2P61A

Crystal structure of protein tm1646 from thermotoga maritima, pfam duf327
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
120
structure length
114
Chain Sequence
EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIYKLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM_1646
publication title Crystal structure of hypothetical protein TM_1646 from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Structural genomics, unknown function
total genus 51
structure length 114
sequence length 120
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03885 DUF327 Protein of unknown function (DUF327)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hypothetical protein TM1646-like domain 2p61A00
2P61A 2QUPA
chains in the Genus database with same CATH superfamily
4LLCA 1TFKB 1T6QA 4ONSA 3SXZA 4CSAA 4GQHA 3I4UA 5L0IA 1XWJA 4NC3A 1E84A 3I5QA 3MYFA 4Q5SF 1OCOC 2Y3BA 2VB6A 2KK1A 2L6HA 3A9CA 2TMVP 3JCUQ 1ORSC 4D4NA 5A6BA 2VH3A 1ZYRF 4O6MA 2Y39A 3GM2A 4I1OB 4PJJA 4EUKB 1HE1A 1ZHTA 3ABLC 1OCZC 1MMAA 5COGA 3HNJA 3PHF2 1Z6AA 3N0TA 3PCVA 1I5NA 4J30B 1SR2A 1D1BA 1JPJA 1OCRC 2HKVA 4HFKB 4LACB 3W8IA 1D0ZA 3SYNA 2O9XA 3GWNA 2YEVA 4W8PA 5A6KA 2XM0A 2LCHA 1VK5A 3ZTMA 2CNWD 1JPNA 2PBEA 4EIYA 1N1CA 3EFOA 4P6IC 4FESA 1MMDA 3U9MA 2BC5A 1LE2A 2I15A 1VYKA 1YAUO 3RQGA 4AE4A 4C3BA 5EHHA 3K7DA 3L8JA 2HMZA 3H2UA 4IARA 2Q9BA 2LFDA 2XL6A 3KH2A 3AGUA 4MW8A 2YL1A 3WHNA 2WZLA 1TR2A 2R7OA 3RYLA 4CBEA 1A7DA 2C04A 3EJNA 4PJLA 5AC5A 3EFOB 3RVZA 2LQGA 3H65A 1I4YA 3HNIA 4AE4B 4CS8A 3HKKA 1C17M 2Y69C 2XSEA 5KYWA 4R32A 1CGME 3Q6NA 3IQ5A 4G0HA 3RQEA 4KI2A 3IQCA 3LJBA 3U3BA 3AG3C 3Q7LA 1YVIA 4PJNA 1XZQA 3DZAA 4N06A 1A0BA 1AVOB 2ZXWC 3KMIA 1F1MA 3W2WA 2QE9A 3F47A 1MNDA 1TWAA 3R7CA 4YL3A 3RW0A 1LI7A 3CSKA 2IXMA 4J32B 3M4BA 3ZDLA 1V55C 3OA1A 1M56C 1ZZPA 4CS9A 1B68A 2A0UA 4RDAA 4DRIB 1CPRA 2Z15A 2AU5A 3TJ6A 1NU7D 1HY5A 4XEVA 3AJMA 3DWWA 3FHDA 4U9DA 3S9OA 4IAOA 4U5EE 2J9WA 2HFIA 3E9VA 3ZSUA 4BJ5A 5A6JA 3FMSA 4OD4A 3C8ZA 5DQTA 5DVWA 4K7BA 4EBKA 4MVOA 1U6HA 4C7OA 5L3VA 1GS9A 1GGQA 3DE8A 1Z5ZA 2BE5F 1TWHA 2Q3TA 2R9RB 3NYJA 4E0HA 4JTDB 3X2QC 4BJ6C 1OKKD 2GWWA 2A0BA 1VB5A 2LFFA 3GEEA 2PF4E 2IXNA 3POVA 1J8MF 4MW3A 1ZHZA 1K40A 3S28A 3EGDB 3HNLA 4OINF 4YT5A 1J8YF 3UGOA 1O5HA 4C7OB 4JZAA 1TWCA 2OKUA 2HV6A 1YA7O 3GEIA 2HUJA 4X0RA 2ETSA 2IXOA 2MWQA 1Q0DA 2L6GA 1A41A 2J9UA 2CNWA 3TOMA 2KGOA 3RIPA 3ZVRA 1XZPA 3KYIA 2XL4A 1SYQA 2OQMA 1FFHA 2EPLX 3ZIBA 4XPXA 5DS6A 1NFOA 2XLHA 2W4MA 3IQTA 1VOMA 4Q7CA 3SP1A 2NUTA 1RKCA 1WTYA 3ECSA 5B3IA 1S05A 2A1DD 3KPHA 3Q7GA 3PMRA 4G7ZF 3N2ZB 5HSWA 2LK4A 4PFOA 1G8XA 3DM9B 1W2WA 3GM3A 4QDLA 3NYLA 3SZRA 2FGYA 5CIVA 4I44A 2ZXPA 4MQ9F 2R25A 4JURI 3W8HA 2AP3A 1QVXA 1ZU4A 1T6UA 2XS8A 2HZ8A 3F46A 3JRTA 3SEOA 1BZ4A 5KYUA 5D91A 2NUTB 1LS1A 4BEMJ 2JPUA 2Q9AA 2JD3A 1Q0FA 4O7GA 2M4EA 3S0XA 5B1BC 3T6BA 1UFBA 5JRAA 1JRAA 4O6YA 2R7UA 1HMOA 1K04A 3K6BA 3QW1A 3TK0A 1GM5A 2NSFA 3S84A 4KC9A 2H8AA 4FWVA 4YT8A 2DYRC 1RJ9B 3S90A 3C62A 3HJCA 1LVKA 3C8GB 3AG4C 2KNHA 4PR9A 5KYUB 1PV3A 4NY3A 1NFNA 2GAQA 1MMNA 2XRHA 1S7ZA 3NKEA 3TD7A 2XLOA 4E7SA 3ASNC 5JVEA 4DVYP 4E17A 4LLEA 4CDAA 1QSPA 1ST6A 1TKNA 2WZGA 5AC4A 3JZ0A 2VC9A 2G3VA 2Y3HA 3FAPB 4Z9JA 5COFA 3NRHA 3OEOA 2Q7RA 3U0CA 1R4TA 2DGJA 3B29A 5E33A 1ZW2A 1FFTC 3VF0A 2OU6A 4XLPF 4LDQA 3UNGC 1PD0A 1G4US 5L0FA 5DS5A 2YWAA 3ZTZA 2HSQA 4QI0A 1H7IA 3V7OA 1G5ZA 1ORJA 1M6TA 3M4CA 4CIHA 2UUIA 1LI5A 2CGEA 2J8WA 1T6IA 1T5OA 1OKKA 1YLMA 2DB4A 2FFHA 2R05A 3AQBA 3G4ZA 4MVQA 4PFPA 3EGXA 3MX3A 4ZLCA 3HTKC 2CDQA 3K1IC 2PFDA 1Z3IX 4OD5A 2VCCA 4MVUA 3T6GB 2WVOA 2ZXOA 4OIRF 3ZQYA 4FAPB 4MTFA 5KYXA 5KYNA 4RD9A 3T9OA 3KKBA 4IJJA 3LEVA 2YKZA 3V5YA 4CS7A 4E18A 3IEEA 3RKOF 2D4UA 2PX0A 3LESA 2Q9CA 3RF3A 1FNTc 2A6EF 1UG7A 2HJMA 4O79A 1Q0KA 4O6NA 1WWPA 5GPGB 3DD7A 4EBJA 1TWGA 3H2VA 3CZ6A 2R7XA 4U5HA 2QNLA 1DOWA 5JT4A 2R7SA 3GEHA 1V74B 4DBRA 3ATPA 5L3QA 4U5BE 2XLWA 3EHMA 3O6XA 1NSGB 3GWLA 1H9GA 4JTAB 3U5SA 1KNYA 4C3DA 1PCXA 4NQFA 5HV9A 4XLNF 4LDKA 3NMJA 4H4KC 4OIOF 2P6VA 1JR8A 4JJGA 4CJGA 1YYXA 3EH2A 1D1AA 1R5ID 1FAPB 1LS4A 2KSFA 2AWCA 2LSEA 4JRZA 4YT2A 1D1CA 2X51A 1D0XA 4B6IA 5FCLA 3EH1A 2VCBA 2EILC 1CPQA 1LIHA 3ABMC 3FOOA 3B0VC 3OWTA 2XXAA 2NPUA 2QLAA 4N4WA 4P9TA 2R7VA 2YL3A 2R7WA 1O87A 1NLXA 3MLGA 2ZXRA 5JS5A 1JAFA 4U5FE 4PJMA 5KYWB 1EI7A 5CI9A 4QI2A 3LEOA 1V54C 4NCQA 256BA 1FMWA 4N6CA 2P0NA 1FTSA 3EQLF 2IBFA 4MVRA 2XLMA 1ZU5A 1M2VA 4EWCA 2G62A 4U5DE 4MNDA 2XXAB 5KYYA 1Y4CA 2EIKC 3LS1A 4CIPA 1RXQA 1EKYA 3AG2C 2J9VA 2NG1A 2W9YA 4J7TA 4MVSA 1EA8A 5JLIA 4KBLA 1HE9A 1LKXA 4HE8D 4I3MA 1A7VA 1CGNA 1SZIA 2YLDA 2IYLD 4EKWA 4CSAC 3G50A 4IWBA 5COMA 1IW7F 3O10A 1ZHXA 1M2VB 2OOCA 1RKEA 3AOUA 4JTCB 3JT1A 1VTMP 3C7JA 3O55A 1QQ3A 2HSBA 4IAQA 4DBQA 5KYYB 4JCHA 1RMVA 1E83A 4HFFB 2EPOA 4XEFA 4JEAA 3VRCA 1Z23A 4E7ZA 5B3SC 5A6BD 1O3UA 4YJWA 1DOVA 1QPUA 1Z7Qc 3SXKA 3AG1C 3CQZA 4E0IA 1BR1A 3ZG1A 1RKEB 3B71A 3RVYA 4DRHB 2EPKX 4BJTA 4YK5A 4F4BA 3QMKA 4AX2A 3W4YA 5BQHA 4M63A 4DVZA 1YJGA 3FAJA 1C03A 1Y6DA 3G4XA 3GODA 4ANJA 2RSEB 2YQYA 3M79A 3MFNA 2WB7A 2BL2A 3N24A 2ICWG 3R2PA 3AGTA 2IOQA 3V5XA 4G7OF 1L7CA 2EPNA 2KYHA 4JEBA 2D5RB 2L81A 2P1AA 2YL0A 3DAFA 4EHPA 1V4AA 2XLVA 3C63A 4JVSA 4XQ1A 1SF8A 3S29A 4KNWA 4ULWA 4ZLDA 3FXHA 4U5CE 4YL1A 1ZW3A 1M57C 3PDMP 3U2MA 2VCAA 3DKAA 4WABA 2MYSA 5BUOA 5T3WA 2A69F 3Q6MA 3ZQVA 4C3EA 4CS8C 3DJNB 1OW7A 4FX5A 1OCCC 4K0DA 4W8KA 1NBBA 3QVZA 4MTOA 2WVNA 1G4WR 2HV7A 1ZVZA 1QLEC 4AL0A 1MMGA 2KJGA 2A68F 2P7VA 3RH3A 2GA0A 5A6AA 3NDBB 1YZAA 1MNEA 1OQCA 1AEPA 2B0JA 3LS0A 4MVZA 4AL1A 1K05A 3GANA 4IB4A 3M15A 1E86A 2KW3C 2GFHA 3LLKA 2L9JA 3NMKA 2R03A 4ULVA 4JC7A 1LE4A 2PNOA 2IXPA 1D0YA 3JTLO 4BEJA 2YLGA 1T01A 2A6HF 3IHUA 5F28E 1KTMA 5B1AC 3RFYA 1RCPA 4CDYA 4DJ9A 4BJ6A 2J7PD 1BBHA 2P61A 3WAQA 4J7YA 3CEXA 1U89A 2H7VC 2X0CA 3QVYA 1HW2A 4HEAJ 3C18A 3ZWIA 4BJ5C 3EG9A 4MS2A 1VYIA 3J06A 4EBBA 1PD1A 3IPMO 3BEHA 3MYIA 5DQZA 2DYSC 3ZC4A 4CJOA 4AK9A 1OR3A 5T1DB 4WGZA 1Q0MA 1QZXA 3UMKA 3V5ZA 4Z9HA 1YDIA 3AQCA 3LLIA 2CYDA 2Y3GA 3DI5A 2AWYA 3FDQA 2LD6A 2NUPA 5JUAA 2ASRA 3UGPA 1TFOB 1HMDA 2LP4A 4U5GA 3EG9B 3ASOC 3ABKC 1BR4A 3UMHA 1EQ1A 4JIOA 3WODF 3A11A 3EGXB 3EZHA 5D92A 3UMIA 2VASA 1E85A 2LIGA 2J0XA 3LUTB 3NKDA 4L6RA 5KYXB 3JYHA 1SMYF 5F5FA 2YZSA 1IZMA 2RD9A 2R7QA 3EPVA 3FOPA 2NUPB 2V3CC 4XPYA 2FAPB 3K1HA 5CI8A 2H7OA 3X1OA 4A2NB 3US6A 2E87A 2KQ9A 2QTVA 2M64A 4G7HF 4DXWA 3DJUB 4CDVA 4N6HA 3JSEO 1FR0A 2ZPAA 1LPEA 1YA9A 2CCYA 4I1MA 3LAYA 3SXMA 5E3AA 1JMWA 5E2QA 3UR3C 1I4ZA 2OJQA 2YVKA 4H54A 3EZIA 5L0JA 3DAGA 4JW1A 1JOGA 4XPWA 4BJ1A 1A7EA 2B0HA 3C8GD 3U9JA 3TQOA 5BQIA 2Y3DA 3VAYA 2J9BA 2NSGA 2XS1A 1BDJB 1VLSA 3HLZA 3JYYA 3O39A 4U9EA 5K0IA 4OIPF 1BR2A 3BRJA 3K33A 4KNVA 3KYJA 1HW1A 5TJ5E 3U8PA 3DM5A 4G78A 2Q4FA 2J45A 2PX3A 2GDCA 3GM1A 2OG2A 2H7BA 1YYJA 3CAXA 3NG1A 1WATA 4IGGA 1NG1A 4MVMA 2C03A 2R02A 4XTKA 3U2LA 1OXBA 2ZD9A 2WZFA 1OR2A 1WN0A 2EIJC 5BQGA 1Z63A 2YLIA 1L3PA 4OIQF 2J0WA 2J7PA 5L0GA 2F22A 1VMAA 3U8VA 2CW0F 2EINC 4XWJA 5DLJA 1OXKA 1OW6A 5JP7A 2AVKA 4P9FA 3SNHA 1YZCA 3HNKA 3QZCA 3SXYA 4JE9A 1ORYA 2OEXA 3EGDA 1AUEA 5EGYA 1TQGA 3FVYA 4GYTA 3ITFA 4DOZA 2MHRA 3L34A 3K1IA 3EHNA 1OW8A 1LM3B 2KC3A 1CGOA 4BG0A 1U0BB 4CX9A 4WGYA 1E2XA 4YWQA 4MTGA 2YL7A 2HMQA 3GORA 3DE9A 3I5PA 4NTFA 4YT4A 3M1CB 1GQAA 2R7RA 1FMVA 5L0CA 4JKVA 4JCZA 5T3TA 3VYWA 4D4XA 3B0UX 2W4BA 5L0HA 4NTBA 4XEKA 1YARO 4RBNA 1APCA 2OEVA 3L1MA 1ZHYA 4UDVA 4GEHA 2R7TA 3TOLA 2WL8A 1H9TA 4LDRA 3RQFA 3VM6A 2XLEA 4DRJB 1M2OA 2HJ3A 2XM4A 3B0PA 3T6JA 2IM8A 2W45A 3U3FA 3K66A 2QUPA 3JSZA 3L8IA 2QY9A 2EPMX 3DMDA 2PP4A 5FZTA 1T9KA 2HS5A 3TJ5A 5AGFA 3IQ6A 2OCCC 5F5HA 3S27A 3JRMO 3E70C 1MQVA 4ER9A 4K1OA 2UUHA 3NMIA 5IY5C 3MBGA 3L0IA 1NZEA 2XL8A 2L7AA 3W2VA 2V26A 1Q0GA 2WVQA 4YN0B 3T4RA 3QTHA 1RJ9A 2G3KA 5JSLA 1WASA 3C8GA 3B9QA 1QKRA 1ZHWA 4JJFA 4NTAA 3WG7C 4PACA 4YL0A 5A69A 2XLDA 5EK0A 3LNMB 4Z9IA 1C02A 1H6GA 2YRFA 4BPMA 4CS9C 4A4AA 3TULA 1VLTA 3KL4A 4WJ0A 3LNRA 4LERA 2J46A 1KU2A 1WGWA 2YHSA 2JX0A 3DXJF 5E3CA 5DS4A 2EIMC 3NYMA 5L0DA 4IRUA 3QW0A 2Q00A 2L6FA 4PK4A 2OJED 4Q4ZF 2I8BA 2DI3A 1NU9C 1WOLA
chains in the Genus database with same CATH topology
2P61A 2QUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P61 A;  2QUP A; 
#chains in the Genus database with same CATH topology
 4LLC A;  1TFK B;  1T6Q A;  4ONS A;  3SXZ A;  4CSA A;  4GQH A;  3I4U A;  5L0I A;  1XWJ A;  4NC3 A;  1E84 A;  3I5Q A;  3MYF A;  4Q5S F;  1OCO C;  2Y3B A;  2VB6 A;  2KK1 A;  2L6H A;  3A9C A;  2TMV P;  3JCU Q;  1ORS C;  4D4N A;  5A6B A;  2VH3 A;  1ZYR F;  4O6M A;  2Y39 A;  3GM2 A;  4I1O B;  4PJJ A;  4EUK B;  1HE1 A;  1ZHT A;  3ABL C;  1OCZ C;  1MMA A;  5COG A;  3HNJ A;  3PHF 2;  1Z6A A;  3N0T A;  3PCV A;  1I5N A;  4J30 B;  1SR2 A;  1D1B A;  1JPJ A;  1OCR C;  2HKV A;  4HFK B;  4LAC B;  3W8I A;  1D0Z A;  3SYN A;  2O9X A;  3GWN A;  2YEV A;  4W8P A;  5A6K A;  2XM0 A;  2LCH A;  1VK5 A;  3ZTM A;  2CNW D;  1JPN A;  2PBE A;  4EIY A;  1N1C A;  3EFO A;  4P6I C;  4FES A;  1MMD A;  3U9M A;  2BC5 A;  1LE2 A;  2I15 A;  1VYK A;  1YAU O;  3RQG A;  4AE4 A;  4C3B A;  5EHH A;  3K7D A;  3L8J A;  2HMZ A;  3H2U A;  4IAR A;  2Q9B A;  2LFD A;  2XL6 A;  3KH2 A;  3AGU A;  4MW8 A;  2YL1 A;  3WHN A;  2WZL A;  1TR2 A;  2R7O A;  3RYL A;  4CBE A;  1A7D A;  2C04 A;  3EJN A;  4PJL A;  5AC5 A;  3EFO B;  3RVZ A;  2LQG A;  3H65 A;  1I4Y A;  3HNI A;  4AE4 B;  4CS8 A;  3HKK A;  1C17 M;  2Y69 C;  2XSE A;  5KYW A;  4R32 A;  1CGM E;  3Q6N A;  3IQ5 A;  4G0H A;  3RQE A;  4KI2 A;  3IQC A;  3LJB A;  3U3B A;  3AG3 C;  3Q7L A;  1YVI A;  4PJN A;  1XZQ A;  3DZA A;  4N06 A;  1A0B A;  1AVO B;  2ZXW C;  3KMI A;  1F1M A;  3W2W A;  2QE9 A;  3F47 A;  1MND A;  1TWA A;  3R7C A;  4YL3 A;  3RW0 A;  1LI7 A;  3CSK A;  2IXM A;  4J32 B;  3M4B A;  3ZDL A;  1V55 C;  3OA1 A;  1M56 C;  1ZZP A;  4CS9 A;  1B68 A;  2A0U A;  4RDA A;  4DRI B;  1CPR A;  2Z15 A;  2AU5 A;  3TJ6 A;  1NU7 D;  1HY5 A;  4XEV A;  3AJM A;  3DWW A;  3FHD A;  4U9D A;  3S9O A;  4IAO A;  4U5E E;  2J9W A;  2HFI A;  3E9V A;  3ZSU A;  4BJ5 A;  5A6J A;  3FMS A;  4OD4 A;  3C8Z A;  5DQT A;  5DVW A;  4K7B A;  4EBK A;  4MVO A;  1U6H A;  4C7O A;  5L3V A;  1GS9 A;  1GGQ A;  3DE8 A;  1Z5Z A;  2BE5 F;  1TWH A;  2Q3T A;  2R9R B;  3NYJ A;  4E0H A;  4JTD B;  3X2Q C;  4BJ6 C;  1OKK D;  2GWW A;  2A0B A;  1VB5 A;  2LFF A;  3GEE A;  2PF4 E;  2IXN A;  3POV A;  1J8M F;  4MW3 A;  1ZHZ A;  1K40 A;  3S28 A;  3EGD B;  3HNL A;  4OIN F;  4YT5 A;  1J8Y F;  3UGO A;  1O5H A;  4C7O B;  4JZA A;  1TWC A;  2OKU A;  2HV6 A;  1YA7 O;  3GEI A;  2HUJ A;  4X0R A;  2ETS A;  2IXO A;  2MWQ A;  1Q0D A;  2L6G A;  1A41 A;  2J9U A;  2CNW A;  3TOM A;  2KGO A;  3RIP A;  3ZVR A;  1XZP A;  3KYI A;  2XL4 A;  1SYQ A;  2OQM A;  1FFH A;  2EPL X;  3ZIB A;  4XPX A;  5DS6 A;  1NFO A;  2XLH A;  2W4M A;  3IQT A;  1VOM A;  4Q7C A;  3SP1 A;  2NUT A;  1RKC A;  1WTY A;  3ECS A;  5B3I A;  1S05 A;  2A1D D;  3KPH A;  3Q7G A;  3PMR A;  4G7Z F;  3N2Z B;  5HSW A;  2LK4 A;  4PFO A;  1G8X A;  3DM9 B;  1W2W A;  3GM3 A;  4QDL A;  3NYL A;  3SZR A;  2FGY A;  5CIV A;  4I44 A;  2ZXP A;  4MQ9 F;  2R25 A;  4JUR I;  3W8H A;  2AP3 A;  1QVX A;  1ZU4 A;  1T6U A;  2XS8 A;  2HZ8 A;  3F46 A;  3JRT A;  3SEO A;  1BZ4 A;  5KYU A;  5D91 A;  2NUT B;  1LS1 A;  4BEM J;  2JPU A;  2Q9A A;  2JD3 A;  1Q0F A;  4O7G A;  2M4E A;  3S0X A;  5B1B C;  3T6B A;  1UFB A;  5JRA A;  1JRA A;  4O6Y A;  2R7U A;  1HMO A;  1K04 A;  3K6B A;  3QW1 A;  3TK0 A;  1GM5 A;  2NSF A;  3S84 A;  4KC9 A;  2H8A A;  4FWV A;  4YT8 A;  2DYR C;  1RJ9 B;  3S90 A;  3C62 A;  3HJC A;  1LVK A;  3C8G B;  3AG4 C;  2KNH A;  4PR9 A;  5KYU B;  1PV3 A;  4NY3 A;  1NFN A;  2GAQ A;  1MMN A;  2XRH A;  1S7Z A;  3NKE A;  3TD7 A;  2XLO A;  4E7S A;  3ASN C;  5JVE A;  4DVY P;  4E17 A;  4LLE A;  4CDA A;  1QSP A;  1ST6 A;  1TKN A;  2WZG A;  5AC4 A;  3JZ0 A;  2VC9 A;  2G3V A;  2Y3H A;  3FAP B;  4Z9J A;  5COF A;  3NRH A;  3OEO A;  2Q7R A;  3U0C A;  1R4T A;  2DGJ A;  3B29 A;  5E33 A;  1ZW2 A;  1FFT C;  3VF0 A;  2OU6 A;  4XLP F;  4LDQ A;  3UNG C;  1PD0 A;  1G4U S;  5L0F A;  5DS5 A;  2YWA A;  3ZTZ A;  2HSQ A;  4QI0 A;  1H7I A;  3V7O A;  1G5Z A;  1ORJ A;  1M6T A;  3M4C A;  4CIH A;  2UUI A;  1LI5 A;  2CGE A;  2J8W A;  1T6I A;  1T5O A;  1OKK A;  1YLM A;  2DB4 A;  2FFH A;  2R05 A;  3AQB A;  3G4Z A;  4MVQ A;  4PFP A;  3EGX A;  3MX3 A;  4ZLC A;  3HTK C;  2CDQ A;  3K1I C;  2PFD A;  1Z3I X;  4OD5 A;  2VCC A;  4MVU A;  3T6G B;  2WVO A;  2ZXO A;  4OIR F;  3ZQY A;  4FAP B;  4MTF A;  5KYX A;  5KYN A;  4RD9 A;  3T9O A;  3KKB A;  4IJJ A;  3LEV A;  2YKZ A;  3V5Y A;  4CS7 A;  4E18 A;  3IEE A;  3RKO F;  2D4U A;  2PX0 A;  3LES A;  2Q9C A;  3RF3 A;  1FNT c;  2A6E F;  1UG7 A;  2HJM A;  4O79 A;  1Q0K A;  4O6N A;  1WWP A;  5GPG B;  3DD7 A;  4EBJ A;  1TWG A;  3H2V A;  3CZ6 A;  2R7X A;  4U5H A;  2QNL A;  1DOW A;  5JT4 A;  2R7S A;  3GEH A;  1V74 B;  4DBR A;  3ATP A;  5L3Q A;  4U5B E;  2XLW A;  3EHM A;  3O6X A;  1NSG B;  3GWL A;  1H9G A;  4JTA B;  3U5S A;  1KNY A;  4C3D A;  1PCX A;  4NQF A;  5HV9 A;  4XLN F;  4LDK A;  3NMJ A;  4H4K C;  4OIO F;  2P6V A;  1JR8 A;  4JJG A;  4CJG A;  1YYX A;  3EH2 A;  1D1A A;  1R5I D;  1FAP B;  1LS4 A;  2KSF A;  2AWC A;  2LSE A;  4JRZ A;  4YT2 A;  1D1C A;  2X51 A;  1D0X A;  4B6I A;  5FCL A;  3EH1 A;  2VCB A;  2EIL C;  1CPQ A;  1LIH A;  3ABM C;  3FOO A;  3B0V C;  3OWT A;  2XXA A;  2NPU A;  2QLA A;  4N4W A;  4P9T A;  2R7V A;  2YL3 A;  2R7W A;  1O87 A;  1NLX A;  3MLG A;  2ZXR A;  5JS5 A;  1JAF A;  4U5F E;  4PJM A;  5KYW B;  1EI7 A;  5CI9 A;  4QI2 A;  3LEO A;  1V54 C;  4NCQ A;  256B A;  1FMW A;  4N6C A;  2P0N A;  1FTS A;  3EQL F;  2IBF A;  4MVR A;  2XLM A;  1ZU5 A;  1M2V A;  4EWC A;  2G62 A;  4U5D E;  4MND A;  2XXA B;  5KYY A;  1Y4C A;  2EIK C;  3LS1 A;  4CIP A;  1RXQ A;  1EKY A;  3AG2 C;  2J9V A;  2NG1 A;  2W9Y A;  4J7T A;  4MVS A;  1EA8 A;  5JLI A;  4KBL A;  1HE9 A;  1LKX A;  4HE8 D;  4I3M A;  1A7V A;  1CGN A;  1SZI A;  2YLD A;  2IYL D;  4EKW A;  4CSA C;  3G50 A;  4IWB A;  5COM A;  1IW7 F;  3O10 A;  1ZHX A;  1M2V B;  2OOC A;  1RKE A;  3AOU A;  4JTC B;  3JT1 A;  1VTM P;  3C7J A;  3O55 A;  1QQ3 A;  2HSB A;  4IAQ A;  4DBQ A;  5KYY B;  4JCH A;  1RMV A;  1E83 A;  4HFF B;  2EPO A;  4XEF A;  4JEA A;  3VRC A;  1Z23 A;  4E7Z A;  5B3S C;  5A6B D;  1O3U A;  4YJW A;  1DOV A;  1QPU A;  1Z7Q c;  3SXK A;  3AG1 C;  3CQZ A;  4E0I A;  1BR1 A;  3ZG1 A;  1RKE B;  3B71 A;  3RVY A;  4DRH B;  2EPK X;  4BJT A;  4YK5 A;  4F4B A;  3QMK A;  4AX2 A;  3W4Y A;  5BQH A;  4M63 A;  4DVZ A;  1YJG A;  3FAJ A;  1C03 A;  1Y6D A;  3G4X A;  3GOD A;  4ANJ A;  2RSE B;  2YQY A;  3M79 A;  3MFN A;  2WB7 A;  2BL2 A;  3N24 A;  2ICW G;  3R2P A;  3AGT A;  2IOQ A;  3V5X A;  4G7O F;  1L7C A;  2EPN A;  2KYH A;  4JEB A;  2D5R B;  2L81 A;  2P1A A;  2YL0 A;  3DAF A;  4EHP A;  1V4A A;  2XLV A;  3C63 A;  4JVS A;  4XQ1 A;  1SF8 A;  3S29 A;  4KNW A;  4ULW A;  4ZLD A;  3FXH A;  4U5C E;  4YL1 A;  1ZW3 A;  1M57 C;  3PDM P;  3U2M A;  2VCA A;  3DKA A;  4WAB A;  2MYS A;  5BUO A;  5T3W A;  2A69 F;  3Q6M A;  3ZQV A;  4C3E A;  4CS8 C;  3DJN B;  1OW7 A;  4FX5 A;  1OCC C;  4K0D A;  4W8K A;  1NBB A;  3QVZ A;  4MTO A;  2WVN A;  1G4W R;  2HV7 A;  1ZVZ A;  1QLE C;  4AL0 A;  1MMG A;  2KJG A;  2A68 F;  2P7V A;  3RH3 A;  2GA0 A;  5A6A A;  3NDB B;  1YZA A;  1MNE A;  1OQC A;  1AEP A;  2B0J A;  3LS0 A;  4MVZ A;  4AL1 A;  1K05 A;  3GAN A;  4IB4 A;  3M15 A;  1E86 A;  2KW3 C;  2GFH A;  3LLK A;  2L9J A;  3NMK A;  2R03 A;  4ULV A;  4JC7 A;  1LE4 A;  2PNO A;  2IXP A;  1D0Y A;  3JTL O;  4BEJ A;  2YLG A;  1T01 A;  2A6H F;  3IHU A;  5F28 E;  1KTM A;  5B1A C;  3RFY A;  1RCP A;  4CDY A;  4DJ9 A;  4BJ6 A;  2J7P D;  1BBH A;  2P61 A;  3WAQ A;  4J7Y A;  3CEX A;  1U89 A;  2H7V C;  2X0C A;  3QVY A;  1HW2 A;  4HEA J;  3C18 A;  3ZWI A;  4BJ5 C;  3EG9 A;  4MS2 A;  1VYI A;  3J06 A;  4EBB A;  1PD1 A;  3IPM O;  3BEH A;  3MYI A;  5DQZ A;  2DYS C;  3ZC4 A;  4CJO A;  4AK9 A;  1OR3 A;  5T1D B;  4WGZ A;  1Q0M A;  1QZX A;  3UMK A;  3V5Z A;  4Z9H A;  1YDI A;  3AQC A;  3LLI A;  2CYD A;  2Y3G A;  3DI5 A;  2AWY A;  3FDQ A;  2LD6 A;  2NUP A;  5JUA A;  2ASR A;  3UGP A;  1TFO B;  1HMD A;  2LP4 A;  4U5G A;  3EG9 B;  3ASO C;  3ABK C;  1BR4 A;  3UMH A;  1EQ1 A;  4JIO A;  3WOD F;  3A11 A;  3EGX B;  3EZH A;  5D92 A;  3UMI A;  2VAS A;  1E85 A;  2LIG A;  2J0X A;  3LUT B;  3NKD A;  4L6R A;  5KYX B;  3JYH A;  1SMY F;  5F5F A;  2YZS A;  1IZM A;  2RD9 A;  2R7Q A;  3EPV A;  3FOP A;  2NUP B;  2V3C C;  4XPY A;  2FAP B;  3K1H A;  5CI8 A;  2H7O A;  3X1O A;  4A2N B;  3US6 A;  2E87 A;  2KQ9 A;  2QTV A;  2M64 A;  4G7H F;  4DXW A;  3DJU B;  4CDV A;  4N6H A;  3JSE O;  1FR0 A;  2ZPA A;  1LPE A;  1YA9 A;  2CCY A;  4I1M A;  3LAY A;  3SXM A;  5E3A A;  1JMW A;  5E2Q A;  3UR3 C;  1I4Z A;  2OJQ A;  2YVK A;  4H54 A;  3EZI A;  5L0J A;  3DAG A;  4JW1 A;  1JOG A;  4XPW A;  4BJ1 A;  1A7E A;  2B0H A;  3C8G D;  3U9J A;  3TQO A;  5BQI A;  2Y3D A;  3VAY A;  2J9B A;  2NSG A;  2XS1 A;  1BDJ B;  1VLS A;  3HLZ A;  3JYY A;  3O39 A;  4U9E A;  5K0I A;  4OIP F;  1BR2 A;  3BRJ A;  3K33 A;  4KNV A;  3KYJ A;  1HW1 A;  5TJ5 E;  3U8P A;  3DM5 A;  4G78 A;  2Q4F A;  2J45 A;  2PX3 A;  2GDC A;  3GM1 A;  2OG2 A;  2H7B A;  1YYJ A;  3CAX A;  3NG1 A;  1WAT A;  4IGG A;  1NG1 A;  4MVM A;  2C03 A;  2R02 A;  4XTK A;  3U2L A;  1OXB A;  2ZD9 A;  2WZF A;  1OR2 A;  1WN0 A;  2EIJ C;  5BQG A;  1Z63 A;  2YLI A;  1L3P A;  4OIQ F;  2J0W A;  2J7P A;  5L0G A;  2F22 A;  1VMA A;  3U8V A;  2CW0 F;  2EIN C;  4XWJ A;  5DLJ A;  1OXK A;  1OW6 A;  5JP7 A;  2AVK A;  4P9F A;  3SNH A;  1YZC A;  3HNK A;  3QZC A;  3SXY A;  4JE9 A;  1ORY A;  2OEX A;  3EGD A;  1AUE A;  5EGY A;  1TQG A;  3FVY A;  4GYT A;  3ITF A;  4DOZ A;  2MHR A;  3L34 A;  3K1I A;  3EHN A;  1OW8 A;  1LM3 B;  2KC3 A;  1CGO A;  4BG0 A;  1U0B B;  4CX9 A;  4WGY A;  1E2X A;  4YWQ A;  4MTG A;  2YL7 A;  2HMQ A;  3GOR A;  3DE9 A;  3I5P A;  4NTF A;  4YT4 A;  3M1C B;  1GQA A;  2R7R A;  1FMV A;  5L0C A;  4JKV A;  4JCZ A;  5T3T A;  3VYW A;  4D4X A;  3B0U X;  2W4B A;  5L0H A;  4NTB A;  4XEK A;  1YAR O;  4RBN A;  1APC A;  2OEV A;  3L1M A;  1ZHY A;  4UDV A;  4GEH A;  2R7T A;  3TOL A;  2WL8 A;  1H9T A;  4LDR A;  3RQF A;  3VM6 A;  2XLE A;  4DRJ B;  1M2O A;  2HJ3 A;  2XM4 A;  3B0P A;  3T6J A;  2IM8 A;  2W45 A;  3U3F A;  3K66 A;  2QUP A;  3JSZ A;  3L8I A;  2QY9 A;  2EPM X;  3DMD A;  2PP4 A;  5FZT A;  1T9K A;  2HS5 A;  3TJ5 A;  5AGF A;  3IQ6 A;  2OCC C;  5F5H A;  3S27 A;  3JRM O;  3E70 C;  1MQV A;  4ER9 A;  4K1O A;  2UUH A;  3NMI A;  5IY5 C;  3MBG A;  3L0I A;  1NZE A;  2XL8 A;  2L7A A;  3W2V A;  2V26 A;  1Q0G A;  2WVQ A;  4YN0 B;  3T4R A;  3QTH A;  1RJ9 A;  2G3K A;  5JSL A;  1WAS A;  3C8G A;  3B9Q A;  1QKR A;  1ZHW A;  4JJF A;  4NTA A;  3WG7 C;  4PAC A;  4YL0 A;  5A69 A;  2XLD A;  5EK0 A;  3LNM B;  4Z9I A;  1C02 A;  1H6G A;  2YRF A;  4BPM A;  4CS9 C;  4A4A A;  3TUL A;  1VLT A;  3KL4 A;  4WJ0 A;  3LNR A;  4LER A;  2J46 A;  1KU2 A;  1WGW A;  2YHS A;  2JX0 A;  3DXJ F;  5E3C A;  5DS4 A;  2EIM C;  3NYM A;  5L0D A;  4IRU A;  3QW0 A;  2Q00 A;  2L6F A;  4PK4 A;  2OJE D;  4Q4Z F;  2I8B A;  2DI3 A;  1NU9 C;  1WOL A; 
#chains in the Genus database with same CATH homology
 2P61 A;  2QUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...