4BPMA

Crystal structure of a human integral membrane enzyme
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE, FUSION PEPTIDE
total genus 66
structure length 162
sequence length 162
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4bpmA00
2Q7RA 3HKKA 3LEOA 5K0IA 3B29A 3DWWA 3PCVA 4JRZA 4JC7A 4NTAA 4YK5A 5BQGA 4J7YA 4JCZA 2PNOA 4YL3A 4AL1A 4J7TA 5BQHA 4NTBA 5BQIA 4BPMA 2UUHA 2UUIA 2H8AA 4AL0A 5HV9A 4YL1A 4YL0A 4NTFA 4WABA
chains in the Genus database with same CATH superfamily
3JT1A 1D0YA 3LLKA 3B0VC 2KJGA 1FMWA 3ITFA 4PR9A 3RYLA 4OINF 3VYWA 5KYYA 2KGOA 2ZXPA 4OD5A 2EPLX 4P9TA 1HMOA 3LJBA 3ASNC 4PJMA 3L1MA 3A11A 4U5CE 4E7ZA 4CIPA 5HSWA 5E33A 1D0XA 1VYKA 2NPUA 2O9XA 2HFIA 4CJOA 3UMHA 2LQGA 2XLDA 5DVWA 1LIHA 3PDMP 3MYFA 1TWCA 3DI5A 3EJNA 4NTBA 2XXAA 1D1CA 2EIKC 5JP7A 3K6BA 1JRAA 3ZDLA 3L0IA 2Z15A 4R32A 5HV9A 1V55C 2WB7A 1G4US 2VASA 4JCHA 3IQ5A 1QKRA 4A4AA 3ZQYA 2W9YA 2XLOA 3B0PA 1NBBA 1NU7D 3POVA 2QY9A 3AJMA 3NG1A 1MNDA 3UGOA 1NFOA 2VCBA 4CS9C 3E9VA 3TULA 3G4XA 4MVMA 2HJ3A 4CSAC 5D91A 3DD7A 4XPYA 1JR8A 3ZSUA 5COGA 1M2VB 3S28A 1E2XA 2I8BA 4CDYA 2JX0A 2OU6A 4NY3A 4IRUA 4U5BE 3N0TA 3N24A 3NMKA 3BRJA 1ZU5A 4LERA 4XQ1A 3QW0A 4NCQA 1UG7A 4MW8A 4JURI 2YWAA 2A6EF 2HZ8A 3M4CA 1R4TA 1S05A 2A0BA 2FFHA 1Z6AA 4BEJA 1TKNA 3RW0A 3PHF2 1ZHXA 4KI2A 2C04A 2OKUA 4YL0A 1SMYF 3TD7A 2CDQA 2WZLA 1YLMA 1JPNA 4EKWA 2R7SA 2YQYA 2R03A 2BE5F 2MYSA 1OCCC 1OCRC 1YZCA 1YYXA 4IB4A 3B29A 3WHNA 2M64A 1TWHA 2G3VA 4XLNF 4WGYA 3CZ6A 4JW1A 4Z9HA 2LFDA 2J0XA 4BJ6A 2EIMC 3EGDA 3LLIA 2J45A 1FAPB 1HE9A 3M1CB 3QZCA 4JEAA 1U6HA 1TWGA 4O7GA 3ZIBA 1Q0DA 1QQ3A 1WGWA 1LM3B 1ORSC 1SZIA 3ABKC 4IARA 2JD3A 1D1BA 5AC4A 4JVSA 3K33A 3ABLC 2Y39A 2EINC 3H2UA 2OEXA 3JRMO 3IEEA 4H54A 4BG0A 5BQHA 2KNHA 1H9GA 1APCA 4GEHA 3V5ZA 1VLTA 4JKVA 2L6HA 3MBGA 4AL0A 2EPKX 4JJFA 4CS8A 2A6HF 1BR4A 1U89A 2J9WA 4G0HA 4N4WA 4KNWA 4ANJA 1R5ID 3S84A 2P1AA 1ZZPA 5K0IA 4YN0B 3U0CA 1FNTc 3L8IA 2VH3A 3T4RA 3LESA 4ULWA 2PBEA 1MMGA 1WN0A 2J9VA 3Q7GA 2Q9AA 4MVSA 3SXMA 1E85A 256BA 5EK0A 2P61A 5FZTA 3B0UX 4MTFA 5B3IA 4CIHA 2AP3A 2ZD9A 3KYJA 3ZWIA 1YA7O 4ZLCA 2KW3C 2PF4E 1B68A 4YWQA 2R9RB 1VTMP 4YT2A 3LS0A 3CSKA 4XEVA 3AGTA 1A7DA 1V4AA 4DRHB 3JRTA 3KL4A 1A41A 2ICWG 1V54C 2P6VA 3GM3A 4YT5A 4EIYA 4LLEA 2HV6A 1E83A 3DM5A 4IWBA 3RVZA 4E17A 1ZVZA 1D0ZA 2IXNA 1IW7F 3DE9A 4U5GA 3DJNB 3VF0A 4DJ9A 2OJQA 3RKOF 4OIQF 2KQ9A 4O6NA 3JTLO 3S0XA 3T6JA 3B71A 2AWYA 4HEAJ 3RQGA 2XXAB 3EFOB 4XPWA 1QZXA 2LK4A 3FAJA 2IXMA 4J7YA 4BEMJ 2YL1A 3GANA 3H2VA 4G78A 3AG2C 2M4EA 3SP1A 3G50A 1NZEA 4C7OA 1TR2A 1OW6A 1ORYA 2A1DD 2VC9A 3IQTA 4M63A 4MVOA 4U5EE 5T3WA 3TOMA 1PCXA 2PX0A 3U5SA 2FAPB 4GQHA 4XPXA 2OJED 2Q9CA 3LUTB 2NUPB 3UGPA 2VCAA 2X51A 3FOPA 2EPNA 1SR2A 5EGYA 4X0RA 2DI3A 3GWNA 3JSEO 3CAXA 2KC3A 3IHUA 1YYJA 1SYQA 3O6XA 3RQFA 2AWCA 5A6JA 1E86A 1GGQA 1BR1A 3Q6NA 2H7VC 2KYHA 1WWPA 3EGXB 1NG1A 3CQZA 3C8GB 4NQFA 2Q3TA 1G8XA 5E2QA 1FTSA 1YARO 1MNEA 2YEVA 5CI8A 5FCLA 2XS1A 3WAQA 2RSEB 3SXKA 1OR3A 3QMKA 1ZHWA 3KPHA 1KU2A 3UR3C 1Z63A 2ETSA 3U3BA 3V5XA 2GWWA 4E0HA 4ULVA 5JLIA 3GM1A 1LE4A 1A7EA 4BJ5A 1A7VA 5JT4A 1OW7A 1VOMA 2YKZA 2WZFA 3FXHA 3ZG1A 2LP4A 2V3CC 3WG7C 3GWLA 2R7TA 1N1CA 4LDKA 2OQMA 3HNLA 4Q5SF 1A0BA 2ASRA 2C03A 3EPVA 3OEOA 2Y3HA 2H7OA 3F47A 1G5ZA 4MS2A 4PACA 4CBEA 5L0IA 4EBJA 1OQCA 2W45A 5E3CA 1M2VA 4YL3A 3TOLA 2BC5A 1ZW3A 1SF8A 2R25A 1I4ZA 3NKDA 4O79A 3TQOA 4C3EA 5CIVA 1RJ9A 4CX9A 3OA1A 1RMVA 1RKEA 3IPMO 5L0DA 1ST6A 2CGEA 3SXZA 1MMAA 4LLCA 3ZTMA 5F5FA 3E70C 1YJGA 1NFNA 3JZ0A 2EIJC 4YL1A 1YAUO 2H7BA 3QVYA 5L0GA 4WABA 1JPJA 3C18A 4OIRF 2J46A 2CYDA 2XM0A 2DB4A 2ZPAA 3G4ZA 1JMWA 3KMIA 4JIOA 4U9DA 2TMVP 3M15A 2YZSA 4BJ6C 1HW1A 2XLVA 2L9JA 2XS8A 3MX3A 3NYLA 4RBNA 3NDBB 4NC3A 3QW1A 3RIPA 3VRCA 2R7WA 2EPOA 3OWTA 3Q7LA 1WOLA 1DOVA 1ZYRF 3BEHA 4FWVA 3U9MA 3U8PA 2FGYA 1EKYA 5KYYB 3EGDB 4OIOF 2J7PD 3K66A 3ASOC 1C02A 2PP4A 4DXWA 4O6YA 5AC5A 5B3SC 3SNHA 2OOCA 5IY5C 1M6TA 5A69A 4KC9A 1I5NA 2VCCA 1YDIA 3DAGA 5JUAA 1EA8A 2G62A 5KYWB 4OIPF 3KH2A 4JTDB 3J06A 3LNRA 3UMKA 3S90A 1WASA 4DVYP 1VB5A 1VLSA 2PX3A 3FAPB 3IQCA 3EFOA 3K1HA 3V5YA 4E7SA 2D4UA 4MVUA 4WJ0A 2QNLA 3EQLF 1T6QA 2J9UA 5L0JA 4PFPA 3X2QC 2E87A 1LVKA 2WVQA 2XM4A 1KNYA 4MNDA 5AGFA 2L6GA 2LD6A 2XSEA 5COMA 5F5HA 4NTAA 4MQ9F 5DQZA 2XL8A 1I4YA 5KYXB 5DS5A 2CW0F 1OCZC 1LI5A 2Y69C 4YK5A 2R7VA 2CCYA 4PJJA 1M56C 5KYUB 2J0WA 2XLEA 1PD1A 1H7IA 5B1AC 4MVRA 3AGUA 3DJUB 1BR2A 1W2WA 1ZHTA 4IAOA 2EPMX 4Z9JA 1E84A 3DE8A 3GEEA 1Q0GA 4N6CA 3WODF 4JJGA 1YZAA 3DKAA 4ER9A 3EG9B 5T1DB 3L8JA 3EGXA 1U0BB 2I15A 1DOWA 2RD9A 4JTCB 1TFKB 1MQVA 3U2MA 3DMDA 4JE9A 3DAFA 4Q4ZF 4N06A 1CGME 3LEVA 2KSFA 4FESA 3W8IA 5L0HA 1Q0KA 3NYJA 1MMNA 1QLEC 2HMQA 2OG2A 3X1OA 4ZLDA 5F28E 5DS6A 1BZ4A 1ZU4A 2B0HA 4JC7A 2R7QA 1XZQA 4XTKA 2IOQA 2G3KA 3U2LA 3HLZA 1LPEA 5A6BD 3AG4C 3GEIA 3W2WA 2Y3BA 5CI9A 3LS1A 1RCPA 3AQBA 4CDAA 5L3QA 4XLPF 1CPQA 2HSBA 1C17M 1Z7Qc 2X0CA 4AE4B 3VM6A 1TFOB 1K04A 3K1IA 4D4NA 2GFHA 4PJLA 2HS5A 1LKXA 3I5PA 2HUJA 1RKCA 2J9BA 1QPUA 4LDQA 3RQEA 5JS5A 4QI2A 2CNWD 2WVOA 3VAYA 4DVZA 3JYHA 3ATPA 4K1OA 2W4BA 2Q7RA 2WVNA 4IJJA 2QUPA 1PV3A 3C63A 5KYNA 1RJ9B 1V74B 2L7AA 2YL7A 2YHSA 4HE8D 1PD0A 1OR2A 3HJCA 1RXQA 2YLGA 1HMDA 3AQCA 3C8GA 3S29A 2PNOA 5COFA 4AL1A 2XRHA 3ZQVA 2NUTB 3FHDA 4PFOA 1T6UA 3RFYA 4P9FA 2HSQA 3FVYA 1QSPA 1FMVA 2HV7A 4I3MA 4WGZA 1OCOC 4BPMA 5BQIA 3DXJF 3DZAA 1HY5A 2ZXRA 2WL8A 4CDVA 1LE2A 3A9CA 4H4KC 3JSZA 3H65A 2R02A 2R7RA 1YA9A 1BDJB 2Y3DA 2IBFA 4GYTA 1F1MA 1CGOA 2OCCC 3KYIA 3W8HA 5D92A 2IXOA 4JZAA 4U5FE 1T5OA 1Y4CA 2YL0A 2D5RB 1H9TA 1KTMA 4IGGA 1CPRA 2YLIA 1UFBA 2EILC 2Q4FA 3MFNA 4FX5A 4C3BA 3M79A 4YT8A 2XLMA 3W4YA 3HTKC 5KYWA 1T9KA 3NMJA 3I4UA 3UMIA 2LCHA 1BBHA 3DM9B 5BUOA 1NLXA 2B0JA 3U8VA 3SXYA 4W8KA 2NSGA 3FOOA 4I1OB 1IZMA 2L81A 3L34A 2XLHA 2ZXOA 4MTOA 3GODA 2LFFA 3EHMA 1RKEB 2NSFA 2IYLD 1J8MF 3MLGA 2OEVA 4K7BA 2WZGA 3JCUQ 3I5QA 3O10A 3Q6MA 2F22A 2HMZA 1H6GA 4A2NB 2PFDA 4NTFA 4IAQA 4MW3A 3EH1A 2J8WA 2JPUA 3C8ZA 3LEOA 2YRFA 3GORA 4OD4A 4DBQA 4FAPB 4U9EA 3EZIA 1LI7A 3C7JA 3PCVA 3K7DA 4MTGA 2VB6A 1AUEA 1XZPA 3KKBA 1AEPA 2MHRA 1T6IA 2V26A 4Q7CA 2P0NA 3EH2A 2NG1A 4CS9A 1Y6DA 4CSAA 1EI7A 5T3TA 2J7PA 4RDAA 5B1BC 4UDVA 1OW8A 4CS8C 1J8YF 1T01A 1S7ZA 2L6FA 1O5HA 4DOZA 3U9JA 2IM8A 4QI0A 1VMAA 3QTHA 2DGJA 2AVKA 4F4BA 3ABMC 1Q0FA 2CNWA 1OXBA 1O3UA 1ZHYA 4J32B 4XEKA 5JRAA 3RH3A 4AX2A 5JVEA 3M4BA 3R2PA 1ORJA 1M57C 3T9OA 4J30B 1HE1A 1LS4A 2P7VA 3FMSA 3HKKA 4E0IA 1NU9C 2HJMA 2XLWA 1D1AA 2Y3GA 4PJNA 3DWWA 3T6GB 2Q9BA 3NMIA 3JYYA 4XEFA 4DRIB 2R7XA 3S27A 2QE9A 2GA0A 3NKEA 3U3FA 2QTVA 1Q0MA 3UNGC 5GPGB 4ONSA 2MWQA 4AK9A 2YL3A 5KYXA 3NRHA 4JCZA 1TWAA 4HFKB 3ZTZA 5L0FA 4G7OF 3RF3A 4J7TA 3LAYA 4I44A 4EBKA 2YLDA 5KYUA 3SYNA 3ZC4A 1GM5A 1HW2A 3HNKA 1QVXA 4I1MA 2HKVA 4EHPA 4YT4A 1G4WR 3US6A 3SEOA 2UUHA 4CS7A 3EHNA 3LNMB 4EWCA 3GEHA 4MVQA 4BJ1A 2W4MA 2BL2A 1VK5A 1ZHZA 3IQ6A 3V7OA 5A6KA 3EG9A 1XWJA 3ECSA 1JOGA 1ZW2A 2QLAA 5L0CA 4U5DE 4XWJA 3F46A 3FDQA 3EZHA 4BJTA 4W8PA 2NUTA 2YVKA 4MVZA 3O55A 2AU5A 3RVYA 1CGNA 5A6BA 1VYIA 4EUKB 1TQGA 4U5HA 1JAFA 4LACB 1C03A 5L3VA 3K1IC 1WTYA 4PK4A 1FFHA 2LIGA 4DBRA 4L6RA 1Z23A 1L3PA 1L7CA 4Z9IA 3S9OA 5EHHA 2H8AA 2A0UA 3HNJA 4JTAB 4AE4A 4CJGA 4E18A 4HFFB 3ZVRA 1M2OA 1K05A 3GM2A 3NYMA 1MMDA 4B6IA 1FR0A 4N6HA 4K0DA 1NSGB 2A69F 2XL4A 3W2VA 5DS4A 2R7OA 4P6IC 3CEXA 5JSLA 3TJ6A 1LS1A 3HNIA 4JEBA 4D4XA 4YJWA 1O87A 3O39A 1WATA 3B9QA 5A6AA 2GAQA 2IXPA 4JRZA 1Z5ZA 4G7HF 2XL6A 1AVOB 5DLJA 2Q00A 5BQGA 2A68F 1GS9A 3MYIA 3QVZA 3PMRA 2LSEA 4DRJB 4C7OB 4KNVA 1OKKD 5DQTA 2R7UA 1Z3IX 2ZXWC 4EBBA 3R7CA 4BJ5C 1OKKA 2DYRC 1K40A 1FFTC 3AG3C 4C3DA 3AG1C 3TK0A 4KBLA 3T6BA 2NUPA 2UUIA 3C8GD 2DYSC 3TJ5A 4G7ZF 3SZRA 4RD9A 1OXKA 2KK1A 1YVIA 5TJ5E 3AOUA 4O6MA 3N2ZB 1GQAA 5E3AA 1EQ1A 2R05A 2GDCA 4LDRA 4QDLA 3C62A
chains in the Genus database with same CATH topology
2Q7RA 3HKKA 3LEOA 5K0IA 3B29A 3DWWA 3PCVA 4JRZA 4JC7A 4NTAA 4YK5A 5BQGA 4J7YA 4JCZA 2PNOA 4YL3A 4AL1A 4J7TA 5BQHA 4NTBA 5BQIA 4BPMA 2UUHA 2UUIA 2H8AA 4AL0A 5HV9A 4YL1A 4YL0A 4NTFA 4WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7R A;  3HKK A;  3LEO A;  5K0I A;  3B29 A;  3DWW A;  3PCV A;  4JRZ A;  4JC7 A;  4NTA A;  4YK5 A;  5BQG A;  4J7Y A;  4JCZ A;  2PNO A;  4YL3 A;  4AL1 A;  4J7T A;  5BQH A;  4NTB A;  5BQI A;  4BPM A;  2UUH A;  2UUI A;  2H8A A;  4AL0 A;  5HV9 A;  4YL1 A;  4YL0 A;  4NTF A;  4WAB A; 
#chains in the Genus database with same CATH topology
 3JT1 A;  1D0Y A;  3LLK A;  3B0V C;  2KJG A;  1FMW A;  3ITF A;  4PR9 A;  3RYL A;  4OIN F;  3VYW A;  5KYY A;  2KGO A;  2ZXP A;  4OD5 A;  2EPL X;  4P9T A;  1HMO A;  3LJB A;  3ASN C;  4PJM A;  3L1M A;  3A11 A;  4U5C E;  4E7Z A;  4CIP A;  5HSW A;  5E33 A;  1D0X A;  1VYK A;  2NPU A;  2O9X A;  2HFI A;  4CJO A;  3UMH A;  2LQG A;  2XLD A;  5DVW A;  1LIH A;  3PDM P;  3MYF A;  1TWC A;  3DI5 A;  3EJN A;  4NTB A;  2XXA A;  1D1C A;  2EIK C;  5JP7 A;  3K6B A;  1JRA A;  3ZDL A;  3L0I A;  2Z15 A;  4R32 A;  5HV9 A;  1V55 C;  2WB7 A;  1G4U S;  2VAS A;  4JCH A;  3IQ5 A;  1QKR A;  4A4A A;  3ZQY A;  2W9Y A;  2XLO A;  3B0P A;  1NBB A;  1NU7 D;  3POV A;  2QY9 A;  3AJM A;  3NG1 A;  1MND A;  3UGO A;  1NFO A;  2VCB A;  4CS9 C;  3E9V A;  3TUL A;  3G4X A;  4MVM A;  2HJ3 A;  4CSA C;  5D91 A;  3DD7 A;  4XPY A;  1JR8 A;  3ZSU A;  5COG A;  1M2V B;  3S28 A;  1E2X A;  2I8B A;  4CDY A;  2JX0 A;  2OU6 A;  4NY3 A;  4IRU A;  4U5B E;  3N0T A;  3N24 A;  3NMK A;  3BRJ A;  1ZU5 A;  4LER A;  4XQ1 A;  3QW0 A;  4NCQ A;  1UG7 A;  4MW8 A;  4JUR I;  2YWA A;  2A6E F;  2HZ8 A;  3M4C A;  1R4T A;  1S05 A;  2A0B A;  2FFH A;  1Z6A A;  4BEJ A;  1TKN A;  3RW0 A;  3PHF 2;  1ZHX A;  4KI2 A;  2C04 A;  2OKU A;  4YL0 A;  1SMY F;  3TD7 A;  2CDQ A;  2WZL A;  1YLM A;  1JPN A;  4EKW A;  2R7S A;  2YQY A;  2R03 A;  2BE5 F;  2MYS A;  1OCC C;  1OCR C;  1YZC A;  1YYX A;  4IB4 A;  3B29 A;  3WHN A;  2M64 A;  1TWH A;  2G3V A;  4XLN F;  4WGY A;  3CZ6 A;  4JW1 A;  4Z9H A;  2LFD A;  2J0X A;  4BJ6 A;  2EIM C;  3EGD A;  3LLI A;  2J45 A;  1FAP B;  1HE9 A;  3M1C B;  3QZC A;  4JEA A;  1U6H A;  1TWG A;  4O7G A;  3ZIB A;  1Q0D A;  1QQ3 A;  1WGW A;  1LM3 B;  1ORS C;  1SZI A;  3ABK C;  4IAR A;  2JD3 A;  1D1B A;  5AC4 A;  4JVS A;  3K33 A;  3ABL C;  2Y39 A;  2EIN C;  3H2U A;  2OEX A;  3JRM O;  3IEE A;  4H54 A;  4BG0 A;  5BQH A;  2KNH A;  1H9G A;  1APC A;  4GEH A;  3V5Z A;  1VLT A;  4JKV A;  2L6H A;  3MBG A;  4AL0 A;  2EPK X;  4JJF A;  4CS8 A;  2A6H F;  1BR4 A;  1U89 A;  2J9W A;  4G0H A;  4N4W A;  4KNW A;  4ANJ A;  1R5I D;  3S84 A;  2P1A A;  1ZZP A;  5K0I A;  4YN0 B;  3U0C A;  1FNT c;  3L8I A;  2VH3 A;  3T4R A;  3LES A;  4ULW A;  2PBE A;  1MMG A;  1WN0 A;  2J9V A;  3Q7G A;  2Q9A A;  4MVS A;  3SXM A;  1E85 A;  256B A;  5EK0 A;  2P61 A;  5FZT A;  3B0U X;  4MTF A;  5B3I A;  4CIH A;  2AP3 A;  2ZD9 A;  3KYJ A;  3ZWI A;  1YA7 O;  4ZLC A;  2KW3 C;  2PF4 E;  1B68 A;  4YWQ A;  2R9R B;  1VTM P;  4YT2 A;  3LS0 A;  3CSK A;  4XEV A;  3AGT A;  1A7D A;  1V4A A;  4DRH B;  3JRT A;  3KL4 A;  1A41 A;  2ICW G;  1V54 C;  2P6V A;  3GM3 A;  4YT5 A;  4EIY A;  4LLE A;  2HV6 A;  1E83 A;  3DM5 A;  4IWB A;  3RVZ A;  4E17 A;  1ZVZ A;  1D0Z A;  2IXN A;  1IW7 F;  3DE9 A;  4U5G A;  3DJN B;  3VF0 A;  4DJ9 A;  2OJQ A;  3RKO F;  4OIQ F;  2KQ9 A;  4O6N A;  3JTL O;  3S0X A;  3T6J A;  3B71 A;  2AWY A;  4HEA J;  3RQG A;  2XXA B;  3EFO B;  4XPW A;  1QZX A;  2LK4 A;  3FAJ A;  2IXM A;  4J7Y A;  4BEM J;  2YL1 A;  3GAN A;  3H2V A;  4G78 A;  3AG2 C;  2M4E A;  3SP1 A;  3G50 A;  1NZE A;  4C7O A;  1TR2 A;  1OW6 A;  1ORY A;  2A1D D;  2VC9 A;  3IQT A;  4M63 A;  4MVO A;  4U5E E;  5T3W A;  3TOM A;  1PCX A;  2PX0 A;  3U5S A;  2FAP B;  4GQH A;  4XPX A;  2OJE D;  2Q9C A;  3LUT B;  2NUP B;  3UGP A;  2VCA A;  2X51 A;  3FOP A;  2EPN A;  1SR2 A;  5EGY A;  4X0R A;  2DI3 A;  3GWN A;  3JSE O;  3CAX A;  2KC3 A;  3IHU A;  1YYJ A;  1SYQ A;  3O6X A;  3RQF A;  2AWC A;  5A6J A;  1E86 A;  1GGQ A;  1BR1 A;  3Q6N A;  2H7V C;  2KYH A;  1WWP A;  3EGX B;  1NG1 A;  3CQZ A;  3C8G B;  4NQF A;  2Q3T A;  1G8X A;  5E2Q A;  1FTS A;  1YAR O;  1MNE A;  2YEV A;  5CI8 A;  5FCL A;  2XS1 A;  3WAQ A;  2RSE B;  3SXK A;  1OR3 A;  3QMK A;  1ZHW A;  3KPH A;  1KU2 A;  3UR3 C;  1Z63 A;  2ETS A;  3U3B A;  3V5X A;  2GWW A;  4E0H A;  4ULV A;  5JLI A;  3GM1 A;  1LE4 A;  1A7E A;  4BJ5 A;  1A7V A;  5JT4 A;  1OW7 A;  1VOM A;  2YKZ A;  2WZF A;  3FXH A;  3ZG1 A;  2LP4 A;  2V3C C;  3WG7 C;  3GWL A;  2R7T A;  1N1C A;  4LDK A;  2OQM A;  3HNL A;  4Q5S F;  1A0B A;  2ASR A;  2C03 A;  3EPV A;  3OEO A;  2Y3H A;  2H7O A;  3F47 A;  1G5Z A;  4MS2 A;  4PAC A;  4CBE A;  5L0I A;  4EBJ A;  1OQC A;  2W45 A;  5E3C A;  1M2V A;  4YL3 A;  3TOL A;  2BC5 A;  1ZW3 A;  1SF8 A;  2R25 A;  1I4Z A;  3NKD A;  4O79 A;  3TQO A;  4C3E A;  5CIV A;  1RJ9 A;  4CX9 A;  3OA1 A;  1RMV A;  1RKE A;  3IPM O;  5L0D A;  1ST6 A;  2CGE A;  3SXZ A;  1MMA A;  4LLC A;  3ZTM A;  5F5F A;  3E70 C;  1YJG A;  1NFN A;  3JZ0 A;  2EIJ C;  4YL1 A;  1YAU O;  2H7B A;  3QVY A;  5L0G A;  4WAB A;  1JPJ A;  3C18 A;  4OIR F;  2J46 A;  2CYD A;  2XM0 A;  2DB4 A;  2ZPA A;  3G4Z A;  1JMW A;  3KMI A;  4JIO A;  4U9D A;  2TMV P;  3M15 A;  2YZS A;  4BJ6 C;  1HW1 A;  2XLV A;  2L9J A;  2XS8 A;  3MX3 A;  3NYL A;  4RBN A;  3NDB B;  4NC3 A;  3QW1 A;  3RIP A;  3VRC A;  2R7W A;  2EPO A;  3OWT A;  3Q7L A;  1WOL A;  1DOV A;  1ZYR F;  3BEH A;  4FWV A;  3U9M A;  3U8P A;  2FGY A;  1EKY A;  5KYY B;  3EGD B;  4OIO F;  2J7P D;  3K66 A;  3ASO C;  1C02 A;  2PP4 A;  4DXW A;  4O6Y A;  5AC5 A;  5B3S C;  3SNH A;  2OOC A;  5IY5 C;  1M6T A;  5A69 A;  4KC9 A;  1I5N A;  2VCC A;  1YDI A;  3DAG A;  5JUA A;  1EA8 A;  2G62 A;  5KYW B;  4OIP F;  3KH2 A;  4JTD B;  3J06 A;  3LNR A;  3UMK A;  3S90 A;  1WAS A;  4DVY P;  1VB5 A;  1VLS A;  2PX3 A;  3FAP B;  3IQC A;  3EFO A;  3K1H A;  3V5Y A;  4E7S A;  2D4U A;  4MVU A;  4WJ0 A;  2QNL A;  3EQL F;  1T6Q A;  2J9U A;  5L0J A;  4PFP A;  3X2Q C;  2E87 A;  1LVK A;  2WVQ A;  2XM4 A;  1KNY A;  4MND A;  5AGF A;  2L6G A;  2LD6 A;  2XSE A;  5COM A;  5F5H A;  4NTA A;  4MQ9 F;  5DQZ A;  2XL8 A;  1I4Y A;  5KYX B;  5DS5 A;  2CW0 F;  1OCZ C;  1LI5 A;  2Y69 C;  4YK5 A;  2R7V A;  2CCY A;  4PJJ A;  1M56 C;  5KYU B;  2J0W A;  2XLE A;  1PD1 A;  1H7I A;  5B1A C;  4MVR A;  3AGU A;  3DJU B;  1BR2 A;  1W2W A;  1ZHT A;  4IAO A;  2EPM X;  4Z9J A;  1E84 A;  3DE8 A;  3GEE A;  1Q0G A;  4N6C A;  3WOD F;  4JJG A;  1YZA A;  3DKA A;  4ER9 A;  3EG9 B;  5T1D B;  3L8J A;  3EGX A;  1U0B B;  2I15 A;  1DOW A;  2RD9 A;  4JTC B;  1TFK B;  1MQV A;  3U2M A;  3DMD A;  4JE9 A;  3DAF A;  4Q4Z F;  4N06 A;  1CGM E;  3LEV A;  2KSF A;  4FES A;  3W8I A;  5L0H A;  1Q0K A;  3NYJ A;  1MMN A;  1QLE C;  2HMQ A;  2OG2 A;  3X1O A;  4ZLD A;  5F28 E;  5DS6 A;  1BZ4 A;  1ZU4 A;  2B0H A;  4JC7 A;  2R7Q A;  1XZQ A;  4XTK A;  2IOQ A;  2G3K A;  3U2L A;  3HLZ A;  1LPE A;  5A6B D;  3AG4 C;  3GEI A;  3W2W A;  2Y3B A;  5CI9 A;  3LS1 A;  1RCP A;  3AQB A;  4CDA A;  5L3Q A;  4XLP F;  1CPQ A;  2HSB A;  1C17 M;  1Z7Q c;  2X0C A;  4AE4 B;  3VM6 A;  1TFO B;  1K04 A;  3K1I A;  4D4N A;  2GFH A;  4PJL A;  2HS5 A;  1LKX A;  3I5P A;  2HUJ A;  1RKC A;  2J9B A;  1QPU A;  4LDQ A;  3RQE A;  5JS5 A;  4QI2 A;  2CNW D;  2WVO A;  3VAY A;  4DVZ A;  3JYH A;  3ATP A;  4K1O A;  2W4B A;  2Q7R A;  2WVN A;  4IJJ A;  2QUP A;  1PV3 A;  3C63 A;  5KYN A;  1RJ9 B;  1V74 B;  2L7A A;  2YL7 A;  2YHS A;  4HE8 D;  1PD0 A;  1OR2 A;  3HJC A;  1RXQ A;  2YLG A;  1HMD A;  3AQC A;  3C8G A;  3S29 A;  2PNO A;  5COF A;  4AL1 A;  2XRH A;  3ZQV A;  2NUT B;  3FHD A;  4PFO A;  1T6U A;  3RFY A;  4P9F A;  2HSQ A;  3FVY A;  1QSP A;  1FMV A;  2HV7 A;  4I3M A;  4WGZ A;  1OCO C;  4BPM A;  5BQI A;  3DXJ F;  3DZA A;  1HY5 A;  2ZXR A;  2WL8 A;  4CDV A;  1LE2 A;  3A9C A;  4H4K C;  3JSZ A;  3H65 A;  2R02 A;  2R7R A;  1YA9 A;  1BDJ B;  2Y3D A;  2IBF A;  4GYT A;  1F1M A;  1CGO A;  2OCC C;  3KYI A;  3W8H A;  5D92 A;  2IXO A;  4JZA A;  4U5F E;  1T5O A;  1Y4C A;  2YL0 A;  2D5R B;  1H9T A;  1KTM A;  4IGG A;  1CPR A;  2YLI A;  1UFB A;  2EIL C;  2Q4F A;  3MFN A;  4FX5 A;  4C3B A;  3M79 A;  4YT8 A;  2XLM A;  3W4Y A;  3HTK C;  5KYW A;  1T9K A;  3NMJ A;  3I4U A;  3UMI A;  2LCH A;  1BBH A;  3DM9 B;  5BUO A;  1NLX A;  2B0J A;  3U8V A;  3SXY A;  4W8K A;  2NSG A;  3FOO A;  4I1O B;  1IZM A;  2L81 A;  3L34 A;  2XLH A;  2ZXO A;  4MTO A;  3GOD A;  2LFF A;  3EHM A;  1RKE B;  2NSF A;  2IYL D;  1J8M F;  3MLG A;  2OEV A;  4K7B A;  2WZG A;  3JCU Q;  3I5Q A;  3O10 A;  3Q6M A;  2F22 A;  2HMZ A;  1H6G A;  4A2N B;  2PFD A;  4NTF A;  4IAQ A;  4MW3 A;  3EH1 A;  2J8W A;  2JPU A;  3C8Z A;  3LEO A;  2YRF A;  3GOR A;  4OD4 A;  4DBQ A;  4FAP B;  4U9E A;  3EZI A;  1LI7 A;  3C7J A;  3PCV A;  3K7D A;  4MTG A;  2VB6 A;  1AUE A;  1XZP A;  3KKB A;  1AEP A;  2MHR A;  1T6I A;  2V26 A;  4Q7C A;  2P0N A;  3EH2 A;  2NG1 A;  4CS9 A;  1Y6D A;  4CSA A;  1EI7 A;  5T3T A;  2J7P A;  4RDA A;  5B1B C;  4UDV A;  1OW8 A;  4CS8 C;  1J8Y F;  1T01 A;  1S7Z A;  2L6F A;  1O5H A;  4DOZ A;  3U9J A;  2IM8 A;  4QI0 A;  1VMA A;  3QTH A;  2DGJ A;  2AVK A;  4F4B A;  3ABM C;  1Q0F A;  2CNW A;  1OXB A;  1O3U A;  1ZHY A;  4J32 B;  4XEK A;  5JRA A;  3RH3 A;  4AX2 A;  5JVE A;  3M4B A;  3R2P A;  1ORJ A;  1M57 C;  3T9O A;  4J30 B;  1HE1 A;  1LS4 A;  2P7V A;  3FMS A;  3HKK A;  4E0I A;  1NU9 C;  2HJM A;  2XLW A;  1D1A A;  2Y3G A;  4PJN A;  3DWW A;  3T6G B;  2Q9B A;  3NMI A;  3JYY A;  4XEF A;  4DRI B;  2R7X A;  3S27 A;  2QE9 A;  2GA0 A;  3NKE A;  3U3F A;  2QTV A;  1Q0M A;  3UNG C;  5GPG B;  4ONS A;  2MWQ A;  4AK9 A;  2YL3 A;  5KYX A;  3NRH A;  4JCZ A;  1TWA A;  4HFK B;  3ZTZ A;  5L0F A;  4G7O F;  3RF3 A;  4J7T A;  3LAY A;  4I44 A;  4EBK A;  2YLD A;  5KYU A;  3SYN A;  3ZC4 A;  1GM5 A;  1HW2 A;  3HNK A;  1QVX A;  4I1M A;  2HKV A;  4EHP A;  4YT4 A;  1G4W R;  3US6 A;  3SEO A;  2UUH A;  4CS7 A;  3EHN A;  3LNM B;  4EWC A;  3GEH A;  4MVQ A;  4BJ1 A;  2W4M A;  2BL2 A;  1VK5 A;  1ZHZ A;  3IQ6 A;  3V7O A;  5A6K A;  3EG9 A;  1XWJ A;  3ECS A;  1JOG A;  1ZW2 A;  2QLA A;  5L0C A;  4U5D E;  4XWJ A;  3F46 A;  3FDQ A;  3EZH A;  4BJT A;  4W8P A;  2NUT A;  2YVK A;  4MVZ A;  3O55 A;  2AU5 A;  3RVY A;  1CGN A;  5A6B A;  1VYI A;  4EUK B;  1TQG A;  4U5H A;  1JAF A;  4LAC B;  1C03 A;  5L3V A;  3K1I C;  1WTY A;  4PK4 A;  1FFH A;  2LIG A;  4DBR A;  4L6R A;  1Z23 A;  1L3P A;  1L7C A;  4Z9I A;  3S9O A;  5EHH A;  2H8A A;  2A0U A;  3HNJ A;  4JTA B;  4AE4 A;  4CJG A;  4E18 A;  4HFF B;  3ZVR A;  1M2O A;  1K05 A;  3GM2 A;  3NYM A;  1MMD A;  4B6I A;  1FR0 A;  4N6H A;  4K0D A;  1NSG B;  2A69 F;  2XL4 A;  3W2V A;  5DS4 A;  2R7O A;  4P6I C;  3CEX A;  5JSL A;  3TJ6 A;  1LS1 A;  3HNI A;  4JEB A;  4D4X A;  4YJW A;  1O87 A;  3O39 A;  1WAT A;  3B9Q A;  5A6A A;  2GAQ A;  2IXP A;  4JRZ A;  1Z5Z A;  4G7H F;  2XL6 A;  1AVO B;  5DLJ A;  2Q00 A;  5BQG A;  2A68 F;  1GS9 A;  3MYI A;  3QVZ A;  3PMR A;  2LSE A;  4DRJ B;  4C7O B;  4KNV A;  1OKK D;  5DQT A;  2R7U A;  1Z3I X;  2ZXW C;  4EBB A;  3R7C A;  4BJ5 C;  1OKK A;  2DYR C;  1K40 A;  1FFT C;  3AG3 C;  4C3D A;  3AG1 C;  3TK0 A;  4KBL A;  3T6B A;  2NUP A;  2UUI A;  3C8G D;  2DYS C;  3TJ5 A;  4G7Z F;  3SZR A;  4RD9 A;  1OXK A;  2KK1 A;  1YVI A;  5TJ5 E;  3AOU A;  4O6M A;  3N2Z B;  1GQA A;  5E3A A;  1EQ1 A;  2R05 A;  2GDC A;  4LDR A;  4QDL A;  3C62 A; 
#chains in the Genus database with same CATH homology
 2Q7R A;  3HKK A;  3LEO A;  5K0I A;  3B29 A;  3DWW A;  3PCV A;  4JRZ A;  4JC7 A;  4NTA A;  4YK5 A;  5BQG A;  4J7Y A;  4JCZ A;  2PNO A;  4YL3 A;  4AL1 A;  4J7T A;  5BQH A;  4NTB A;  5BQI A;  4BPM A;  2UUH A;  2UUI A;  2H8A A;  4AL0 A;  5HV9 A;  4YL1 A;  4YL0 A;  4NTF A;  4WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...