2WZLA

The structure of the n-rna binding domain of the mokola virus phosphoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
b'DIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMARLEEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHOPROTEIN
publication title The Structure of the N-RNA Binding Domain of the Mokola Virus Phosphoprotein
pubmed doi rcsb
source organism Mokola virus
molecule tags Viral protein
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03012 PP_M1 Phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wzlA00
3OA1A 2WZLA 1VYIA
chains in the Genus database with same CATH superfamily
3U2LA 3A11A 1K04A 1E85A 4OIQF 1PCXA 2EIKC 5E33A 2MYSA 2CDQA 1H9GA 3LNMB 4BPMA 2VCAA 2YL3A 4G0HA 4JTAB 4ONSA 3RIPA 2O9XA 1D0ZA 4PJMA 5B1BC 3GORA 1JPNA 4CS7A 2Y3DA 1S05A 4DBQA 1E83A 1BR4A 2XS1A 3RF3A 4NCQA 1EQ1A 3AQBA 4MW8A 4U5BE 2KK1A 1BDJB 3WODF 4YWQA 4Z9JA 1OW7A 2IXPA 2LP4A 1A7DA 3AJMA 1M2VA 2Q7RA 2MHRA 2VCBA 1OW8A 3GM2A 3F46A 2HSQA 1VLTA 3E9VA 1LI5A 1MMNA 3MFNA 5HSWA 2GDCA 3UGOA 3IQ6A 5L0JA 4LLEA 2Z15A 2M4EA 2ZXWC 3L0IA 4YL1A 4YT4A 2H7BA 1MMDA 5K0IA 1M6TA 4M63A 256BA 2A6EF 2EPOA 1ZHTA 2L6GA 4E0HA 3FAPB 4AK9A 3MLGA 4DJ9A 3N2ZB 1A7VA 2OCCC 2Q00A 2L7AA 4YN0B 5AC5A 2YVKA 1AUEA 1E2XA 3DE8A 2HFIA 1HMOA 3IPMO 4JEAA 3ZTMA 1SMYF 4JRZA 3U0CA 3GWNA 5TJ5E 5DVWA 3UMIA 4ER9A 1CGNA 1WATA 1YZCA 2YHSA 4LERA 2R7XA 4U5GA 1MMAA 4W8KA 4XWJA 3SXYA 3HKKA 3JCUQ 4J32B 5KYWA 3QW0A 2AP3A 2ASRA 2YLIA 2J0WA 1RJ9A 4JTDB 4XEVA 5F5HA 3US6A 2G3KA 2J9WA 4CIPA 2QUPA 3K1IA 5IY5C 2OOCA 2YLDA 3LS0A 3KH2A 1WOLA 3UNGC 3U9JA 1RKEA 2NUTA 5DQTA 5FCLA 5JUAA 2AWYA 2B0HA 4JJFA 2YWAA 1Y6DA 3FOOA 3OEOA 4U9DA 4U5CE 3T6JA 3HJCA 3E70C 4E18A 3NYLA 3RW0A 4DRIB 3PCVA 1YVIA 4A2NB 2Q4FA 1NBBA 1LIHA 2WL8A 2WZFA 4IAOA 4JTCB 1KU2A 4G78A 2LD6A 1D1BA 2PBEA 4IGGA 2ZXRA 1YDIA 1JRAA 2J9BA 4JC7A 3VRCA 1OQCA 2A0BA 1EA8A 4H4KC 4E7ZA 3DAFA 2ZXOA 4D4XA 3C18A 4Z9IA 1M2VB 1WASA 2NUPA 4HFFB 3LS1A 3DM5A 3POVA 2HJMA 3X2QC 2R7WA 2XL4A 1FNTc 1HW1A 1PD1A 2DYRC 3AG2C 4I1MA 2A1DD 1R5ID 3NMKA 3MYFA 3B9QA 3Q6MA 3TOLA 3VF0A 3ZTZA 4CJOA 3AG4C 4E0IA 5EHHA 2WB7A 1H9TA 3SXZA 4P9TA 1D0XA 1V4AA 4YJWA 1FMWA 4YT5A 5L3VA 3FHDA 4D4NA 5BQGA 3B71A 2BE5F 2RSEB 2EINC 1DOWA 1I4YA 4CDYA 1K40A 3G4XA 3QVYA 2L6HA 4MVOA 5E3AA 4BJ1A 3S0XA 2Q9CA 1HY5A 1YLMA 1APCA 1IZMA 2V26A 5COGA 1BR2A 3T4RA 3NDBB 1LM3B 4F4BA 1OCOC 3CSKA 5DLJA 3TQOA 1O5HA 1QVXA 1S7ZA 2KSFA 2KC3A 2NSGA 1LE4A 1KTMA 1RKCA 5CIVA 5KYWB 4B6IA 4NY3A 2HS5A 1KNYA 3MX3A 3R2PA 4I3MA 5AGFA 3U3BA 3ZQVA 4Q4ZF 2XXAB 1RKEB 2NUTB 3W2VA 3U5SA 1VTMP 2GAQA 1LE2A 4DRJB 3V5ZA 2YL0A 4FWVA 1MNDA 1FAPB 1WGWA 3H2VA 1WWPA 3EZHA 4JCHA 3C8ZA 5L0IA 4MS2A 1SZIA 4CDAA 2OU6A 3CQZA 1NG1A 3KMIA 5KYYA 4PFPA 3QZCA 3U8PA 4QI0A 2H8AA 4O7GA 4AE4B 4EWCA 3K33A 4QDLA 2E87A 2FGYA 3HTKC 1G8XA 1FMVA 2W4MA 3IEEA 4K7BA 2Y39A 3V7OA 3BEHA 1T6QA 4BEJA 2HV7A 2NUPB 4NTAA 2MWQA 5F28E 1Q0MA 1A0BA 3EHNA 2I8BA 4YK5A 5L0DA 3SNHA 3ZG1A 4NC3A 1B68A 3WHNA 5JRAA 1VYIA 3Q6NA 4G7ZF 3JZ0A 3RQFA 1W2WA 2R9RB 2Y69C 3C8GD 3TULA 3W8IA 4ULVA 1U0BB 1K05A 1OR3A 3LLIA 4G7OF 4LDKA 2PFDA 3U9MA 3VYWA 3DD7A 3QTHA 3TK0A 5A6BD 4W8PA 2ZD9A 4NTBA 1GM5A 4XPXA 1OW6A 1NU7D 2XLDA 3TD7A 3GEHA 4PFOA 2EIJC 2YQYA 4EBKA 1C02A 2B0JA 2EILC 2VC9A 4H54A 5KYNA 4I1OB 4QI2A 3UMKA 1EI7A 2DYSC 3M79A 3L34A 2ICWG 4ZLCA 1BR1A 2LFDA 3IQ5A 3TJ5A 4JIOA 4FX5A 4G7HF 2PNOA 2XS8A 2LQGA 3EZIA 4CSAA 4MVZA 2KNHA 4P6IC 3FAJA 4L6RA 3G50A 2M64A 2XL6A 3H2UA 2P7VA 4OIPF 3QW1A 5A6AA 1CGOA 1U6HA 1VMAA 3EPVA 1J8YF 1U89A 3GANA 2KW3C 1A41A 4ANJA 5DS5A 3AQCA 1V74B 3L8IA 4KC9A 1Q0DA 2PP4A 3JYHA 3OWTA 2XRHA 3SYNA 5KYYB 2R7RA 1GGQA 1JOGA 1ORYA 2Y3BA 2FFHA 2ETSA 3O55A 2V3CC 4CS9C 3RQGA 5HV9A 3S27A 3U3FA 3N24A 1L7CA 4XPWA 4BJ5C 4KNVA 2XXAA 5AC4A 4BG0A 2R03A 3HNJA 4K0DA 1M2OA 1WTYA 2J7PD 5JSLA 4N6HA 2PX3A 4PJJA 1ZHXA 4HEAJ 1TFKB 1LKXA 4WABA 2NSFA 4A4AA 3NKEA 4MVSA 3S29A 3EQLF 3ZIBA 3SXKA 3KKBA 3NYJA 4MNDA 4N6CA 2J45A 4X0RA 4AE4A 2IBFA 3DKAA 4CS8A 3UGPA 4CX9A 1TQGA 2CCYA 3DI5A 1Q0FA 2QY9A 2W4BA 1DOVA 2DGJA 3HNIA 2Q9AA 2IXMA 2QLAA 3TJ6A 4DVYP 3RYLA 5COFA 4DBRA 1XZQA 2GWWA 3L8JA 2R25A 3O6XA 3M4BA 1YAUO 4IRUA 2CW0F 2HKVA 1OCRC 2X51A 3S9OA 3HNLA 2XLWA 1JPJA 4EKWA 3Q7LA 1R4TA 1T9KA 5D91A 4BJTA 3R7CA 5DQZA 1OCCC 3S90A 5KYUA 2YL7A 2J7PA 3B0UX 1FFHA 2QNLA 2R05A 4RDAA 1NLXA 1MMGA 2A68F 4MQ9F 4RBNA 3BRJA 3DMDA 4IJJA 4ZLDA 3ZDLA 2IXOA 2H7VC 2L9JA 4J7YA 2R7VA 4MVRA 1Z3IX 3C8GB 2PF4E 1TWAA 3ASNC 2HV6A 4GQHA 4JE9A 3LAYA 3SEOA 4LLCA 4O6YA 2Y3GA 4MVQA 4I44A 1ZZPA 2IM8A 2WVNA 2AU5A 2G62A 3GWLA 3M4CA 4HFKB 5L0GA 1ZW2A 2YKZA 4OD5A 2D5RB 4XPYA 3EH1A 2JX0A 3LLKA 2VASA 4MTFA 2HMQA 1I5NA 5T3WA 3SP1A 1Z63A 2XM4A 4EUKB 3RKOF 4NQFA 3ZVRA 5A6KA 1OXBA 1QSPA 4OIRF 3GEIA 4XEKA 1C17M 1GQAA 2VB6A 1Y4CA 2ZXPA 4IAQA 3FXHA 4BJ6C 4EHPA 1YA9A 3VAYA 4MTGA 2W9YA 2EPMX 2YL1A 1L3PA 3MBGA 1HE9A 1LS1A 2P1AA 3W8HA 4UDVA 4MVMA 1NZEA 4CIHA 4Q5SF 3ATPA 3JSEO 1FTSA 3JT1A 4XLPF 1VYKA 1ZVZA 4LDQA 1ZU5A 3FOPA 5JT4A 2VCCA 3GODA 4XEFA 1V55C 3N0TA 2P61A 5E3CA 3LESA 3C62A 5JLIA 2HMZA 1I4ZA 3EG9A 3JTLO 2AVKA 1LPEA 1VB5A 2EIMC 4DVZA 5B3SC 3X1OA 3TOMA 1BBHA 1Z5ZA 2OQMA 1LI7A 1NSGB 3RQEA 1OXKA 4KBLA 3F47A 5B1AC 3EGDB 1CPRA 3JSZA 2OEVA 3LEOA 2BL2A 2J8WA 5JS5A 4U5FE 1H6GA 5JVEA 4DXWA 3Q7GA 2OG2A 2GA0A 3ZC4A 2BC5A 1G4WR 2XLOA 4JZAA 3WAQA 4AX2A 1O87A 1FFTC 4C3EA 3LNRA 4Q7CA 1YZAA 3U2MA 3UR3C 2YRFA 3NYMA 5D92A 1RMVA 3KYJA 5KYUB 3I4UA 2J46A 4AL1A 2CYDA 5L0CA 3L1MA 3KPHA 3ZSUA 4J7TA 3EFOA 1ZHZA 2J9VA 3J06A 4LACB 3RVYA 3FMSA 3IQCA 3NKDA 4YL0A 4ULWA 2WZGA 3QVZA 1QPUA 4IARA 1UFBA 3LEVA 4YT8A 4FESA 3HNKA 3RH3A 4C7OA 4YL3A 3W2WA 3MYIA 2IYLD 3NMJA 5KYXA 4PR9A 2OEXA 1V54C 4R32A 1ZYRF 1JMWA 4JCZA 2ZPAA 4CSAC 4JW1A 3K1HA 4YT2A 1JAFA 3ASOC 3B0VC 4RD9A 5DS4A 2WVQA 4JJGA 1T6IA 2X0CA 4Z9HA 1IW7F 2I15A 1HW2A 1NFOA 3NG1A 1YYXA 5EK0A 3M1CB 5COMA 4EIYA 2R02A 1M57C 1PD0A 2LIGA 4DRHB 5BQIA 3GEEA 3CAXA 1AEPA 1XZPA 4PJNA 4WGZA 4XLNF 4OINF 3RFYA 3C8GA 3IHUA 3U8VA 1YJGA 4AL0A 2F22A 3K1IC 3FVYA 2PX0A 3FDQA 3DZAA 4JEBA 3JRTA 2OJED 3UMHA 3C63A 3I5QA 2NG1A 5A6BA 2L6FA 2DB4A 2XL8A 4PACA 1M56C 3AOUA 3EH2A 1TR2A 4O6NA 4N4WA 2KYHA 3K7DA 2YLGA 3GM1A 4U5EE 3EG9B 2KGOA 2CNWD 4J30B 3LUTB 5T1DB 3DE9A 3PHF2 4OIOF 3KL4A 3ABKC 3AG1C 1CPQA 2R7OA 1XWJA 2QTVA 2WZLA 3DWWA 5BQHA 4C3DA 4CS8C 4O6MA 2P6VA 2EPNA 3O10A 4BEMJ 1MQVA 2OKUA 4JKVA 1OKKD 2LCHA 3JRMO 2YZSA 2J9UA 5F5FA 3NRHA 2XSEA 3CZ6A 2DI3A 4GYTA 3VM6A 4KNWA 1UG7A 2HSBA 1QKRA 2LFFA 3NMIA 3O39A 1SF8A 2C03A 2R7SA 1AVOB 3H65A 3CEXA 1QQ3A 3EFOB 3DJUB 2P0NA 1NU9C 2XLEA 3K66A 3LJBA 4XQ1A 2TMVP 3DXJF 3B0PA 3EGDA 4JVSA 1PV3A 4HE8D 2RD9A 4O79A 5B3IA 4C7OB 1TWHA 3B29A 4WGYA 4MTOA 4CS9A 2LSEA 2IXNA 1RCPA 5KYXB 2CNWA 3OA1A 1JR8A 1D0YA 4BJ5A 3T6GB 4FAPB 4N06A 5DS6A 1O3UA 2GFHA 5A6JA 3A9CA 4CDVA 1CGME 1OCZC 2J0XA 1YYJA 2AWCA 1N1CA 2C04A 2JD3A 3K6BA 2UUIA 1OKKA 3ABMC 2D4UA 5A69A 1VLSA 1G4US 4IB4A 2Y3HA 3DJNB 1SYQA 2JPUA 4U5DE 2EPLX 1NFNA 2A6HF 1WN0A 1YARO 5JP7A 1Z23A 3ZQYA 3EGXA 1MNEA 1VK5A 2Q3TA 1A7EA 3AG3C 4XTKA 5FZTA 4KI2A 3DM9B 3V5YA 1QLEC 1T01A 3DAGA 1LVKA 5EGYA 3GM3A 3S28A 5CI8A 1Q0GA 4WJ0A 1ZHWA 5GPGB 1J8MF 3RVZA 1F1MA 2XM0A 4C3BA 3IQTA 4EBJA 2L81A 1ZU4A 2H7OA 4EBBA 2EPKX 2R7QA 2HUJA 2R7TA 3C7JA 3ZWIA 1HMDA 3ABLC 3HLZA 3T6BA 1C03A 1T6UA 4LDRA 3WG7C 2YEVA 5E2QA 1OR2A 1QZXA 1ST6A 2A0UA 2W45A 3G4ZA 3SXMA 1G5ZA 4P9FA 1GS9A 3AGUA 2XLMA 1Z7Qc 2XLHA 5CI9A 4U9EA 3PDMP 1D1AA 1TWCA 2HJ3A 3ITFA 2LK4A 1T5OA 4OD4A 2NPUA 4E17A 2KQ9A 5BUOA 1TFOB 3KYIA 1E86A 1RJ9B 2XLVA 3I5PA 3QMKA 3T9OA 2R7UA 1D1CA 4DOZA 1ZHYA 1TKNA 1RXQA 2G3VA 1EKYA 3AGTA 4PJLA 1HE1A 1SR2A 1ORJA 1VOMA 1YA7O 1ZW3A 3EHMA 4K1OA 3W4YA 2VH3A 2UUHA 1ORSC 2FAPB 4JURI 5L0HA 4PK4A 5L3QA 2Q9BA 1TWGA 4U5HA 2OJQA 1BZ4A 3V5XA 2IOQA 5L0FA 1FR0A 3S84A 4CJGA 2A69F 4IWBA 5T3TA 4BJ6A 1E84A 2WVOA 2CGEA 4MVUA 4NTFA 2QE9A 1Q0KA 2HZ8A 3SZRA 3M15A 3PMRA 4GEHA 4CBEA 3EGXB 3EJNA 3JYYA 4E7SA 1LS4A 1Z6AA 2KJGA 4MW3A 3ECSA 1H7IA
chains in the Genus database with same CATH topology
4OIQF 1PCXA 2EIKC 5E33A 2MYSA 2CDQA 3RIPA 4G0HA 2O9XA 1D0ZA 4PJMA 5B1BC 4DBQA 1JPNA 4CS7A 2Y3DA 1BR4A 3AQBA 4U5BE 3WODF 4YWQA 2IXPA 1M2VA 3F46A 3E9VA 1MMNA 5HSWA 3UGOA 4LLEA 2Z15A 2M4EA 2ZXWC 3L0IA 4YT4A 2H7BA 1MMDA 4M63A 2A6EF 1ZHTA 4AK9A 3MLGA 3N2ZB 2OCCC 4YN0B 1SMYF 5DVWA 3UMIA 2YHSA 4LERA 2R7XA 4U5GA 1MMAA 4W8KA 4XWJA 3JCUQ 4J32B 5KYWA 3W2WA 3W8HA 5F5HA 2J0WA 1RJ9A 2G3KA 2J9WA 5IY5C 3UNGC 3LS0A 3KH2A 5DQTA 5FCLA 2NUTA 4JJFA 3OEOA 4U5CE 3T6JA 3HJCA 3E70C 3NYLA 4A2NB 2WZFA 2WL8A 4IAOA 1KU2A 1D1BA 2ZXRA 5BUOA 4H4KC 4E7ZA 3DAFA 2ZXOA 1M2VB 2NUPA 4HFFB 3LS1A 3DM5A 3POVA 3X2QC 2R7WA 2XL4A 2DYRC 1PD1A 3AG2C 4I1MA 2A1DD 3Q6MA 3B9QA 3AG4C 5EHHA 2WB7A 1D0XA 4YJWA 1FMWA 4YT5A 5L3VA 3FHDA 2BE5F 2EINC 5E3AA 4BJ1A 3S0XA 2Q9CA 3T4RA 3NDBB 1IZMA 2V26A 1BR2A 4F4BA 1OCOC 3CSKA 5DLJA 1O5HA 1S7ZA 5KYWB 4B6IA 4NY3A 4I3MA 3MX3A 4Q4ZF 2XXAB 2NUTB 3W2VA 4FWVA 1MNDA 1WGWA 3EZHA 4JCHA 1SZIA 3CQZA 1NG1A 3KMIA 5KYYA 4PFPA 3QZCA 4QI0A 4O7GA 4AE4B 4EWCA 3K33A 4QDLA 2E87A 2FGYA 3HTKC 1G8XA 1FMVA 2W4MA 3IEEA 4K7BA 2Y39A 3V7OA 4BEJA 2HV7A 2NUPB 2MWQA 3EHNA 2I8BA 3SNHA 3ZG1A 1VYIA 3Q6NA 4G7ZF 1W2WA 2Y69C 3W8IA 3LLIA 4G7OF 2PFDA 3VYWA 3DD7A 1NU7D 3TD7A 4PFOA 2EIJC 2B0JA 2EILC 5KYNA 4I1OB 4QI2A 3UMKA 2DYSC 3L34A 4ZLCA 1BR1A 4FX5A 4G7HF 3EZIA 4CSAA 2KNHA 4P6IC 3FAJA 4OIPF 2P7VA 1VMAA 3EPVA 3GANA 1J8YF 2KW3C 4ANJA 5DS5A 3AQCA 4KC9A 5KYYB 2PP4A 3JYHA 3OWTA 2XRHA 3SYNA 2R7RA 2Y3BA 2V3CC 2FFHA 4CS9C 3S27A 3N24A 4BJ5C 4KNVA 2XXAA 4BG0A 4K0DA 1M2OA 2J7PD 2PX3A 4PJJA 1ZHXA 4HEAJ 1LKXA 3NKEA 3S29A 3ZIBA 3EQLF 3KKBA 3NYJA 4MNDA 4X0RA 2J45A 4AE4A 4CS8A 3UGPA 2QY9A 2W4BA 2DGJA 4DVYP 2Q9AA 2IXMA 3RYLA 4DBRA 3O6XA 4IRUA 2CW0F 1OCRC 2X51A 1JPJA 3Q7LA 5D91A 4BJTA 5DQZA 1OCCC 5KYUA 2J7PA 3B0UX 1FFHA 4RDAA 1MMGA 2A68F 4MQ9F 4RBNA 3DMDA 4IJJA 4ZLDA 2IXOA 2H7VC 2L9JA 2R7VA 1Z3IX 2PF4E 1TWAA 3ASNC 2HV6A 3SEOA 3LAYA 4LLCA 4O6YA 2Y3GA 4I44A 5F5FA 2WVNA 4HFKB 2G62A 4OD5A 2D5RB 3EH1A 3LLKA 2VASA 5T3WA 3SP1A 1Z63A 3RKOF 3ZVRA 4OIRF 2VB6A 2ZXPA 4BJ6C 3VAYA 2W9YA 1LS1A 1NZEA 4CIHA 4Q5SF 1FTSA 3JT1A 4XLPF 1VYKA 1ZU5A 3GODA 1V55C 3N0TA 5E3CA 3LESA 3EG9A 5B3SC 2EIMC 4DVZA 3X1OA 1Z5ZA 5B1AC 4KBLA 3F47A 3EGDB 3JSZA 4U5FE 3Q7GA 2OG2A 3ZC4A 4AX2A 4JZAA 1O87A 1FFTC 4C3EA 3LNRA 4Q7CA 3UR3C 3NYMA 5D92A 5KYUB 3I4UA 2J46A 3ZSUA 3EFOA 1ZHZA 2J9VA 4LACB 3NKDA 4ULWA 2WZGA 4YT8A 3LEVA 4FESA 3RH3A 4C7OA 2IYLD 5KYXA 1V54C 1ZYRF 2ZPAA 4CSAC 4JW1A 3K1HA 4YT2A 3ASOC 3B0VC 4RD9A 5DS4A 2WVQA 4JJGA 1IW7F 3NG1A 3M1CB 1M57C 1PD0A 4PJNA 4XLNF 4OINF 3RFYA 3K1IC 3FVYA 2PX0A 3FDQA 3DZAA 3JRTA 3UMHA 3I5QA 2NG1A 1M56C 3EH2A 1TR2A 4O6NA 3K7DA 4U5EE 3EG9B 2KGOA 2CNWD 4J30B 5T1DB 4OIOF 3PHF2 3KL4A 3ABKC 3AG1C 2R7OA 2WZLA 2QTVA 4C3DA 4CS8C 4O6MA 2P6VA 1OKKD 2YZSA 2J9UA 3NRHA 2XSEA 3CZ6A 4GYTA 4KNWA 3O39A 1SF8A 2C03A 2R7SA 3H65A 3EFOB 3DJUB 1NU9C 3K66A 3LJBA 3DXJF 3B0PA 3EGDA 4JVSA 4O79A 4HE8D 4C7OB 1TWHA 4CS9A 2LSEA 2IXNA 5KYXB 2CNWA 3OA1A 1D0YA 4BJ5A 4N06A 5DS6A 2GFHA 1OCZC 2J0XA 3K6BA 2C04A 1N1CA 2JD3A 1OKKA 3ABMC 2Y3HA 3DJNB 4U5DE 2A6HF 1Z23A 3EGXA 1MNEA 1VK5A 2Q3TA 3AG3C 4XTKA 4KI2A 3DM9B 1QLEC 3DAGA 1LVKA 5EGYA 3S28A 5CI8A 4WJ0A 1ZHWA 1J8MF 4C3BA 2L81A 1ZU4A 2H7OA 4EBBA 2R7QA 2R7TA 3ABLC 3HLZA 3T6BA 3WG7C 2YEVA 5E2QA 1QZXA 1ST6A 2W45A 5CI9A 1D1AA 1TWCA 3ITFA 4OD4A 2KQ9A 1RJ9B 3I5PA 3QMKA 2R7UA 1D1CA 4DOZA 1ZHYA 1TKNA 2G3VA 4PJLA 1VOMA 3EHMA 2VH3A 4JURI 4PK4A 5L3QA 2Q9BA 1TWGA 4U5HA 2IOQA 2A69F 4IWBA 5T3TA 4BJ6A 2WVOA 2CGEA 3SZRA 4GEHA 3PMRA 4CBEA 3EGXB 3EJNA 4E7SA 1Z6AA 2KJGA 3ECSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  2WZL A;  1VYI A; 
#chains in the Genus database with same CATH topology
 3U2L A;  3A11 A;  1K04 A;  1E85 A;  4OIQ F;  1PCX A;  2EIK C;  5E33 A;  2MYS A;  2CDQ A;  1H9G A;  3LNM B;  4BPM A;  2VCA A;  2YL3 A;  4G0H A;  4JTA B;  4ONS A;  3RIP A;  2O9X A;  1D0Z A;  4PJM A;  5B1B C;  3GOR A;  1JPN A;  4CS7 A;  2Y3D A;  1S05 A;  4DBQ A;  1E83 A;  1BR4 A;  2XS1 A;  3RF3 A;  4NCQ A;  1EQ1 A;  3AQB A;  4MW8 A;  4U5B E;  2KK1 A;  1BDJ B;  3WOD F;  4YWQ A;  4Z9J A;  1OW7 A;  2IXP A;  2LP4 A;  1A7D A;  3AJM A;  1M2V A;  2Q7R A;  2MHR A;  2VCB A;  1OW8 A;  3GM2 A;  3F46 A;  2HSQ A;  1VLT A;  3E9V A;  1LI5 A;  1MMN A;  3MFN A;  5HSW A;  2GDC A;  3UGO A;  3IQ6 A;  5L0J A;  4LLE A;  2Z15 A;  2M4E A;  2ZXW C;  3L0I A;  4YL1 A;  4YT4 A;  2H7B A;  1MMD A;  5K0I A;  1M6T A;  4M63 A;  256B A;  2A6E F;  2EPO A;  1ZHT A;  2L6G A;  4E0H A;  3FAP B;  4AK9 A;  3MLG A;  4DJ9 A;  3N2Z B;  1A7V A;  2OCC C;  2Q00 A;  2L7A A;  4YN0 B;  5AC5 A;  2YVK A;  1AUE A;  1E2X A;  3DE8 A;  2HFI A;  1HMO A;  3IPM O;  4JEA A;  3ZTM A;  1SMY F;  4JRZ A;  3U0C A;  3GWN A;  5TJ5 E;  5DVW A;  3UMI A;  4ER9 A;  1CGN A;  1WAT A;  1YZC A;  2YHS A;  4LER A;  2R7X A;  4U5G A;  1MMA A;  4W8K A;  4XWJ A;  3SXY A;  3HKK A;  3JCU Q;  4J32 B;  5KYW A;  3QW0 A;  2AP3 A;  2ASR A;  2YLI A;  2J0W A;  1RJ9 A;  4JTD B;  4XEV A;  5F5H A;  3US6 A;  2G3K A;  2J9W A;  4CIP A;  2QUP A;  3K1I A;  5IY5 C;  2OOC A;  2YLD A;  3LS0 A;  3KH2 A;  1WOL A;  3UNG C;  3U9J A;  1RKE A;  2NUT A;  5DQT A;  5FCL A;  5JUA A;  2AWY A;  2B0H A;  4JJF A;  2YWA A;  1Y6D A;  3FOO A;  3OEO A;  4U9D A;  4U5C E;  3T6J A;  3HJC A;  3E70 C;  4E18 A;  3NYL A;  3RW0 A;  4DRI B;  3PCV A;  1YVI A;  4A2N B;  2Q4F A;  1NBB A;  1LIH A;  2WL8 A;  2WZF A;  4IAO A;  4JTC B;  1KU2 A;  4G78 A;  2LD6 A;  1D1B A;  2PBE A;  4IGG A;  2ZXR A;  1YDI A;  1JRA A;  2J9B A;  4JC7 A;  3VRC A;  1OQC A;  2A0B A;  1EA8 A;  4H4K C;  4E7Z A;  3DAF A;  2ZXO A;  4D4X A;  3C18 A;  4Z9I A;  1M2V B;  1WAS A;  2NUP A;  4HFF B;  3LS1 A;  3DM5 A;  3POV A;  2HJM A;  3X2Q C;  2R7W A;  2XL4 A;  1FNT c;  1HW1 A;  1PD1 A;  2DYR C;  3AG2 C;  4I1M A;  2A1D D;  1R5I D;  3NMK A;  3MYF A;  3B9Q A;  3Q6M A;  3TOL A;  3VF0 A;  3ZTZ A;  4CJO A;  3AG4 C;  4E0I A;  5EHH A;  2WB7 A;  1H9T A;  3SXZ A;  4P9T A;  1D0X A;  1V4A A;  4YJW A;  1FMW A;  4YT5 A;  5L3V A;  3FHD A;  4D4N A;  5BQG A;  3B71 A;  2BE5 F;  2RSE B;  2EIN C;  1DOW A;  1I4Y A;  4CDY A;  1K40 A;  3G4X A;  3QVY A;  2L6H A;  4MVO A;  5E3A A;  4BJ1 A;  3S0X A;  2Q9C A;  1HY5 A;  1YLM A;  1APC A;  1IZM A;  2V26 A;  5COG A;  1BR2 A;  3T4R A;  3NDB B;  1LM3 B;  4F4B A;  1OCO C;  3CSK A;  5DLJ A;  3TQO A;  1O5H A;  1QVX A;  1S7Z A;  2KSF A;  2KC3 A;  2NSG A;  1LE4 A;  1KTM A;  1RKC A;  5CIV A;  5KYW B;  4B6I A;  4NY3 A;  2HS5 A;  1KNY A;  3MX3 A;  3R2P A;  4I3M A;  5AGF A;  3U3B A;  3ZQV A;  4Q4Z F;  2XXA B;  1RKE B;  2NUT B;  3W2V A;  3U5S A;  1VTM P;  2GAQ A;  1LE2 A;  4DRJ B;  3V5Z A;  2YL0 A;  4FWV A;  1MND A;  1FAP B;  1WGW A;  3H2V A;  1WWP A;  3EZH A;  4JCH A;  3C8Z A;  5L0I A;  4MS2 A;  1SZI A;  4CDA A;  2OU6 A;  3CQZ A;  1NG1 A;  3KMI A;  5KYY A;  4PFP A;  3QZC A;  3U8P A;  4QI0 A;  2H8A A;  4O7G A;  4AE4 B;  4EWC A;  3K33 A;  4QDL A;  2E87 A;  2FGY A;  3HTK C;  1G8X A;  1FMV A;  2W4M A;  3IEE A;  4K7B A;  2Y39 A;  3V7O A;  3BEH A;  1T6Q A;  4BEJ A;  2HV7 A;  2NUP B;  4NTA A;  2MWQ A;  5F28 E;  1Q0M A;  1A0B A;  3EHN A;  2I8B A;  4YK5 A;  5L0D A;  3SNH A;  3ZG1 A;  4NC3 A;  1B68 A;  3WHN A;  5JRA A;  1VYI A;  3Q6N A;  4G7Z F;  3JZ0 A;  3RQF A;  1W2W A;  2R9R B;  2Y69 C;  3C8G D;  3TUL A;  3W8I A;  4ULV A;  1U0B B;  1K05 A;  1OR3 A;  3LLI A;  4G7O F;  4LDK A;  2PFD A;  3U9M A;  3VYW A;  3DD7 A;  3QTH A;  3TK0 A;  5A6B D;  4W8P A;  2ZD9 A;  4NTB A;  1GM5 A;  4XPX A;  1OW6 A;  1NU7 D;  2XLD A;  3TD7 A;  3GEH A;  4PFO A;  2EIJ C;  2YQY A;  4EBK A;  1C02 A;  2B0J A;  2EIL C;  2VC9 A;  4H54 A;  5KYN A;  4I1O B;  4QI2 A;  3UMK A;  1EI7 A;  2DYS C;  3M79 A;  3L34 A;  2ICW G;  4ZLC A;  1BR1 A;  2LFD A;  3IQ5 A;  3TJ5 A;  4JIO A;  4FX5 A;  4G7H F;  2PNO A;  2XS8 A;  2LQG A;  3EZI A;  4CSA A;  4MVZ A;  2KNH A;  4P6I C;  3FAJ A;  4L6R A;  3G50 A;  2M64 A;  2XL6 A;  3H2U A;  2P7V A;  4OIP F;  3QW1 A;  5A6A A;  1CGO A;  1U6H A;  1VMA A;  3EPV A;  1J8Y F;  1U89 A;  3GAN A;  2KW3 C;  1A41 A;  4ANJ A;  5DS5 A;  3AQC A;  1V74 B;  3L8I A;  4KC9 A;  1Q0D A;  2PP4 A;  3JYH A;  3OWT A;  2XRH A;  3SYN A;  5KYY B;  2R7R A;  1GGQ A;  1JOG A;  1ORY A;  2Y3B A;  2FFH A;  2ETS A;  3O55 A;  2V3C C;  4CS9 C;  3RQG A;  5HV9 A;  3S27 A;  3U3F A;  3N24 A;  1L7C A;  4XPW A;  4BJ5 C;  4KNV A;  2XXA A;  5AC4 A;  4BG0 A;  2R03 A;  3HNJ A;  4K0D A;  1M2O A;  1WTY A;  2J7P D;  5JSL A;  4N6H A;  2PX3 A;  4PJJ A;  1ZHX A;  4HEA J;  1TFK B;  1LKX A;  4WAB A;  2NSF A;  4A4A A;  3NKE A;  4MVS A;  3S29 A;  3EQL F;  3ZIB A;  3SXK A;  3KKB A;  3NYJ A;  4MND A;  4N6C A;  2J45 A;  4X0R A;  4AE4 A;  2IBF A;  3DKA A;  4CS8 A;  3UGP A;  4CX9 A;  1TQG A;  2CCY A;  3DI5 A;  1Q0F A;  2QY9 A;  2W4B A;  1DOV A;  2DGJ A;  3HNI A;  2Q9A A;  2IXM A;  2QLA A;  3TJ6 A;  4DVY P;  3RYL A;  5COF A;  4DBR A;  1XZQ A;  2GWW A;  3L8J A;  2R25 A;  3O6X A;  3M4B A;  1YAU O;  4IRU A;  2CW0 F;  2HKV A;  1OCR C;  2X51 A;  3S9O A;  3HNL A;  2XLW A;  1JPJ A;  4EKW A;  3Q7L A;  1R4T A;  1T9K A;  5D91 A;  4BJT A;  3R7C A;  5DQZ A;  1OCC C;  3S90 A;  5KYU A;  2YL7 A;  2J7P A;  3B0U X;  1FFH A;  2QNL A;  2R05 A;  4RDA A;  1NLX A;  1MMG A;  2A68 F;  4MQ9 F;  4RBN A;  3BRJ A;  3DMD A;  4IJJ A;  4ZLD A;  3ZDL A;  2IXO A;  2H7V C;  2L9J A;  4J7Y A;  2R7V A;  4MVR A;  1Z3I X;  3C8G B;  2PF4 E;  1TWA A;  3ASN C;  2HV6 A;  4GQH A;  4JE9 A;  3LAY A;  3SEO A;  4LLC A;  4O6Y A;  2Y3G A;  4MVQ A;  4I44 A;  1ZZP A;  2IM8 A;  2WVN A;  2AU5 A;  2G62 A;  3GWL A;  3M4C A;  4HFK B;  5L0G A;  1ZW2 A;  2YKZ A;  4OD5 A;  2D5R B;  4XPY A;  3EH1 A;  2JX0 A;  3LLK A;  2VAS A;  4MTF A;  2HMQ A;  1I5N A;  5T3W A;  3SP1 A;  1Z63 A;  2XM4 A;  4EUK B;  3RKO F;  4NQF A;  3ZVR A;  5A6K A;  1OXB A;  1QSP A;  4OIR F;  3GEI A;  4XEK A;  1C17 M;  1GQA A;  2VB6 A;  1Y4C A;  2ZXP A;  4IAQ A;  3FXH A;  4BJ6 C;  4EHP A;  1YA9 A;  3VAY A;  4MTG A;  2W9Y A;  2EPM X;  2YL1 A;  1L3P A;  3MBG A;  1HE9 A;  1LS1 A;  2P1A A;  3W8H A;  4UDV A;  4MVM A;  1NZE A;  4CIH A;  4Q5S F;  3ATP A;  3JSE O;  1FTS A;  3JT1 A;  4XLP F;  1VYK A;  1ZVZ A;  4LDQ A;  1ZU5 A;  3FOP A;  5JT4 A;  2VCC A;  3GOD A;  4XEF A;  1V55 C;  3N0T A;  2P61 A;  5E3C A;  3LES A;  3C62 A;  5JLI A;  2HMZ A;  1I4Z A;  3EG9 A;  3JTL O;  2AVK A;  1LPE A;  1VB5 A;  2EIM C;  4DVZ A;  5B3S C;  3X1O A;  3TOM A;  1BBH A;  1Z5Z A;  2OQM A;  1LI7 A;  1NSG B;  3RQE A;  1OXK A;  4KBL A;  3F47 A;  5B1A C;  3EGD B;  1CPR A;  3JSZ A;  2OEV A;  3LEO A;  2BL2 A;  2J8W A;  5JS5 A;  4U5F E;  1H6G A;  5JVE A;  4DXW A;  3Q7G A;  2OG2 A;  2GA0 A;  3ZC4 A;  2BC5 A;  1G4W R;  2XLO A;  4JZA A;  3WAQ A;  4AX2 A;  1O87 A;  1FFT C;  4C3E A;  3LNR A;  4Q7C A;  1YZA A;  3U2M A;  3UR3 C;  2YRF A;  3NYM A;  5D92 A;  1RMV A;  3KYJ A;  5KYU B;  3I4U A;  2J46 A;  4AL1 A;  2CYD A;  5L0C A;  3L1M A;  3KPH A;  3ZSU A;  4J7T A;  3EFO A;  1ZHZ A;  2J9V A;  3J06 A;  4LAC B;  3RVY A;  3FMS A;  3IQC A;  3NKD A;  4YL0 A;  4ULW A;  2WZG A;  3QVZ A;  1QPU A;  4IAR A;  1UFB A;  3LEV A;  4YT8 A;  4FES A;  3HNK A;  3RH3 A;  4C7O A;  4YL3 A;  3W2W A;  3MYI A;  2IYL D;  3NMJ A;  5KYX A;  4PR9 A;  2OEX A;  1V54 C;  4R32 A;  1ZYR F;  1JMW A;  4JCZ A;  2ZPA A;  4CSA C;  4JW1 A;  3K1H A;  4YT2 A;  1JAF A;  3ASO C;  3B0V C;  4RD9 A;  5DS4 A;  2WVQ A;  4JJG A;  1T6I A;  2X0C A;  4Z9H A;  1IW7 F;  2I15 A;  1HW2 A;  1NFO A;  3NG1 A;  1YYX A;  5EK0 A;  3M1C B;  5COM A;  4EIY A;  2R02 A;  1M57 C;  1PD0 A;  2LIG A;  4DRH B;  5BQI A;  3GEE A;  3CAX A;  1AEP A;  1XZP A;  4PJN A;  4WGZ A;  4XLN F;  4OIN F;  3RFY A;  3C8G A;  3IHU A;  3U8V A;  1YJG A;  4AL0 A;  2F22 A;  3K1I C;  3FVY A;  2PX0 A;  3FDQ A;  3DZA A;  4JEB A;  3JRT A;  2OJE D;  3UMH A;  3C63 A;  3I5Q A;  2NG1 A;  5A6B A;  2L6F A;  2DB4 A;  2XL8 A;  4PAC A;  1M56 C;  3AOU A;  3EH2 A;  1TR2 A;  4O6N A;  4N4W A;  2KYH A;  3K7D A;  2YLG A;  3GM1 A;  4U5E E;  3EG9 B;  2KGO A;  2CNW D;  4J30 B;  3LUT B;  5T1D B;  3DE9 A;  3PHF 2;  4OIO F;  3KL4 A;  3ABK C;  3AG1 C;  1CPQ A;  2R7O A;  1XWJ A;  2QTV A;  2WZL A;  3DWW A;  5BQH A;  4C3D A;  4CS8 C;  4O6M A;  2P6V A;  2EPN A;  3O10 A;  4BEM J;  1MQV A;  2OKU A;  4JKV A;  1OKK D;  2LCH A;  3JRM O;  2YZS A;  2J9U A;  5F5F A;  3NRH A;  2XSE A;  3CZ6 A;  2DI3 A;  4GYT A;  3VM6 A;  4KNW A;  1UG7 A;  2HSB A;  1QKR A;  2LFF A;  3NMI A;  3O39 A;  1SF8 A;  2C03 A;  2R7S A;  1AVO B;  3H65 A;  3CEX A;  1QQ3 A;  3EFO B;  3DJU B;  2P0N A;  1NU9 C;  2XLE A;  3K66 A;  3LJB A;  4XQ1 A;  2TMV P;  3DXJ F;  3B0P A;  3EGD A;  4JVS A;  1PV3 A;  4HE8 D;  2RD9 A;  4O79 A;  5B3I A;  4C7O B;  1TWH A;  3B29 A;  4WGY A;  4MTO A;  4CS9 A;  2LSE A;  2IXN A;  1RCP A;  5KYX B;  2CNW A;  3OA1 A;  1JR8 A;  1D0Y A;  4BJ5 A;  3T6G B;  4FAP B;  4N06 A;  5DS6 A;  1O3U A;  2GFH A;  5A6J A;  3A9C A;  4CDV A;  1CGM E;  1OCZ C;  2J0X A;  1YYJ A;  2AWC A;  1N1C A;  2C04 A;  2JD3 A;  3K6B A;  2UUI A;  1OKK A;  3ABM C;  2D4U A;  5A69 A;  1VLS A;  1G4U S;  4IB4 A;  2Y3H A;  3DJN B;  1SYQ A;  2JPU A;  4U5D E;  2EPL X;  1NFN A;  2A6H F;  1WN0 A;  1YAR O;  5JP7 A;  1Z23 A;  3ZQY A;  3EGX A;  1MNE A;  1VK5 A;  2Q3T A;  1A7E A;  3AG3 C;  4XTK A;  5FZT A;  4KI2 A;  3DM9 B;  3V5Y A;  1QLE C;  1T01 A;  3DAG A;  1LVK A;  5EGY A;  3GM3 A;  3S28 A;  5CI8 A;  1Q0G A;  4WJ0 A;  1ZHW A;  5GPG B;  1J8M F;  3RVZ A;  1F1M A;  2XM0 A;  4C3B A;  3IQT A;  4EBJ A;  2L81 A;  1ZU4 A;  2H7O A;  4EBB A;  2EPK X;  2R7Q A;  2HUJ A;  2R7T A;  3C7J A;  3ZWI A;  1HMD A;  3ABL C;  3HLZ A;  3T6B A;  1C03 A;  1T6U A;  4LDR A;  3WG7 C;  2YEV A;  5E2Q A;  1OR2 A;  1QZX A;  1ST6 A;  2A0U A;  2W45 A;  3G4Z A;  3SXM A;  1G5Z A;  4P9F A;  1GS9 A;  3AGU A;  2XLM A;  1Z7Q c;  2XLH A;  5CI9 A;  4U9E A;  3PDM P;  1D1A A;  1TWC A;  2HJ3 A;  3ITF A;  2LK4 A;  1T5O A;  4OD4 A;  2NPU A;  4E17 A;  2KQ9 A;  5BUO A;  1TFO B;  3KYI A;  1E86 A;  1RJ9 B;  2XLV A;  3I5P A;  3QMK A;  3T9O A;  2R7U A;  1D1C A;  4DOZ A;  1ZHY A;  1TKN A;  1RXQ A;  2G3V A;  1EKY A;  3AGT A;  4PJL A;  1HE1 A;  1SR2 A;  1ORJ A;  1VOM A;  1YA7 O;  1ZW3 A;  3EHM A;  4K1O A;  3W4Y A;  2VH3 A;  2UUH A;  1ORS C;  2FAP B;  4JUR I;  5L0H A;  4PK4 A;  5L3Q A;  2Q9B A;  1TWG A;  4U5H A;  2OJQ A;  1BZ4 A;  3V5X A;  2IOQ A;  5L0F A;  1FR0 A;  3S84 A;  4CJG A;  2A69 F;  4IWB A;  5T3T A;  4BJ6 A;  1E84 A;  2WVO A;  2CGE A;  4MVU A;  4NTF A;  2QE9 A;  1Q0K A;  2HZ8 A;  3SZR A;  3M15 A;  3PMR A;  4GEH A;  4CBE A;  3EGX B;  3EJN A;  3JYY A;  4E7S A;  1LS4 A;  1Z6A A;  2KJG A;  4MW3 A;  3ECS A;  1H7I A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  1PCX A;  2EIK C;  5E33 A;  2MYS A;  2CDQ A;  3RIP A;  4G0H A;  2O9X A;  1D0Z A;  4PJM A;  5B1B C;  4DBQ A;  1JPN A;  4CS7 A;  2Y3D A;  1BR4 A;  3AQB A;  4U5B E;  3WOD F;  4YWQ A;  2IXP A;  1M2V A;  3F46 A;  3E9V A;  1MMN A;  5HSW A;  3UGO A;  4LLE A;  2Z15 A;  2M4E A;  2ZXW C;  3L0I A;  4YT4 A;  2H7B A;  1MMD A;  4M63 A;  2A6E F;  1ZHT A;  4AK9 A;  3MLG A;  3N2Z B;  2OCC C;  4YN0 B;  1SMY F;  5DVW A;  3UMI A;  2YHS A;  4LER A;  2R7X A;  4U5G A;  1MMA A;  4W8K A;  4XWJ A;  3JCU Q;  4J32 B;  5KYW A;  3W2W A;  3W8H A;  5F5H A;  2J0W A;  1RJ9 A;  2G3K A;  2J9W A;  5IY5 C;  3UNG C;  3LS0 A;  3KH2 A;  5DQT A;  5FCL A;  2NUT A;  4JJF A;  3OEO A;  4U5C E;  3T6J A;  3HJC A;  3E70 C;  3NYL A;  4A2N B;  2WZF A;  2WL8 A;  4IAO A;  1KU2 A;  1D1B A;  2ZXR A;  5BUO A;  4H4K C;  4E7Z A;  3DAF A;  2ZXO A;  1M2V B;  2NUP A;  4HFF B;  3LS1 A;  3DM5 A;  3POV A;  3X2Q C;  2R7W A;  2XL4 A;  2DYR C;  1PD1 A;  3AG2 C;  4I1M A;  2A1D D;  3Q6M A;  3B9Q A;  3AG4 C;  5EHH A;  2WB7 A;  1D0X A;  4YJW A;  1FMW A;  4YT5 A;  5L3V A;  3FHD A;  2BE5 F;  2EIN C;  5E3A A;  4BJ1 A;  3S0X A;  2Q9C A;  3T4R A;  3NDB B;  1IZM A;  2V26 A;  1BR2 A;  4F4B A;  1OCO C;  3CSK A;  5DLJ A;  1O5H A;  1S7Z A;  5KYW B;  4B6I A;  4NY3 A;  4I3M A;  3MX3 A;  4Q4Z F;  2XXA B;  2NUT B;  3W2V A;  4FWV A;  1MND A;  1WGW A;  3EZH A;  4JCH A;  1SZI A;  3CQZ A;  1NG1 A;  3KMI A;  5KYY A;  4PFP A;  3QZC A;  4QI0 A;  4O7G A;  4AE4 B;  4EWC A;  3K33 A;  4QDL A;  2E87 A;  2FGY A;  3HTK C;  1G8X A;  1FMV A;  2W4M A;  3IEE A;  4K7B A;  2Y39 A;  3V7O A;  4BEJ A;  2HV7 A;  2NUP B;  2MWQ A;  3EHN A;  2I8B A;  3SNH A;  3ZG1 A;  1VYI A;  3Q6N A;  4G7Z F;  1W2W A;  2Y69 C;  3W8I A;  3LLI A;  4G7O F;  2PFD A;  3VYW A;  3DD7 A;  1NU7 D;  3TD7 A;  4PFO A;  2EIJ C;  2B0J A;  2EIL C;  5KYN A;  4I1O B;  4QI2 A;  3UMK A;  2DYS C;  3L34 A;  4ZLC A;  1BR1 A;  4FX5 A;  4G7H F;  3EZI A;  4CSA A;  2KNH A;  4P6I C;  3FAJ A;  4OIP F;  2P7V A;  1VMA A;  3EPV A;  3GAN A;  1J8Y F;  2KW3 C;  4ANJ A;  5DS5 A;  3AQC A;  4KC9 A;  5KYY B;  2PP4 A;  3JYH A;  3OWT A;  2XRH A;  3SYN A;  2R7R A;  2Y3B A;  2V3C C;  2FFH A;  4CS9 C;  3S27 A;  3N24 A;  4BJ5 C;  4KNV A;  2XXA A;  4BG0 A;  4K0D A;  1M2O A;  2J7P D;  2PX3 A;  4PJJ A;  1ZHX A;  4HEA J;  1LKX A;  3NKE A;  3S29 A;  3ZIB A;  3EQL F;  3KKB A;  3NYJ A;  4MND A;  4X0R A;  2J45 A;  4AE4 A;  4CS8 A;  3UGP A;  2QY9 A;  2W4B A;  2DGJ A;  4DVY P;  2Q9A A;  2IXM A;  3RYL A;  4DBR A;  3O6X A;  4IRU A;  2CW0 F;  1OCR C;  2X51 A;  1JPJ A;  3Q7L A;  5D91 A;  4BJT A;  5DQZ A;  1OCC C;  5KYU A;  2J7P A;  3B0U X;  1FFH A;  4RDA A;  1MMG A;  2A68 F;  4MQ9 F;  4RBN A;  3DMD A;  4IJJ A;  4ZLD A;  2IXO A;  2H7V C;  2L9J A;  2R7V A;  1Z3I X;  2PF4 E;  1TWA A;  3ASN C;  2HV6 A;  3SEO A;  3LAY A;  4LLC A;  4O6Y A;  2Y3G A;  4I44 A;  5F5F A;  2WVN A;  4HFK B;  2G62 A;  4OD5 A;  2D5R B;  3EH1 A;  3LLK A;  2VAS A;  5T3W A;  3SP1 A;  1Z63 A;  3RKO F;  3ZVR A;  4OIR F;  2VB6 A;  2ZXP A;  4BJ6 C;  3VAY A;  2W9Y A;  1LS1 A;  1NZE A;  4CIH A;  4Q5S F;  1FTS A;  3JT1 A;  4XLP F;  1VYK A;  1ZU5 A;  3GOD A;  1V55 C;  3N0T A;  5E3C A;  3LES A;  3EG9 A;  5B3S C;  2EIM C;  4DVZ A;  3X1O A;  1Z5Z A;  5B1A C;  4KBL A;  3F47 A;  3EGD B;  3JSZ A;  4U5F E;  3Q7G A;  2OG2 A;  3ZC4 A;  4AX2 A;  4JZA A;  1O87 A;  1FFT C;  4C3E A;  3LNR A;  4Q7C A;  3UR3 C;  3NYM A;  5D92 A;  5KYU B;  3I4U A;  2J46 A;  3ZSU A;  3EFO A;  1ZHZ A;  2J9V A;  4LAC B;  3NKD A;  4ULW A;  2WZG A;  4YT8 A;  3LEV A;  4FES A;  3RH3 A;  4C7O A;  2IYL D;  5KYX A;  1V54 C;  1ZYR F;  2ZPA A;  4CSA C;  4JW1 A;  3K1H A;  4YT2 A;  3ASO C;  3B0V C;  4RD9 A;  5DS4 A;  2WVQ A;  4JJG A;  1IW7 F;  3NG1 A;  3M1C B;  1M57 C;  1PD0 A;  4PJN A;  4XLN F;  4OIN F;  3RFY A;  3K1I C;  3FVY A;  2PX0 A;  3FDQ A;  3DZA A;  3JRT A;  3UMH A;  3I5Q A;  2NG1 A;  1M56 C;  3EH2 A;  1TR2 A;  4O6N A;  3K7D A;  4U5E E;  3EG9 B;  2KGO A;  2CNW D;  4J30 B;  5T1D B;  4OIO F;  3PHF 2;  3KL4 A;  3ABK C;  3AG1 C;  2R7O A;  2WZL A;  2QTV A;  4C3D A;  4CS8 C;  4O6M A;  2P6V A;  1OKK D;  2YZS A;  2J9U A;  3NRH A;  2XSE A;  3CZ6 A;  4GYT A;  4KNW A;  3O39 A;  1SF8 A;  2C03 A;  2R7S A;  3H65 A;  3EFO B;  3DJU B;  1NU9 C;  3K66 A;  3LJB A;  3DXJ F;  3B0P A;  3EGD A;  4JVS A;  4O79 A;  4HE8 D;  4C7O B;  1TWH A;  4CS9 A;  2LSE A;  2IXN A;  5KYX B;  2CNW A;  3OA1 A;  1D0Y A;  4BJ5 A;  4N06 A;  5DS6 A;  2GFH A;  1OCZ C;  2J0X A;  3K6B A;  2C04 A;  1N1C A;  2JD3 A;  1OKK A;  3ABM C;  2Y3H A;  3DJN B;  4U5D E;  2A6H F;  1Z23 A;  3EGX A;  1MNE A;  1VK5 A;  2Q3T A;  3AG3 C;  4XTK A;  4KI2 A;  3DM9 B;  1QLE C;  3DAG A;  1LVK A;  5EGY A;  3S28 A;  5CI8 A;  4WJ0 A;  1ZHW A;  1J8M F;  4C3B A;  2L81 A;  1ZU4 A;  2H7O A;  4EBB A;  2R7Q A;  2R7T A;  3ABL C;  3HLZ A;  3T6B A;  3WG7 C;  2YEV A;  5E2Q A;  1QZX A;  1ST6 A;  2W45 A;  5CI9 A;  1D1A A;  1TWC A;  3ITF A;  4OD4 A;  2KQ9 A;  1RJ9 B;  3I5P A;  3QMK A;  2R7U A;  1D1C A;  4DOZ A;  1ZHY A;  1TKN A;  2G3V A;  4PJL A;  1VOM A;  3EHM A;  2VH3 A;  4JUR I;  4PK4 A;  5L3Q A;  2Q9B A;  1TWG A;  4U5H A;  2IOQ A;  2A69 F;  4IWB A;  5T3T A;  4BJ6 A;  2WVO A;  2CGE A;  3SZR A;  4GEH A;  3PMR A;  4CBE A;  3EGX B;  3EJN A;  4E7S A;  1Z6A A;  2KJG A;  3ECS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...