2WZLA

The structure of the n-rna binding domain of the mokola virus phosphoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
DIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMARLEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords PHOSPHOPROTEIN
publication title The Structure of the N-RNA Binding Domain of the Mokola Virus Phosphoprotein
pubmed doi rcsb
source organism Mokola virus
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03012 PP_M1 Phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wzlA00
3OA1A 1VYIA 2WZLA
chains in the Genus database with same CATH superfamily
1V55C 3EGXB 5KYXB 3AG2C 1OXBA 2GA0A 3N2ZB 1XWJA 5E3CA 3RYLA 1T6QA 4EUKB 1YDIA 4RDAA 2Y3GA 4Q7CA 2FAPB 4GQHA 3ZWIA 3OWTA 2XL4A 3DWWA 3PCVA 3UR3C 1RCPA 2YQYA 3TJ6A 4QDLA 4W8PA 2AVKA 1Z63A 5JP7A 2AWCA 4JKVA 2LSEA 4IJJA 4MTFA 3AOUA 2HUJA 3AG1C 3CQZA 3HNLA 5T1DB 2HMZA 3ZTZA 4CJGA 5JS5A 3S84A 2WVQA 3TK0A 2DYSC 3TULA 2GWWA 2BC5A 1SF8A 4DRIB 4OD4A 5HSWA 3B71A 2Z15A 1Q0MA 3ATPA 4DVYP 1VLSA 3W8HA 1HW2A 5JLIA 4HEAJ 2MWQA 3BEHA 3DAFA 3KKBA 1A0BA 1FMVA 2NG1A 3ABKC 2H8AA 3G4XA 4IB4A 2WZGA 1IZMA 3GEIA 4GEHA 1FAPB 1AUEA 4KNWA 2QNLA 3O39A 4LDRA 4MTGA 3PMRA 4C3EA 4R32A 2J7PD 2ZPAA 1B68A 1XZQA 4G78A 3MLGA 2Q9BA 1QZXA 3QTHA 5CI8A 3KYJA 4E7ZA 2A68F 3S90A 4FESA 4AE4B 3NYMA 3EZIA 3JCUQ 3EHNA 3GWLA 4JVSA 2IOQA 2XLOA 1LE2A 3AGTA 3GM1A 3ZDLA 1Q0FA 3EHMA 3H65A 3LESA 4BJ6A 4DOZA 4I1OB 4MS2A 2HJMA 1ZU5A 5COMA 1WWPA 1G4WR 3NKDA 2J45A 4U5GA 3UMIA 1D0ZA 3C18A 1Z7Qc 1JR8A 2P1AA 3SP1A 2EIJC 3LS0A 3MBGA 3L34A 3NYLA 4CS8C 1ZW2A 2XS1A 2R7UA 5F5FA 1ZU4A 2EPLX 3DKAA 5B3IA 1CGOA 3RVZA 1BR1A 4KBLA 5KYUA 3I4UA 3RFYA 1T6UA 4WGYA 1W2WA 2W4BA 4CIPA 1YJGA 2KK1A 2VCCA 4I44A 4E7SA 1A7DA 2XLWA 5A6KA 5JRAA 1VMAA 3B0PA 2Y3HA 3ECSA 2YL0A 2W45A 3C8GB 5A6AA 1E2XA 1AVOB 1QPUA 4C7OA 2HV7A 1GGQA 2VCBA 1LIHA 1TKNA 4JC7A 2NSFA 4LDKA 4NTAA 4PACA 4XPWA 1I5NA 2ZXWC 4MTOA 2WZFA 3C63A 4BJ6C 1BBHA 1VYKA 4LDQA 4JTDB 3HJCA 1E83A 4G7ZF 2YHSA 2QUPA 4MVMA 1G8XA 2XRHA 1EKYA 1XZPA 4Q4ZF 2YWAA 4ZLDA 5FCLA 3JYHA 1OW6A 4IRUA 3JSZA 2PF4E 2A0BA 2XLEA 3K66A 5E3AA 3WAQA 2XLMA 4B6IA 5A6BD 2HZ8A 1LE4A 2R7WA 3ZSUA 1D0XA 2A6HF 3DJUB 3U8PA 2R7TA 1ZHTA 3EFOA 2M4EA 1ZYRF 2XL8A 5E33A 5K0IA 1FR0A 2OCCC 2L7AA 4P6IC 1MMNA 3FOOA 1D1BA 1HY5A 3LJBA 4CBEA 1VYIA 3K6BA 1YAUO 1O3UA 2ZXPA 2G62A 3KMIA 1R5ID 2PFDA 3RIPA 4MNDA 2BE5F 4MW3A 1NG1A 2YRFA 4YL0A 4DJ9A 1WN0A 2YVKA 3TD7A 2J7PA 5L0IA 5BQHA 2J8WA 4Q5SF 2PBEA 4W8KA 1LI7A 1V54C 2XLVA 3H2VA 2NUPB 2B0JA 2R7VA 1HE9A 4DRHB 5A6JA 4RBNA 4OIOF 2PX0A 4KC9A 2WVNA 2NSGA 1GS9A 1OR3A 4IAQA 4KNVA 3AQBA 4NTBA 2XS8A 2OEVA 1L7CA 2ETSA 2CNWD 3B9QA 2KJGA 3GM3A 3RQFA 3IQCA 3U5SA 3EGDA 1T5OA 1HW1A 3R2PA 4GYTA 2Q3TA 2VASA 2DB4A 4CX9A 2L9JA 3VF0A 1WATA 1YZCA 4NTFA 3U0CA 2WL8A 1I4YA 1HMDA 1S7ZA 3IPMO 3KYIA 1RMVA 3H2UA 3C8ZA 1YYXA 4MVUA 3GM2A 1QSPA 2LK4A 2Y39A 3JZ0A 3VM6A 1D1AA 1UFBA 4XTKA 3JYYA 4ULWA 4F4BA 3DZAA 3AJMA 1A41A 1WGWA 1J8YF 2EPOA 2HV6A 3LEOA 4WJ0A 4AL0A 5B1BC 5L0FA 1YLMA 3ZVRA 1A7EA 2P61A 2A6EF 3EZHA 1MNEA 5KYUB 2XM0A 5HV9A 4G0HA 1Z23A 4XEVA 2UUHA 4EIYA 5L0CA 2FGYA 4FWVA 2J9BA 3X1OA 5A69A 1RKEB 2LFDA 2WB7A 1JAFA 4MVSA 4U5DE 5F28E 5BQIA 2OU6A 1IW7F 1LS4A 1OCOC 1TQGA 4J30B 3U9JA 5DS6A 1RXQA 2JD3A 4K1OA 1V74B 3F47A 1Z5ZA 5DVWA 4DVZA 2KYHA 2O9XA 1SMYF 3IEEA 4G7OF 4X0RA 4NC3A 4FX5A 2IXNA 1NFNA 1YZAA 2B0HA 5TJ5E 4ANJA 3N0TA 3U2LA 1TWCA 4H54A 5A6BA 1E85A 1RKCA 2X51A 3IQ6A 3SXKA 4CDAA 1JPNA 4U5FE 2F22A 4WGZA 3J06A 2LP4A 2P6VA 2HFIA 2ASRA 2I8BA 3F46A 4JTAB 3SZRA 3EQLF 1D1CA 2M64A 4MVZA 2J9WA 2EIKC 3LLKA 2NUTA 4MVOA 2YL1A 4YN0B 3K1IA 4CS9A 4P9TA 5AGFA 2D5RB 2OJQA 2R03A 3V5YA 3M4CA 1MNDA 3QW1A 4A2NB 3JSEO 1NFOA 4J7TA 4YT8A 3JT1A 1V4AA 3NMKA 2HMQA 2RSEB 3W4YA 4QI0A 1K04A 3TQOA 1K40A 2BL2A 3HNKA 2R25A 1Q0DA 3V5ZA 3C7JA 1JRAA 2R02A 4HFFB 3WHNA 4NCQA 4PJMA 2LD6A 3EH1A 2YL3A 3U3BA 3W2WA 2VCAA 4ONSA 4CDVA 4E18A 1ZHXA 3Q7GA 1HMOA 2W9YA 3ABLC 4JZAA 3HLZA 5JVEA 1MMGA 4AK9A 2KNHA 2CNWA 2UUIA 3US6A 1CPQA 4N4WA 2L6HA 1BR2A 1NU7D 4DBQA 2ZXRA 1S05A 2AP3A 2EIMC 2OEXA 1PCXA 3S28A 2GAQA 4D4NA 1RJ9A 2VC9A 4CJOA 1I4ZA 4RD9A 3KH2A 3M15A 3QVZA 4BJTA 2H7VC 2ZXOA 3EGXA 4I3MA 4P9FA 4PJJA 5KYXA 3LEVA 2JX0A 1ZZPA 4LERA 4Z9HA 2HSQA 5KYWA 3T9OA 1ORYA 1G4US 3GWNA 4ER9A 3O55A 3NMJA 1BZ4A 4MVRA 4O6MA 5D92A 4XLPF 3UGOA 4CIHA 2PNOA 4PR9A 3CZ6A 4Z9JA 4JJFA 1OCZC 1QKRA 3FAPB 3I5QA 4K0DA 3NYJA 5E2QA 2VH3A 4I1MA 4JJGA 5CI9A 4IWBA 3KPHA 4EHPA 5DS5A 1NBBA 2LCHA 2C04A 3DE8A 5EHHA 2LQGA 4BJ5A 4YT2A 1OCRC 1LVKA 1EA8A 3EJNA 4XLNF 4O6YA 2A0UA 3DD7A 4U5CE 1Z3IX 5FZTA 3ABMC 2HKVA 5KYNA 1PD0A 1F1MA 5JT4A 4Z9IA 4N6CA 1E84A 2R7QA 3M4BA 3S29A 4C3DA 3E9VA 3K33A 1MQVA 3WG7C 1TWGA 3NMIA 2DYRC 2PX3A 4MW8A 4O7GA 1YARO 4OIPF 4XQ1A 3ZIBA 3DMDA 2FFHA 2CGEA 2H7OA 5AC4A 2XXAA 5IY5C 4AX2A 1O87A 3AGUA 3ASOC 3G4ZA 2P0NA 4CSAA 3OA1A 5DS4A 1N1CA 1OQCA 3GODA 4AE4A 4O6NA 3UNGC 4WABA 1MMAA 1M2OA 3DM5A 1Z6AA 1BDJB 3FMSA 1APCA 5JUAA 1VK5A 4JCZA 4DXWA 1KTMA 4LACB 1DOVA 1NLXA 3RQGA 1H6GA 4MQ9F 3DXJF 5GPGB 2WZLA 4YL1A 3RKOF 1NU9C 2D4UA 4YK5A 3A11A 1YA9A 2YZSA 2IXPA 1WOLA 4JRZA 3QW0A 1LPEA 5COGA 2VB6A 2I15A 3FDQA 1FTSA 4JE9A 3X2QC 4U9EA 3V5XA 1DOWA 2Y3DA 1O5HA 2G3VA 3HTKC 2LIGA 4U5BE 3ZTMA 5EGYA 2KW3C 1G5ZA 1MMDA 4NQFA 2NPUA 1FFTC 1U6HA 3MYFA 3ZQYA 1ZHZA 1ORJA 1Y4CA 2GFHA 2YKZA 2IYLD 4D4XA 5DLJA 4UDVA 3POVA 3VAYA 3E70C 3RF3A 3BRJA 1H9TA 4OIQF 1CPRA 1FMWA 3FOPA 4YT5A 2R7OA 4JTCB 3S9OA 3ZG1A 1BR4A 3EH2A 3LAYA 4HE8D 4JEBA 3V7OA 4C7OB 1M6TA 3L0IA 1VLTA 2J46A 3VYWA 1L3PA 4DRJB 3CEXA 1SR2A 4JEAA 4PJLA 4ULVA 3T4RA 5KYWB 4G7HF 1ZW3A 3PDMP 4JIOA 256BA 3EG9A 3RVYA 4EBBA 3T6BA 5F5HA 3IHUA 2R7SA 1YYJA 2J0WA 4JURI 3UGPA 1Q0GA 3DJNB 4BEJA 2EPKX 2YLDA 2Y69C 3AG4C 5KYYA 2YEVA 1T6IA 3AQCA 4H4KC 3ZC4A 2HSBA 1H9GA 2RD9A 3LS1A 1QLEC 3TOMA 3QMKA 5L3VA 3SXYA 5L3QA 5B1AC 3L1MA 1ZHYA 3OEOA 4J32B 4LLEA 3UMKA 4E0IA 4EWCA 2L6FA 3IQ5A 1M2VA 2V3CC 3EFOB 3MFNA 2QTVA 4IGGA 2XSEA 3SEOA 3R7CA 5L0DA 1ZVZA 3W8IA 5DQTA 2CDQA 5BUOA 1OW7A 1PV3A 1LS1A 3JTLO 5D91A 3AG3C 2CW0F 2ZD9A 1T01A 4CS8A 2GDCA 3LNMB 4BG0A 1KU2A 4XPYA 4YJWA 1EI7A 2X0CA 1ZHWA 3DI5A 1VTMP 1OKKD 2J9VA 4MVQA 2YLIA 3C62A 1OCCC 4OIRF 3UMHA 1NZEA 2HS5A 2R7RA 2NUPA 2XXAB 3HNJA 4JW1A 1OR2A 2WVOA 3G50A 1H7IA 2PP4A 3K1HA 2A69F 1YA7O 3ASNC 2OKUA 3S27A 3HNIA 3T6GB 2R7XA 2CYDA 3O6XA 4XWJA 4U5HA 2CCYA 3Q6MA 4PFOA 3QZCA 5JSLA 4CS7A 1T9KA 2Y3BA 4E0HA 4XEFA 2L81A 4HFKB 3RH3A 4CS9C 3K1IC 3EGDB 3GORA 2DI3A 2LFFA 1ST6A 3NDBB 3GEEA 3GEHA 1NSGB 3JRMO 1M57C 2IBFA 2IXMA 5COFA 2OG2A 2XLDA 3WODF 3C8GD 3U8VA 4YT4A 2Q00A 3W2VA 2J0XA 2L6GA 5B3SC 4JCHA 4M63A 3B0VC 3SXMA 3U3FA 3DM9B 1E86A 3DE9A 2Q9CA 2MHRA 3SYNA 1U89A 2YL7A 1K05A 3FVYA 2C03A 2KSFA 1QVXA 1VOMA 2V26A 5T3WA 3U9MA 3FXHA 2R9RB 3NRHA 4OD5A 4C3BA 3L8IA 4DBRA 1M56C 2OOCA 3M1CB 4EBKA 1RKEA 1JMWA 1GQAA 1LM3B 1SZIA 3SNHA 2KGOA 5BQGA 3RQEA 4NY3A 1C03A 2KC3A 4AL1A 4A4AA 4YL3A 3M79A 4FAPB 1WASA 1TWAA 2HJ3A 3Q7LA 3MYIA 4OINF 3U2MA 2OQMA 4EKWA 2IM8A 2EINC 3S0XA 3LUTB 5DQZA 4IAOA 4J7YA 4CDYA 3A9CA 1QQ3A 1WTYA 3QVYA 3KL4A 1LKXA 2EILC 3EG9B 2Q4FA 1J8MF 1CGNA 4BPMA 4O79A 2QY9A 3LLIA 4BJ1A 1U0BB 5T3TA 3Q6NA 4XEKA 1D0YA 1PD1A 3FAJA 4ZLCA 2AU5A 2A1DD 5KYYB 3PHF2 1JOGA 1ORSC 5AC5A 3JRTA 3TOLA 1AEPA 2XLHA 3CSKA 1KNYA 2JPUA 3HKKA 3NKEA 2DGJA 2NUTB 1UG7A 1FFHA 4LLCA 1M2VB 2MYSA 2Q9AA 2KQ9A 1FNTc 2OJED 2H7BA 4IARA 1C17M 1C02A 1SYQA 2YLGA 2AWYA 2P7VA 3O10A 4BEMJ 2TMVP 3MX3A 4XPXA 4BJ5C 4PK4A 3DAGA 1EQ1A 1OKKA 3L8JA 1JPJA 1OXKA 3ITFA 4K7BA 3RW0A 2ICWG 2G3KA 3T6JA 3NG1A 5CIVA 3GANA 4N06A 1YVIA 3FHDA 4EBJA 4QI2A 2XL6A 3K7DA 2QLAA 1HE1A 1OW8A 1TWHA 4PFPA 5EK0A 4N6HA 3VRCA 2EPMX 2XM4A 3B0UX 3CAXA 4U9DA 3TJ5A 2R05A 1GM5A 1TFKB 5L0HA 3N24A 4E17A 1Y6DA 3LNRA 4PJNA 3I5PA 3ZQVA 2E87A 1TR2A 2W4MA 3IQTA 5L0GA 4L6RA 4CSAC 1CGME 3C8GA 2Q7RA 4YWQA 1R4TA 2QE9A 3B29A 1LI5A 1Q0KA 1RJ9B 2IXOA 4U5EE 3EPVA 2EPNA 3SXZA 1VB5A 4KI2A 2J9UA 1A7VA 1TFOB 5L0JA
chains in the Genus database with same CATH topology
1V55C 3EGXB 5KYXB 3AG2C 3RYLA 3N2ZB 5E3CA 4RDAA 2Y3GA 4Q7CA 3OWTA 2XL4A 3UR3C 4QDLA 1Z63A 2LSEA 4IJJA 3AG1C 3CQZA 5T1DB 2WVQA 2DYSC 1SF8A 4OD4A 5HSWA 2Z15A 4DVYP 3W8HA 4HEAJ 2MWQA 3DAFA 3KKBA 1FMVA 2NG1A 3ABKC 2WZGA 1IZMA 4GEHA 4KNWA 3O39A 3PMRA 4C3EA 2J7PD 2ZPAA 3MLGA 2Q9BA 1QZXA 5CI8A 4E7ZA 2A68F 4FESA 4AE4B 3NYMA 3EZIA 3JCUQ 3EHNA 4JVSA 2IOQA 3H65A 3EHMA 3LESA 4BJ6A 4DOZA 4I1OB 1ZU5A 3NKDA 2J45A 4U5GA 3UMIA 1D0ZA 3SP1A 2EIJC 3LS0A 3L34A 3NYLA 4CS8C 2R7UA 5F5FA 1ZU4A 1BR1A 4KBLA 5KYUA 3I4UA 3RFYA 1W2WA 2W4BA 4I44A 4E7SA 1VMAA 3B0PA 2Y3HA 3ECSA 2W45A 4C7OA 2HV7A 1TKNA 2ZXWC 2WZFA 4BJ6C 1VYKA 3HJCA 4G7ZF 2YHSA 1G8XA 2XRHA 4Q4ZF 4ZLDA 3JYHA 4IRUA 3JSZA 2PF4E 3K66A 4B6IA 5E3AA 2R7WA 3ZSUA 1D0XA 2A6HF 3DJUB 2R7TA 1ZHTA 3EFOA 2M4EA 1ZYRF 5E33A 2OCCC 4P6IC 1MMNA 1D1BA 3LJBA 4CBEA 1VYIA 3K6BA 3KMIA 2ZXPA 2G62A 3RIPA 2PFDA 4MNDA 2BE5F 1NG1A 3TD7A 2J7PA 4Q5SF 4W8KA 1V54C 2NUPB 2B0JA 2R7VA 4RBNA 4OIOF 2PX0A 4KC9A 2WVNA 4KNVA 3AQBA 3B9QA 2CNWD 2KJGA 3EGDA 4GYTA 2Q3TA 2VASA 2L9JA 2WL8A 1S7ZA 2Y39A 1D1AA 4XTKA 4ULWA 4F4BA 3DZAA 1WGWA 1J8YF 4WJ0A 2HV6A 5B1BC 3ZVRA 2A6EF 3EZHA 1MNEA 5KYUB 4G0HA 1Z23A 2FGYA 4FWVA 3X1OA 2WB7A 4U5DE 1IW7F 1OCOC 4J30B 5DS6A 2JD3A 3F47A 1Z5ZA 5DVWA 4DVZA 2O9XA 1SMYF 3IEEA 4G7OF 4X0RA 4FX5A 2IXNA 4ANJA 3N0TA 1TWCA 2X51A 1JPNA 4U5FE 2P6VA 2I8BA 3F46A 3SZRA 3EQLF 1D1CA 2J9WA 2EIKC 3LLKA 2NUTA 4YN0B 4CS9A 3PHF2 2D5RB 4A2NB 1MNDA 4YT8A 3JT1A 4QI0A 4HFFB 4PJMA 3EH1A 3W2WA 1ZHXA 3Q7GA 2W9YA 3ABLC 4JZAA 3HLZA 1MMGA 4AK9A 2KNHA 2CNWA 1BR2A 1NU7D 4DBQA 2ZXRA 2EIMC 1PCXA 3S28A 1RJ9A 4RD9A 3KH2A 4BJTA 2H7VC 3EGXA 2ZXOA 4I3MA 4PJJA 5KYXA 3LEVA 4LERA 5KYWA 4O6MA 5D92A 4XLPF 3UGOA 4CIHA 3CZ6A 4JJFA 1OCZC 4K0DA 5E2QA 3I5QA 3NYJA 2VH3A 4I1MA 4JJGA 5CI9A 4IWBA 5DS5A 2C04A 5EHHA 4BJ5A 4YT2A 1OCRC 1LVKA 3EJNA 4XLNF 4O6YA 3DD7A 4U5CE 1Z3IX 5KYNA 3ABMC 1PD0A 2R7QA 3S29A 4C3DA 3E9VA 3K33A 3WG7C 1TWGA 2DYRC 2PX3A 4O7GA 4OIPF 3ZIBA 3DMDA 2FFHA 2CGEA 2H7OA 2XXAA 5IY5C 4AX2A 1O87A 3ASOC 4CSAA 3OA1A 5DS4A 1N1CA 3GODA 4AE4A 4O6NA 3UNGC 1MMAA 1M2OA 3DM5A 1Z6AA 1VK5A 4LACB 4MQ9F 3DXJF 2WZLA 3RKOF 1NU9C 2YZSA 2IXPA 2VB6A 3FDQA 1FTSA 3X2QC 2Y3DA 1O5HA 2G3VA 3HTKC 4U5BE 5EGYA 2KW3C 1MMDA 1FFTC 1ZHZA 2GFHA 2IYLD 3POVA 5DLJA 4OIQF 3VAYA 3E70C 1FMWA 4YT5A 2R7OA 3ZG1A 1BR4A 3EH2A 3LAYA 4HE8D 3V7OA 4C7OB 3L0IA 2J46A 3VYWA 3T4RA 4PJLA 5KYWB 4G7HF 3EG9A 4EBBA 3T6BA 5F5HA 2R7SA 2J0WA 4JURI 3UGPA 4BEJA 3DJNB 3AG4C 2Y69C 5KYYA 2YEVA 3AQCA 4H4KC 3ZC4A 3LS1A 5L3QA 1QLEC 3QMKA 5L3VA 5B1AC 3OEOA 1ZHYA 3UMKA 4J32B 4LLEA 4EWCA 5FCLA 1M2VA 2V3CC 3EFOB 2QTVA 2XSEA 3SEOA 3W8IA 5DQTA 2CDQA 5BUOA 1LS1A 5D91A 3AG3C 2CW0F 4CS8A 4BG0A 1KU2A 4YJWA 1ZHWA 1OKKD 2J9VA 1OCCC 4OIRF 3UMHA 1NZEA 2XXAB 2R7RA 2NUPA 4JW1A 2WVOA 2PP4A 3K1HA 2A69F 3ASNC 3S27A 2R7XA 4XWJA 3O6XA 4U5HA 4PFOA 3Q6MA 4CS7A 3QZCA 2Y3BA 2L81A 4HFKB 3RH3A 4CS9C 3K1IC 3EGDB 1ST6A 3NDBB 1M57C 2IXMA 2OG2A 3WODF 4YT4A 3W2VA 2J0XA 5B3SC 3B0VC 4JCHA 4M63A 3DM9B 2Q9CA 3SYNA 3FVYA 2C03A 2V26A 1VOMA 5T3WA 3NRHA 4OD5A 4C3BA 4DBRA 1M56C 3M1CB 1SZIA 3SNHA 2KGOA 4NY3A 1TWAA 3Q7LA 4OINF 3S0XA 2EINC 5DQZA 4IAOA 3KL4A 1LKXA 2EILC 3EG9B 1J8MF 4O79A 2QY9A 3LLIA 4BJ1A 5T3TA 3Q6NA 1D0YA 1PD1A 3FAJA 4ZLCA 5KYYB 2A1DD 3JRTA 3NKEA 3CSKA 2DGJA 2NUTB 1FFHA 4LLCA 1M2VB 2MYSA 2Q9AA 2KQ9A 2H7BA 2P7VA 3MX3A 4BJ5C 4PK4A 3DAGA 1OKKA 1JPJA 3ITFA 4K7BA 2G3KA 3T6JA 3NG1A 3GANA 4N06A 3FHDA 4QI2A 3K7DA 4PFPA 1TWHA 3B0UX 3N24A 3LNRA 4PJNA 3I5PA 2E87A 1TR2A 2W4MA 4CSAC 4YWQA 4U5EE 1RJ9B 2IXOA 3EPVA 4KI2A 2J9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  1VYI A;  2WZL A; 
#chains in the Genus database with same CATH topology
 1V55 C;  3EGX B;  5KYX B;  3AG2 C;  1OXB A;  2GA0 A;  3N2Z B;  1XWJ A;  5E3C A;  3RYL A;  1T6Q A;  4EUK B;  1YDI A;  4RDA A;  2Y3G A;  4Q7C A;  2FAP B;  4GQH A;  3ZWI A;  3OWT A;  2XL4 A;  3DWW A;  3PCV A;  3UR3 C;  1RCP A;  2YQY A;  3TJ6 A;  4QDL A;  4W8P A;  2AVK A;  1Z63 A;  5JP7 A;  2AWC A;  4JKV A;  2LSE A;  4IJJ A;  4MTF A;  3AOU A;  2HUJ A;  3AG1 C;  3CQZ A;  3HNL A;  5T1D B;  2HMZ A;  3ZTZ A;  4CJG A;  5JS5 A;  3S84 A;  2WVQ A;  3TK0 A;  2DYS C;  3TUL A;  2GWW A;  2BC5 A;  1SF8 A;  4DRI B;  4OD4 A;  5HSW A;  3B71 A;  2Z15 A;  1Q0M A;  3ATP A;  4DVY P;  1VLS A;  3W8H A;  1HW2 A;  5JLI A;  4HEA J;  2MWQ A;  3BEH A;  3DAF A;  3KKB A;  1A0B A;  1FMV A;  2NG1 A;  3ABK C;  2H8A A;  3G4X A;  4IB4 A;  2WZG A;  1IZM A;  3GEI A;  4GEH A;  1FAP B;  1AUE A;  4KNW A;  2QNL A;  3O39 A;  4LDR A;  4MTG A;  3PMR A;  4C3E A;  4R32 A;  2J7P D;  2ZPA A;  1B68 A;  1XZQ A;  4G78 A;  3MLG A;  2Q9B A;  1QZX A;  3QTH A;  5CI8 A;  3KYJ A;  4E7Z A;  2A68 F;  3S90 A;  4FES A;  4AE4 B;  3NYM A;  3EZI A;  3JCU Q;  3EHN A;  3GWL A;  4JVS A;  2IOQ A;  2XLO A;  1LE2 A;  3AGT A;  3GM1 A;  3ZDL A;  1Q0F A;  3EHM A;  3H65 A;  3LES A;  4BJ6 A;  4DOZ A;  4I1O B;  4MS2 A;  2HJM A;  1ZU5 A;  5COM A;  1WWP A;  1G4W R;  3NKD A;  2J45 A;  4U5G A;  3UMI A;  1D0Z A;  3C18 A;  1Z7Q c;  1JR8 A;  2P1A A;  3SP1 A;  2EIJ C;  3LS0 A;  3MBG A;  3L34 A;  3NYL A;  4CS8 C;  1ZW2 A;  2XS1 A;  2R7U A;  5F5F A;  1ZU4 A;  2EPL X;  3DKA A;  5B3I A;  1CGO A;  3RVZ A;  1BR1 A;  4KBL A;  5KYU A;  3I4U A;  3RFY A;  1T6U A;  4WGY A;  1W2W A;  2W4B A;  4CIP A;  1YJG A;  2KK1 A;  2VCC A;  4I44 A;  4E7S A;  1A7D A;  2XLW A;  5A6K A;  5JRA A;  1VMA A;  3B0P A;  2Y3H A;  3ECS A;  2YL0 A;  2W45 A;  3C8G B;  5A6A A;  1E2X A;  1AVO B;  1QPU A;  4C7O A;  2HV7 A;  1GGQ A;  2VCB A;  1LIH A;  1TKN A;  4JC7 A;  2NSF A;  4LDK A;  4NTA A;  4PAC A;  4XPW A;  1I5N A;  2ZXW C;  4MTO A;  2WZF A;  3C63 A;  4BJ6 C;  1BBH A;  1VYK A;  4LDQ A;  4JTD B;  3HJC A;  1E83 A;  4G7Z F;  2YHS A;  2QUP A;  4MVM A;  1G8X A;  2XRH A;  1EKY A;  1XZP A;  4Q4Z F;  2YWA A;  4ZLD A;  5FCL A;  3JYH A;  1OW6 A;  4IRU A;  3JSZ A;  2PF4 E;  2A0B A;  2XLE A;  3K66 A;  5E3A A;  3WAQ A;  2XLM A;  4B6I A;  5A6B D;  2HZ8 A;  1LE4 A;  2R7W A;  3ZSU A;  1D0X A;  2A6H F;  3DJU B;  3U8P A;  2R7T A;  1ZHT A;  3EFO A;  2M4E A;  1ZYR F;  2XL8 A;  5E33 A;  5K0I A;  1FR0 A;  2OCC C;  2L7A A;  4P6I C;  1MMN A;  3FOO A;  1D1B A;  1HY5 A;  3LJB A;  4CBE A;  1VYI A;  3K6B A;  1YAU O;  1O3U A;  2ZXP A;  2G62 A;  3KMI A;  1R5I D;  2PFD A;  3RIP A;  4MND A;  2BE5 F;  4MW3 A;  1NG1 A;  2YRF A;  4YL0 A;  4DJ9 A;  1WN0 A;  2YVK A;  3TD7 A;  2J7P A;  5L0I A;  5BQH A;  2J8W A;  4Q5S F;  2PBE A;  4W8K A;  1LI7 A;  1V54 C;  2XLV A;  3H2V A;  2NUP B;  2B0J A;  2R7V A;  1HE9 A;  4DRH B;  5A6J A;  4RBN A;  4OIO F;  2PX0 A;  4KC9 A;  2WVN A;  2NSG A;  1GS9 A;  1OR3 A;  4IAQ A;  4KNV A;  3AQB A;  4NTB A;  2XS8 A;  2OEV A;  1L7C A;  2ETS A;  2CNW D;  3B9Q A;  2KJG A;  3GM3 A;  3RQF A;  3IQC A;  3U5S A;  3EGD A;  1T5O A;  1HW1 A;  3R2P A;  4GYT A;  2Q3T A;  2VAS A;  2DB4 A;  4CX9 A;  2L9J A;  3VF0 A;  1WAT A;  1YZC A;  4NTF A;  3U0C A;  2WL8 A;  1I4Y A;  1HMD A;  1S7Z A;  3IPM O;  3KYI A;  1RMV A;  3H2U A;  3C8Z A;  1YYX A;  4MVU A;  3GM2 A;  1QSP A;  2LK4 A;  2Y39 A;  3JZ0 A;  3VM6 A;  1D1A A;  1UFB A;  4XTK A;  3JYY A;  4ULW A;  4F4B A;  3DZA A;  3AJM A;  1A41 A;  1WGW A;  1J8Y F;  2EPO A;  2HV6 A;  3LEO A;  4WJ0 A;  4AL0 A;  5B1B C;  5L0F A;  1YLM A;  3ZVR A;  1A7E A;  2P61 A;  2A6E F;  3EZH A;  1MNE A;  5KYU B;  2XM0 A;  5HV9 A;  4G0H A;  1Z23 A;  4XEV A;  2UUH A;  4EIY A;  5L0C A;  2FGY A;  4FWV A;  2J9B A;  3X1O A;  5A69 A;  1RKE B;  2LFD A;  2WB7 A;  1JAF A;  4MVS A;  4U5D E;  5F28 E;  5BQI A;  2OU6 A;  1IW7 F;  1LS4 A;  1OCO C;  1TQG A;  4J30 B;  3U9J A;  5DS6 A;  1RXQ A;  2JD3 A;  4K1O A;  1V74 B;  3F47 A;  1Z5Z A;  5DVW A;  4DVZ A;  2KYH A;  2O9X A;  1SMY F;  3IEE A;  4G7O F;  4X0R A;  4NC3 A;  4FX5 A;  2IXN A;  1NFN A;  1YZA A;  2B0H A;  5TJ5 E;  4ANJ A;  3N0T A;  3U2L A;  1TWC A;  4H54 A;  5A6B A;  1E85 A;  1RKC A;  2X51 A;  3IQ6 A;  3SXK A;  4CDA A;  1JPN A;  4U5F E;  2F22 A;  4WGZ A;  3J06 A;  2LP4 A;  2P6V A;  2HFI A;  2ASR A;  2I8B A;  3F46 A;  4JTA B;  3SZR A;  3EQL F;  1D1C A;  2M64 A;  4MVZ A;  2J9W A;  2EIK C;  3LLK A;  2NUT A;  4MVO A;  2YL1 A;  4YN0 B;  3K1I A;  4CS9 A;  4P9T A;  5AGF A;  2D5R B;  2OJQ A;  2R03 A;  3V5Y A;  3M4C A;  1MND A;  3QW1 A;  4A2N B;  3JSE O;  1NFO A;  4J7T A;  4YT8 A;  3JT1 A;  1V4A A;  3NMK A;  2HMQ A;  2RSE B;  3W4Y A;  4QI0 A;  1K04 A;  3TQO A;  1K40 A;  2BL2 A;  3HNK A;  2R25 A;  1Q0D A;  3V5Z A;  3C7J A;  1JRA A;  2R02 A;  4HFF B;  3WHN A;  4NCQ A;  4PJM A;  2LD6 A;  3EH1 A;  2YL3 A;  3U3B A;  3W2W A;  2VCA A;  4ONS A;  4CDV A;  4E18 A;  1ZHX A;  3Q7G A;  1HMO A;  2W9Y A;  3ABL C;  4JZA A;  3HLZ A;  5JVE A;  1MMG A;  4AK9 A;  2KNH A;  2CNW A;  2UUI A;  3US6 A;  1CPQ A;  4N4W A;  2L6H A;  1BR2 A;  1NU7 D;  4DBQ A;  2ZXR A;  1S05 A;  2AP3 A;  2EIM C;  2OEX A;  1PCX A;  3S28 A;  2GAQ A;  4D4N A;  1RJ9 A;  2VC9 A;  4CJO A;  1I4Z A;  4RD9 A;  3KH2 A;  3M15 A;  3QVZ A;  4BJT A;  2H7V C;  2ZXO A;  3EGX A;  4I3M A;  4P9F A;  4PJJ A;  5KYX A;  3LEV A;  2JX0 A;  1ZZP A;  4LER A;  4Z9H A;  2HSQ A;  5KYW A;  3T9O A;  1ORY A;  1G4U S;  3GWN A;  4ER9 A;  3O55 A;  3NMJ A;  1BZ4 A;  4MVR A;  4O6M A;  5D92 A;  4XLP F;  3UGO A;  4CIH A;  2PNO A;  4PR9 A;  3CZ6 A;  4Z9J A;  4JJF A;  1OCZ C;  1QKR A;  3FAP B;  3I5Q A;  4K0D A;  3NYJ A;  5E2Q A;  2VH3 A;  4I1M A;  4JJG A;  5CI9 A;  4IWB A;  3KPH A;  4EHP A;  5DS5 A;  1NBB A;  2LCH A;  2C04 A;  3DE8 A;  5EHH A;  2LQG A;  4BJ5 A;  4YT2 A;  1OCR C;  1LVK A;  1EA8 A;  3EJN A;  4XLN F;  4O6Y A;  2A0U A;  3DD7 A;  4U5C E;  1Z3I X;  5FZT A;  3ABM C;  2HKV A;  5KYN A;  1PD0 A;  1F1M A;  5JT4 A;  4Z9I A;  4N6C A;  1E84 A;  2R7Q A;  3M4B A;  3S29 A;  4C3D A;  3E9V A;  3K33 A;  1MQV A;  3WG7 C;  1TWG A;  3NMI A;  2DYR C;  2PX3 A;  4MW8 A;  4O7G A;  1YAR O;  4OIP F;  4XQ1 A;  3ZIB A;  3DMD A;  2FFH A;  2CGE A;  2H7O A;  5AC4 A;  2XXA A;  5IY5 C;  4AX2 A;  1O87 A;  3AGU A;  3ASO C;  3G4Z A;  2P0N A;  4CSA A;  3OA1 A;  5DS4 A;  1N1C A;  1OQC A;  3GOD A;  4AE4 A;  4O6N A;  3UNG C;  4WAB A;  1MMA A;  1M2O A;  3DM5 A;  1Z6A A;  1BDJ B;  3FMS A;  1APC A;  5JUA A;  1VK5 A;  4JCZ A;  4DXW A;  1KTM A;  4LAC B;  1DOV A;  1NLX A;  3RQG A;  1H6G A;  4MQ9 F;  3DXJ F;  5GPG B;  2WZL A;  4YL1 A;  3RKO F;  1NU9 C;  2D4U A;  4YK5 A;  3A11 A;  1YA9 A;  2YZS A;  2IXP A;  1WOL A;  4JRZ A;  3QW0 A;  1LPE A;  5COG A;  2VB6 A;  2I15 A;  3FDQ A;  1FTS A;  4JE9 A;  3X2Q C;  4U9E A;  3V5X A;  1DOW A;  2Y3D A;  1O5H A;  2G3V A;  3HTK C;  2LIG A;  4U5B E;  3ZTM A;  5EGY A;  2KW3 C;  1G5Z A;  1MMD A;  4NQF A;  2NPU A;  1FFT C;  1U6H A;  3MYF A;  3ZQY A;  1ZHZ A;  1ORJ A;  1Y4C A;  2GFH A;  2YKZ A;  2IYL D;  4D4X A;  5DLJ A;  4UDV A;  3POV A;  3VAY A;  3E70 C;  3RF3 A;  3BRJ A;  1H9T A;  4OIQ F;  1CPR A;  1FMW A;  3FOP A;  4YT5 A;  2R7O A;  4JTC B;  3S9O A;  3ZG1 A;  1BR4 A;  3EH2 A;  3LAY A;  4HE8 D;  4JEB A;  3V7O A;  4C7O B;  1M6T A;  3L0I A;  1VLT A;  2J46 A;  3VYW A;  1L3P A;  4DRJ B;  3CEX A;  1SR2 A;  4JEA A;  4PJL A;  4ULV A;  3T4R A;  5KYW B;  4G7H F;  1ZW3 A;  3PDM P;  4JIO A;  256B A;  3EG9 A;  3RVY A;  4EBB A;  3T6B A;  5F5H A;  3IHU A;  2R7S A;  1YYJ A;  2J0W A;  4JUR I;  3UGP A;  1Q0G A;  3DJN B;  4BEJ A;  2EPK X;  2YLD A;  2Y69 C;  3AG4 C;  5KYY A;  2YEV A;  1T6I A;  3AQC A;  4H4K C;  3ZC4 A;  2HSB A;  1H9G A;  2RD9 A;  3LS1 A;  1QLE C;  3TOM A;  3QMK A;  5L3V A;  3SXY A;  5L3Q A;  5B1A C;  3L1M A;  1ZHY A;  3OEO A;  4J32 B;  4LLE A;  3UMK A;  4E0I A;  4EWC A;  2L6F A;  3IQ5 A;  1M2V A;  2V3C C;  3EFO B;  3MFN A;  2QTV A;  4IGG A;  2XSE A;  3SEO A;  3R7C A;  5L0D A;  1ZVZ A;  3W8I A;  5DQT A;  2CDQ A;  5BUO A;  1OW7 A;  1PV3 A;  1LS1 A;  3JTL O;  5D91 A;  3AG3 C;  2CW0 F;  2ZD9 A;  1T01 A;  4CS8 A;  2GDC A;  3LNM B;  4BG0 A;  1KU2 A;  4XPY A;  4YJW A;  1EI7 A;  2X0C A;  1ZHW A;  3DI5 A;  1VTM P;  1OKK D;  2J9V A;  4MVQ A;  2YLI A;  3C62 A;  1OCC C;  4OIR F;  3UMH A;  1NZE A;  2HS5 A;  2R7R A;  2NUP A;  2XXA B;  3HNJ A;  4JW1 A;  1OR2 A;  2WVO A;  3G50 A;  1H7I A;  2PP4 A;  3K1H A;  2A69 F;  1YA7 O;  3ASN C;  2OKU A;  3S27 A;  3HNI A;  3T6G B;  2R7X A;  2CYD A;  3O6X A;  4XWJ A;  4U5H A;  2CCY A;  3Q6M A;  4PFO A;  3QZC A;  5JSL A;  4CS7 A;  1T9K A;  2Y3B A;  4E0H A;  4XEF A;  2L81 A;  4HFK B;  3RH3 A;  4CS9 C;  3K1I C;  3EGD B;  3GOR A;  2DI3 A;  2LFF A;  1ST6 A;  3NDB B;  3GEE A;  3GEH A;  1NSG B;  3JRM O;  1M57 C;  2IBF A;  2IXM A;  5COF A;  2OG2 A;  2XLD A;  3WOD F;  3C8G D;  3U8V A;  4YT4 A;  2Q00 A;  3W2V A;  2J0X A;  2L6G A;  5B3S C;  4JCH A;  4M63 A;  3B0V C;  3SXM A;  3U3F A;  3DM9 B;  1E86 A;  3DE9 A;  2Q9C A;  2MHR A;  3SYN A;  1U89 A;  2YL7 A;  1K05 A;  3FVY A;  2C03 A;  2KSF A;  1QVX A;  1VOM A;  2V26 A;  5T3W A;  3U9M A;  3FXH A;  2R9R B;  3NRH A;  4OD5 A;  4C3B A;  3L8I A;  4DBR A;  1M56 C;  2OOC A;  3M1C B;  4EBK A;  1RKE A;  1JMW A;  1GQA A;  1LM3 B;  1SZI A;  3SNH A;  2KGO A;  5BQG A;  3RQE A;  4NY3 A;  1C03 A;  2KC3 A;  4AL1 A;  4A4A A;  4YL3 A;  3M79 A;  4FAP B;  1WAS A;  1TWA A;  2HJ3 A;  3Q7L A;  3MYI A;  4OIN F;  3U2M A;  2OQM A;  4EKW A;  2IM8 A;  2EIN C;  3S0X A;  3LUT B;  5DQZ A;  4IAO A;  4J7Y A;  4CDY A;  3A9C A;  1QQ3 A;  1WTY A;  3QVY A;  3KL4 A;  1LKX A;  2EIL C;  3EG9 B;  2Q4F A;  1J8M F;  1CGN A;  4BPM A;  4O79 A;  2QY9 A;  3LLI A;  4BJ1 A;  1U0B B;  5T3T A;  3Q6N A;  4XEK A;  1D0Y A;  1PD1 A;  3FAJ A;  4ZLC A;  2AU5 A;  2A1D D;  5KYY B;  3PHF 2;  1JOG A;  1ORS C;  5AC5 A;  3JRT A;  3TOL A;  1AEP A;  2XLH A;  3CSK A;  1KNY A;  2JPU A;  3HKK A;  3NKE A;  2DGJ A;  2NUT B;  1UG7 A;  1FFH A;  4LLC A;  1M2V B;  2MYS A;  2Q9A A;  2KQ9 A;  1FNT c;  2OJE D;  2H7B A;  4IAR A;  1C17 M;  1C02 A;  1SYQ A;  2YLG A;  2AWY A;  2P7V A;  3O10 A;  4BEM J;  2TMV P;  3MX3 A;  4XPX A;  4BJ5 C;  4PK4 A;  3DAG A;  1EQ1 A;  1OKK A;  3L8J A;  1JPJ A;  1OXK A;  3ITF A;  4K7B A;  3RW0 A;  2ICW G;  2G3K A;  3T6J A;  3NG1 A;  5CIV A;  3GAN A;  4N06 A;  1YVI A;  3FHD A;  4EBJ A;  4QI2 A;  2XL6 A;  3K7D A;  2QLA A;  1HE1 A;  1OW8 A;  1TWH A;  4PFP A;  5EK0 A;  4N6H A;  3VRC A;  2EPM X;  2XM4 A;  3B0U X;  3CAX A;  4U9D A;  3TJ5 A;  2R05 A;  1GM5 A;  1TFK B;  5L0H A;  3N24 A;  4E17 A;  1Y6D A;  3LNR A;  4PJN A;  3I5P A;  3ZQV A;  2E87 A;  1TR2 A;  2W4M A;  3IQT A;  5L0G A;  4L6R A;  4CSA C;  1CGM E;  3C8G A;  2Q7R A;  4YWQ A;  1R4T A;  2QE9 A;  3B29 A;  1LI5 A;  1Q0K A;  1RJ9 B;  2IXO A;  4U5E E;  3EPV A;  2EPN A;  3SXZ A;  1VB5 A;  4KI2 A;  2J9U A;  1A7V A;  1TFO B;  5L0J A; 
#chains in the Genus database with same CATH homology
 1V55 C;  3EGX B;  5KYX B;  3AG2 C;  3RYL A;  3N2Z B;  5E3C A;  4RDA A;  2Y3G A;  4Q7C A;  3OWT A;  2XL4 A;  3UR3 C;  4QDL A;  1Z63 A;  2LSE A;  4IJJ A;  3AG1 C;  3CQZ A;  5T1D B;  2WVQ A;  2DYS C;  1SF8 A;  4OD4 A;  5HSW A;  2Z15 A;  4DVY P;  3W8H A;  4HEA J;  2MWQ A;  3DAF A;  3KKB A;  1FMV A;  2NG1 A;  3ABK C;  2WZG A;  1IZM A;  4GEH A;  4KNW A;  3O39 A;  3PMR A;  4C3E A;  2J7P D;  2ZPA A;  3MLG A;  2Q9B A;  1QZX A;  5CI8 A;  4E7Z A;  2A68 F;  4FES A;  4AE4 B;  3NYM A;  3EZI A;  3JCU Q;  3EHN A;  4JVS A;  2IOQ A;  3H65 A;  3EHM A;  3LES A;  4BJ6 A;  4DOZ A;  4I1O B;  1ZU5 A;  3NKD A;  2J45 A;  4U5G A;  3UMI A;  1D0Z A;  3SP1 A;  2EIJ C;  3LS0 A;  3L34 A;  3NYL A;  4CS8 C;  2R7U A;  5F5F A;  1ZU4 A;  1BR1 A;  4KBL A;  5KYU A;  3I4U A;  3RFY A;  1W2W A;  2W4B A;  4I44 A;  4E7S A;  1VMA A;  3B0P A;  2Y3H A;  3ECS A;  2W45 A;  4C7O A;  2HV7 A;  1TKN A;  2ZXW C;  2WZF A;  4BJ6 C;  1VYK A;  3HJC A;  4G7Z F;  2YHS A;  1G8X A;  2XRH A;  4Q4Z F;  4ZLD A;  3JYH A;  4IRU A;  3JSZ A;  2PF4 E;  3K66 A;  4B6I A;  5E3A A;  2R7W A;  3ZSU A;  1D0X A;  2A6H F;  3DJU B;  2R7T A;  1ZHT A;  3EFO A;  2M4E A;  1ZYR F;  5E33 A;  2OCC C;  4P6I C;  1MMN A;  1D1B A;  3LJB A;  4CBE A;  1VYI A;  3K6B A;  3KMI A;  2ZXP A;  2G62 A;  3RIP A;  2PFD A;  4MND A;  2BE5 F;  1NG1 A;  3TD7 A;  2J7P A;  4Q5S F;  4W8K A;  1V54 C;  2NUP B;  2B0J A;  2R7V A;  4RBN A;  4OIO F;  2PX0 A;  4KC9 A;  2WVN A;  4KNV A;  3AQB A;  3B9Q A;  2CNW D;  2KJG A;  3EGD A;  4GYT A;  2Q3T A;  2VAS A;  2L9J A;  2WL8 A;  1S7Z A;  2Y39 A;  1D1A A;  4XTK A;  4ULW A;  4F4B A;  3DZA A;  1WGW A;  1J8Y F;  4WJ0 A;  2HV6 A;  5B1B C;  3ZVR A;  2A6E F;  3EZH A;  1MNE A;  5KYU B;  4G0H A;  1Z23 A;  2FGY A;  4FWV A;  3X1O A;  2WB7 A;  4U5D E;  1IW7 F;  1OCO C;  4J30 B;  5DS6 A;  2JD3 A;  3F47 A;  1Z5Z A;  5DVW A;  4DVZ A;  2O9X A;  1SMY F;  3IEE A;  4G7O F;  4X0R A;  4FX5 A;  2IXN A;  4ANJ A;  3N0T A;  1TWC A;  2X51 A;  1JPN A;  4U5F E;  2P6V A;  2I8B A;  3F46 A;  3SZR A;  3EQL F;  1D1C A;  2J9W A;  2EIK C;  3LLK A;  2NUT A;  4YN0 B;  4CS9 A;  3PHF 2;  2D5R B;  4A2N B;  1MND A;  4YT8 A;  3JT1 A;  4QI0 A;  4HFF B;  4PJM A;  3EH1 A;  3W2W A;  1ZHX A;  3Q7G A;  2W9Y A;  3ABL C;  4JZA A;  3HLZ A;  1MMG A;  4AK9 A;  2KNH A;  2CNW A;  1BR2 A;  1NU7 D;  4DBQ A;  2ZXR A;  2EIM C;  1PCX A;  3S28 A;  1RJ9 A;  4RD9 A;  3KH2 A;  4BJT A;  2H7V C;  3EGX A;  2ZXO A;  4I3M A;  4PJJ A;  5KYX A;  3LEV A;  4LER A;  5KYW A;  4O6M A;  5D92 A;  4XLP F;  3UGO A;  4CIH A;  3CZ6 A;  4JJF A;  1OCZ C;  4K0D A;  5E2Q A;  3I5Q A;  3NYJ A;  2VH3 A;  4I1M A;  4JJG A;  5CI9 A;  4IWB A;  5DS5 A;  2C04 A;  5EHH A;  4BJ5 A;  4YT2 A;  1OCR C;  1LVK A;  3EJN A;  4XLN F;  4O6Y A;  3DD7 A;  4U5C E;  1Z3I X;  5KYN A;  3ABM C;  1PD0 A;  2R7Q A;  3S29 A;  4C3D A;  3E9V A;  3K33 A;  3WG7 C;  1TWG A;  2DYR C;  2PX3 A;  4O7G A;  4OIP F;  3ZIB A;  3DMD A;  2FFH A;  2CGE A;  2H7O A;  2XXA A;  5IY5 C;  4AX2 A;  1O87 A;  3ASO C;  4CSA A;  3OA1 A;  5DS4 A;  1N1C A;  3GOD A;  4AE4 A;  4O6N A;  3UNG C;  1MMA A;  1M2O A;  3DM5 A;  1Z6A A;  1VK5 A;  4LAC B;  4MQ9 F;  3DXJ F;  2WZL A;  3RKO F;  1NU9 C;  2YZS A;  2IXP A;  2VB6 A;  3FDQ A;  1FTS A;  3X2Q C;  2Y3D A;  1O5H A;  2G3V A;  3HTK C;  4U5B E;  5EGY A;  2KW3 C;  1MMD A;  1FFT C;  1ZHZ A;  2GFH A;  2IYL D;  3POV A;  5DLJ A;  4OIQ F;  3VAY A;  3E70 C;  1FMW A;  4YT5 A;  2R7O A;  3ZG1 A;  1BR4 A;  3EH2 A;  3LAY A;  4HE8 D;  3V7O A;  4C7O B;  3L0I A;  2J46 A;  3VYW A;  3T4R A;  4PJL A;  5KYW B;  4G7H F;  3EG9 A;  4EBB A;  3T6B A;  5F5H A;  2R7S A;  2J0W A;  4JUR I;  3UGP A;  4BEJ A;  3DJN B;  3AG4 C;  2Y69 C;  5KYY A;  2YEV A;  3AQC A;  4H4K C;  3ZC4 A;  3LS1 A;  5L3Q A;  1QLE C;  3QMK A;  5L3V A;  5B1A C;  3OEO A;  1ZHY A;  3UMK A;  4J32 B;  4LLE A;  4EWC A;  5FCL A;  1M2V A;  2V3C C;  3EFO B;  2QTV A;  2XSE A;  3SEO A;  3W8I A;  5DQT A;  2CDQ A;  5BUO A;  1LS1 A;  5D91 A;  3AG3 C;  2CW0 F;  4CS8 A;  4BG0 A;  1KU2 A;  4YJW A;  1ZHW A;  1OKK D;  2J9V A;  1OCC C;  4OIR F;  3UMH A;  1NZE A;  2XXA B;  2R7R A;  2NUP A;  4JW1 A;  2WVO A;  2PP4 A;  3K1H A;  2A69 F;  3ASN C;  3S27 A;  2R7X A;  4XWJ A;  3O6X A;  4U5H A;  4PFO A;  3Q6M A;  4CS7 A;  3QZC A;  2Y3B A;  2L81 A;  4HFK B;  3RH3 A;  4CS9 C;  3K1I C;  3EGD B;  1ST6 A;  3NDB B;  1M57 C;  2IXM A;  2OG2 A;  3WOD F;  4YT4 A;  3W2V A;  2J0X A;  5B3S C;  3B0V C;  4JCH A;  4M63 A;  3DM9 B;  2Q9C A;  3SYN A;  3FVY A;  2C03 A;  2V26 A;  1VOM A;  5T3W A;  3NRH A;  4OD5 A;  4C3B A;  4DBR A;  1M56 C;  3M1C B;  1SZI A;  3SNH A;  2KGO A;  4NY3 A;  1TWA A;  3Q7L A;  4OIN F;  3S0X A;  2EIN C;  5DQZ A;  4IAO A;  3KL4 A;  1LKX A;  2EIL C;  3EG9 B;  1J8M F;  4O79 A;  2QY9 A;  3LLI A;  4BJ1 A;  5T3T A;  3Q6N A;  1D0Y A;  1PD1 A;  3FAJ A;  4ZLC A;  5KYY B;  2A1D D;  3JRT A;  3NKE A;  3CSK A;  2DGJ A;  2NUT B;  1FFH A;  4LLC A;  1M2V B;  2MYS A;  2Q9A A;  2KQ9 A;  2H7B A;  2P7V A;  3MX3 A;  4BJ5 C;  4PK4 A;  3DAG A;  1OKK A;  1JPJ A;  3ITF A;  4K7B A;  2G3K A;  3T6J A;  3NG1 A;  3GAN A;  4N06 A;  3FHD A;  4QI2 A;  3K7D A;  4PFP A;  1TWH A;  3B0U X;  3N24 A;  3LNR A;  4PJN A;  3I5P A;  2E87 A;  1TR2 A;  2W4M A;  4CSA C;  4YWQ A;  4U5E E;  1RJ9 B;  2IXO A;  3EPV A;  4KI2 A;  2J9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...