3LLKA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
250
structure length
241
Chain Sequence
LADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
total genus 84
structure length 241
sequence length 250
chains with identical sequence B, C
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3llkA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3llkA01
3GWLA 1OQCA 4E0IA 3MBGA 3R7CA 3U5SA 3LLKA 3TK0A 3U2MA 3TD7A 3W4YA 2HJ3A 3GWNA 4LDKA 3U2LA 4E0HA 3O55A 1JR8A 1JRAA 3LLIA
chains in the Genus database with same CATH superfamily
1TFKB 2ZPAA 2XLEA 3EFOA 3NRHA 5BQGA 4D4XA 4JRZA 3S84A 3U3BA 1FTSA 5KYNA 1AVOB 1EA8A 2YLGA 2W4MA 4LDQA 4D4NA 1TKNA 4E7ZA 3IQCA 2AP3A 3EH2A 1VLTA 1U89A 2Q9CA 2R7WA 1PD0A 1C03A 4IB4A 2XS8A 2EPMX 4OIPF 3O39A 3T6JA 1LKXA 4OIRF 4G0HA 4KNWA 2DB4A 3JSZA 1FNTc 3ZQVA 2HV7A 1WN0A 2KYHA 3FVYA 5KYUA 5T3TA 1GS9A 4MVUA 2KW3C 4AL1A 3O6XA 1SMYF 4OINF 1O5HA 1Z23A 1ZW3A 1OW7A 2ZXRA 3HNIA 4C7OA 2BC5A 4WGZA 3K1IA 1T9KA 1B68A 2IM8A 3VM6A 2QNLA 4JTDB 3MX3A 1HMDA 1RJ9A 1ZZPA 4LERA 3RVYA 3T6BA 3QVZA 4H54A 3IEEA 4YT5A 1OW6A 4YJWA 5A6KA 1HMOA 2YEVA 3NYJA 1FMWA 2C04A 4BJ6C 2NSFA 3EZHA 4QI0A 2CGEA 1M57C 3C8GB 2L81A 3T9OA 1MMDA 3SXMA 1NSGB 1RKEA 2R25A 3DJUB 4GQHA 4PFPA 1OQCA 3GORA 5E3AA 5FZTA 4JJFA 2NUTA 1OXBA 1LI7A 2OOCA 3BRJA 2DI3A 3CSKA 5BQIA 4JCZA 4GEHA 3BEHA 4MTFA 2YL7A 3V7OA 4K7BA 2RSEB 1ZVZA 4CSAA 4Q4ZF 1APCA 4U5CE 2IXOA 4DRJB 3DD7A 1ZHTA 4JCHA 2J7PD 3SP1A 3B71A 2JX0A 3GWLA 4KNVA 3PCVA 1E86A 2R02A 3A9CA 1EKYA 3GEEA 3V5ZA 3EGXB 5HV9A 3LEOA 1JRAA 2L6FA 5JS5A 2OKUA 4YL3A 2JD3A 4EUKB 4QI2A 2PX0A 1G8XA 3B0VC 3K33A 1ZYRF 4HE8D 2LFDA 1H9GA 2Y69C 2ICWG 3AOUA 2C03A 2WVQA 3DXJF 3W2VA 3WAQA 4E7SA 1GQAA 2RD9A 1HE1A 4CX9A 1V4AA 2YL1A 3QTHA 1BR4A 2X0CA 3X1OA 1EI7A 4ONSA 1FFHA 1HE9A 4O6MA 2R7XA 3EHNA 4PACA 3F47A 4RBNA 3RQEA 4OIQF 2J0WA 2OQMA 4DJ9A 1OXKA 2XL8A 4P6IC 1VK5A 1MQVA 5KYWA 3PMRA 1DOVA 1K04A 2WZGA 4IRUA 1OKKD 3ZTZA 3U3FA 2YL3A 4MVQA 2WVNA 3TJ5A 3M1CB 4XWJA 5EGYA 5E3CA 1TWAA 2ETSA 3EPVA 3UMIA 1ZU5A 3UMHA 1ZW2A 1L7CA 1TFOB 3Q6NA 1Z3IX 1CPRA 1FAPB 2A0BA 3KYIA 4DBQA 4G78A 1YA9A 4IJJA 1ZHXA 1VYKA 2NUPA 3ATPA 1SYQA 3GODA 4RD9A 3FAPB 2Y3HA 3N24A 2QUPA 1YA7O 1Q0DA 2KQ9A 4YL1A 3TD7A 2JPUA 1LVKA 1C17M 2L6HA 1SR2A 4NTBA 3K7DA 1G5ZA 2HS5A 2QTVA 1YVIA 3DI5A 4XPYA 2D4UA 1XZPA 2A6HF 2EINC 5JUAA 2FAPB 1D0XA 2OG2A 1A41A 3FOPA 1J8MF 2Y3BA 2ZXOA 4CS8C 4YWQA 1WASA 1JMWA 3AQBA 2YVKA 1K05A 4DXWA 2Y39A 4IARA 5A6AA 1Z7Qc 2IOQA 1RCPA 4ER9A 2D5RB 4AE4B 3S90A 1OR2A 2KK1A 1UG7A 4J30B 2BL2A 3MLGA 3K1IC 4Z9HA 4U5GA 2L9JA 3M4BA 2VC9A 2BE5F 3I4UA 5JLIA 4JC7A 5FCLA 1PV3A 2I15A 1VMAA 3NKEA 3DAFA 5E33A 1NU9C 4KBLA 3C18A 3VRCA 4G7ZF 2HKVA 4ZLDA 1NBBA 5L3VA 5KYXB 3ASNC 4JKVA 1S7ZA 1D0ZA 5KYXA 3MBGA 3Q7GA 3T6GB 3S28A 3WHNA 2XM0A 3QMKA 3RYLA 3UGPA 1JAFA 1XZQA 2G3VA 2YWAA 3F46A 3L0IA 4ULWA 1QZXA 1VLSA 1VB5A 1ZHWA 4I44A 5IY5C 3HLZA 3LUTB 4NY3A 2J7PA 3AG1C 5DS6A 4YK5A 1H6GA 3JRMO 4XTKA 2R03A 4WGYA 2PX3A 5CIVA 2L6GA 2V3CC 3OEOA 4JURI 4GYTA 4XQ1A 3M15A 3ZG1A 1NU7D 2H8AA 2KSFA 4CJOA 2HSQA 2WZFA 1CGNA 1O3UA 4P9FA 5COGA 2NUTB 3SEOA 3H2VA 2IXMA 3TK0A 1YLMA 3C8GA 3IPMO 2YLDA 5KYYB 1Q0MA 1ORYA 2Q3TA 4MVMA 4YT4A 4FX5A 4CIHA 3QW1A 4JE9A 1BBHA 3ABKC 3N2ZB 3M79A 4JEBA 3U9JA 1QKRA 2HMZA 1LS4A 3AG4C 3DE9A 3NYMA 3OWTA 5JP7A 3L8IA 4I1OB 1SF8A 4A2NB 4MTGA 4G7HF 1Z63A 3JYHA 3FOOA 3PDMP 2QLAA 1OCZC 3POVA 5B1AC 3MFNA 5JRAA 1NG1A 1TQGA 2DYSC 1I4YA 3KYJA 1HY5A 5F28E 4LDRA 4C3DA 4U5HA 5AC5A 1JPJA 3AJMA 3ZC4A 5A6JA 5L0JA 3MYFA 3G4ZA 3JRTA 2YLIA 1CGOA 3ABMC 5JSLA 5L0CA 5L3QA 1Q0GA 2TMVP 4ULVA 1Y4CA 1LE4A 1JR8A 2UUHA 2R7QA 2PF4E 1RKCA 1CPQA 2ZD9A 3DAGA 3B0UX 2P6VA 1U0BB 1ORJA 1PD1A 4E0HA 1A0BA 1XWJA 5L0GA 3JT1A 1TWHA 3AGUA 3L34A 5T3WA 3VYWA 4DVZA 2XSEA 4EHPA 5DS5A 1UFBA 1CGME 1A7EA 1LE2A 1WWPA 3C7JA 3U2MA 4U5BE 4IAOA 4DOZA 3QW0A 2P1AA 5B3IA 2XXAB 1JOGA 4MQ9F 1OCOC 1VOMA 2OJED 5F5HA 2XLOA 4EKWA 4RDAA 2HV6A 4OD4A 3TJ6A 1LI5A 3GEHA 2R7VA 4BG0A 2YL0A 1LS1A 2YRFA 2XLMA 4B6IA 4CJGA 2R7TA 2Y3DA 5A6BD 1RXQA 3K6BA 4MVOA 3IQ5A 4XEKA 2GA0A 4WJ0A 4NTAA 1MNDA 1TR2A 3DWWA 1E84A 1V55C 4AE4A 4BJ6A 4CIPA 4C3EA 1OKKA 3U8PA 1H7IA 3FHDA 4BJ5A 4NTFA 4E18A 3WODF 3GANA 4IAQA 2J8WA 1V54C 3LNMB 4EBKA 3RH3A 3VF0A 2OEVA 3ABLC 1V74B 1TWCA 1YYJA 3ASOC 4JTCB 2J9VA 2EIJC 3ZSUA 1ZHYA 1MMNA 1D1CA 1MNEA 3C63A 2NSGA 2H7VC 1NLXA 1N1CA 4N6HA 1L3PA 2YKZA 3FMSA 3GM3A 2NUPB 4J7YA 2HUJA 4MNDA 4N4WA 4PJLA 4C7OB 2NPUA 4XLNF 2VCBA 1BR2A 5DQZA 3NMJA 2M64A 5HSWA 5AC4A 4CDYA 5KYYA 3TULA 4HFKB 4EWCA 1G4WR 1TWGA 3SXYA 4CS9A 2IXPA 2EPKX 2CYDA 3GWNA 3U2LA 2XLHA 3V5XA 3RIPA 1M2OA 1WATA 3GM1A 4PR9A 1GGQA 4YN0B 3KH2A 3R2PA 2QY9A 5DVWA 1LIHA 1WTYA 4FESA 5L0HA 4U5DE 1HW1A 2HSBA 5EHHA 2GDCA 4OD5A 3LS0A 3I5QA 5CI8A 4U9DA 2HJMA 2Y3GA 2WL8A 5COFA 3MYIA 1QPUA 3I5PA 3DKAA 5K0IA 1Y6DA 3EFOB 2EIKC 5COMA 4CDVA 1WGWA 2A1DD 2KGOA 5D91A 3ZWIA 5F5FA 1M56C 3ZDLA 3S0XA 2W4BA 1YZCA 2KNHA 2M4EA 3ZQYA 4O79A 2W9YA 3ECSA 1EQ1A 2XL4A 1DOWA 1M2VB 2DYRC 4YT8A 2I8BA 1T01A 2EPNA 2P61A 4MS2A 4PK4A 4DRHB 2XM4A 3SZRA 5DLJA 4N6CA 4PJMA 2CNWD 1OCCC 1QLEC 1U6HA 3EH1A 4Z9IA 3A11A 3U5SA 3JYYA 4Z9JA 2GWWA 4MVSA 3HTKC 3US6A 1OR3A 3M4CA 2L7AA 3SXKA 1H9TA 4I3MA 4JW1A 4BPMA 4EBBA 1KTMA 4W8PA 4JEAA 2FGYA 1NFOA 1QVXA 4NC3A 2AWYA 2OCCC 3EHMA 2NG1A 2R7SA 4MTOA 1RKEB 4LACB 1SZIA 4EIYA 4L6RA 2HFIA 2P0NA 2A68F 3LS1A 3N0TA 4H4KC 3JTLO 3HNLA 2XRHA 1QSPA 3S9OA 3B0PA 3VAYA 2HJ3A 3RVZA 3KMIA 3NKDA 2PNOA 2R7RA 1ZHZA 2A6EF 1MMAA 1RJ9B 5AGFA 4E17A 3SYNA 3U0CA 4WABA 4MVRA 2H7BA 4FAPB 3E9VA 2LP4A 3C8ZA 1BDJB 2XLWA 1KNYA 3TOMA 4G7OF 4PJJA 2VH3A 1G4US 4P9TA 4U5FE 2G62A 1NFNA 2G3KA 3EG9A 3DE8A 3K66A 2WZLA 4LLCA 4J32B 2FFHA 1QQ3A 4O6NA 2XLDA 3NYLA 3TOLA 3UNGC 4IWBA 4CS7A 1FR0A 2LK4A 4CS9C 4BJ5C 3QVYA 5KYUB 1I5NA 1LPEA 3LJBA 3KKBA 2WVOA 1YJGA 3EZIA 3B29A 3DM5A 5EK0A 5L0DA 4EBJA 3DJNB 4K0DA 4E0IA 3HKKA 5KYWB 2OJQA 5L0IA 3UR3C 3CEXA 2CNWA 5DQTA 3RKOF 1FFTC 4CBEA 1M6TA 3NMKA 3O55A 2E87A 3JCUQ 3NG1A 3E70C 3W2WA 2R7OA 3AGTA 1AEPA 1F1MA 1IZMA 3GEIA 3QZCA 4MW8A 2J45A 1YAUO 4ANJA 5L0FA 2F22A 3ZVRA 2MYSA 3EG9B 3UGOA 1FMVA 3LNRA 1WOLA 3KL4A 3S27A 3L1MA 5B3SC 4KI2A 1T6IA 4CS8A 2KC3A 2LSEA 2UUIA 3EGXA 4YT2A 3FDQA 3DM9B 3C8GD 2YZSA 4JJGA 3PHF2 3C62A 3FXHA 4JTAB 4QDLA 3GM2A 4XEFA 3X2QC 2EIMC 3LEVA 2VCCA 3EJNA 1LM3B 1OW8A 2LFFA 2IBFA 2LQGA 2MWQA 2J0XA 3H65A 1I4ZA 3ZIBA 4BJTA 3AQCA 3JSEO 4DBRA 1T6UA 4IGGA 1A7DA 4JZAA 3U9MA 3IQTA 4YL0A 4NCQA 1D1AA 4X0RA 3UMKA 1E85A 1BR1A 3NDBB 2R7UA 3TQOA 256BA 3LAYA 3CAXA 3LLIA 2CW0F 3CQZA 4ZLCA 3R7CA 3NMIA 4W8KA 3IHUA 1E2XA 1NZEA 2V26A 5D92A 3T4RA 4BEJA 3EQLF 4HEAJ 2J9BA 2H7OA 4BJ1A 1Z5ZA 3O10A 2WB7A 2Q9BA 4F4BA 1A7VA 3KPHA 2KJGA 4DVYP 1YDIA 5CI9A 1R5ID 1YZAA 1M2VA 1KU2A 4XEVA 1VTMP 1RMVA 2PP4A 2EILC 3IQ6A 2EPOA 3Q6MA 4LLEA 3SNHA 4JVSA 1D1BA 1K40A 3ZTMA 5DS4A 3EGDA 2A69F 2R9RB 2CCYA 3LLKA 2LIGA 4AL0A 1IW7F 2B0JA 2GAQA 3G50A 4K1OA 3W8HA 5JVEA 5B1BC 1T5OA 2LCHA 2W45A 2ZXWC 1PCXA 3L8JA 1OCRC 2J9UA 5TJ5E 4OIOF 3LESA 4UDVA 2J46A 1ORSC 2R05A 3Q7LA 1T6QA 2Q00A 1C02A 5E2QA 1JPNA 5A69A 1HW2A 2PBEA 3JZ0A 3K1HA 5JT4A 3RQGA 1D0YA 3CZ6A 2VB6A 4XPWA 3HJCA 3H2UA 2Q9AA 4DRIB 3AG2C 1Z6AA 4PFOA 2J9WA 1AUEA 2XS1A 2HMQA 2YQYA 3EGDB 4O6YA 4XPXA 2PFDA 3U8VA 3DZAA 3G4XA 1E83A 3FAJA 4KC9A 1W2WA 1Q0KA 2O9XA 4AX2A 3RF3A 1BZ4A 4XLPF 1S05A 2VASA 2AU5A 4M63A 4O7GA 3OA1A 2B0HA 3AG3C 1R4TA 4R32A 1GM5A 1ZU4A 1YYXA 3W8IA 2DGJA 4CDAA 3RFYA 4U9EA 4PJNA 2OU6A 4U5EE 4BEMJ 2MHRA 3B9QA 4Q7CA 2AVKA 5BUOA 3SXZA 4A4AA 4HFFB 4Q5SF 2EPLX 5A6BA 4NQFA 3W4YA 4CSAC 3DMDA 2IYLD 2VCAA 2ZXPA 3S29A 2P7VA 2OEXA 3ITFA 2XL6A 2YHSA 3HNJA 5BQHA 1VYIA 5GPGB 4MVZA 5T1DB 4FWVA 1ST6A 4LDKA 2HZ8A 1MMGA 2GFHA 2Q7RA 3J06A 2Q4FA 3RW0A 2QE9A 2XLVA 2A0UA 1J8YF 2X51A 3RQFA 4MW3A 4AK9A 3V5YA 4N06A 1Q0FA 2LD6A 3HNKA 1O87A 2ASRA 1YARO 4J7TA 4JIOA 2CDQA 4C3BA 3WG7C 2AWCA 2XXAA 2IXNA 2Z15A 4I1MA
chains in the Genus database with same CATH topology
2ZPAA 3NRHA 3EFOA 1FTSA 5KYNA 2W4MA 1TKNA 4E7ZA 3EH2A 2Q9CA 2R7WA 1PD0A 4OIPF 3O39A 3T6JA 1LKXA 4OIRF 4G0HA 4KNWA 3JSZA 2HV7A 3FVYA 5KYUA 5T3TA 2KW3C 3O6XA 1SMYF 4OINF 1O5HA 1Z23A 2ZXRA 4C7OA 3MX3A 1RJ9A 3T6BA 4LERA 4YT5A 3IEEA 4YJWA 2YEVA 3NYJA 1FMWA 2C04A 2IXNA 4BJ6C 3EZHA 4QI0A 2CGEA 1M57C 2L81A 1MMDA 3DJUB 4PFPA 1OQCA 5E3AA 2NUTA 4JJFA 3CSKA 4GEHA 3V7OA 4K7BA 4CSAA 4Q4ZF 4U5CE 2IXOA 3DD7A 1ZHTA 4JCHA 2J7PD 3SP1A 3GWLA 4KNVA 3EGXB 1JRAA 4QI2A 2JD3A 2PX0A 1G8XA 3B0VC 3K33A 1ZYRF 4HE8D 2Y69C 4E7SA 2C03A 2WVQA 3DXJF 3W2VA 1BR4A 3X1OA 1FFHA 4O6MA 2R7XA 3EHNA 4OIQF 3F47A 4RBNA 2J0WA 4P6IC 1VK5A 5KYWA 3PMRA 2WZGA 4IRUA 1OKKD 2WVNA 5EGYA 3M1CB 4XWJA 5E3CA 1TWAA 3EPVA 3UMIA 1ZU5A 3UMHA 3Q6NA 1Z3IX 4DBQA 4IJJA 1ZHXA 1VYKA 2NUPA 3GODA 4RD9A 2Y3HA 3N24A 2KQ9A 3TD7A 1LVKA 3K7DA 2QTVA 2A6HF 2EINC 1D0XA 2OG2A 2ZXOA 2Y3BA 1J8MF 4CS8C 4YWQA 3AQBA 2Y39A 2IOQA 2D5RB 4AE4B 4J30B 3MLGA 3K1IC 4U5GA 2L9JA 2BE5F 3I4UA 5FCLA 5E33A 1VMAA 3NKEA 3DAFA 1NU9C 4KBLA 4G7ZF 4ZLDA 5L3VA 5KYXB 3ASNC 1S7ZA 1D0ZA 5KYXA 3MBGA 3S28A 3QMKA 3RYLA 3UGPA 3L0IA 2G3VA 3F46A 4ULWA 1QZXA 4I44A 5IY5C 1ZHWA 3HLZA 4NY3A 2J7PA 3AG1C 5DS6A 4XTKA 2PX3A 2V3CC 3OEOA 4JURI 4GYTA 3ZG1A 1NU7D 2WZFA 2NUTB 3SEOA 2IXMA 3TK0A 5KYYB 4YT4A 2Q3TA 4FX5A 4CIHA 3ABKC 3N2ZB 3AG4C 3OWTA 3NYMA 4I1OB 1SF8A 4A2NB 4G7HF 1Z63A 3JYHA 1OCZC 3POVA 5B1AC 1NG1A 2DYSC 4C3DA 4U5HA 1JPJA 3ZC4A 3JRTA 3ABMC 5L3QA 1JR8A 2R7QA 2PF4E 3DAGA 3B0UX 2P6VA 4E0HA 1PD1A 3JT1A 1TWHA 4DVZA 3L34A 5T3WA 3VYWA 5DS5A 2XSEA 3U2MA 2XXAB 4U5BE 4IAOA 4MQ9F 1OCOC 1VOMA 5F5HA 4RDAA 2HV6A 4OD4A 2R7VA 4BG0A 4B6IA 1LS1A 2R7TA 2Y3DA 3K6BA 4WJ0A 1MNDA 1TR2A 1V55C 4AE4A 4BJ6A 4C3EA 1OKKA 3FHDA 4BJ5A 3WODF 3GANA 1V54C 3RH3A 3ABLC 1TWCA 3ASOC 2J9VA 2EIJC 3ZSUA 1ZHYA 1MMNA 1D1CA 1MNEA 2H7VC 1N1CA 2NUPB 4PJLA 4MNDA 4C7OB 4XLNF 1BR2A 5DQZA 5HSWA 5KYYA 4HFKB 4EWCA 1TWGA 4CS9A 2IXPA 3GWNA 3U2LA 3RIPA 1M2OA 4YN0B 5DVWA 3KH2A 2QY9A 4FESA 4U5DE 5EHHA 5CI8A 4OD5A 3LS0A 3I5QA 2Y3GA 2WL8A 3I5PA 3EFOB 2EIKC 1WGWA 2A1DD 2KGOA 5D91A 5F5FA 1M56C 3S0XA 2W4BA 2KNHA 2M4EA 4O79A 2W9YA 3ECSA 2XL4A 2DYRC 1M2VB 4YT8A 2I8BA 4PK4A 3SZRA 5DLJA 4PJMA 2CNWD 1OCCC 1QLEC 3EH1A 3U5SA 3HTKC 4I3MA 4JW1A 4EBBA 2FGYA 2OCCC 3EHMA 2NG1A 2R7SA 4LACB 1SZIA 3N0TA 2A68F 3LS1A 4H4KC 2XRHA 3B0PA 3VAYA 2HJ3A 3KMIA 3NKDA 2R7RA 1ZHZA 2A6EF 1MMAA 1RJ9B 3SYNA 2H7BA 3E9VA 4G7OF 4PJJA 2VH3A 4U5FE 2G62A 3EG9A 2G3KA 3K66A 2WZLA 4LLCA 4J32B 2FFHA 4O6NA 3UNGC 5DS4A 3NYLA 4IWBA 4CS7A 4CS9C 4BJ5C 5KYUB 3LJBA 3KKBA 2WVOA 3EZIA 3DM5A 3DJNB 4K0DA 4E0IA 5KYWB 3UR3C 5DQTA 2CNWA 3RKOF 1FFTC 4CBEA 3O55A 2E87A 3JCUQ 3NG1A 3E70C 3W2WA 2R7OA 1IZMA 3QZCA 2J45A 4ANJA 3ZVRA 2MYSA 3EG9B 3UGOA 1FMVA 3LNRA 3KL4A 3S27A 5B3SC 4KI2A 4CS8A 2LSEA 3EGXA 4YT2A 3FDQA 3DM9B 3PHF2 2YZSA 4JJGA 4QDLA 3X2QC 2EIMC 3LEVA 3EJNA 4DOZA 2MWQA 3ZIBA 3H65A 4BJTA 2J0XA 3AQCA 4DBRA 4JZAA 3UMKA 1D1AA 4X0RA 2R7UA 1BR1A 3NDBB 3LAYA 3LLIA 2CW0F 3CQZA 4ZLCA 3R7CA 4W8KA 1NZEA 5D92A 2V26A 3T4RA 4BEJA 3EQLF 4HEAJ 2H7OA 4BJ1A 1Z5ZA 2WB7A 2Q9BA 4F4BA 4DVYP 2KJGA 5CI9A 1M2VA 1KU2A 2PP4A 2EILC 4LLEA 3Q6MA 3SNHA 4JVSA 1D1BA 3EGDA 2A69F 3LLKA 1IW7F 2B0JA 3W8HA 5B1BC 2W45A 2ZXWC 1PCXA 1OCRC 2J9UA 4OIOF 3LESA 2J46A 3Q7LA 5E2QA 1JPNA 3K1HA 1D0YA 3CZ6A 2VB6A 3HJCA 2Q9AA 3AG2C 1Z6AA 4PFOA 2J9WA 4O6YA 3EGDB 2PFDA 3DZAA 3FAJA 4KC9A 1W2WA 2O9XA 4AX2A 4XLPF 2VASA 4M63A 4O7GA 3OA1A 3AG3C 1ZU4A 3W8IA 2DGJA 3RFYA 4PJNA 4U5EE 3B9QA 4Q7CA 5BUOA 4HFFB 4Q5SF 3W4YA 4CSAC 3DMDA 2IYLD 2ZXPA 3S29A 2P7VA 3ITFA 2YHSA 1VYIA 5T1DB 4FWVA 1ST6A 4LDKA 1MMGA 2GFHA 2X51A 1J8YF 4AK9A 4N06A 1O87A 4C3BA 2XXAA 2CDQA 3WG7C 3Q7GA 2Z15A 4I1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWL A;  1OQC A;  4E0I A;  3MBG A;  3R7C A;  3U5S A;  3LLK A;  3TK0 A;  3U2M A;  3TD7 A;  3W4Y A;  2HJ3 A;  3GWN A;  4LDK A;  3U2L A;  4E0H A;  3O55 A;  1JR8 A;  1JRA A;  3LLI A; 
#chains in the Genus database with same CATH topology
 1TFK B;  2ZPA A;  2XLE A;  3EFO A;  3NRH A;  5BQG A;  4D4X A;  4JRZ A;  3S84 A;  3U3B A;  1FTS A;  5KYN A;  1AVO B;  1EA8 A;  2YLG A;  2W4M A;  4LDQ A;  4D4N A;  1TKN A;  4E7Z A;  3IQC A;  2AP3 A;  3EH2 A;  1VLT A;  1U89 A;  2Q9C A;  2R7W A;  1PD0 A;  1C03 A;  4IB4 A;  2XS8 A;  2EPM X;  4OIP F;  3O39 A;  3T6J A;  1LKX A;  4OIR F;  4G0H A;  4KNW A;  2DB4 A;  3JSZ A;  1FNT c;  3ZQV A;  2HV7 A;  1WN0 A;  2KYH A;  3FVY A;  5KYU A;  5T3T A;  1GS9 A;  4MVU A;  2KW3 C;  4AL1 A;  3O6X A;  1SMY F;  4OIN F;  1O5H A;  1Z23 A;  1ZW3 A;  1OW7 A;  2ZXR A;  3HNI A;  4C7O A;  2BC5 A;  4WGZ A;  3K1I A;  1T9K A;  1B68 A;  2IM8 A;  3VM6 A;  2QNL A;  4JTD B;  3MX3 A;  1HMD A;  1RJ9 A;  1ZZP A;  4LER A;  3RVY A;  3T6B A;  3QVZ A;  4H54 A;  3IEE A;  4YT5 A;  1OW6 A;  4YJW A;  5A6K A;  1HMO A;  2YEV A;  3NYJ A;  1FMW A;  2C04 A;  4BJ6 C;  2NSF A;  3EZH A;  4QI0 A;  2CGE A;  1M57 C;  3C8G B;  2L81 A;  3T9O A;  1MMD A;  3SXM A;  1NSG B;  1RKE A;  2R25 A;  3DJU B;  4GQH A;  4PFP A;  1OQC A;  3GOR A;  5E3A A;  5FZT A;  4JJF A;  2NUT A;  1OXB A;  1LI7 A;  2OOC A;  3BRJ A;  2DI3 A;  3CSK A;  5BQI A;  4JCZ A;  4GEH A;  3BEH A;  4MTF A;  2YL7 A;  3V7O A;  4K7B A;  2RSE B;  1ZVZ A;  4CSA A;  4Q4Z F;  1APC A;  4U5C E;  2IXO A;  4DRJ B;  3DD7 A;  1ZHT A;  4JCH A;  2J7P D;  3SP1 A;  3B71 A;  2JX0 A;  3GWL A;  4KNV A;  3PCV A;  1E86 A;  2R02 A;  3A9C A;  1EKY A;  3GEE A;  3V5Z A;  3EGX B;  5HV9 A;  3LEO A;  1JRA A;  2L6F A;  5JS5 A;  2OKU A;  4YL3 A;  2JD3 A;  4EUK B;  4QI2 A;  2PX0 A;  1G8X A;  3B0V C;  3K33 A;  1ZYR F;  4HE8 D;  2LFD A;  1H9G A;  2Y69 C;  2ICW G;  3AOU A;  2C03 A;  2WVQ A;  3DXJ F;  3W2V A;  3WAQ A;  4E7S A;  1GQA A;  2RD9 A;  1HE1 A;  4CX9 A;  1V4A A;  2YL1 A;  3QTH A;  1BR4 A;  2X0C A;  3X1O A;  1EI7 A;  4ONS A;  1FFH A;  1HE9 A;  4O6M A;  2R7X A;  3EHN A;  4PAC A;  3F47 A;  4RBN A;  3RQE A;  4OIQ F;  2J0W A;  2OQM A;  4DJ9 A;  1OXK A;  2XL8 A;  4P6I C;  1VK5 A;  1MQV A;  5KYW A;  3PMR A;  1DOV A;  1K04 A;  2WZG A;  4IRU A;  1OKK D;  3ZTZ A;  3U3F A;  2YL3 A;  4MVQ A;  2WVN A;  3TJ5 A;  3M1C B;  4XWJ A;  5EGY A;  5E3C A;  1TWA A;  2ETS A;  3EPV A;  3UMI A;  1ZU5 A;  3UMH A;  1ZW2 A;  1L7C A;  1TFO B;  3Q6N A;  1Z3I X;  1CPR A;  1FAP B;  2A0B A;  3KYI A;  4DBQ A;  4G78 A;  1YA9 A;  4IJJ A;  1ZHX A;  1VYK A;  2NUP A;  3ATP A;  1SYQ A;  3GOD A;  4RD9 A;  3FAP B;  2Y3H A;  3N24 A;  2QUP A;  1YA7 O;  1Q0D A;  2KQ9 A;  4YL1 A;  3TD7 A;  2JPU A;  1LVK A;  1C17 M;  2L6H A;  1SR2 A;  4NTB A;  3K7D A;  1G5Z A;  2HS5 A;  2QTV A;  1YVI A;  3DI5 A;  4XPY A;  2D4U A;  1XZP A;  2A6H F;  2EIN C;  5JUA A;  2FAP B;  1D0X A;  2OG2 A;  1A41 A;  3FOP A;  1J8M F;  2Y3B A;  2ZXO A;  4CS8 C;  4YWQ A;  1WAS A;  1JMW A;  3AQB A;  2YVK A;  1K05 A;  4DXW A;  2Y39 A;  4IAR A;  5A6A A;  1Z7Q c;  2IOQ A;  1RCP A;  4ER9 A;  2D5R B;  4AE4 B;  3S90 A;  1OR2 A;  2KK1 A;  1UG7 A;  4J30 B;  2BL2 A;  3MLG A;  3K1I C;  4Z9H A;  4U5G A;  2L9J A;  3M4B A;  2VC9 A;  2BE5 F;  3I4U A;  5JLI A;  4JC7 A;  5FCL A;  1PV3 A;  2I15 A;  1VMA A;  3NKE A;  3DAF A;  5E33 A;  1NU9 C;  4KBL A;  3C18 A;  3VRC A;  4G7Z F;  2HKV A;  4ZLD A;  1NBB A;  5L3V A;  5KYX B;  3ASN C;  4JKV A;  1S7Z A;  1D0Z A;  5KYX A;  3MBG A;  3Q7G A;  3T6G B;  3S28 A;  3WHN A;  2XM0 A;  3QMK A;  3RYL A;  3UGP A;  1JAF A;  1XZQ A;  2G3V A;  2YWA A;  3F46 A;  3L0I A;  4ULW A;  1QZX A;  1VLS A;  1VB5 A;  1ZHW A;  4I44 A;  5IY5 C;  3HLZ A;  3LUT B;  4NY3 A;  2J7P A;  3AG1 C;  5DS6 A;  4YK5 A;  1H6G A;  3JRM O;  4XTK A;  2R03 A;  4WGY A;  2PX3 A;  5CIV A;  2L6G A;  2V3C C;  3OEO A;  4JUR I;  4GYT A;  4XQ1 A;  3M15 A;  3ZG1 A;  1NU7 D;  2H8A A;  2KSF A;  4CJO A;  2HSQ A;  2WZF A;  1CGN A;  1O3U A;  4P9F A;  5COG A;  2NUT B;  3SEO A;  3H2V A;  2IXM A;  3TK0 A;  1YLM A;  3C8G A;  3IPM O;  2YLD A;  5KYY B;  1Q0M A;  1ORY A;  2Q3T A;  4MVM A;  4YT4 A;  4FX5 A;  4CIH A;  3QW1 A;  4JE9 A;  1BBH A;  3ABK C;  3N2Z B;  3M79 A;  4JEB A;  3U9J A;  1QKR A;  2HMZ A;  1LS4 A;  3AG4 C;  3DE9 A;  3NYM A;  3OWT A;  5JP7 A;  3L8I A;  4I1O B;  1SF8 A;  4A2N B;  4MTG A;  4G7H F;  1Z63 A;  3JYH A;  3FOO A;  3PDM P;  2QLA A;  1OCZ C;  3POV A;  5B1A C;  3MFN A;  5JRA A;  1NG1 A;  1TQG A;  2DYS C;  1I4Y A;  3KYJ A;  1HY5 A;  5F28 E;  4LDR A;  4C3D A;  4U5H A;  5AC5 A;  1JPJ A;  3AJM A;  3ZC4 A;  5A6J A;  5L0J A;  3MYF A;  3G4Z A;  3JRT A;  2YLI A;  1CGO A;  3ABM C;  5JSL A;  5L0C A;  5L3Q A;  1Q0G A;  2TMV P;  4ULV A;  1Y4C A;  1LE4 A;  1JR8 A;  2UUH A;  2R7Q A;  2PF4 E;  1RKC A;  1CPQ A;  2ZD9 A;  3DAG A;  3B0U X;  2P6V A;  1U0B B;  1ORJ A;  1PD1 A;  4E0H A;  1A0B A;  1XWJ A;  5L0G A;  3JT1 A;  1TWH A;  3AGU A;  3L34 A;  5T3W A;  3VYW A;  4DVZ A;  2XSE A;  4EHP A;  5DS5 A;  1UFB A;  1CGM E;  1A7E A;  1LE2 A;  1WWP A;  3C7J A;  3U2M A;  4U5B E;  4IAO A;  4DOZ A;  3QW0 A;  2P1A A;  5B3I A;  2XXA B;  1JOG A;  4MQ9 F;  1OCO C;  1VOM A;  2OJE D;  5F5H A;  2XLO A;  4EKW A;  4RDA A;  2HV6 A;  4OD4 A;  3TJ6 A;  1LI5 A;  3GEH A;  2R7V A;  4BG0 A;  2YL0 A;  1LS1 A;  2YRF A;  2XLM A;  4B6I A;  4CJG A;  2R7T A;  2Y3D A;  5A6B D;  1RXQ A;  3K6B A;  4MVO A;  3IQ5 A;  4XEK A;  2GA0 A;  4WJ0 A;  4NTA A;  1MND A;  1TR2 A;  3DWW A;  1E84 A;  1V55 C;  4AE4 A;  4BJ6 A;  4CIP A;  4C3E A;  1OKK A;  3U8P A;  1H7I A;  3FHD A;  4BJ5 A;  4NTF A;  4E18 A;  3WOD F;  3GAN A;  4IAQ A;  2J8W A;  1V54 C;  3LNM B;  4EBK A;  3RH3 A;  3VF0 A;  2OEV A;  3ABL C;  1V74 B;  1TWC A;  1YYJ A;  3ASO C;  4JTC B;  2J9V A;  2EIJ C;  3ZSU A;  1ZHY A;  1MMN A;  1D1C A;  1MNE A;  3C63 A;  2NSG A;  2H7V C;  1NLX A;  1N1C A;  4N6H A;  1L3P A;  2YKZ A;  3FMS A;  3GM3 A;  2NUP B;  4J7Y A;  2HUJ A;  4MND A;  4N4W A;  4PJL A;  4C7O B;  2NPU A;  4XLN F;  2VCB A;  1BR2 A;  5DQZ A;  3NMJ A;  2M64 A;  5HSW A;  5AC4 A;  4CDY A;  5KYY A;  3TUL A;  4HFK B;  4EWC A;  1G4W R;  1TWG A;  3SXY A;  4CS9 A;  2IXP A;  2EPK X;  2CYD A;  3GWN A;  3U2L A;  2XLH A;  3V5X A;  3RIP A;  1M2O A;  1WAT A;  3GM1 A;  4PR9 A;  1GGQ A;  4YN0 B;  3KH2 A;  3R2P A;  2QY9 A;  5DVW A;  1LIH A;  1WTY A;  4FES A;  5L0H A;  4U5D E;  1HW1 A;  2HSB A;  5EHH A;  2GDC A;  4OD5 A;  3LS0 A;  3I5Q A;  5CI8 A;  4U9D A;  2HJM A;  2Y3G A;  2WL8 A;  5COF A;  3MYI A;  1QPU A;  3I5P A;  3DKA A;  5K0I A;  1Y6D A;  3EFO B;  2EIK C;  5COM A;  4CDV A;  1WGW A;  2A1D D;  2KGO A;  5D91 A;  3ZWI A;  5F5F A;  1M56 C;  3ZDL A;  3S0X A;  2W4B A;  1YZC A;  2KNH A;  2M4E A;  3ZQY A;  4O79 A;  2W9Y A;  3ECS A;  1EQ1 A;  2XL4 A;  1DOW A;  1M2V B;  2DYR C;  4YT8 A;  2I8B A;  1T01 A;  2EPN A;  2P61 A;  4MS2 A;  4PK4 A;  4DRH B;  2XM4 A;  3SZR A;  5DLJ A;  4N6C A;  4PJM A;  2CNW D;  1OCC C;  1QLE C;  1U6H A;  3EH1 A;  4Z9I A;  3A11 A;  3U5S A;  3JYY A;  4Z9J A;  2GWW A;  4MVS A;  3HTK C;  3US6 A;  1OR3 A;  3M4C A;  2L7A A;  3SXK A;  1H9T A;  4I3M A;  4JW1 A;  4BPM A;  4EBB A;  1KTM A;  4W8P A;  4JEA A;  2FGY A;  1NFO A;  1QVX A;  4NC3 A;  2AWY A;  2OCC C;  3EHM A;  2NG1 A;  2R7S A;  4MTO A;  1RKE B;  4LAC B;  1SZI A;  4EIY A;  4L6R A;  2HFI A;  2P0N A;  2A68 F;  3LS1 A;  3N0T A;  4H4K C;  3JTL O;  3HNL A;  2XRH A;  1QSP A;  3S9O A;  3B0P A;  3VAY A;  2HJ3 A;  3RVZ A;  3KMI A;  3NKD A;  2PNO A;  2R7R A;  1ZHZ A;  2A6E F;  1MMA A;  1RJ9 B;  5AGF A;  4E17 A;  3SYN A;  3U0C A;  4WAB A;  4MVR A;  2H7B A;  4FAP B;  3E9V A;  2LP4 A;  3C8Z A;  1BDJ B;  2XLW A;  1KNY A;  3TOM A;  4G7O F;  4PJJ A;  2VH3 A;  1G4U S;  4P9T A;  4U5F E;  2G62 A;  1NFN A;  2G3K A;  3EG9 A;  3DE8 A;  3K66 A;  2WZL A;  4LLC A;  4J32 B;  2FFH A;  1QQ3 A;  4O6N A;  2XLD A;  3NYL A;  3TOL A;  3UNG C;  4IWB A;  4CS7 A;  1FR0 A;  2LK4 A;  4CS9 C;  4BJ5 C;  3QVY A;  5KYU B;  1I5N A;  1LPE A;  3LJB A;  3KKB A;  2WVO A;  1YJG A;  3EZI A;  3B29 A;  3DM5 A;  5EK0 A;  5L0D A;  4EBJ A;  3DJN B;  4K0D A;  4E0I A;  3HKK A;  5KYW B;  2OJQ A;  5L0I A;  3UR3 C;  3CEX A;  2CNW A;  5DQT A;  3RKO F;  1FFT C;  4CBE A;  1M6T A;  3NMK A;  3O55 A;  2E87 A;  3JCU Q;  3NG1 A;  3E70 C;  3W2W A;  2R7O A;  3AGT A;  1AEP A;  1F1M A;  1IZM A;  3GEI A;  3QZC A;  4MW8 A;  2J45 A;  1YAU O;  4ANJ A;  5L0F A;  2F22 A;  3ZVR A;  2MYS A;  3EG9 B;  3UGO A;  1FMV A;  3LNR A;  1WOL A;  3KL4 A;  3S27 A;  3L1M A;  5B3S C;  4KI2 A;  1T6I A;  4CS8 A;  2KC3 A;  2LSE A;  2UUI A;  3EGX A;  4YT2 A;  3FDQ A;  3DM9 B;  3C8G D;  2YZS A;  4JJG A;  3PHF 2;  3C62 A;  3FXH A;  4JTA B;  4QDL A;  3GM2 A;  4XEF A;  3X2Q C;  2EIM C;  3LEV A;  2VCC A;  3EJN A;  1LM3 B;  1OW8 A;  2LFF A;  2IBF A;  2LQG A;  2MWQ A;  2J0X A;  3H65 A;  1I4Z A;  3ZIB A;  4BJT A;  3AQC A;  3JSE O;  4DBR A;  1T6U A;  4IGG A;  1A7D A;  4JZA A;  3U9M A;  3IQT A;  4YL0 A;  4NCQ A;  1D1A A;  4X0R A;  3UMK A;  1E85 A;  1BR1 A;  3NDB B;  2R7U A;  3TQO A;  256B A;  3LAY A;  3CAX A;  3LLI A;  2CW0 F;  3CQZ A;  4ZLC A;  3R7C A;  3NMI A;  4W8K A;  3IHU A;  1E2X A;  1NZE A;  2V26 A;  5D92 A;  3T4R A;  4BEJ A;  3EQL F;  4HEA J;  2J9B A;  2H7O A;  4BJ1 A;  1Z5Z A;  3O10 A;  2WB7 A;  2Q9B A;  4F4B A;  1A7V A;  3KPH A;  2KJG A;  4DVY P;  1YDI A;  5CI9 A;  1R5I D;  1YZA A;  1M2V A;  1KU2 A;  4XEV A;  1VTM P;  1RMV A;  2PP4 A;  2EIL C;  3IQ6 A;  2EPO A;  3Q6M A;  4LLE A;  3SNH A;  4JVS A;  1D1B A;  1K40 A;  3ZTM A;  5DS4 A;  3EGD A;  2A69 F;  2R9R B;  2CCY A;  3LLK A;  2LIG A;  4AL0 A;  1IW7 F;  2B0J A;  2GAQ A;  3G50 A;  4K1O A;  3W8H A;  5JVE A;  5B1B C;  1T5O A;  2LCH A;  2W45 A;  2ZXW C;  1PCX A;  3L8J A;  1OCR C;  2J9U A;  5TJ5 E;  4OIO F;  3LES A;  4UDV A;  2J46 A;  1ORS C;  2R05 A;  3Q7L A;  1T6Q A;  2Q00 A;  1C02 A;  5E2Q A;  1JPN A;  5A69 A;  1HW2 A;  2PBE A;  3JZ0 A;  3K1H A;  5JT4 A;  3RQG A;  1D0Y A;  3CZ6 A;  2VB6 A;  4XPW A;  3HJC A;  3H2U A;  2Q9A A;  4DRI B;  3AG2 C;  1Z6A A;  4PFO A;  2J9W A;  1AUE A;  2XS1 A;  2HMQ A;  2YQY A;  3EGD B;  4O6Y A;  4XPX A;  2PFD A;  3U8V A;  3DZA A;  3G4X A;  1E83 A;  3FAJ A;  4KC9 A;  1W2W A;  1Q0K A;  2O9X A;  4AX2 A;  3RF3 A;  1BZ4 A;  4XLP F;  1S05 A;  2VAS A;  2AU5 A;  4M63 A;  4O7G A;  3OA1 A;  2B0H A;  3AG3 C;  1R4T A;  4R32 A;  1GM5 A;  1ZU4 A;  1YYX A;  3W8I A;  2DGJ A;  4CDA A;  3RFY A;  4U9E A;  4PJN A;  2OU6 A;  4U5E E;  4BEM J;  2MHR A;  3B9Q A;  4Q7C A;  2AVK A;  5BUO A;  3SXZ A;  4A4A A;  4HFF B;  4Q5S F;  2EPL X;  5A6B A;  4NQF A;  3W4Y A;  4CSA C;  3DMD A;  2IYL D;  2VCA A;  2ZXP A;  3S29 A;  2P7V A;  2OEX A;  3ITF A;  2XL6 A;  2YHS A;  3HNJ A;  5BQH A;  1VYI A;  5GPG B;  4MVZ A;  5T1D B;  4FWV A;  1ST6 A;  4LDK A;  2HZ8 A;  1MMG A;  2GFH A;  2Q7R A;  3J06 A;  2Q4F A;  3RW0 A;  2QE9 A;  2XLV A;  2A0U A;  1J8Y F;  2X51 A;  3RQF A;  4MW3 A;  4AK9 A;  3V5Y A;  4N06 A;  1Q0F A;  2LD6 A;  3HNK A;  1O87 A;  2ASR A;  1YAR O;  4J7T A;  4JIO A;  2CDQ A;  4C3B A;  3WG7 C;  2AWC A;  2XXA A;  2IXN A;  2Z15 A;  4I1M A; 
#chains in the Genus database with same CATH homology
 2ZPA A;  3NRH A;  3EFO A;  1FTS A;  5KYN A;  2W4M A;  1TKN A;  4E7Z A;  3EH2 A;  2Q9C A;  2R7W A;  1PD0 A;  4OIP F;  3O39 A;  3T6J A;  1LKX A;  4OIR F;  4G0H A;  4KNW A;  3JSZ A;  2HV7 A;  3FVY A;  5KYU A;  5T3T A;  2KW3 C;  3O6X A;  1SMY F;  4OIN F;  1O5H A;  1Z23 A;  2ZXR A;  4C7O A;  3MX3 A;  1RJ9 A;  3T6B A;  4LER A;  4YT5 A;  3IEE A;  4YJW A;  2YEV A;  3NYJ A;  1FMW A;  2C04 A;  2IXN A;  4BJ6 C;  3EZH A;  4QI0 A;  2CGE A;  1M57 C;  2L81 A;  1MMD A;  3DJU B;  4PFP A;  1OQC A;  5E3A A;  2NUT A;  4JJF A;  3CSK A;  4GEH A;  3V7O A;  4K7B A;  4CSA A;  4Q4Z F;  4U5C E;  2IXO A;  3DD7 A;  1ZHT A;  4JCH A;  2J7P D;  3SP1 A;  3GWL A;  4KNV A;  3EGX B;  1JRA A;  4QI2 A;  2JD3 A;  2PX0 A;  1G8X A;  3B0V C;  3K33 A;  1ZYR F;  4HE8 D;  2Y69 C;  4E7S A;  2C03 A;  2WVQ A;  3DXJ F;  3W2V A;  1BR4 A;  3X1O A;  1FFH A;  4O6M A;  2R7X A;  3EHN A;  4OIQ F;  3F47 A;  4RBN A;  2J0W A;  4P6I C;  1VK5 A;  5KYW A;  3PMR A;  2WZG A;  4IRU A;  1OKK D;  2WVN A;  5EGY A;  3M1C B;  4XWJ A;  5E3C A;  1TWA A;  3EPV A;  3UMI A;  1ZU5 A;  3UMH A;  3Q6N A;  1Z3I X;  4DBQ A;  4IJJ A;  1ZHX A;  1VYK A;  2NUP A;  3GOD A;  4RD9 A;  2Y3H A;  3N24 A;  2KQ9 A;  3TD7 A;  1LVK A;  3K7D A;  2QTV A;  2A6H F;  2EIN C;  1D0X A;  2OG2 A;  2ZXO A;  2Y3B A;  1J8M F;  4CS8 C;  4YWQ A;  3AQB A;  2Y39 A;  2IOQ A;  2D5R B;  4AE4 B;  4J30 B;  3MLG A;  3K1I C;  4U5G A;  2L9J A;  2BE5 F;  3I4U A;  5FCL A;  5E33 A;  1VMA A;  3NKE A;  3DAF A;  1NU9 C;  4KBL A;  4G7Z F;  4ZLD A;  5L3V A;  5KYX B;  3ASN C;  1S7Z A;  1D0Z A;  5KYX A;  3MBG A;  3S28 A;  3QMK A;  3RYL A;  3UGP A;  3L0I A;  2G3V A;  3F46 A;  4ULW A;  1QZX A;  4I44 A;  5IY5 C;  1ZHW A;  3HLZ A;  4NY3 A;  2J7P A;  3AG1 C;  5DS6 A;  4XTK A;  2PX3 A;  2V3C C;  3OEO A;  4JUR I;  4GYT A;  3ZG1 A;  1NU7 D;  2WZF A;  2NUT B;  3SEO A;  2IXM A;  3TK0 A;  5KYY B;  4YT4 A;  2Q3T A;  4FX5 A;  4CIH A;  3ABK C;  3N2Z B;  3AG4 C;  3OWT A;  3NYM A;  4I1O B;  1SF8 A;  4A2N B;  4G7H F;  1Z63 A;  3JYH A;  1OCZ C;  3POV A;  5B1A C;  1NG1 A;  2DYS C;  4C3D A;  4U5H A;  1JPJ A;  3ZC4 A;  3JRT A;  3ABM C;  5L3Q A;  1JR8 A;  2R7Q A;  2PF4 E;  3DAG A;  3B0U X;  2P6V A;  4E0H A;  1PD1 A;  3JT1 A;  1TWH A;  4DVZ A;  3L34 A;  5T3W A;  3VYW A;  5DS5 A;  2XSE A;  3U2M A;  2XXA B;  4U5B E;  4IAO A;  4MQ9 F;  1OCO C;  1VOM A;  5F5H A;  4RDA A;  2HV6 A;  4OD4 A;  2R7V A;  4BG0 A;  4B6I A;  1LS1 A;  2R7T A;  2Y3D A;  3K6B A;  4WJ0 A;  1MND A;  1TR2 A;  1V55 C;  4AE4 A;  4BJ6 A;  4C3E A;  1OKK A;  3FHD A;  4BJ5 A;  3WOD F;  3GAN A;  1V54 C;  3RH3 A;  3ABL C;  1TWC A;  3ASO C;  2J9V A;  2EIJ C;  3ZSU A;  1ZHY A;  1MMN A;  1D1C A;  1MNE A;  2H7V C;  1N1C A;  2NUP B;  4PJL A;  4MND A;  4C7O B;  4XLN F;  1BR2 A;  5DQZ A;  5HSW A;  5KYY A;  4HFK B;  4EWC A;  1TWG A;  4CS9 A;  2IXP A;  3GWN A;  3U2L A;  3RIP A;  1M2O A;  4YN0 B;  5DVW A;  3KH2 A;  2QY9 A;  4FES A;  4U5D E;  5EHH A;  5CI8 A;  4OD5 A;  3LS0 A;  3I5Q A;  2Y3G A;  2WL8 A;  3I5P A;  3EFO B;  2EIK C;  1WGW A;  2A1D D;  2KGO A;  5D91 A;  5F5F A;  1M56 C;  3S0X A;  2W4B A;  2KNH A;  2M4E A;  4O79 A;  2W9Y A;  3ECS A;  2XL4 A;  2DYR C;  1M2V B;  4YT8 A;  2I8B A;  4PK4 A;  3SZR A;  5DLJ A;  4PJM A;  2CNW D;  1OCC C;  1QLE C;  3EH1 A;  3U5S A;  3HTK C;  4I3M A;  4JW1 A;  4EBB A;  2FGY A;  2OCC C;  3EHM A;  2NG1 A;  2R7S A;  4LAC B;  1SZI A;  3N0T A;  2A68 F;  3LS1 A;  4H4K C;  2XRH A;  3B0P A;  3VAY A;  2HJ3 A;  3KMI A;  3NKD A;  2R7R A;  1ZHZ A;  2A6E F;  1MMA A;  1RJ9 B;  3SYN A;  2H7B A;  3E9V A;  4G7O F;  4PJJ A;  2VH3 A;  4U5F E;  2G62 A;  3EG9 A;  2G3K A;  3K66 A;  2WZL A;  4LLC A;  4J32 B;  2FFH A;  4O6N A;  3UNG C;  5DS4 A;  3NYL A;  4IWB A;  4CS7 A;  4CS9 C;  4BJ5 C;  5KYU B;  3LJB A;  3KKB A;  2WVO A;  3EZI A;  3DM5 A;  3DJN B;  4K0D A;  4E0I A;  5KYW B;  3UR3 C;  5DQT A;  2CNW A;  3RKO F;  1FFT C;  4CBE A;  3O55 A;  2E87 A;  3JCU Q;  3NG1 A;  3E70 C;  3W2W A;  2R7O A;  1IZM A;  3QZC A;  2J45 A;  4ANJ A;  3ZVR A;  2MYS A;  3EG9 B;  3UGO A;  1FMV A;  3LNR A;  3KL4 A;  3S27 A;  5B3S C;  4KI2 A;  4CS8 A;  2LSE A;  3EGX A;  4YT2 A;  3FDQ A;  3DM9 B;  3PHF 2;  2YZS A;  4JJG A;  4QDL A;  3X2Q C;  2EIM C;  3LEV A;  3EJN A;  4DOZ A;  2MWQ A;  3ZIB A;  3H65 A;  4BJT A;  2J0X A;  3AQC A;  4DBR A;  4JZA A;  3UMK A;  1D1A A;  4X0R A;  2R7U A;  1BR1 A;  3NDB B;  3LAY A;  3LLI A;  2CW0 F;  3CQZ A;  4ZLC A;  3R7C A;  4W8K A;  1NZE A;  5D92 A;  2V26 A;  3T4R A;  4BEJ A;  3EQL F;  4HEA J;  2H7O A;  4BJ1 A;  1Z5Z A;  2WB7 A;  2Q9B A;  4F4B A;  4DVY P;  2KJG A;  5CI9 A;  1M2V A;  1KU2 A;  2PP4 A;  2EIL C;  4LLE A;  3Q6M A;  3SNH A;  4JVS A;  1D1B A;  3EGD A;  2A69 F;  3LLK A;  1IW7 F;  2B0J A;  3W8H A;  5B1B C;  2W45 A;  2ZXW C;  1PCX A;  1OCR C;  2J9U A;  4OIO F;  3LES A;  2J46 A;  3Q7L A;  5E2Q A;  1JPN A;  3K1H A;  1D0Y A;  3CZ6 A;  2VB6 A;  3HJC A;  2Q9A A;  3AG2 C;  1Z6A A;  4PFO A;  2J9W A;  4O6Y A;  3EGD B;  2PFD A;  3DZA A;  3FAJ A;  4KC9 A;  1W2W A;  2O9X A;  4AX2 A;  4XLP F;  2VAS A;  4M63 A;  4O7G A;  3OA1 A;  3AG3 C;  1ZU4 A;  3W8I A;  2DGJ A;  3RFY A;  4PJN A;  4U5E E;  3B9Q A;  4Q7C A;  5BUO A;  4HFF B;  4Q5S F;  3W4Y A;  4CSA C;  3DMD A;  2IYL D;  2ZXP A;  3S29 A;  2P7V A;  3ITF A;  2YHS A;  1VYI A;  5T1D B;  4FWV A;  1ST6 A;  4LDK A;  1MMG A;  2GFH A;  2X51 A;  1J8Y F;  4AK9 A;  4N06 A;  1O87 A;  4C3B A;  2XXA A;  2CDQ A;  3WG7 C;  3Q7G A;  2Z15 A;  4I1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...