4BPMA

Crystal structure of a human integral membrane enzyme
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
162
structure length
162
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHFLPAALRAALLGRLRTLRPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE, FUSION PEPTIDE
publication title Crystallizing Membrane Proteins in the Lipidic Mesophase. Experience with Human Prostaglandin E2 Synthase 1 and an Evolving Strategy.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 162
sequence length 162
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4bpmA00
2H8AA 5BQGA 5HV9A 4NTAA 4NTFA 4YL0A 4YL3A 4AL0A 5K0IA 4JCZA 4NTBA 3PCVA 3LEOA 2Q7RA 4YK5A 2UUIA 3HKKA 5BQHA 2PNOA 4JC7A 3DWWA 2UUHA 4J7TA 5BQIA 3B29A 4JRZA 4WABA 4BPMA 4AL1A 4J7YA 4YL1A
chains in the Genus database with same CATH superfamily
3B0UX 3E70C 1G4WR 2IXOA 2YVKA 4JW1A 4XEVA 4IAOA 3A9CA 5D92A 2A6HF 1GQAA 2CNWA 4CJOA 4EWCA 1NG1A 4OD4A 4U5DE 4HFFB 2YRFA 2R03A 2A0BA 2VH3A 3B71A 3RF3A 4BJ1A 3LESA 4N6HA 1Z63A 4CSAA 1BBHA 3EGXB 4ZLCA 3NYMA 4MVRA 3G4ZA 4PR9A 5KYXB 2YLDA 3MFNA 2UUIA 3C8GB 2PX3A 3ABMC 4BJ5C 2A69F 3G50A 3EJNA 4Z9JA 4G0HA 1XWJA 3HNLA 3ZC4A 1Y6DA 2WVNA 4P9FA 2LFFA 3KYJA 4DJ9A 4J7TA 3SNHA 2XXAA 1FAPB 2Q3TA 2Q9CA 3M79A 4MW3A 1T6QA 1ZU5A 3EPVA 1LE2A 4DBRA 3T4RA 4G7OF 4PK4A 3RQFA 1FFTC 3U8PA 3H2VA 2LCHA 3S27A 2Q7RA 2IYLD 3F47A 1T01A 3DI5A 2I15A 4NC3A 5GPGB 2AWYA 4FX5A 1T6IA 1TR2A 1OQCA 3RIPA 3QMKA 4HEAJ 4JTCB 4ULWA 3LLIA 5B1AC 4AL0A 3EGXA 1N1CA 1Q0MA 1M2OA 3FAPB 3B9QA 2H7OA 2FFHA 3EZHA 3G4XA 1SYQA 3LEOA 4YT5A 1CPQA 1LE4A 4GEHA 3RW0A 4NY3A 4R32A 3W8IA 4YT8A 4RDAA 4HE8D 3RVZA 2EPKX 1G4US 2LFDA 3GORA 3Q6MA 1V55C 3O6XA 2HV6A 3TJ6A 5B3IA 2R7OA 1BDJB 1K40A 5COMA 3R7CA 3U0CA 2ICWG 4I1MA 3K33A 4KNWA 2C03A 1NZEA 5A6BD 4U9DA 1YJGA 4YL1A 1Y4CA 1D0YA 1A7EA 4MVQA 4K0DA 3T6BA 4DBQA 2IOQA 3FOOA 1QSPA 3RQGA 4IARA 3L1MA 4MTOA 5AC5A 1LIHA 3LUTB 4JVSA 3EHNA 4C7OB 1LI5A 4XPXA 1Q0FA 3Q7GA 5DS5A 3LEVA 5COFA 3MLGA 2I8BA 1WASA 1YLMA 1Z3IX 2ASRA 2DYSC 4NTBA 1S05A 1MQVA 4U9EA 3MYFA 4CBEA 3ASNC 4E18A 5HSWA 3BRJA 5FZTA 2B0JA 3HJCA 1OKKD 1VK5A 1YA7O 2G3KA 4U5FE 1ZZPA 2J9VA 4EHPA 3SEOA 2J0WA 1UFBA 5JVEA 2J8WA 2BE5F 4L6RA 3NYJA 4CS8A 5T3WA 3TOMA 3DM9B 2ZD9A 3NG1A 4JZAA 4PJLA 3DAFA 3GODA 3ATPA 3JTLO 2Q4FA 2OEVA 1CPRA 1R5ID 2YL7A 4IAQA 2JPUA 3HNKA 4EBKA 2NUTB 5L0GA 3EFOA 1O87A 1WOLA 3DKAA 2J7PD 2RD9A 4CIPA 4DVYP 4XTKA 1E83A 2HKVA 1M2VB 4WGZA 2HUJA 1QQ3A 2VCCA 2A1DD 4N6CA 3X1OA 3AQBA 5AGFA 1WATA 1QVXA 5CIVA 3UGPA 2UUHA 3DAGA 1D1CA 1SF8A 2YKZA 4RD9A 4H54A 4LLCA 3LNMB 2GFHA 1LKXA 2MYSA 3N24A 4BPMA 4C3EA 4MVZA 1ZHXA 3FVYA 1YZAA 1CGOA 2FAPB 4JEAA 2VC9A 3S9OA 5DQZA 1D0ZA 5IY5C 2E87A 2KGOA 3FOPA 1KNYA 2PX0A 3RH3A 5DS4A 3FAJA 4IGGA 3DZAA 4BEJA 5TJ5E 4I1OB 2OOCA 2NUTA 3AOUA 4JJFA 1D1AA 4U5CE 3ZWIA 4E17A 1DOVA 1NSGB 1NBBA 2L6HA 1A41A 1H9GA 2PP4A 4GYTA 4P9TA 1UG7A 4N06A 5CI8A 3PMRA 4W8KA 4ZLDA 1YYXA 3TJ5A 3V5YA 3N0TA 2C04A 2XM0A 3R2PA 2YEVA 4HFKB 3WG7C 3QW1A 5B1BC 1JRAA 2IXNA 3QVZA 4CDYA 4Q7CA 1FTSA 1RKEA 2ZXOA 1YVIA 3HTKC 4U5GA 1TWGA 4O79A 3NKDA 4RBNA 4DRIB 1H6GA 2AVKA 2EINC 2H7VC 4CIHA 3HNIA 4MS2A 4O7GA 4E0IA 2HSQA 2PF4E 1TKNA 3FDQA 5E3AA 3JCUQ 1SMYF 4JURI 2AWCA 1RXQA 2GDCA 1CGNA 3NMIA 2HSBA 3UMIA 2HFIA 2HS5A 4PACA 1K04A 4JJGA 4YL3A 2KYHA 3U3BA 1IZMA 2BL2A 3AG1C 4JCZA 4H4KC 4YT4A 4BJ6A 1NU9C 2YQYA 4G7ZF 1EA8A 3F46A 2J9UA 3IHUA 4U5EE 2HJ3A 3GWLA 3S28A 3N2ZB 3K1HA 5D91A 1E84A 1SR2A 2R05A 2Y3BA 2ZPAA 3VYWA 4KNVA 5T3TA 1Z6AA 3JYHA 4OIRF 2BC5A 4KI2A 3NYLA 1KTMA 4PJJA 4C3DA 2WZFA 4Z9IA 1OR2A 2L81A 2Q9BA 2Y3HA 4YWQA 3C8ZA 4J7YA 1YDIA 2NUPB 3NKEA 5L0DA 3LNRA 1JR8A 4QDLA 2R7WA 2H8AA 1R4TA 2NG1A 3M4CA 2JD3A 2X0CA 2KJGA 2YL1A 3JSZA 4CS9A 4OINF 1RCPA 2XLEA 2J7PA 2OG2A 4NTFA 3CSKA 4ONSA 2R7RA 5KYNA 3FHDA 1C17M 5FCLA 5EGYA 2WVQA 4X0RA 1TFOB 3LLKA 1ORJA 2MHRA 2J9WA 5KYXA 3T6JA 1GGQA 2V26A 3C8GA 1D1BA 1HY5A 1XZPA 3JRMO 3T9OA 2HJMA 2L7AA 2OEXA 4CS8C 3UGOA 1FR0A 1ZU4A 3IQCA 5BQIA 4MVSA 1FMVA 2YL0A 5E33A 2QUPA 4IWBA 1ZHZA 5KYWB 3TD7A 3MBGA 3VF0A 2NUPA 2H7BA 3EG9B 1GS9A 3HNJA 3Q7LA 1W2WA 4O6YA 5JUAA 5L3QA 2XLDA 2J9BA 1E2XA 3EGDB 1A7VA 2L9JA 4DRHB 2L6FA 3JZ0A 1HW1A 2NSGA 2XL4A 2R9RB 4XEKA 3RFYA 3UR3C 1BR1A 1M57C 5KYUB 3S90A 1ZHWA 2XLHA 2Y3DA 1RMVA 1V54C 1VB5A 1TQGA 4M63A 3X2QC 2QTVA 3WHNA 5L0JA 5L3VA 1PV3A 1SZIA 2WVOA 3ZSUA 3Q6NA 4O6MA 4JC7A 1YA9A 3NRHA 3SXKA 2CDQA 4BJ5A 1MMDA 2EPNA 3GM1A 5L0FA 3LAYA 1VYKA 1PD1A 1O5HA 3C18A 3AJMA 3JT1A 3GWNA 3UMKA 5A6KA 2VCBA 3LS0A 1V4AA 4MVOA 5DQTA 5JSLA 4QI2A 4K7BA 2EPOA 4XWJA 1RJ9B 3S84A 2CYDA 5A6AA 2MWQA 3SXYA 5JRAA 4DVZA 4Q5SF 2CNWD 4OIPF 4EBBA 3EGDA 5COGA 3PHF2 3SP1A 1BZ4A 5L0CA 1IW7F 3IEEA 3V5XA 3EH2A 5JT4A 2XS8A 1Z5ZA 4NCQA 1LVKA 1MMGA 1WN0A 2D5RB 3O39A 1MNEA 4N4WA 1TWCA 1I4ZA 2EPLX 3GM2A 2KC3A 2XRHA 1ORYA 3JRTA 1T5OA 4J30B 4CDVA 5A69A 1BR2A 3K1IC 1NU7D 3QW0A 3VRCA 1OCCC 3B29A 4JRZA 2YL3A 4MTFA 3DJNB 3W2WA 3VM6A 4DXWA 2G3VA 3ITFA 3AGTA 3K6BA 3U5SA 1FNTc 2HMQA 2VCAA 3H65A 5KYYB 256BA 2XSEA 3K7DA 4OD5A 1B68A 3S0XA 2AP3A 1EQ1A 5JP7A 1Q0KA 1OXKA 1VTMP 1OW6A 4LDRA 3US6A 3V5ZA 4E7ZA 4CSAC 4MQ9F 2CGEA 1VLSA 5HV9A 3POVA 4NTAA 2IXMA 3DE8A 2NPUA 4YL0A 3CQZA 4CS7A 3CEXA 2J0XA 2LQGA 1M2VA 3ASOC 4YK5A 2QLAA 2B0HA 2DGJA 4I44A 2OCCC 2OQMA 4AE4B 4YJWA 3U2MA 2P61A 3I5QA 3C7JA 4Q4ZF 1WTYA 2HZ8A 2PNOA 1TWHA 1YAUO 2P7VA 3ZTZA 4AK9A 3SZRA 4E7SA 1JPJA 4K1OA 3ZTMA 2R7XA 3O55A 3KYIA 4EKWA 3TULA 3MX3A 1HW2A 3BEHA 3V7OA 5A6BA 4XEFA 1JAFA 3FXHA 3GEHA 2TMVP 1OW7A 4ER9A 2R02A 3LS1A 1C02A 1J8MF 2XLWA 2HV7A 4O6NA 3L8JA 1HMOA 2W45A 3VAYA 4YT2A 4XPWA 2Y39A 3AGUA 4MW8A 2YLIA 2KW3C 1ZW2A 2WZGA 4IJJA 5AC4A 4P6IC 4OIQF 1NLXA 3IPMO 2R7SA 1E85A 4F4BA 4BG0A 4U5BE 1NFOA 1ZVZA 2LIGA 1PCXA 1QLEC 2VB6A 3AG4C 4EBJA 2QY9A 3M4BA 1OKKA 4J32B 2IM8A 1QKRA 2JX0A 1I4YA 3RVYA 2R7UA 3IQTA 1TWAA 4AL1A 1EI7A 2LP4A 3U8VA 1CGME 3DXJF 4C3BA 4YN0B 1S7ZA 3K66A 3LJBA 3EQLF 2WL8A 3ZQYA 3C62A 4B6IA 4MVUA 3GANA 3IQ6A 3T6GB 3KH2A 3J06A 2R7TA 2YHSA 3OEOA 4KBLA 5B3SC 1D0XA 1Z7Qc 3DMDA 1V74B 4GQHA 3EHMA 5EHHA 3I4UA 2OKUA 4XQ1A 4I3MA 3B0PA 1ZHYA 2CCYA 4LLEA 1AUEA 4FWVA 2J45A 4PFOA 2LSEA 2EIMC 2A6EF 2G62A 5F28E 2IXPA 1H7IA 4IB4A 1QPUA 3DM5A 1YYJA 3JYYA 4LDKA 4ULVA 5F5HA 3UNGC 2W4BA 4A4AA 4D4NA 2RSEB 2ZXRA 2Q9AA 2WZLA 3AG2C 3GEEA 5CI9A 1O3UA 2A68F 4MTGA 3NDBB 4C7OA 2OJED 4PJNA 4OIOF 1VLTA 2OU6A 4WGYA 3U9JA 1FMWA 1APCA 4JTDB 2EIJC 3W8HA 1PD0A 3ZVRA 3FMSA 1C03A 2XL8A 3U9MA 1LS1A 3ZDLA 1NFNA 4MVMA 2XLMA 1HMDA 3ABKC 3UMHA 4CDAA 4G7HF 3KPHA 2DB4A 1L3PA 2DI3A 2Y69C 2YZSA 3NMJA 5F5FA 3KMIA 4IRUA 1LPEA 2EPMX 2W9YA 4EIYA 4G78A 4ANJA 5L0IA 5JLIA 3TK0A 3PCVA 1U0BB 4JKVA 1Q0GA 1OCOC 2VASA 3SXMA 3DE9A 1J8YF 1LS4A 1OXBA 2KQ9A 1OCRC 4UDVA 3C63A 3U3FA 1JOGA 1G5ZA 2CW0F 4BJTA 2X51A 4LDQA 1Z23A 5EK0A 3PDMP 4LERA 4JIOA 2XLVA 3M15A 2WB7A 1ZYRF 4WJ0A 4LACB 4NQFA 2LD6A 3KL4A 3W4YA 2GWWA 4U5HA 5DLJA 3L34A 4JE9A 5KYWA 1TFKB 2DYRC 2GA0A 3EG9A 4CJGA 3GEIA 3EFOB 2YWAA 4A2NB 1H9TA 1YARO 2R7QA 4W8PA 5T1DB 4DRJB 3ZQVA 3ABLC 3AQCA 4QI0A 5KYUA 5L0HA 2ETSA 2HMZA 3WAQA 2XM4A 3L0IA 2KK1A 1KU2A 1OCZC 1QZXA 2QNLA 1DOWA 4D4XA 3SYNA 2R25A 3KKBA 1RKCA 1G8XA 3DWWA 4DOZA 3QVYA 1U6HA 4AX2A 1ORSC 1T9KA 2A0UA 1AVOB 2FGYA 4PJMA 3MYIA 1M6TA 3SXZA 3B0VC 2Q00A 2KSFA 1OR3A 3RYLA 1ZHTA 2GAQA 1RJ9A 3I5PA 4JTAB 2IBFA 2NSFA 1OW8A 2PFDA 4XLNF 4BJ6C 5E2QA 3OA1A 4PFPA 2R7VA 1HE1A 1EKYA 1FFHA 3L8IA 3S29A 2LK4A 1VOMA 1JPNA 1ZW3A 2J46A 3QZCA 2XLOA 1GM5A 3C8GD 5BQHA 3ECSA 2W4MA 3EZIA 1JMWA 4Z9HA 1WGWA 4E0HA 1XZQA 1WWPA 2V3CC 2D4UA 1K05A 1RKEB 2EIKC 1MMAA 1A7DA 1E86A 3A11A 3EH1A 3H2UA 4KC9A 1LM3B 4CS9C 3HLZA 3WODF 3ZIBA 2M64A 4EUKB 1VYIA 1MMNA 2OJQA 3JSEO 5KYYA 1I5NA 4CX9A 2O9XA 4MNDA 5DS6A 1F1MA 1VMAA 5BQGA 5JS5A 1LI7A 3RQEA 3RKOF 1U89A 1T6UA 3E9VA 3TQOA 2EILC 1YZCA 5E3CA 3M1CB 2P6VA 2KNHA 2XL6A 5K0IA 3DD7A 1MNDA 2P1AA 4JCHA 2M4EA 3QTHA 3IQ5A 2AU5A 2XS1A 3ZG1A 3CAXA 5BUOA 3HKKA 4JEBA 1Q0DA 2Y3GA 3CZ6A 2ZXPA 3GM3A 3AG3C 3TOLA 4FAPB 1M56C 4AE4A 3O10A 4FESA 2PBEA 1BR4A 1L7CA 1HE9A 4XPYA 5DVWA 2L6GA 5A6JA 2P0NA 1A0BA 4XLPF 2QE9A 2YLGA 3NMKA 2XXAB 1ST6A 4WABA 2F22A 2Z15A 3K1IA 2ZXWC 3U2LA 4BEMJ 3DJUB 3W2VA 3OWTA 1AEPA
chains in the Genus database with same CATH topology
2H8AA 5BQGA 5HV9A 4NTAA 4NTFA 4YL0A 4YL3A 4AL0A 5K0IA 4JCZA 4NTBA 3PCVA 3LEOA 2Q7RA 4YK5A 2UUIA 3HKKA 5BQHA 2PNOA 4JC7A 3DWWA 2UUHA 4J7TA 5BQIA 3B29A 4JRZA 4WABA 4BPMA 4AL1A 4J7YA 4YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8A A;  5BQG A;  5HV9 A;  4NTA A;  4NTF A;  4YL0 A;  4YL3 A;  4AL0 A;  5K0I A;  4JCZ A;  4NTB A;  3PCV A;  3LEO A;  2Q7R A;  4YK5 A;  2UUI A;  3HKK A;  5BQH A;  2PNO A;  4JC7 A;  3DWW A;  2UUH A;  4J7T A;  5BQI A;  3B29 A;  4JRZ A;  4WAB A;  4BPM A;  4AL1 A;  4J7Y A;  4YL1 A; 
#chains in the Genus database with same CATH topology
 3B0U X;  3E70 C;  1G4W R;  2IXO A;  2YVK A;  4JW1 A;  4XEV A;  4IAO A;  3A9C A;  5D92 A;  2A6H F;  1GQA A;  2CNW A;  4CJO A;  4EWC A;  1NG1 A;  4OD4 A;  4U5D E;  4HFF B;  2YRF A;  2R03 A;  2A0B A;  2VH3 A;  3B71 A;  3RF3 A;  4BJ1 A;  3LES A;  4N6H A;  1Z63 A;  4CSA A;  1BBH A;  3EGX B;  4ZLC A;  3NYM A;  4MVR A;  3G4Z A;  4PR9 A;  5KYX B;  2YLD A;  3MFN A;  2UUI A;  3C8G B;  2PX3 A;  3ABM C;  4BJ5 C;  2A69 F;  3G50 A;  3EJN A;  4Z9J A;  4G0H A;  1XWJ A;  3HNL A;  3ZC4 A;  1Y6D A;  2WVN A;  4P9F A;  2LFF A;  3KYJ A;  4DJ9 A;  4J7T A;  3SNH A;  2XXA A;  1FAP B;  2Q3T A;  2Q9C A;  3M79 A;  4MW3 A;  1T6Q A;  1ZU5 A;  3EPV A;  1LE2 A;  4DBR A;  3T4R A;  4G7O F;  4PK4 A;  3RQF A;  1FFT C;  3U8P A;  3H2V A;  2LCH A;  3S27 A;  2Q7R A;  2IYL D;  3F47 A;  1T01 A;  3DI5 A;  2I15 A;  4NC3 A;  5GPG B;  2AWY A;  4FX5 A;  1T6I A;  1TR2 A;  1OQC A;  3RIP A;  3QMK A;  4HEA J;  4JTC B;  4ULW A;  3LLI A;  5B1A C;  4AL0 A;  3EGX A;  1N1C A;  1Q0M A;  1M2O A;  3FAP B;  3B9Q A;  2H7O A;  2FFH A;  3EZH A;  3G4X A;  1SYQ A;  3LEO A;  4YT5 A;  1CPQ A;  1LE4 A;  4GEH A;  3RW0 A;  4NY3 A;  4R32 A;  3W8I A;  4YT8 A;  4RDA A;  4HE8 D;  3RVZ A;  2EPK X;  1G4U S;  2LFD A;  3GOR A;  3Q6M A;  1V55 C;  3O6X A;  2HV6 A;  3TJ6 A;  5B3I A;  2R7O A;  1BDJ B;  1K40 A;  5COM A;  3R7C A;  3U0C A;  2ICW G;  4I1M A;  3K33 A;  4KNW A;  2C03 A;  1NZE A;  5A6B D;  4U9D A;  1YJG A;  4YL1 A;  1Y4C A;  1D0Y A;  1A7E A;  4MVQ A;  4K0D A;  3T6B A;  4DBQ A;  2IOQ A;  3FOO A;  1QSP A;  3RQG A;  4IAR A;  3L1M A;  4MTO A;  5AC5 A;  1LIH A;  3LUT B;  4JVS A;  3EHN A;  4C7O B;  1LI5 A;  4XPX A;  1Q0F A;  3Q7G A;  5DS5 A;  3LEV A;  5COF A;  3MLG A;  2I8B A;  1WAS A;  1YLM A;  1Z3I X;  2ASR A;  2DYS C;  4NTB A;  1S05 A;  1MQV A;  4U9E A;  3MYF A;  4CBE A;  3ASN C;  4E18 A;  5HSW A;  3BRJ A;  5FZT A;  2B0J A;  3HJC A;  1OKK D;  1VK5 A;  1YA7 O;  2G3K A;  4U5F E;  1ZZP A;  2J9V A;  4EHP A;  3SEO A;  2J0W A;  1UFB A;  5JVE A;  2J8W A;  2BE5 F;  4L6R A;  3NYJ A;  4CS8 A;  5T3W A;  3TOM A;  3DM9 B;  2ZD9 A;  3NG1 A;  4JZA A;  4PJL A;  3DAF A;  3GOD A;  3ATP A;  3JTL O;  2Q4F A;  2OEV A;  1CPR A;  1R5I D;  2YL7 A;  4IAQ A;  2JPU A;  3HNK A;  4EBK A;  2NUT B;  5L0G A;  3EFO A;  1O87 A;  1WOL A;  3DKA A;  2J7P D;  2RD9 A;  4CIP A;  4DVY P;  4XTK A;  1E83 A;  2HKV A;  1M2V B;  4WGZ A;  2HUJ A;  1QQ3 A;  2VCC A;  2A1D D;  4N6C A;  3X1O A;  3AQB A;  5AGF A;  1WAT A;  1QVX A;  5CIV A;  3UGP A;  2UUH A;  3DAG A;  1D1C A;  1SF8 A;  2YKZ A;  4RD9 A;  4H54 A;  4LLC A;  3LNM B;  2GFH A;  1LKX A;  2MYS A;  3N24 A;  4BPM A;  4C3E A;  4MVZ A;  1ZHX A;  3FVY A;  1YZA A;  1CGO A;  2FAP B;  4JEA A;  2VC9 A;  3S9O A;  5DQZ A;  1D0Z A;  5IY5 C;  2E87 A;  2KGO A;  3FOP A;  1KNY A;  2PX0 A;  3RH3 A;  5DS4 A;  3FAJ A;  4IGG A;  3DZA A;  4BEJ A;  5TJ5 E;  4I1O B;  2OOC A;  2NUT A;  3AOU A;  4JJF A;  1D1A A;  4U5C E;  3ZWI A;  4E17 A;  1DOV A;  1NSG B;  1NBB A;  2L6H A;  1A41 A;  1H9G A;  2PP4 A;  4GYT A;  4P9T A;  1UG7 A;  4N06 A;  5CI8 A;  3PMR A;  4W8K A;  4ZLD A;  1YYX A;  3TJ5 A;  3V5Y A;  3N0T A;  2C04 A;  2XM0 A;  3R2P A;  2YEV A;  4HFK B;  3WG7 C;  3QW1 A;  5B1B C;  1JRA A;  2IXN A;  3QVZ A;  4CDY A;  4Q7C A;  1FTS A;  1RKE A;  2ZXO A;  1YVI A;  3HTK C;  4U5G A;  1TWG A;  4O79 A;  3NKD A;  4RBN A;  4DRI B;  1H6G A;  2AVK A;  2EIN C;  2H7V C;  4CIH A;  3HNI A;  4MS2 A;  4O7G A;  4E0I A;  2HSQ A;  2PF4 E;  1TKN A;  3FDQ A;  5E3A A;  3JCU Q;  1SMY F;  4JUR I;  2AWC A;  1RXQ A;  2GDC A;  1CGN A;  3NMI A;  2HSB A;  3UMI A;  2HFI A;  2HS5 A;  4PAC A;  1K04 A;  4JJG A;  4YL3 A;  2KYH A;  3U3B A;  1IZM A;  2BL2 A;  3AG1 C;  4JCZ A;  4H4K C;  4YT4 A;  4BJ6 A;  1NU9 C;  2YQY A;  4G7Z F;  1EA8 A;  3F46 A;  2J9U A;  3IHU A;  4U5E E;  2HJ3 A;  3GWL A;  3S28 A;  3N2Z B;  3K1H A;  5D91 A;  1E84 A;  1SR2 A;  2R05 A;  2Y3B A;  2ZPA A;  3VYW A;  4KNV A;  5T3T A;  1Z6A A;  3JYH A;  4OIR F;  2BC5 A;  4KI2 A;  3NYL A;  1KTM A;  4PJJ A;  4C3D A;  2WZF A;  4Z9I A;  1OR2 A;  2L81 A;  2Q9B A;  2Y3H A;  4YWQ A;  3C8Z A;  4J7Y A;  1YDI A;  2NUP B;  3NKE A;  5L0D A;  3LNR A;  1JR8 A;  4QDL A;  2R7W A;  2H8A A;  1R4T A;  2NG1 A;  3M4C A;  2JD3 A;  2X0C A;  2KJG A;  2YL1 A;  3JSZ A;  4CS9 A;  4OIN F;  1RCP A;  2XLE A;  2J7P A;  2OG2 A;  4NTF A;  3CSK A;  4ONS A;  2R7R A;  5KYN A;  3FHD A;  1C17 M;  5FCL A;  5EGY A;  2WVQ A;  4X0R A;  1TFO B;  3LLK A;  1ORJ A;  2MHR A;  2J9W A;  5KYX A;  3T6J A;  1GGQ A;  2V26 A;  3C8G A;  1D1B A;  1HY5 A;  1XZP A;  3JRM O;  3T9O A;  2HJM A;  2L7A A;  2OEX A;  4CS8 C;  3UGO A;  1FR0 A;  1ZU4 A;  3IQC A;  5BQI A;  4MVS A;  1FMV A;  2YL0 A;  5E33 A;  2QUP A;  4IWB A;  1ZHZ A;  5KYW B;  3TD7 A;  3MBG A;  3VF0 A;  2NUP A;  2H7B A;  3EG9 B;  1GS9 A;  3HNJ A;  3Q7L A;  1W2W A;  4O6Y A;  5JUA A;  5L3Q A;  2XLD A;  2J9B A;  1E2X A;  3EGD B;  1A7V A;  2L9J A;  4DRH B;  2L6F A;  3JZ0 A;  1HW1 A;  2NSG A;  2XL4 A;  2R9R B;  4XEK A;  3RFY A;  3UR3 C;  1BR1 A;  1M57 C;  5KYU B;  3S90 A;  1ZHW A;  2XLH A;  2Y3D A;  1RMV A;  1V54 C;  1VB5 A;  1TQG A;  4M63 A;  3X2Q C;  2QTV A;  3WHN A;  5L0J A;  5L3V A;  1PV3 A;  1SZI A;  2WVO A;  3ZSU A;  3Q6N A;  4O6M A;  4JC7 A;  1YA9 A;  3NRH A;  3SXK A;  2CDQ A;  4BJ5 A;  1MMD A;  2EPN A;  3GM1 A;  5L0F A;  3LAY A;  1VYK A;  1PD1 A;  1O5H A;  3C18 A;  3AJM A;  3JT1 A;  3GWN A;  3UMK A;  5A6K A;  2VCB A;  3LS0 A;  1V4A A;  4MVO A;  5DQT A;  5JSL A;  4QI2 A;  4K7B A;  2EPO A;  4XWJ A;  1RJ9 B;  3S84 A;  2CYD A;  5A6A A;  2MWQ A;  3SXY A;  5JRA A;  4DVZ A;  4Q5S F;  2CNW D;  4OIP F;  4EBB A;  3EGD A;  5COG A;  3PHF 2;  3SP1 A;  1BZ4 A;  5L0C A;  1IW7 F;  3IEE A;  3V5X A;  3EH2 A;  5JT4 A;  2XS8 A;  1Z5Z A;  4NCQ A;  1LVK A;  1MMG A;  1WN0 A;  2D5R B;  3O39 A;  1MNE A;  4N4W A;  1TWC A;  1I4Z A;  2EPL X;  3GM2 A;  2KC3 A;  2XRH A;  1ORY A;  3JRT A;  1T5O A;  4J30 B;  4CDV A;  5A69 A;  1BR2 A;  3K1I C;  1NU7 D;  3QW0 A;  3VRC A;  1OCC C;  3B29 A;  4JRZ A;  2YL3 A;  4MTF A;  3DJN B;  3W2W A;  3VM6 A;  4DXW A;  2G3V A;  3ITF A;  3AGT A;  3K6B A;  3U5S A;  1FNT c;  2HMQ A;  2VCA A;  3H65 A;  5KYY B;  256B A;  2XSE A;  3K7D A;  4OD5 A;  1B68 A;  3S0X A;  2AP3 A;  1EQ1 A;  5JP7 A;  1Q0K A;  1OXK A;  1VTM P;  1OW6 A;  4LDR A;  3US6 A;  3V5Z A;  4E7Z A;  4CSA C;  4MQ9 F;  2CGE A;  1VLS A;  5HV9 A;  3POV A;  4NTA A;  2IXM A;  3DE8 A;  2NPU A;  4YL0 A;  3CQZ A;  4CS7 A;  3CEX A;  2J0X A;  2LQG A;  1M2V A;  3ASO C;  4YK5 A;  2QLA A;  2B0H A;  2DGJ A;  4I44 A;  2OCC C;  2OQM A;  4AE4 B;  4YJW A;  3U2M A;  2P61 A;  3I5Q A;  3C7J A;  4Q4Z F;  1WTY A;  2HZ8 A;  2PNO A;  1TWH A;  1YAU O;  2P7V A;  3ZTZ A;  4AK9 A;  3SZR A;  4E7S A;  1JPJ A;  4K1O A;  3ZTM A;  2R7X A;  3O55 A;  3KYI A;  4EKW A;  3TUL A;  3MX3 A;  1HW2 A;  3BEH A;  3V7O A;  5A6B A;  4XEF A;  1JAF A;  3FXH A;  3GEH A;  2TMV P;  1OW7 A;  4ER9 A;  2R02 A;  3LS1 A;  1C02 A;  1J8M F;  2XLW A;  2HV7 A;  4O6N A;  3L8J A;  1HMO A;  2W45 A;  3VAY A;  4YT2 A;  4XPW A;  2Y39 A;  3AGU A;  4MW8 A;  2YLI A;  2KW3 C;  1ZW2 A;  2WZG A;  4IJJ A;  5AC4 A;  4P6I C;  4OIQ F;  1NLX A;  3IPM O;  2R7S A;  1E85 A;  4F4B A;  4BG0 A;  4U5B E;  1NFO A;  1ZVZ A;  2LIG A;  1PCX A;  1QLE C;  2VB6 A;  3AG4 C;  4EBJ A;  2QY9 A;  3M4B A;  1OKK A;  4J32 B;  2IM8 A;  1QKR A;  2JX0 A;  1I4Y A;  3RVY A;  2R7U A;  3IQT A;  1TWA A;  4AL1 A;  1EI7 A;  2LP4 A;  3U8V A;  1CGM E;  3DXJ F;  4C3B A;  4YN0 B;  1S7Z A;  3K66 A;  3LJB A;  3EQL F;  2WL8 A;  3ZQY A;  3C62 A;  4B6I A;  4MVU A;  3GAN A;  3IQ6 A;  3T6G B;  3KH2 A;  3J06 A;  2R7T A;  2YHS A;  3OEO A;  4KBL A;  5B3S C;  1D0X A;  1Z7Q c;  3DMD A;  1V74 B;  4GQH A;  3EHM A;  5EHH A;  3I4U A;  2OKU A;  4XQ1 A;  4I3M A;  3B0P A;  1ZHY A;  2CCY A;  4LLE A;  1AUE A;  4FWV A;  2J45 A;  4PFO A;  2LSE A;  2EIM C;  2A6E F;  2G62 A;  5F28 E;  2IXP A;  1H7I A;  4IB4 A;  1QPU A;  3DM5 A;  1YYJ A;  3JYY A;  4LDK A;  4ULV A;  5F5H A;  3UNG C;  2W4B A;  4A4A A;  4D4N A;  2RSE B;  2ZXR A;  2Q9A A;  2WZL A;  3AG2 C;  3GEE A;  5CI9 A;  1O3U A;  2A68 F;  4MTG A;  3NDB B;  4C7O A;  2OJE D;  4PJN A;  4OIO F;  1VLT A;  2OU6 A;  4WGY A;  3U9J A;  1FMW A;  1APC A;  4JTD B;  2EIJ C;  3W8H A;  1PD0 A;  3ZVR A;  3FMS A;  1C03 A;  2XL8 A;  3U9M A;  1LS1 A;  3ZDL A;  1NFN A;  4MVM A;  2XLM A;  1HMD A;  3ABK C;  3UMH A;  4CDA A;  4G7H F;  3KPH A;  2DB4 A;  1L3P A;  2DI3 A;  2Y69 C;  2YZS A;  3NMJ A;  5F5F A;  3KMI A;  4IRU A;  1LPE A;  2EPM X;  2W9Y A;  4EIY A;  4G78 A;  4ANJ A;  5L0I A;  5JLI A;  3TK0 A;  3PCV A;  1U0B B;  4JKV A;  1Q0G A;  1OCO C;  2VAS A;  3SXM A;  3DE9 A;  1J8Y F;  1LS4 A;  1OXB A;  2KQ9 A;  1OCR C;  4UDV A;  3C63 A;  3U3F A;  1JOG A;  1G5Z A;  2CW0 F;  4BJT A;  2X51 A;  4LDQ A;  1Z23 A;  5EK0 A;  3PDM P;  4LER A;  4JIO A;  2XLV A;  3M15 A;  2WB7 A;  1ZYR F;  4WJ0 A;  4LAC B;  4NQF A;  2LD6 A;  3KL4 A;  3W4Y A;  2GWW A;  4U5H A;  5DLJ A;  3L34 A;  4JE9 A;  5KYW A;  1TFK B;  2DYR C;  2GA0 A;  3EG9 A;  4CJG A;  3GEI A;  3EFO B;  2YWA A;  4A2N B;  1H9T A;  1YAR O;  2R7Q A;  4W8P A;  5T1D B;  4DRJ B;  3ZQV A;  3ABL C;  3AQC A;  4QI0 A;  5KYU A;  5L0H A;  2ETS A;  2HMZ A;  3WAQ A;  2XM4 A;  3L0I A;  2KK1 A;  1KU2 A;  1OCZ C;  1QZX A;  2QNL A;  1DOW A;  4D4X A;  3SYN A;  2R25 A;  3KKB A;  1RKC A;  1G8X A;  3DWW A;  4DOZ A;  3QVY A;  1U6H A;  4AX2 A;  1ORS C;  1T9K A;  2A0U A;  1AVO B;  2FGY A;  4PJM A;  3MYI A;  1M6T A;  3SXZ A;  3B0V C;  2Q00 A;  2KSF A;  1OR3 A;  3RYL A;  1ZHT A;  2GAQ A;  1RJ9 A;  3I5P A;  4JTA B;  2IBF A;  2NSF A;  1OW8 A;  2PFD A;  4XLN F;  4BJ6 C;  5E2Q A;  3OA1 A;  4PFP A;  2R7V A;  1HE1 A;  1EKY A;  1FFH A;  3L8I A;  3S29 A;  2LK4 A;  1VOM A;  1JPN A;  1ZW3 A;  2J46 A;  3QZC A;  2XLO A;  1GM5 A;  3C8G D;  5BQH A;  3ECS A;  2W4M A;  3EZI A;  1JMW A;  4Z9H A;  1WGW A;  4E0H A;  1XZQ A;  1WWP A;  2V3C C;  2D4U A;  1K05 A;  1RKE B;  2EIK C;  1MMA A;  1A7D A;  1E86 A;  3A11 A;  3EH1 A;  3H2U A;  4KC9 A;  1LM3 B;  4CS9 C;  3HLZ A;  3WOD F;  3ZIB A;  2M64 A;  4EUK B;  1VYI A;  1MMN A;  2OJQ A;  3JSE O;  5KYY A;  1I5N A;  4CX9 A;  2O9X A;  4MND A;  5DS6 A;  1F1M A;  1VMA A;  5BQG A;  5JS5 A;  1LI7 A;  3RQE A;  3RKO F;  1U89 A;  1T6U A;  3E9V A;  3TQO A;  2EIL C;  1YZC A;  5E3C A;  3M1C B;  2P6V A;  2KNH A;  2XL6 A;  5K0I A;  3DD7 A;  1MND A;  2P1A A;  4JCH A;  2M4E A;  3QTH A;  3IQ5 A;  2AU5 A;  2XS1 A;  3ZG1 A;  3CAX A;  5BUO A;  3HKK A;  4JEB A;  1Q0D A;  2Y3G A;  3CZ6 A;  2ZXP A;  3GM3 A;  3AG3 C;  3TOL A;  4FAP B;  1M56 C;  4AE4 A;  3O10 A;  4FES A;  2PBE A;  1BR4 A;  1L7C A;  1HE9 A;  4XPY A;  5DVW A;  2L6G A;  5A6J A;  2P0N A;  1A0B A;  4XLP F;  2QE9 A;  2YLG A;  3NMK A;  2XXA B;  1ST6 A;  4WAB A;  2F22 A;  2Z15 A;  3K1I A;  2ZXW C;  3U2L A;  4BEM J;  3DJU B;  3W2V A;  3OWT A;  1AEP A; 
#chains in the Genus database with same CATH homology
 2H8A A;  5BQG A;  5HV9 A;  4NTA A;  4NTF A;  4YL0 A;  4YL3 A;  4AL0 A;  5K0I A;  4JCZ A;  4NTB A;  3PCV A;  3LEO A;  2Q7R A;  4YK5 A;  2UUI A;  3HKK A;  5BQH A;  2PNO A;  4JC7 A;  3DWW A;  2UUH A;  4J7T A;  5BQI A;  3B29 A;  4JRZ A;  4WAB A;  4BPM A;  4AL1 A;  4J7Y A;  4YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...