA 1XZPA 2HSBA 3FXHA 3RVYA 1VMAA 1LI5A 3IPMO 1K05A 1LKXA 4JTDB 1FTSA 3JYHA 4PFPA 2WL8A 3TULA 4EKWA 5FCLA 2J9WA 1ZHWA 1N1CA 2NUTB 2LSEA 2YL0A 3HNIA 3KYIA 4MVOA 4XLNF 1H9TA 4N4WA 1W2WA 2H7VC 1ZVZA 2I8BA 3LNMB 2IXMA 3DAFA 5COGA 1KU2A 3K6BA 3S90A 3EQLF 3HLZA 4WGZA 2LCHA 3T6GB 1HE9A 3NDBB 4HE8D 1Z63A 1Q0GA 1LPEA 3JZ0A 3EZHA 1MMNA 2I15A 3IQCA 4K7BA 3RYLA 4YT8A 4C7OB 2PX0A 3JYYA 1TQGA 3L8JA 2NSGA 4XLPF 3C62A 2EIJC 4JEBA 4K1OA 4O7GA 2RD9A 1UFBA 4HFFB 4QI2A 2LQGA 4J32B 2M4EA 1LE4A 4LDRA 4XPYA 3K1HA 2BE5F 1YJGA 3OA1A 1FMVA 3ZSUA 3V7OA 2OQMA 4ER9A 5AGFA 4OINF 4EIYA 2PBEA 1E86A 1MNDA 4LACB 4XWJA 2EPOA 3GEEA 4GEHA 4AE4A 3DE8A 4E7SA 3U5SA 2M64A 3K1IA 3QZCA 5EK0A 2L6HA 3C63A 3PMRA 4IRUA 2MYSA 2LP4A 1LIHA 1VYIA 1EA8A 4YJWA 3T4RA 4LLCA 3DZAA 3VYWA 4P6IC 2WZFA 2CGEA 4NC3A 4G7ZF 5L0IA 4BEJA 3FHDA 1LS4A 3H65A 3U8PA 2O9XA 3B9QA 2P61A 3DJUB 3EJNA 2DI3A 4O6YA 1CPRA 3U9JA 3FDQA 3AGUA 5COMA 3TOMA 3NKEA 5KYWB 3TJ6A 2KNHA 5TJ5E 2HJMA 2V26A 2J7PD 2V3CC 2W4MA 2Y3BA 4YN0B 1MMGA 3KL4A 5F5FA 2H7OA 4IB4A 4WABA 1GM5A 2ASRA 5E2QA 1E84A 4U5HA 3DI5A 3IQ6A 1M2OA 1BBHA 2Z15A 1PCXA 2R7XA 3M1CB 1D1BA 5JSLA 4BJ6A 3NRHA 3GEIA 1RJ9A 4YT2A 3U9MA 5JT4A 1QSPA 1PD1A 1ORJA 1TWHA 3T6JA 1YDIA 1YZCA 2WVQA 4KNWA 4M63A 3I5PA 2W4BA 3GORA 3LS1A 2HMZA 3BRJA 4PJLA 3RH3A 2Y3GA 3ZQYA 4CDAA 4E18A 2Q3TA 2ZD9A 4LDQA 5HV9A 2KJGA 3T6BA 2QTVA 2MHRA 2WVOA 5B1AC 1NSGB 2XLEA 4C3EA 2G62A 4IARA 3U2LA 4F4BA 3VAYA 1OW7A 1E83A 1U89A 4J7YA 3KYJA 1EI7A 2AWYA 1TWGA 4PACA 3B29A 3MFNA 1NFOA 1VK5A 3M79A 1E2XA 1VB5A 4JTAB 3SZRA 5IY5C 2KGOA 1AEPA 2DB4A 3IQTA 1OQCA 4JURI 1TFOB 1D0XA 1APCA 1EKYA 3L1MA 2R7SA 3ZWIA 2XL8A 3S29A 5JP7A 1OR3A 2IYLD 3LJBA 2J9UA 2EILC 3W8HA 4CIHA 1YYXA 3DMDA 4Z9JA 3X2QC 1NU7D 4U5CE 4DVYP 3GM2A 3ZTZA 5D91A 1J8MF 3S9OA 5B3SC 1ZW3A 3EH1A 1BR1A 1WN0A 3AG3C 1LVKA 2XLWA 4CBEA 3H2VA 4RBNA 2R7RA 1RKEA 3U8VA 1RXQA 3PHF2 1OCZC 2HUJA 3ZQVA 2XXAA 2OKUA 1FFTC 2IM8A 1Z23A 3GEHA 3SEOA 4BJ5A 3Q6NA 1M2VA 2HV7A 2L7AA 4I3MA 3TQOA 1JMWA 2J9BA 1O87A 4ANJA 1Z3IX 2YWAA 1NG1A 1Q0MA 5KYXA 2J9VA 2YL7A 1HW1A 4IAOA 2W45A 3CEXA 5DQZA 4BJ1A 5JS5A 3RQEA 4UDVA 3MBGA 1FR0A 2VCBA 2NSFA 3EFOA 3Q6MA 3QMKA 5E33A 4YWQA 2OJED 1DOVA 2EIMC 4U9EA 2XLDA 3F46A 3VM6A 2C04A 1LM3B 2A6EF 4MNDA 4CDVA 4MW8A 5F5HA 1GGQA 1YYJA 1A41A 3K1IC 3NYMA 3AJMA 1R5ID 4U5EE 4YL0A 1WTYA 2YRFA 2J45A 4Q5SF 1M56C 3Q7LA 4GYTA 3EGXA 1OKKD 1ORSC 3EGXB 1QQ3A 2KSFA 3SNHA 5EHHA 2IXOA 1NFNA 2P1AA 5GPGB 4C3BA 3M15A 4CS9A 3GWNA 4ZLCA 3N2ZB 4D4NA 3S84A 1F1MA 1QVXA 5E3AA 4CS7A 2WZGA 2OG2A 1M57C 2GWWA 2J0WA 3CQZA 3JRMO 5BQIA 4JEAA 3KPHA 4DRHB 4KC9A 3NMJA 2IXPA 3ZC4A 2OCCC 1ZHXA 3C7JA 3US6A 1D0YA 4OIPF 3QVZA 3GWLA 3ZTMA 4MTFA 3MX3A 4YL3A 1MMDA 1FFHA 4LLEA 1G4US 2Q00A 3ATPA 5FZTA 4BJ6C 3PDMP 4CSAA 3KH2A 4G0HA 2YLIA 5T3WA 3J06A 2QNLA 1WGWA 3NMKA 1J8YF 4JJFA 1PD0A 3RW0A 3JTLO 1T01A 3RQGA 2HJ3A 5A6AA 1SF8A 3S0XA 1C02A 3CAXA 4AE4B 1OCRC 2IBFA 2OJQA 5B1BC 2IXNA 1YA7O 2TMVP 2A68F 4FAPB 1RKCA 5L3VA 4MTOA 1QPUA 4U5DE 3S28A 1YZAA 2NUPA 2WZLA 3ABMC 3B0VC 1SMYF 2YKZA 3AQCA 1IZMA 2B0JA 2XL6A 4MVSA 4N6CA 1G4WR 5L3QA 3DWWA 1O5HA 3JSZA 4PJMA 2QY9A 3JRTA 4P9FA 2CNWA 3U0CA 3SXKA 3DE9A 2HV6A 4PR9A 3SXZA 2YL3A 4XEVA 3RIPA 4LDKA 4BEMJ 3ABKC 5AC5A 2PNOA 4DBRA 1JPNA 3HKKA 1B68A 1Y6DA 1MMAA 1OW8A 2L6FA 2PF4E 2QLAA 3C18A 4XEFA 3G4ZA 4B6IA 3DAGA 5L0CA 3G4XA 1GQAA 2J46A 1SYQA 2J0XA 3C8ZA 1OW6A 3GANA 3IQ5A 3Q7GA 4FESA 1KNYA 1SR2A 2HFIA 1L7CA 2CCYA 5KYUA 2J8WA 3HTKC 2L6GA 1JOGA 2EPMX 1OR2A 1T5OA 1T9KA 1A7EA 3BEHA 1RJ9B 2R05A 3KKBA 3NG1A 1EQ1A 4BJ5C 2HZ8A 1ZU5A 1JAFA 3EG9A 4DRIB 3ECSA 4O79A 3M4BA 4QDLA 5A6BA 4DJ9A 3LS0A 2RSEB 4HFKB 1BZ4A 2VB6A 256BA 2VASA 1I5NA 3AQBA 2AU5A 3FMSA 2D4UA 3L34A 4O6NA 3UMIA 4AX2A 3I4UA 2R02A 2KYHA 4JZAA 3UR3C 1CGOA 3V5ZA 3EGDA 1FAPB 2XS8A 2DGJA 5JLIA 3QTHA 2EPNA 2QE9A 2YVKA 3EGDB 3NYJA 3LLIA 1ZW2A 3ASOC 4MVZA 2YHSA 4MTGA 3LEOA 4KNVA 3KMIA 4EHPA 2XL4A 2Q9CA 4MVUA 2P7VA 2HKVA 4MVQA 4JRZA 4E0IA 3V5YA 2ETSA 4G7OF 4EWCA 3POVA 1M6TA 2UUIA 3EZIA 2XLMA 4YT4A 3DD7A 2NG1A 4JC7A 1Q0FA 2BC5A 4Q7CA 3ABLC 3AG2C 2Q7RA 5A69A 1QLEC 3DM9B 1U6HA 5L0HA 2P0NA 3IEEA 4JIOA 4L6RA 2HSQA 4CS9C 2ICWG 2Y39A 3EHNA 2VC9A 1D1AA 4PK4A 3MLGA 1QKRA 4DBQA 3U3BA 2HMQA 4AL1A 2YZSA 4IAQA 4I1MA 3RKOF 2AWCA 1Y4CA 3WHNA 1A7VA 5DS4A 5BUOA 3SXMA 1RKEB 1TWAA 1NU9C 4CJOA 4CIPA 4ONSA 2WVNA 1WATA 2XXAB 1T6IA 2R7OA 4RD9A 4DOZA 1YA9A 1AVOB 3HNLA 5D92A 3LESA 1M2VB 1T6UA 1OCCC 1K40A 3DM5A 4CSAC 5KYXB 2JD3A 3LLKA 4IJJA 1FNTc 4PJJA 5BQHA 1TKNA 4G7HF 4ZLDA 2GDCA 4MS2A 1XZQA 3SP1A 3WODF 3DKAA 2C03A 5L0GA 1C17M 1D0ZA 1Z6AA 3EFOB 4U5GA 2EPKX 3S27A 4OIQF 3LUTB 4EBKA 1PV3A 2F22A 2PFDA 2CW0F 5JVEA 1YVIA 3LAYA 2G3VA 1TR2A 4E7ZA 2XS1A 3B0UX 2D5RB 2LD6A 2XM0A 2ZXPA 2CNWD 3UMKA 2Q4FA 3FAPB 4BG0A 4U5FE 3C8GA 3H2UA 1V74B 4R32A 3UGOA 2P6VA 2KW3C 4OD4A 2R7WA 4NTAA 5CI9A 4A4AA 1OXKA 1TFKB 3FOPA 3U3FA 4FX5A 3FAJA 1HW2A 1ST6A 3G50A 3NKDA 4DXWA 3EH2A 3RF3A 4Z9IA 1AUEA 2ZPAA 4JCHA 3TOLA 5CIVA 5COFA 3ZG1A 2Q9AA 3R2PA 4XPXA 3HJCA 3O10A 1G8XA 2BL2A 1IW7F 1NLXA 3GODA 4CS8A 2LIGA 1LI7A 3NYLA 2AVKA 1VYKA 3IHUA 2FGYA 4CJGA 5A6BD 2OEVA 2X0CA 4H54A 4OIOF 4NTFA 2NUTA 3GM1A 4NCQA 2ZXRA 3QW0A 2A0BA 4OD5A 3W8IA 1SZIA 1HMOA 1ZHZA 2LK4A 1G5ZA 2MWQA 3AGTA 1S7ZA 1ZYRF 1VTMP 1LS1A 2KC3A 5DLJA 4GQHA 1ORYA 2Q9BA 3K7DA 4OIRF 1QZXA 3T9OA 4C7OA 1H7IA 3L0IA 3MYFA 4NY3A 4EBBA 4MQ9F 3AG4C 4K0DA 1JR8A 4KBLA 1HE1A 1NBBA 5T1DB 4ULWA 2YLGA 3LEVA 2L81A 3JCUQ 5B3IA 4U5BE 4JVSA
chains in the Genus database with same CATH topology
2W9YA 2Y69C 3DXJF 1VOMA 1BR4A 2NUPB 2ZXOA 3ITFA 5T3TA 5DVWA 5E3CA 1V54C 2Y3DA 1ZU4A 2R7UA 3W2WA 4C3DA 3EPVA 3X1OA 2R7QA 5DQTA 5DS5A 5KYYA 2DYRC 4X0RA 3AG1C 5KYYB 2YEVA 4DVZA 3W4YA 3U2MA 3CZ6A 3O6XA 4RDAA 1D1CA 5KYUB 2H7BA 3O39A 5CI8A 2PX3A 1JRAA 3N24A 5KYWA 1V55C 4N06A 2A69F 3EG9B 4PJNA 4I1OB 1OKKA 2A1DD 1TWCA 2R7TA 4KI2A 1ZHYA 1FMWA 1BR2A 2E87A 4H4KC 4XTKA 1MNEA 2CDQA 1Z5ZA 3WG7C 3N0TA 3UMHA 4W8KA 4BJTA 2FFHA 3TD7A 4QI0A 3SYNA 2XRHA 3I5QA 4AK9A 3UGPA 2KQ9A 4WJ0A 3LNRA 3UNGC 3ZVRA 2R7VA 4HEAJ 4A2NB 4PFOA 3B0PA 4JJGA 2IOQA 5KYNA 2DYSC 3F47A 5HSWA 4YT5A 3W2VA 3E70C 2Y3HA 4CS8C 3EHMA 2EIKC 3R7CA 3K66A 4JW1A 5DS6A 3TK0A 4J30B 2X51A 2J7PA 2G3KA 3K33A 3E9VA 2WB7A 3FVYA 2EINC 2A6HF 1NZEA 3OEOA 2ZXWC 5EGYA 4LERA 3CSKA 2GFHA 3RFYA 3ASNC 3O55A 4Q4ZF 2XSEA 3JT1A 1JPJA 4FWVA 4I44A 2PP4A 1ZHTA 3VYWA 2L9JA 3OWTA 2VH3A 4O6MA 3DJNB 4IWBA 3ZIBA 4E0HA 1OCOC 1VMAA 1LKXA 1FTSA 3JYHA 4PFPA 2WL8A 5FCLA 2J9WA 1ZHWA 1N1CA 2NUTB 2LSEA 4XLNF 1W2WA 2H7VC 2I8BA 2IXMA 3DAFA 1KU2A 3K6BA 3NDBB 3EQLF 3HLZA 4HE8D 1Z63A 3EZHA 1MMNA 4K7BA 4C7OB 3RYLA 4YT8A 2PX0A 4XLPF 2EIJC 4O7GA 4HFFB 4QI2A 4J32B 2M4EA 3K1HA 2BE5F 3OA1A 1FMVA 3ZSUA 3V7OA 4OINF 1MNDA 4LACB 4XWJA 4GEHA 4AE4A 4E7SA 3U5SA 3QZCA 3PMRA 4IRUA 2MYSA 1VYIA 4YJWA 3T4RA 4LLCA 3DZAA 4P6IC 2WZFA 2CGEA 4BEJA 3FHDA 3H65A 2O9XA 3B9QA 3DJUB 3EJNA 4O6YA 3FDQA 3NKEA 5KYWB 2KNHA 2V26A 2J7PD 2V3CC 2W4MA 2Y3BA 4YN0B 1MMGA 3KL4A 5F5FA 2H7OA 5E2QA 4U5HA 1M2OA 2Z15A 1PCXA 2R7XA 3M1CB 1D1BA 4BJ6A 3NRHA 1RJ9A 4YT2A 1PD1A 3T6JA 1TWHA 3UGOA 4C3EA 2WVQA 4KNWA 4M63A 3I5PA 2W4BA 3LS1A 3RH3A 4G7ZF 4PJLA 2Y3GA 2Q3TA 2KJGA 3T6BA 2QTVA 5B1AC 2WVOA 2G62A 3U2LA 4F4BA 3VAYA 1TWGA 1VK5A 3SZRA 2KGOA 4JURI 1OQCA 1D0XA 2R7SA 3S29A 2IYLD 3LJBA 2J9UA 2EILC 3W8HA 4CIHA 3DMDA 3X2QC 1NU7D 4U5CE 4DVYP 5D91A 1J8MF 5B3SC 3EH1A 1BR1A 3AG3C 1LVKA 4CBEA 4RBNA 2R7RA 3PHF2 1OCZC 2XXAA 1FFTC 1Z23A 3SEOA 4BJ5A 3Q6NA 1M2VA 2HV7A 4I3MA 4ANJA 1O87A 1Z3IX 1NG1A 5KYXA 2J9VA 4IAOA 2W45A 4BJ1A 5DQZA 3MBGA 3EFOA 3Q6MA 3QMKA 5E33A 4YWQA 2EIMC 3F46A 2C04A 2A6EF 4MNDA 5F5HA 3K1IC 3NYMA 4U5EE 2J45A 4Q5SF 1M56C 3Q7LA 4GYTA 3EGXA 1OKKD 3EGXB 3SNHA 5EHHA 2IXOA 4C3BA 4CS9A 3GWNA 4ZLCA 3N2ZB 5E3AA 4CS7A 2WZGA 2OG2A 1M57C 3CQZA 2J0WA 4KC9A 2IXPA 3ZC4A 2OCCC 1ZHXA 1D0YA 4OIPF 3GWLA 3MX3A 1MMDA 1FFHA 4LLEA 4CSAA 4BJ6C 3KH2A 4G0HA 5T3WA 1WGWA 1J8YF 4JJFA 1PD0A 2HJ3A 1SF8A 3S0XA 4AE4B 1OCRC 5B1BC 2IXNA 2A68F 3B0VC 5L3VA 4U5DE 3S28A 2NUPA 2WZLA 3ABMC 1SMYF 3AQCA 1IZMA 2B0JA 5L3QA 1O5HA 3JSZA 4PJMA 2QY9A 3JRTA 2CNWA 2HV6A 3RIPA 4LDKA 3ABKC 4DBRA 1JPNA 1MMAA 2PF4E 4B6IA 3DAGA 2J46A 2J0XA 3GANA 3Q7GA 4FESA 5KYUA 3HTKC 3KKBA 1RJ9B 3NG1A 4BJ5C 1ZU5A 3EG9A 3ECSA 4O79A 4QDLA 3LS0A 4HFKB 2VB6A 2VASA 3AQBA 4O6NA 3L34A 3UMIA 4AX2A 3I4UA 4JZAA 3UR3C 3EGDA 2DGJA 3EGDB 3NYJA 3LLIA 3ASOC 2YHSA 4KNVA 3KMIA 2XL4A 2Q9CA 4E0IA 2P7VA 4G7OF 4EWCA 3POVA 3EZIA 4YT4A 3DD7A 2NG1A 4Q7CA 3ABLC 3AG2C 1QLEC 3DM9B 3IEEA 4CS9C 2Y39A 3EHNA 1D1AA 4PK4A 3MLGA 4DBQA 2YZSA 4I1MA 3RKOF 5BUOA 5DS4A 1TWAA 1NU9C 2WVNA 2XXAB 2R7OA 4RD9A 4DOZA 5D92A 3LESA 1M2VB 1OCCC 3DM5A 4CSAC 5KYXB 2JD3A 3LLKA 4IJJA 4PJJA 4ZLDA 1TKNA 4G7HF 3SP1A 3WODF 2C03A 4OIQF 1D0ZA 1Z6AA 3EFOB 4U5GA 3S27A 2PFDA 2CW0F 3LAYA 2G3VA 1TR2A 4E7ZA 3B0UX 2D5RB 2ZXPA 2CNWD 3UMKA 4BG0A 4U5FE 2P6VA 2KW3C 4OD4A 2R7WA 5CI9A 4FX5A 3FAJA 1ST6A 3NKDA 3EH2A 2ZPAA 4JCHA 3ZG1A 2Q9AA 3HJCA 1G8XA 4CS8A 1IW7F 3GODA 3NYLA 1VYKA 2FGYA 4OIOF 2NUTA 2ZXRA 4OD5A 3W8IA 1SZIA 1ZHZA 2MWQA 1S7ZA 1ZYRF 1LS1A 5DLJA 2Q9BA 3K7DA 4OIRF 1QZXA 4C7OA 3L0IA 4NY3A 5IY5C 4EBBA 4MQ9F 3AG4C 4K0DA 1JR8A 4KBLA 5T1DB 4ULWA 3LEVA 2L81A 3JCUQ 4U5BE 4JVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TK0 A;  1JRA A;  3GWL A;  4E0H A;  3U2L A;  4LDK A;  3LLI A;  1OQC A;  4E0I A;  3GWN A;  3U5S A;  2HJ3 A;  3R7C A;  3O55 A;  3W4Y A;  1JR8 A;  3LLK A;  3U2M A;  3MBG A;  3TD7 A; 
#chains in the Genus database with same CATH topology
 2W9Y A;  2Y69 C;  1YAU O;  3DXJ F;  1VOM A;  1BR4 A;  2NUP B;  4JKV A;  5BQG A;  2ZXO A;  3ITF A;  5T3T A;  2HS5 A;  5DVW A;  3HNJ A;  1A7D A;  1WAS A;  2VCC A;  3QVY A;  5E3C A;  1V54 C;  2Y3D A;  3WAQ A;  1ZU4 A;  3HNK A;  1Q0D A;  1UG7 A;  4JCZ A;  3W2W A;  4C3D A;  5L0D A;  3EPV A;  3X1O A;  2R7U A;  2R7Q A;  1BDJ B;  5F28 E;  4D4X A;  5AC4 A;  5DQT A;  5L0F A;  1LE2 A;  2XM4 A;  4CX9 A;  5KYY A;  5DS5 A;  2DYR C;  4X0R A;  3AG1 C;  1S05 A;  1I4Y A;  2YLD A;  3TJ5 A;  5KYY B;  1HY5 A;  2YEV A;  3ZDL A;  4DVZ A;  2A0U A;  3FOO A;  3W4Y A;  2OEX A;  3U2M A;  3CZ6 A;  3O6X A;  4RDA A;  4YL1 A;  1RCP A;  1D1C A;  5KYU B;  3A9C A;  5JRA A;  2H7B A;  2YQY A;  1I4Z A;  3O39 A;  1VLT A;  5CI8 A;  1Q0K A;  2PX3 A;  1JRA A;  3N24 A;  5KYW A;  1V55 C;  2GA0 A;  4N06 A;  2A69 F;  3EG9 B;  4PJN A;  4I1O B;  1OKK A;  1CGM E;  1VLS A;  2LFD A;  4E17 A;  3GM3 A;  2VCA A;  2LFF A;  4Z9H A;  1H9G A;  2A1D D;  3RQF A;  1TWC A;  2R7T A;  4NTB A;  4KI2 A;  4MVR A;  1ZHY A;  2YL1 A;  1FMW A;  1BR2 A;  2E87 A;  2XLV A;  4U9D A;  4H4K C;  3C8G D;  4W8P A;  2UUH A;  4XTK A;  5A6J A;  1MNE A;  2CDQ A;  1K04 A;  1Z5Z A;  3WG7 C;  3MYI A;  3N0T A;  3UMH A;  2JPU A;  4W8K A;  4BJT A;  2FFH A;  3TD7 A;  4MW3 A;  1H6G A;  3V5X A;  4QI0 A;  2JX0 A;  2XRH A;  3B71 A;  3I5Q A;  3SYN A;  2R03 A;  1WWP A;  4AK9 A;  2XLO A;  1Z7Q c;  3UGP A;  2KQ9 A;  4XEK A;  4J7T A;  3LNR A;  4WJ0 A;  3UNG C;  3ZVR A;  4HEA J;  2R7V A;  1CGN A;  4PFO A;  3VF0 A;  4A2N B;  2QUP A;  3B0P A;  4JJG A;  1ZZP A;  4EBJ A;  1HMD A;  2IOQ A;  5KYN A;  2OOC A;  2DYS C;  3RVZ A;  1E85 A;  4EUK B;  5K0I A;  1YAR O;  3F47 A;  1O3U A;  3JSE O;  5HSW A;  1CPQ A;  4YT5 A;  3W2V A;  2FAP B;  1V4A A;  4JE9 A;  2R25 A;  4NQF A;  1C03 A;  1OXB A;  3E70 C;  3AOU A;  2Y3H A;  2H8A A;  4CS8 C;  3EHM A;  2EIK C;  3QW1 A;  3R7C A;  1MQV A;  4WGY A;  3K66 A;  4JW1 A;  3M4C A;  2XLH A;  4N6H A;  4CDY A;  4JTC B;  4DRJ B;  5DS6 A;  3NMI A;  3TK0 A;  4J30 B;  2X51 A;  2EPL X;  1R4T A;  2J7P A;  2NPU A;  4XQ1 A;  4IGG A;  2G3K A;  3K33 A;  2OU6 A;  3E9V A;  4ULV A;  2WB7 A;  3FVY A;  4G78 A;  1KTM A;  1L3P A;  3L8I A;  2EIN C;  5JUA A;  2A6H F;  2CYD A;  4MVM A;  3VRC A;  1NZE A;  1GS9 A;  3OEO A;  4P9T A;  1YLM A;  2ZXW C;  2R9R B;  5A6K A;  3C8G B;  5L0J A;  5EGY A;  1WOL A;  3CSK A;  4LER A;  3SXY A;  2GFH A;  2GAQ A;  3RFY A;  3ASN C;  1A0B A;  3O55 A;  4BPM A;  4Q4Z F;  2XSE A;  2B0H A;  1T6Q A;  3JT1 A;  1JPJ A;  4FWV A;  4AL0 A;  4I44 A;  2PP4 A;  4XPW A;  1ZHT A;  1XWJ A;  2L9J A;  3A11 A;  2VH3 A;  3OWT A;  3PCV A;  4O6M A;  3DJN B;  4IWB A;  2KK1 A;  3ZIB A;  1RMV A;  4YK5 A;  1U0B B;  4E0H A;  1OCO C;  2AP3 A;  1DOW A;  1XZP A;  2HSB A;  3FXH A;  3RVY A;  1VMA A;  1LI5 A;  3IPM O;  1K05 A;  1LKX A;  4JTD B;  1FTS A;  3JYH A;  4PFP A;  2WL8 A;  3TUL A;  4EKW A;  5FCL A;  2J9W A;  1ZHW A;  1N1C A;  2NUT B;  2LSE A;  2YL0 A;  3HNI A;  3KYI A;  4MVO A;  4XLN F;  1H9T A;  4N4W A;  1W2W A;  2H7V C;  1ZVZ A;  2I8B A;  3LNM B;  2IXM A;  3DAF A;  5COG A;  1KU2 A;  3K6B A;  3S90 A;  3EQL F;  3HLZ A;  4WGZ A;  2LCH A;  3T6G B;  1HE9 A;  3NDB B;  4HE8 D;  1Z63 A;  1Q0G A;  1LPE A;  3JZ0 A;  3EZH A;  1MMN A;  2I15 A;  3IQC A;  4K7B A;  3RYL A;  4YT8 A;  4C7O B;  2PX0 A;  3JYY A;  1TQG A;  3L8J A;  2NSG A;  4XLP F;  3C62 A;  2EIJ C;  4JEB A;  4K1O A;  4O7G A;  2RD9 A;  1UFB A;  4HFF B;  4QI2 A;  2LQG A;  4J32 B;  2M4E A;  1LE4 A;  4LDR A;  4XPY A;  3K1H A;  2BE5 F;  1YJG A;  3OA1 A;  1FMV A;  3ZSU A;  3V7O A;  2OQM A;  4ER9 A;  5AGF A;  4OIN F;  4EIY A;  2PBE A;  1E86 A;  1MND A;  4LAC B;  4XWJ A;  2EPO A;  3GEE A;  4GEH A;  4AE4 A;  3DE8 A;  4E7S A;  3U5S A;  2M64 A;  3K1I A;  3QZC A;  5EK0 A;  2L6H A;  3C63 A;  3PMR A;  4IRU A;  2MYS A;  2LP4 A;  1LIH A;  1VYI A;  1EA8 A;  4YJW A;  3T4R A;  4LLC A;  3DZA A;  3VYW A;  4P6I C;  2WZF A;  2CGE A;  4NC3 A;  4G7Z F;  5L0I A;  4BEJ A;  3FHD A;  1LS4 A;  3H65 A;  3U8P A;  2O9X A;  3B9Q A;  2P61 A;  3DJU B;  3EJN A;  2DI3 A;  4O6Y A;  1CPR A;  3U9J A;  3FDQ A;  3AGU A;  5COM A;  3TOM A;  3NKE A;  5KYW B;  3TJ6 A;  2KNH A;  5TJ5 E;  2HJM A;  2V26 A;  2J7P D;  2V3C C;  2W4M A;  2Y3B A;  4YN0 B;  1MMG A;  3KL4 A;  5F5F A;  2H7O A;  4IB4 A;  4WAB A;  1GM5 A;  2ASR A;  5E2Q A;  1E84 A;  4U5H A;  3DI5 A;  3IQ6 A;  1M2O A;  1BBH A;  2Z15 A;  1PCX A;  2R7X A;  3M1C B;  1D1B A;  5JSL A;  4BJ6 A;  3NRH A;  3GEI A;  1RJ9 A;  4YT2 A;  3U9M A;  5JT4 A;  1QSP A;  1PD1 A;  1ORJ A;  1TWH A;  3T6J A;  1YDI A;  1YZC A;  2WVQ A;  4KNW A;  4M63 A;  3I5P A;  2W4B A;  3GOR A;  3LS1 A;  2HMZ A;  3BRJ A;  4PJL A;  3RH3 A;  2Y3G A;  3ZQY A;  4CDA A;  4E18 A;  2Q3T A;  2ZD9 A;  4LDQ A;  5HV9 A;  2KJG A;  3T6B A;  2QTV A;  2MHR A;  2WVO A;  5B1A C;  1NSG B;  2XLE A;  4C3E A;  2G62 A;  4IAR A;  3U2L A;  4F4B A;  3VAY A;  1OW7 A;  1E83 A;  1U89 A;  4J7Y A;  3KYJ A;  1EI7 A;  2AWY A;  1TWG A;  4PAC A;  3B29 A;  3MFN A;  1NFO A;  1VK5 A;  3M79 A;  1E2X A;  1VB5 A;  4JTA B;  3SZR A;  5IY5 C;  2KGO A;  1AEP A;  2DB4 A;  3IQT A;  1OQC A;  4JUR I;  1TFO B;  1D0X A;  1APC A;  1EKY A;  3L1M A;  2R7S A;  3ZWI A;  2XL8 A;  3S29 A;  5JP7 A;  1OR3 A;  2IYL D;  3LJB A;  2J9U A;  2EIL C;  3W8H A;  4CIH A;  1YYX A;  3DMD A;  4Z9J A;  3X2Q C;  1NU7 D;  4U5C E;  4DVY P;  3GM2 A;  3ZTZ A;  5D91 A;  1J8M F;  3S9O A;  5B3S C;  1ZW3 A;  3EH1 A;  1BR1 A;  1WN0 A;  3AG3 C;  1LVK A;  2XLW A;  4CBE A;  3H2V A;  4RBN A;  2R7R A;  1RKE A;  3U8V A;  1RXQ A;  3PHF 2;  1OCZ C;  2HUJ A;  3ZQV A;  2XXA A;  2OKU A;  1FFT C;  2IM8 A;  1Z23 A;  3GEH A;  3SEO A;  4BJ5 A;  3Q6N A;  1M2V A;  2HV7 A;  2L7A A;  4I3M A;  3TQO A;  1JMW A;  2J9B A;  1O87 A;  4ANJ A;  1Z3I X;  2YWA A;  1NG1 A;  1Q0M A;  5KYX A;  2J9V A;  2YL7 A;  1HW1 A;  4IAO A;  2W45 A;  3CEX A;  5DQZ A;  4BJ1 A;  5JS5 A;  3RQE A;  4UDV A;  3MBG A;  1FR0 A;  2VCB A;  2NSF A;  3EFO A;  3Q6M A;  3QMK A;  5E33 A;  4YWQ A;  2OJE D;  1DOV A;  2EIM C;  4U9E A;  2XLD A;  3F46 A;  3VM6 A;  2C04 A;  1LM3 B;  2A6E F;  4MND A;  4CDV A;  4MW8 A;  5F5H A;  1GGQ A;  1YYJ A;  1A41 A;  3K1I C;  3NYM A;  3AJM A;  1R5I D;  4U5E E;  4YL0 A;  1WTY A;  2YRF A;  2J45 A;  4Q5S F;  1M56 C;  3Q7L A;  4GYT A;  3EGX A;  1OKK D;  1ORS C;  3EGX B;  1QQ3 A;  2KSF A;  3SNH A;  5EHH A;  2IXO A;  1NFN A;  2P1A A;  5GPG B;  4C3B A;  3M15 A;  4CS9 A;  3GWN A;  4ZLC A;  3N2Z B;  4D4N A;  3S84 A;  1F1M A;  1QVX A;  5E3A A;  4CS7 A;  2WZG A;  2OG2 A;  1M57 C;  2GWW A;  2J0W A;  3CQZ A;  3JRM O;  5BQI A;  4JEA A;  3KPH A;  4DRH B;  4KC9 A;  3NMJ A;  2IXP A;  3ZC4 A;  2OCC C;  1ZHX A;  3C7J A;  3US6 A;  1D0Y A;  4OIP F;  3QVZ A;  3GWL A;  3ZTM A;  4MTF A;  3MX3 A;  4YL3 A;  1MMD A;  1FFH A;  4LLE A;  1G4U S;  2Q00 A;  3ATP A;  5FZT A;  4BJ6 C;  3PDM P;  4CSA A;  3KH2 A;  4G0H A;  2YLI A;  5T3W A;  3J06 A;  2QNL A;  1WGW A;  3NMK A;  1J8Y F;  4JJF A;  1PD0 A;  3RW0 A;  3JTL O;  1T01 A;  3RQG A;  2HJ3 A;  5A6A A;  1SF8 A;  3S0X A;  1C02 A;  3CAX A;  4AE4 B;  1OCR C;  2IBF A;  2OJQ A;  5B1B C;  2IXN A;  1YA7 O;  2TMV P;  2A68 F;  4FAP B;  1RKC A;  5L3V A;  4MTO A;  1QPU A;  4U5D E;  3S28 A;  1YZA A;  2NUP A;  2WZL A;  3ABM C;  3B0V C;  1SMY F;  2YKZ A;  3AQC A;  1IZM A;  2B0J A;  2XL6 A;  4MVS A;  4N6C A;  1G4W R;  5L3Q A;  3DWW A;  1O5H A;  3JSZ A;  4PJM A;  2QY9 A;  3JRT A;  4P9F A;  2CNW A;  3U0C A;  3SXK A;  3DE9 A;  2HV6 A;  4PR9 A;  3SXZ A;  2YL3 A;  4XEV A;  3RIP A;  4LDK A;  4BEM J;  3ABK C;  5AC5 A;  2PNO A;  4DBR A;  1JPN A;  3HKK A;  1B68 A;  1Y6D A;  1MMA A;  1OW8 A;  2L6F A;  2PF4 E;  2QLA A;  3C18 A;  4XEF A;  3G4Z A;  4B6I A;  3DAG A;  5L0C A;  3G4X A;  1GQA A;  2J46 A;  1SYQ A;  2J0X A;  3C8Z A;  1OW6 A;  3GAN A;  3IQ5 A;  3Q7G A;  4FES A;  1KNY A;  1SR2 A;  2HFI A;  1L7C A;  2CCY A;  5KYU A;  2J8W A;  3HTK C;  2L6G A;  1JOG A;  2EPM X;  1OR2 A;  1T5O A;  1T9K A;  1A7E A;  3BEH A;  1RJ9 B;  2R05 A;  3KKB A;  3NG1 A;  1EQ1 A;  4BJ5 C;  2HZ8 A;  1ZU5 A;  1JAF A;  3EG9 A;  4DRI B;  3ECS A;  4O79 A;  3M4B A;  4QDL A;  5A6B A;  4DJ9 A;  3LS0 A;  2RSE B;  4HFK B;  1BZ4 A;  2VB6 A;  256B A;  2VAS A;  1I5N A;  3AQB A;  2AU5 A;  3FMS A;  2D4U A;  3L34 A;  4O6N A;  3UMI A;  4AX2 A;  3I4U A;  2R02 A;  2KYH A;  4JZA A;  3UR3 C;  1CGO A;  3V5Z A;  3EGD A;  1FAP B;  2XS8 A;  2DGJ A;  5JLI A;  3QTH A;  2EPN A;  2QE9 A;  2YVK A;  3EGD B;  3NYJ A;  3LLI A;  1ZW2 A;  3ASO C;  4MVZ A;  2YHS A;  4MTG A;  3LEO A;  4KNV A;  3KMI A;  4EHP A;  2XL4 A;  2Q9C A;  4MVU A;  2P7V A;  2HKV A;  4MVQ A;  4JRZ A;  4E0I A;  3V5Y A;  2ETS A;  4G7O F;  4EWC A;  3POV A;  1M6T A;  2UUI A;  3EZI A;  2XLM A;  4YT4 A;  3DD7 A;  2NG1 A;  4JC7 A;  1Q0F A;  2BC5 A;  4Q7C A;  3ABL C;  3AG2 C;  2Q7R A;  5A69 A;  1QLE C;  3DM9 B;  1U6H A;  5L0H A;  2P0N A;  3IEE A;  4JIO A;  4L6R A;  2HSQ A;  4CS9 C;  2ICW G;  2Y39 A;  3EHN A;  2VC9 A;  1D1A A;  4PK4 A;  3MLG A;  1QKR A;  4DBQ A;  3U3B A;  2HMQ A;  4AL1 A;  2YZS A;  4IAQ A;  4I1M A;  3RKO F;  2AWC A;  1Y4C A;  3WHN A;  1A7V A;  5DS4 A;  5BUO A;  3SXM A;  1RKE B;  1TWA A;  1NU9 C;  4CJO A;  4CIP A;  4ONS A;  2WVN A;  1WAT A;  2XXA B;  1T6I A;  2R7O A;  4RD9 A;  4DOZ A;  1YA9 A;  1AVO B;  3HNL A;  5D92 A;  3LES A;  1M2V B;  1T6U A;  1OCC C;  1K40 A;  3DM5 A;  4CSA C;  5KYX B;  2JD3 A;  3LLK A;  4IJJ A;  1FNT c;  4PJJ A;  5BQH A;  1TKN A;  4G7H F;  4ZLD A;  2GDC A;  4MS2 A;  1XZQ A;  3SP1 A;  3WOD F;  3DKA A;  2C03 A;  5L0G A;  1C17 M;  1D0Z A;  1Z6A A;  3EFO B;  4U5G A;  2EPK X;  3S27 A;  4OIQ F;  3LUT B;  4EBK A;  1PV3 A;  2F22 A;  2PFD A;  2CW0 F;  5JVE A;  1YVI A;  3LAY A;  2G3V A;  1TR2 A;  4E7Z A;  2XS1 A;  3B0U X;  2D5R B;  2LD6 A;  2XM0 A;  2ZXP A;  2CNW D;  3UMK A;  2Q4F A;  3FAP B;  4BG0 A;  4U5F E;  3C8G A;  3H2U A;  1V74 B;  4R32 A;  3UGO A;  2P6V A;  2KW3 C;  4OD4 A;  2R7W A;  4NTA A;  5CI9 A;  4A4A A;  1OXK A;  1TFK B;  3FOP A;  3U3F A;  4FX5 A;  3FAJ A;  1HW2 A;  1ST6 A;  3G50 A;  3NKD A;  4DXW A;  3EH2 A;  3RF3 A;  4Z9I A;  1AUE A;  2ZPA A;  4JCH A;  3TOL A;  5CIV A;  5COF A;  3ZG1 A;  2Q9A A;  3R2P A;  4XPX A;  3HJC A;  3O10 A;  1G8X A;  2BL2 A;  1IW7 F;  1NLX A;  3GOD A;  4CS8 A;  2LIG A;  1LI7 A;  3NYL A;  2AVK A;  1VYK A;  3IHU A;  2FGY A;  4CJG A;  5A6B D;  2OEV A;  2X0C A;  4H54 A;  4OIO F;  4NTF A;  2NUT A;  3GM1 A;  4NCQ A;  2ZXR A;  3QW0 A;  2A0B A;  4OD5 A;  3W8I A;  1SZI A;  1HMO A;  1ZHZ A;  2LK4 A;  1G5Z A;  2MWQ A;  3AGT A;  1S7Z A;  1ZYR F;  1VTM P;  1LS1 A;  2KC3 A;  5DLJ A;  4GQH A;  1ORY A;  2Q9B A;  3K7D A;  4OIR F;  1QZX A;  3T9O A;  4C7O A;  1H7I A;  3L0I A;  3MYF A;  4NY3 A;  4EBB A;  4MQ9 F;  3AG4 C;  4K0D A;  1JR8 A;  4KBL A;  1HE1 A;  1NBB A;  5T1D B;  4ULW A;  2YLG A;  3LEV A;  2L81 A;  3JCU Q;  5B3I A;  4U5B E;  4JVS A; 
#chains in the Genus database with same CATH homology
 2W9Y A;  2Y69 C;  3DXJ F;  1VOM A;  1BR4 A;  2NUP B;  2ZXO A;  3ITF A;  5T3T A;  5DVW A;  5E3C A;  1V54 C;  2Y3D A;  1ZU4 A;  2R7U A;  3W2W A;  4C3D A;  3EPV A;  3X1O A;  2R7Q A;  5DQT A;  5DS5 A;  5KYY A;  2DYR C;  4X0R A;  3AG1 C;  5KYY B;  2YEV A;  4DVZ A;  3W4Y A;  3U2M A;  3CZ6 A;  3O6X A;  4RDA A;  1D1C A;  5KYU B;  2H7B A;  3O39 A;  5CI8 A;  2PX3 A;  1JRA A;  3N24 A;  5KYW A;  1V55 C;  4N06 A;  2A69 F;  3EG9 B;  4PJN A;  4I1O B;  1OKK A;  2A1D D;  1TWC A;  2R7T A;  4KI2 A;  1ZHY A;  1FMW A;  1BR2 A;  2E87 A;  4H4K C;  4XTK A;  1MNE A;  2CDQ A;  1Z5Z A;  3WG7 C;  3N0T A;  3UMH A;  4W8K A;  4BJT A;  2FFH A;  3TD7 A;  4QI0 A;  3SYN A;  2XRH A;  3I5Q A;  4AK9 A;  3UGP A;  2KQ9 A;  4WJ0 A;  3LNR A;  3UNG C;  3ZVR A;  2R7V A;  4HEA J;  4A2N B;  4PFO A;  3B0P A;  4JJG A;  2IOQ A;  5KYN A;  2DYS C;  3F47 A;  5HSW A;  4YT5 A;  3W2V A;  3E70 C;  2Y3H A;  4CS8 C;  3EHM A;  2EIK C;  3R7C A;  3K66 A;  4JW1 A;  5DS6 A;  3TK0 A;  4J30 B;  2X51 A;  2J7P A;  2G3K A;  3K33 A;  3E9V A;  2WB7 A;  3FVY A;  2EIN C;  2A6H F;  1NZE A;  3OEO A;  2ZXW C;  5EGY A;  4LER A;  3CSK A;  2GFH A;  3RFY A;  3ASN C;  3O55 A;  4Q4Z F;  2XSE A;  3JT1 A;  1JPJ A;  4FWV A;  4I44 A;  2PP4 A;  1ZHT A;  3VYW A;  2L9J A;  3OWT A;  2VH3 A;  4O6M A;  3DJN B;  4IWB A;  3ZIB A;  4E0H A;  1OCO C;  1VMA A;  1LKX A;  1FTS A;  3JYH A;  4PFP A;  2WL8 A;  5FCL A;  2J9W A;  1ZHW A;  1N1C A;  2NUT B;  2LSE A;  4XLN F;  1W2W A;  2H7V C;  2I8B A;  2IXM A;  3DAF A;  1KU2 A;  3K6B A;  3NDB B;  3EQL F;  3HLZ A;  4HE8 D;  1Z63 A;  3EZH A;  1MMN A;  4K7B A;  4C7O B;  3RYL A;  4YT8 A;  2PX0 A;  4XLP F;  2EIJ C;  4O7G A;  4HFF B;  4QI2 A;  4J32 B;  2M4E A;  3K1H A;  2BE5 F;  3OA1 A;  1FMV A;  3ZSU A;  3V7O A;  4OIN F;  1MND A;  4LAC B;  4XWJ A;  4GEH A;  4AE4 A;  4E7S A;  3U5S A;  3QZC A;  3PMR A;  4IRU A;  2MYS A;  1VYI A;  4YJW A;  3T4R A;  4LLC A;  3DZA A;  4P6I C;  2WZF A;  2CGE A;  4BEJ A;  3FHD A;  3H65 A;  2O9X A;  3B9Q A;  3DJU B;  3EJN A;  4O6Y A;  3FDQ A;  3NKE A;  5KYW B;  2KNH A;  2V26 A;  2J7P D;  2V3C C;  2W4M A;  2Y3B A;  4YN0 B;  1MMG A;  3KL4 A;  5F5F A;  2H7O A;  5E2Q A;  4U5H A;  1M2O A;  2Z15 A;  1PCX A;  2R7X A;  3M1C B;  1D1B A;  4BJ6 A;  3NRH A;  1RJ9 A;  4YT2 A;  1PD1 A;  3T6J A;  1TWH A;  3UGO A;  4C3E A;  2WVQ A;  4KNW A;  4M63 A;  3I5P A;  2W4B A;  3LS1 A;  3RH3 A;  4G7Z F;  4PJL A;  2Y3G A;  2Q3T A;  2KJG A;  3T6B A;  2QTV A;  5B1A C;  2WVO A;  2G62 A;  3U2L A;  4F4B A;  3VAY A;  1TWG A;  1VK5 A;  3SZR A;  2KGO A;  4JUR I;  1OQC A;  1D0X A;  2R7S A;  3S29 A;  2IYL D;  3LJB A;  2J9U A;  2EIL C;  3W8H A;  4CIH A;  3DMD A;  3X2Q C;  1NU7 D;  4U5C E;  4DVY P;  5D91 A;  1J8M F;  5B3S C;  3EH1 A;  1BR1 A;  3AG3 C;  1LVK A;  4CBE A;  4RBN A;  2R7R A;  3PHF 2;  1OCZ C;  2XXA A;  1FFT C;  1Z23 A;  3SEO A;  4BJ5 A;  3Q6N A;  1M2V A;  2HV7 A;  4I3M A;  4ANJ A;  1O87 A;  1Z3I X;  1NG1 A;  5KYX A;  2J9V A;  4IAO A;  2W45 A;  4BJ1 A;  5DQZ A;  3MBG A;  3EFO A;  3Q6M A;  3QMK A;  5E33 A;  4YWQ A;  2EIM C;  3F46 A;  2C04 A;  2A6E F;  4MND A;  5F5H A;  3K1I C;  3NYM A;  4U5E E;  2J45 A;  4Q5S F;  1M56 C;  3Q7L A;  4GYT A;  3EGX A;  1OKK D;  3EGX B;  3SNH A;  5EHH A;  2IXO A;  4C3B A;  4CS9 A;  3GWN A;  4ZLC A;  3N2Z B;  5E3A A;  4CS7 A;  2WZG A;  2OG2 A;  1M57 C;  3CQZ A;  2J0W A;  4KC9 A;  2IXP A;  3ZC4 A;  2OCC C;  1ZHX A;  1D0Y A;  4OIP F;  3GWL A;  3MX3 A;  1MMD A;  1FFH A;  4LLE A;  4CSA A;  4BJ6 C;  3KH2 A;  4G0H A;  5T3W A;  1WGW A;  1J8Y F;  4JJF A;  1PD0 A;  2HJ3 A;  1SF8 A;  3S0X A;  4AE4 B;  1OCR C;  5B1B C;  2IXN A;  2A68 F;  3B0V C;  5L3V A;  4U5D E;  3S28 A;  2NUP A;  2WZL A;  3ABM C;  1SMY F;  3AQC A;  1IZM A;  2B0J A;  5L3Q A;  1O5H A;  3JSZ A;  4PJM A;  2QY9 A;  3JRT A;  2CNW A;  2HV6 A;  3RIP A;  4LDK A;  3ABK C;  4DBR A;  1JPN A;  1MMA A;  2PF4 E;  4B6I A;  3DAG A;  2J46 A;  2J0X A;  3GAN A;  3Q7G A;  4FES A;  5KYU A;  3HTK C;  3KKB A;  1RJ9 B;  3NG1 A;  4BJ5 C;  1ZU5 A;  3EG9 A;  3ECS A;  4O79 A;  4QDL A;  3LS0 A;  4HFK B;  2VB6 A;  2VAS A;  3AQB A;  4O6N A;  3L34 A;  3UMI A;  4AX2 A;  3I4U A;  4JZA A;  3UR3 C;  3EGD A;  2DGJ A;  3EGD B;  3NYJ A;  3LLI A;  3ASO C;  2YHS A;  4KNV A;  3KMI A;  2XL4 A;  2Q9C A;  4E0I A;  2P7V A;  4G7O F;  4EWC A;  3POV A;  3EZI A;  4YT4 A;  3DD7 A;  2NG1 A;  4Q7C A;  3ABL C;  3AG2 C;  1QLE C;  3DM9 B;  3IEE A;  4CS9 C;  2Y39 A;  3EHN A;  1D1A A;  4PK4 A;  3MLG A;  4DBQ A;  2YZS A;  4I1M A;  3RKO F;  5BUO A;  5DS4 A;  1TWA A;  1NU9 C;  2WVN A;  2XXA B;  2R7O A;  4RD9 A;  4DOZ A;  5D92 A;  3LES A;  1M2V B;  1OCC C;  3DM5 A;  4CSA C;  5KYX B;  2JD3 A;  3LLK A;  4IJJ A;  4PJJ A;  4ZLD A;  1TKN A;  4G7H F;  3SP1 A;  3WOD F;  2C03 A;  4OIQ F;  1D0Z A;  1Z6A A;  3EFO B;  4U5G A;  3S27 A;  2PFD A;  2CW0 F;  3LAY A;  2G3V A;  1TR2 A;  4E7Z A;  3B0U X;  2D5R B;  2ZXP A;  2CNW D;  3UMK A;  4BG0 A;  4U5F E;  2P6V A;  2KW3 C;  4OD4 A;  2R7W A;  5CI9 A;  4FX5 A;  3FAJ A;  1ST6 A;  3NKD A;  3EH2 A;  2ZPA A;  4JCH A;  3ZG1 A;  2Q9A A;  3HJC A;  1G8X A;  4CS8 A;  1IW7 F;  3GOD A;  3NYL A;  1VYK A;  2FGY A;  4OIO F;  2NUT A;  2ZXR A;  4OD5 A;  3W8I A;  1SZI A;  1ZHZ A;  2MWQ A;  1S7Z A;  1ZYR F;  1LS1 A;  5DLJ A;  2Q9B A;  3K7D A;  4OIR F;  1QZX A;  4C7O A;  3L0I A;  4NY3 A;  5IY5 C;  4EBB A;  4MQ9 F;  3AG4 C;  4K0D A;  1JR8 A;  4KBL A;  5T1D B;  4ULW A;  3LEV A;  2L81 A;  3JCU Q;  4U5B E;  4JVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...