2P61A

Crystal structure of protein tm1646 from thermotoga maritima, pfam duf327
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
120
structure length
114
Chain Sequence
EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIYKLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein TM_1646
publication title Crystal structure of hypothetical protein TM_1646 from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
total genus 51
structure length 114
sequence length 120
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03885 DUF327 Protein of unknown function (DUF327)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hypothetical protein TM1646-like domain 2p61A00
2QUPA 2P61A
chains in the Genus database with same CATH superfamily
4MTGA 2LSEA 3NMJA 3U9MA 4N6CA 1K04A 1TWCA 4D4XA 5BUOA 1OXBA 2XLDA 4HFFB 4BG0A 4IAOA 1SR2A 5KYWB 3RQGA 4JURI 3GM2A 3X1OA 2HV7A 3HJCA 3S9OA 1VYKA 2LP4A 4AK9A 5JS5A 1RXQA 3ZIBA 2WZFA 3KL4A 3QVYA 1F1MA 4MW3A 4DXWA 3T6GB 1MQVA 4YK5A 5AC4A 4OIOF 1WN0A 2XS1A 1WWPA 1Q0KA 3E70C 1HE9A 5BQHA 2YLDA 1DOVA 4QDLA 5IY5C 2R9RB 5COMA 5DQTA 4JJGA 3C7JA 4Z9IA 4JCZA 4MVMA 2J8WA 2R7OA 2EIKC 1ORSC 3NYLA 5EK0A 2H8AA 4NTFA 3RW0A 4FAPB 2P0NA 5L0CA 5KYUA 3GEHA 4U9DA 1FFTC 1H6GA 3EZHA 3PHF2 2TMVP 3RIPA 1HW1A 1GM5A 1XWJA 4PJMA 1TWAA 1ZU5A 4BJ6C 1JRAA 4JC7A 2HMQA 1HMOA 3EH2A 1NBBA 4MVRA 2HJ3A 2R7TA 1GGQA 1EI7A 1GQAA 4Z9JA 2W4MA 5L0FA 4QI0A 4U5FE 4EBKA 3ABMC 4E18A 3Q7LA 2OU6A 1Y4CA 3GORA 1Y6DA 2YLGA 3AGUA 4IJJA 2CYDA 3HNKA 4CS8A 4OD4A 5B3IA 2B0HA 1NLXA 1MNDA 3WAQA 1OQCA 3ASNC 3DM9B 4J32B 2OEVA 4PK4A 4CJGA 1O3UA 3LAYA 3FVYA 5T3TA 3W4YA 4D4NA 3JCUQ 1FNTc 1Z5ZA 3DJUB 4JTCB 1H9TA 1NSGB 2HSBA 2A68F 2YL7A 3ABLC 3K6BA 4O79A 2X0CA 5EGYA 1LE4A 4MTFA 1O5HA 4PJJA 4U5EE 2J46A 2Y3HA 3I5PA 5COFA 3V5YA 4HEAJ 3ZDLA 1K05A 2XLHA 4U5DE 1LS1A 1QQ3A 1IZMA 2M64A 2LK4A 4DJ9A 1OCOC 2XL4A 4X0RA 1Z7Qc 3M4CA 3LLIA 4MNDA 3WHNA 5L0GA 4Q7CA 2X51A 1U6HA 4JRZA 1G4US 1VYIA 2IM8A 1ZW3A 5FCLA 2XLOA 4GYTA 3CAXA 4BEMJ 4C3EA 2GWWA 1SMYF 2LFDA 2QTVA 4I44A 3UR3C 4NQFA 1TQGA 2ZPAA 4JVSA 3CSKA 5KYYA 1G5ZA 2LFFA 3W2VA 2W9YA 2D4UA 1FFHA 3AG3C 3ZG1A 3DAFA 2HS5A 3JRMO 1CGNA 2WZGA 2YVKA 1S05A 2R7QA 2QLAA 3LUTB 2R7SA 3EGXB 5A6JA 4JEAA 1L7CA 4G78A 3F47A 4G7OF 3V7OA 3ZC4A 4E0HA 4M63A 1MMGA 1VK5A 1VMAA 3S29A 1OW6A 1Q0MA 2QUPA 2KQ9A 1ORYA 2KGOA 3DJNB 3GM1A 2EPOA 2YLIA 3R2PA 4GEHA 1PCXA 1LI5A 5E33A 3E9VA 3IQTA 4LDKA 2Q7RA 4C3DA 2J0XA 4K1OA 4LACB 1ST6A 4OD5A 4U5CE 1PD0A 3LLKA 4KNWA 2IBFA 3K1HA 4BJ6A 2NSGA 3L0IA 1BR2A 3AGTA 3EG9B 1LS4A 3AG4C 4MS2A 3ZSUA 1I4ZA 3AG2C 3H2UA 4IAQA 4LDRA 4EBBA 1M2VB 4JE9A 5F5FA 4OINF 3S90A 3Q7GA 3LJBA 2NUPB 1G4WR 1GS9A 4ER9A 3IEEA 2L9JA 1TFKB 1FMWA 1M2OA 2EPLX 4JCHA 5BQGA 3VRCA 4CJOA 3MBGA 5CI8A 2RSEB 2XM4A 4ULVA 4A2NB 3KMIA 1U89A 4E0IA 1FR0A 1YZCA 3KYJA 1CGME 3KPHA 4PACA 1TWHA 3TULA 3GWNA 2DYSC 2J0WA 3U8PA 3B29A 2OOCA 4WJ0A 5F28E 1CPRA 1BDJB 1MNEA 3ZWIA 4W8KA 2P1AA 4O6YA 3UGPA 4N06A 3EH1A 3HNLA 1VTMP 2L6GA 1FMVA 2XL8A 4XTKA 1CGOA 2VC9A 2ZD9A 3JRTA 4H4KC 1V55C 1JOGA 1QVXA 1E85A 4DRHB 2QNLA 3G4XA 4EBJA 3U0CA 2P61A 5A6KA 1L3PA 1M2VA 2FAPB 2XRHA 4ZLDA 3WODF 2NUPA 3NG1A 1OR3A 1Z3IX 2JD3A 2B0JA 3GWLA 3W8IA 3EGDA 3R7CA 3FHDA 1YVIA 4MTOA 1A7EA 3MYIA 2Y3BA 1WTYA 4YJWA 4DVZA 3T9OA 2A1DD 4CS8C 1FAPB 3UMKA 2BL2A 3EFOA 2H7BA 4XEFA 2I8BA 1EKYA 3RH3A 1XZPA 4BJ5C 2DB4A 4MVZA 2JPUA 2HFIA 1SF8A 3FAJA 4J30B 1ZU4A 2AVKA 2YQYA 4QI2A 3T4RA 3TJ5A 4DVYP 2YHSA 2GFHA 4FESA 1ZHWA 1S7ZA 2MHRA 3MFNA 5AC5A 1LIHA 1HE1A 1R5ID 1E86A 1T01A 1YA7O 2A69F 3C8GD 4YT5A 2UUIA 1E84A 2Y3GA 2ZXPA 4DRIB 3N2ZB 4KC9A 2H7OA 4WGZA 1BR1A 1APCA 2IYLD 1A7DA 2J9UA 2WVOA 2LCHA 1OCCC 1NFNA 2OJQA 4E17A 4EIYA 1LVKA 4CX9A 5HV9A 1UFBA 1ZYRF 3AJMA 1D0XA 3O55A 3K33A 3JSZA 3FDQA 3V5XA 3U3FA 2XLMA 2CGEA 4U5BE 4G7HF 2J9BA 3T6JA 3M79A 2KJGA 4JW1A 3C18A 3Q6MA 4ONSA 3S27A 5A6AA 3JZ0A 4CBEA 3DAGA 2CNWD 1MMAA 3NRHA 2CW0F 4DBRA 1RJ9B 1BR4A 2HUJA 2KK1A 2FFHA 3DMDA 4JZAA 4IB4A 4MQ9F 1WASA 3AQCA 3IHUA 3LNRA 3MX3A 3DXJF 3S28A 1T9KA 3IQ5A 4A4AA 1YARO 5L3VA 1U0BB 4KI2A 3ITFA 2DGJA 4YL0A 3TQOA 1M56C 1R4TA 2YEVA 1RCPA 4AX2A 2W45A 4P9TA 4B6IA 4EHPA 1NFOA 2L7AA 3SZRA 2YL1A 3ECSA 2L6HA 4CIHA 2V3CC 2VCAA 2H7VC 3CEXA 4PFPA 5D91A 4E7ZA 1Q0DA 3B0UX 4I1OB 1TKNA 3K1IC 4J7TA 4XLPF 3GODA 5B1AC 4DBQA 1G8XA 4KBLA 1Q0FA 4DOZA 1NU7D 3AQBA 1QLEC 5GPGB 4YL1A 4RBNA 4JTDB 1AEPA 1LKXA 1MMDA 3SYNA 2IXPA 3QW0A 3NYMA 3NKDA 4XWJA 4CSAC 1RJ9A 5T1DB 4XLNF 2XXAB 2BC5A 3EHNA 1D1BA 4MVQA 2IXNA 4U5HA 3W2WA 2CCYA 2Y69C 4ZLCA 5B3SC 3ASOC 3H65A 2KSFA 1RKCA 1TFOB 2HJMA 3FOOA 1VLTA 1H7IA 1VB5A 1YA9A 3L1MA 2AWYA 5AGFA 2LD6A 5JP7A 1H9GA 1N1CA 4BJ5A 1QSPA 3DE9A 4Q5SF 2C03A 3DKAA 3N0TA 3QZCA 1AUEA 4H54A 1WGWA 1I4YA 5L0HA 4LDQA 5KYWA 1WATA 2EILC 2KNHA 3POVA 4JKVA 3RQFA 3RF3A 3DZAA 2Q9AA 1YAUO 2Q9CA 3U5SA 4UDVA 3HKKA 3N24A 2PBEA 1ZVZA 4U5GA 4NC3A 4OIQF 1OKKD 4CS7A 4YT8A 3NKEA 4XQ1A 4IARA 2WB7A 2WVQA 1LPEA 1KTMA 5COGA 4P9FA 2G3KA 3C8ZA 5E2QA 3C8GB 1I5NA 2NUTB 2Q4FA 5JUAA 3KKBA 2ZXRA 4LERA 3DI5A 4IRUA 5CI9A 1QKRA 4E7SA 3LESA 2YRFA 2F22A 4RD9A 4DRJB 4K0DA 1EA8A 4JJFA 4CDAA 3EGXA 3HNJA 1OCRC 3GEEA 4CS9C 4YWQA 3ZVRA 3G50A 1RKEB 3EPVA 3HTKC 2Q00A 3SXMA 4NTBA 3AOUA 2IOQA 4I1MA 2L81A 3PMRA 2GA0A 1E83A 1ZW2A 5BQIA 1W2WA 3QVZA 1J8MF 3FOPA 4AL0A 5JVEA 5D92A 3QMKA 2MYSA 3LS0A 2OG2A 3DD7A 4K7BA 1DOWA 2KC3A 4FWVA 1K40A 3OEOA 5DVWA 2J7PA 4YT2A 2NG1A 1M6TA 3RYLA 3US6A 4C7OA 2AWCA 4CIPA 3T6BA 1Z23A 3PCVA 1YDIA 2R03A 2Y39A 4I3MA 1T6QA 2VCCA 3HLZA 4MVUA 1VOMA 5L3QA 1LE2A 2FGYA 3EJNA 2LIGA 1Q0GA 2Z15A 3EG9A 3FAPB 3KYIA 4ULWA 3NMKA 3SXKA 3M15A 3EZIA 3C8GA 3K1IA 3NYJA 2PX0A 5DLJA 3U9JA 4EUKB 3W8HA 2PFDA 4IGGA 5DS4A 5L0JA 4CDYA 1ORJA 1D0ZA 1ZHZA 4WABA 2QY9A 3O39A 3V5ZA 4ANJA 2A0BA 3JSEO 5DS5A 1RKEA 2PF4E 3GM3A 3UMIA 1RMVA 3JT1A 4N4WA 1OCZC 3M4BA 2EPMX 4CSAA 5KYUB 2D5RB 2J7PD 5E3CA 3F46A 3FMSA 4O6NA 4O7GA 2A6HF 1A41A 1QPUA 3L8IA 3Q6NA 4FX5A 3X2QC 4BJ1A 2CNWA 4XPXA 3JTLO 3PDMP 1O87A 3I5QA 1LM3B 2WZLA 1BBHA 1TWGA 4LLCA 3VM6A 2RD9A 1KNYA 2Y3DA 3VAYA 1T6IA 2PP4A 5CIVA 3RKOF 3CZ6A 2R7RA 1V74B 1J8YF 2XL6A 5JRAA 4IWBA 3M1CB 3GEIA 2VB6A 4XPYA 1PD1A 3U8VA 1NG1A 1OW7A 2YL3A 2XLEA 2YKZA 1D1AA 2Q3TA 2ZXWC 2R02A 1C03A 2P7VA 2QE9A 5FZTA 2JX0A 3RFYA 2R25A 1ZZPA 2G3VA 3IPMO 1XZQA 3U2LA 4RDAA 3SXZA 5TJ5E 5KYXB 2C04A 4O6MA 4G7ZF 1ZHTA 3A9CA 3DE8A 3U3BA 3J06A 2ETSA 4CS9A 5E3AA 1TR2A 2I15A 1B68A 1OR2A 5L0IA 1D0YA 4NY3A 4GQHA 2VH3A 4PJLA 2DI3A 4Z9HA 4AE4B 3TK0A 3H2VA 3UMHA 4YT4A 3I4UA 2OQMA 2J45A 3U2MA 2EPKX 3NDBB 3S84A 1OXKA 4XEKA 4WGYA 5A6BA 4AL1A 4Q4ZF 1JMWA 2J9WA 2HZ8A 2NPUA 2LQGA 2R7VA 3QW1A 4PFOA 4XPWA 5A6BD 5KYYB 3WG7C 1M57C 2VASA 4BEJA 4C3BA 2AU5A 1E2XA 4EKWA 4CDVA 1AVOB 3DM5A 3VYWA 4C7OB 2A0UA 3ZQYA 1OKKA 1PV3A 1T5OA 3O6XA 5KYXA 4OIPF 4F4BA 3HNIA 3K7DA 4G0HA 2G62A 3LEOA 2NSFA 3CQZA 4HE8D 1Z63A 1UG7A 2Q9BA 2WL8A 1JPJA 1V4AA 1HY5A 1JR8A 2WVNA 4XEVA 4YL3A 5T3WA 4AE4A 3C62A 3O10A 4J7YA 2AP3A 3B9QA 3IQ6A 4OIRF 2IXMA 1D1CA 2ASRA 3ABKC 2HKVA 1NU9C 5A69A 4L6RA 1JPNA 2HV6A 3JYHA 3L34A 4MVSA 3SNHA 3UNGC 1A0BA 1KU2A 2MWQA 1YJGA 3DWWA 3IQCA 2VCBA 2PNOA 3LEVA 1SYQA 4BJTA 3TJ6A 4YN0B 3MYFA 2EPNA 2E87A 1YYXA 2ICWG 3S0XA 1WOLA 3QTHA 5L0DA 2IXOA 2OEXA 2P6VA 2XM0A 3BRJA 1C17M 3A11A 1ZHYA 3C63A 2HSQA 1A7VA 3L8JA 1Z6AA 3ZTMA 3ZTZA 2A6EF 3SEOA 4BPMA 5JT4A 2UUHA 2XLVA 3ZQVA 2GAQA 3B0PA 2KYHA 3TD7A 2XSEA 4LLEA 4JIOA 5EHHA 1BZ4A 1YZAA 2OCCC 2XXAA 3UGOA 1NZEA 1YLMA 5DS6A 2YL0A 3B0VC 1ZHXA 5B1BC 3SP1A 5JSLA 4W8PA 3B71A 2OJED 4MW8A 3RQEA 5F5HA 4NTAA 4EWCA 3TOMA 2YZSA 4MVOA 2GDCA 1MMNA 2XS8A 2EIMC 3OWTA 3RVZA 2XLWA 2EIJC 2R7XA 2KW3C 1OW8A 2L6FA 4NCQA 3TOLA 1HW2A 3EHMA 1VLSA 1JAFA 256BA 5K0IA 3LS1A 4HFKB 3NMIA 1LI7A 5KYNA 4JTAB 5DQZA 2PX3A 3GANA 3BEHA 4JEBA 2R7UA 4KNVA 3EGDB 4PR9A 1HMDA 2M4EA 4U9EA 1T6UA 3AG1C 3SXYA 2DYRC 2HMZA 3MLGA 2O9XA 2NUTA 1C02A 3OA1A 3ATPA 3EQLF 1SZIA 4PJNA 4R32A 4P6IC 3EFOB 3KH2A 2J9VA 3RVYA 1YYJA 2CDQA 1V54C 2OKUA 2V26A 2BE5F 3LNMB 5JLIA 2R05A 5HSWA 1EQ1A 3JYYA 4N6HA 2R7WA 3VF0A 1CPQA 2EINC 2YWAA 2ZXOA 1QZXA 2W4BA 1IW7F 3FXHA 3K66A 1FTSA 3G4ZA
chains in the Genus database with same CATH topology
2QUPA 2P61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QUP A;  2P61 A; 
#chains in the Genus database with same CATH topology
 4MTG A;  2LSE A;  3NMJ A;  3U9M A;  4N6C A;  1K04 A;  1TWC A;  4D4X A;  5BUO A;  1OXB A;  2XLD A;  4HFF B;  4BG0 A;  4IAO A;  1SR2 A;  5KYW B;  3RQG A;  4JUR I;  3GM2 A;  3X1O A;  2HV7 A;  3HJC A;  3S9O A;  1VYK A;  2LP4 A;  4AK9 A;  5JS5 A;  1RXQ A;  3ZIB A;  2WZF A;  3KL4 A;  3QVY A;  1F1M A;  4MW3 A;  4DXW A;  3T6G B;  1MQV A;  4YK5 A;  5AC4 A;  4OIO F;  1WN0 A;  2XS1 A;  1WWP A;  1Q0K A;  3E70 C;  1HE9 A;  5BQH A;  2YLD A;  1DOV A;  4QDL A;  5IY5 C;  2R9R B;  5COM A;  5DQT A;  4JJG A;  3C7J A;  4Z9I A;  4JCZ A;  4MVM A;  2J8W A;  2R7O A;  2EIK C;  1ORS C;  3NYL A;  5EK0 A;  2H8A A;  4NTF A;  3RW0 A;  4FAP B;  2P0N A;  5L0C A;  5KYU A;  3GEH A;  4U9D A;  1FFT C;  1H6G A;  3EZH A;  3PHF 2;  2TMV P;  3RIP A;  1HW1 A;  1GM5 A;  1XWJ A;  4PJM A;  1TWA A;  1ZU5 A;  4BJ6 C;  1JRA A;  4JC7 A;  2HMQ A;  1HMO A;  3EH2 A;  1NBB A;  4MVR A;  2HJ3 A;  2R7T A;  1GGQ A;  1EI7 A;  1GQA A;  4Z9J A;  2W4M A;  5L0F A;  4QI0 A;  4U5F E;  4EBK A;  3ABM C;  4E18 A;  3Q7L A;  2OU6 A;  1Y4C A;  3GOR A;  1Y6D A;  2YLG A;  3AGU A;  4IJJ A;  2CYD A;  3HNK A;  4CS8 A;  4OD4 A;  5B3I A;  2B0H A;  1NLX A;  1MND A;  3WAQ A;  1OQC A;  3ASN C;  3DM9 B;  4J32 B;  2OEV A;  4PK4 A;  4CJG A;  1O3U A;  3LAY A;  3FVY A;  5T3T A;  3W4Y A;  4D4N A;  3JCU Q;  1FNT c;  1Z5Z A;  3DJU B;  4JTC B;  1H9T A;  1NSG B;  2HSB A;  2A68 F;  2YL7 A;  3ABL C;  3K6B A;  4O79 A;  2X0C A;  5EGY A;  1LE4 A;  4MTF A;  1O5H A;  4PJJ A;  4U5E E;  2J46 A;  2Y3H A;  3I5P A;  5COF A;  3V5Y A;  4HEA J;  3ZDL A;  1K05 A;  2XLH A;  4U5D E;  1LS1 A;  1QQ3 A;  1IZM A;  2M64 A;  2LK4 A;  4DJ9 A;  1OCO C;  2XL4 A;  4X0R A;  1Z7Q c;  3M4C A;  3LLI A;  4MND A;  3WHN A;  5L0G A;  4Q7C A;  2X51 A;  1U6H A;  4JRZ A;  1G4U S;  1VYI A;  2IM8 A;  1ZW3 A;  5FCL A;  2XLO A;  4GYT A;  3CAX A;  4BEM J;  4C3E A;  2GWW A;  1SMY F;  2LFD A;  2QTV A;  4I44 A;  3UR3 C;  4NQF A;  1TQG A;  2ZPA A;  4JVS A;  3CSK A;  5KYY A;  1G5Z A;  2LFF A;  3W2V A;  2W9Y A;  2D4U A;  1FFH A;  3AG3 C;  3ZG1 A;  3DAF A;  2HS5 A;  3JRM O;  1CGN A;  2WZG A;  2YVK A;  1S05 A;  2R7Q A;  2QLA A;  3LUT B;  2R7S A;  3EGX B;  5A6J A;  4JEA A;  1L7C A;  4G78 A;  3F47 A;  4G7O F;  3V7O A;  3ZC4 A;  4E0H A;  4M63 A;  1MMG A;  1VK5 A;  1VMA A;  3S29 A;  1OW6 A;  1Q0M A;  2QUP A;  2KQ9 A;  1ORY A;  2KGO A;  3DJN B;  3GM1 A;  2EPO A;  2YLI A;  3R2P A;  4GEH A;  1PCX A;  1LI5 A;  5E33 A;  3E9V A;  3IQT A;  4LDK A;  2Q7R A;  4C3D A;  2J0X A;  4K1O A;  4LAC B;  1ST6 A;  4OD5 A;  4U5C E;  1PD0 A;  3LLK A;  4KNW A;  2IBF A;  3K1H A;  4BJ6 A;  2NSG A;  3L0I A;  1BR2 A;  3AGT A;  3EG9 B;  1LS4 A;  3AG4 C;  4MS2 A;  3ZSU A;  1I4Z A;  3AG2 C;  3H2U A;  4IAQ A;  4LDR A;  4EBB A;  1M2V B;  4JE9 A;  5F5F A;  4OIN F;  3S90 A;  3Q7G A;  3LJB A;  2NUP B;  1G4W R;  1GS9 A;  4ER9 A;  3IEE A;  2L9J A;  1TFK B;  1FMW A;  1M2O A;  2EPL X;  4JCH A;  5BQG A;  3VRC A;  4CJO A;  3MBG A;  5CI8 A;  2RSE B;  2XM4 A;  4ULV A;  4A2N B;  3KMI A;  1U89 A;  4E0I A;  1FR0 A;  1YZC A;  3KYJ A;  1CGM E;  3KPH A;  4PAC A;  1TWH A;  3TUL A;  3GWN A;  2DYS C;  2J0W A;  3U8P A;  3B29 A;  2OOC A;  4WJ0 A;  5F28 E;  1CPR A;  1BDJ B;  1MNE A;  3ZWI A;  4W8K A;  2P1A A;  4O6Y A;  3UGP A;  4N06 A;  3EH1 A;  3HNL A;  1VTM P;  2L6G A;  1FMV A;  2XL8 A;  4XTK A;  1CGO A;  2VC9 A;  2ZD9 A;  3JRT A;  4H4K C;  1V55 C;  1JOG A;  1QVX A;  1E85 A;  4DRH B;  2QNL A;  3G4X A;  4EBJ A;  3U0C A;  2P61 A;  5A6K A;  1L3P A;  1M2V A;  2FAP B;  2XRH A;  4ZLD A;  3WOD F;  2NUP A;  3NG1 A;  1OR3 A;  1Z3I X;  2JD3 A;  2B0J A;  3GWL A;  3W8I A;  3EGD A;  3R7C A;  3FHD A;  1YVI A;  4MTO A;  1A7E A;  3MYI A;  2Y3B A;  1WTY A;  4YJW A;  4DVZ A;  3T9O A;  2A1D D;  4CS8 C;  1FAP B;  3UMK A;  2BL2 A;  3EFO A;  2H7B A;  4XEF A;  2I8B A;  1EKY A;  3RH3 A;  1XZP A;  4BJ5 C;  2DB4 A;  4MVZ A;  2JPU A;  2HFI A;  1SF8 A;  3FAJ A;  4J30 B;  1ZU4 A;  2AVK A;  2YQY A;  4QI2 A;  3T4R A;  3TJ5 A;  4DVY P;  2YHS A;  2GFH A;  4FES A;  1ZHW A;  1S7Z A;  2MHR A;  3MFN A;  5AC5 A;  1LIH A;  1HE1 A;  1R5I D;  1E86 A;  1T01 A;  1YA7 O;  2A69 F;  3C8G D;  4YT5 A;  2UUI A;  1E84 A;  2Y3G A;  2ZXP A;  4DRI B;  3N2Z B;  4KC9 A;  2H7O A;  4WGZ A;  1BR1 A;  1APC A;  2IYL D;  1A7D A;  2J9U A;  2WVO A;  2LCH A;  1OCC C;  1NFN A;  2OJQ A;  4E17 A;  4EIY A;  1LVK A;  4CX9 A;  5HV9 A;  1UFB A;  1ZYR F;  3AJM A;  1D0X A;  3O55 A;  3K33 A;  3JSZ A;  3FDQ A;  3V5X A;  3U3F A;  2XLM A;  2CGE A;  4U5B E;  4G7H F;  2J9B A;  3T6J A;  3M79 A;  2KJG A;  4JW1 A;  3C18 A;  3Q6M A;  4ONS A;  3S27 A;  5A6A A;  3JZ0 A;  4CBE A;  3DAG A;  2CNW D;  1MMA A;  3NRH A;  2CW0 F;  4DBR A;  1RJ9 B;  1BR4 A;  2HUJ A;  2KK1 A;  2FFH A;  3DMD A;  4JZA A;  4IB4 A;  4MQ9 F;  1WAS A;  3AQC A;  3IHU A;  3LNR A;  3MX3 A;  3DXJ F;  3S28 A;  1T9K A;  3IQ5 A;  4A4A A;  1YAR O;  5L3V A;  1U0B B;  4KI2 A;  3ITF A;  2DGJ A;  4YL0 A;  3TQO A;  1M56 C;  1R4T A;  2YEV A;  1RCP A;  4AX2 A;  2W45 A;  4P9T A;  4B6I A;  4EHP A;  1NFO A;  2L7A A;  3SZR A;  2YL1 A;  3ECS A;  2L6H A;  4CIH A;  2V3C C;  2VCA A;  2H7V C;  3CEX A;  4PFP A;  5D91 A;  4E7Z A;  1Q0D A;  3B0U X;  4I1O B;  1TKN A;  3K1I C;  4J7T A;  4XLP F;  3GOD A;  5B1A C;  4DBQ A;  1G8X A;  4KBL A;  1Q0F A;  4DOZ A;  1NU7 D;  3AQB A;  1QLE C;  5GPG B;  4YL1 A;  4RBN A;  4JTD B;  1AEP A;  1LKX A;  1MMD A;  3SYN A;  2IXP A;  3QW0 A;  3NYM A;  3NKD A;  4XWJ A;  4CSA C;  1RJ9 A;  5T1D B;  4XLN F;  2XXA B;  2BC5 A;  3EHN A;  1D1B A;  4MVQ A;  2IXN A;  4U5H A;  3W2W A;  2CCY A;  2Y69 C;  4ZLC A;  5B3S C;  3ASO C;  3H65 A;  2KSF A;  1RKC A;  1TFO B;  2HJM A;  3FOO A;  1VLT A;  1H7I A;  1VB5 A;  1YA9 A;  3L1M A;  2AWY A;  5AGF A;  2LD6 A;  5JP7 A;  1H9G A;  1N1C A;  4BJ5 A;  1QSP A;  3DE9 A;  4Q5S F;  2C03 A;  3DKA A;  3N0T A;  3QZC A;  1AUE A;  4H54 A;  1WGW A;  1I4Y A;  5L0H A;  4LDQ A;  5KYW A;  1WAT A;  2EIL C;  2KNH A;  3POV A;  4JKV A;  3RQF A;  3RF3 A;  3DZA A;  2Q9A A;  1YAU O;  2Q9C A;  3U5S A;  4UDV A;  3HKK A;  3N24 A;  2PBE A;  1ZVZ A;  4U5G A;  4NC3 A;  4OIQ F;  1OKK D;  4CS7 A;  4YT8 A;  3NKE A;  4XQ1 A;  4IAR A;  2WB7 A;  2WVQ A;  1LPE A;  1KTM A;  5COG A;  4P9F A;  2G3K A;  3C8Z A;  5E2Q A;  3C8G B;  1I5N A;  2NUT B;  2Q4F A;  5JUA A;  3KKB A;  2ZXR A;  4LER A;  3DI5 A;  4IRU A;  5CI9 A;  1QKR A;  4E7S A;  3LES A;  2YRF A;  2F22 A;  4RD9 A;  4DRJ B;  4K0D A;  1EA8 A;  4JJF A;  4CDA A;  3EGX A;  3HNJ A;  1OCR C;  3GEE A;  4CS9 C;  4YWQ A;  3ZVR A;  3G50 A;  1RKE B;  3EPV A;  3HTK C;  2Q00 A;  3SXM A;  4NTB A;  3AOU A;  2IOQ A;  4I1M A;  2L81 A;  3PMR A;  2GA0 A;  1E83 A;  1ZW2 A;  5BQI A;  1W2W A;  3QVZ A;  1J8M F;  3FOP A;  4AL0 A;  5JVE A;  5D92 A;  3QMK A;  2MYS A;  3LS0 A;  2OG2 A;  3DD7 A;  4K7B A;  1DOW A;  2KC3 A;  4FWV A;  1K40 A;  3OEO A;  5DVW A;  2J7P A;  4YT2 A;  2NG1 A;  1M6T A;  3RYL A;  3US6 A;  4C7O A;  2AWC A;  4CIP A;  3T6B A;  1Z23 A;  3PCV A;  1YDI A;  2R03 A;  2Y39 A;  4I3M A;  1T6Q A;  2VCC A;  3HLZ A;  4MVU A;  1VOM A;  5L3Q A;  1LE2 A;  2FGY A;  3EJN A;  2LIG A;  1Q0G A;  2Z15 A;  3EG9 A;  3FAP B;  3KYI A;  4ULW A;  3NMK A;  3SXK A;  3M15 A;  3EZI A;  3C8G A;  3K1I A;  3NYJ A;  2PX0 A;  5DLJ A;  3U9J A;  4EUK B;  3W8H A;  2PFD A;  4IGG A;  5DS4 A;  5L0J A;  4CDY A;  1ORJ A;  1D0Z A;  1ZHZ A;  4WAB A;  2QY9 A;  3O39 A;  3V5Z A;  4ANJ A;  2A0B A;  3JSE O;  5DS5 A;  1RKE A;  2PF4 E;  3GM3 A;  3UMI A;  1RMV A;  3JT1 A;  4N4W A;  1OCZ C;  3M4B A;  2EPM X;  4CSA A;  5KYU B;  2D5R B;  2J7P D;  5E3C A;  3F46 A;  3FMS A;  4O6N A;  4O7G A;  2A6H F;  1A41 A;  1QPU A;  3L8I A;  3Q6N A;  4FX5 A;  3X2Q C;  4BJ1 A;  2CNW A;  4XPX A;  3JTL O;  3PDM P;  1O87 A;  3I5Q A;  1LM3 B;  2WZL A;  1BBH A;  1TWG A;  4LLC A;  3VM6 A;  2RD9 A;  1KNY A;  2Y3D A;  3VAY A;  1T6I A;  2PP4 A;  5CIV A;  3RKO F;  3CZ6 A;  2R7R A;  1V74 B;  1J8Y F;  2XL6 A;  5JRA A;  4IWB A;  3M1C B;  3GEI A;  2VB6 A;  4XPY A;  1PD1 A;  3U8V A;  1NG1 A;  1OW7 A;  2YL3 A;  2XLE A;  2YKZ A;  1D1A A;  2Q3T A;  2ZXW C;  2R02 A;  1C03 A;  2P7V A;  2QE9 A;  5FZT A;  2JX0 A;  3RFY A;  2R25 A;  1ZZP A;  2G3V A;  3IPM O;  1XZQ A;  3U2L A;  4RDA A;  3SXZ A;  5TJ5 E;  5KYX B;  2C04 A;  4O6M A;  4G7Z F;  1ZHT A;  3A9C A;  3DE8 A;  3U3B A;  3J06 A;  2ETS A;  4CS9 A;  5E3A A;  1TR2 A;  2I15 A;  1B68 A;  1OR2 A;  5L0I A;  1D0Y A;  4NY3 A;  4GQH A;  2VH3 A;  4PJL A;  2DI3 A;  4Z9H A;  4AE4 B;  3TK0 A;  3H2V A;  3UMH A;  4YT4 A;  3I4U A;  2OQM A;  2J45 A;  3U2M A;  2EPK X;  3NDB B;  3S84 A;  1OXK A;  4XEK A;  4WGY A;  5A6B A;  4AL1 A;  4Q4Z F;  1JMW A;  2J9W A;  2HZ8 A;  2NPU A;  2LQG A;  2R7V A;  3QW1 A;  4PFO A;  4XPW A;  5A6B D;  5KYY B;  3WG7 C;  1M57 C;  2VAS A;  4BEJ A;  4C3B A;  2AU5 A;  1E2X A;  4EKW A;  4CDV A;  1AVO B;  3DM5 A;  3VYW A;  4C7O B;  2A0U A;  3ZQY A;  1OKK A;  1PV3 A;  1T5O A;  3O6X A;  5KYX A;  4OIP F;  4F4B A;  3HNI A;  3K7D A;  4G0H A;  2G62 A;  3LEO A;  2NSF A;  3CQZ A;  4HE8 D;  1Z63 A;  1UG7 A;  2Q9B A;  2WL8 A;  1JPJ A;  1V4A A;  1HY5 A;  1JR8 A;  2WVN A;  4XEV A;  4YL3 A;  5T3W A;  4AE4 A;  3C62 A;  3O10 A;  4J7Y A;  2AP3 A;  3B9Q A;  3IQ6 A;  4OIR F;  2IXM A;  1D1C A;  2ASR A;  3ABK C;  2HKV A;  1NU9 C;  5A69 A;  4L6R A;  1JPN A;  2HV6 A;  3JYH A;  3L34 A;  4MVS A;  3SNH A;  3UNG C;  1A0B A;  1KU2 A;  2MWQ A;  1YJG A;  3DWW A;  3IQC A;  2VCB A;  2PNO A;  3LEV A;  1SYQ A;  4BJT A;  3TJ6 A;  4YN0 B;  3MYF A;  2EPN A;  2E87 A;  1YYX A;  2ICW G;  3S0X A;  1WOL A;  3QTH A;  5L0D A;  2IXO A;  2OEX A;  2P6V A;  2XM0 A;  3BRJ A;  1C17 M;  3A11 A;  1ZHY A;  3C63 A;  2HSQ A;  1A7V A;  3L8J A;  1Z6A A;  3ZTM A;  3ZTZ A;  2A6E F;  3SEO A;  4BPM A;  5JT4 A;  2UUH A;  2XLV A;  3ZQV A;  2GAQ A;  3B0P A;  2KYH A;  3TD7 A;  2XSE A;  4LLE A;  4JIO A;  5EHH A;  1BZ4 A;  1YZA A;  2OCC C;  2XXA A;  3UGO A;  1NZE A;  1YLM A;  5DS6 A;  2YL0 A;  3B0V C;  1ZHX A;  5B1B C;  3SP1 A;  5JSL A;  4W8P A;  3B71 A;  2OJE D;  4MW8 A;  3RQE A;  5F5H A;  4NTA A;  4EWC A;  3TOM A;  2YZS A;  4MVO A;  2GDC A;  1MMN A;  2XS8 A;  2EIM C;  3OWT A;  3RVZ A;  2XLW A;  2EIJ C;  2R7X A;  2KW3 C;  1OW8 A;  2L6F A;  4NCQ A;  3TOL A;  1HW2 A;  3EHM A;  1VLS A;  1JAF A;  256B A;  5K0I A;  3LS1 A;  4HFK B;  3NMI A;  1LI7 A;  5KYN A;  4JTA B;  5DQZ A;  2PX3 A;  3GAN A;  3BEH A;  4JEB A;  2R7U A;  4KNV A;  3EGD B;  4PR9 A;  1HMD A;  2M4E A;  4U9E A;  1T6U A;  3AG1 C;  3SXY A;  2DYR C;  2HMZ A;  3MLG A;  2O9X A;  2NUT A;  1C02 A;  3OA1 A;  3ATP A;  3EQL F;  1SZI A;  4PJN A;  4R32 A;  4P6I C;  3EFO B;  3KH2 A;  2J9V A;  3RVY A;  1YYJ A;  2CDQ A;  1V54 C;  2OKU A;  2V26 A;  2BE5 F;  3LNM B;  5JLI A;  2R05 A;  5HSW A;  1EQ1 A;  3JYY A;  4N6H A;  2R7W A;  3VF0 A;  1CPQ A;  2EIN C;  2YWA A;  2ZXO A;  1QZX A;  2W4B A;  1IW7 F;  3FXH A;  3K66 A;  1FTS A;  3G4Z A; 
#chains in the Genus database with same CATH homology
 2QUP A;  2P61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...