2WZLA

The structure of the n-rna binding domain of the mokola virus phosphoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
DIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMARLEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structure of the N-RNA Binding Domain of the Mokola Virus Phosphoprotein
pubmed doi rcsb
source organism Mokola virus
molecule tags Viral protein
molecule keywords PHOSPHOPROTEIN
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03012 PP_M1 Phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wzlA00
3OA1A 2WZLA 1VYIA
chains in the Genus database with same CATH superfamily
4CS9C 1T6UA 5BQIA 3ABLC 5COGA 3I4UA 1LVKA 3NYJA 1CGOA 2OEVA 4Z9JA 4ZLCA 2PNOA 5L0CA 4YJWA 2EPLX 5A6BA 3X1OA 2JPUA 3OWTA 4G0HA 3U2LA 3VRCA 4J7TA 3GM1A 5DVWA 2OU6A 3SXKA 3K33A 4MVOA 3L34A 1E84A 4PJLA 2A68F 1MMNA 1OKKD 2KSFA 4ER9A 1R4TA 3PHF2 4OINF 4G7OF 2R7XA 3O6XA 2VB6A 2OG2A 2J45A 3EHNA 2HV6A 4U5DE 3LS0A 3V5YA 4MVZA 1ZW2A 1APCA 3KYJA 2EPOA 4N06A 2YL0A 5JT4A 3RIPA 3EJNA 1QZXA 4WJ0A 5FCLA 4E7SA 1YLMA 5L3VA 4IARA 3RQGA 2J9WA 4O6MA 3Q7GA 2DYSC 2ZXWC 3SYNA 3T6JA 1OCCC 2HZ8A 1YAUO 5IY5C 1YYXA 3KL4A 1CPQA 3RF3A 1AUEA 1RKEB 2R05A 1UFBA 4U5HA 4DRJB 1YARO 2M64A 1RKCA 4OIOF 1OR2A 3B0UX 4K1OA 5B1AC 3C8GB 2HSQA 2YWAA 5DQZA 2YL1A 1OCRC 1S7ZA 3EH1A 3N2ZB 3L8IA 4EHPA 2PP4A 3T6GB 1BR4A 2GFHA 2GDCA 4JURI 4B6IA 4N4WA 1RJ9A 4LDKA 5HSWA 2A0BA 1VTMP 5F5HA 3UR3C 4XEFA 3HNKA 3NMIA 4XPWA 1VLTA 5KYWB 5KYWA 3SXYA 1WGWA 2CNWA 3EGXB 2PBEA 1A7DA 2H7BA 5AGFA 4YK5A 3ZQVA 4AL0A 1OXBA 4LERA 4E17A 1BR1A 2W45A 4PR9A 1GM5A 2XLWA 4FWVA 4DXWA 3ECSA 3HNJA 4OD5A 4O6YA 4CDYA 4AE4A 4JTDB 4MTGA 2ETSA 3AOUA 3GODA 4BPMA 3FXHA 2Y3GA 4MTOA 1LE4A 2Y3HA 1OKKA 2NSFA 4LDQA 4WABA 3SNHA 3TK0A 4C3DA 1YVIA 2R9RB 2P0NA 4BJ6A 1WTYA 3T9OA 2EIJC 1U0BB 5KYYA 4ONSA 2BL2A 4DRIB 4P9TA 3WODF 5F5FA 2Q9AA 1Y4CA 1C03A 3ZIBA 2J8WA 2L7AA 2VCAA 5KYUA 4A4AA 5DS4A 4CSAC 1GS9A 2LK4A 3BEHA 2B0HA 2PX0A 4NTAA 1TKNA 1HW1A 2W4MA 4Q4ZF 4EIYA 1FR0A 3SEOA 2KQ9A 2XL6A 2OKUA 5A6JA 2XL8A 2OJED 2YKZA 1PV3A 1PCXA 1RJ9B 3UMHA 2CDQA 5HV9A 5EGYA 2JX0A 5E2QA 1MQVA 5D91A 3SXMA 3SXZA 1WOLA 3U2MA 3N24A 2J7PD 4BJ1A 2A0UA 4OIRF 3POVA 2R02A 5E3AA 2F22A 1M2VB 2CNWD 4H54A 4IAQA 1OW8A 5DQTA 5JS5A 2D5RB 2ZD9A 5JLIA 2GAQA 4EWCA 2L6GA 1TFOB 3JCUQ 3U8VA 3U5SA 3J06A 3FAPB 2C04A 2YEVA 1FFHA 1HY5A 2EPKX 2GWWA 2ZXRA 3CAXA 1OCOC 4BJ5A 3GEHA 1ZHZA 4IJJA 2NUTB 2LD6A 1NG1A 1G8XA 4W8KA 5E3CA 4PJJA 3US6A 1ZYRF 5COFA 4R32A 1QLEC 3O10A 2UUIA 3V5XA 3HNIA 3ATPA 3FOPA 4YL3A 5JSLA 3EZHA 1C02A 1M2OA 1Z6AA 4AE4B 4LLCA 3B9QA 4W8PA 4MQ9F 1K40A 2DGJA 2V3CC 4U5CE 3EFOB 4E18A 3RH3A 2NG1A 2OQMA 5L3QA 1ZHXA 3T6BA 2L6HA 1A7EA 2YHSA 1A0BA 3ITFA 5CI9A 3VF0A 4QI2A 1ORYA 1YA7O 3DI5A 2IXPA 3W2VA 1JPJA 3GEEA 2HJ3A 1M57C 4DRHB 1HW2A 1Z7Qc 4JW1A 2YL7A 2ZPAA 4ULVA 2L81A 1L7CA 2C03A 2M4EA 4XLPF 1FMVA 2IYLD 1ZHTA 2HKVA 4MW3A 3EGDA 1JAFA 3IHUA 4XLNF 1LS4A 2A69F 2P7VA 2XXAB 2Q9BA 3HNLA 3NKDA 3W2WA 2LP4A 3QVZA 1HE9A 4N6CA 3S28A 3RYLA 1FTSA 4ZLDA 2HUJA 3NRHA 3JT1A 2EPNA 3L0IA 5L0JA 2CW0F 4YWQA 1I4YA 2YZSA 5GPGB 4JJFA 1BDJB 2FFHA 1LS1A 4CJGA 3DKAA 2P6VA 4O6NA 1T6QA 2NUPA 1I5NA 2KW3C 3DE8A 4JEBA 1Q0GA 1CGME 3AG3C 4E0HA 3TD7A 4C7OA 3S84A 4LLEA 1FAPB 3TQOA 1WN0A 2Q4FA 1T6IA 3B71A 2ASRA 3GWNA 1BZ4A 4NTFA 4JIOA 5L0GA 2R03A 3FVYA 1F1MA 1KNYA 4MS2A 1H9GA 4XEVA 5EK0A 1LE2A 3G50A 5JVEA 3K6BA 3DAGA 3VAYA 2HSBA 4H4KC 3X2QC 3H65A 2HMQA 2IXNA 2AWCA 3F46A 4KNWA 1K05A 5COMA 3IPMO 3UGOA 1VMAA 4Z9HA 2HV7A 3BRJA 3EHMA 4MW8A 1IZMA 2OJQA 4C3EA 1R5ID 4I44A 2XLVA 3HKKA 4X0RA 3MYIA 3GM2A 3KYIA 4KC9A 2ZXOA 1VYKA 3GWLA 3JRTA 5BQHA 1YYJA 3ZC4A 1NU9C 1AEPA 1TQGA 2RSEB 5DS6A 3DJNB 4Q7CA 1NZEA 2QY9A 4J7YA 1J8YF 4YT2A 2ICWG 3MBGA 3I5PA 1E85A 4ULWA 1IW7F 4P9FA 3M4BA 1MMGA 4U5EE 3CZ6A 3WAQA 1VOMA 5T3TA 3C8ZA 4KNVA 2HFIA 1QKRA 3GORA 1O5HA 3U3BA 1B68A 1M6TA 1ZZPA 3W8IA 4LDRA 3LLIA 1KTMA 2X0CA 3ZTMA 1FMWA 4OD4A 3ASNC 3R7CA 5DS5A 1L3PA 1Q0DA 3OEOA 4BG0A 4JE9A 5K0IA 2WZLA 4CX9A 3ASOC 4JTAB 4K0DA 1C17M 4IRUA 3LEOA 1YJGA 4AL1A 2EINC 3AQBA 3MLGA 1V55C 3UNGC 4CIPA 1E83A 2H8AA 2E87A 4EKWA 4D4NA 5A6KA 3U0CA 1G4US 3M1CB 4RBNA 1OCZC 1S05A 3NDBB 2OOCA 1TWAA 3IQ5A 3C62A 1I4ZA 4IB4A 5F28E 1Y6DA 1ZHYA 5KYXB 2EIKC 3IQ6A 2AWYA 5EHHA 1ZVZA 4CS9A 3CEXA 3W4YA 3AGUA 4CJOA 2J7PA 5JRAA 3CQZA 3AG2C 1T9KA 1YZCA 3VM6A 4CS8A 2XS1A 5L0DA 4J32B 2R7UA 2H7VC 1NBBA 1A41A 1OQCA 2I8BA 1O87A 3JYYA 4N6HA 1DOVA 1OW6A 3LNRA 5AC4A 2J0XA 4U5FE 3RFYA 2OCCC 5L0IA 2Q3TA 4YL0A 3O39A 3EZIA 1U89A 1D0YA 3EQLF 3PMRA 4E7ZA 4DBRA 4U5BE 2XLEA 3A11A 3K7DA 3LUTB 2KC3A 3AGTA 4U5GA 2IOQA 4OIPF 4MTFA 3TOLA 3LS1A 4BEMJ 1NU7D 2AU5A 3FAJA 4CSAA 3SZRA 3LLKA 4IAOA 2IXOA 2HJMA 3M15A 1W2WA 3S90A 1HE1A 4CBEA 1TR2A 3L1MA 1Q0MA 1YA9A 4GYTA 1Z23A 1ZU4A 3LJBA 1U6HA 1D0XA 2CYDA 2EPMX 3ZWIA 3E70C 3FMSA 3O55A 3WHNA 2WVNA 3RQFA 3AJMA 2LCHA 2DB4A 2L6FA 1MMAA 2YVKA 4PFOA 5L0HA 2VC9A 3EH2A 5E33A 4DBQA 4UDVA 1H9TA 3N0TA 2Q9CA 1LKXA 4U9EA 2P61A 1OR3A 1OW7A 3DMDA 5DLJA 2OEXA 3HTKC 4JCZA 2QLAA 4MVRA 5TJ5E 2Q7RA 4YL1A 4NQFA 1XWJA 2EIMC 3U9JA 4P6IC 4G7ZF 3IQCA 5JP7A 4G78A 3TOMA 2PFDA 1TWCA 3ABMC 3C63A 1VLSA 5CI8A 3DJUB 1NFOA 3A9CA 3KPHA 1RCPA 2VCCA 2WVQA 3JYHA 3KH2A 4MVSA 3T4RA 5L0FA 2J9VA 4PJMA 4BEJA 1V74B 3JRMO 1QQ3A 3ABKC 3NMKA 2G62A 4FESA 3MYFA 3B0VC 2AVKA 2QE9A 1EKYA 1Q0FA 4MNDA 1XZPA 4PFPA 3RKOF 2KGOA 1O3UA 3S9OA 3U3FA 3IEEA 3S0XA 3NMJA 2ZXPA 1M56C 2TMVP 2VASA 2CGEA 4IGGA 3U8PA 4XWJA 3K1HA 3QTHA 5CIVA 1UG7A 1V54C 2A6HF 2PX3A 3Q7LA 1TWHA 4GEHA 4HE8D 3ZQYA 2J9BA 1GQAA 4EBBA 4JVSA 5T1DB 1G5ZA 1WATA 3E9VA 4WGYA 4MVUA 1GGQA 5B1BC 4XPXA 4Z9IA 5B3IA 2HS5A 1MNEA 2DI3A 2MWQA 3G4XA 3V5ZA 4CDAA 2V26A 2LIGA 4BJ6C 4XTKA 2YLIA 3DM9B 4C3BA 5KYXA 1QSPA 3C8GA 3TULA 1E86A 3MFNA 4JRZA 3ZG1A 3JTLO 4KI2A 3EG9B 1EA8A 1VK5A 2D4UA 2WZGA 4JEAA 2KYHA 3NYLA 3V7OA 2W9YA 3UMKA 3F47A 1ZU5A 1HMDA 2UUHA 3VYWA 3KKBA 4NTBA 3ZTZA 4OIQF 4QI0A 1FFTC 3NKEA 2LQGA 1EI7A 1MMDA 2G3VA 2R25A 3OA1A 1T5OA 4CS7A 3EGDB 4DVYP 2WZFA 3C7JA 2O9XA 2W4BA 3R2PA 1JR8A 4AX2A 2XRHA 3DM5A 4HFKB 4A2NB 1LI7A 4E0IA 4F4BA 1BR2A 2P1AA 2XLDA 4U9DA 1YDIA 2NPUA 2YLGA 4JCHA 3S29A 3MX3A 2NUPB 2R7OA 3AQCA 4MVMA 3DAFA 2EILC 3Q6MA 3WG7C 2Z15A 3RQEA 3LEVA 4XQ1A 3PCVA 2XLHA 3EFOA 3DXJF 1Z3IX 3NG1A 3NYMA 4GQHA 3TJ6A 2R7WA 2YQYA 3UMIA 4FAPB 1LI5A 4HFFB 4BJ5C 2QUPA 2Y39A 5KYYB 1EQ1A 1N1CA 1CGNA 2Y69C 3FHDA 2A6EF 2J46A 4AK9A 1BBHA 1ZHWA 3CSKA 1OXKA 2R7SA 1SMYF 2Y3BA 2R7VA 1JRAA 3PDMP 4YN0B 1VB5A 1SZIA 2IXMA 1Q0KA 1DOWA 2XS8A 3G4ZA 5JUAA 1VYIA 2KJGA 1TWGA 2GA0A 4JC7A 1NSGB 1ORSC 1J8MF 4K7BA 5D92A 3W8HA 4JKVA 256BA 4EBKA 3EGXA 1SYQA 4D4XA 3M4CA 3RVYA 5T3WA 2QTVA 2WB7A 4PJNA 1QPUA 2MHRA 5BQGA 3U9MA 1JPNA 4PACA 4WGZA 4NY3A 1Z5ZA 4IWBA 4Q5SF 3KMIA 3RW0A 3TJ5A 4CS8C 1T01A 1LPEA 2I15A 2KNHA 2VCBA 2X51A 2XLOA 2YLDA 4EBJA 5B3SC 4C7OB 3GANA 1HMOA 2RD9A 3B0PA 2BE5F 2CCYA 2YRFA 3JZ0A 3DE9A 5A69A 1NFNA 2R7RA 5KYNA 2A1DD 3C8GD 1V4AA 2MYSA 1H6GA 1MNDA 2IM8A 3HLZA 2WVOA 2BC5A 1AVOB 2VH3A 3JSZA 1JOGA 5KYUB 4O79A 3ZSUA 2XL4A 3FOOA 1LM3B 2KK1A 1PD1A 3QMKA 4NCQA 4JZAA 4ANJA 4XPYA 5A6AA 4RD9A 3ZDLA 1WWPA 3H2UA 1LIHA 3K1IA 3DWWA 4LACB 4BJTA 1M2VA 1A7VA 1NLXA 4YT8A 1RMVA 2FGYA 2YL3A 5BUOA 2LFDA 2Y3DA 4M63A 4JTCB 2IBFA 2L9JA 4CDVA 4G7HF 1JMWA 2J9UA 2NSGA 3JSEO 4DOZA 4I3MA 3RVZA 4RDAA 1ST6A 5A6BD 3LAYA 3M79A 2WL8A 2LSEA 3QVYA 2AP3A 3QW1A 4I1OB 3DZAA 3QZCA 1D1AA 3K66A 3SP1A 2DYRC 2XSEA 2XXAA 2B0JA 4KBLA 1WASA 3EG9A 3GM3A 3UGPA 2J0WA 1H7IA 3AG4C 1TFKB 4YT5A 1Z63A 3FDQA 2HMZA 3I5QA 4J30B 4DJ9A 3K1IC 5FZTA 2G3KA 1PD0A 4O7GA 4PK4A 4I1MA 2JD3A 2XM0A 2PF4E 1RKEA 3B29A 3EPVA 3LESA 1E2XA 2NUTA 1FNTc 3L8JA 3IQTA 2FAPB 1XZQA 1ORJA 4JJGA 1D0ZA 2LFFA 2R7QA 2QNLA 3C18A 1CPRA 1SF8A 4HEAJ 1QVXA 3LNMB 4QDLA 4YT4A 1D1CA 1YZAA 1K04A 2XM4A 4MVQA 4NC3A 4XEKA 3S27A 5AC5A 1SR2A 1RXQA 4CIHA 2Q00A 4FX5A 4EUKB 2XLMA 3Q6NA 1D1BA 3DD7A 3ZVRA 3GEIA 3H2VA 3HJCA 1G4WR 4L6RA 4DVZA 2R7TA 2H7OA 3QW0A 3AG1C 1ZW3A 1KU2A
chains in the Genus database with same CATH topology
4CS9C 3ABLC 3I4UA 1LVKA 3NYJA 4ZLCA 4YJWA 3X1OA 3OWTA 4G0HA 5DVWA 3K33A 3L34A 4PJLA 2A68F 1MMNA 1OKKD 2R7XA 3PHF2 4OINF 4G7OF 3O6XA 2VB6A 2OG2A 2J45A 3EHNA 2HV6A 4U5DE 3LS0A 4N06A 3RIPA 3EJNA 1QZXA 4WJ0A 5FCLA 4E7SA 5L3VA 2J9WA 4O6MA 3Q7GA 2DYSC 2ZXWC 3SYNA 3T6JA 1OCCC 5IY5C 3KL4A 4U5HA 4OIOF 3B0UX 5B1AC 5DQZA 1OCRC 1S7ZA 3EH1A 3N2ZB 2PP4A 1BR4A 2GFHA 4JURI 4B6IA 1RJ9A 5HSWA 5F5HA 3UR3C 5KYWB 5KYWA 1WGWA 2CNWA 3EGXB 2H7BA 4LERA 1BR1A 2W45A 4FWVA 3ECSA 4OD5A 4O6YA 4AE4A 3GODA 2Y3GA 2Y3HA 1OKKA 3SNHA 4C3DA 4BJ6A 2EIJC 5KYYA 5F5FA 3WODF 2Q9AA 3ZIBA 5KYUA 4CSAC 5DS4A 2PX0A 1TKNA 2W4MA 4Q4ZF 3SEOA 2KQ9A 3UMHA 1PCXA 1RJ9B 2CDQA 5EGYA 5E2QA 5D91A 3N24A 2J7PD 4BJ1A 4OIRF 3POVA 5E3AA 1M2VB 2CNWD 5DQTA 2D5RB 4EWCA 3JCUQ 2C04A 2YEVA 1FFHA 4BJ5A 2ZXRA 1OCOC 1ZHZA 4IJJA 2NUTB 5E3CA 1NG1A 1G8XA 4W8KA 1Z63A 4PJJA 1ZYRF 1QLEC 3EZHA 1M2OA 1Z6AA 4AE4B 4LLCA 3B9QA 4MQ9F 2DGJA 2V3CC 4U5CE 3EFOB 3RH3A 5L3QA 1ZHXA 3T6BA 3ITFA 2YHSA 5CI9A 4QI2A 3W2VA 2IXPA 1JPJA 1M57C 4JW1A 2ZPAA 2L81A 2C03A 2M4EA 4XLPF 1FMVA 2IYLD 1ZHTA 3EGDA 4XLNF 2P7VA 2A69F 2XXAB 2Q9BA 3NKDA 3W2WA 3S28A 3RYLA 1FTSA 4ZLDA 3NRHA 3JT1A 3L0IA 2CW0F 4YWQA 2YZSA 4JJFA 2FFHA 1LS1A 2P6VA 4O6NA 2NUPA 2KW3C 3AG3C 3TD7A 4C7OA 4LLEA 3FVYA 3K6BA 3DAGA 3VAYA 4H4KC 3X2QC 3H65A 2IXNA 4KNWA 3F46A 3UGOA 1VMAA 2HV7A 3EHMA 4C3EA 1IZMA 4I44A 4X0RA 4KC9A 2ZXOA 1VYKA 3JRTA 3ZC4A 1NU9C 5DS6A 3DJNB 4Q7CA 1NZEA 2QY9A 4YT2A 1J8YF 3I5PA 4ULWA 1IW7F 1MMGA 4U5EE 3CZ6A 1VOMA 5T3TA 4KNVA 1O5HA 3W8IA 3LLIA 1FMWA 4OD4A 3ASNC 5DS5A 3OEOA 4BG0A 2WZLA 3ASOC 4K0DA 4IRUA 2EINC 3AQBA 3MLGA 1V55C 3UNGC 2E87A 3M1CB 4RBNA 1OCZC 3NDBB 1TWAA 1ZHYA 5KYXB 2EIKC 5EHHA 4CS9A 2J7PA 3CQZA 3AG2C 4CS8A 2R7UA 4J32B 2H7VC 2I8BA 1O87A 3LNRA 2J0XA 4U5FE 3RFYA 1KU2A 2Q3TA 3O39A 3EZIA 1D0YA 3EQLF 3PMRA 4E7ZA 4DBRA 4U5BE 3K7DA 4U5GA 4OIPF 2IOQA 3LS1A 1NU7D 3FAJA 4CSAA 3SZRA 3LLKA 4IAOA 2IXOA 1W2WA 4CBEA 1TR2A 4GYTA 1Z23A 1ZU4A 3LJBA 1D0XA 3E70C 2WVNA 1MMAA 4PFOA 3EH2A 5E33A 4DBQA 3N0TA 2Q9CA 1LKXA 3DMDA 5DLJA 3HTKC 2EIMC 4P6IC 4G7ZF 2PFDA 1TWCA 3ABMC 5CI8A 3DJUB 3T4RA 3KH2A 2WVQA 3JYHA 2J9VA 4PJMA 4BEJA 3ABKC 4FESA 2G62A 3B0VC 4MNDA 4PFPA 2KGOA 3IEEA 3S0XA 2ZXPA 1M56C 2VASA 2CGEA 4XWJA 3K1HA 1V54C 3Q7LA 2A6HF 2PX3A 4GEHA 1TWHA 4HE8D 4EBBA 4JVSA 5T1DB 3E9VA 5B1BC 1MNEA 2MWQA 2V26A 4BJ6C 4XTKA 3DM9B 5KYXA 4C3BA 3ZG1A 4KI2A 3EG9B 1VK5A 2WZGA 3NYLA 3V7OA 2W9YA 3UMKA 3F47A 1ZU5A 3VYWA 3KKBA 4OIQF 4QI0A 1FFTC 3NKEA 4CS7A 1MMDA 2G3VA 4DVYP 3OA1A 3EGDB 2WZFA 2O9XA 2W4BA 4AX2A 2XRHA 3DM5A 4HFKB 4A2NB 4F4BA 1BR2A 4JCHA 3S29A 3MX3A 2NUPB 2R7OA 3AQCA 3DAFA 2EILC 3Q6MA 3WG7C 2Z15A 3LEVA 3EFOA 3DXJF 1Z3IX 3NG1A 3NYMA 2R7WA 3UMIA 4HFFB 4BJ5C 2Y39A 5KYYB 1N1CA 2Y69C 3FHDA 2A6EF 2J46A 4AK9A 1ZHWA 3CSKA 2R7SA 1SMYF 2Y3BA 2R7VA 4YN0B 1SZIA 2IXMA 1VYIA 2KJGA 1TWGA 1J8MF 4K7BA 5D92A 3W8HA 3EGXA 5T3WA 2QTVA 2WB7A 4PJNA 1JPNA 4NY3A 1Z5ZA 4IWBA 4Q5SF 3KMIA 4CS8C 2KNHA 4C7OB 2X51A 5B3SC 3GANA 3B0PA 2BE5F 2R7RA 5KYNA 2A1DD 2MYSA 1MNDA 3HLZA 2WVOA 2VH3A 3JSZA 5KYUB 4O79A 3ZSUA 2XL4A 1PD1A 3QMKA 4ANJA 4JZAA 4RD9A 4LACB 4BJTA 1M2VA 4YT8A 2FGYA 5BUOA 2Y3DA 4M63A 2L9JA 4G7HF 2J9UA 4DOZA 4I3MA 4RDAA 1ST6A 3LAYA 2WL8A 2LSEA 3SP1A 4I1OB 2XXAA 3DZAA 3QZCA 1D1AA 3K66A 2DYRC 2XSEA 2B0JA 4KBLA 3EG9A 3UGPA 2J0WA 3AG4C 4YT5A 3FDQA 4J30B 3I5QA 3K1IC 2G3KA 1PD0A 4O7GA 4PK4A 4I1MA 2JD3A 3EPVA 2PF4E 3LESA 3RKOF 2NUTA 4JJGA 1D0ZA 2R7QA 4HEAJ 4QDLA 4YT4A 1SF8A 1D1CA 4CIHA 3S27A 4FX5A 3Q6NA 1D1BA 3DD7A 3ZVRA 3HJCA 4DVZA 2R7TA 2H7OA 3AG1C 2NG1A 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  2WZL A;  1VYI A; 
#chains in the Genus database with same CATH topology
 4CS9 C;  1T6U A;  5BQI A;  3ABL C;  5COG A;  3I4U A;  1LVK A;  3NYJ A;  1CGO A;  2OEV A;  4Z9J A;  4ZLC A;  2PNO A;  5L0C A;  4YJW A;  2EPL X;  5A6B A;  3X1O A;  2JPU A;  3OWT A;  4G0H A;  3U2L A;  3VRC A;  4J7T A;  3GM1 A;  5DVW A;  2OU6 A;  3SXK A;  3K33 A;  4MVO A;  3L34 A;  1E84 A;  4PJL A;  2A68 F;  1MMN A;  1OKK D;  2KSF A;  4ER9 A;  1R4T A;  3PHF 2;  4OIN F;  4G7O F;  2R7X A;  3O6X A;  2VB6 A;  2OG2 A;  2J45 A;  3EHN A;  2HV6 A;  4U5D E;  3LS0 A;  3V5Y A;  4MVZ A;  1ZW2 A;  1APC A;  3KYJ A;  2EPO A;  4N06 A;  2YL0 A;  5JT4 A;  3RIP A;  3EJN A;  1QZX A;  4WJ0 A;  5FCL A;  4E7S A;  1YLM A;  5L3V A;  4IAR A;  3RQG A;  2J9W A;  4O6M A;  3Q7G A;  2DYS C;  2ZXW C;  3SYN A;  3T6J A;  1OCC C;  2HZ8 A;  1YAU O;  5IY5 C;  1YYX A;  3KL4 A;  1CPQ A;  3RF3 A;  1AUE A;  1RKE B;  2R05 A;  1UFB A;  4U5H A;  4DRJ B;  1YAR O;  2M64 A;  1RKC A;  4OIO F;  1OR2 A;  3B0U X;  4K1O A;  5B1A C;  3C8G B;  2HSQ A;  2YWA A;  5DQZ A;  2YL1 A;  1OCR C;  1S7Z A;  3EH1 A;  3N2Z B;  3L8I A;  4EHP A;  2PP4 A;  3T6G B;  1BR4 A;  2GFH A;  2GDC A;  4JUR I;  4B6I A;  4N4W A;  1RJ9 A;  4LDK A;  5HSW A;  2A0B A;  1VTM P;  5F5H A;  3UR3 C;  4XEF A;  3HNK A;  3NMI A;  4XPW A;  1VLT A;  5KYW B;  5KYW A;  3SXY A;  1WGW A;  2CNW A;  3EGX B;  2PBE A;  1A7D A;  2H7B A;  5AGF A;  4YK5 A;  3ZQV A;  4AL0 A;  1OXB A;  4LER A;  4E17 A;  1BR1 A;  2W45 A;  4PR9 A;  1GM5 A;  2XLW A;  4FWV A;  4DXW A;  3ECS A;  3HNJ A;  4OD5 A;  4O6Y A;  4CDY A;  4AE4 A;  4JTD B;  4MTG A;  2ETS A;  3AOU A;  3GOD A;  4BPM A;  3FXH A;  2Y3G A;  4MTO A;  1LE4 A;  2Y3H A;  1OKK A;  2NSF A;  4LDQ A;  4WAB A;  3SNH A;  3TK0 A;  4C3D A;  1YVI A;  2R9R B;  2P0N A;  4BJ6 A;  1WTY A;  3T9O A;  2EIJ C;  1U0B B;  5KYY A;  4ONS A;  2BL2 A;  4DRI B;  4P9T A;  3WOD F;  5F5F A;  2Q9A A;  1Y4C A;  1C03 A;  3ZIB A;  2J8W A;  2L7A A;  2VCA A;  5KYU A;  4A4A A;  5DS4 A;  4CSA C;  1GS9 A;  2LK4 A;  3BEH A;  2B0H A;  2PX0 A;  4NTA A;  1TKN A;  1HW1 A;  2W4M A;  4Q4Z F;  4EIY A;  1FR0 A;  3SEO A;  2KQ9 A;  2XL6 A;  2OKU A;  5A6J A;  2XL8 A;  2OJE D;  2YKZ A;  1PV3 A;  1PCX A;  1RJ9 B;  3UMH A;  2CDQ A;  5HV9 A;  5EGY A;  2JX0 A;  5E2Q A;  1MQV A;  5D91 A;  3SXM A;  3SXZ A;  1WOL A;  3U2M A;  3N24 A;  2J7P D;  4BJ1 A;  2A0U A;  4OIR F;  3POV A;  2R02 A;  5E3A A;  2F22 A;  1M2V B;  2CNW D;  4H54 A;  4IAQ A;  1OW8 A;  5DQT A;  5JS5 A;  2D5R B;  2ZD9 A;  5JLI A;  2GAQ A;  4EWC A;  2L6G A;  1TFO B;  3JCU Q;  3U8V A;  3U5S A;  3J06 A;  3FAP B;  2C04 A;  2YEV A;  1FFH A;  1HY5 A;  2EPK X;  2GWW A;  2ZXR A;  3CAX A;  1OCO C;  4BJ5 A;  3GEH A;  1ZHZ A;  4IJJ A;  2NUT B;  2LD6 A;  1NG1 A;  1G8X A;  4W8K A;  5E3C A;  4PJJ A;  3US6 A;  1ZYR F;  5COF A;  4R32 A;  1QLE C;  3O10 A;  2UUI A;  3V5X A;  3HNI A;  3ATP A;  3FOP A;  4YL3 A;  5JSL A;  3EZH A;  1C02 A;  1M2O A;  1Z6A A;  4AE4 B;  4LLC A;  3B9Q A;  4W8P A;  4MQ9 F;  1K40 A;  2DGJ A;  2V3C C;  4U5C E;  3EFO B;  4E18 A;  3RH3 A;  2NG1 A;  2OQM A;  5L3Q A;  1ZHX A;  3T6B A;  2L6H A;  1A7E A;  2YHS A;  1A0B A;  3ITF A;  5CI9 A;  3VF0 A;  4QI2 A;  1ORY A;  1YA7 O;  3DI5 A;  2IXP A;  3W2V A;  1JPJ A;  3GEE A;  2HJ3 A;  1M57 C;  4DRH B;  1HW2 A;  1Z7Q c;  4JW1 A;  2YL7 A;  2ZPA A;  4ULV A;  2L81 A;  1L7C A;  2C03 A;  2M4E A;  4XLP F;  1FMV A;  2IYL D;  1ZHT A;  2HKV A;  4MW3 A;  3EGD A;  1JAF A;  3IHU A;  4XLN F;  1LS4 A;  2A69 F;  2P7V A;  2XXA B;  2Q9B A;  3HNL A;  3NKD A;  3W2W A;  2LP4 A;  3QVZ A;  1HE9 A;  4N6C A;  3S28 A;  3RYL A;  1FTS A;  4ZLD A;  2HUJ A;  3NRH A;  3JT1 A;  2EPN A;  3L0I A;  5L0J A;  2CW0 F;  4YWQ A;  1I4Y A;  2YZS A;  5GPG B;  4JJF A;  1BDJ B;  2FFH A;  1LS1 A;  4CJG A;  3DKA A;  2P6V A;  4O6N A;  1T6Q A;  2NUP A;  1I5N A;  2KW3 C;  3DE8 A;  4JEB A;  1Q0G A;  1CGM E;  3AG3 C;  4E0H A;  3TD7 A;  4C7O A;  3S84 A;  4LLE A;  1FAP B;  3TQO A;  1WN0 A;  2Q4F A;  1T6I A;  3B71 A;  2ASR A;  3GWN A;  1BZ4 A;  4NTF A;  4JIO A;  5L0G A;  2R03 A;  3FVY A;  1F1M A;  1KNY A;  4MS2 A;  1H9G A;  4XEV A;  5EK0 A;  1LE2 A;  3G50 A;  5JVE A;  3K6B A;  3DAG A;  3VAY A;  2HSB A;  4H4K C;  3X2Q C;  3H65 A;  2HMQ A;  2IXN A;  2AWC A;  3F46 A;  4KNW A;  1K05 A;  5COM A;  3IPM O;  3UGO A;  1VMA A;  4Z9H A;  2HV7 A;  3BRJ A;  3EHM A;  4MW8 A;  1IZM A;  2OJQ A;  4C3E A;  1R5I D;  4I44 A;  2XLV A;  3HKK A;  4X0R A;  3MYI A;  3GM2 A;  3KYI A;  4KC9 A;  2ZXO A;  1VYK A;  3GWL A;  3JRT A;  5BQH A;  1YYJ A;  3ZC4 A;  1NU9 C;  1AEP A;  1TQG A;  2RSE B;  5DS6 A;  3DJN B;  4Q7C A;  1NZE A;  2QY9 A;  4J7Y A;  1J8Y F;  4YT2 A;  2ICW G;  3MBG A;  3I5P A;  1E85 A;  4ULW A;  1IW7 F;  4P9F A;  3M4B A;  1MMG A;  4U5E E;  3CZ6 A;  3WAQ A;  1VOM A;  5T3T A;  3C8Z A;  4KNV A;  2HFI A;  1QKR A;  3GOR A;  1O5H A;  3U3B A;  1B68 A;  1M6T A;  1ZZP A;  3W8I A;  4LDR A;  3LLI A;  1KTM A;  2X0C A;  3ZTM A;  1FMW A;  4OD4 A;  3ASN C;  3R7C A;  5DS5 A;  1L3P A;  1Q0D A;  3OEO A;  4BG0 A;  4JE9 A;  5K0I A;  2WZL A;  4CX9 A;  3ASO C;  4JTA B;  4K0D A;  1C17 M;  4IRU A;  3LEO A;  1YJG A;  4AL1 A;  2EIN C;  3AQB A;  3MLG A;  1V55 C;  3UNG C;  4CIP A;  1E83 A;  2H8A A;  2E87 A;  4EKW A;  4D4N A;  5A6K A;  3U0C A;  1G4U S;  3M1C B;  4RBN A;  1OCZ C;  1S05 A;  3NDB B;  2OOC A;  1TWA A;  3IQ5 A;  3C62 A;  1I4Z A;  4IB4 A;  5F28 E;  1Y6D A;  1ZHY A;  5KYX B;  2EIK C;  3IQ6 A;  2AWY A;  5EHH A;  1ZVZ A;  4CS9 A;  3CEX A;  3W4Y A;  3AGU A;  4CJO A;  2J7P A;  5JRA A;  3CQZ A;  3AG2 C;  1T9K A;  1YZC A;  3VM6 A;  4CS8 A;  2XS1 A;  5L0D A;  4J32 B;  2R7U A;  2H7V C;  1NBB A;  1A41 A;  1OQC A;  2I8B A;  1O87 A;  3JYY A;  4N6H A;  1DOV A;  1OW6 A;  3LNR A;  5AC4 A;  2J0X A;  4U5F E;  3RFY A;  2OCC C;  5L0I A;  2Q3T A;  4YL0 A;  3O39 A;  3EZI A;  1U89 A;  1D0Y A;  3EQL F;  3PMR A;  4E7Z A;  4DBR A;  4U5B E;  2XLE A;  3A11 A;  3K7D A;  3LUT B;  2KC3 A;  3AGT A;  4U5G A;  2IOQ A;  4OIP F;  4MTF A;  3TOL A;  3LS1 A;  4BEM J;  1NU7 D;  2AU5 A;  3FAJ A;  4CSA A;  3SZR A;  3LLK A;  4IAO A;  2IXO A;  2HJM A;  3M15 A;  1W2W A;  3S90 A;  1HE1 A;  4CBE A;  1TR2 A;  3L1M A;  1Q0M A;  1YA9 A;  4GYT A;  1Z23 A;  1ZU4 A;  3LJB A;  1U6H A;  1D0X A;  2CYD A;  2EPM X;  3ZWI A;  3E70 C;  3FMS A;  3O55 A;  3WHN A;  2WVN A;  3RQF A;  3AJM A;  2LCH A;  2DB4 A;  2L6F A;  1MMA A;  2YVK A;  4PFO A;  5L0H A;  2VC9 A;  3EH2 A;  5E33 A;  4DBQ A;  4UDV A;  1H9T A;  3N0T A;  2Q9C A;  1LKX A;  4U9E A;  2P61 A;  1OR3 A;  1OW7 A;  3DMD A;  5DLJ A;  2OEX A;  3HTK C;  4JCZ A;  2QLA A;  4MVR A;  5TJ5 E;  2Q7R A;  4YL1 A;  4NQF A;  1XWJ A;  2EIM C;  3U9J A;  4P6I C;  4G7Z F;  3IQC A;  5JP7 A;  4G78 A;  3TOM A;  2PFD A;  1TWC A;  3ABM C;  3C63 A;  1VLS A;  5CI8 A;  3DJU B;  1NFO A;  3A9C A;  3KPH A;  1RCP A;  2VCC A;  2WVQ A;  3JYH A;  3KH2 A;  4MVS A;  3T4R A;  5L0F A;  2J9V A;  4PJM A;  4BEJ A;  1V74 B;  3JRM O;  1QQ3 A;  3ABK C;  3NMK A;  2G62 A;  4FES A;  3MYF A;  3B0V C;  2AVK A;  2QE9 A;  1EKY A;  1Q0F A;  4MND A;  1XZP A;  4PFP A;  3RKO F;  2KGO A;  1O3U A;  3S9O A;  3U3F A;  3IEE A;  3S0X A;  3NMJ A;  2ZXP A;  1M56 C;  2TMV P;  2VAS A;  2CGE A;  4IGG A;  3U8P A;  4XWJ A;  3K1H A;  3QTH A;  5CIV A;  1UG7 A;  1V54 C;  2A6H F;  2PX3 A;  3Q7L A;  1TWH A;  4GEH A;  4HE8 D;  3ZQY A;  2J9B A;  1GQA A;  4EBB A;  4JVS A;  5T1D B;  1G5Z A;  1WAT A;  3E9V A;  4WGY A;  4MVU A;  1GGQ A;  5B1B C;  4XPX A;  4Z9I A;  5B3I A;  2HS5 A;  1MNE A;  2DI3 A;  2MWQ A;  3G4X A;  3V5Z A;  4CDA A;  2V26 A;  2LIG A;  4BJ6 C;  4XTK A;  2YLI A;  3DM9 B;  4C3B A;  5KYX A;  1QSP A;  3C8G A;  3TUL A;  1E86 A;  3MFN A;  4JRZ A;  3ZG1 A;  3JTL O;  4KI2 A;  3EG9 B;  1EA8 A;  1VK5 A;  2D4U A;  2WZG A;  4JEA A;  2KYH A;  3NYL A;  3V7O A;  2W9Y A;  3UMK A;  3F47 A;  1ZU5 A;  1HMD A;  2UUH A;  3VYW A;  3KKB A;  4NTB A;  3ZTZ A;  4OIQ F;  4QI0 A;  1FFT C;  3NKE A;  2LQG A;  1EI7 A;  1MMD A;  2G3V A;  2R25 A;  3OA1 A;  1T5O A;  4CS7 A;  3EGD B;  4DVY P;  2WZF A;  3C7J A;  2O9X A;  2W4B A;  3R2P A;  1JR8 A;  4AX2 A;  2XRH A;  3DM5 A;  4HFK B;  4A2N B;  1LI7 A;  4E0I A;  4F4B A;  1BR2 A;  2P1A A;  2XLD A;  4U9D A;  1YDI A;  2NPU A;  2YLG A;  4JCH A;  3S29 A;  3MX3 A;  2NUP B;  2R7O A;  3AQC A;  4MVM A;  3DAF A;  2EIL C;  3Q6M A;  3WG7 C;  2Z15 A;  3RQE A;  3LEV A;  4XQ1 A;  3PCV A;  2XLH A;  3EFO A;  3DXJ F;  1Z3I X;  3NG1 A;  3NYM A;  4GQH A;  3TJ6 A;  2R7W A;  2YQY A;  3UMI A;  4FAP B;  1LI5 A;  4HFF B;  4BJ5 C;  2QUP A;  2Y39 A;  5KYY B;  1EQ1 A;  1N1C A;  1CGN A;  2Y69 C;  3FHD A;  2A6E F;  2J46 A;  4AK9 A;  1BBH A;  1ZHW A;  3CSK A;  1OXK A;  2R7S A;  1SMY F;  2Y3B A;  2R7V A;  1JRA A;  3PDM P;  4YN0 B;  1VB5 A;  1SZI A;  2IXM A;  1Q0K A;  1DOW A;  2XS8 A;  3G4Z A;  5JUA A;  1VYI A;  2KJG A;  1TWG A;  2GA0 A;  4JC7 A;  1NSG B;  1ORS C;  1J8M F;  4K7B A;  5D92 A;  3W8H A;  4JKV A;  256B A;  4EBK A;  3EGX A;  1SYQ A;  4D4X A;  3M4C A;  3RVY A;  5T3W A;  2QTV A;  2WB7 A;  4PJN A;  1QPU A;  2MHR A;  5BQG A;  3U9M A;  1JPN A;  4PAC A;  4WGZ A;  4NY3 A;  1Z5Z A;  4IWB A;  4Q5S F;  3KMI A;  3RW0 A;  3TJ5 A;  4CS8 C;  1T01 A;  1LPE A;  2I15 A;  2KNH A;  2VCB A;  2X51 A;  2XLO A;  2YLD A;  4EBJ A;  5B3S C;  4C7O B;  3GAN A;  1HMO A;  2RD9 A;  3B0P A;  2BE5 F;  2CCY A;  2YRF A;  3JZ0 A;  3DE9 A;  5A69 A;  1NFN A;  2R7R A;  5KYN A;  2A1D D;  3C8G D;  1V4A A;  2MYS A;  1H6G A;  1MND A;  2IM8 A;  3HLZ A;  2WVO A;  2BC5 A;  1AVO B;  2VH3 A;  3JSZ A;  1JOG A;  5KYU B;  4O79 A;  3ZSU A;  2XL4 A;  3FOO A;  1LM3 B;  2KK1 A;  1PD1 A;  3QMK A;  4NCQ A;  4JZA A;  4ANJ A;  4XPY A;  5A6A A;  4RD9 A;  3ZDL A;  1WWP A;  3H2U A;  1LIH A;  3K1I A;  3DWW A;  4LAC B;  4BJT A;  1M2V A;  1A7V A;  1NLX A;  4YT8 A;  1RMV A;  2FGY A;  2YL3 A;  5BUO A;  2LFD A;  2Y3D A;  4M63 A;  4JTC B;  2IBF A;  2L9J A;  4CDV A;  4G7H F;  1JMW A;  2J9U A;  2NSG A;  3JSE O;  4DOZ A;  4I3M A;  3RVZ A;  4RDA A;  1ST6 A;  5A6B D;  3LAY A;  3M79 A;  2WL8 A;  2LSE A;  3QVY A;  2AP3 A;  3QW1 A;  4I1O B;  3DZA A;  3QZC A;  1D1A A;  3K66 A;  3SP1 A;  2DYR C;  2XSE A;  2XXA A;  2B0J A;  4KBL A;  1WAS A;  3EG9 A;  3GM3 A;  3UGP A;  2J0W A;  1H7I A;  3AG4 C;  1TFK B;  4YT5 A;  1Z63 A;  3FDQ A;  2HMZ A;  3I5Q A;  4J30 B;  4DJ9 A;  3K1I C;  5FZT A;  2G3K A;  1PD0 A;  4O7G A;  4PK4 A;  4I1M A;  2JD3 A;  2XM0 A;  2PF4 E;  1RKE A;  3B29 A;  3EPV A;  3LES A;  1E2X A;  2NUT A;  1FNT c;  3L8J A;  3IQT A;  2FAP B;  1XZQ A;  1ORJ A;  4JJG A;  1D0Z A;  2LFF A;  2R7Q A;  2QNL A;  3C18 A;  1CPR A;  1SF8 A;  4HEA J;  1QVX A;  3LNM B;  4QDL A;  4YT4 A;  1D1C A;  1YZA A;  1K04 A;  2XM4 A;  4MVQ A;  4NC3 A;  4XEK A;  3S27 A;  5AC5 A;  1SR2 A;  1RXQ A;  4CIH A;  2Q00 A;  4FX5 A;  4EUK B;  2XLM A;  3Q6N A;  1D1B A;  3DD7 A;  3ZVR A;  3GEI A;  3H2V A;  3HJC A;  1G4W R;  4L6R A;  4DVZ A;  2R7T A;  2H7O A;  3QW0 A;  3AG1 C;  1ZW3 A;  1KU2 A; 
#chains in the Genus database with same CATH homology
 4CS9 C;  3ABL C;  3I4U A;  1LVK A;  3NYJ A;  4ZLC A;  4YJW A;  3X1O A;  3OWT A;  4G0H A;  5DVW A;  3K33 A;  3L34 A;  4PJL A;  2A68 F;  1MMN A;  1OKK D;  2R7X A;  3PHF 2;  4OIN F;  4G7O F;  3O6X A;  2VB6 A;  2OG2 A;  2J45 A;  3EHN A;  2HV6 A;  4U5D E;  3LS0 A;  4N06 A;  3RIP A;  3EJN A;  1QZX A;  4WJ0 A;  5FCL A;  4E7S A;  5L3V A;  2J9W A;  4O6M A;  3Q7G A;  2DYS C;  2ZXW C;  3SYN A;  3T6J A;  1OCC C;  5IY5 C;  3KL4 A;  4U5H A;  4OIO F;  3B0U X;  5B1A C;  5DQZ A;  1OCR C;  1S7Z A;  3EH1 A;  3N2Z B;  2PP4 A;  1BR4 A;  2GFH A;  4JUR I;  4B6I A;  1RJ9 A;  5HSW A;  5F5H A;  3UR3 C;  5KYW B;  5KYW A;  1WGW A;  2CNW A;  3EGX B;  2H7B A;  4LER A;  1BR1 A;  2W45 A;  4FWV A;  3ECS A;  4OD5 A;  4O6Y A;  4AE4 A;  3GOD A;  2Y3G A;  2Y3H A;  1OKK A;  3SNH A;  4C3D A;  4BJ6 A;  2EIJ C;  5KYY A;  5F5F A;  3WOD F;  2Q9A A;  3ZIB A;  5KYU A;  4CSA C;  5DS4 A;  2PX0 A;  1TKN A;  2W4M A;  4Q4Z F;  3SEO A;  2KQ9 A;  3UMH A;  1PCX A;  1RJ9 B;  2CDQ A;  5EGY A;  5E2Q A;  5D91 A;  3N24 A;  2J7P D;  4BJ1 A;  4OIR F;  3POV A;  5E3A A;  1M2V B;  2CNW D;  5DQT A;  2D5R B;  4EWC A;  3JCU Q;  2C04 A;  2YEV A;  1FFH A;  4BJ5 A;  2ZXR A;  1OCO C;  1ZHZ A;  4IJJ A;  2NUT B;  5E3C A;  1NG1 A;  1G8X A;  4W8K A;  1Z63 A;  4PJJ A;  1ZYR F;  1QLE C;  3EZH A;  1M2O A;  1Z6A A;  4AE4 B;  4LLC A;  3B9Q A;  4MQ9 F;  2DGJ A;  2V3C C;  4U5C E;  3EFO B;  3RH3 A;  5L3Q A;  1ZHX A;  3T6B A;  3ITF A;  2YHS A;  5CI9 A;  4QI2 A;  3W2V A;  2IXP A;  1JPJ A;  1M57 C;  4JW1 A;  2ZPA A;  2L81 A;  2C03 A;  2M4E A;  4XLP F;  1FMV A;  2IYL D;  1ZHT A;  3EGD A;  4XLN F;  2P7V A;  2A69 F;  2XXA B;  2Q9B A;  3NKD A;  3W2W A;  3S28 A;  3RYL A;  1FTS A;  4ZLD A;  3NRH A;  3JT1 A;  3L0I A;  2CW0 F;  4YWQ A;  2YZS A;  4JJF A;  2FFH A;  1LS1 A;  2P6V A;  4O6N A;  2NUP A;  2KW3 C;  3AG3 C;  3TD7 A;  4C7O A;  4LLE A;  3FVY A;  3K6B A;  3DAG A;  3VAY A;  4H4K C;  3X2Q C;  3H65 A;  2IXN A;  4KNW A;  3F46 A;  3UGO A;  1VMA A;  2HV7 A;  3EHM A;  4C3E A;  1IZM A;  4I44 A;  4X0R A;  4KC9 A;  2ZXO A;  1VYK A;  3JRT A;  3ZC4 A;  1NU9 C;  5DS6 A;  3DJN B;  4Q7C A;  1NZE A;  2QY9 A;  4YT2 A;  1J8Y F;  3I5P A;  4ULW A;  1IW7 F;  1MMG A;  4U5E E;  3CZ6 A;  1VOM A;  5T3T A;  4KNV A;  1O5H A;  3W8I A;  3LLI A;  1FMW A;  4OD4 A;  3ASN C;  5DS5 A;  3OEO A;  4BG0 A;  2WZL A;  3ASO C;  4K0D A;  4IRU A;  2EIN C;  3AQB A;  3MLG A;  1V55 C;  3UNG C;  2E87 A;  3M1C B;  4RBN A;  1OCZ C;  3NDB B;  1TWA A;  1ZHY A;  5KYX B;  2EIK C;  5EHH A;  4CS9 A;  2J7P A;  3CQZ A;  3AG2 C;  4CS8 A;  2R7U A;  4J32 B;  2H7V C;  2I8B A;  1O87 A;  3LNR A;  2J0X A;  4U5F E;  3RFY A;  1KU2 A;  2Q3T A;  3O39 A;  3EZI A;  1D0Y A;  3EQL F;  3PMR A;  4E7Z A;  4DBR A;  4U5B E;  3K7D A;  4U5G A;  4OIP F;  2IOQ A;  3LS1 A;  1NU7 D;  3FAJ A;  4CSA A;  3SZR A;  3LLK A;  4IAO A;  2IXO A;  1W2W A;  4CBE A;  1TR2 A;  4GYT A;  1Z23 A;  1ZU4 A;  3LJB A;  1D0X A;  3E70 C;  2WVN A;  1MMA A;  4PFO A;  3EH2 A;  5E33 A;  4DBQ A;  3N0T A;  2Q9C A;  1LKX A;  3DMD A;  5DLJ A;  3HTK C;  2EIM C;  4P6I C;  4G7Z F;  2PFD A;  1TWC A;  3ABM C;  5CI8 A;  3DJU B;  3T4R A;  3KH2 A;  2WVQ A;  3JYH A;  2J9V A;  4PJM A;  4BEJ A;  3ABK C;  4FES A;  2G62 A;  3B0V C;  4MND A;  4PFP A;  2KGO A;  3IEE A;  3S0X A;  2ZXP A;  1M56 C;  2VAS A;  2CGE A;  4XWJ A;  3K1H A;  1V54 C;  3Q7L A;  2A6H F;  2PX3 A;  4GEH A;  1TWH A;  4HE8 D;  4EBB A;  4JVS A;  5T1D B;  3E9V A;  5B1B C;  1MNE A;  2MWQ A;  2V26 A;  4BJ6 C;  4XTK A;  3DM9 B;  5KYX A;  4C3B A;  3ZG1 A;  4KI2 A;  3EG9 B;  1VK5 A;  2WZG A;  3NYL A;  3V7O A;  2W9Y A;  3UMK A;  3F47 A;  1ZU5 A;  3VYW A;  3KKB A;  4OIQ F;  4QI0 A;  1FFT C;  3NKE A;  4CS7 A;  1MMD A;  2G3V A;  4DVY P;  3OA1 A;  3EGD B;  2WZF A;  2O9X A;  2W4B A;  4AX2 A;  2XRH A;  3DM5 A;  4HFK B;  4A2N B;  4F4B A;  1BR2 A;  4JCH A;  3S29 A;  3MX3 A;  2NUP B;  2R7O A;  3AQC A;  3DAF A;  2EIL C;  3Q6M A;  3WG7 C;  2Z15 A;  3LEV A;  3EFO A;  3DXJ F;  1Z3I X;  3NG1 A;  3NYM A;  2R7W A;  3UMI A;  4HFF B;  4BJ5 C;  2Y39 A;  5KYY B;  1N1C A;  2Y69 C;  3FHD A;  2A6E F;  2J46 A;  4AK9 A;  1ZHW A;  3CSK A;  2R7S A;  1SMY F;  2Y3B A;  2R7V A;  4YN0 B;  1SZI A;  2IXM A;  1VYI A;  2KJG A;  1TWG A;  1J8M F;  4K7B A;  5D92 A;  3W8H A;  3EGX A;  5T3W A;  2QTV A;  2WB7 A;  4PJN A;  1JPN A;  4NY3 A;  1Z5Z A;  4IWB A;  4Q5S F;  3KMI A;  4CS8 C;  2KNH A;  4C7O B;  2X51 A;  5B3S C;  3GAN A;  3B0P A;  2BE5 F;  2R7R A;  5KYN A;  2A1D D;  2MYS A;  1MND A;  3HLZ A;  2WVO A;  2VH3 A;  3JSZ A;  5KYU B;  4O79 A;  3ZSU A;  2XL4 A;  1PD1 A;  3QMK A;  4ANJ A;  4JZA A;  4RD9 A;  4LAC B;  4BJT A;  1M2V A;  4YT8 A;  2FGY A;  5BUO A;  2Y3D A;  4M63 A;  2L9J A;  4G7H F;  2J9U A;  4DOZ A;  4I3M A;  4RDA A;  1ST6 A;  3LAY A;  2WL8 A;  2LSE A;  3SP1 A;  4I1O B;  2XXA A;  3DZA A;  3QZC A;  1D1A A;  3K66 A;  2DYR C;  2XSE A;  2B0J A;  4KBL A;  3EG9 A;  3UGP A;  2J0W A;  3AG4 C;  4YT5 A;  3FDQ A;  4J30 B;  3I5Q A;  3K1I C;  2G3K A;  1PD0 A;  4O7G A;  4PK4 A;  4I1M A;  2JD3 A;  3EPV A;  2PF4 E;  3LES A;  3RKO F;  2NUT A;  4JJG A;  1D0Z A;  2R7Q A;  4HEA J;  4QDL A;  4YT4 A;  1SF8 A;  1D1C A;  4CIH A;  3S27 A;  4FX5 A;  3Q6N A;  1D1B A;  3DD7 A;  3ZVR A;  3HJC A;  4DVZ A;  2R7T A;  2H7O A;  3AG1 C;  2NG1 A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...