2WZLA

The structure of the n-rna binding domain of the mokola virus phosphoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
DIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNLDDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMARLEEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHOPROTEIN
publication title The Structure of the N-RNA Binding Domain of the Mokola Virus Phosphoprotein
pubmed doi rcsb
source organism Mokola virus
molecule tags Viral protein
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03012 PP_M1 Phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2wzlA00
3OA1A 1VYIA 2WZLA
chains in the Genus database with same CATH superfamily
1BR4A 1VMAA 5L0HA 1RMVA 4AK9A 4JJFA 5JRAA 3LNMB 3S29A 1LS4A 3LNRA 1J8YF 1K04A 4AE4B 2EINC 3LAYA 1YAUO 3SNHA 1DOWA 1Q0FA 4P6IC 1M56C 2HSQA 2A69F 4PJLA 1E86A 1T6QA 4ULWA 5T3TA 1SYQA 1VYKA 4YN0B 3SZRA 1V4AA 4D4NA 4D4XA 2OQMA 1TR2A 5KYWB 2J7PA 1OQCA 2F22A 2EPLX 2GAQA 2WZGA 4PACA 1I5NA 3B71A 5A6BD 4JEAA 4JTAB 4O79A 3VM6A 2R7RA 1C17M 3UGOA 5AC5A 1M2VA 1OW6A 3GORA 3IQTA 1OCZC 3ABKC 1OR2A 3T9OA 1YLMA 4C3DA 4R32A 2MYSA 2OEVA 3LESA 1J8MF 2NUTA 3N2ZB 3W2WA 2LFDA 5A6KA 3U0CA 1SF8A 1NFOA 1Z5ZA 2DYSC 2YRFA 1OCOC 3C7JA 4ULVA 3LS0A 3DKAA 4OIOF 3SYNA 4YL1A 2EPMX 3HJCA 1MNEA 1ZVZA 1EKYA 3AG2C 1JRAA 2H8AA 4IARA 1Z7Qc 4H4KC 1WN0A 5EK0A 2IXMA 3UNGC 4YT8A 1CPQA 2XLMA 2M64A 1WWPA 1ORSC 1ZW2A 1Z3IX 2HV6A 2KK1A 3R2PA 4BG0A 4P9TA 3C8GA 3F47A 3L8IA 4G78A 4YT2A 2XLWA 2W45A 3QVZA 4WABA 5AGFA 2XL8A 3UR3C 4YT5A 3IQ6A 3W2VA 3JRMO 2EIMC 5DS6A 1C02A 4JRZA 3O39A 4GQHA 4MTFA 1ZZPA 4OINF 1EQ1A 4NY3A 4XLPF 4LDRA 5COFA 1ORYA 2WVQA 1AEPA 5E3AA 5EGYA 3T4RA 1Z6AA 2Q7RA 3DD7A 2ZXOA 5JP7A 4W8KA 4BJ1A 2PBEA 3FOOA 2GWWA 3DZAA 4U9EA 5E33A 4IB4A 3U9JA 4LDQA 5GPGB 1A41A 1DOVA 1RCPA 3GEEA 4E17A 1NSGB 3ABLC 3C63A 3RW0A 3UMHA 5JLIA 3PHF2 2V3CC 4JVSA 3FAPB 3AG1C 4M63A 3X2QC 4EKWA 2R9RB 1JAFA 2EPKX 1ORJA 2KGOA 3JSZA 2L6GA 1GS9A 2CNWA 3QVYA 5KYXA 3IEEA 3ZTMA 4BEMJ 1LPEA 3U2LA 1E83A 2CYDA 2XLVA 3IQCA 5F28E 2HJ3A 3S28A 1O5HA 5HSWA 2R7XA 2YKZA 2J46A 1I4YA 1SR2A 4I3MA 3M15A 1MMAA 3RVYA 4K1OA 1LI7A 1Y6DA 2OG2A 3QW0A 1JR8A 2HMZA 3GEIA 3SEOA 3G4ZA 2IXOA 5L0DA 2J0WA 4JCZA 2WB7A 4CBEA 4JCHA 4K0DA 3U8VA 3H2VA 1ZYRF 3NYMA 2P61A 3N0TA 2J9UA 4JIOA 2ZPAA 2Y39A 5DLJA 4DRIB 3EFOB 1AUEA 1XWJA 1ZHWA 4XTKA 4I1OB 5T3WA 3EG9A 3EHNA 3B9QA 3NMIA 2LD6A 4EBBA 3EQLF 1C03A 4I44A 4O6NA 4MQ9F 2LIGA 2XL6A 2XXAA 3EH2A 3NMKA 3FXHA 3N24A 3NMJA 1VTMP 5L3QA 2YVKA 5E3CA 4DBRA 1D0XA 3L8JA 1R5ID 3U8PA 1TWCA 2H7BA 3M4CA 2R7UA 4ZLDA 4J7YA 1LM3B 2WL8A 2PX0A 2X0CA 3RKOF 3DE8A 3K66A 3GANA 4XEFA 5AC4A 2L81A 5A6AA 4E0HA 1T01A 2VB6A 1L3PA 3U9MA 4XPXA 1FFTC 4U5EE 1IW7F 2G62A 3KPHA 3EGXB 3AQBA 1ZHYA 3FVYA 3U3FA 2J0XA 3AOUA 3ECSA 4JJGA 4JZAA 4A4AA 4Q5SF 3H65A 4NTBA 2R7VA 3X1OA 4IAQA 4K7BA 2CW0F 1OXBA 2Y3GA 1QVXA 3DJUB 2G3VA 4L6RA 3GM2A 2GFHA 3QZCA 2R05A 4MVRA 4Z9HA 3ZC4A 2FFHA 2Q9CA 3NKDA 1YARO 2E87A 3SXZA 4E0IA 2P0NA 3US6A 1VLSA 1TWHA 4JE9A 2KC3A 3K1HA 4CDYA 3V5YA 4EWCA 3NDBB 3LJBA 2FAPB 3KYIA 4X0RA 3ZDLA 2KW3C 4H54A 1OCCC 5COMA 5K0IA 1TWAA 3GEHA 1RKEB 3AJMA 4O6MA 1U89A 4LACB 1GGQA 2HMQA 4CIPA 3SXKA 3ABMC 3S90A 1Q0DA 4PJMA 3HNJA 4RBNA 3PDMP 2OEXA 4KI2A 3TULA 3DJNB 4U5FE 2AP3A 1YZAA 1TKNA 2B0JA 2LSEA 2PP4A 2Q4FA 3FOPA 3I5PA 2LCHA 5CI8A 3TK0A 3UGPA 1JPNA 2R7SA 4EIYA 2NG1A 3MYIA 2LP4A 3O10A 4IGGA 4U5GA 1ZHZA 2CCYA 3E70C 4RDAA 3SP1A 4BJ5C 5A6JA 3B0UX 1D1AA 1A7VA 1LKXA 2NUPB 2R7QA 3RH3A 1HE1A 4N6HA 2R7WA 1U0BB 3ZG1A 3DE9A 4DBQA 2CNWD 2OJQA 2OJED 1T9KA 2XSEA 5F5FA 1QZXA 1YYXA 5B3SC 1XZQA 4CDAA 1JPJA 1JOGA 1VB5A 2Q00A 2XM4A 3K33A 3NG1A 5TJ5E 1WGWA 4MVMA 4EUKB 2A6EF 1S7ZA 3EZHA 2I8BA 4FAPB 256BA 2IXNA 1BR1A 4AE4A 2ICWG 3TD7A 4XPWA 1FFHA 2A0UA 2VCCA 2I15A 2W4BA 4J7TA 3WG7C 4G0HA 5L3VA 1OKKD 3C8GB 5L0FA 2O9XA 3VAYA 3JCUQ 4MNDA 5KYWA 3L34A 4YJWA 1S05A 3QTHA 1HMOA 5BUOA 3DWWA 5DQZA 3KH2A 2M4EA 3MLGA 4IRUA 2J9VA 1SZIA 2BL2A 4MVUA 2NSFA 2Q9BA 4C3BA 3HKKA 3I5QA 3V5ZA 2YEVA 4WGZA 4WGYA 2KYHA 4B6IA 4CS8C 5KYNA 4N6CA 1AVOB 3M4BA 2KSFA 2MHRA 3ATPA 2A1DD 3KYJA 3M1CB 5BQGA 5A69A 3HNKA 4U5CE 4Z9JA 3JT1A 2XM0A 4OD4A 3VF0A 1R4TA 3EPVA 3CEXA 2Y3BA 3Q6NA 4YK5A 5FCLA 2QE9A 1CGME 3C18A 2NSGA 2YLDA 4NQFA 5DQTA 4BJ5A 4ZLCA 3AG4C 4E7ZA 3MX3A 4U9DA 5EHHA 1TFOB 2Q9AA 4NCQA 2A68F 2GA0A 1YVIA 3SXMA 3E9VA 5JVEA 1O87A 3EH1A 4OIPF 1UFBA 4F4BA 3O6XA 3ASOC 4PJJA 2VH3A 5FZTA 3EGDB 4ANJA 1G5ZA 2WZFA 3T6BA 1KNYA 1GM5A 2XS1A 3AG3C 2EPNA 3C62A 4DRHB 2GDCA 2ZXRA 4KBLA 4MTGA 5COGA 3S9OA 5KYUB 1LI5A 3HNLA 1PV3A 2IM8A 3FHDA 3LEVA 3S27A 2KJGA 2BE5F 3RYLA 2DI3A 3M79A 4MW8A 2XL4A 3POVA 4DVYP 2HUJA 4IWBA 5A6BA 3RVZA 3EG9B 4IAOA 2AWCA 2RSEB 5IY5C 4N06A 4QI2A 1Q0KA 1RJ9A 1G8XA 2DYRC 2OKUA 1MMDA 4XPYA 2PX3A 2L6HA 4J30B 3W4YA 1MMGA 1T6IA 2EPOA 2TMVP 2A0BA 3GM1A 2MWQA 1ZHXA 2IOQA 1M57C 2P1AA 1A7EA 4PR9A 4YT4A 3RQGA 2UUIA 1FNTc 4XQ1A 1G4US 3EZIA 2Y3DA 4A2NB 3ZIBA 1RXQA 2J7PD 4C7OB 4RD9A 5CI9A 2OCCC 2WVOA 2Y69C 3L1MA 2LK4A 5KYYB 4OIQF 2FGYA 2AWYA 2JPUA 2H7OA 4CS7A 5JSLA 4AL0A 4G7ZF 2VASA 5JT4A 2IXPA 5L0CA 3R7CA 3A11A 1HY5A 1N1CA 4MVZA 3OEOA 2B0HA 2CGEA 2YL3A 3FDQA 3EHMA 1O3UA 2P6VA 3EFOA 2L6FA 3U2MA 1ZHTA 4PJNA 4MVSA 1H6GA 3DI5A 1H9GA 3LLKA 4CS9A 3V5XA 4CS9C 3JYHA 4XEVA 5E2QA 3RQEA 4C3EA 3B0VC 5L0IA 1G4WR 2XS8A 4MVQA 3DAFA 3C8GD 3VRCA 2VCBA 2C03A 3MBGA 4NC3A 3RF3A 1K40A 4PFPA 3SXYA 4YL3A 3LS1A 2HZ8A 2Y3HA 4AL1A 1YZCA 1ZW3A 4Q7CA 3TQOA 4CJOA 1YJGA 1TQGA 4FESA 2UUHA 3B29A 4HEAJ 1BDJB 2QLAA 1YA7O 4OIRF 1QKRA 1PD0A 1LE2A 2YL7A 4LDKA 2JD3A 3S0XA 1HE9A 5L0JA 3AGUA 1V74B 1E2XA 2YZSA 2R25A 2R7OA 4JTCB 4PK4A 1M2VB 3JYYA 4E7SA 1FMVA 4CSAA 3B0PA 4CSAC 3WAQA 5D92A 1Z23A 1VK5A 2ASRA 2PFDA 3GM3A 1FR0A 2KNHA 1LIHA 2NUTB 3ZQYA 3PMRA 2X51A 1NU9C 3NRHA 1V54C 3A9CA 1K05A 1I4ZA 3G4XA 2JX0A 2HV7A 3BRJA 1CGNA 3ITFA 3TOLA 2WVNA 4QDLA 3VYWA 1EI7A 1RKEA 4EBKA 3Q7GA 3KMIA 5HV9A 1OXKA 1ST6A 2ZD9A 3LEOA 4ONSA 5F5HA 3KL4A 4DXWA 4AX2A 3L0IA 1A0BA 4JURI 4DJ9A 1BR2A 2PF4E 3U5SA 3IPMO 1D1CA 5T1DB 3J06A 3IQ5A 3GODA 4JW1A 4XWJA 1NBBA 3MFNA 1T5OA 2NUPA 2D5RB 4HE8D 1CGOA 2VC9A 2ETSA 4DOZA 1YA9A 4LERA 4MS2A 3ZWIA 3TJ6A 1NZEA 2Z15A 3OWTA 4KC9A 4MW3A 1HW1A 1FTSA 2W4MA 4DVZA 1WTYA 3ZSUA 4CS8A 3AQCA 1D0YA 2AVKA 1WOLA 2C04A 2HKVA 1A7DA 5B1AC 2QY9A 2YL1A 3NYJA 3ZTZA 4KNVA 4U5DE 4YWQA 4JTDB 1Q0GA 4QI0A 1CPRA 1TWGA 3HLZA 1HMDA 4EHPA 4Q4ZF 5KYXB 5B1BC 4CIHA 3Q7LA 3FMSA 3GWNA 4OD5A 3T6JA 4U5BE 2J9WA 4EBJA 4ER9A 1NU7D 3IHUA 4MTOA 5D91A 2Q3TA 4LLCA 2EIJC 1VOMA 1QSPA 1IZMA 5L0GA 3CZ6A 4P9FA 5JUAA 4NTAA 2YLIA 1D1BA 3FAJA 3JTLO 4O7GA 4U5HA 5BQHA 1YYJA 3JZ0A 1WATA 1U6HA 3LLIA 2P7VA 1V55C 3I4UA 3JSEO 4LLEA 3DXJF 3H2UA 2R03A 1MQVA 4JC7A 1QQ3A 1QPUA 2YWAA 3NYLA 1RJ9B 2EIKC 2V26A 3WODF 1KTMA 2YHSA 3ASNC 5DS4A 1Y4CA 1MMNA 4G7HF 3PCVA 3O55A 4Z9IA 3S84A 1TFKB 1NLXA 3AGTA 4J32B 5JS5A 2HJMA 2YLGA 2XXAB 4JEBA 5DS5A 3DMDA 4W8PA 2W9YA 2IBFA 2QTVA 2J8WA 4IJJA 3F46A 3K6BA 2HFIA 1OW8A 2BC5A 1H9TA 4BPMA 3CSKA 1WASA 2DGJA 3K1IA 2PNOA 2L9JA 3K1IC 3T6GB 4CX9A 4GYTA 1PD1A 3EGDA 5CIVA 2YQYA 3Q6MA 2VCAA 2KQ9A 3BEHA 3CAXA 3G50A 4YL0A 3W8HA 4HFKB 1SMYF 1W2WA 2XLDA 1LVKA 4N4WA 4NTFA 5KYUA 2AU5A 2OOCA 1B68A 1OKKA 2DB4A 3DM9B 3QW1A 4JKVA 1YDIA 2CDQA 3DAGA 2HSBA 1JMWA 1OW7A 4I1MA 3RFYA 4BJTA 3JRTA 2HS5A 2QNLA 3ZVRA 1BZ4A 3OA1A 1E85A 2YL0A 3RQFA 1E84A 4WJ0A 1RKCA 2WZLA 1KU2A 1VLTA 3C8ZA 3LUTB 3ZQVA 3U3BA 4E18A 4UDVA 2OU6A 2XLHA 4BJ6A 2LFFA 4BJ6C 1M6TA 4XLNF 1LE4A 1OCRC 2D4UA 4KNWA 5DVWA 1FAPB 1APCA 1H7IA 2L7AA 3UMKA 1M2OA 4MVOA 3V7OA 2ZXPA 3NKEA 1D0ZA 4GEHA 4FX5A 3WHNA 1UG7A 4O6YA 4XEKA 4C7OA 2H7VC 4G7OF 1FMWA 5KYYA 1OR3A 2XLEA 1GQAA 2G3KA 2IYLD 3HNIA 2XRHA 3W8IA 3HTKC 4FWVA 3MYFA 5BQIA 1NG1A 2LQGA 3RIPA 1ZU5A 3UMIA 4CJGA 2ZXWC 1L7CA 3EJNA 1HW2A 2EILC 3KKBA 3TJ5A 1NFNA 1F1MA 3CQZA 2R7TA 3EGXA 4CDVA 3DM5A 1VYIA 2QUPA 1MNDA 2NPUA 1ZU4A 1XZPA 4PFOA 4HFFB 1EA8A 5B3IA 1PCXA 1BBHA 1Q0MA 3TOMA 2J45A 3K7DA 3QMKA 3GWLA 4BEJA 2A6HF 1T6UA 1LS1A 1Z63A 1QLEC 2RD9A 4DRJB 2XLOA 2J9BA 2R02A
chains in the Genus database with same CATH topology
1BR4A 1VMAA 4AK9A 4JJFA 3S29A 3LNRA 1J8YF 4AE4B 2EINC 3LAYA 3SNHA 4P6IC 1M56C 2A69F 4PJLA 4ULWA 5T3TA 1VYKA 4YN0B 3SZRA 5KYWB 1TR2A 2J7PA 2WZGA 3S0XA 4O79A 2R7RA 3UGOA 1M2VA 1OCZC 3ABKC 4C3DA 2MYSA 3LESA 1J8MF 2NUTA 3N2ZB 3W2WA 1SF8A 1Z5ZA 2DYSC 1OCOC 3LS0A 4OIOF 3SYNA 3HJCA 1MNEA 3AG2C 4H4KC 2IXMA 3UNGC 4YT8A 1Z3IX 2HV6A 4BG0A 3F47A 4YT2A 2W45A 3UR3C 4YT5A 3W2VA 5DS6A 2EIMC 4OINF 3O39A 4NY3A 4XLPF 5E3AA 2WVQA 5EGYA 3T4RA 1Z6AA 3DD7A 2ZXOA 4BJ1A 4W8KA 5E33A 3DZAA 3ABLC 3PHF2 3UMHA 2V3CC 4JVSA 3X2QC 3AG1C 4M63A 2KGOA 3JSZA 2CNWA 5KYXA 3IEEA 3S28A 5HSWA 1O5HA 2R7XA 4I3MA 2J46A 1MMAA 2OG2A 3SEOA 2IXOA 2J0WA 2WB7A 4CBEA 4JCHA 4K0DA 1ZYRF 3NYMA 3N0TA 2J9UA 2ZPAA 2Y39A 5DLJA 3EFOB 1ZHWA 4XTKA 5T3WA 4I1OB 3EG9A 3EHNA 3B9QA 4EBBA 3EQLF 4I44A 4O6NA 4MQ9F 2XXAA 3EH2A 3N24A 5L3QA 5E3CA 4DBRA 1D0XA 1TWCA 2H7BA 2R7UA 4ZLDA 2WL8A 2PX0A 3RKOF 3K66A 3GANA 2L81A 2VB6A 1FFTC 4U5EE 1IW7F 2G62A 3EGXB 3AQBA 1ZHYA 3FVYA 2J0XA 4JJGA 3ECSA 4JZAA 2R7VA 4Q5SF 3H65A 3X1OA 4K7BA 2CW0F 2Y3GA 3DJUB 2G3VA 2GFHA 3QZCA 3ZC4A 2FFHA 2Q9CA 3NKDA 2E87A 1TWHA 4EWCA 3K1HA 3NDBB 3LJBA 4X0RA 2KW3C 1OCCC 1TWAA 4O6MA 4LACB 3ABMC 4PJMA 4RBNA 4KI2A 3DJNB 4U5FE 4JW1A 2B0JA 1TKNA 2LSEA 3I5PA 2PP4A 5CI8A 3UGPA 2R7SA 1JPNA 2NG1A 4BJ5A 4BJ5C 4U5GA 1ZHZA 3E70C 4RDAA 3SP1A 3B0UX 1D1AA 1LKXA 2R7WA 2NUPB 2R7QA 3RH3A 3ZG1A 4DBQA 2CNWD 2XSEA 5F5FA 1QZXA 5B3SC 1JPJA 3K33A 3NG1A 1WGWA 2A6EF 1S7ZA 3EZHA 2I8BA 2IXNA 1BR1A 4AE4A 3TD7A 1FFHA 3WG7C 2W4BA 4G0HA 5L3VA 1OKKD 2O9XA 3VAYA 3JCUQ 4MNDA 5KYWA 3L34A 4YJWA 5BUOA 5DQZA 3KH2A 2M4EA 3MLGA 4IRUA 2J9VA 1SZIA 2Q9BA 4C3BA 3I5QA 2YEVA 4CS8C 4B6IA 5KYNA 3M1CB 2A1DD 4U5CE 3JT1A 4OD4A 3EPVA 2Y3BA 3Q6NA 5FCLA 5DQTA 4ZLCA 3AG4C 4E7ZA 3MX3A 5EHHA 2Q9AA 2A68F 3E9VA 1O87A 3EH1A 4OIPF 4F4BA 3O6XA 3ASOC 4PJJA 2VH3A 3EGDB 4ANJA 2WZFA 3T6BA 3AG3C 2ZXRA 4KBLA 5KYUB 3LEVA 3FHDA 3S27A 2KJGA 2BE5F 3RYLA 2XL4A 3POVA 4IWBA 3EG9B 4IAOA 5IY5C 4QI2A 4N06A 1RJ9A 1G8XA 2DYRC 1MMDA 2PX3A 4J30B 1MMGA 2MWQA 1ZHXA 2IOQA 1M57C 4YT4A 3EZIA 2Y3DA 4A2NB 3ZIBA 2J7PD 4C7OB 4RD9A 5CI9A 2OCCC 2WVOA 2Y69C 5KYYB 4OIQF 2FGYA 4CS7A 2H7OA 4G7ZF 2VASA 2IXPA 1N1CA 3OEOA 2CGEA 3FDQA 3EHMA 2P6VA 3EFOA 1ZHTA 4PJNA 3LLKA 4CS9A 4CS9C 3JYHA 5E2QA 4C3EA 3B0VC 3DAFA 2C03A 4PFPA 3LS1A 2Y3HA 4Q7CA 4FESA 4HEAJ 4OIRF 1PD0A 2JD3A 2YZSA 2R7OA 4PK4A 1M2VB 4E7SA 1FMVA 4CSAA 3B0PA 4CSAC 5D92A 1Z23A 1VK5A 2PFDA 2KNHA 2NUTB 3PMRA 2X51A 1NU9C 3NRHA 1V54C 2HV7A 3ITFA 2WVNA 4QDLA 3VYWA 3Q7GA 3KMIA 1ST6A 5F5HA 3KL4A 4AX2A 3L0IA 4JURI 1BR2A 2PF4E 1D1CA 5T1DB 3GODA 4XWJA 2NUPA 2D5RB 4HE8D 4DOZA 4LERA 1NZEA 2Z15A 3OWTA 4KC9A 2W4MA 1FTSA 4DVZA 3ZSUA 4CS8A 3AQCA 1D0YA 2C04A 5B1AC 2QY9A 3NYJA 4KNVA 4U5DE 4YWQA 4QI0A 1TWGA 3HLZA 4Q4ZF 5KYXB 5B1BC 4CIHA 3Q7LA 4OD5A 3T6JA 4U5BE 2J9WA 1NU7D 5D91A 2Q3TA 4LLCA 2EIJC 1VOMA 1IZMA 3CZ6A 4U5HA 1D1BA 3FAJA 4O7GA 3LLIA 2P7VA 1V55C 3I4UA 4LLEA 4DVYP 3DXJF 3WODF 3NYLA 1RJ9B 2EIKC 2V26A 2YHSA 3ASNC 5DS4A 1MMNA 4G7HF 4J32B 2XXAB 5DS5A 3DMDA 2W9YA 2QTVA 4IJJA 3F46A 3K6BA 3CSKA 2DGJA 3K1IC 2L9JA 4GYTA 1PD1A 3EGDA 3Q6MA 3W8HA 2KQ9A 4HFKB 1SMYF 1W2WA 1LVKA 5KYUA 1OKKA 3DM9B 2CDQA 3DAGA 3RFYA 4I1MA 4BJTA 3JRTA 3ZVRA 3OA1A 4WJ0A 2WZLA 1KU2A 4BJ6A 4BJ6C 4XLNF 1OCRC 4KNWA 5DVWA 3UMKA 1M2OA 3V7OA 2ZXPA 3NKEA 1D0ZA 4GEHA 4FX5A 4O6YA 4C7OA 4G7OF 2H7VC 1FMWA 5KYYA 2IYLD 2G3KA 2XRHA 3W8IA 3HTKC 4FWVA 1NG1A 3RIPA 1ZU5A 3UMIA 2ZXWC 3EJNA 2EILC 3KKBA 2R7TA 3CQZA 3EGXA 3DM5A 1VYIA 1MNDA 1ZU4A 4PFOA 4HFFB 1PCXA 2J45A 3K7DA 3QMKA 4BEJA 2A6HF 1LS1A 1Z63A 1QLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  1VYI A;  2WZL A; 
#chains in the Genus database with same CATH topology
 1BR4 A;  1VMA A;  5L0H A;  1RMV A;  4AK9 A;  4JJF A;  5JRA A;  3LNM B;  3S29 A;  1LS4 A;  3LNR A;  1J8Y F;  1K04 A;  4AE4 B;  2EIN C;  3LAY A;  1YAU O;  3SNH A;  1DOW A;  1Q0F A;  4P6I C;  1M56 C;  2HSQ A;  2A69 F;  4PJL A;  1E86 A;  1T6Q A;  4ULW A;  5T3T A;  1SYQ A;  1VYK A;  4YN0 B;  3SZR A;  1V4A A;  4D4N A;  4D4X A;  2OQM A;  1TR2 A;  5KYW B;  2J7P A;  1OQC A;  2F22 A;  2EPL X;  2GAQ A;  2WZG A;  4PAC A;  1I5N A;  3B71 A;  5A6B D;  4JEA A;  4JTA B;  4O79 A;  3VM6 A;  2R7R A;  1C17 M;  3UGO A;  5AC5 A;  1M2V A;  1OW6 A;  3GOR A;  3IQT A;  1OCZ C;  3ABK C;  1OR2 A;  3T9O A;  1YLM A;  4C3D A;  4R32 A;  2MYS A;  2OEV A;  3LES A;  1J8M F;  2NUT A;  3N2Z B;  3W2W A;  2LFD A;  5A6K A;  3U0C A;  1SF8 A;  1NFO A;  1Z5Z A;  2DYS C;  2YRF A;  1OCO C;  3C7J A;  4ULV A;  3LS0 A;  3DKA A;  4OIO F;  3SYN A;  4YL1 A;  2EPM X;  3HJC A;  1MNE A;  1ZVZ A;  1EKY A;  3AG2 C;  1JRA A;  2H8A A;  4IAR A;  1Z7Q c;  4H4K C;  1WN0 A;  5EK0 A;  2IXM A;  3UNG C;  4YT8 A;  1CPQ A;  2XLM A;  2M64 A;  1WWP A;  1ORS C;  1ZW2 A;  1Z3I X;  2HV6 A;  2KK1 A;  3R2P A;  4BG0 A;  4P9T A;  3C8G A;  3F47 A;  3L8I A;  4G78 A;  4YT2 A;  2XLW A;  2W45 A;  3QVZ A;  4WAB A;  5AGF A;  2XL8 A;  3UR3 C;  4YT5 A;  3IQ6 A;  3W2V A;  3JRM O;  2EIM C;  5DS6 A;  1C02 A;  4JRZ A;  3O39 A;  4GQH A;  4MTF A;  1ZZP A;  4OIN F;  1EQ1 A;  4NY3 A;  4XLP F;  4LDR A;  5COF A;  1ORY A;  2WVQ A;  1AEP A;  5E3A A;  5EGY A;  3T4R A;  1Z6A A;  2Q7R A;  3DD7 A;  2ZXO A;  5JP7 A;  4W8K A;  4BJ1 A;  2PBE A;  3FOO A;  2GWW A;  3DZA A;  4U9E A;  5E33 A;  4IB4 A;  3U9J A;  4LDQ A;  5GPG B;  1A41 A;  1DOV A;  1RCP A;  3GEE A;  4E17 A;  1NSG B;  3ABL C;  3C63 A;  3RW0 A;  3UMH A;  5JLI A;  3PHF 2;  2V3C C;  4JVS A;  3FAP B;  3AG1 C;  4M63 A;  3X2Q C;  4EKW A;  2R9R B;  1JAF A;  2EPK X;  1ORJ A;  2KGO A;  3JSZ A;  2L6G A;  1GS9 A;  2CNW A;  3QVY A;  5KYX A;  3IEE A;  3ZTM A;  4BEM J;  1LPE A;  3U2L A;  1E83 A;  2CYD A;  2XLV A;  3IQC A;  5F28 E;  2HJ3 A;  3S28 A;  1O5H A;  5HSW A;  2R7X A;  2YKZ A;  2J46 A;  1I4Y A;  1SR2 A;  4I3M A;  3M15 A;  1MMA A;  3RVY A;  4K1O A;  1LI7 A;  1Y6D A;  2OG2 A;  3QW0 A;  1JR8 A;  2HMZ A;  3GEI A;  3SEO A;  3G4Z A;  2IXO A;  5L0D A;  2J0W A;  4JCZ A;  2WB7 A;  4CBE A;  4JCH A;  4K0D A;  3U8V A;  3H2V A;  1ZYR F;  3NYM A;  2P61 A;  3N0T A;  2J9U A;  4JIO A;  2ZPA A;  2Y39 A;  5DLJ A;  4DRI B;  3EFO B;  1AUE A;  1XWJ A;  1ZHW A;  4XTK A;  4I1O B;  5T3W A;  3EG9 A;  3EHN A;  3B9Q A;  3NMI A;  2LD6 A;  4EBB A;  3EQL F;  1C03 A;  4I44 A;  4O6N A;  4MQ9 F;  2LIG A;  2XL6 A;  2XXA A;  3EH2 A;  3NMK A;  3FXH A;  3N24 A;  3NMJ A;  1VTM P;  5L3Q A;  2YVK A;  5E3C A;  4DBR A;  1D0X A;  3L8J A;  1R5I D;  3U8P A;  1TWC A;  2H7B A;  3M4C A;  2R7U A;  4ZLD A;  4J7Y A;  1LM3 B;  2WL8 A;  2PX0 A;  2X0C A;  3RKO F;  3DE8 A;  3K66 A;  3GAN A;  4XEF A;  5AC4 A;  2L81 A;  5A6A A;  4E0H A;  1T01 A;  2VB6 A;  1L3P A;  3U9M A;  4XPX A;  1FFT C;  4U5E E;  1IW7 F;  2G62 A;  3KPH A;  3EGX B;  3AQB A;  1ZHY A;  3FVY A;  3U3F A;  2J0X A;  3AOU A;  3ECS A;  4JJG A;  4JZA A;  4A4A A;  4Q5S F;  3H65 A;  4NTB A;  2R7V A;  3X1O A;  4IAQ A;  4K7B A;  2CW0 F;  1OXB A;  2Y3G A;  1QVX A;  3DJU B;  2G3V A;  4L6R A;  3GM2 A;  2GFH A;  3QZC A;  2R05 A;  4MVR A;  4Z9H A;  3ZC4 A;  2FFH A;  2Q9C A;  3NKD A;  1YAR O;  2E87 A;  3SXZ A;  4E0I A;  2P0N A;  3US6 A;  1VLS A;  1TWH A;  4JE9 A;  2KC3 A;  3K1H A;  4CDY A;  3V5Y A;  4EWC A;  3NDB B;  3LJB A;  2FAP B;  3KYI A;  4X0R A;  3ZDL A;  2KW3 C;  4H54 A;  1OCC C;  5COM A;  5K0I A;  1TWA A;  3GEH A;  1RKE B;  3AJM A;  4O6M A;  1U89 A;  4LAC B;  1GGQ A;  2HMQ A;  4CIP A;  3SXK A;  3ABM C;  3S90 A;  1Q0D A;  4PJM A;  3HNJ A;  4RBN A;  3PDM P;  2OEX A;  4KI2 A;  3TUL A;  3DJN B;  4U5F E;  2AP3 A;  1YZA A;  1TKN A;  2B0J A;  2LSE A;  2PP4 A;  2Q4F A;  3FOP A;  3I5P A;  2LCH A;  5CI8 A;  3TK0 A;  3UGP A;  1JPN A;  2R7S A;  4EIY A;  2NG1 A;  3MYI A;  2LP4 A;  3O10 A;  4IGG A;  4U5G A;  1ZHZ A;  2CCY A;  3E70 C;  4RDA A;  3SP1 A;  4BJ5 C;  5A6J A;  3B0U X;  1D1A A;  1A7V A;  1LKX A;  2NUP B;  2R7Q A;  3RH3 A;  1HE1 A;  4N6H A;  2R7W A;  1U0B B;  3ZG1 A;  3DE9 A;  4DBQ A;  2CNW D;  2OJQ A;  2OJE D;  1T9K A;  2XSE A;  5F5F A;  1QZX A;  1YYX A;  5B3S C;  1XZQ A;  4CDA A;  1JPJ A;  1JOG A;  1VB5 A;  2Q00 A;  2XM4 A;  3K33 A;  3NG1 A;  5TJ5 E;  1WGW A;  4MVM A;  4EUK B;  2A6E F;  1S7Z A;  3EZH A;  2I8B A;  4FAP B;  256B A;  2IXN A;  1BR1 A;  4AE4 A;  2ICW G;  3TD7 A;  4XPW A;  1FFH A;  2A0U A;  2VCC A;  2I15 A;  2W4B A;  4J7T A;  3WG7 C;  4G0H A;  5L3V A;  1OKK D;  3C8G B;  5L0F A;  2O9X A;  3VAY A;  3JCU Q;  4MND A;  5KYW A;  3L34 A;  4YJW A;  1S05 A;  3QTH A;  1HMO A;  5BUO A;  3DWW A;  5DQZ A;  3KH2 A;  2M4E A;  3MLG A;  4IRU A;  2J9V A;  1SZI A;  2BL2 A;  4MVU A;  2NSF A;  2Q9B A;  4C3B A;  3HKK A;  3I5Q A;  3V5Z A;  2YEV A;  4WGZ A;  4WGY A;  2KYH A;  4B6I A;  4CS8 C;  5KYN A;  4N6C A;  1AVO B;  3M4B A;  2KSF A;  2MHR A;  3ATP A;  2A1D D;  3KYJ A;  3M1C B;  5BQG A;  5A69 A;  3HNK A;  4U5C E;  4Z9J A;  3JT1 A;  2XM0 A;  4OD4 A;  3VF0 A;  1R4T A;  3EPV A;  3CEX A;  2Y3B A;  3Q6N A;  4YK5 A;  5FCL A;  2QE9 A;  1CGM E;  3C18 A;  2NSG A;  2YLD A;  4NQF A;  5DQT A;  4BJ5 A;  4ZLC A;  3AG4 C;  4E7Z A;  3MX3 A;  4U9D A;  5EHH A;  1TFO B;  2Q9A A;  4NCQ A;  2A68 F;  2GA0 A;  1YVI A;  3SXM A;  3E9V A;  5JVE A;  1O87 A;  3EH1 A;  4OIP F;  1UFB A;  4F4B A;  3O6X A;  3ASO C;  4PJJ A;  2VH3 A;  5FZT A;  3EGD B;  4ANJ A;  1G5Z A;  2WZF A;  3T6B A;  1KNY A;  1GM5 A;  2XS1 A;  3AG3 C;  2EPN A;  3C62 A;  4DRH B;  2GDC A;  2ZXR A;  4KBL A;  4MTG A;  5COG A;  3S9O A;  5KYU B;  1LI5 A;  3HNL A;  1PV3 A;  2IM8 A;  3FHD A;  3LEV A;  3S27 A;  2KJG A;  2BE5 F;  3RYL A;  2DI3 A;  3M79 A;  4MW8 A;  2XL4 A;  3POV A;  4DVY P;  2HUJ A;  4IWB A;  5A6B A;  3RVZ A;  3EG9 B;  4IAO A;  2AWC A;  2RSE B;  5IY5 C;  4N06 A;  4QI2 A;  1Q0K A;  1RJ9 A;  1G8X A;  2DYR C;  2OKU A;  1MMD A;  4XPY A;  2PX3 A;  2L6H A;  4J30 B;  3W4Y A;  1MMG A;  1T6I A;  2EPO A;  2TMV P;  2A0B A;  3GM1 A;  2MWQ A;  1ZHX A;  2IOQ A;  1M57 C;  2P1A A;  1A7E A;  4PR9 A;  4YT4 A;  3RQG A;  2UUI A;  1FNT c;  4XQ1 A;  1G4U S;  3EZI A;  2Y3D A;  4A2N B;  3ZIB A;  1RXQ A;  2J7P D;  4C7O B;  4RD9 A;  5CI9 A;  2OCC C;  2WVO A;  2Y69 C;  3L1M A;  2LK4 A;  5KYY B;  4OIQ F;  2FGY A;  2AWY A;  2JPU A;  2H7O A;  4CS7 A;  5JSL A;  4AL0 A;  4G7Z F;  2VAS A;  5JT4 A;  2IXP A;  5L0C A;  3R7C A;  3A11 A;  1HY5 A;  1N1C A;  4MVZ A;  3OEO A;  2B0H A;  2CGE A;  2YL3 A;  3FDQ A;  3EHM A;  1O3U A;  2P6V A;  3EFO A;  2L6F A;  3U2M A;  1ZHT A;  4PJN A;  4MVS A;  1H6G A;  3DI5 A;  1H9G A;  3LLK A;  4CS9 A;  3V5X A;  4CS9 C;  3JYH A;  4XEV A;  5E2Q A;  3RQE A;  4C3E A;  3B0V C;  5L0I A;  1G4W R;  2XS8 A;  4MVQ A;  3DAF A;  3C8G D;  3VRC A;  2VCB A;  2C03 A;  3MBG A;  4NC3 A;  3RF3 A;  1K40 A;  4PFP A;  3SXY A;  4YL3 A;  3LS1 A;  2HZ8 A;  2Y3H A;  4AL1 A;  1YZC A;  1ZW3 A;  4Q7C A;  3TQO A;  4CJO A;  1YJG A;  1TQG A;  4FES A;  2UUH A;  3B29 A;  4HEA J;  1BDJ B;  2QLA A;  1YA7 O;  4OIR F;  1QKR A;  1PD0 A;  1LE2 A;  2YL7 A;  4LDK A;  2JD3 A;  3S0X A;  1HE9 A;  5L0J A;  3AGU A;  1V74 B;  1E2X A;  2YZS A;  2R25 A;  2R7O A;  4JTC B;  4PK4 A;  1M2V B;  3JYY A;  4E7S A;  1FMV A;  4CSA A;  3B0P A;  4CSA C;  3WAQ A;  5D92 A;  1Z23 A;  1VK5 A;  2ASR A;  2PFD A;  3GM3 A;  1FR0 A;  2KNH A;  1LIH A;  2NUT B;  3ZQY A;  3PMR A;  2X51 A;  1NU9 C;  3NRH A;  1V54 C;  3A9C A;  1K05 A;  1I4Z A;  3G4X A;  2JX0 A;  2HV7 A;  3BRJ A;  1CGN A;  3ITF A;  3TOL A;  2WVN A;  4QDL A;  3VYW A;  1EI7 A;  1RKE A;  4EBK A;  3Q7G A;  3KMI A;  5HV9 A;  1OXK A;  1ST6 A;  2ZD9 A;  3LEO A;  4ONS A;  5F5H A;  3KL4 A;  4DXW A;  4AX2 A;  3L0I A;  1A0B A;  4JUR I;  4DJ9 A;  1BR2 A;  2PF4 E;  3U5S A;  3IPM O;  1D1C A;  5T1D B;  3J06 A;  3IQ5 A;  3GOD A;  4JW1 A;  4XWJ A;  1NBB A;  3MFN A;  1T5O A;  2NUP A;  2D5R B;  4HE8 D;  1CGO A;  2VC9 A;  2ETS A;  4DOZ A;  1YA9 A;  4LER A;  4MS2 A;  3ZWI A;  3TJ6 A;  1NZE A;  2Z15 A;  3OWT A;  4KC9 A;  4MW3 A;  1HW1 A;  1FTS A;  2W4M A;  4DVZ A;  1WTY A;  3ZSU A;  4CS8 A;  3AQC A;  1D0Y A;  2AVK A;  1WOL A;  2C04 A;  2HKV A;  1A7D A;  5B1A C;  2QY9 A;  2YL1 A;  3NYJ A;  3ZTZ A;  4KNV A;  4U5D E;  4YWQ A;  4JTD B;  1Q0G A;  4QI0 A;  1CPR A;  1TWG A;  3HLZ A;  1HMD A;  4EHP A;  4Q4Z F;  5KYX B;  5B1B C;  4CIH A;  3Q7L A;  3FMS A;  3GWN A;  4OD5 A;  3T6J A;  4U5B E;  2J9W A;  4EBJ A;  4ER9 A;  1NU7 D;  3IHU A;  4MTO A;  5D91 A;  2Q3T A;  4LLC A;  2EIJ C;  1VOM A;  1QSP A;  1IZM A;  5L0G A;  3CZ6 A;  4P9F A;  5JUA A;  4NTA A;  2YLI A;  1D1B A;  3FAJ A;  3JTL O;  4O7G A;  4U5H A;  5BQH A;  1YYJ A;  3JZ0 A;  1WAT A;  1U6H A;  3LLI A;  2P7V A;  1V55 C;  3I4U A;  3JSE O;  4LLE A;  3DXJ F;  3H2U A;  2R03 A;  1MQV A;  4JC7 A;  1QQ3 A;  1QPU A;  2YWA A;  3NYL A;  1RJ9 B;  2EIK C;  2V26 A;  3WOD F;  1KTM A;  2YHS A;  3ASN C;  5DS4 A;  1Y4C A;  1MMN A;  4G7H F;  3PCV A;  3O55 A;  4Z9I A;  3S84 A;  1TFK B;  1NLX A;  3AGT A;  4J32 B;  5JS5 A;  2HJM A;  2YLG A;  2XXA B;  4JEB A;  5DS5 A;  3DMD A;  4W8P A;  2W9Y A;  2IBF A;  2QTV A;  2J8W A;  4IJJ A;  3F46 A;  3K6B A;  2HFI A;  1OW8 A;  2BC5 A;  1H9T A;  4BPM A;  3CSK A;  1WAS A;  2DGJ A;  3K1I A;  2PNO A;  2L9J A;  3K1I C;  3T6G B;  4CX9 A;  4GYT A;  1PD1 A;  3EGD A;  5CIV A;  2YQY A;  3Q6M A;  2VCA A;  2KQ9 A;  3BEH A;  3CAX A;  3G50 A;  4YL0 A;  3W8H A;  4HFK B;  1SMY F;  1W2W A;  2XLD A;  1LVK A;  4N4W A;  4NTF A;  5KYU A;  2AU5 A;  2OOC A;  1B68 A;  1OKK A;  2DB4 A;  3DM9 B;  3QW1 A;  4JKV A;  1YDI A;  2CDQ A;  3DAG A;  2HSB A;  1JMW A;  1OW7 A;  4I1M A;  3RFY A;  4BJT A;  3JRT A;  2HS5 A;  2QNL A;  3ZVR A;  1BZ4 A;  3OA1 A;  1E85 A;  2YL0 A;  3RQF A;  1E84 A;  4WJ0 A;  1RKC A;  2WZL A;  1KU2 A;  1VLT A;  3C8Z A;  3LUT B;  3ZQV A;  3U3B A;  4E18 A;  4UDV A;  2OU6 A;  2XLH A;  4BJ6 A;  2LFF A;  4BJ6 C;  1M6T A;  4XLN F;  1LE4 A;  1OCR C;  2D4U A;  4KNW A;  5DVW A;  1FAP B;  1APC A;  1H7I A;  2L7A A;  3UMK A;  1M2O A;  4MVO A;  3V7O A;  2ZXP A;  3NKE A;  1D0Z A;  4GEH A;  4FX5 A;  3WHN A;  1UG7 A;  4O6Y A;  4XEK A;  4C7O A;  2H7V C;  4G7O F;  1FMW A;  5KYY A;  1OR3 A;  2XLE A;  1GQA A;  2G3K A;  2IYL D;  3HNI A;  2XRH A;  3W8I A;  3HTK C;  4FWV A;  3MYF A;  5BQI A;  1NG1 A;  2LQG A;  3RIP A;  1ZU5 A;  3UMI A;  4CJG A;  2ZXW C;  1L7C A;  3EJN A;  1HW2 A;  2EIL C;  3KKB A;  3TJ5 A;  1NFN A;  1F1M A;  3CQZ A;  2R7T A;  3EGX A;  4CDV A;  3DM5 A;  1VYI A;  2QUP A;  1MND A;  2NPU A;  1ZU4 A;  1XZP A;  4PFO A;  4HFF B;  1EA8 A;  5B3I A;  1PCX A;  1BBH A;  1Q0M A;  3TOM A;  2J45 A;  3K7D A;  3QMK A;  3GWL A;  4BEJ A;  2A6H F;  1T6U A;  1LS1 A;  1Z63 A;  1QLE C;  2RD9 A;  4DRJ B;  2XLO A;  2J9B A;  2R02 A; 
#chains in the Genus database with same CATH homology
 1BR4 A;  1VMA A;  4AK9 A;  4JJF A;  3S29 A;  3LNR A;  1J8Y F;  4AE4 B;  2EIN C;  3LAY A;  3SNH A;  4P6I C;  1M56 C;  2A69 F;  4PJL A;  4ULW A;  5T3T A;  1VYK A;  4YN0 B;  3SZR A;  5KYW B;  1TR2 A;  2J7P A;  2WZG A;  3S0X A;  4O79 A;  2R7R A;  3UGO A;  1M2V A;  1OCZ C;  3ABK C;  4C3D A;  2MYS A;  3LES A;  1J8M F;  2NUT A;  3N2Z B;  3W2W A;  1SF8 A;  1Z5Z A;  2DYS C;  1OCO C;  3LS0 A;  4OIO F;  3SYN A;  3HJC A;  1MNE A;  3AG2 C;  4H4K C;  2IXM A;  3UNG C;  4YT8 A;  1Z3I X;  2HV6 A;  4BG0 A;  3F47 A;  4YT2 A;  2W45 A;  3UR3 C;  4YT5 A;  3W2V A;  5DS6 A;  2EIM C;  4OIN F;  3O39 A;  4NY3 A;  4XLP F;  5E3A A;  2WVQ A;  5EGY A;  3T4R A;  1Z6A A;  3DD7 A;  2ZXO A;  4BJ1 A;  4W8K A;  5E33 A;  3DZA A;  3ABL C;  3PHF 2;  3UMH A;  2V3C C;  4JVS A;  3X2Q C;  3AG1 C;  4M63 A;  2KGO A;  3JSZ A;  2CNW A;  5KYX A;  3IEE A;  3S28 A;  5HSW A;  1O5H A;  2R7X A;  4I3M A;  2J46 A;  1MMA A;  2OG2 A;  3SEO A;  2IXO A;  2J0W A;  2WB7 A;  4CBE A;  4JCH A;  4K0D A;  1ZYR F;  3NYM A;  3N0T A;  2J9U A;  2ZPA A;  2Y39 A;  5DLJ A;  3EFO B;  1ZHW A;  4XTK A;  5T3W A;  4I1O B;  3EG9 A;  3EHN A;  3B9Q A;  4EBB A;  3EQL F;  4I44 A;  4O6N A;  4MQ9 F;  2XXA A;  3EH2 A;  3N24 A;  5L3Q A;  5E3C A;  4DBR A;  1D0X A;  1TWC A;  2H7B A;  2R7U A;  4ZLD A;  2WL8 A;  2PX0 A;  3RKO F;  3K66 A;  3GAN A;  2L81 A;  2VB6 A;  1FFT C;  4U5E E;  1IW7 F;  2G62 A;  3EGX B;  3AQB A;  1ZHY A;  3FVY A;  2J0X A;  4JJG A;  3ECS A;  4JZA A;  2R7V A;  4Q5S F;  3H65 A;  3X1O A;  4K7B A;  2CW0 F;  2Y3G A;  3DJU B;  2G3V A;  2GFH A;  3QZC A;  3ZC4 A;  2FFH A;  2Q9C A;  3NKD A;  2E87 A;  1TWH A;  4EWC A;  3K1H A;  3NDB B;  3LJB A;  4X0R A;  2KW3 C;  1OCC C;  1TWA A;  4O6M A;  4LAC B;  3ABM C;  4PJM A;  4RBN A;  4KI2 A;  3DJN B;  4U5F E;  4JW1 A;  2B0J A;  1TKN A;  2LSE A;  3I5P A;  2PP4 A;  5CI8 A;  3UGP A;  2R7S A;  1JPN A;  2NG1 A;  4BJ5 A;  4BJ5 C;  4U5G A;  1ZHZ A;  3E70 C;  4RDA A;  3SP1 A;  3B0U X;  1D1A A;  1LKX A;  2R7W A;  2NUP B;  2R7Q A;  3RH3 A;  3ZG1 A;  4DBQ A;  2CNW D;  2XSE A;  5F5F A;  1QZX A;  5B3S C;  1JPJ A;  3K33 A;  3NG1 A;  1WGW A;  2A6E F;  1S7Z A;  3EZH A;  2I8B A;  2IXN A;  1BR1 A;  4AE4 A;  3TD7 A;  1FFH A;  3WG7 C;  2W4B A;  4G0H A;  5L3V A;  1OKK D;  2O9X A;  3VAY A;  3JCU Q;  4MND A;  5KYW A;  3L34 A;  4YJW A;  5BUO A;  5DQZ A;  3KH2 A;  2M4E A;  3MLG A;  4IRU A;  2J9V A;  1SZI A;  2Q9B A;  4C3B A;  3I5Q A;  2YEV A;  4CS8 C;  4B6I A;  5KYN A;  3M1C B;  2A1D D;  4U5C E;  3JT1 A;  4OD4 A;  3EPV A;  2Y3B A;  3Q6N A;  5FCL A;  5DQT A;  4ZLC A;  3AG4 C;  4E7Z A;  3MX3 A;  5EHH A;  2Q9A A;  2A68 F;  3E9V A;  1O87 A;  3EH1 A;  4OIP F;  4F4B A;  3O6X A;  3ASO C;  4PJJ A;  2VH3 A;  3EGD B;  4ANJ A;  2WZF A;  3T6B A;  3AG3 C;  2ZXR A;  4KBL A;  5KYU B;  3LEV A;  3FHD A;  3S27 A;  2KJG A;  2BE5 F;  3RYL A;  2XL4 A;  3POV A;  4IWB A;  3EG9 B;  4IAO A;  5IY5 C;  4QI2 A;  4N06 A;  1RJ9 A;  1G8X A;  2DYR C;  1MMD A;  2PX3 A;  4J30 B;  1MMG A;  2MWQ A;  1ZHX A;  2IOQ A;  1M57 C;  4YT4 A;  3EZI A;  2Y3D A;  4A2N B;  3ZIB A;  2J7P D;  4C7O B;  4RD9 A;  5CI9 A;  2OCC C;  2WVO A;  2Y69 C;  5KYY B;  4OIQ F;  2FGY A;  4CS7 A;  2H7O A;  4G7Z F;  2VAS A;  2IXP A;  1N1C A;  3OEO A;  2CGE A;  3FDQ A;  3EHM A;  2P6V A;  3EFO A;  1ZHT A;  4PJN A;  3LLK A;  4CS9 A;  4CS9 C;  3JYH A;  5E2Q A;  4C3E A;  3B0V C;  3DAF A;  2C03 A;  4PFP A;  3LS1 A;  2Y3H A;  4Q7C A;  4FES A;  4HEA J;  4OIR F;  1PD0 A;  2JD3 A;  2YZS A;  2R7O A;  4PK4 A;  1M2V B;  4E7S A;  1FMV A;  4CSA A;  3B0P A;  4CSA C;  5D92 A;  1Z23 A;  1VK5 A;  2PFD A;  2KNH A;  2NUT B;  3PMR A;  2X51 A;  1NU9 C;  3NRH A;  1V54 C;  2HV7 A;  3ITF A;  2WVN A;  4QDL A;  3VYW A;  3Q7G A;  3KMI A;  1ST6 A;  5F5H A;  3KL4 A;  4AX2 A;  3L0I A;  4JUR I;  1BR2 A;  2PF4 E;  1D1C A;  5T1D B;  3GOD A;  4XWJ A;  2NUP A;  2D5R B;  4HE8 D;  4DOZ A;  4LER A;  1NZE A;  2Z15 A;  3OWT A;  4KC9 A;  2W4M A;  1FTS A;  4DVZ A;  3ZSU A;  4CS8 A;  3AQC A;  1D0Y A;  2C04 A;  5B1A C;  2QY9 A;  3NYJ A;  4KNV A;  4U5D E;  4YWQ A;  4QI0 A;  1TWG A;  3HLZ A;  4Q4Z F;  5KYX B;  5B1B C;  4CIH A;  3Q7L A;  4OD5 A;  3T6J A;  4U5B E;  2J9W A;  1NU7 D;  5D91 A;  2Q3T A;  4LLC A;  2EIJ C;  1VOM A;  1IZM A;  3CZ6 A;  4U5H A;  1D1B A;  3FAJ A;  4O7G A;  3LLI A;  2P7V A;  1V55 C;  3I4U A;  4LLE A;  4DVY P;  3DXJ F;  3WOD F;  3NYL A;  1RJ9 B;  2EIK C;  2V26 A;  2YHS A;  3ASN C;  5DS4 A;  1MMN A;  4G7H F;  4J32 B;  2XXA B;  5DS5 A;  3DMD A;  2W9Y A;  2QTV A;  4IJJ A;  3F46 A;  3K6B A;  3CSK A;  2DGJ A;  3K1I C;  2L9J A;  4GYT A;  1PD1 A;  3EGD A;  3Q6M A;  3W8H A;  2KQ9 A;  4HFK B;  1SMY F;  1W2W A;  1LVK A;  5KYU A;  1OKK A;  3DM9 B;  2CDQ A;  3DAG A;  3RFY A;  4I1M A;  4BJT A;  3JRT A;  3ZVR A;  3OA1 A;  4WJ0 A;  2WZL A;  1KU2 A;  4BJ6 A;  4BJ6 C;  4XLN F;  1OCR C;  4KNW A;  5DVW A;  3UMK A;  1M2O A;  3V7O A;  2ZXP A;  3NKE A;  1D0Z A;  4GEH A;  4FX5 A;  4O6Y A;  4C7O A;  4G7O F;  2H7V C;  1FMW A;  5KYY A;  2IYL D;  2G3K A;  2XRH A;  3W8I A;  3HTK C;  4FWV A;  1NG1 A;  3RIP A;  1ZU5 A;  3UMI A;  2ZXW C;  3EJN A;  2EIL C;  3KKB A;  2R7T A;  3CQZ A;  3EGX A;  3DM5 A;  1VYI A;  1MND A;  1ZU4 A;  4PFO A;  4HFF B;  1PCX A;  2J45 A;  3K7D A;  3QMK A;  4BEJ A;  2A6H F;  1LS1 A;  1Z63 A;  1QLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...