4BPMA

Crystal structure of a human integral membrane enzyme
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
b'SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE, FUSION PEPTIDE
publication title Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 66
structure length 162
sequence length 162
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4bpmA00
4WABA 4AL0A 2H8AA 4NTFA 3HKKA 4JC7A 4NTBA 4BPMA 2PNOA 5BQGA 4JRZA 4NTAA 5BQIA 5HV9A 4YL0A 4JCZA 4J7TA 4J7YA 4YL1A 5K0IA 3PCVA 2UUIA 4AL1A 5BQHA 4YL3A 2UUHA 3LEOA 3B29A 4YK5A 3DWWA 2Q7RA
chains in the Genus database with same CATH superfamily
2WVNA 3JT1A 3B9QA 2ICWG 3HKKA 1WATA 3EH2A 3Q6NA 4E7SA 4H54A 1UFBA 1U0BB 3F46A 3K33A 4EWCA 3MBGA 2L9JA 2R7VA 3I5QA 4LLEA 2AWYA 2J7PD 1FNTc 4E0IA 3KPHA 1NSGB 3L0IA 3US6A 3EGXA 1WTYA 4JW1A 5KYXA 4MVSA 2M64A 3LLIA 4WJ0A 4BJ6A 3ZSUA 4A2NB 1RKCA 1TWAA 4PFOA 1A0BA 4DVYP 1EI7A 4JTDB 4Z9HA 5FZTA 3V5ZA 5AC4A 1OQCA 3K6BA 3S0XA 4NCQA 3ZC4A 2PFDA 2YL0A 1OCCC 2CNWA 3H2VA 5A6AA 4JEBA 1PCXA 1ORYA 1HE9A 3B0PA 2LSEA 2NSFA 2EIKC 2OOCA 2Q4FA 2WL8A 4MTOA 3TD7A 1GGQA 4XEVA 2EIJC 2H7OA 5EGYA 4JEAA 2OJQA 2QY9A 3S90A 1QZXA 1XWJA 1C03A 2XLHA 3SXZA 4KC9A 3E70C 4G7OF 4MVQA 3U8PA 2P7VA 3ATPA 3JRMO 4J7YA 4RDAA 2EPLX 2NG1A 2ETSA 2MYSA 2EPKX 3AJMA 3HNLA 4IRUA 3AG3C 1VOMA 5E2QA 3RF3A 4BJTA 2XL8A 3O6XA 3QTHA 4Q4ZF 1D0ZA 4HEAJ 2R7RA 1ORJA 3DAGA 3Q7LA 1RMVA 1A7DA 2P6VA 1BR2A 2IM8A 2Q9AA 4ZLDA 5KYYB 2YQYA 3LESA 3RH3A 4HE8D 3IEEA 1FFTC 2V26A 5A6KA 4M63A 4Q5SF 3ASOC 1PD0A 1RJ9B 5BQGA 1O5HA 5B1BC 5A6JA 1K40A 1YAUO 2VCCA 4XQ1A 2IOQA 2PP4A 3LJBA 2DI3A 1OW8A 1Y4CA 2J8WA 3IQ5A 1ZW2A 4JIOA 1E84A 1Q0GA 5JS5A 2GA0A 4P6IC 4YT2A 3SP1A 1MQVA 4MNDA 1QVXA 4NY3A 3EG9B 4LDKA 2PX3A 5L0JA 1EQ1A 1Z63A 4WGYA 2L81A 2HMQA 5KYYA 1NLXA 4JKVA 1O87A 1FAPB 2E87A 3SNHA 1NBBA 2UUHA 4H4KC 1QLEC 2AVKA 4JTCB 4K1OA 1LE4A 4Q7CA 3RW0A 2GAQA 4P9TA 2CDQA 4CS9A 5IY5C 4XPWA 1U6HA 3L1MA 4LLCA 3B0VC 3CAXA 1DOWA 1I4ZA 3EFOB 1WWPA 5L3VA 2QLAA 2NUTA 4B6IA 4DRHB 4I1OB 5DS4A 1APCA 3C8GD 4MW8A 3HLZA 3JYHA 2CGEA 3UNGC 2R05A 4CBEA 3EG9A 4JURI 3NMIA 2XLVA 1M2VA 1YA9A 1YVIA 3I5PA 4JJGA 2P0NA 3DE8A 1D1CA 1LPEA 3L8JA 3GWNA 1JOGA 3DJNB 2FFHA 3LNRA 2KNHA 4XTKA 2J9BA 2R25A 1OKKA 2XL6A 3LEVA 1OW7A 3ASNC 1I4YA 2YRFA 1XZPA 2HV7A 2KJGA 3DD7A 5B1AC 2OEXA 3VM6A 2IXMA 3NYJA 3UMKA 2XLMA 1E83A 3DM9B 3EFOA 3UR3C 5HSWA 1S05A 2YZSA 1VLSA 4U5CE 4BEMJ 5L0IA 1G8XA 1TWCA 1Q0FA 3JTLO 3DAFA 1G4US 2A1DD 1G4WR 4NTBA 4O79A 1QPUA 1C17M 1ST6A 4U5HA 1T9KA 4U9DA 4DBRA 4EKWA 3DZAA 3IQ6A 2R7WA 1RKEA 5DQTA 4I3MA 3IQCA 1RXQA 3ZVRA 1VTMP 2WZGA 1MMNA 4CDAA 3OWTA 3UMHA 1AUEA 4O6YA 1FMVA 2R7XA 5KYWB 3HTKC 4KI2A 4MQ9F 2CYDA 3JZ0A 3L8IA 4ANJA 2AP3A 4DBQA 4I44A 1B68A 3ABMC 3POVA 1WGWA 1WASA 4MTFA 3BEHA 2JD3A 4GEHA 4CIPA 1LI7A 2FGYA 3EZHA 5T3TA 3S9OA 3MYIA 2RD9A 1YARO 2C03A 4LACB 4NTFA 4CSAA 4JC7A 3T6GB 3W2VA 2D5RB 3AG2C 3M15A 5GPGB 4CS8A 3SXKA 3TULA 2G62A 2HSQA 256BA 1L7CA 4YT5A 3K7DA 3FVYA 1OW6A 4W8PA 5L0FA 2R9RB 4IAOA 1YYJA 4PFPA 1FFHA 3M4BA 5KYWA 2ZXPA 1VLTA 1Z6AA 2AU5A 2YVKA 3MFNA 1ZVZA 1D0YA 2Y39A 3PMRA 1D1BA 1NFOA 4JZAA 2WB7A 3M79A 3K1IA 3SEOA 3Q6MA 1LVKA 2W4MA 4IJJA 5DQZA 5BUOA 2CNWD 3QW1A 4DOZA 4E7ZA 1RCPA 3TQOA 2G3KA 5T1DB 5COFA 3U9MA 1R5ID 3DKAA 2Y69C 2YHSA 1Z23A 3O10A 3R7CA 1V55C 5D91A 2OQMA 2KSFA 4YK5A 3RQFA 4AL0A 1UG7A 1GM5A 2H7BA 3QMKA 2H7VC 3EQLF 1CGNA 4XWJA 4BJ5C 2ASRA 3CQZA 4G7ZF 4J30B 4N06A 3ZG1A 3GM3A 1WOLA 4IWBA 1WN0A 3HNIA 5TJ5E 4K7BA 4BEJA 2QE9A 2JPUA 4DRJB 5A6BD 2XXAB 3GORA 2YL7A 4K0DA 5E3CA 5JLIA 2HV6A 2C04A 2W4BA 2J0XA 1OR2A 2XSEA 2Q00A 4IAQA 3SXMA 2M4EA 3MX3A 4CDYA 2J7PA 1V74B 3V5YA 3DJUB 5BQHA 2HJMA 1Z5ZA 4YL3A 2MWQA 3FMSA 2D4UA 4JVSA 2OG2A 1IZMA 1I5NA 2NUPB 3T6BA 3WODF 4GQHA 1LE2A 1E86A 1TFKB 2LCHA 3CEXA 4PJJA 2O9XA 1EA8A 2YKZA 1TR2A 3KKBA 4GYTA 3NKEA 3VRCA 4CX9A 5KYUB 4KNWA 1YZAA 3R2PA 2PNOA 3VYWA 4C3DA 2EPOA 4JCHA 4NQFA 2HZ8A 2PX0A 5CIVA 4UDVA 2NPUA 1JAFA 2GWWA 3OEOA 4LDRA 1H9TA 3RYLA 2LP4A 1T6QA 3RQEA 2WZLA 2IXNA 3RKOF 3NYLA 1FTSA 4CJOA 1SYQA 1MMAA 1JPNA 2I15A 2UUIA 4EBBA 1A41A 1V4AA 4BG0A 5F5HA 3GEEA 5L0DA 3J06A 1HY5A 4BPMA 1QSPA 3V5XA 4U9EA 4ER9A 3BRJA 1T6UA 2TMVP 1RJ9A 3N24A 3FDQA 5T3WA 3EJNA 3ZDLA 1FMWA 1M2OA 1QQ3A 2R7QA 2XLWA 4YJWA 2LFDA 2YWAA 4OD4A 2P61A 4JRZA 3RFYA 4AX2A 5AC5A 2G3VA 3QW0A 3EHNA 4N6HA 5COGA 1KNYA 2OU6A 2XS1A 4KNVA 3UMIA 4DRIB 2ZD9A 3OA1A 1OKKD 3RVZA 3LS1A 1H7IA 2AWCA 2YL1A 4O6NA 2PBEA 1N1CA 3C7JA 1NZEA 1VYKA 2L7AA 4FAPB 3FOOA 3MYFA 1T5OA 3FAPB 1ZU4A 2R02A 2ZXRA 2B0HA 4YL1A 2XL4A 3C8GB 3PCVA 4PJNA 1NU7D 4C7OB 3JRTA 1OCRC 3G4ZA 2Y3GA 3JSZA 3U5SA 3U0CA 1YJGA 1VMAA 2EPNA 2KW3C 3ITFA 3LEOA 4W8KA 3GEIA 5JP7A 3W4YA 1L3PA 3NMKA 3U9JA 2J9VA 2IXOA 2IYLD 2LFFA 5B3SC 1PD1A 4OD5A 2VASA 4JJFA 2VCBA 1Z3IX 4A4AA 1OXKA 2HJ3A 3VF0A 1KTMA 2J45A 1AVOB 4NTAA 4XEFA 2I8BA 1LIHA 3ZQVA 2YLGA 2A6HF 3EH1A 1C02A 4EBKA 3W8HA 1SR2A 5L0CA 3UGOA 4XPYA 2J46A 1YZCA 3GODA 3HNJA 4Z9IA 1XZQA 3ZWIA 3GM2A 2DYRC 4JTAB 4N4WA 2B0JA 3C8GA 3FXHA 4DVZA 3EGDB 3M4CA 1VK5A 3U2MA 1BZ4A 3U3FA 3ZTZA 2HFIA 4AK9A 4F4BA 1ZYRF 4O7GA 3V7OA 5L3QA 4XLNF 3LUTB 1H9GA 4XLPF 4ULWA 5L0GA 1LS1A 2DB4A 2ZPAA 3G4XA 4OINF 2HS5A 4BJ6C 3ZTMA 1TFOB 4R32A 2WVQA 4E0HA 1OCOC 3A11A 3DWWA 3IHUA 5K0IA 1E85A 4QI0A 3WAQA 5L0HA 2YLIA 4LDQA 5FCLA 4QI2A 4FESA 2Q9BA 2NSGA 3RVYA 5COMA 4C3EA 3H65A 2BL2A 4MS2A 1BBHA 3FAJA 4E18A 4ZLCA 1KU2A 2YL3A 2X51A 5CI9A 5EK0A 2DGJA 5HV9A 3U2LA 1CPRA 1SMYF 2KK1A 2QNLA 1BR4A 3EGDA 3B71A 2J9UA 3FOPA 2VCAA 2DYSC 2QTVA 4HFFB 4MVMA 2PF4E 3N0TA 4BJ1A 2IBFA 3EGXB 1GQAA 1ZHZA 2YEVA 3O55A 5JT4A 1ZW3A 5KYXB 2OEVA 3SXYA 2WZFA 4AL1A 3X2QC 5DLJA 3EPVA 1A7EA 1K04A 2F22A 3WHNA 3ABLC 2VH3A 3KMIA 1HE1A 1BR1A 3DXJF 2MHRA 1ZU5A 3AOUA 1K05A 3QVYA 4IB4A 5F5FA 3UGPA 1M56C 4OIRF 3HNKA 3O39A 3AQCA 1MNEA 2WVOA 1ZHYA 3C63A 1LKXA 1NG1A 2Q3TA 3LS0A 5D92A 3AGUA 1D1AA 5E33A 4OIQF 3L34A 4D4XA 2GFHA 1T01A 1ZZPA 1IW7F 2A68F 4FX5A 2EIMC 3RQGA 4MVUA 1A7VA 3DM5A 4IARA 4U5BE 1OR3A 1ORSC 5E3AA 2OJED 4PJMA 3X1OA 4G7HF 3NKDA 4WGZA 4ULVA 2KGOA 3W2WA 1LI5A 2L6GA 1V54C 1PV3A 4LERA 1MNDA 2Y3DA 3ABKC 1O3UA 2XM4A 3F47A 4PR9A 2Q7RA 4WABA 1Q0KA 1YLMA 2H8AA 2Y3BA 1W2WA 2EPMX 2QUPA 3K66A 3N2ZB 3TJ6A 1D0XA 4G78A 4CS7A 3I4UA 4CS9C 4DXWA 4IGGA 4U5EE 3ZQYA 2XXAA 2W9YA 2JX0A 3GEHA 1MMGA 3JSEO 2W45A 4U5GA 4EBJA 1SZIA 3KYJA 1BDJB 4YL0A 1EKYA 3T9OA 1R4TA 4CIHA 4ONSA 4PK4A 3NDBB 5JVEA 3JCUQ 3MLGA 3QVZA 1Y6DA 4PJLA 4RBNA 5KYNA 1Q0MA 1OCZC 2L6FA 2RSEB 1JMWA 2FAPB 2LD6A 1TWHA 2EILC 3K1HA 1LS4A 4I1MA 4NC3A 2VC9A 3RIPA 3TJ5A 2V3CC 2J0WA 1GS9A 5DS6A 1QKRA 1VYIA 1J8MF 2NUPA 3C62A 3C8ZA 2LQGA 4BJ5A 2XLEA 3SZRA 1JPJA 2CCYA 5AGFA 3IPMO 1LM3B 1TQGA 5F28E 1JR8A 1S7ZA 2J9WA 3IQTA 3KL4A 4PACA 2A0UA 5KYUA 3PDMP 1CGME 3AG4C 3TOMA 1CGOA 5A6BA 3NMJA 2A69F 4U5DE 3ZIBA 4YN0B 1ZHXA 4J32B 1J8YF 4MW3A 4YT8A 2L6HA 4U5FE 2NUTB 2P1AA 3AQBA 3SYNA 3T6JA 3CZ6A 4FWVA 3DMDA 4MVOA 3HJCA 4OIOF 4J7TA 3M1CB 4E17A 3AGTA 2CW0F 3JYYA 2LIGA 4MVZA 4MVRA 1M2VB 3W8IA 4L6RA 1ZHTA 3PHF2 2R03A 1FR0A 1G5ZA 2R7UA 5JSLA 4N6CA 1JRAA 2LK4A 1NFNA 3U3BA 1HMOA 3B0UX 2VB6A 3B29A 3Q7GA 1HW1A 3C18A 1T6IA 2YLDA 4XPXA 3WG7C 2HUJA 3DE9A 4O6MA 1E2XA 3S27A 3A9CA 3LAYA 1CPQA 2XM0A 4CSAC 3ECSA 5B3IA 5EHHA 5JRAA 1YA7O 4KBLA 4AE4B 4EUKB 4CJGA 4CS8C 3H2UA 2Z15A 1RKEB 5CI8A 3NG1A 3QZCA 4JCZA 2HMZA 3U8VA 2XRHA 4C3BA 3G50A 4EHPA 4C7OA 4JE9A 2KC3A 4HFKB 4P9FA 1HMDA 3TOLA 2BE5F 1DOVA 1TKNA 2GDCA 1Z7Qc 3S84A 4DJ9A 3NYMA 3EHMA 1TWGA 2R7TA 3K1IC 1M6TA 2A0BA 3CSKA 1Q0DA 3DI5A 5A69A 3FHDA 5JUAA 3KYIA 3KH2A 1AEPA 2KQ9A 2Q9CA 2XLDA 4RD9A 3EZIA 5DVWA 2IXPA 2ZXOA 2XLOA 1VB5A 2OKUA 4AE4A 3S29A 2HSBA 3GM1A 1OXBA 1YYXA 2Y3HA 2OCCC 5BQIA 3E9VA 3NRHA 3VAYA 1HW2A 4MTGA 4YWQA 5DS5A 4G0HA 4Z9JA 3LNMB 2R7OA 1M57C 2HKVA 2X0CA 2BC5A 1H6GA 3TK0A 1MMDA 4XEKA 1SF8A 3AG1C 4D4NA 2R7SA 1YDIA 4OIPF 1U89A 3GANA 1F1MA 3GWLA 1ZHWA 2XS8A 3S28A 4X0RA 2KYHA 3LLKA 4YT4A 4EIYA 4QDLA 1NU9C 4CDVA 3T4RA 2ZXWC 2A6EF 2EINC
chains in the Genus database with same CATH topology
4WABA 4AL0A 2H8AA 4NTFA 3HKKA 4JC7A 4NTBA 4BPMA 2PNOA 5BQGA 4JRZA 4NTAA 5BQIA 5HV9A 4YL0A 4JCZA 4J7TA 4J7YA 4YL1A 5K0IA 3PCVA 2UUIA 4AL1A 5BQHA 4YL3A 2UUHA 3LEOA 3B29A 4YK5A 3DWWA 2Q7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAB A;  4AL0 A;  2H8A A;  4NTF A;  3HKK A;  4JC7 A;  4NTB A;  4BPM A;  2PNO A;  5BQG A;  4JRZ A;  4NTA A;  5BQI A;  5HV9 A;  4YL0 A;  4JCZ A;  4J7T A;  4J7Y A;  4YL1 A;  5K0I A;  3PCV A;  2UUI A;  4AL1 A;  5BQH A;  4YL3 A;  2UUH A;  3LEO A;  3B29 A;  4YK5 A;  3DWW A;  2Q7R A; 
#chains in the Genus database with same CATH topology
 2WVN A;  3JT1 A;  3B9Q A;  2ICW G;  3HKK A;  1WAT A;  3EH2 A;  3Q6N A;  4E7S A;  4H54 A;  1UFB A;  1U0B B;  3F46 A;  3K33 A;  4EWC A;  3MBG A;  2L9J A;  2R7V A;  3I5Q A;  4LLE A;  2AWY A;  2J7P D;  1FNT c;  4E0I A;  3KPH A;  1NSG B;  3L0I A;  3US6 A;  3EGX A;  1WTY A;  4JW1 A;  5KYX A;  4MVS A;  2M64 A;  3LLI A;  4WJ0 A;  4BJ6 A;  3ZSU A;  4A2N B;  1RKC A;  1TWA A;  4PFO A;  1A0B A;  4DVY P;  1EI7 A;  4JTD B;  4Z9H A;  5FZT A;  3V5Z A;  5AC4 A;  1OQC A;  3K6B A;  3S0X A;  4NCQ A;  3ZC4 A;  2PFD A;  2YL0 A;  1OCC C;  2CNW A;  3H2V A;  5A6A A;  4JEB A;  1PCX A;  1ORY A;  1HE9 A;  3B0P A;  2LSE A;  2NSF A;  2EIK C;  2OOC A;  2Q4F A;  2WL8 A;  4MTO A;  3TD7 A;  1GGQ A;  4XEV A;  2EIJ C;  2H7O A;  5EGY A;  4JEA A;  2OJQ A;  2QY9 A;  3S90 A;  1QZX A;  1XWJ A;  1C03 A;  2XLH A;  3SXZ A;  4KC9 A;  3E70 C;  4G7O F;  4MVQ A;  3U8P A;  2P7V A;  3ATP A;  3JRM O;  4J7Y A;  4RDA A;  2EPL X;  2NG1 A;  2ETS A;  2MYS A;  2EPK X;  3AJM A;  3HNL A;  4IRU A;  3AG3 C;  1VOM A;  5E2Q A;  3RF3 A;  4BJT A;  2XL8 A;  3O6X A;  3QTH A;  4Q4Z F;  1D0Z A;  4HEA J;  2R7R A;  1ORJ A;  3DAG A;  3Q7L A;  1RMV A;  1A7D A;  2P6V A;  1BR2 A;  2IM8 A;  2Q9A A;  4ZLD A;  5KYY B;  2YQY A;  3LES A;  3RH3 A;  4HE8 D;  3IEE A;  1FFT C;  2V26 A;  5A6K A;  4M63 A;  4Q5S F;  3ASO C;  1PD0 A;  1RJ9 B;  5BQG A;  1O5H A;  5B1B C;  5A6J A;  1K40 A;  1YAU O;  2VCC A;  4XQ1 A;  2IOQ A;  2PP4 A;  3LJB A;  2DI3 A;  1OW8 A;  1Y4C A;  2J8W A;  3IQ5 A;  1ZW2 A;  4JIO A;  1E84 A;  1Q0G A;  5JS5 A;  2GA0 A;  4P6I C;  4YT2 A;  3SP1 A;  1MQV A;  4MND A;  1QVX A;  4NY3 A;  3EG9 B;  4LDK A;  2PX3 A;  5L0J A;  1EQ1 A;  1Z63 A;  4WGY A;  2L81 A;  2HMQ A;  5KYY A;  1NLX A;  4JKV A;  1O87 A;  1FAP B;  2E87 A;  3SNH A;  1NBB A;  2UUH A;  4H4K C;  1QLE C;  2AVK A;  4JTC B;  4K1O A;  1LE4 A;  4Q7C A;  3RW0 A;  2GAQ A;  4P9T A;  2CDQ A;  4CS9 A;  5IY5 C;  4XPW A;  1U6H A;  3L1M A;  4LLC A;  3B0V C;  3CAX A;  1DOW A;  1I4Z A;  3EFO B;  1WWP A;  5L3V A;  2QLA A;  2NUT A;  4B6I A;  4DRH B;  4I1O B;  5DS4 A;  1APC A;  3C8G D;  4MW8 A;  3HLZ A;  3JYH A;  2CGE A;  3UNG C;  2R05 A;  4CBE A;  3EG9 A;  4JUR I;  3NMI A;  2XLV A;  1M2V A;  1YA9 A;  1YVI A;  3I5P A;  4JJG A;  2P0N A;  3DE8 A;  1D1C A;  1LPE A;  3L8J A;  3GWN A;  1JOG A;  3DJN B;  2FFH A;  3LNR A;  2KNH A;  4XTK A;  2J9B A;  2R25 A;  1OKK A;  2XL6 A;  3LEV A;  1OW7 A;  3ASN C;  1I4Y A;  2YRF A;  1XZP A;  2HV7 A;  2KJG A;  3DD7 A;  5B1A C;  2OEX A;  3VM6 A;  2IXM A;  3NYJ A;  3UMK A;  2XLM A;  1E83 A;  3DM9 B;  3EFO A;  3UR3 C;  5HSW A;  1S05 A;  2YZS A;  1VLS A;  4U5C E;  4BEM J;  5L0I A;  1G8X A;  1TWC A;  1Q0F A;  3JTL O;  3DAF A;  1G4U S;  2A1D D;  1G4W R;  4NTB A;  4O79 A;  1QPU A;  1C17 M;  1ST6 A;  4U5H A;  1T9K A;  4U9D A;  4DBR A;  4EKW A;  3DZA A;  3IQ6 A;  2R7W A;  1RKE A;  5DQT A;  4I3M A;  3IQC A;  1RXQ A;  3ZVR A;  1VTM P;  2WZG A;  1MMN A;  4CDA A;  3OWT A;  3UMH A;  1AUE A;  4O6Y A;  1FMV A;  2R7X A;  5KYW B;  3HTK C;  4KI2 A;  4MQ9 F;  2CYD A;  3JZ0 A;  3L8I A;  4ANJ A;  2AP3 A;  4DBQ A;  4I44 A;  1B68 A;  3ABM C;  3POV A;  1WGW A;  1WAS A;  4MTF A;  3BEH A;  2JD3 A;  4GEH A;  4CIP A;  1LI7 A;  2FGY A;  3EZH A;  5T3T A;  3S9O A;  3MYI A;  2RD9 A;  1YAR O;  2C03 A;  4LAC B;  4NTF A;  4CSA A;  4JC7 A;  3T6G B;  3W2V A;  2D5R B;  3AG2 C;  3M15 A;  5GPG B;  4CS8 A;  3SXK A;  3TUL A;  2G62 A;  2HSQ A;  256B A;  1L7C A;  4YT5 A;  3K7D A;  3FVY A;  1OW6 A;  4W8P A;  5L0F A;  2R9R B;  4IAO A;  1YYJ A;  4PFP A;  1FFH A;  3M4B A;  5KYW A;  2ZXP A;  1VLT A;  1Z6A A;  2AU5 A;  2YVK A;  3MFN A;  1ZVZ A;  1D0Y A;  2Y39 A;  3PMR A;  1D1B A;  1NFO A;  4JZA A;  2WB7 A;  3M79 A;  3K1I A;  3SEO A;  3Q6M A;  1LVK A;  2W4M A;  4IJJ A;  5DQZ A;  5BUO A;  2CNW D;  3QW1 A;  4DOZ A;  4E7Z A;  1RCP A;  3TQO A;  2G3K A;  5T1D B;  5COF A;  3U9M A;  1R5I D;  3DKA A;  2Y69 C;  2YHS A;  1Z23 A;  3O10 A;  3R7C A;  1V55 C;  5D91 A;  2OQM A;  2KSF A;  4YK5 A;  3RQF A;  4AL0 A;  1UG7 A;  1GM5 A;  2H7B A;  3QMK A;  2H7V C;  3EQL F;  1CGN A;  4XWJ A;  4BJ5 C;  2ASR A;  3CQZ A;  4G7Z F;  4J30 B;  4N06 A;  3ZG1 A;  3GM3 A;  1WOL A;  4IWB A;  1WN0 A;  3HNI A;  5TJ5 E;  4K7B A;  4BEJ A;  2QE9 A;  2JPU A;  4DRJ B;  5A6B D;  2XXA B;  3GOR A;  2YL7 A;  4K0D A;  5E3C A;  5JLI A;  2HV6 A;  2C04 A;  2W4B A;  2J0X A;  1OR2 A;  2XSE A;  2Q00 A;  4IAQ A;  3SXM A;  2M4E A;  3MX3 A;  4CDY A;  2J7P A;  1V74 B;  3V5Y A;  3DJU B;  5BQH A;  2HJM A;  1Z5Z A;  4YL3 A;  2MWQ A;  3FMS A;  2D4U A;  4JVS A;  2OG2 A;  1IZM A;  1I5N A;  2NUP B;  3T6B A;  3WOD F;  4GQH A;  1LE2 A;  1E86 A;  1TFK B;  2LCH A;  3CEX A;  4PJJ A;  2O9X A;  1EA8 A;  2YKZ A;  1TR2 A;  3KKB A;  4GYT A;  3NKE A;  3VRC A;  4CX9 A;  5KYU B;  4KNW A;  1YZA A;  3R2P A;  2PNO A;  3VYW A;  4C3D A;  2EPO A;  4JCH A;  4NQF A;  2HZ8 A;  2PX0 A;  5CIV A;  4UDV A;  2NPU A;  1JAF A;  2GWW A;  3OEO A;  4LDR A;  1H9T A;  3RYL A;  2LP4 A;  1T6Q A;  3RQE A;  2WZL A;  2IXN A;  3RKO F;  3NYL A;  1FTS A;  4CJO A;  1SYQ A;  1MMA A;  1JPN A;  2I15 A;  2UUI A;  4EBB A;  1A41 A;  1V4A A;  4BG0 A;  5F5H A;  3GEE A;  5L0D A;  3J06 A;  1HY5 A;  4BPM A;  1QSP A;  3V5X A;  4U9E A;  4ER9 A;  3BRJ A;  1T6U A;  2TMV P;  1RJ9 A;  3N24 A;  3FDQ A;  5T3W A;  3EJN A;  3ZDL A;  1FMW A;  1M2O A;  1QQ3 A;  2R7Q A;  2XLW A;  4YJW A;  2LFD A;  2YWA A;  4OD4 A;  2P61 A;  4JRZ A;  3RFY A;  4AX2 A;  5AC5 A;  2G3V A;  3QW0 A;  3EHN A;  4N6H A;  5COG A;  1KNY A;  2OU6 A;  2XS1 A;  4KNV A;  3UMI A;  4DRI B;  2ZD9 A;  3OA1 A;  1OKK D;  3RVZ A;  3LS1 A;  1H7I A;  2AWC A;  2YL1 A;  4O6N A;  2PBE A;  1N1C A;  3C7J A;  1NZE A;  1VYK A;  2L7A A;  4FAP B;  3FOO A;  3MYF A;  1T5O A;  3FAP B;  1ZU4 A;  2R02 A;  2ZXR A;  2B0H A;  4YL1 A;  2XL4 A;  3C8G B;  3PCV A;  4PJN A;  1NU7 D;  4C7O B;  3JRT A;  1OCR C;  3G4Z A;  2Y3G A;  3JSZ A;  3U5S A;  3U0C A;  1YJG A;  1VMA A;  2EPN A;  2KW3 C;  3ITF A;  3LEO A;  4W8K A;  3GEI A;  5JP7 A;  3W4Y A;  1L3P A;  3NMK A;  3U9J A;  2J9V A;  2IXO A;  2IYL D;  2LFF A;  5B3S C;  1PD1 A;  4OD5 A;  2VAS A;  4JJF A;  2VCB A;  1Z3I X;  4A4A A;  1OXK A;  2HJ3 A;  3VF0 A;  1KTM A;  2J45 A;  1AVO B;  4NTA A;  4XEF A;  2I8B A;  1LIH A;  3ZQV A;  2YLG A;  2A6H F;  3EH1 A;  1C02 A;  4EBK A;  3W8H A;  1SR2 A;  5L0C A;  3UGO A;  4XPY A;  2J46 A;  1YZC A;  3GOD A;  3HNJ A;  4Z9I A;  1XZQ A;  3ZWI A;  3GM2 A;  2DYR C;  4JTA B;  4N4W A;  2B0J A;  3C8G A;  3FXH A;  4DVZ A;  3EGD B;  3M4C A;  1VK5 A;  3U2M A;  1BZ4 A;  3U3F A;  3ZTZ A;  2HFI A;  4AK9 A;  4F4B A;  1ZYR F;  4O7G A;  3V7O A;  5L3Q A;  4XLN F;  3LUT B;  1H9G A;  4XLP F;  4ULW A;  5L0G A;  1LS1 A;  2DB4 A;  2ZPA A;  3G4X A;  4OIN F;  2HS5 A;  4BJ6 C;  3ZTM A;  1TFO B;  4R32 A;  2WVQ A;  4E0H A;  1OCO C;  3A11 A;  3DWW A;  3IHU A;  5K0I A;  1E85 A;  4QI0 A;  3WAQ A;  5L0H A;  2YLI A;  4LDQ A;  5FCL A;  4QI2 A;  4FES A;  2Q9B A;  2NSG A;  3RVY A;  5COM A;  4C3E A;  3H65 A;  2BL2 A;  4MS2 A;  1BBH A;  3FAJ A;  4E18 A;  4ZLC A;  1KU2 A;  2YL3 A;  2X51 A;  5CI9 A;  5EK0 A;  2DGJ A;  5HV9 A;  3U2L A;  1CPR A;  1SMY F;  2KK1 A;  2QNL A;  1BR4 A;  3EGD A;  3B71 A;  2J9U A;  3FOP A;  2VCA A;  2DYS C;  2QTV A;  4HFF B;  4MVM A;  2PF4 E;  3N0T A;  4BJ1 A;  2IBF A;  3EGX B;  1GQA A;  1ZHZ A;  2YEV A;  3O55 A;  5JT4 A;  1ZW3 A;  5KYX B;  2OEV A;  3SXY A;  2WZF A;  4AL1 A;  3X2Q C;  5DLJ A;  3EPV A;  1A7E A;  1K04 A;  2F22 A;  3WHN A;  3ABL C;  2VH3 A;  3KMI A;  1HE1 A;  1BR1 A;  3DXJ F;  2MHR A;  1ZU5 A;  3AOU A;  1K05 A;  3QVY A;  4IB4 A;  5F5F A;  3UGP A;  1M56 C;  4OIR F;  3HNK A;  3O39 A;  3AQC A;  1MNE A;  2WVO A;  1ZHY A;  3C63 A;  1LKX A;  1NG1 A;  2Q3T A;  3LS0 A;  5D92 A;  3AGU A;  1D1A A;  5E33 A;  4OIQ F;  3L34 A;  4D4X A;  2GFH A;  1T01 A;  1ZZP A;  1IW7 F;  2A68 F;  4FX5 A;  2EIM C;  3RQG A;  4MVU A;  1A7V A;  3DM5 A;  4IAR A;  4U5B E;  1OR3 A;  1ORS C;  5E3A A;  2OJE D;  4PJM A;  3X1O A;  4G7H F;  3NKD A;  4WGZ A;  4ULV A;  2KGO A;  3W2W A;  1LI5 A;  2L6G A;  1V54 C;  1PV3 A;  4LER A;  1MND A;  2Y3D A;  3ABK C;  1O3U A;  2XM4 A;  3F47 A;  4PR9 A;  2Q7R A;  4WAB A;  1Q0K A;  1YLM A;  2H8A A;  2Y3B A;  1W2W A;  2EPM X;  2QUP A;  3K66 A;  3N2Z B;  3TJ6 A;  1D0X A;  4G78 A;  4CS7 A;  3I4U A;  4CS9 C;  4DXW A;  4IGG A;  4U5E E;  3ZQY A;  2XXA A;  2W9Y A;  2JX0 A;  3GEH A;  1MMG A;  3JSE O;  2W45 A;  4U5G A;  4EBJ A;  1SZI A;  3KYJ A;  1BDJ B;  4YL0 A;  1EKY A;  3T9O A;  1R4T A;  4CIH A;  4ONS A;  4PK4 A;  3NDB B;  5JVE A;  3JCU Q;  3MLG A;  3QVZ A;  1Y6D A;  4PJL A;  4RBN A;  5KYN A;  1Q0M A;  1OCZ C;  2L6F A;  2RSE B;  1JMW A;  2FAP B;  2LD6 A;  1TWH A;  2EIL C;  3K1H A;  1LS4 A;  4I1M A;  4NC3 A;  2VC9 A;  3RIP A;  3TJ5 A;  2V3C C;  2J0W A;  1GS9 A;  5DS6 A;  1QKR A;  1VYI A;  1J8M F;  2NUP A;  3C62 A;  3C8Z A;  2LQG A;  4BJ5 A;  2XLE A;  3SZR A;  1JPJ A;  2CCY A;  5AGF A;  3IPM O;  1LM3 B;  1TQG A;  5F28 E;  1JR8 A;  1S7Z A;  2J9W A;  3IQT A;  3KL4 A;  4PAC A;  2A0U A;  5KYU A;  3PDM P;  1CGM E;  3AG4 C;  3TOM A;  1CGO A;  5A6B A;  3NMJ A;  2A69 F;  4U5D E;  3ZIB A;  4YN0 B;  1ZHX A;  4J32 B;  1J8Y F;  4MW3 A;  4YT8 A;  2L6H A;  4U5F E;  2NUT B;  2P1A A;  3AQB A;  3SYN A;  3T6J A;  3CZ6 A;  4FWV A;  3DMD A;  4MVO A;  3HJC A;  4OIO F;  4J7T A;  3M1C B;  4E17 A;  3AGT A;  2CW0 F;  3JYY A;  2LIG A;  4MVZ A;  4MVR A;  1M2V B;  3W8I A;  4L6R A;  1ZHT A;  3PHF 2;  2R03 A;  1FR0 A;  1G5Z A;  2R7U A;  5JSL A;  4N6C A;  1JRA A;  2LK4 A;  1NFN A;  3U3B A;  1HMO A;  3B0U X;  2VB6 A;  3B29 A;  3Q7G A;  1HW1 A;  3C18 A;  1T6I A;  2YLD A;  4XPX A;  3WG7 C;  2HUJ A;  3DE9 A;  4O6M A;  1E2X A;  3S27 A;  3A9C A;  3LAY A;  1CPQ A;  2XM0 A;  4CSA C;  3ECS A;  5B3I A;  5EHH A;  5JRA A;  1YA7 O;  4KBL A;  4AE4 B;  4EUK B;  4CJG A;  4CS8 C;  3H2U A;  2Z15 A;  1RKE B;  5CI8 A;  3NG1 A;  3QZC A;  4JCZ A;  2HMZ A;  3U8V A;  2XRH A;  4C3B A;  3G50 A;  4EHP A;  4C7O A;  4JE9 A;  2KC3 A;  4HFK B;  4P9F A;  1HMD A;  3TOL A;  2BE5 F;  1DOV A;  1TKN A;  2GDC A;  1Z7Q c;  3S84 A;  4DJ9 A;  3NYM A;  3EHM A;  1TWG A;  2R7T A;  3K1I C;  1M6T A;  2A0B A;  3CSK A;  1Q0D A;  3DI5 A;  5A69 A;  3FHD A;  5JUA A;  3KYI A;  3KH2 A;  1AEP A;  2KQ9 A;  2Q9C A;  2XLD A;  4RD9 A;  3EZI A;  5DVW A;  2IXP A;  2ZXO A;  2XLO A;  1VB5 A;  2OKU A;  4AE4 A;  3S29 A;  2HSB A;  3GM1 A;  1OXB A;  1YYX A;  2Y3H A;  2OCC C;  5BQI A;  3E9V A;  3NRH A;  3VAY A;  1HW2 A;  4MTG A;  4YWQ A;  5DS5 A;  4G0H A;  4Z9J A;  3LNM B;  2R7O A;  1M57 C;  2HKV A;  2X0C A;  2BC5 A;  1H6G A;  3TK0 A;  1MMD A;  4XEK A;  1SF8 A;  3AG1 C;  4D4N A;  2R7S A;  1YDI A;  4OIP F;  1U89 A;  3GAN A;  1F1M A;  3GWL A;  1ZHW A;  2XS8 A;  3S28 A;  4X0R A;  2KYH A;  3LLK A;  4YT4 A;  4EIY A;  4QDL A;  1NU9 C;  4CDV A;  3T4R A;  2ZXW C;  2A6E F;  2EIN C; 
#chains in the Genus database with same CATH homology
 4WAB A;  4AL0 A;  2H8A A;  4NTF A;  3HKK A;  4JC7 A;  4NTB A;  4BPM A;  2PNO A;  5BQG A;  4JRZ A;  4NTA A;  5BQI A;  5HV9 A;  4YL0 A;  4JCZ A;  4J7T A;  4J7Y A;  4YL1 A;  5K0I A;  3PCV A;  2UUI A;  4AL1 A;  5BQH A;  4YL3 A;  2UUH A;  3LEO A;  3B29 A;  4YK5 A;  3DWW A;  2Q7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...