2WZLA

The structure of the n-rna binding domain of the mokola virus phosphoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
DIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMARLEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the N-RNA Binding Domain of the Mokola Virus Phosphoprotein
pubmed doi rcsb
source organism Mokola virus
molecule tags Viral protein
molecule keywords PHOSPHOPROTEIN
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03012 PP_M1 Phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wzlA00
2WZLA 3OA1A 1VYIA
chains in the Genus database with same CATH superfamily
2ZXRA 1SMYF 3DXJF 2XXAB 1OCCC 3G4XA 3IEEA 3L8JA 5JLIA 5L0IA 1QQ3A 2A68F 2FAPB 4MVQA 4W8KA 5KYXB 1HMDA 1WASA 2IM8A 2XL6A 1JMWA 2R7OA 1V55C 3U5SA 3QVYA 4IB4A 3LJBA 1J8YF 4JKVA 1HMOA 1SZIA 1VOMA 2DI3A 3K7DA 2X0CA 1S05A 2M64A 3EGDA 2Q9AA 1V4AA 1JPJA 3NMKA 4XQ1A 1MMDA 4AL0A 1Q0GA 3NYJA 1T9KA 3T6JA 1V54C 2J9UA 3KYIA 5L0JA 4OIPF 1VLSA 1ZHXA 3V5YA 4CS8A 3O10A 3ZG1A 2IOQA 4Z9JA 3O39A 1QZXA 2J9BA 3K6BA 2HSQA 1KNYA 3JRTA 3ZC4A 3IQTA 2J0WA 2WVQA 3V7OA 3L8IA 1O5HA 2DYSC 4JTDB 3ZQYA 3LS0A 1ORYA 1NFOA 1WATA 1YA9A 2QLAA 2WL8A 2YKZA 4N06A 1QKRA 2Y69C 3EH2A 3RVYA 1WOLA 3T9OA 2CNWA 3WODF 4G7ZF 4NC3A 4BEJA 4EUKB 4U5GA 1MQVA 2R05A 4I1MA 4ER9A 4BJ5A 4P6IC 1HY5A 1A7EA 3R2PA 3PDMP 1K04A 3DZAA 3QW1A 4PFOA 3RQGA 4DVZA 1PD0A 4GEHA 3LS1A 4IRUA 1FMVA 2AVKA 1NBBA 4IWBA 2V3CC 2WVNA 1OW7A 4MVSA 3AQBA 3EFOA 2A1DD 3M15A 3CEXA 3SYNA 4JURI 4ULVA 3TJ5A 3Q7LA 3FMSA 4KI2A 2P61A 2Q00A 3C7JA 5JSLA 3B29A 2XXAA 2A6HF 3S9OA 4CDVA 3FAPB 2J0XA 4U9EA 3KMIA 3DMDA 4D4XA 4P9FA 2Q4FA 3HKKA 3ZDLA 4AE4B 2I8BA 3ZWIA 2XM4A 4K0DA 2IXPA 2XLDA 256BA 4JCZA 4NQFA 4KBLA 4DRIB 4FAPB 2W9YA 3HNJA 3E70C 1LE2A 1RCPA 1XZPA 2L7AA 3HNIA 3KYJA 5AC5A 1NSGB 2VC9A 2A6EF 3B0PA 3FAJA 3JSZA 3AG4C 2LFFA 2CCYA 3UNGC 1YA7O 1OCZC 2B0HA 3Q6MA 3LESA 1MMAA 4MQ9F 2EPMX 3ZVRA 2YRFA 2KNHA 3AOUA 2HS5A 1O3UA 3MLGA 3C8ZA 2ZD9A 1PD1A 5L0GA 2AWYA 1KU2A 3SXYA 5F5FA 2NUPB 1MNDA 1U6HA 4P9TA 4U5DE 4WABA 4CX9A 5JT4A 2J9VA 2NSGA 2OEXA 4OINF 3Q7GA 2OOCA 1A0BA 2WB7A 3EJNA 3N2ZB 1QVXA 2HV7A 1H9GA 1QSPA 4U5CE 1E85A 2EIKC 2CYDA 2CGEA 3SP1A 4BJTA 1Q0MA 3ATPA 5JUAA 2XSEA 4YT5A 3AG2C 3G4ZA 5BQGA 2GFHA 2FFHA 3FOPA 3S28A 1DOWA 4B6IA 2AU5A 3C8GB 2LQGA 4HFFB 5COMA 3EHMA 1Q0DA 1AUEA 2PBEA 3TULA 3N0TA 3ZTMA 1TWCA 1O87A 1T5OA 4HEAJ 4QI0A 4N6CA 3NRHA 3B0UX 3EFOB 2Z15A 4K1OA 1ZVZA 4U5EE 1G4US 4NCQA 2XLVA 2P7VA 2RSEB 3H65A 4MVZA 4XPYA 3V5ZA 4IARA 2EIJC 3CSKA 4MW3A 2LIGA 1XZQA 4XEVA 4U9DA 5JP7A 1SYQA 4PJLA 2R7UA 2EIMC 3LNMB 4MVRA 4E18A 3R7CA 1TQGA 4IAQA 1LPEA 3AJMA 5DS5A 3WG7C 2E87A 1JR8A 1M2VA 3QVZA 1CGNA 1M57C 1Y4CA 2PX3A 2XLEA 1NG1A 1FFHA 2J7PA 2A0UA 2M4EA 2O9XA 3ABKC 5T3TA 2ICWG 3M79A 3T4RA 4YT8A 1W2WA 2XM0A 4BEMJ 3EG9A 3M1CB 1C17M 4MS2A 1RKEB 4Z9IA 3AG3C 1WGWA 4WJ0A 3C63A 4D4NA 2HUJA 1VYKA 3VYWA 4EKWA 5CIVA 4A2NB 3W2VA 1EI7A 1YYXA 2L9JA 1C03A 2DYRC 1Z3IX 1D0XA 2KSFA 1TR2A 2YLGA 1OCRC 4Q5SF 3OA1A 2BC5A 4FWVA 3QW0A 2HMQA 4JVSA 3T6BA 4LLCA 1R4TA 3ECSA 1M56C 3SXMA 1T6UA 1LVKA 2PF4E 2PP4A 2Y3DA 1U89A 3VAYA 4EBBA 2KJGA 2P6VA 2W4MA 2OJQA 1M6TA 4J7YA 1TKNA 2KQ9A 2R7QA 3LEOA 3MBGA 4DXWA 2TMVP 2EPLX 1C02A 4GQHA 4ULWA 1E84A 3FDQA 2OJED 5K0IA 1YDIA 2PFDA 1CGME 3UR3C 4C7OA 3W8IA 2LFDA 2YL0A 2XLWA 3F46A 4E0HA 1FAPB 5HV9A 2L6GA 2XL8A 1PCXA 2HJ3A 3CAXA 3L0IA 3ZSUA 1ST6A 2QNLA 4CDYA 4YK5A 1NFNA 3C8GA 2WZFA 3JSEO 5FZTA 1E86A 1U0BB 4LACB 4G78A 1I4ZA 3C8GD 3GODA 3S90A 2A69F 3MYIA 1RJ9A 2OG2A 3M4BA 5HSWA 4UDVA 2H7OA 2A0BA 2Q3TA 2LCHA 4CJOA 5B3IA 1UFBA 4PACA 5A6JA 2HJMA 1M2VB 4XEFA 2EPKX 1OW6A 5KYUB 4JE9A 3UGOA 4BJ1A 2IYLD 1APCA 3FXHA 2IXMA 2ZXOA 4LLEA 5F28E 3S29A 1GQAA 1GM5A 3UMKA 1LI7A 4O79A 3G50A 2OKUA 2HFIA 4MVOA 1RKEA 1ZU5A 3LLKA 1ZW3A 1D1BA 4JRZA 2KC3A 1NU9C 1ORJA 2C04A 2V26A 4DJ9A 4XWJA 3KH2A 3WAQA 5EK0A 2GAQA 4CS7A 1BDJB 4JZAA 2R7XA 1HE1A 1ZHWA 2OCCC 3EGXB 3L34A 4IAOA 3W8HA 3TQOA 4CJGA 2XLMA 5E33A 3RQFA 3HTKC 3BRJA 4YJWA 3SXZA 3VRCA 4FESA 4JC7A 5DS6A 3E9VA 1YLMA 4K7BA 4W8PA 1TWGA 1IZMA 3MYFA 2CNWD 5FCLA 5JVEA 2X51A 4LDRA 3GANA 2OEVA 3EHNA 3IPMO 5L3VA 5L3QA 3NYLA 2MHRA 4JJGA 1L7CA 4XPXA 2R7VA 1QLEC 1SF8A 1K05A 2XLHA 1RKCA 4M63A 5D92A 4PJMA 3J06A 4JJFA 2R7TA 3VF0A 1XWJA 1VLTA 4PR9A 1RJ9B 2YHSA 5COGA 5COFA 1ZHYA 2J8WA 3DAFA 4AK9A 4BPMA 1NLXA 1JPNA 2FGYA 4JIOA 5B1BC 1LM3B 1NZEA 2YL3A 3AG1C 3FOOA 4CBEA 3DKAA 2KK1A 4XLNF 5AGFA 4OIOF 2XRHA 1FTSA 4KC9A 2Y3HA 4RD9A 2H7BA 1VB5A 1J8MF 1JRAA 2YVKA 5BUOA 5D91A 1Z63A 4O6NA 3O55A 2D4UA 4YWQA 1CPQA 1OCOC 3B9QA 4U5HA 4CDAA 5F5HA 4CIHA 4ANJA 1H9TA 1WN0A 3A9CA 3LNRA 4I1OB 2YLDA 4AE4A 2EINC 3QMKA 3DE9A 4HE8D 4PJJA 4J7TA 3U9JA 1L3PA 3K66A 2VASA 1E83A 4O6YA 2JPUA 4L6RA 1YJGA 3HNLA 4OD4A 3DI5A 2R7WA 1BR1A 3B71A 3JT1A 4BJ5C 5IY5C 2R03A 4O6MA 3DM9B 4XLPF 3F47A 1OR2A 4NTFA 4Q7CA 4EBJA 1D0ZA 2B0JA 2R7RA 3GORA 3IQCA 3NYMA 1K40A 4PJNA 1YARO 3ABMC 5KYYA 4CS8C 4Q4ZF 4A4AA 3C18A 4GYTA 1HW2A 3EZIA 3GWLA 3LLIA 2JD3A 2AWCA 2NUPA 4JEBA 4WGYA 3RIPA 3T6GB 4G0HA 1CGOA 2IXNA 5BQHA 4ZLDA 1YAUO 1SR2A 2XL4A 2R7SA 2NPUA 2JX0A 4NY3A 4QDLA 5GPGB 1VMAA 5EHHA 1V74B 1A41A 3DWWA 4YL3A 3TD7A 1Q0FA 3DJNB 2H8AA 1MMGA 5E2QA 1Y6DA 3TOLA 2GWWA 3RH3A 3VM6A 4C7OB 2QY9A 3U3BA 3ABLC 5L0FA 2ETSA 4J30B 3NKDA 4RBNA 1I4YA 4E7ZA 2DGJA 1BZ4A 2LSEA 3FHDA 1H6GA 3JYYA 4BG0A 2PNOA 3EH1A 5KYXA 2J46A 1ZHZA 2YZSA 4JEAA 2W4BA 1VK5A 4LDKA 3IQ5A 3SEOA 5DQTA 3NDBB 2YEVA 1FNTc 5TJ5E 3S27A 2XS8A 4YT2A 2Q9CA 3HNKA 1CPRA 2NSFA 5A6BA 1EKYA 2I15A 1PV3A 3UMHA 5A6KA 5T3WA 1YZCA 4YL1A 3OEOA 4BJ6A 3QZCA 4Z9HA 4J32B 2HSBA 1A7DA 3EGDB 2BE5F 2KYHA 4IGGA 2ZXPA 5DS4A 3EG9B 4OIQF 2DB4A 1LS1A 5CI8A 3DAGA 4JCHA 4HFKB 3JCUQ 2OU6A 2LP4A 1ZYRF 2Q9BA 1Z7Qc 5L0HA 4IJJA 3GEHA 4C3EA 4FX5A 3C62A 3U3FA 2EILC 3AGTA 2L6HA 3LAYA 1R5ID 2P1AA 4DRJB 3US6A 5L0CA 3RF3A 1MMNA 3UMIA 2OQMA 3LEVA 2VB6A 3U9MA 5B1AC 3DM5A 1RXQA 3DE8A 3PMRA 2G3VA 2LD6A 3EQLF 1TFKB 1EA8A 2Q7RA 5JRAA 5JS5A 3ITFA 5BQIA 4DOZA 1VTMP 3EGXA 5DLJA 2HV6A 5A6AA 3JZ0A 3K1IA 4XTKA 1A7VA 3GEIA 3GM3A 5KYWA 5E3AA 1TWHA 4DVYP 5A69A 1KTMA 2D5RB 1JAFA 1OR3A 5EGYA 1F1MA 2ASRA 1M2OA 2CDQA 2IXOA 2NUTB 3CQZA 1ZHTA 1NU7D 3M4CA 3RYLA 2MWQA 3X2QC 3NKEA 4CSAC 1OXBA 5KYUA 2Y3GA 3ZTZA 4AX2A 1TWAA 3U2LA 2VH3A 3HLZA 3WHNA 1FMWA 2F22A 1Z6AA 2VCCA 4AL1A 3KL4A 4C3DA 2YL1A 3H2UA 2UUIA 3KPHA 2R9RB 3UGPA 3I5PA 2HMZA 4N6HA 2C03A 3U8VA 4MNDA 2MYSA 3GM1A 2HKVA 4ONSA 3AGUA 3NMJA 3LUTB 1TFOB 4E0IA 3MX3A 1JOGA 1G5ZA 1LI5A 1LS4A 4MVUA 3IHUA 1WWPA 4E7SA 3KKBA 3RW0A 2L81A 2NG1A 3L1MA 2HZ8A 3K1HA 1YZAA 4EIYA 3Q6NA 4JTAB 5B3SC 2GA0A 3PCVA 4R32A 3S0XA 4CSAA 3SNHA 2W45A 2G3KA 3ZQVA 4CS9C 3W2WA 2PX0A 1BR4A 4MTFA 3GEEA 2Y3BA 3N24A 3TK0A 3U2MA 3I5QA 3ASNC 2XS1A 5KYNA 3SZRA 4CIPA 2WZLA 4MVMA 1ORSC 4NTBA 2RD9A 1E2XA 3U8PA 3PHF2 4F4BA 3ASOC 5KYWB 1OKKD 4KNWA 1T01A 5L0DA 1T6QA 2GDCA 3FVYA 4MTGA 4XPWA 4I44A 1OKKA 2IBFA 2YQYA 1GS9A 3I4UA 3O6XA 1WTYA 1HE9A 2UUHA 2ZXWC 3AQCA 3K1IC 3V5XA 5E3CA 1FR0A 4N4WA 4YN0B 1T6IA 2WZGA 3MFNA 1QPUA 1GGQA 1ZZPA 4MW8A 2R25A 3CZ6A 4BJ6C 4ZLCA 3RQEA 2L6FA 3JYHA 4PFPA 2P0NA 2H7VC 2J9WA 3EZHA 3S84A 3QTHA 3NMIA 5CI9A 1HW1A 3JTLO 4YL0A 5A6BD 2YWAA 2Y39A 4NTAA 1FFTC 3GWNA 1UG7A 4I3MA 3DJUB 1D1CA 2EPOA 4LDQA 2QE9A 4XEKA 5DVWA 4KNVA 3A11A 4G7OF 1Q0KA 2J7PD 4WGZA 4O7GA 2AP3A 3ZIBA 3JRMO 2BL2A 1OQCA 2WVOA 3K33A 5T1DB 3X1OA 1AEPA 2KGOA 1H7IA 4C3BA 4DRHB 1S7ZA 1AVOB 1MNEA 4OD5A 4OIRF 1BBHA 4EBKA 4H4KC 1VYIA 3GM2A 2YLIA 1B68A 1Z5ZA 5KYYB 3TOMA 2QUPA 3IQ6A 2VCBA 5DQZA 4G7HF 2QTVA 1OW8A 4EWCA 4MTOA 4QI2A 4PK4A 3H2VA 3NG1A 1N1CA 4CS9A 2EPNA 2YL7A 4X0RA 4DBQA 3SXKA 1OXKA 4U5BE 2NUTA 1ZW2A 2LK4A 4H54A 1I5NA 5AC4A 4E17A 2G62A 3HJCA 4DBRA 2VCAA 3TJ6A 4JW1A 3BEHA 3RFYA 1YYJA 1G8XA 1ZU4A 3OWTA 3B0VC 2CW0F 4RDAA 1RMVA 1IW7F 1LIHA 1YVIA 2ZPAA 4U5FE 3DD7A 4JTCB 1D1AA 3W4YA 2R02A 1LE4A 2XLOA 1D0YA 1BR2A 3EPVA 3POVA 4YT4A 3RKOF 3U0CA 1G4WR 1EQ1A 1Z23A 4LERA 3RVZA 4EHPA 1LKXA 1DOVA 2KW3C 2J45A
chains in the Genus database with same CATH topology
2ZXRA 1SMYF 3DXJF 2XXAB 1OCCC 3IEEA 2A68F 4W8KA 5KYXB 2R7OA 1V55C 3LJBA 1J8YF 1SZIA 1VOMA 3K7DA 3EGDA 2Q9AA 1JPJA 1MMDA 3NYJA 3T6JA 1V54C 2J9UA 4OIPF 1ZHXA 4CS8A 3ZG1A 2IOQA 3O39A 1QZXA 3K6BA 3JRTA 3ZC4A 2J0WA 2WVQA 3V7OA 1O5HA 2DYSC 3LS0A 2WL8A 4YT5A 4N06A 2Y69C 3WODF 3EH2A 2CNWA 4G7ZF 4BEJA 4U5GA 4I1MA 4BJ5A 4P6IC 3DZAA 4PFOA 4DVZA 1PD0A 4GEHA 3LS1A 4IRUA 1FMVA 4IWBA 2V3CC 2WVNA 3AQBA 3EFOA 2A1DD 3SYNA 4JURI 3Q7LA 4KI2A 2XXAA 2A6HF 2J0XA 3KMIA 3DMDA 4AE4B 2I8BA 4K0DA 2IXPA 4KBLA 2W9YA 3E70C 3JSZA 2A6EF 3B0PA 3FAJA 3AG4C 3UNGC 1OCZC 3Q6MA 3LESA 1MMAA 4MQ9F 3ZVRA 2KNHA 3MLGA 1PD1A 5F5FA 1KU2A 2NUPB 1MNDA 4U5DE 2J9VA 4OINF 3Q7GA 2WB7A 3EJNA 3N2ZB 2HV7A 4U5CE 2EIKC 3SP1A 2CGEA 4BJTA 2XSEA 3AG2C 2GFHA 2FFHA 3S28A 4B6IA 4HFFB 3EHMA 3N0TA 1TWCA 1O87A 4HEAJ 4QI0A 3NRHA 3B0UX 3EFOB 2Z15A 4U5EE 2P7VA 3H65A 2EIJC 3CSKA 2R7UA 4PJLA 2EIMC 5DS5A 3WG7C 2E87A 1M2VA 1M57C 2PX3A 3ABKC 1NG1A 1FFHA 2J7PA 2M4EA 2O9XA 5T3TA 3T4RA 4YT8A 1W2WA 3EG9A 3M1CB 3AG3C 1WGWA 4WJ0A 1VYKA 3VYWA 4A2NB 3W2VA 2L9JA 2DYRC 1Z3IX 1D0XA 1TR2A 1OCRC 4Q5SF 3OA1A 3T6BA 4JVSA 4LLCA 3ECSA 1M56C 1LVKA 2PF4E 2PP4A 2Y3DA 3VAYA 4EBBA 2KJGA 2P6VA 2W4MA 1TKNA 2KQ9A 2R7QA 4ULWA 3FDQA 2PFDA 3UR3C 4C7OA 3W8IA 3F46A 3L0IA 1PCXA 3ZSUA 1ST6A 2WZFA 4LACB 3GODA 2A69F 1RJ9A 2OG2A 5HSWA 2H7OA 2Q3TA 1M2VB 5KYUB 3UGOA 4BJ1A 2IYLD 2IXMA 2ZXOA 4LLEA 3S29A 3UMKA 4O79A 3LLKA 1ZU5A 1D1BA 1NU9C 2C04A 2V26A 4XWJA 3KH2A 4CS7A 4JZAA 2R7XA 1ZHWA 2OCCC 3EGXB 3L34A 4IAOA 3W8HA 5E33A 3HTKC 4YJWA 4FESA 5DS6A 3E9VA 4K7BA 1TWGA 1IZMA 2CNWD 5FCLA 2X51A 3GANA 3EHNA 5L3VA 5L3QA 3NYLA 4JJGA 2R7VA 1QLEC 1SF8A 4M63A 5D92A 4PJMA 4JJFA 2R7TA 1RJ9B 2YHSA 4AK9A 1ZHYA 3DAFA 1JPNA 2FGYA 5B1BC 1NZEA 3AG1C 4CBEA 4XLNF 4OIOF 2XRHA 1FTSA 4KC9A 2Y3HA 4RD9A 2H7BA 1J8MF 5BUOA 5D91A 1Z63A 4O6NA 4YWQA 1OCOC 3B9QA 4U5HA 5F5HA 4CIHA 4ANJA 3LNRA 4I1OB 4AE4A 2EINC 3QMKA 4HE8D 4PJJA 3K66A 2VASA 4O6YA 4OD4A 2R7WA 1BR1A 3JT1A 4BJ5C 5IY5C 4O6MA 3DM9B 4XLPF 3F47A 4Q7CA 2R7RA 1D0ZA 2B0JA 3NYMA 3ABMC 5KYYA 4CS8C 4Q4ZF 4GYTA 3EZIA 3LLIA 3RIPA 2JD3A 2NUPA 4G0HA 2IXNA 4ZLDA 2XL4A 2R7SA 4QDLA 4NY3A 5EHHA 1VMAA 3TD7A 3DJNB 1MMGA 5E2QA 3RH3A 4C7OB 2QY9A 3ABLC 4J30B 3NKDA 4RBNA 4E7ZA 2DGJA 2LSEA 3FHDA 4BG0A 3EH1A 5KYXA 2J46A 1ZHZA 2YZSA 2W4BA 1VK5A 3SEOA 5DQTA 3NDBB 2YEVA 3S27A 4YT2A 2Q9CA 3UMHA 5T3WA 4BJ6A 3OEOA 3QZCA 4J32B 3EGDB 2BE5F 2ZXPA 5DS4A 3EG9B 4OIQF 1LS1A 5CI8A 3DAGA 4JCHA 4HFKB 3JCUQ 1ZYRF 2Q9BA 4IJJA 4C3EA 4FX5A 2EILC 3LAYA 1MMNA 3UMIA 3LEVA 2VB6A 5B1AC 3DM5A 3PMRA 2G3VA 3EQLF 3ITFA 4DOZA 3EGXA 5DLJA 2HV6A 4XTKA 5KYWA 5E3AA 1TWHA 4DVYP 2D5RB 5EGYA 3CQZA 2CDQA 1M2OA 2IXOA 2NUTB 1ZHTA 1NU7D 3RYLA 3X2QC 2MWQA 4CSAC 3NKEA 5KYUA 2Y3GA 4AX2A 1TWAA 2VH3A 3HLZA 1FMWA 1Z6AA 4C3DA 3KL4A 3UGPA 3I5PA 2C03A 4MNDA 2MYSA 3MX3A 4E7SA 3KKBA 2L81A 2NG1A 3K1HA 3Q6NA 5B3SC 3S0XA 4CSAA 3SNHA 2W45A 2G3KA 4CS9C 3W2WA 2PX0A 1BR4A 2Y3BA 3N24A 3I5QA 3ASNC 5KYNA 3SZRA 2WZLA 3PHF2 4F4BA 3ASOC 5KYWB 1OKKD 4KNWA 3FVYA 4YN0B 4I44A 4FWVA 1OKKA 3O6XA 3I4UA 4PJNA 3K1IC 2ZXWC 3AQCA 5E3CA 2WZGA 3CZ6A 4ZLCA 4BJ6C 3JYHA 4PFPA 2H7VC 2J9WA 3EZHA 5CI9A 2Y39A 1FFTC 4I3MA 3DJUB 1D1CA 5DVWA 4KNVA 4G7OF 2J7PD 4O7GA 3ZIBA 2WVOA 3K33A 3X1OA 5T1DB 2KGOA 4C3BA 1S7ZA 1MNEA 4OD5A 4OIRF 4H4KC 1VYIA 1Z5ZA 5KYYB 4G7HF 5DQZA 2QTVA 4QI2A 4EWCA 4PK4A 3NG1A 1N1CA 4CS9A 4X0RA 4DBQA 4U5BE 2NUTA 2G62A 3HJCA 4DBRA 4JW1A 3RFYA 3B0VC 1G8XA 1ZU4A 3OWTA 2CW0F 4RDAA 1IW7F 2ZPAA 4U5FE 3DD7A 1D1AA 1D0YA 1BR2A 3EPVA 3POVA 4YT4A 3RKOF 1Z23A 4LERA 1LKXA 2KW3C 2J45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZL A;  3OA1 A;  1VYI A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  1SMY F;  3DXJ F;  2XXA B;  1OCC C;  3G4X A;  3IEE A;  3L8J A;  5JLI A;  5L0I A;  1QQ3 A;  2A68 F;  2FAP B;  4MVQ A;  4W8K A;  5KYX B;  1HMD A;  1WAS A;  2IM8 A;  2XL6 A;  1JMW A;  2R7O A;  1V55 C;  3U5S A;  3QVY A;  4IB4 A;  3LJB A;  1J8Y F;  4JKV A;  1HMO A;  1SZI A;  1VOM A;  2DI3 A;  3K7D A;  2X0C A;  1S05 A;  2M64 A;  3EGD A;  2Q9A A;  1V4A A;  1JPJ A;  3NMK A;  4XQ1 A;  1MMD A;  4AL0 A;  1Q0G A;  3NYJ A;  1T9K A;  3T6J A;  1V54 C;  2J9U A;  3KYI A;  5L0J A;  4OIP F;  1VLS A;  1ZHX A;  3V5Y A;  4CS8 A;  3O10 A;  3ZG1 A;  2IOQ A;  4Z9J A;  3O39 A;  1QZX A;  2J9B A;  3K6B A;  2HSQ A;  1KNY A;  3JRT A;  3ZC4 A;  3IQT A;  2J0W A;  2WVQ A;  3V7O A;  3L8I A;  1O5H A;  2DYS C;  4JTD B;  3ZQY A;  3LS0 A;  1ORY A;  1NFO A;  1WAT A;  1YA9 A;  2QLA A;  2WL8 A;  2YKZ A;  4N06 A;  1QKR A;  2Y69 C;  3EH2 A;  3RVY A;  1WOL A;  3T9O A;  2CNW A;  3WOD F;  4G7Z F;  4NC3 A;  4BEJ A;  4EUK B;  4U5G A;  1MQV A;  2R05 A;  4I1M A;  4ER9 A;  4BJ5 A;  4P6I C;  1HY5 A;  1A7E A;  3R2P A;  3PDM P;  1K04 A;  3DZA A;  3QW1 A;  4PFO A;  3RQG A;  4DVZ A;  1PD0 A;  4GEH A;  3LS1 A;  4IRU A;  1FMV A;  2AVK A;  1NBB A;  4IWB A;  2V3C C;  2WVN A;  1OW7 A;  4MVS A;  3AQB A;  3EFO A;  2A1D D;  3M15 A;  3CEX A;  3SYN A;  4JUR I;  4ULV A;  3TJ5 A;  3Q7L A;  3FMS A;  4KI2 A;  2P61 A;  2Q00 A;  3C7J A;  5JSL A;  3B29 A;  2XXA A;  2A6H F;  3S9O A;  4CDV A;  3FAP B;  2J0X A;  4U9E A;  3KMI A;  3DMD A;  4D4X A;  4P9F A;  2Q4F A;  3HKK A;  3ZDL A;  4AE4 B;  2I8B A;  3ZWI A;  2XM4 A;  4K0D A;  2IXP A;  2XLD A;  256B A;  4JCZ A;  4NQF A;  4KBL A;  4DRI B;  4FAP B;  2W9Y A;  3HNJ A;  3E70 C;  1LE2 A;  1RCP A;  1XZP A;  2L7A A;  3HNI A;  3KYJ A;  5AC5 A;  1NSG B;  2VC9 A;  2A6E F;  3B0P A;  3FAJ A;  3JSZ A;  3AG4 C;  2LFF A;  2CCY A;  3UNG C;  1YA7 O;  1OCZ C;  2B0H A;  3Q6M A;  3LES A;  1MMA A;  4MQ9 F;  2EPM X;  3ZVR A;  2YRF A;  2KNH A;  3AOU A;  2HS5 A;  1O3U A;  3MLG A;  3C8Z A;  2ZD9 A;  1PD1 A;  5L0G A;  2AWY A;  1KU2 A;  3SXY A;  5F5F A;  2NUP B;  1MND A;  1U6H A;  4P9T A;  4U5D E;  4WAB A;  4CX9 A;  5JT4 A;  2J9V A;  2NSG A;  2OEX A;  4OIN F;  3Q7G A;  2OOC A;  1A0B A;  2WB7 A;  3EJN A;  3N2Z B;  1QVX A;  2HV7 A;  1H9G A;  1QSP A;  4U5C E;  1E85 A;  2EIK C;  2CYD A;  2CGE A;  3SP1 A;  4BJT A;  1Q0M A;  3ATP A;  5JUA A;  2XSE A;  4YT5 A;  3AG2 C;  3G4Z A;  5BQG A;  2GFH A;  2FFH A;  3FOP A;  3S28 A;  1DOW A;  4B6I A;  2AU5 A;  3C8G B;  2LQG A;  4HFF B;  5COM A;  3EHM A;  1Q0D A;  1AUE A;  2PBE A;  3TUL A;  3N0T A;  3ZTM A;  1TWC A;  1O87 A;  1T5O A;  4HEA J;  4QI0 A;  4N6C A;  3NRH A;  3B0U X;  3EFO B;  2Z15 A;  4K1O A;  1ZVZ A;  4U5E E;  1G4U S;  4NCQ A;  2XLV A;  2P7V A;  2RSE B;  3H65 A;  4MVZ A;  4XPY A;  3V5Z A;  4IAR A;  2EIJ C;  3CSK A;  4MW3 A;  2LIG A;  1XZQ A;  4XEV A;  4U9D A;  5JP7 A;  1SYQ A;  4PJL A;  2R7U A;  2EIM C;  3LNM B;  4MVR A;  4E18 A;  3R7C A;  1TQG A;  4IAQ A;  1LPE A;  3AJM A;  5DS5 A;  3WG7 C;  2E87 A;  1JR8 A;  1M2V A;  3QVZ A;  1CGN A;  1M57 C;  1Y4C A;  2PX3 A;  2XLE A;  1NG1 A;  1FFH A;  2J7P A;  2A0U A;  2M4E A;  2O9X A;  3ABK C;  5T3T A;  2ICW G;  3M79 A;  3T4R A;  4YT8 A;  1W2W A;  2XM0 A;  4BEM J;  3EG9 A;  3M1C B;  1C17 M;  4MS2 A;  1RKE B;  4Z9I A;  3AG3 C;  1WGW A;  4WJ0 A;  3C63 A;  4D4N A;  2HUJ A;  1VYK A;  3VYW A;  4EKW A;  5CIV A;  4A2N B;  3W2V A;  1EI7 A;  1YYX A;  2L9J A;  1C03 A;  2DYR C;  1Z3I X;  1D0X A;  2KSF A;  1TR2 A;  2YLG A;  1OCR C;  4Q5S F;  3OA1 A;  2BC5 A;  4FWV A;  3QW0 A;  2HMQ A;  4JVS A;  3T6B A;  4LLC A;  1R4T A;  3ECS A;  1M56 C;  3SXM A;  1T6U A;  1LVK A;  2PF4 E;  2PP4 A;  2Y3D A;  1U89 A;  3VAY A;  4EBB A;  2KJG A;  2P6V A;  2W4M A;  2OJQ A;  1M6T A;  4J7Y A;  1TKN A;  2KQ9 A;  2R7Q A;  3LEO A;  3MBG A;  4DXW A;  2TMV P;  2EPL X;  1C02 A;  4GQH A;  4ULW A;  1E84 A;  3FDQ A;  2OJE D;  5K0I A;  1YDI A;  2PFD A;  1CGM E;  3UR3 C;  4C7O A;  3W8I A;  2LFD A;  2YL0 A;  2XLW A;  3F46 A;  4E0H A;  1FAP B;  5HV9 A;  2L6G A;  2XL8 A;  1PCX A;  2HJ3 A;  3CAX A;  3L0I A;  3ZSU A;  1ST6 A;  2QNL A;  4CDY A;  4YK5 A;  1NFN A;  3C8G A;  2WZF A;  3JSE O;  5FZT A;  1E86 A;  1U0B B;  4LAC B;  4G78 A;  1I4Z A;  3C8G D;  3GOD A;  3S90 A;  2A69 F;  3MYI A;  1RJ9 A;  2OG2 A;  3M4B A;  5HSW A;  4UDV A;  2H7O A;  2A0B A;  2Q3T A;  2LCH A;  4CJO A;  5B3I A;  1UFB A;  4PAC A;  5A6J A;  2HJM A;  1M2V B;  4XEF A;  2EPK X;  1OW6 A;  5KYU B;  4JE9 A;  3UGO A;  4BJ1 A;  2IYL D;  1APC A;  3FXH A;  2IXM A;  2ZXO A;  4LLE A;  5F28 E;  3S29 A;  1GQA A;  1GM5 A;  3UMK A;  1LI7 A;  4O79 A;  3G50 A;  2OKU A;  2HFI A;  4MVO A;  1RKE A;  1ZU5 A;  3LLK A;  1ZW3 A;  1D1B A;  4JRZ A;  2KC3 A;  1NU9 C;  1ORJ A;  2C04 A;  2V26 A;  4DJ9 A;  4XWJ A;  3KH2 A;  3WAQ A;  5EK0 A;  2GAQ A;  4CS7 A;  1BDJ B;  4JZA A;  2R7X A;  1HE1 A;  1ZHW A;  2OCC C;  3EGX B;  3L34 A;  4IAO A;  3W8H A;  3TQO A;  4CJG A;  2XLM A;  5E33 A;  3RQF A;  3HTK C;  3BRJ A;  4YJW A;  3SXZ A;  3VRC A;  4FES A;  4JC7 A;  5DS6 A;  3E9V A;  1YLM A;  4K7B A;  4W8P A;  1TWG A;  1IZM A;  3MYF A;  2CNW D;  5FCL A;  5JVE A;  2X51 A;  4LDR A;  3GAN A;  2OEV A;  3EHN A;  3IPM O;  5L3V A;  5L3Q A;  3NYL A;  2MHR A;  4JJG A;  1L7C A;  4XPX A;  2R7V A;  1QLE C;  1SF8 A;  1K05 A;  2XLH A;  1RKC A;  4M63 A;  5D92 A;  4PJM A;  3J06 A;  4JJF A;  2R7T A;  3VF0 A;  1XWJ A;  1VLT A;  4PR9 A;  1RJ9 B;  2YHS A;  5COG A;  5COF A;  1ZHY A;  2J8W A;  3DAF A;  4AK9 A;  4BPM A;  1NLX A;  1JPN A;  2FGY A;  4JIO A;  5B1B C;  1LM3 B;  1NZE A;  2YL3 A;  3AG1 C;  3FOO A;  4CBE A;  3DKA A;  2KK1 A;  4XLN F;  5AGF A;  4OIO F;  2XRH A;  1FTS A;  4KC9 A;  2Y3H A;  4RD9 A;  2H7B A;  1VB5 A;  1J8M F;  1JRA A;  2YVK A;  5BUO A;  5D91 A;  1Z63 A;  4O6N A;  3O55 A;  2D4U A;  4YWQ A;  1CPQ A;  1OCO C;  3B9Q A;  4U5H A;  4CDA A;  5F5H A;  4CIH A;  4ANJ A;  1H9T A;  1WN0 A;  3A9C A;  3LNR A;  4I1O B;  2YLD A;  4AE4 A;  2EIN C;  3QMK A;  3DE9 A;  4HE8 D;  4PJJ A;  4J7T A;  3U9J A;  1L3P A;  3K66 A;  2VAS A;  1E83 A;  4O6Y A;  2JPU A;  4L6R A;  1YJG A;  3HNL A;  4OD4 A;  3DI5 A;  2R7W A;  1BR1 A;  3B71 A;  3JT1 A;  4BJ5 C;  5IY5 C;  2R03 A;  4O6M A;  3DM9 B;  4XLP F;  3F47 A;  1OR2 A;  4NTF A;  4Q7C A;  4EBJ A;  1D0Z A;  2B0J A;  2R7R A;  3GOR A;  3IQC A;  3NYM A;  1K40 A;  4PJN A;  1YAR O;  3ABM C;  5KYY A;  4CS8 C;  4Q4Z F;  4A4A A;  3C18 A;  4GYT A;  1HW2 A;  3EZI A;  3GWL A;  3LLI A;  2JD3 A;  2AWC A;  2NUP A;  4JEB A;  4WGY A;  3RIP A;  3T6G B;  4G0H A;  1CGO A;  2IXN A;  5BQH A;  4ZLD A;  1YAU O;  1SR2 A;  2XL4 A;  2R7S A;  2NPU A;  2JX0 A;  4NY3 A;  4QDL A;  5GPG B;  1VMA A;  5EHH A;  1V74 B;  1A41 A;  3DWW A;  4YL3 A;  3TD7 A;  1Q0F A;  3DJN B;  2H8A A;  1MMG A;  5E2Q A;  1Y6D A;  3TOL A;  2GWW A;  3RH3 A;  3VM6 A;  4C7O B;  2QY9 A;  3U3B A;  3ABL C;  5L0F A;  2ETS A;  4J30 B;  3NKD A;  4RBN A;  1I4Y A;  4E7Z A;  2DGJ A;  1BZ4 A;  2LSE A;  3FHD A;  1H6G A;  3JYY A;  4BG0 A;  2PNO A;  3EH1 A;  5KYX A;  2J46 A;  1ZHZ A;  2YZS A;  4JEA A;  2W4B A;  1VK5 A;  4LDK A;  3IQ5 A;  3SEO A;  5DQT A;  3NDB B;  2YEV A;  1FNT c;  5TJ5 E;  3S27 A;  2XS8 A;  4YT2 A;  2Q9C A;  3HNK A;  1CPR A;  2NSF A;  5A6B A;  1EKY A;  2I15 A;  1PV3 A;  3UMH A;  5A6K A;  5T3W A;  1YZC A;  4YL1 A;  3OEO A;  4BJ6 A;  3QZC A;  4Z9H A;  4J32 B;  2HSB A;  1A7D A;  3EGD B;  2BE5 F;  2KYH A;  4IGG A;  2ZXP A;  5DS4 A;  3EG9 B;  4OIQ F;  2DB4 A;  1LS1 A;  5CI8 A;  3DAG A;  4JCH A;  4HFK B;  3JCU Q;  2OU6 A;  2LP4 A;  1ZYR F;  2Q9B A;  1Z7Q c;  5L0H A;  4IJJ A;  3GEH A;  4C3E A;  4FX5 A;  3C62 A;  3U3F A;  2EIL C;  3AGT A;  2L6H A;  3LAY A;  1R5I D;  2P1A A;  4DRJ B;  3US6 A;  5L0C A;  3RF3 A;  1MMN A;  3UMI A;  2OQM A;  3LEV A;  2VB6 A;  3U9M A;  5B1A C;  3DM5 A;  1RXQ A;  3DE8 A;  3PMR A;  2G3V A;  2LD6 A;  3EQL F;  1TFK B;  1EA8 A;  2Q7R A;  5JRA A;  5JS5 A;  3ITF A;  5BQI A;  4DOZ A;  1VTM P;  3EGX A;  5DLJ A;  2HV6 A;  5A6A A;  3JZ0 A;  3K1I A;  4XTK A;  1A7V A;  3GEI A;  3GM3 A;  5KYW A;  5E3A A;  1TWH A;  4DVY P;  5A69 A;  1KTM A;  2D5R B;  1JAF A;  1OR3 A;  5EGY A;  1F1M A;  2ASR A;  1M2O A;  2CDQ A;  2IXO A;  2NUT B;  3CQZ A;  1ZHT A;  1NU7 D;  3M4C A;  3RYL A;  2MWQ A;  3X2Q C;  3NKE A;  4CSA C;  1OXB A;  5KYU A;  2Y3G A;  3ZTZ A;  4AX2 A;  1TWA A;  3U2L A;  2VH3 A;  3HLZ A;  3WHN A;  1FMW A;  2F22 A;  1Z6A A;  2VCC A;  4AL1 A;  3KL4 A;  4C3D A;  2YL1 A;  3H2U A;  2UUI A;  3KPH A;  2R9R B;  3UGP A;  3I5P A;  2HMZ A;  4N6H A;  2C03 A;  3U8V A;  4MND A;  2MYS A;  3GM1 A;  2HKV A;  4ONS A;  3AGU A;  3NMJ A;  3LUT B;  1TFO B;  4E0I A;  3MX3 A;  1JOG A;  1G5Z A;  1LI5 A;  1LS4 A;  4MVU A;  3IHU A;  1WWP A;  4E7S A;  3KKB A;  3RW0 A;  2L81 A;  2NG1 A;  3L1M A;  2HZ8 A;  3K1H A;  1YZA A;  4EIY A;  3Q6N A;  4JTA B;  5B3S C;  2GA0 A;  3PCV A;  4R32 A;  3S0X A;  4CSA A;  3SNH A;  2W45 A;  2G3K A;  3ZQV A;  4CS9 C;  3W2W A;  2PX0 A;  1BR4 A;  4MTF A;  3GEE A;  2Y3B A;  3N24 A;  3TK0 A;  3U2M A;  3I5Q A;  3ASN C;  2XS1 A;  5KYN A;  3SZR A;  4CIP A;  2WZL A;  4MVM A;  1ORS C;  4NTB A;  2RD9 A;  1E2X A;  3U8P A;  3PHF 2;  4F4B A;  3ASO C;  5KYW B;  1OKK D;  4KNW A;  1T01 A;  5L0D A;  1T6Q A;  2GDC A;  3FVY A;  4MTG A;  4XPW A;  4I44 A;  1OKK A;  2IBF A;  2YQY A;  1GS9 A;  3I4U A;  3O6X A;  1WTY A;  1HE9 A;  2UUH A;  2ZXW C;  3AQC A;  3K1I C;  3V5X A;  5E3C A;  1FR0 A;  4N4W A;  4YN0 B;  1T6I A;  2WZG A;  3MFN A;  1QPU A;  1GGQ A;  1ZZP A;  4MW8 A;  2R25 A;  3CZ6 A;  4BJ6 C;  4ZLC A;  3RQE A;  2L6F A;  3JYH A;  4PFP A;  2P0N A;  2H7V C;  2J9W A;  3EZH A;  3S84 A;  3QTH A;  3NMI A;  5CI9 A;  1HW1 A;  3JTL O;  4YL0 A;  5A6B D;  2YWA A;  2Y39 A;  4NTA A;  1FFT C;  3GWN A;  1UG7 A;  4I3M A;  3DJU B;  1D1C A;  2EPO A;  4LDQ A;  2QE9 A;  4XEK A;  5DVW A;  4KNV A;  3A11 A;  4G7O F;  1Q0K A;  2J7P D;  4WGZ A;  4O7G A;  2AP3 A;  3ZIB A;  3JRM O;  2BL2 A;  1OQC A;  2WVO A;  3K33 A;  5T1D B;  3X1O A;  1AEP A;  2KGO A;  1H7I A;  4C3B A;  4DRH B;  1S7Z A;  1AVO B;  1MNE A;  4OD5 A;  4OIR F;  1BBH A;  4EBK A;  4H4K C;  1VYI A;  3GM2 A;  2YLI A;  1B68 A;  1Z5Z A;  5KYY B;  3TOM A;  2QUP A;  3IQ6 A;  2VCB A;  5DQZ A;  4G7H F;  2QTV A;  1OW8 A;  4EWC A;  4MTO A;  4QI2 A;  4PK4 A;  3H2V A;  3NG1 A;  1N1C A;  4CS9 A;  2EPN A;  2YL7 A;  4X0R A;  4DBQ A;  3SXK A;  1OXK A;  4U5B E;  2NUT A;  1ZW2 A;  2LK4 A;  4H54 A;  1I5N A;  5AC4 A;  4E17 A;  2G62 A;  3HJC A;  4DBR A;  2VCA A;  3TJ6 A;  4JW1 A;  3BEH A;  3RFY A;  1YYJ A;  1G8X A;  1ZU4 A;  3OWT A;  3B0V C;  2CW0 F;  4RDA A;  1RMV A;  1IW7 F;  1LIH A;  1YVI A;  2ZPA A;  4U5F E;  3DD7 A;  4JTC B;  1D1A A;  3W4Y A;  2R02 A;  1LE4 A;  2XLO A;  1D0Y A;  1BR2 A;  3EPV A;  3POV A;  4YT4 A;  3RKO F;  3U0C A;  1G4W R;  1EQ1 A;  1Z23 A;  4LER A;  3RVZ A;  4EHP A;  1LKX A;  1DOV A;  2KW3 C;  2J45 A; 
#chains in the Genus database with same CATH homology
 2ZXR A;  1SMY F;  3DXJ F;  2XXA B;  1OCC C;  3IEE A;  2A68 F;  4W8K A;  5KYX B;  2R7O A;  1V55 C;  3LJB A;  1J8Y F;  1SZI A;  1VOM A;  3K7D A;  3EGD A;  2Q9A A;  1JPJ A;  1MMD A;  3NYJ A;  3T6J A;  1V54 C;  2J9U A;  4OIP F;  1ZHX A;  4CS8 A;  3ZG1 A;  2IOQ A;  3O39 A;  1QZX A;  3K6B A;  3JRT A;  3ZC4 A;  2J0W A;  2WVQ A;  3V7O A;  1O5H A;  2DYS C;  3LS0 A;  2WL8 A;  4YT5 A;  4N06 A;  2Y69 C;  3WOD F;  3EH2 A;  2CNW A;  4G7Z F;  4BEJ A;  4U5G A;  4I1M A;  4BJ5 A;  4P6I C;  3DZA A;  4PFO A;  4DVZ A;  1PD0 A;  4GEH A;  3LS1 A;  4IRU A;  1FMV A;  4IWB A;  2V3C C;  2WVN A;  3AQB A;  3EFO A;  2A1D D;  3SYN A;  4JUR I;  3Q7L A;  4KI2 A;  2XXA A;  2A6H F;  2J0X A;  3KMI A;  3DMD A;  4AE4 B;  2I8B A;  4K0D A;  2IXP A;  4KBL A;  2W9Y A;  3E70 C;  3JSZ A;  2A6E F;  3B0P A;  3FAJ A;  3AG4 C;  3UNG C;  1OCZ C;  3Q6M A;  3LES A;  1MMA A;  4MQ9 F;  3ZVR A;  2KNH A;  3MLG A;  1PD1 A;  5F5F A;  1KU2 A;  2NUP B;  1MND A;  4U5D E;  2J9V A;  4OIN F;  3Q7G A;  2WB7 A;  3EJN A;  3N2Z B;  2HV7 A;  4U5C E;  2EIK C;  3SP1 A;  2CGE A;  4BJT A;  2XSE A;  3AG2 C;  2GFH A;  2FFH A;  3S28 A;  4B6I A;  4HFF B;  3EHM A;  3N0T A;  1TWC A;  1O87 A;  4HEA J;  4QI0 A;  3NRH A;  3B0U X;  3EFO B;  2Z15 A;  4U5E E;  2P7V A;  3H65 A;  2EIJ C;  3CSK A;  2R7U A;  4PJL A;  2EIM C;  5DS5 A;  3WG7 C;  2E87 A;  1M2V A;  1M57 C;  2PX3 A;  3ABK C;  1NG1 A;  1FFH A;  2J7P A;  2M4E A;  2O9X A;  5T3T A;  3T4R A;  4YT8 A;  1W2W A;  3EG9 A;  3M1C B;  3AG3 C;  1WGW A;  4WJ0 A;  1VYK A;  3VYW A;  4A2N B;  3W2V A;  2L9J A;  2DYR C;  1Z3I X;  1D0X A;  1TR2 A;  1OCR C;  4Q5S F;  3OA1 A;  3T6B A;  4JVS A;  4LLC A;  3ECS A;  1M56 C;  1LVK A;  2PF4 E;  2PP4 A;  2Y3D A;  3VAY A;  4EBB A;  2KJG A;  2P6V A;  2W4M A;  1TKN A;  2KQ9 A;  2R7Q A;  4ULW A;  3FDQ A;  2PFD A;  3UR3 C;  4C7O A;  3W8I A;  3F46 A;  3L0I A;  1PCX A;  3ZSU A;  1ST6 A;  2WZF A;  4LAC B;  3GOD A;  2A69 F;  1RJ9 A;  2OG2 A;  5HSW A;  2H7O A;  2Q3T A;  1M2V B;  5KYU B;  3UGO A;  4BJ1 A;  2IYL D;  2IXM A;  2ZXO A;  4LLE A;  3S29 A;  3UMK A;  4O79 A;  3LLK A;  1ZU5 A;  1D1B A;  1NU9 C;  2C04 A;  2V26 A;  4XWJ A;  3KH2 A;  4CS7 A;  4JZA A;  2R7X A;  1ZHW A;  2OCC C;  3EGX B;  3L34 A;  4IAO A;  3W8H A;  5E33 A;  3HTK C;  4YJW A;  4FES A;  5DS6 A;  3E9V A;  4K7B A;  1TWG A;  1IZM A;  2CNW D;  5FCL A;  2X51 A;  3GAN A;  3EHN A;  5L3V A;  5L3Q A;  3NYL A;  4JJG A;  2R7V A;  1QLE C;  1SF8 A;  4M63 A;  5D92 A;  4PJM A;  4JJF A;  2R7T A;  1RJ9 B;  2YHS A;  4AK9 A;  1ZHY A;  3DAF A;  1JPN A;  2FGY A;  5B1B C;  1NZE A;  3AG1 C;  4CBE A;  4XLN F;  4OIO F;  2XRH A;  1FTS A;  4KC9 A;  2Y3H A;  4RD9 A;  2H7B A;  1J8M F;  5BUO A;  5D91 A;  1Z63 A;  4O6N A;  4YWQ A;  1OCO C;  3B9Q A;  4U5H A;  5F5H A;  4CIH A;  4ANJ A;  3LNR A;  4I1O B;  4AE4 A;  2EIN C;  3QMK A;  4HE8 D;  4PJJ A;  3K66 A;  2VAS A;  4O6Y A;  4OD4 A;  2R7W A;  1BR1 A;  3JT1 A;  4BJ5 C;  5IY5 C;  4O6M A;  3DM9 B;  4XLP F;  3F47 A;  4Q7C A;  2R7R A;  1D0Z A;  2B0J A;  3NYM A;  3ABM C;  5KYY A;  4CS8 C;  4Q4Z F;  4GYT A;  3EZI A;  3LLI A;  3RIP A;  2JD3 A;  2NUP A;  4G0H A;  2IXN A;  4ZLD A;  2XL4 A;  2R7S A;  4QDL A;  4NY3 A;  5EHH A;  1VMA A;  3TD7 A;  3DJN B;  1MMG A;  5E2Q A;  3RH3 A;  4C7O B;  2QY9 A;  3ABL C;  4J30 B;  3NKD A;  4RBN A;  4E7Z A;  2DGJ A;  2LSE A;  3FHD A;  4BG0 A;  3EH1 A;  5KYX A;  2J46 A;  1ZHZ A;  2YZS A;  2W4B A;  1VK5 A;  3SEO A;  5DQT A;  3NDB B;  2YEV A;  3S27 A;  4YT2 A;  2Q9C A;  3UMH A;  5T3W A;  4BJ6 A;  3OEO A;  3QZC A;  4J32 B;  3EGD B;  2BE5 F;  2ZXP A;  5DS4 A;  3EG9 B;  4OIQ F;  1LS1 A;  5CI8 A;  3DAG A;  4JCH A;  4HFK B;  3JCU Q;  1ZYR F;  2Q9B A;  4IJJ A;  4C3E A;  4FX5 A;  2EIL C;  3LAY A;  1MMN A;  3UMI A;  3LEV A;  2VB6 A;  5B1A C;  3DM5 A;  3PMR A;  2G3V A;  3EQL F;  3ITF A;  4DOZ A;  3EGX A;  5DLJ A;  2HV6 A;  4XTK A;  5KYW A;  5E3A A;  1TWH A;  4DVY P;  2D5R B;  5EGY A;  3CQZ A;  2CDQ A;  1M2O A;  2IXO A;  2NUT B;  1ZHT A;  1NU7 D;  3RYL A;  3X2Q C;  2MWQ A;  4CSA C;  3NKE A;  5KYU A;  2Y3G A;  4AX2 A;  1TWA A;  2VH3 A;  3HLZ A;  1FMW A;  1Z6A A;  4C3D A;  3KL4 A;  3UGP A;  3I5P A;  2C03 A;  4MND A;  2MYS A;  3MX3 A;  4E7S A;  3KKB A;  2L81 A;  2NG1 A;  3K1H A;  3Q6N A;  5B3S C;  3S0X A;  4CSA A;  3SNH A;  2W45 A;  2G3K A;  4CS9 C;  3W2W A;  2PX0 A;  1BR4 A;  2Y3B A;  3N24 A;  3I5Q A;  3ASN C;  5KYN A;  3SZR A;  2WZL A;  3PHF 2;  4F4B A;  3ASO C;  5KYW B;  1OKK D;  4KNW A;  3FVY A;  4YN0 B;  4I44 A;  4FWV A;  1OKK A;  3O6X A;  3I4U A;  4PJN A;  3K1I C;  2ZXW C;  3AQC A;  5E3C A;  2WZG A;  3CZ6 A;  4ZLC A;  4BJ6 C;  3JYH A;  4PFP A;  2H7V C;  2J9W A;  3EZH A;  5CI9 A;  2Y39 A;  1FFT C;  4I3M A;  3DJU B;  1D1C A;  5DVW A;  4KNV A;  4G7O F;  2J7P D;  4O7G A;  3ZIB A;  2WVO A;  3K33 A;  3X1O A;  5T1D B;  2KGO A;  4C3B A;  1S7Z A;  1MNE A;  4OD5 A;  4OIR F;  4H4K C;  1VYI A;  1Z5Z A;  5KYY B;  4G7H F;  5DQZ A;  2QTV A;  4QI2 A;  4EWC A;  4PK4 A;  3NG1 A;  1N1C A;  4CS9 A;  4X0R A;  4DBQ A;  4U5B E;  2NUT A;  2G62 A;  3HJC A;  4DBR A;  4JW1 A;  3RFY A;  3B0V C;  1G8X A;  1ZU4 A;  3OWT A;  2CW0 F;  4RDA A;  1IW7 F;  2ZPA A;  4U5F E;  3DD7 A;  1D1A A;  1D0Y A;  1BR2 A;  3EPV A;  3POV A;  4YT4 A;  3RKO F;  1Z23 A;  4LER A;  1LKX A;  2KW3 C;  2J45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...