4BPMA

Crystal structure of a human integral membrane enzyme
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
b'SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE, FUSION PEPTIDE
molecule tags Isomerase
source organism Homo sapiens
publication title Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
pubmed doi rcsb
total genus 66
structure length 162
sequence length 162
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4bpmA00
3DWWA 4JC7A 4AL0A 5BQIA 5HV9A 3HKKA 2PNOA 5K0IA 4YL1A 3PCVA 4WABA 2UUHA 4YK5A 3LEOA 2H8AA 4JCZA 3B29A 5BQGA 5BQHA 4YL0A 4NTFA 4J7YA 4JRZA 2UUIA 4J7TA 4NTAA 4YL3A 4AL1A 2Q7RA 4BPMA 4NTBA
chains in the Genus database with same CATH superfamily
1WATA 3SXMA 3RYLA 4N6HA 5HV9A 2G3KA 4O6NA 3V7OA 3U9JA 2R7SA 2J9VA 1NU9C 1GM5A 2I15A 3K6BA 1QVXA 2W9YA 1D0YA 4KC9A 5TJ5E 3U8PA 2P61A 4ULWA 1HW2A 1I4ZA 2J46A 1ZU4A 3S28A 2RSEB 3M15A 3N2ZB 2GFHA 4YK5A 4OIPF 1S05A 2OOCA 3GEEA 2L6FA 4JCZA 4JKVA 3EPVA 3EGXA 1YAUO 3KMIA 1ZZPA 3HNKA 2AU5A 2CGEA 2OJED 2ZXRA 3DE9A 4YL0A 3TJ5A 3T9OA 3IEEA 5DS4A 4PACA 2X51A 5HSWA 1MQVA 1OR3A 2Z15A 3FHDA 4IB4A 4CDAA 1A7EA 2GAQA 2M64A 2QE9A 2NUTA 1T01A 4BJTA 2WVQA 4JCHA 4F4BA 4HEAJ 4NTBA 1FFTC 2A0UA 5JT4A 5L0CA 3JSZA 3GEIA 3DMDA 1XWJA 3EH1A 2A68F 4MW3A 3GM2A 3IQ5A 1H9GA 4JW1A 3ZG1A 3U8VA 4JTAB 3M4CA 3PCVA 4YT5A 4EBBA 4AE4B 2HS5A 3U3FA 4MVOA 4EUKB 4XEFA 2EINC 2OEXA 3NYJA 1OCCC 3U2LA 5DQTA 3IQCA 1NFNA 4DOZA 3K33A 4XPWA 1Y6DA 4JJGA 3HJCA 5CI8A 3JYHA 3UMHA 3ZWIA 1FNTc 2YEVA 2CNWD 1YZAA 1O5HA 2ZPAA 3FMSA 1ZW2A 2KSFA 3EG9B 3M79A 4U9EA 1RJ9B 3L0IA 3TOLA 2YLIA 1PD1A 2NSGA 1LS1A 2J9UA 3C18A 5E33A 4CSAA 2P0NA 1SF8A 4BPMA 4J7TA 1UFBA 1Y4CA 3JYYA 2YLGA 3MBGA 3VYWA 5B3SC 3FOOA 3M4BA 1OW7A 1HY5A 4BEJA 1M2VB 3L34A 2HJMA 3W2WA 1CGME 3AGTA 1IW7F 1HMOA 4N6CA 4X0RA 5AGFA 4G7HF 1FFHA 1ORYA 1G4WR 4A4AA 5EHHA 1CGOA 3JT1A 3ZTZA 5A6JA 4PK4A 3QVYA 5A69A 4OD5A 2GDCA 2YL1A 1KNYA 3LAYA 3LEOA 1MMNA 4IAOA 4LERA 5A6KA 4C3BA 1Z3IX 5DVWA 2Q00A 2R7QA 3UMKA 1AEPA 5BQHA 4MTFA 1ORJA 1VYIA 4JTCB 3AG1C 3ZQYA 4MTOA 2J7PA 1U6HA 3NYMA 3G4ZA 4K0DA 4JZAA 5F28E 4Q7CA 4QI0A 3TK0A 5JUAA 1ZHXA 3EQLF 2YLDA 1A41A 1LVKA 3NKEA 3QVZA 1QLEC 4XQ1A 4YL3A 3RQEA 2CYDA 5COMA 5BUOA 4HFFB 4I44A 3DWWA 3SNHA 2VH3A 1R4TA 1GQAA 2OKUA 4WGZA 3TJ6A 3V5ZA 2NUPB 5BQIA 3R7CA 2IXOA 2OG2A 3DM5A 4N06A 4U5CE 3GM1A 5CI9A 3RFYA 3WODF 4YT2A 2R25A 1APCA 2IBFA 4I1OB 1K40A 5DQZA 2X0CA 3KYIA 1ZHZA 1V4AA 2DYRC 5KYYA 2A69F 4E7SA 3KL4A 3EG9A 2OU6A 1LI7A 1M2OA 2VASA 4JTDB 3W8IA 5DS5A 1BR2A 1Q0DA 2OQMA 2IM8A 1PV3A 3BEHA 3ZTMA 2PX3A 1H6GA 4P6IC 3SXYA 4DJ9A 5JRAA 1TWGA 1VMAA 2XLOA 2TMVP 4ULVA 4P9TA 5JP7A 4K1OA 3KH2A 3R2PA 1NU7D 1JOGA 2CCYA 3RVYA 4YT4A 3UNGC 4I1MA 3EFOA 5JLIA 4IGGA 2OEVA 2OJQA 1QZXA 2HSBA 3FAPB 1Z5ZA 5DLJA 2DI3A 3CSKA 2HV6A 3UGPA 1V55C 2L6HA 4MVQA 256BA 4NQFA 2EPMX 2XL8A 3O6XA 4BJ1A 4MVRA 4LLCA 4MVUA 1JR8A 2XL4A 3HLZA 1FTSA 1BBHA 1RJ9A 4G78A 2L9JA 3LJBA 4E7ZA 3B29A 3GWNA 1HE9A 1KU2A 2HUJA 4Q5SF 5L3VA 2DYSC 2E87A 4JEBA 4JURI 2XS8A 2LK4A 1D1AA 3ABMC 4PJJA 1Q0MA 2XXAB 1OKKD 1Q0GA 1XZPA 2A6EF 2AP3A 3K7DA 4AE4A 4XPYA 3LNMB 1ZU5A 2YQYA 4JC7A 3IPMO 1PD0A 2LIGA 1EA8A 3LLIA 2L81A 3RH3A 3T6BA 3Q7LA 1C03A 3IQ6A 5K0IA 3KKBA 2LCHA 1MMGA 4MTGA 4EKWA 2Q9AA 4UDVA 1TR2A 3NKDA 3W4YA 1DOVA 1H7IA 1V74B 3NYLA 3C8ZA 3JRTA 4U5BE 2EPKX 1WTYA 4EBJA 1OW8A 1VLTA 3EZIA 5COGA 1D1CA 2G3VA 2BE5F 3O39A 3L8IA 1ZVZA 1D0ZA 1E86A 3HNLA 4EHPA 4PFOA 1I4YA 5B1BC 3TULA 3DI5A 4QDLA 4PJMA 3LESA 4JEAA 3W2VA 3HNJA 3U9MA 2PF4E 2VCAA 1JRAA 3VM6A 3C8GB 1CGNA 1MMAA 3ATPA 4OD4A 3ABKC 4AL1A 4CS9C 3B71A 4ANJA 1KTMA 1R5ID 1V54C 3A11A 2KYHA 5KYUA 2G62A 3AJMA 1O3UA 3DJUB 2KW3C 4HE8D 3NG1A 1SMYF 3K1IC 3S90A 1NSGB 5CIVA 1JPNA 4IRUA 5E2QA 3HNIA 3N24A 2QTVA 2LSEA 3T6JA 1ZHYA 2XS1A 5T1DB 5L0IA 3LNRA 1WN0A 2EPOA 3EHNA 3MLGA 4CS8A 2KGOA 1WOLA 3B9QA 4NCQA 2YZSA 2AWCA 3L8JA 4LDQA 2W4MA 2HMQA 3CEXA 3NMIA 4XEKA 1JAFA 2L6GA 1IZMA 1S7ZA 4HFKB 2CNWA 2EIJC 4U5GA 1JPJA 3K66A 2YWAA 5L0FA 1WGWA 3EGXB 1LKXA 2UUIA 3H2UA 1EI7A 2WZLA 2HMZA 2OCCC 4LDRA 5EGYA 2R02A 1VK5A 1ZYRF 2QUPA 2XSEA 3F46A 2JPUA 3AOUA 1TWCA 4DRHB 1B68A 1MMDA 1H9TA 2GA0A 1FMWA 1QKRA 1RKEB 2HJ3A 2J9WA 1YA7O 5KYWA 4IARA 4RD9A 2IOQA 4FAPB 5GPGB 3QTHA 4WABA 4Q4ZF 1YA9A 2UUHA 2BL2A 3DKAA 4OIOF 1Z6AA 3CQZA 3DAFA 3JZ0A 1Z7Qc 4DVZA 3NDBB 2C04A 2J9BA 3L1MA 4PR9A 4DRJB 4R32A 2L7AA 5BQGA 4Z9JA 1E83A 4CS7A 4QI2A 5A6BA 3JTLO 4OINF 3C7JA 2FAPB 4IJJA 1M57C 3EJNA 2R7RA 1OCZC 3S0XA 2VCBA 3X1OA 3S9OA 2LFFA 4KNWA 3WHNA 3ZIBA 2J7PD 2Y3HA 1YYJA 2BC5A 3NMJA 3DD7A 1C17M 2MHRA 3E9VA 4D4XA 1Z63A 4JVSA 3DE8A 5AC5A 3IHUA 2ASRA 4CX9A 3RIPA 4GEHA 3GM3A 2KJGA 2Q9CA 1D1BA 3ABLC 5T3WA 3TQOA 3ZC4A 3GWLA 4K7BA 2YVKA 2WVNA 2YRFA 3ASNC 3S29A 3A9CA 2M4EA 1AVOB 3SYNA 2P6VA 3EHMA 2NPUA 2H8AA 3MFNA 4FESA 1U0BB 3OWTA 3ZVRA 1VYKA 1OW6A 1FMVA 2A0BA 2HV7A 2J0XA 3LUTB 3RQFA 4XLNF 5KYUB 2ZXOA 3PHF2 2FGYA 1W2WA 2XL6A 3PMRA 3V5YA 2NSFA 3B0VC 5KYWB 1ORSC 3G50A 3MYIA 4P9FA 2C03A 3OEOA 2V3CC 1HE1A 1C02A 1TWHA 1Z23A 3ITFA 3W8HA 4MVZA 4J32B 1TFKB 2V26A 3SXKA 3U0CA 3CAXA 1NG1A 1U89A 1OXKA 2D5RB 1A7VA 2HFIA 4L6RA 2Y69C 4DBRA 4WJ0A 2R7UA 2EIMC 2PFDA 2EIKC 2YHSA 4NC3A 1K04A 1VB5A 5JSLA 3WAQA 4E18A 4Z9IA 2A1DD 2RD9A 2R7WA 2P1AA 3GODA 2W45A 3HTKC 1LE2A 2HZ8A 2J45A 5B1AC 4CJOA 2ZXPA 3WG7C 2WZFA 3EGDA 4W8PA 3QW0A 1PCXA 4U5DE 5FCLA 1ZW3A 1Q0KA 2EILC 3UMIA 4CJGA 3ECSA 3CZ6A 3UGOA 4EIYA 4BEMJ 3V5XA 3B0UX 1OKKA 2LD6A 1YYXA 3EGDB 4IAQA 2R9RB 3SP1A 3G4XA 3BRJA 4EBKA 3SEOA 3DAGA 4O7GA 3U2MA 2PNOA 3ZDLA 1BDJB 3H2VA 1YJGA 3GANA 3NMKA 3TOMA 4DBQA 3LEVA 1DOWA 1TQGA 4XWJA 2R7OA 4CBEA 1M2VA 2J0WA 3UR3C 4CS8C 4E0IA 2R03A 4G0HA 4CDYA 2I8BA 2VC9A 2B0JA 1EQ1A 3AQBA 1O87A 3C8GD 4C3EA 1OQCA 4LACB 1T6UA 1ZHTA 1K05A 3JSEO 4RDAA 3Q7GA 4XLPF 4JRZA 2Q9BA 3SZRA 3RKOF 3LS0A 4CS9A 4MVSA 3C63A 4C3DA 5EK0A 1VLSA 2IXPA 2MYSA 5A6AA 2Q4FA 1QQ3A 1D0XA 3GEHA 4WGYA 1NZEA 4XTKA 3E70C 4CIPA 3I5PA 5KYXA 3FDQA 1YLMA 3F47A 3ZSUA 1EKYA 1J8MF 4BJ5C 2PBEA 2CDQA 1OR2A 2QNLA 2LP4A 2XRHA 3LS1A 2Y3DA 4U5EE 3AG2C 4BG0A 4BJ6C 2R7XA 5DS6A 4G7ZF 1YZCA 1M56C 2ZD9A 3C8GA 4H4KC 5KYYB 1Q0FA 1E85A 2B0HA 2IYLD 4DRIB 5JS5A 1N1CA 1OXBA 1XZQA 2NUPA 4NTAA 1CPRA 3RW0A 1UG7A 5E3CA 3OA1A 3EZHA 3C62A 5IY5C 1MNEA 5L0HA 4D4NA 4AL0A 3JCUQ 4U5HA 3FXHA 4MQ9F 3US6A 2R7VA 4KNVA 3Q6MA 3U5SA 3RVZA 2QY9A 3QZCA 2A6HF 3KYJA 3EFOB 4M63A 2F22A 4KBLA 3FVYA 2XLVA 2XLEA 4PJLA 2XM0A 2J8WA 1MNDA 3IQTA 2GWWA 1WASA 4KI2A 3MYFA 2JD3A 3U3BA 1G8XA 1YARO 1TFOB 2WVOA 4MNDA 3H65A 1OCRC 3QMKA 4J30B 5D92A 4BJ6A 3I4UA 3DXJF 4FX5A 4E0HA 2AWYA 2VCCA 4OIQF 2XXAA 5A6BD 1A7DA 4YWQA 4PJNA 3RQGA 1JMWA 1QSPA 1ST6A 4W8KA 4CDVA 4E17A 1T5OA 3I5QA 1E84A 1G4US 2LQGA 2W4BA 1AUEA 2DGJA 4FWVA 4GYTA 5L0JA 4O79A 2NG1A 4MW8A 1FR0A 4YJWA 3T6GB 5L3QA 3SXZA 2H7VC 1LS4A 4XPXA 4Z9HA 1LIHA 2LFDA 1I5NA 1VOMA 4MVMA 5D91A 4JE9A 2XLDA 3M1CB 2XLHA 2PP4A 3QW1A 3T4RA 2YL0A 4CIHA 2Y39A 3K1HA 4O6YA 3B0PA 3PDMP 1YDIA 1HW1A 1ZHWA 5T3TA 2H7BA 1VTMP 4G7OF 4IWBA 2R05A 5AC4A 4JIOA 1LI5A 1F1MA 1CPQA 1RXQA 2H7OA 2QLAA 2YL3A 4PFPA 2YKZA 3VF0A 1YVIA 4ER9A 3ZQVA 2HKVA 3O10A 4OIRF 1QPUA 1T6IA 1GS9A 2HSQA 2R7TA 2KC3A 2D4UA 1J8YF 2WZGA 4U9DA 5KYXB 5L0DA 3DZAA 1G5ZA 3KPHA 3MX3A 1RKEA 4ZLCA 1TKNA 2FFHA 4LLEA 3RF3A 5FZTA 2PX0A 2WL8A 3Q6NA 4ZLDA 2O9XA 1LPEA 1A0BA 1OCOC 1RKCA 3TD7A 3HKKA 2NUTB 1L7CA 2IXNA 3JRMO 2YL7A 2KNHA 4MS2A 3FOPA 4U5FE 5JVEA 3EH2A 1SZIA 4C7OB 1L3PA 2VB6A 2DB4A 3X2QC 4AX2A 3AG3C 4N4WA 2Q3TA 2EPLX 4LDKA 3J06A 3AQCA 3NRHA 3VRCA 1FAPB 1RMVA 4H54A 4J7YA 1BR4A 1GGQA 4ONSA 3POVA 1M6TA 2EPNA 2Y3BA 1TWAA 1T9KA 2ICWG 4A2NB 2Q7RA 4O6MA 1SR2A 3DM9B 3N0TA 4B6IA 4BJ5A 4YN0B 3ASOC 2XM4A 4JJFA 5F5HA 3AGUA 1BR1A 2XLWA 4EWCA 1LM3B 4YL1A 3DJNB 2AVKA 2CW0F 4AK9A 4C7OA 4RBNA 2ZXWC 5E3AA 4YT8A 3K1IA 1NFOA 4DVYP 3S84A 5F5FA 1E2XA 5KYNA 1SYQA 2P7VA 2ETSA 5COFA 2Y3GA 1BZ4A 3GORA 3FAJA 3O55A 3S27A 4I3MA 1NBBA 3VAYA 1LE4A 2KK1A 1WWPA 5L0GA 1T6QA 2MWQA 5B3IA 3AG4C 4NTFA 2IXMA 2JX0A 4GQHA 4DXWA 2KQ9A 4XEVA 1NLXA 4NY3A 2WB7A 1RCPA 2XLMA 4CSAC 1HMDA 3LLKA
chains in the Genus database with same CATH topology
3DWWA 4JC7A 4AL0A 5BQIA 5HV9A 3HKKA 2PNOA 5K0IA 4YL1A 3PCVA 4WABA 2UUHA 4YK5A 3LEOA 2H8AA 4JCZA 3B29A 5BQGA 5BQHA 4YL0A 4NTFA 4J7YA 4JRZA 2UUIA 4J7TA 4NTAA 4YL3A 4AL1A 2Q7RA 4BPMA 4NTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWW A;  4JC7 A;  4AL0 A;  5BQI A;  5HV9 A;  3HKK A;  2PNO A;  5K0I A;  4YL1 A;  3PCV A;  4WAB A;  2UUH A;  4YK5 A;  3LEO A;  2H8A A;  4JCZ A;  3B29 A;  5BQG A;  5BQH A;  4YL0 A;  4NTF A;  4J7Y A;  4JRZ A;  2UUI A;  4J7T A;  4NTA A;  4YL3 A;  4AL1 A;  2Q7R A;  4BPM A;  4NTB A; 
#chains in the Genus database with same CATH topology
 1WAT A;  3SXM A;  3RYL A;  4N6H A;  5HV9 A;  2G3K A;  4O6N A;  3V7O A;  3U9J A;  2R7S A;  2J9V A;  1NU9 C;  1GM5 A;  2I15 A;  3K6B A;  1QVX A;  2W9Y A;  1D0Y A;  4KC9 A;  5TJ5 E;  3U8P A;  2P61 A;  4ULW A;  1HW2 A;  1I4Z A;  2J46 A;  1ZU4 A;  3S28 A;  2RSE B;  3M15 A;  3N2Z B;  2GFH A;  4YK5 A;  4OIP F;  1S05 A;  2OOC A;  3GEE A;  2L6F A;  4JCZ A;  4JKV A;  3EPV A;  3EGX A;  1YAU O;  3KMI A;  1ZZP A;  3HNK A;  2AU5 A;  2CGE A;  2OJE D;  2ZXR A;  3DE9 A;  4YL0 A;  3TJ5 A;  3T9O A;  3IEE A;  5DS4 A;  4PAC A;  2X51 A;  5HSW A;  1MQV A;  1OR3 A;  2Z15 A;  3FHD A;  4IB4 A;  4CDA A;  1A7E A;  2GAQ A;  2M64 A;  2QE9 A;  2NUT A;  1T01 A;  4BJT A;  2WVQ A;  4JCH A;  4F4B A;  4HEA J;  4NTB A;  1FFT C;  2A0U A;  5JT4 A;  5L0C A;  3JSZ A;  3GEI A;  3DMD A;  1XWJ A;  3EH1 A;  2A68 F;  4MW3 A;  3GM2 A;  3IQ5 A;  1H9G A;  4JW1 A;  3ZG1 A;  3U8V A;  4JTA B;  3M4C A;  3PCV A;  4YT5 A;  4EBB A;  4AE4 B;  2HS5 A;  3U3F A;  4MVO A;  4EUK B;  4XEF A;  2EIN C;  2OEX A;  3NYJ A;  1OCC C;  3U2L A;  5DQT A;  3IQC A;  1NFN A;  4DOZ A;  3K33 A;  4XPW A;  1Y6D A;  4JJG A;  3HJC A;  5CI8 A;  3JYH A;  3UMH A;  3ZWI A;  1FNT c;  2YEV A;  2CNW D;  1YZA A;  1O5H A;  2ZPA A;  3FMS A;  1ZW2 A;  2KSF A;  3EG9 B;  3M79 A;  4U9E A;  1RJ9 B;  3L0I A;  3TOL A;  2YLI A;  1PD1 A;  2NSG A;  1LS1 A;  2J9U A;  3C18 A;  5E33 A;  4CSA A;  2P0N A;  1SF8 A;  4BPM A;  4J7T A;  1UFB A;  1Y4C A;  3JYY A;  2YLG A;  3MBG A;  3VYW A;  5B3S C;  3FOO A;  3M4B A;  1OW7 A;  1HY5 A;  4BEJ A;  1M2V B;  3L34 A;  2HJM A;  3W2W A;  1CGM E;  3AGT A;  1IW7 F;  1HMO A;  4N6C A;  4X0R A;  5AGF A;  4G7H F;  1FFH A;  1ORY A;  1G4W R;  4A4A A;  5EHH A;  1CGO A;  3JT1 A;  3ZTZ A;  5A6J A;  4PK4 A;  3QVY A;  5A69 A;  4OD5 A;  2GDC A;  2YL1 A;  1KNY A;  3LAY A;  3LEO A;  1MMN A;  4IAO A;  4LER A;  5A6K A;  4C3B A;  1Z3I X;  5DVW A;  2Q00 A;  2R7Q A;  3UMK A;  1AEP A;  5BQH A;  4MTF A;  1ORJ A;  1VYI A;  4JTC B;  3AG1 C;  3ZQY A;  4MTO A;  2J7P A;  1U6H A;  3NYM A;  3G4Z A;  4K0D A;  4JZA A;  5F28 E;  4Q7C A;  4QI0 A;  3TK0 A;  5JUA A;  1ZHX A;  3EQL F;  2YLD A;  1A41 A;  1LVK A;  3NKE A;  3QVZ A;  1QLE C;  4XQ1 A;  4YL3 A;  3RQE A;  2CYD A;  5COM A;  5BUO A;  4HFF B;  4I44 A;  3DWW A;  3SNH A;  2VH3 A;  1R4T A;  1GQA A;  2OKU A;  4WGZ A;  3TJ6 A;  3V5Z A;  2NUP B;  5BQI A;  3R7C A;  2IXO A;  2OG2 A;  3DM5 A;  4N06 A;  4U5C E;  3GM1 A;  5CI9 A;  3RFY A;  3WOD F;  4YT2 A;  2R25 A;  1APC A;  2IBF A;  4I1O B;  1K40 A;  5DQZ A;  2X0C A;  3KYI A;  1ZHZ A;  1V4A A;  2DYR C;  5KYY A;  2A69 F;  4E7S A;  3KL4 A;  3EG9 A;  2OU6 A;  1LI7 A;  1M2O A;  2VAS A;  4JTD B;  3W8I A;  5DS5 A;  1BR2 A;  1Q0D A;  2OQM A;  2IM8 A;  1PV3 A;  3BEH A;  3ZTM A;  2PX3 A;  1H6G A;  4P6I C;  3SXY A;  4DJ9 A;  5JRA A;  1TWG A;  1VMA A;  2XLO A;  2TMV P;  4ULV A;  4P9T A;  5JP7 A;  4K1O A;  3KH2 A;  3R2P A;  1NU7 D;  1JOG A;  2CCY A;  3RVY A;  4YT4 A;  3UNG C;  4I1M A;  3EFO A;  5JLI A;  4IGG A;  2OEV A;  2OJQ A;  1QZX A;  2HSB A;  3FAP B;  1Z5Z A;  5DLJ A;  2DI3 A;  3CSK A;  2HV6 A;  3UGP A;  1V55 C;  2L6H A;  4MVQ A;  256B A;  4NQF A;  2EPM X;  2XL8 A;  3O6X A;  4BJ1 A;  4MVR A;  4LLC A;  4MVU A;  1JR8 A;  2XL4 A;  3HLZ A;  1FTS A;  1BBH A;  1RJ9 A;  4G78 A;  2L9J A;  3LJB A;  4E7Z A;  3B29 A;  3GWN A;  1HE9 A;  1KU2 A;  2HUJ A;  4Q5S F;  5L3V A;  2DYS C;  2E87 A;  4JEB A;  4JUR I;  2XS8 A;  2LK4 A;  1D1A A;  3ABM C;  4PJJ A;  1Q0M A;  2XXA B;  1OKK D;  1Q0G A;  1XZP A;  2A6E F;  2AP3 A;  3K7D A;  4AE4 A;  4XPY A;  3LNM B;  1ZU5 A;  2YQY A;  4JC7 A;  3IPM O;  1PD0 A;  2LIG A;  1EA8 A;  3LLI A;  2L81 A;  3RH3 A;  3T6B A;  3Q7L A;  1C03 A;  3IQ6 A;  5K0I A;  3KKB A;  2LCH A;  1MMG A;  4MTG A;  4EKW A;  2Q9A A;  4UDV A;  1TR2 A;  3NKD A;  3W4Y A;  1DOV A;  1H7I A;  1V74 B;  3NYL A;  3C8Z A;  3JRT A;  4U5B E;  2EPK X;  1WTY A;  4EBJ A;  1OW8 A;  1VLT A;  3EZI A;  5COG A;  1D1C A;  2G3V A;  2BE5 F;  3O39 A;  3L8I A;  1ZVZ A;  1D0Z A;  1E86 A;  3HNL A;  4EHP A;  4PFO A;  1I4Y A;  5B1B C;  3TUL A;  3DI5 A;  4QDL A;  4PJM A;  3LES A;  4JEA A;  3W2V A;  3HNJ A;  3U9M A;  2PF4 E;  2VCA A;  1JRA A;  3VM6 A;  3C8G B;  1CGN A;  1MMA A;  3ATP A;  4OD4 A;  3ABK C;  4AL1 A;  4CS9 C;  3B71 A;  4ANJ A;  1KTM A;  1R5I D;  1V54 C;  3A11 A;  2KYH A;  5KYU A;  2G62 A;  3AJM A;  1O3U A;  3DJU B;  2KW3 C;  4HE8 D;  3NG1 A;  1SMY F;  3K1I C;  3S90 A;  1NSG B;  5CIV A;  1JPN A;  4IRU A;  5E2Q A;  3HNI A;  3N24 A;  2QTV A;  2LSE A;  3T6J A;  1ZHY A;  2XS1 A;  5T1D B;  5L0I A;  3LNR A;  1WN0 A;  2EPO A;  3EHN A;  3MLG A;  4CS8 A;  2KGO A;  1WOL A;  3B9Q A;  4NCQ A;  2YZS A;  2AWC A;  3L8J A;  4LDQ A;  2W4M A;  2HMQ A;  3CEX A;  3NMI A;  4XEK A;  1JAF A;  2L6G A;  1IZM A;  1S7Z A;  4HFK B;  2CNW A;  2EIJ C;  4U5G A;  1JPJ A;  3K66 A;  2YWA A;  5L0F A;  1WGW A;  3EGX B;  1LKX A;  2UUI A;  3H2U A;  1EI7 A;  2WZL A;  2HMZ A;  2OCC C;  4LDR A;  5EGY A;  2R02 A;  1VK5 A;  1ZYR F;  2QUP A;  2XSE A;  3F46 A;  2JPU A;  3AOU A;  1TWC A;  4DRH B;  1B68 A;  1MMD A;  1H9T A;  2GA0 A;  1FMW A;  1QKR A;  1RKE B;  2HJ3 A;  2J9W A;  1YA7 O;  5KYW A;  4IAR A;  4RD9 A;  2IOQ A;  4FAP B;  5GPG B;  3QTH A;  4WAB A;  4Q4Z F;  1YA9 A;  2UUH A;  2BL2 A;  3DKA A;  4OIO F;  1Z6A A;  3CQZ A;  3DAF A;  3JZ0 A;  1Z7Q c;  4DVZ A;  3NDB B;  2C04 A;  2J9B A;  3L1M A;  4PR9 A;  4DRJ B;  4R32 A;  2L7A A;  5BQG A;  4Z9J A;  1E83 A;  4CS7 A;  4QI2 A;  5A6B A;  3JTL O;  4OIN F;  3C7J A;  2FAP B;  4IJJ A;  1M57 C;  3EJN A;  2R7R A;  1OCZ C;  3S0X A;  2VCB A;  3X1O A;  3S9O A;  2LFF A;  4KNW A;  3WHN A;  3ZIB A;  2J7P D;  2Y3H A;  1YYJ A;  2BC5 A;  3NMJ A;  3DD7 A;  1C17 M;  2MHR A;  3E9V A;  4D4X A;  1Z63 A;  4JVS A;  3DE8 A;  5AC5 A;  3IHU A;  2ASR A;  4CX9 A;  3RIP A;  4GEH A;  3GM3 A;  2KJG A;  2Q9C A;  1D1B A;  3ABL C;  5T3W A;  3TQO A;  3ZC4 A;  3GWL A;  4K7B A;  2YVK A;  2WVN A;  2YRF A;  3ASN C;  3S29 A;  3A9C A;  2M4E A;  1AVO B;  3SYN A;  2P6V A;  3EHM A;  2NPU A;  2H8A A;  3MFN A;  4FES A;  1U0B B;  3OWT A;  3ZVR A;  1VYK A;  1OW6 A;  1FMV A;  2A0B A;  2HV7 A;  2J0X A;  3LUT B;  3RQF A;  4XLN F;  5KYU B;  2ZXO A;  3PHF 2;  2FGY A;  1W2W A;  2XL6 A;  3PMR A;  3V5Y A;  2NSF A;  3B0V C;  5KYW B;  1ORS C;  3G50 A;  3MYI A;  4P9F A;  2C03 A;  3OEO A;  2V3C C;  1HE1 A;  1C02 A;  1TWH A;  1Z23 A;  3ITF A;  3W8H A;  4MVZ A;  4J32 B;  1TFK B;  2V26 A;  3SXK A;  3U0C A;  3CAX A;  1NG1 A;  1U89 A;  1OXK A;  2D5R B;  1A7V A;  2HFI A;  4L6R A;  2Y69 C;  4DBR A;  4WJ0 A;  2R7U A;  2EIM C;  2PFD A;  2EIK C;  2YHS A;  4NC3 A;  1K04 A;  1VB5 A;  5JSL A;  3WAQ A;  4E18 A;  4Z9I A;  2A1D D;  2RD9 A;  2R7W A;  2P1A A;  3GOD A;  2W45 A;  3HTK C;  1LE2 A;  2HZ8 A;  2J45 A;  5B1A C;  4CJO A;  2ZXP A;  3WG7 C;  2WZF A;  3EGD A;  4W8P A;  3QW0 A;  1PCX A;  4U5D E;  5FCL A;  1ZW3 A;  1Q0K A;  2EIL C;  3UMI A;  4CJG A;  3ECS A;  3CZ6 A;  3UGO A;  4EIY A;  4BEM J;  3V5X A;  3B0U X;  1OKK A;  2LD6 A;  1YYX A;  3EGD B;  4IAQ A;  2R9R B;  3SP1 A;  3G4X A;  3BRJ A;  4EBK A;  3SEO A;  3DAG A;  4O7G A;  3U2M A;  2PNO A;  3ZDL A;  1BDJ B;  3H2V A;  1YJG A;  3GAN A;  3NMK A;  3TOM A;  4DBQ A;  3LEV A;  1DOW A;  1TQG A;  4XWJ A;  2R7O A;  4CBE A;  1M2V A;  2J0W A;  3UR3 C;  4CS8 C;  4E0I A;  2R03 A;  4G0H A;  4CDY A;  2I8B A;  2VC9 A;  2B0J A;  1EQ1 A;  3AQB A;  1O87 A;  3C8G D;  4C3E A;  1OQC A;  4LAC B;  1T6U A;  1ZHT A;  1K05 A;  3JSE O;  4RDA A;  3Q7G A;  4XLP F;  4JRZ A;  2Q9B A;  3SZR A;  3RKO F;  3LS0 A;  4CS9 A;  4MVS A;  3C63 A;  4C3D A;  5EK0 A;  1VLS A;  2IXP A;  2MYS A;  5A6A A;  2Q4F A;  1QQ3 A;  1D0X A;  3GEH A;  4WGY A;  1NZE A;  4XTK A;  3E70 C;  4CIP A;  3I5P A;  5KYX A;  3FDQ A;  1YLM A;  3F47 A;  3ZSU A;  1EKY A;  1J8M F;  4BJ5 C;  2PBE A;  2CDQ A;  1OR2 A;  2QNL A;  2LP4 A;  2XRH A;  3LS1 A;  2Y3D A;  4U5E E;  3AG2 C;  4BG0 A;  4BJ6 C;  2R7X A;  5DS6 A;  4G7Z F;  1YZC A;  1M56 C;  2ZD9 A;  3C8G A;  4H4K C;  5KYY B;  1Q0F A;  1E85 A;  2B0H A;  2IYL D;  4DRI B;  5JS5 A;  1N1C A;  1OXB A;  1XZQ A;  2NUP A;  4NTA A;  1CPR A;  3RW0 A;  1UG7 A;  5E3C A;  3OA1 A;  3EZH A;  3C62 A;  5IY5 C;  1MNE A;  5L0H A;  4D4N A;  4AL0 A;  3JCU Q;  4U5H A;  3FXH A;  4MQ9 F;  3US6 A;  2R7V A;  4KNV A;  3Q6M A;  3U5S A;  3RVZ A;  2QY9 A;  3QZC A;  2A6H F;  3KYJ A;  3EFO B;  4M63 A;  2F22 A;  4KBL A;  3FVY A;  2XLV A;  2XLE A;  4PJL A;  2XM0 A;  2J8W A;  1MND A;  3IQT A;  2GWW A;  1WAS A;  4KI2 A;  3MYF A;  2JD3 A;  3U3B A;  1G8X A;  1YAR O;  1TFO B;  2WVO A;  4MND A;  3H65 A;  1OCR C;  3QMK A;  4J30 B;  5D92 A;  4BJ6 A;  3I4U A;  3DXJ F;  4FX5 A;  4E0H A;  2AWY A;  2VCC A;  4OIQ F;  2XXA A;  5A6B D;  1A7D A;  4YWQ A;  4PJN A;  3RQG A;  1JMW A;  1QSP A;  1ST6 A;  4W8K A;  4CDV A;  4E17 A;  1T5O A;  3I5Q A;  1E84 A;  1G4U S;  2LQG A;  2W4B A;  1AUE A;  2DGJ A;  4FWV A;  4GYT A;  5L0J A;  4O79 A;  2NG1 A;  4MW8 A;  1FR0 A;  4YJW A;  3T6G B;  5L3Q A;  3SXZ A;  2H7V C;  1LS4 A;  4XPX A;  4Z9H A;  1LIH A;  2LFD A;  1I5N A;  1VOM A;  4MVM A;  5D91 A;  4JE9 A;  2XLD A;  3M1C B;  2XLH A;  2PP4 A;  3QW1 A;  3T4R A;  2YL0 A;  4CIH A;  2Y39 A;  3K1H A;  4O6Y A;  3B0P A;  3PDM P;  1YDI A;  1HW1 A;  1ZHW A;  5T3T A;  2H7B A;  1VTM P;  4G7O F;  4IWB A;  2R05 A;  5AC4 A;  4JIO A;  1LI5 A;  1F1M A;  1CPQ A;  1RXQ A;  2H7O A;  2QLA A;  2YL3 A;  4PFP A;  2YKZ A;  3VF0 A;  1YVI A;  4ER9 A;  3ZQV A;  2HKV A;  3O10 A;  4OIR F;  1QPU A;  1T6I A;  1GS9 A;  2HSQ A;  2R7T A;  2KC3 A;  2D4U A;  1J8Y F;  2WZG A;  4U9D A;  5KYX B;  5L0D A;  3DZA A;  1G5Z A;  3KPH A;  3MX3 A;  1RKE A;  4ZLC A;  1TKN A;  2FFH A;  4LLE A;  3RF3 A;  5FZT A;  2PX0 A;  2WL8 A;  3Q6N A;  4ZLD A;  2O9X A;  1LPE A;  1A0B A;  1OCO C;  1RKC A;  3TD7 A;  3HKK A;  2NUT B;  1L7C A;  2IXN A;  3JRM O;  2YL7 A;  2KNH A;  4MS2 A;  3FOP A;  4U5F E;  5JVE A;  3EH2 A;  1SZI A;  4C7O B;  1L3P A;  2VB6 A;  2DB4 A;  3X2Q C;  4AX2 A;  3AG3 C;  4N4W A;  2Q3T A;  2EPL X;  4LDK A;  3J06 A;  3AQC A;  3NRH A;  3VRC A;  1FAP B;  1RMV A;  4H54 A;  4J7Y A;  1BR4 A;  1GGQ A;  4ONS A;  3POV A;  1M6T A;  2EPN A;  2Y3B A;  1TWA A;  1T9K A;  2ICW G;  4A2N B;  2Q7R A;  4O6M A;  1SR2 A;  3DM9 B;  3N0T A;  4B6I A;  4BJ5 A;  4YN0 B;  3ASO C;  2XM4 A;  4JJF A;  5F5H A;  3AGU A;  1BR1 A;  2XLW A;  4EWC A;  1LM3 B;  4YL1 A;  3DJN B;  2AVK A;  2CW0 F;  4AK9 A;  4C7O A;  4RBN A;  2ZXW C;  5E3A A;  4YT8 A;  3K1I A;  1NFO A;  4DVY P;  3S84 A;  5F5F A;  1E2X A;  5KYN A;  1SYQ A;  2P7V A;  2ETS A;  5COF A;  2Y3G A;  1BZ4 A;  3GOR A;  3FAJ A;  3O55 A;  3S27 A;  4I3M A;  1NBB A;  3VAY A;  1LE4 A;  2KK1 A;  1WWP A;  5L0G A;  1T6Q A;  2MWQ A;  5B3I A;  3AG4 C;  4NTF A;  2IXM A;  2JX0 A;  4GQH A;  4DXW A;  2KQ9 A;  4XEV A;  1NLX A;  4NY3 A;  2WB7 A;  1RCP A;  2XLM A;  4CSA C;  1HMD A;  3LLK A; 
#chains in the Genus database with same CATH homology
 3DWW A;  4JC7 A;  4AL0 A;  5BQI A;  5HV9 A;  3HKK A;  2PNO A;  5K0I A;  4YL1 A;  3PCV A;  4WAB A;  2UUH A;  4YK5 A;  3LEO A;  2H8A A;  4JCZ A;  3B29 A;  5BQG A;  5BQH A;  4YL0 A;  4NTF A;  4J7Y A;  4JRZ A;  2UUI A;  4J7T A;  4NTA A;  4YL3 A;  4AL1 A;  2Q7R A;  4BPM A;  4NTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...