4BPMA

Crystal structure of a human integral membrane enzyme
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE, FUSION PEPTIDE
total genus 66
structure length 162
sequence length 162
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4bpmA00
3DWWA 3HKKA 2UUIA 4YL0A 2Q7RA 5BQHA 4YL1A 5HV9A 4AL0A 4J7TA 4JRZA 5BQGA 3B29A 2UUHA 3LEOA 4BPMA 2H8AA 5K0IA 4WABA 4AL1A 4NTAA 5BQIA 2PNOA 4NTBA 4JCZA 3PCVA 4YK5A 4JC7A 4NTFA 4YL3A 4J7YA
chains in the Genus database with same CATH superfamily
4I1OB 1TWAA 3ZQVA 3S0XA 3FOPA 3HNJA 2HS5A 3ABLC 4OIQF 3ASNC 2R05A 1KTMA 3FDQA 5A6BA 3VRCA 3LUTB 1ZHXA 4AE4B 4DRHB 3V5ZA 4XEKA 2Y3GA 4MTGA 1DOVA 3RYLA 1U89A 2EPMX 2J9BA 4D4NA 1K40A 3W2VA 2RSEB 3EG9B 3B29A 4MVRA 2XLDA 4BJ1A 1ZHTA 2OOCA 3RH3A 4WGZA 4EKWA 1NZEA 1CPQA 2KK1A 1OQCA 3DJUB 3GM2A 4JIOA 2Q4FA 1VK5A 3MX3A 4E7SA 3AG2C 4BJTA 1G4WR 2YQYA 3A11A 3H65A 3HJCA 1D0XA 3MLGA 2XL4A 4NTBA 4X0RA 1H6GA 3AQBA 3TQOA 5JRAA 2YEVA 2XM4A 3PHF2 2LFFA 3TOMA 1MNEA 2ICWG 5FCLA 4YT8A 2OG2A 2WZFA 4U5HA 2VCAA 2WZLA 3IHUA 4H54A 4LDKA 4YN0B 3K33A 5T3TA 2DB4A 4A4AA 3FXHA 2XSEA 1TKNA 2Q7RA 4QDLA 1V4AA 3GEIA 4AX2A 1O87A 1VLTA 2WZGA 1Z3IX 1A7DA 5E3CA 5F5HA 4B6IA 2DGJA 5A6BD 2LK4A 1BR1A 4DBRA 1C03A 3U0CA 4OD4A 2VB6A 1I4YA 2KJGA 1QPUA 1H9TA 1MMAA 1OR2A 2M64A 4N06A 4OINF 1S7ZA 2KGOA 2ZD9A 4ULWA 2ZXRA 2TMVP 5COMA 3GORA 5KYNA 4LDRA 3H2VA 1F1MA 4PJJA 1M2VB 3LS0A 3VF0A 3OWTA 3R2PA 1YARO 1LS1A 3T6JA 1CPRA 3F47A 4NY3A 4O6NA 2NUTB 3ABMC 2OJQA 1QVXA 1JPJA 1FFHA 5F5FA 1OW8A 2V26A 3UMKA 2HSQA 2YL1A 4HFKB 3UGPA 2LD6A 2R9RB 4O79A 1RKEA 3B0VC 5L3VA 1I5NA 2XXAA 1APCA 4PACA 3C18A 4G7ZF 2HUJA 3EH2A 2UUHA 5FZTA 1NFOA 4G78A 3JYHA 3AG3C 4JEAA 3L0IA 4DVYP 3JTLO 5GPGB 5L0HA 1RCPA 1H7IA 3DE8A 2BL2A 2LFDA 3CZ6A 1Z7Qc 4G0HA 3GEHA 3KMIA 2WVQA 4PJMA 5T1DB 3A9CA 4NTFA 3EPVA 256BA 2CCYA 3U8VA 2PFDA 2HZ8A 1L3PA 2CYDA 1OCCC 3JT1A 1OCZC 4I1MA 1VLSA 2H7BA 1NG1A 4IGGA 4MVZA 3WHNA 3N24A 2GDCA 2HV6A 1T6UA 3CSKA 1ZW2A 3NDBB 4E18A 2XLVA 3NKDA 1YZAA 3J06A 4Z9HA 3L8JA 2WVOA 3RVYA 3AJMA 2J9VA 2AWYA 3EFOB 4NQFA 2VCCA 4CBEA 4EIYA 5EHHA 2Y3DA 3EGXB 1Z6AA 4XWJA 4ULVA 3B9QA 5A6AA 2YHSA 1HMOA 3M1CB 2VCBA 4CIPA 4BPMA 1V55C 1FFTC 1ZU5A 1LI5A 2YKZA 4EBKA 3ASOC 2Q3TA 1U6HA 5COFA 4Z9IA 2OU6A 2GAQA 4J30B 2AU5A 2EIJC 1WN0A 1NBBA 5D91A 1Q0GA 3SXYA 2B0JA 2WVNA 4DBQA 4I44A 1RKEB 2QE9A 2YLGA 3GM3A 2GFHA 3W8IA 4G7OF 2D5RB 2W4MA 3EHNA 4C3EA 1ORSC 4CS8A 4DRIB 4FAPB 4W8PA 3K66A 2QUPA 4P9TA 5AC4A 3W4YA 1YA9A 2W4BA 4R32A 1ZZPA 3V5XA 2NUPA 3HNLA 2OEXA 2I8BA 4CS9A 2AWCA 1JAFA 2HKVA 1JMWA 4CSAA 3EGDA 5TJ5E 4YWQA 5A6JA 1CGME 3IQTA 3U9JA 2DI3A 1UFBA 3HNIA 1PD1A 2KYHA 2MYSA 2YRFA 3NYJA 1HY5A 2R7TA 3T6BA 5L0GA 1K05A 1OR3A 3SXZA 3NKEA 2Q00A 3FAJA 2A0BA 1WOLA 3LESA 5JS5A 4OIRF 1VTMP 2J7PA 4U5FE 2NSGA 2EPNA 2NPUA 2NSFA 3QZCA 4DVZA 1E83A 1Z23A 1BR2A 2KNHA 3PDMP 3R7CA 1QLEC 3UMHA 4NC3A 1OCRC 3DKAA 2PX3A 1B68A 4L6RA 1M6TA 2R02A 4JURI 2WB7A 2A1DD 2FFHA 1C17M 2PF4E 3NRHA 4YT5A 1FAPB 3RIPA 2CDQA 4MW8A 4W8KA 1RJ9A 1SR2A 1V54C 5B1AC 3U3FA 2OKUA 2XRHA 4WJ0A 3UR3C 1TWHA 2QTVA 2NG1A 2H8AA 4JW1A 2J0XA 2QLAA 1PCXA 2P61A 3ABKC 2XM0A 4F4BA 2JD3A 4MVSA 4PFOA 3POVA 1YYJA 4JC7A 3QVYA 1J8YF 2CNWA 2XL6A 4EBJA 4BJ5C 5L3QA 2XLHA 3QVZA 4MVQA 3VYWA 4E0IA 3UGOA 2YLIA 4AK9A 3DD7A 4U5DE 3V7OA 3ZWIA 2R7RA 3KYJA 3B0UX 1JPNA 4C7OA 4CJGA 1XZPA 2FGYA 1Q0FA 4GQHA 4AE4A 2J46A 5JVEA 1NU9C 4K7BA 3L1MA 4IJJA 2L6GA 3KKBA 3Q7GA 5IY5C 1MNDA 5BUOA 3ECSA 1EQ1A 4YL1A 1M56C 4AL0A 1WWPA 3JRTA 5EK0A 3U9MA 5A69A 3W8HA 1BBHA 1YYXA 2L6HA 2R25A 1D0YA 2ZXPA 1WATA 4FESA 4O6YA 4BJ6C 3TD7A 1LE2A 1QSPA 3ZSUA 1WGWA 1A7EA 3MYIA 4O6MA 1A0BA 3I5QA 1NFNA 4NCQA 2HSBA 3NMIA 3PCVA 4A2NB 4BG0A 1M57C 4HE8D 5DS4A 3AOUA 1YVIA 3EZHA 2QY9A 1Z5ZA 3NMKA 2CW0F 4O7GA 4D4XA 1MMGA 4XPXA 4EBBA 4PJNA 1YZCA 3X2QC 1NU7D 4MW3A 4RBNA 4CIHA 2ASRA 4RDAA 3DMDA 1NLXA 3DJNB 1VYKA 4E0HA 4IARA 1HW1A 2IXPA 3C8GA 2NUTA 2B0HA 3EGDB 3KPHA 4H4KC 1TWCA 5HSWA 3N2ZB 4P6IC 2HJMA 1YJGA 3DI5A 3EFOA 2MWQA 2EILC 4QI2A 3C8GB 3EH1A 4CS8C 4P9FA 4AL1A 3KL4A 3AQCA 2PNOA 1DOWA 3MFNA 5JT4A 4GYTA 3JSZA 3K7DA 3G4XA 2P7VA 3TJ6A 3Q6NA 1MMDA 2LQGA 3Q6MA 3EZIA 1LVKA 4MVMA 3L34A 3QTHA 5L0FA 2AVKA 3O6XA 1HW2A 1NSGB 5AGFA 4CS9C 1OKKD 2EINC 3SYNA 3S28A 2XLMA 1TQGA 3C7JA 3HNKA 2LIGA 3EJNA 5E3AA 2OQMA 3RKOF 5DQZA 1WASA 3T9OA 4DRJB 2PBEA 5B3IA 4EWCA 5DS6A 1XZQA 2R7OA 1OXKA 3U5SA 3M79A 2A68F 4XTKA 4XLPF 3FMSA 2X0CA 2Y3HA 3C8ZA 3MYFA 1EI7A 4KNWA 2XS1A 4KI2A 2VH3A 3U8PA 3GEEA 4ZLDA 3MBGA 5T3WA 3I4UA 1T6QA 1S05A 3EHMA 4KNVA 4C7OB 2XLEA 2H7VC 3ZTMA 5KYXB 3DWWA 1LE4A 4KC9A 1O3UA 3BEHA 4YJWA 3UMIA 2BE5F 1YDIA 2HFIA 1BZ4A 2PP4A 2IXNA 3F46A 4LLEA 3K1IA 4XLNF 3VAYA 1BDJB 1D0ZA 3S29A 4CDYA 1G4US 2C03A 1IZMA 1ORJA 1VB5A 2Q9AA 3SP1A 1RJ9B 3ATPA 3DAFA 4C3DA 2D4UA 2VASA 5CI9A 4BJ5A 4M63A 4JRZA 2XXAB 5BQGA 5AC5A 1ZW3A 3LEOA 1YAUO 2JPUA 5L0IA 1T9KA 2L6FA 2QNLA 3Q7LA 4OIOF 2YZSA 1E84A 2OEVA 2R7WA 3U2LA 3GM1A 2BC5A 4FWVA 4U9EA 4ANJA 4EUKB 2IXMA 5A6KA 5E33A 1R4TA 4CDAA 4YL3A 3QW0A 3RQEA 2LCHA 2AP3A 3EGXA 1TFOB 4MTFA 1IW7F 1RXQA 3GANA 4MVUA 3JCUQ 1HMDA 4ZLCA 5E2QA 2Y69C 3H2UA 2UUIA 1GM5A 3DM9B 2G3KA 3L8IA 2J0WA 2J8WA 2O9XA 4G7HF 4JVSA 1I4ZA 4LLCA 3E9VA 2E87A 1V74B 2XS8A 1KNYA 1EKYA 4MQ9F 3AG4C 3M4CA 5CIVA 4CSAC 1U0BB 2G3VA 4Q5SF 1FMWA 3LAYA 4IRUA 2IOQA 4JEBA 2NUPB 3K1HA 4KBLA 5D92A 5KYWB 4MS2A 2ZXWC 3T6GB 5KYUB 2A0UA 2HJ3A 1LM3B 1T5OA 3VM6A 4DOZA 2R7VA 3LNMB 1HE9A 3QW1A 3WAQA 4CDVA 4XQ1A 2XLWA 3RQGA 4Q4ZF 4U5CE 1R5ID 2WL8A 1OW6A 3CAXA 3I5PA 3C62A 3OEOA 2EPKX 3KYIA 3ZQYA 4MVOA 4YT4A 4FX5A 3JYYA 4U9DA 3US6A 4BEMJ 1A7VA 1K04A 1MQVA 3FAPB 4IAOA 1WTYA 1LKXA 3U2MA 5EGYA 2R7SA 3SXKA 4J7TA 4XPWA 1LI7A 1E85A 1M2VA 1OW7A 2IXOA 1GGQA 1OCOC 5B1BC 2VC9A 3G4ZA 3WODF 5L0DA 4WABA 3DXJF 5KYUA 3LEVA 2H7OA 1A41A 4ER9A 1HE1A 3C8GD 4JCZA 4PJLA 4ONSA 5COGA 4QI0A 3SEOA 3ZVRA 2A6HF 1XWJA 4Z9JA 4E17A 4BJ6A 5DS5A 1ZHYA 2R03A 4J32B 2Y39A 2ETSA 2RD9A 3RW0A 4XEFA 5CI8A 1M2OA 4CJOA 3B0PA 1W2WA 4LERA 2GWWA 3IQ6A 4JZAA 1Q0MA 3HLZA 2FAPB 4XEVA 1GQAA 3W2WA 3ZC4A 4HEAJ 5JLIA 5L0JA 5KYYA 1BR4A 3SXMA 4OIPF 1SYQA 1E2XA 5DQTA 4JCHA 3ZTZA 5B3SC 1ZHZA 4CS7A 2Q9CA 2CGEA 4JTAB 3V5YA 1G5ZA 2G62A 1ZYRF 2YVKA 4IAQA 2KW3C 4Q7CA 3GODA 2JX0A 1C02A 3NG1A 3O10A 2P6VA 4LDQA 3G50A 4MNDA 3S90A 3EQLF 3O39A 3S84A 3T4RA 1FMVA 4BEJA 1FNTc 4YK5A 2J9WA 2L7AA 2HMQA 3CEXA 1LIHA 2R7QA 2J9UA 3PMRA 1G8XA 3TK0A 3U3BA 1QQ3A 1UG7A 4EHPA 1KU2A 1AEPA 3SZRA 3HKKA 1Y6DA 2PX0A 4U5GA 3NYMA 4YL0A 3M15A 1L7CA 3UNGC 3OA1A 2P0NA 4E7ZA 3LLIA 1ST6A 2MHRA 2EIMC 2W45A 2KC3A 4XPYA 5JP7A 1PV3A 4RD9A 3TOLA 1CGNA 3K1IC 3JSEO 5JSLA 1T01A 1TR2A 4N6CA 1MMNA 1VMAA 3RF3A 3AGUA 1ZHWA 5KYXA 1VOMA 2Z15A 3DAGA 1ZU4A 4PR9A 4DJ9A 3CQZA 4JJFA 2OJED 3DE9A 5BQIA 1T6IA 2R7XA 4U5BE 1D1CA 5DVWA 4C3BA 3AG1C 2P1AA 2EIKC 2HMZA 1J8MF 2IYLD 1TWGA 2ZXOA 1YLMA 2V3CC 4JTDB 2YL0A 1JOGA 1SZIA 2KSFA 3NMJA 1OXBA 1YA7O 1JRAA 3DZAA 4LACB 4K0DA 1LS4A 4I3MA 3ZDLA 1H9GA 4JJGA 4JE9A 4N4WA 3HTKC 1JR8A 3IEEA 3M4BA 2F22A 2I15A 3FOOA 1RMVA 1LPEA 3JRMO 3ITFA 2J45A 2CNWD 4MTOA 3IQ5A 4K1OA 3RQFA 2HV7A 5BQHA 1SMYF 5HV9A 2YWAA 3EG9A 4WGYA 2L9JA 1GS9A 2EPLX 2GA0A 3TULA 1Q0KA 1RKCA 5F28E 2IBFA 4PFPA 1FTSA 1TFKB 3LLKA 3LNRA 5K0IA 4IWBA 4NTAA 3ZIBA 4N6HA 5JUAA 5KYWA 1D1BA 2DYSC 2LSEA 1AUEA 2EPOA 3WG7C 1E86A 3E70C 3B71A 4U5EE 1Q0DA 2Y3BA 3K6BA 2A6EF 2LP4A 4J7YA 2DYRC 1FR0A 3GWNA 4YT2A 5L0CA 1Y4CA 2X51A 2YL3A 1OKKA 2OCCC 3JZ0A 3LS1A 4OD5A 3GWLA 3S9OA 3QMKA 4CX9A 3RFYA 1Z63A 2XL8A 3S27A 3BRJA 2M4EA 3NYLA 1CGOA 3C63A 1SF8A 5DLJA 3RVZA 4DXWA 2XLOA 3ZG1A 2C04A 4IB4A 1N1CA 3KH2A 2IM8A 4HFFB 3FHDA 2A69F 4JKVA 3O55A 3DM5A 4PK4A 3X1OA 1EA8A 3LJBA 1AVOB 1ORYA 5KYYB 2L81A 3TJ5A 1D1AA 2ZPAA 2KQ9A 1QKRA 2YL7A 3IQCA 3N0TA 1O5HA 1ZVZA 4GEHA 4UDVA 1VYIA 2J7PD 2YLDA 3SNHA 4JTCB 2R7UA 3FVYA 3IPMO 1QZXA 3AGTA 1PD0A 2W9YA 2Q9BA
chains in the Genus database with same CATH topology
3DWWA 3HKKA 2UUIA 4YL0A 2Q7RA 5BQHA 4YL1A 5HV9A 4AL0A 4J7TA 4JRZA 5BQGA 3B29A 2UUHA 3LEOA 4BPMA 2H8AA 5K0IA 4WABA 4AL1A 4NTAA 5BQIA 2PNOA 4NTBA 4JCZA 3PCVA 4YK5A 4JC7A 4NTFA 4YL3A 4J7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  3HKK A;  2UUI A;  4YL0 A;  2Q7R A;  5BQH A;  4YL1 A;  5HV9 A;  4AL0 A;  4J7T A;  4JRZ A;  5BQG A;  3B29 A;  2UUH A;  3LEO A;  4BPM A;  2H8A A;  5K0I A;  4WAB A;  4AL1 A;  4NTA A;  5BQI A;  2PNO A;  4NTB A;  4JCZ A;  3PCV A;  4YK5 A;  4JC7 A;  4NTF A;  4YL3 A;  4J7Y A; 
#chains in the Genus database with same CATH topology
 4I1O B;  1TWA A;  3ZQV A;  3S0X A;  3FOP A;  3HNJ A;  2HS5 A;  3ABL C;  4OIQ F;  3ASN C;  2R05 A;  1KTM A;  3FDQ A;  5A6B A;  3VRC A;  3LUT B;  1ZHX A;  4AE4 B;  4DRH B;  3V5Z A;  4XEK A;  2Y3G A;  4MTG A;  1DOV A;  3RYL A;  1U89 A;  2EPM X;  2J9B A;  4D4N A;  1K40 A;  3W2V A;  2RSE B;  3EG9 B;  3B29 A;  4MVR A;  2XLD A;  4BJ1 A;  1ZHT A;  2OOC A;  3RH3 A;  4WGZ A;  4EKW A;  1NZE A;  1CPQ A;  2KK1 A;  1OQC A;  3DJU B;  3GM2 A;  4JIO A;  2Q4F A;  1VK5 A;  3MX3 A;  4E7S A;  3AG2 C;  4BJT A;  1G4W R;  2YQY A;  3A11 A;  3H65 A;  3HJC A;  1D0X A;  3MLG A;  2XL4 A;  4NTB A;  4X0R A;  1H6G A;  3AQB A;  3TQO A;  5JRA A;  2YEV A;  2XM4 A;  3PHF 2;  2LFF A;  3TOM A;  1MNE A;  2ICW G;  5FCL A;  4YT8 A;  2OG2 A;  2WZF A;  4U5H A;  2VCA A;  2WZL A;  3IHU A;  4H54 A;  4LDK A;  4YN0 B;  3K33 A;  5T3T A;  2DB4 A;  4A4A A;  3FXH A;  2XSE A;  1TKN A;  2Q7R A;  4QDL A;  1V4A A;  3GEI A;  4AX2 A;  1O87 A;  1VLT A;  2WZG A;  1Z3I X;  1A7D A;  5E3C A;  5F5H A;  4B6I A;  2DGJ A;  5A6B D;  2LK4 A;  1BR1 A;  4DBR A;  1C03 A;  3U0C A;  4OD4 A;  2VB6 A;  1I4Y A;  2KJG A;  1QPU A;  1H9T A;  1MMA A;  1OR2 A;  2M64 A;  4N06 A;  4OIN F;  1S7Z A;  2KGO A;  2ZD9 A;  4ULW A;  2ZXR A;  2TMV P;  5COM A;  3GOR A;  5KYN A;  4LDR A;  3H2V A;  1F1M A;  4PJJ A;  1M2V B;  3LS0 A;  3VF0 A;  3OWT A;  3R2P A;  1YAR O;  1LS1 A;  3T6J A;  1CPR A;  3F47 A;  4NY3 A;  4O6N A;  2NUT B;  3ABM C;  2OJQ A;  1QVX A;  1JPJ A;  1FFH A;  5F5F A;  1OW8 A;  2V26 A;  3UMK A;  2HSQ A;  2YL1 A;  4HFK B;  3UGP A;  2LD6 A;  2R9R B;  4O79 A;  1RKE A;  3B0V C;  5L3V A;  1I5N A;  2XXA A;  1APC A;  4PAC A;  3C18 A;  4G7Z F;  2HUJ A;  3EH2 A;  2UUH A;  5FZT A;  1NFO A;  4G78 A;  3JYH A;  3AG3 C;  4JEA A;  3L0I A;  4DVY P;  3JTL O;  5GPG B;  5L0H A;  1RCP A;  1H7I A;  3DE8 A;  2BL2 A;  2LFD A;  3CZ6 A;  1Z7Q c;  4G0H A;  3GEH A;  3KMI A;  2WVQ A;  4PJM A;  5T1D B;  3A9C A;  4NTF A;  3EPV A;  256B A;  2CCY A;  3U8V A;  2PFD A;  2HZ8 A;  1L3P A;  2CYD A;  1OCC C;  3JT1 A;  1OCZ C;  4I1M A;  1VLS A;  2H7B A;  1NG1 A;  4IGG A;  4MVZ A;  3WHN A;  3N24 A;  2GDC A;  2HV6 A;  1T6U A;  3CSK A;  1ZW2 A;  3NDB B;  4E18 A;  2XLV A;  3NKD A;  1YZA A;  3J06 A;  4Z9H A;  3L8J A;  2WVO A;  3RVY A;  3AJM A;  2J9V A;  2AWY A;  3EFO B;  4NQF A;  2VCC A;  4CBE A;  4EIY A;  5EHH A;  2Y3D A;  3EGX B;  1Z6A A;  4XWJ A;  4ULV A;  3B9Q A;  5A6A A;  2YHS A;  1HMO A;  3M1C B;  2VCB A;  4CIP A;  4BPM A;  1V55 C;  1FFT C;  1ZU5 A;  1LI5 A;  2YKZ A;  4EBK A;  3ASO C;  2Q3T A;  1U6H A;  5COF A;  4Z9I A;  2OU6 A;  2GAQ A;  4J30 B;  2AU5 A;  2EIJ C;  1WN0 A;  1NBB A;  5D91 A;  1Q0G A;  3SXY A;  2B0J A;  2WVN A;  4DBQ A;  4I44 A;  1RKE B;  2QE9 A;  2YLG A;  3GM3 A;  2GFH A;  3W8I A;  4G7O F;  2D5R B;  2W4M A;  3EHN A;  4C3E A;  1ORS C;  4CS8 A;  4DRI B;  4FAP B;  4W8P A;  3K66 A;  2QUP A;  4P9T A;  5AC4 A;  3W4Y A;  1YA9 A;  2W4B A;  4R32 A;  1ZZP A;  3V5X A;  2NUP A;  3HNL A;  2OEX A;  2I8B A;  4CS9 A;  2AWC A;  1JAF A;  2HKV A;  1JMW A;  4CSA A;  3EGD A;  5TJ5 E;  4YWQ A;  5A6J A;  1CGM E;  3IQT A;  3U9J A;  2DI3 A;  1UFB A;  3HNI A;  1PD1 A;  2KYH A;  2MYS A;  2YRF A;  3NYJ A;  1HY5 A;  2R7T A;  3T6B A;  5L0G A;  1K05 A;  1OR3 A;  3SXZ A;  3NKE A;  2Q00 A;  3FAJ A;  2A0B A;  1WOL A;  3LES A;  5JS5 A;  4OIR F;  1VTM P;  2J7P A;  4U5F E;  2NSG A;  2EPN A;  2NPU A;  2NSF A;  3QZC A;  4DVZ A;  1E83 A;  1Z23 A;  1BR2 A;  2KNH A;  3PDM P;  3R7C A;  1QLE C;  3UMH A;  4NC3 A;  1OCR C;  3DKA A;  2PX3 A;  1B68 A;  4L6R A;  1M6T A;  2R02 A;  4JUR I;  2WB7 A;  2A1D D;  2FFH A;  1C17 M;  2PF4 E;  3NRH A;  4YT5 A;  1FAP B;  3RIP A;  2CDQ A;  4MW8 A;  4W8K A;  1RJ9 A;  1SR2 A;  1V54 C;  5B1A C;  3U3F A;  2OKU A;  2XRH A;  4WJ0 A;  3UR3 C;  1TWH A;  2QTV A;  2NG1 A;  2H8A A;  4JW1 A;  2J0X A;  2QLA A;  1PCX A;  2P61 A;  3ABK C;  2XM0 A;  4F4B A;  2JD3 A;  4MVS A;  4PFO A;  3POV A;  1YYJ A;  4JC7 A;  3QVY A;  1J8Y F;  2CNW A;  2XL6 A;  4EBJ A;  4BJ5 C;  5L3Q A;  2XLH A;  3QVZ A;  4MVQ A;  3VYW A;  4E0I A;  3UGO A;  2YLI A;  4AK9 A;  3DD7 A;  4U5D E;  3V7O A;  3ZWI A;  2R7R A;  3KYJ A;  3B0U X;  1JPN A;  4C7O A;  4CJG A;  1XZP A;  2FGY A;  1Q0F A;  4GQH A;  4AE4 A;  2J46 A;  5JVE A;  1NU9 C;  4K7B A;  3L1M A;  4IJJ A;  2L6G A;  3KKB A;  3Q7G A;  5IY5 C;  1MND A;  5BUO A;  3ECS A;  1EQ1 A;  4YL1 A;  1M56 C;  4AL0 A;  1WWP A;  3JRT A;  5EK0 A;  3U9M A;  5A69 A;  3W8H A;  1BBH A;  1YYX A;  2L6H A;  2R25 A;  1D0Y A;  2ZXP A;  1WAT A;  4FES A;  4O6Y A;  4BJ6 C;  3TD7 A;  1LE2 A;  1QSP A;  3ZSU A;  1WGW A;  1A7E A;  3MYI A;  4O6M A;  1A0B A;  3I5Q A;  1NFN A;  4NCQ A;  2HSB A;  3NMI A;  3PCV A;  4A2N B;  4BG0 A;  1M57 C;  4HE8 D;  5DS4 A;  3AOU A;  1YVI A;  3EZH A;  2QY9 A;  1Z5Z A;  3NMK A;  2CW0 F;  4O7G A;  4D4X A;  1MMG A;  4XPX A;  4EBB A;  4PJN A;  1YZC A;  3X2Q C;  1NU7 D;  4MW3 A;  4RBN A;  4CIH A;  2ASR A;  4RDA A;  3DMD A;  1NLX A;  3DJN B;  1VYK A;  4E0H A;  4IAR A;  1HW1 A;  2IXP A;  3C8G A;  2NUT A;  2B0H A;  3EGD B;  3KPH A;  4H4K C;  1TWC A;  5HSW A;  3N2Z B;  4P6I C;  2HJM A;  1YJG A;  3DI5 A;  3EFO A;  2MWQ A;  2EIL C;  4QI2 A;  3C8G B;  3EH1 A;  4CS8 C;  4P9F A;  4AL1 A;  3KL4 A;  3AQC A;  2PNO A;  1DOW A;  3MFN A;  5JT4 A;  4GYT A;  3JSZ A;  3K7D A;  3G4X A;  2P7V A;  3TJ6 A;  3Q6N A;  1MMD A;  2LQG A;  3Q6M A;  3EZI A;  1LVK A;  4MVM A;  3L34 A;  3QTH A;  5L0F A;  2AVK A;  3O6X A;  1HW2 A;  1NSG B;  5AGF A;  4CS9 C;  1OKK D;  2EIN C;  3SYN A;  3S28 A;  2XLM A;  1TQG A;  3C7J A;  3HNK A;  2LIG A;  3EJN A;  5E3A A;  2OQM A;  3RKO F;  5DQZ A;  1WAS A;  3T9O A;  4DRJ B;  2PBE A;  5B3I A;  4EWC A;  5DS6 A;  1XZQ A;  2R7O A;  1OXK A;  3U5S A;  3M79 A;  2A68 F;  4XTK A;  4XLP F;  3FMS A;  2X0C A;  2Y3H A;  3C8Z A;  3MYF A;  1EI7 A;  4KNW A;  2XS1 A;  4KI2 A;  2VH3 A;  3U8P A;  3GEE A;  4ZLD A;  3MBG A;  5T3W A;  3I4U A;  1T6Q A;  1S05 A;  3EHM A;  4KNV A;  4C7O B;  2XLE A;  2H7V C;  3ZTM A;  5KYX B;  3DWW A;  1LE4 A;  4KC9 A;  1O3U A;  3BEH A;  4YJW A;  3UMI A;  2BE5 F;  1YDI A;  2HFI A;  1BZ4 A;  2PP4 A;  2IXN A;  3F46 A;  4LLE A;  3K1I A;  4XLN F;  3VAY A;  1BDJ B;  1D0Z A;  3S29 A;  4CDY A;  1G4U S;  2C03 A;  1IZM A;  1ORJ A;  1VB5 A;  2Q9A A;  3SP1 A;  1RJ9 B;  3ATP A;  3DAF A;  4C3D A;  2D4U A;  2VAS A;  5CI9 A;  4BJ5 A;  4M63 A;  4JRZ A;  2XXA B;  5BQG A;  5AC5 A;  1ZW3 A;  3LEO A;  1YAU O;  2JPU A;  5L0I A;  1T9K A;  2L6F A;  2QNL A;  3Q7L A;  4OIO F;  2YZS A;  1E84 A;  2OEV A;  2R7W A;  3U2L A;  3GM1 A;  2BC5 A;  4FWV A;  4U9E A;  4ANJ A;  4EUK B;  2IXM A;  5A6K A;  5E33 A;  1R4T A;  4CDA A;  4YL3 A;  3QW0 A;  3RQE A;  2LCH A;  2AP3 A;  3EGX A;  1TFO B;  4MTF A;  1IW7 F;  1RXQ A;  3GAN A;  4MVU A;  3JCU Q;  1HMD A;  4ZLC A;  5E2Q A;  2Y69 C;  3H2U A;  2UUI A;  1GM5 A;  3DM9 B;  2G3K A;  3L8I A;  2J0W A;  2J8W A;  2O9X A;  4G7H F;  4JVS A;  1I4Z A;  4LLC A;  3E9V A;  2E87 A;  1V74 B;  2XS8 A;  1KNY A;  1EKY A;  4MQ9 F;  3AG4 C;  3M4C A;  5CIV A;  4CSA C;  1U0B B;  2G3V A;  4Q5S F;  1FMW A;  3LAY A;  4IRU A;  2IOQ A;  4JEB A;  2NUP B;  3K1H A;  4KBL A;  5D92 A;  5KYW B;  4MS2 A;  2ZXW C;  3T6G B;  5KYU B;  2A0U A;  2HJ3 A;  1LM3 B;  1T5O A;  3VM6 A;  4DOZ A;  2R7V A;  3LNM B;  1HE9 A;  3QW1 A;  3WAQ A;  4CDV A;  4XQ1 A;  2XLW A;  3RQG A;  4Q4Z F;  4U5C E;  1R5I D;  2WL8 A;  1OW6 A;  3CAX A;  3I5P A;  3C62 A;  3OEO A;  2EPK X;  3KYI A;  3ZQY A;  4MVO A;  4YT4 A;  4FX5 A;  3JYY A;  4U9D A;  3US6 A;  4BEM J;  1A7V A;  1K04 A;  1MQV A;  3FAP B;  4IAO A;  1WTY A;  1LKX A;  3U2M A;  5EGY A;  2R7S A;  3SXK A;  4J7T A;  4XPW A;  1LI7 A;  1E85 A;  1M2V A;  1OW7 A;  2IXO A;  1GGQ A;  1OCO C;  5B1B C;  2VC9 A;  3G4Z A;  3WOD F;  5L0D A;  4WAB A;  3DXJ F;  5KYU A;  3LEV A;  2H7O A;  1A41 A;  4ER9 A;  1HE1 A;  3C8G D;  4JCZ A;  4PJL A;  4ONS A;  5COG A;  4QI0 A;  3SEO A;  3ZVR A;  2A6H F;  1XWJ A;  4Z9J A;  4E17 A;  4BJ6 A;  5DS5 A;  1ZHY A;  2R03 A;  4J32 B;  2Y39 A;  2ETS A;  2RD9 A;  3RW0 A;  4XEF A;  5CI8 A;  1M2O A;  4CJO A;  3B0P A;  1W2W A;  4LER A;  2GWW A;  3IQ6 A;  4JZA A;  1Q0M A;  3HLZ A;  2FAP B;  4XEV A;  1GQA A;  3W2W A;  3ZC4 A;  4HEA J;  5JLI A;  5L0J A;  5KYY A;  1BR4 A;  3SXM A;  4OIP F;  1SYQ A;  1E2X A;  5DQT A;  4JCH A;  3ZTZ A;  5B3S C;  1ZHZ A;  4CS7 A;  2Q9C A;  2CGE A;  4JTA B;  3V5Y A;  1G5Z A;  2G62 A;  1ZYR F;  2YVK A;  4IAQ A;  2KW3 C;  4Q7C A;  3GOD A;  2JX0 A;  1C02 A;  3NG1 A;  3O10 A;  2P6V A;  4LDQ A;  3G50 A;  4MND A;  3S90 A;  3EQL F;  3O39 A;  3S84 A;  3T4R A;  1FMV A;  4BEJ A;  1FNT c;  4YK5 A;  2J9W A;  2L7A A;  2HMQ A;  3CEX A;  1LIH A;  2R7Q A;  2J9U A;  3PMR A;  1G8X A;  3TK0 A;  3U3B A;  1QQ3 A;  1UG7 A;  4EHP A;  1KU2 A;  1AEP A;  3SZR A;  3HKK A;  1Y6D A;  2PX0 A;  4U5G A;  3NYM A;  4YL0 A;  3M15 A;  1L7C A;  3UNG C;  3OA1 A;  2P0N A;  4E7Z A;  3LLI A;  1ST6 A;  2MHR A;  2EIM C;  2W45 A;  2KC3 A;  4XPY A;  5JP7 A;  1PV3 A;  4RD9 A;  3TOL A;  1CGN A;  3K1I C;  3JSE O;  5JSL A;  1T01 A;  1TR2 A;  4N6C A;  1MMN A;  1VMA A;  3RF3 A;  3AGU A;  1ZHW A;  5KYX A;  1VOM A;  2Z15 A;  3DAG A;  1ZU4 A;  4PR9 A;  4DJ9 A;  3CQZ A;  4JJF A;  2OJE D;  3DE9 A;  5BQI A;  1T6I A;  2R7X A;  4U5B E;  1D1C A;  5DVW A;  4C3B A;  3AG1 C;  2P1A A;  2EIK C;  2HMZ A;  1J8M F;  2IYL D;  1TWG A;  2ZXO A;  1YLM A;  2V3C C;  4JTD B;  2YL0 A;  1JOG A;  1SZI A;  2KSF A;  3NMJ A;  1OXB A;  1YA7 O;  1JRA A;  3DZA A;  4LAC B;  4K0D A;  1LS4 A;  4I3M A;  3ZDL A;  1H9G A;  4JJG A;  4JE9 A;  4N4W A;  3HTK C;  1JR8 A;  3IEE A;  3M4B A;  2F22 A;  2I15 A;  3FOO A;  1RMV A;  1LPE A;  3JRM O;  3ITF A;  2J45 A;  2CNW D;  4MTO A;  3IQ5 A;  4K1O A;  3RQF A;  2HV7 A;  5BQH A;  1SMY F;  5HV9 A;  2YWA A;  3EG9 A;  4WGY A;  2L9J A;  1GS9 A;  2EPL X;  2GA0 A;  3TUL A;  1Q0K A;  1RKC A;  5F28 E;  2IBF A;  4PFP A;  1FTS A;  1TFK B;  3LLK A;  3LNR A;  5K0I A;  4IWB A;  4NTA A;  3ZIB A;  4N6H A;  5JUA A;  5KYW A;  1D1B A;  2DYS C;  2LSE A;  1AUE A;  2EPO A;  3WG7 C;  1E86 A;  3E70 C;  3B71 A;  4U5E E;  1Q0D A;  2Y3B A;  3K6B A;  2A6E F;  2LP4 A;  4J7Y A;  2DYR C;  1FR0 A;  3GWN A;  4YT2 A;  5L0C A;  1Y4C A;  2X51 A;  2YL3 A;  1OKK A;  2OCC C;  3JZ0 A;  3LS1 A;  4OD5 A;  3GWL A;  3S9O A;  3QMK A;  4CX9 A;  3RFY A;  1Z63 A;  2XL8 A;  3S27 A;  3BRJ A;  2M4E A;  3NYL A;  1CGO A;  3C63 A;  1SF8 A;  5DLJ A;  3RVZ A;  4DXW A;  2XLO A;  3ZG1 A;  2C04 A;  4IB4 A;  1N1C A;  3KH2 A;  2IM8 A;  4HFF B;  3FHD A;  2A69 F;  4JKV A;  3O55 A;  3DM5 A;  4PK4 A;  3X1O A;  1EA8 A;  3LJB A;  1AVO B;  1ORY A;  5KYY B;  2L81 A;  3TJ5 A;  1D1A A;  2ZPA A;  2KQ9 A;  1QKR A;  2YL7 A;  3IQC A;  3N0T A;  1O5H A;  1ZVZ A;  4GEH A;  4UDV A;  1VYI A;  2J7P D;  2YLD A;  3SNH A;  4JTC B;  2R7U A;  3FVY A;  3IPM O;  1QZX A;  3AGT A;  1PD0 A;  2W9Y A;  2Q9B A; 
#chains in the Genus database with same CATH homology
 3DWW A;  3HKK A;  2UUI A;  4YL0 A;  2Q7R A;  5BQH A;  4YL1 A;  5HV9 A;  4AL0 A;  4J7T A;  4JRZ A;  5BQG A;  3B29 A;  2UUH A;  3LEO A;  4BPM A;  2H8A A;  5K0I A;  4WAB A;  4AL1 A;  4NTA A;  5BQI A;  2PNO A;  4NTB A;  4JCZ A;  3PCV A;  4YK5 A;  4JC7 A;  4NTF A;  4YL3 A;  4J7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...