2P61A

Crystal structure of protein tm1646 from thermotoga maritima, pfam duf327
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
120
structure length
114
Chain Sequence
EFFDILEDVKEDHFEKLLEEAVEEVIDSGNELVRSPTPSNLKRYKNAIKEFLKLIEKKIYKLNSGRARLHLVVEEVNEKLMDLTEKIMKNEWQTINLAARIEEINGLILNLYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TM_1646
publication title Crystal structure of hypothetical protein TM_1646 from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Structural genomics, unknown function
total genus 51
structure length 114
sequence length 120
ec nomenclature
pdb deposition date 2007-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03885 DUF327 Protein of unknown function (DUF327)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hypothetical protein TM1646-like domain 2p61A00
2QUPA 2P61A
chains in the Genus database with same CATH superfamily
1V54C 2A6HF 1BBHA 1V4AA 2HKVA 2J9UA 4LLCA 4U5DE 3S28A 4O6YA 3EGXA 2XRHA 2C03A 4XPWA 1WATA 1HW2A 3EGDA 3TJ5A 4BEMJ 3MLGA 2RD9A 5K0IA 2Y3BA 4PJNA 3AQCA 4PJMA 5A6KA 2P61A 2VB6A 4DOZA 2EILC 4BJ5C 1VLTA 4HFFB 3ZTZA 1E2XA 1T6UA 2YEVA 1M6TA 3NG1A 3PHF2 1K40A 2CCYA 1TFKB 2Q7RA 2E87A 4EWCA 3M1CB 4N4WA 5DS6A 2W9YA 1UG7A 2A0UA 2IBFA 3PDMP 2Y3GA 1YJGA 1YA9A 4J7TA 2J9WA 1UFBA 3TOMA 1QPUA 2GDCA 3SZRA 3DE8A 4NTAA 4A4AA 1OXKA 3NMIA 4JCHA 4Q7CA 4YT2A 4OIOF 4WGZA 1HW1A 2Y69C 4JJFA 4NC3A 4Z9HA 4NCQA 1WGWA 3RF3A 2OCCC 1SR2A 3LEOA 2AVKA 2YL1A 3EH2A 3ZQYA 3LLKA 1JPNA 2FFHA 4AK9A 3UMIA 1YYXA 3B0VC 3IHUA 3DD7A 1OR3A 1RJ9A 2HUJA 2Q3TA 2DB4A 1RCPA 4G78A 1J8YF 3DJNB 2C04A 3X2QC 5TJ5E 2VC9A 2ETSA 1JOGA 3K66A 4JEBA 5A6BA 3GEHA 4G7ZF 1V74B 3E9VA 4PR9A 4BJTA 5KYYA 4BPMA 1Y6DA 4J30B 4MVRA 2JPUA 4YK5A 1KTMA 4MVOA 1XWJA 3RFYA 4BJ6A 3VYWA 1OW7A 3H2UA 5IY5C 4HEAJ 3V5YA 3C63A 2ZXWC 3JYHA 2NUPB 4C7OA 2R7OA 3M4BA 2AP3A 2PBEA 3CZ6A 5B1BC 3U9MA 4Q4ZF 5CIVA 4RD9A 2A1DD 3BRJA 1S05A 2UUHA 4U9EA 3S9OA 1NBBA 2P1AA 3T4RA 5AC4A 5JVEA 3IPMO 3K33A 5L0CA 2LK4A 1GQAA 3KPHA 4MW3A 4MTGA 2KK1A 4MVUA 1ZU4A 3X1OA 1OKKA 2WZGA 1OR2A 4F4BA 1JAFA 3UNGC 5F5FA 3GORA 2ZPAA 1JPJA 3LNMB 2B0HA 3EGXB 1Q0KA 2KNHA 4U5FE 2L6FA 3EGDB 2EPNA 3DAFA 1OW6A 3B71A 2L81A 1LKXA 1C17M 5COGA 5DS4A 5L0HA 5DQZA 4EBJA 2R7VA 2NSFA 2J8WA 3B29A 1Q0GA 4U5EE 1CGME 1N1CA 1TWCA 2NG1A 4K0DA 4MVQA 5T1DB 3RIPA 4OINF 3UGPA 4WJ0A 5AGFA 2YKZA 1R5ID 1CGNA 4I1OB 5KYWA 1VB5A 2CNWD 4NTBA 3ZIBA 2CW0F 4DVYP 3T6BA 3DWWA 3IQCA 3S27A 3U3FA 4N06A 3O55A 1K04A 1OCOC 2LFDA 4EHPA 3UGOA 1ZYRF 4YL3A 3Q6MA 3K6BA 2YL3A 1YARO 3SXKA 4B6IA 4Z9IA 4UDVA 5JSLA 3K1IA 4LDRA 5JT4A 4E0IA 2Q4FA 3E70C 1NFOA 1MMNA 1JR8A 2BL2A 2QTVA 3SEOA 2J7PD 3VAYA 4JJGA 4MTOA 4O7GA 1E86A 2VCBA 3QZCA 2IXMA 1IZMA 1DOWA 2HMQA 1JRAA 4CBEA 1KU2A 3NDBB 3J06A 4PACA 1RJ9B 4JZAA 1D0ZA 1O87A 3L8JA 2KC3A 3LJBA 2HSBA 1NLXA 3GODA 4CDAA 3QVZA 4DXWA 4WGYA 1T5OA 3SXZA 1TWAA 3FOOA 3SYNA 3T6JA 5KYYB 1C02A 1L3PA 1M57C 2R7UA 3S84A 3DM5A 5EHHA 3RQFA 5HV9A 4FAPB 1ZHWA 4PK4A 3LS1A 3ATPA 5A6AA 3JTLO 3RQEA 4C7OB 3FOPA 4JEAA 5L3VA 2LFFA 1QVXA 4NY3A 5D92A 4JTDB 2Q00A 3AOUA 1C03A 3HNIA 4IB4A 2V3CC 1QKRA 1BR1A 5E3CA 1B68A 1I4ZA 3US6A 4IAQA 3EQLF 1PD1A 2BE5F 2LCHA 4R32A 2R7RA 1Q0FA 2QY9A 3NYMA 4J7YA 4DRIB 2J9BA 4G0HA 3K1HA 1DOVA 2R05A 3ZSUA 2YLIA 3HNLA 1ZHTA 4ER9A 1D0YA 2XM4A 3CEXA 3LNRA 3AQBA 1T6QA 4MW8A 2CYDA 2JX0A 3TD7A 3Q7LA 2XXAA 2OG2A 2D5RB 3AG1C 4XLNF 3W4YA 1PCXA 2R7TA 4OIRF 4K1OA 1LS1A 5L0DA 1Z23A 3DE9A 2NPUA 3KKBA 1EKYA 1WTYA 2EPLX 2GAQA 4IWBA 3W8HA 1H7IA 4P6IC 3DMDA 3TULA 1TR2A 4GQHA 4J32B 3TQOA 2OEXA 3C8GA 3N2ZB 5A69A 1LE4A 3TK0A 1ZU5A 2XLVA 5KYWB 2DYSC 1ZW2A 2ZXPA 1K05A 3MX3A 1XZQA 2OJQA 5FZTA 4YJWA 1G5ZA 2EPKX 2PNOA 2RSEB 3AJMA 4XPYA 2GFHA 2QLAA 1A7DA 3ABKC 4PJLA 3IEEA 4RDAA 3GM3A 2X0CA 5B3IA 4H4KC 3KL4A 5F28E 2XS8A 2GA0A 5A6BD 1L7CA 3L8IA 3MYFA 2MYSA 4X0RA 3RH3A 2EPOA 2XL6A 3F47A 2P0NA 4AE4A 2X51A 2KGOA 2Q9BA 4XPXA 1MNEA 4DBRA 1Z63A 2J45A 3MBGA 4I3MA 3FAJA 2EIJC 1A7EA 2PFDA 1GS9A 3O6XA 1BR2A 3VM6A 3JCUQ 4KI2A 2R02A 1E83A 1LVKA 5HSWA 3ZDLA 4OD4A 5BUOA 4N6CA 5CI9A 1OQCA 1G4US 1D1BA 1MNDA 3T6GB 2J0XA 2XLHA 5DLJA 3R2PA 3NKEA 1OCRC 3M4CA 3AG4C 4JURI 1NG1A 2AWCA 1YYJA 3W2VA 4CJOA 1U0BB 3EZHA 2HZ8A 2WVOA 2R9RB 3GWNA 1E85A 1W2WA 4BJ1A 3G4ZA 2A6EF 1AEPA 2B0JA 5COFA 3SNHA 3U3BA 5L0FA 3A9CA 3C7JA 3N24A 4HE8D 2J9VA 3WODF 3LS0A 1A41A 1VOMA 1YZCA 1FFHA 2EIKC 2KW3C 1VLSA 2ZXRA 2HSQA 1LIHA 4MVMA 4DBQA 4NQFA 3EG9A 4CJGA 2UUIA 4FX5A 5DQTA 4BEJA 1VYKA 1U6HA 2R25A 2L7AA 3FHDA 3OWTA 3ZQVA 3JYYA 4C3DA 1J8MF 4W8KA 4LLEA 4EKWA 1SMYF 3IQTA 2XXAB 1ORJA 4C3BA 3U0CA 2XLEA 5L0GA 1AVOB 4Z9JA 1NU7D 3Q6NA 4CSAA 4U5BE 2IXPA 3TJ6A 3JRMO 1EA8A 1RKCA 3L1MA 2BC5A 3FVYA 4FESA 5A6JA 2H8AA 1NZEA 3CSKA 3LAYA 1O3UA 3C8GB 1IW7F 4U5CE 2YLGA 4D4NA 3ECSA 3OEOA 4CIHA 1FNTc 1TQGA 4CS8C 5JUAA 2EIMC 3EHMA 4XWJA 4CX9A 4YWQA 2D4UA 4XQ1A 2LP4A 5E2QA 4E7ZA 2XL8A 4DRHB 3WG7C 5JLIA 2IXNA 5KYXA 4MTFA 2G3VA 3AGTA 2FAPB 3EFOB 2LIGA 4ULWA 1PD0A 4P9TA 1I4YA 1YVIA 4MVZA 1QLEC 3MFNA 4QDLA 3NYJA 2Y3DA 4GYTA 2NUTA 2KSFA 3I4UA 4AE4B 2XSEA 2HV7A 1ST6A 3NRHA 3QW0A 2IXOA 4DJ9A 1Q0DA 3HKKA 4HFKB 3BEHA 1WWPA 1QSPA 2LQGA 1RXQA 3GANA 3GM1A 5E33A 1NU9C 1BDJB 4JVSA 3DI5A 4DVZA 4JC7A 2ICWG 4XEFA 3RW0A 4YT8A 1HMOA 5L3QA 2QUPA 2XLOA 3O39A 3L34A 1OKKD 2Z15A 3RKOF 2AU5A 2P7VA 4D4XA 3I5QA 3ASNC 1Q0MA 3DJUB 3AG3C 2M64A 4CIPA 1T6IA 4IAOA 4CS9C 1GM5A 3V7OA 5GPGB 2YL0A 1TWHA 2OJED 3DAGA 1NFNA 4KBLA 3S29A 4IRUA 1FMVA 3EG9B 2YRFA 2XLDA 1ZVZA 2W45A 1MMGA 3EJNA 1FTSA 2F22A 1WOLA 3C62A 3U2LA 4BJ5A 5B1AC 2LD6A 4AL0A 1RMVA 1YAUO 1YA7O 2OOCA 2ZD9A 2WL8A 5BQGA 5KYXB 4JKVA 3QW1A 2HMZA 4IGGA 4OIPF 1TKNA 3DM9B 3UR3C 3KMIA 3LLIA 4MVSA 1YDIA 2WB7A 3A11A 2CDQA 4I44A 1APCA 1CGOA 1YLMA 4M63A 2WVNA 3NMKA 5L0IA 3U5SA 2XS1A 2HJ3A 4LACB 3EPVA 1A7VA 5B3SC 1Z3IX 2HFIA 2VASA 4JIOA 1EQ1A 2O9XA 2OQMA 3S90A 3KYIA 3AG2C 1PV3A 1OCZC 3NYLA 2DI3A 1HE1A 2R7QA 1FFTC 1VYIA 2AWYA 2GWWA 3ITFA 3NKDA 4MNDA 4O6NA 3PCVA 1EI7A 1U89A 2WVQA 3FXHA 5COMA 3RVZA 2DYRC 2VCCA 1Z5ZA 1OW8A 2A68F 3HJCA 2NUTB 1NSGB 1GGQA 2YZSA 4L6RA 5L0JA 3B0UX 2Y39A 2H7BA 2I8BA 3C18A 2L9JA 3EFOA 3K7DA 3RVYA 4OIQF 1ORYA 4K7BA 2QE9A 1OXBA 3S0XA 4YL0A 1RKEA 1ZHYA 4XEKA 3SP1A 3CQZA 2NSGA 2YWAA 4LERA 3N0TA 3QVYA 5KYUA 4XEVA 3H2VA 2I15A 4G7HF 4P9FA 4PJJA 3HNJA 2PX0A 3JSZA 4GEHA 3I5PA 3U8VA 4KNVA 2HV6A 4CDVA 5EGYA 2PX3A 1VK5A 4E17A 4JW1A 3POVA 1G8XA 3MYIA 1D1AA 1H9GA 2G3KA 3JT1A 2PF4E 2G62A 256BA 1SF8A 4MS2A 3G4XA 3HLZA 3F46A 2YVKA 3DKAA 2VCAA 4YL1A 1KNYA 3EHNA 1WN0A 3IQ5A 2OKUA 4MQ9F 3RQGA 3C8GD 1H9TA 3C8ZA 4BJ6C 4C3EA 1AUEA 2CNWA 2A0BA 4CS8A 3ABMC 1Z6AA 2L6HA 2PP4A 2Q9AA 4YT5A 3VF0A 4XTKA 3RYLA 4AL1A 4ANJA 1A0BA 3EH1A 1V55C 1JMWA 4E0HA 3O10A 3W8IA 1LS4A 2OEVA 1QZXA 2IOQA 2MWQA 1M56C 2J7PA 4ONSA 1HE9A 4O6MA 4IJJA 2YHSA 1ZZPA 2H7VC 3ASOC 3Q7GA 3QMKA 2DGJA 4KC9A 4QI0A 4EIYA 2WZLA 3NMJA 3CAXA 1YZAA 1ZHZA 2ASRA 2Q9CA 5T3WA 4DRJB 5E3AA 5CI8A 4U5GA 1QQ3A 2TMVP 1FR0A 4RBNA 1LE2A 2XLMA 3UMHA 3ZVRA 1ZW3A 5D91A 3TOLA 3M79A 2R7WA 4JTCB 4Q5SF 1CPRA 4EBBA 1Y4CA 5FCLA 2YL7A 3V5XA 3B9QA 2M4EA 4PFPA 1T9KA 3M15A 3SXMA 1OCCC 1SYQA 3U9JA 4YN0B 1M2VA 1M2OA 1S7ZA 5T3TA 1RKEB 4JE9A 4YT4A 3JRTA 4BG0A 4H54A 3EZIA 3DZAA 4CS9A 2JD3A 3ZG1A 2FGYA 2XM0A 5KYUB 1ORSC 4JTAB 4WABA 2MHRA 3KYJA 3FDQA 1LI5A 2XLWA 4N6HA 1O5HA 3WAQA 1TWGA 4O79A 3HTKC 3ZC4A 2W4BA 5JRAA 4ZLDA 1F1MA 2KJGA 1WASA 2KYHA 4PFOA 1MMDA 1HMDA 5BQHA 1D0XA 4G7OF 1SZIA 4JCZA 5AC5A 5DVWA 4XLPF 3IQ6A 2HS5A 3G50A 3VRCA 3WHNA 2IM8A 2VH3A 3PMRA 4E7SA 4A2NB 4CSAC 2R7XA 1HY5A 1LM3B 4CDYA 5KYNA 2IYLD 4U5HA 1XZPA 3U2MA 3ZTMA 3HNKA 3LESA 3GEIA 4OD5A 5DS5A 3AGUA 2ZXOA 4EUKB 5F5HA 5EK0A 1TFOB 2W4MA 4I1MA 3ZWIA 1E84A 2H7OA 1ZHXA 2P6VA 2EPMX 2Y3HA 3B0PA 3LEVA 2XL4A 4AX2A 4NTFA 3K1IC 2A69F 3FMSA 4KNWA 3R7CA 1Z7Qc 4JRZA 4ULVA 1T01A 4LDQA 2J46A 4ZLCA 1LI7A 2KQ9A 3DXJF 3V5ZA 5JP7A 1LPEA 3GM2A 3GEEA 2LSEA 1R4TA 2WZFA 4FWVA 1MQVA 3T9OA 3GWLA 4QI2A 3L0IA 4CS7A 1FMWA 1MMAA 4E18A 3QTHA 2YQYA 3FAPB 3U8PA 1VTMP 2J0WA 1BR4A 1D1CA 4LDKA 2NUPA 1I5NA 3W2WA 4U9DA 3H65A 2CGEA 3JSEO 1VMAA 2QNLA 4EBKA 3JZ0A 2YLDA 1BZ4A 3KH2A 3OA1A 2V26A 3ABLC 1FAPB 2R03A 2EINC 3LUTB 2L6GA 2OU6A 1CPQA 1G4WR 1M2VB 3UMKA 2HJMA 5BQIA 2R7SA 3SXYA 5JS5A 4IARA 4W8PA 1H6GA
chains in the Genus database with same CATH topology
2QUPA 2P61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QUP A;  2P61 A; 
#chains in the Genus database with same CATH topology
 1V54 C;  2A6H F;  1BBH A;  1V4A A;  2HKV A;  2J9U A;  4LLC A;  4U5D E;  3S28 A;  4O6Y A;  3EGX A;  2XRH A;  2C03 A;  4XPW A;  1WAT A;  1HW2 A;  3EGD A;  3TJ5 A;  4BEM J;  3MLG A;  2RD9 A;  5K0I A;  2Y3B A;  4PJN A;  3AQC A;  4PJM A;  5A6K A;  2P61 A;  2VB6 A;  4DOZ A;  2EIL C;  4BJ5 C;  1VLT A;  4HFF B;  3ZTZ A;  1E2X A;  1T6U A;  2YEV A;  1M6T A;  3NG1 A;  3PHF 2;  1K40 A;  2CCY A;  1TFK B;  2Q7R A;  2E87 A;  4EWC A;  3M1C B;  4N4W A;  5DS6 A;  2W9Y A;  1UG7 A;  2A0U A;  2IBF A;  3PDM P;  2Y3G A;  1YJG A;  1YA9 A;  4J7T A;  2J9W A;  1UFB A;  3TOM A;  1QPU A;  2GDC A;  3SZR A;  3DE8 A;  4NTA A;  4A4A A;  1OXK A;  3NMI A;  4JCH A;  4Q7C A;  4YT2 A;  4OIO F;  4WGZ A;  1HW1 A;  2Y69 C;  4JJF A;  4NC3 A;  4Z9H A;  4NCQ A;  1WGW A;  3RF3 A;  2OCC C;  1SR2 A;  3LEO A;  2AVK A;  2YL1 A;  3EH2 A;  3ZQY A;  3LLK A;  1JPN A;  2FFH A;  4AK9 A;  3UMI A;  1YYX A;  3B0V C;  3IHU A;  3DD7 A;  1OR3 A;  1RJ9 A;  2HUJ A;  2Q3T A;  2DB4 A;  1RCP A;  4G78 A;  1J8Y F;  3DJN B;  2C04 A;  3X2Q C;  5TJ5 E;  2VC9 A;  2ETS A;  1JOG A;  3K66 A;  4JEB A;  5A6B A;  3GEH A;  4G7Z F;  1V74 B;  3E9V A;  4PR9 A;  4BJT A;  5KYY A;  4BPM A;  1Y6D A;  4J30 B;  4MVR A;  2JPU A;  4YK5 A;  1KTM A;  4MVO A;  1XWJ A;  3RFY A;  4BJ6 A;  3VYW A;  1OW7 A;  3H2U A;  5IY5 C;  4HEA J;  3V5Y A;  3C63 A;  2ZXW C;  3JYH A;  2NUP B;  4C7O A;  2R7O A;  3M4B A;  2AP3 A;  2PBE A;  3CZ6 A;  5B1B C;  3U9M A;  4Q4Z F;  5CIV A;  4RD9 A;  2A1D D;  3BRJ A;  1S05 A;  2UUH A;  4U9E A;  3S9O A;  1NBB A;  2P1A A;  3T4R A;  5AC4 A;  5JVE A;  3IPM O;  3K33 A;  5L0C A;  2LK4 A;  1GQA A;  3KPH A;  4MW3 A;  4MTG A;  2KK1 A;  4MVU A;  1ZU4 A;  3X1O A;  1OKK A;  2WZG A;  1OR2 A;  4F4B A;  1JAF A;  3UNG C;  5F5F A;  3GOR A;  2ZPA A;  1JPJ A;  3LNM B;  2B0H A;  3EGX B;  1Q0K A;  2KNH A;  4U5F E;  2L6F A;  3EGD B;  2EPN A;  3DAF A;  1OW6 A;  3B71 A;  2L81 A;  1LKX A;  1C17 M;  5COG A;  5DS4 A;  5L0H A;  5DQZ A;  4EBJ A;  2R7V A;  2NSF A;  2J8W A;  3B29 A;  1Q0G A;  4U5E E;  1CGM E;  1N1C A;  1TWC A;  2NG1 A;  4K0D A;  4MVQ A;  5T1D B;  3RIP A;  4OIN F;  3UGP A;  4WJ0 A;  5AGF A;  2YKZ A;  1R5I D;  1CGN A;  4I1O B;  5KYW A;  1VB5 A;  2CNW D;  4NTB A;  3ZIB A;  2CW0 F;  4DVY P;  3T6B A;  3DWW A;  3IQC A;  3S27 A;  3U3F A;  4N06 A;  3O55 A;  1K04 A;  1OCO C;  2LFD A;  4EHP A;  3UGO A;  1ZYR F;  4YL3 A;  3Q6M A;  3K6B A;  2YL3 A;  1YAR O;  3SXK A;  4B6I A;  4Z9I A;  4UDV A;  5JSL A;  3K1I A;  4LDR A;  5JT4 A;  4E0I A;  2Q4F A;  3E70 C;  1NFO A;  1MMN A;  1JR8 A;  2BL2 A;  2QTV A;  3SEO A;  2J7P D;  3VAY A;  4JJG A;  4MTO A;  4O7G A;  1E86 A;  2VCB A;  3QZC A;  2IXM A;  1IZM A;  1DOW A;  2HMQ A;  1JRA A;  4CBE A;  1KU2 A;  3NDB B;  3J06 A;  4PAC A;  1RJ9 B;  4JZA A;  1D0Z A;  1O87 A;  3L8J A;  2KC3 A;  3LJB A;  2HSB A;  1NLX A;  3GOD A;  4CDA A;  3QVZ A;  4DXW A;  4WGY A;  1T5O A;  3SXZ A;  1TWA A;  3FOO A;  3SYN A;  3T6J A;  5KYY B;  1C02 A;  1L3P A;  1M57 C;  2R7U A;  3S84 A;  3DM5 A;  5EHH A;  3RQF A;  5HV9 A;  4FAP B;  1ZHW A;  4PK4 A;  3LS1 A;  3ATP A;  5A6A A;  3JTL O;  3RQE A;  4C7O B;  3FOP A;  4JEA A;  5L3V A;  2LFF A;  1QVX A;  4NY3 A;  5D92 A;  4JTD B;  2Q00 A;  3AOU A;  1C03 A;  3HNI A;  4IB4 A;  2V3C C;  1QKR A;  1BR1 A;  5E3C A;  1B68 A;  1I4Z A;  3US6 A;  4IAQ A;  3EQL F;  1PD1 A;  2BE5 F;  2LCH A;  4R32 A;  2R7R A;  1Q0F A;  2QY9 A;  3NYM A;  4J7Y A;  4DRI B;  2J9B A;  4G0H A;  3K1H A;  1DOV A;  2R05 A;  3ZSU A;  2YLI A;  3HNL A;  1ZHT A;  4ER9 A;  1D0Y A;  2XM4 A;  3CEX A;  3LNR A;  3AQB A;  1T6Q A;  4MW8 A;  2CYD A;  2JX0 A;  3TD7 A;  3Q7L A;  2XXA A;  2OG2 A;  2D5R B;  3AG1 C;  4XLN F;  3W4Y A;  1PCX A;  2R7T A;  4OIR F;  4K1O A;  1LS1 A;  5L0D A;  1Z23 A;  3DE9 A;  2NPU A;  3KKB A;  1EKY A;  1WTY A;  2EPL X;  2GAQ A;  4IWB A;  3W8H A;  1H7I A;  4P6I C;  3DMD A;  3TUL A;  1TR2 A;  4GQH A;  4J32 B;  3TQO A;  2OEX A;  3C8G A;  3N2Z B;  5A69 A;  1LE4 A;  3TK0 A;  1ZU5 A;  2XLV A;  5KYW B;  2DYS C;  1ZW2 A;  2ZXP A;  1K05 A;  3MX3 A;  1XZQ A;  2OJQ A;  5FZT A;  4YJW A;  1G5Z A;  2EPK X;  2PNO A;  2RSE B;  3AJM A;  4XPY A;  2GFH A;  2QLA A;  1A7D A;  3ABK C;  4PJL A;  3IEE A;  4RDA A;  3GM3 A;  2X0C A;  5B3I A;  4H4K C;  3KL4 A;  5F28 E;  2XS8 A;  2GA0 A;  5A6B D;  1L7C A;  3L8I A;  3MYF A;  2MYS A;  4X0R A;  3RH3 A;  2EPO A;  2XL6 A;  3F47 A;  2P0N A;  4AE4 A;  2X51 A;  2KGO A;  2Q9B A;  4XPX A;  1MNE A;  4DBR A;  1Z63 A;  2J45 A;  3MBG A;  4I3M A;  3FAJ A;  2EIJ C;  1A7E A;  2PFD A;  1GS9 A;  3O6X A;  1BR2 A;  3VM6 A;  3JCU Q;  4KI2 A;  2R02 A;  1E83 A;  1LVK A;  5HSW A;  3ZDL A;  4OD4 A;  5BUO A;  4N6C A;  5CI9 A;  1OQC A;  1G4U S;  1D1B A;  1MND A;  3T6G B;  2J0X A;  2XLH A;  5DLJ A;  3R2P A;  3NKE A;  1OCR C;  3M4C A;  3AG4 C;  4JUR I;  1NG1 A;  2AWC A;  1YYJ A;  3W2V A;  4CJO A;  1U0B B;  3EZH A;  2HZ8 A;  2WVO A;  2R9R B;  3GWN A;  1E85 A;  1W2W A;  4BJ1 A;  3G4Z A;  2A6E F;  1AEP A;  2B0J A;  5COF A;  3SNH A;  3U3B A;  5L0F A;  3A9C A;  3C7J A;  3N24 A;  4HE8 D;  2J9V A;  3WOD F;  3LS0 A;  1A41 A;  1VOM A;  1YZC A;  1FFH A;  2EIK C;  2KW3 C;  1VLS A;  2ZXR A;  2HSQ A;  1LIH A;  4MVM A;  4DBQ A;  4NQF A;  3EG9 A;  4CJG A;  2UUI A;  4FX5 A;  5DQT A;  4BEJ A;  1VYK A;  1U6H A;  2R25 A;  2L7A A;  3FHD A;  3OWT A;  3ZQV A;  3JYY A;  4C3D A;  1J8M F;  4W8K A;  4LLE A;  4EKW A;  1SMY F;  3IQT A;  2XXA B;  1ORJ A;  4C3B A;  3U0C A;  2XLE A;  5L0G A;  1AVO B;  4Z9J A;  1NU7 D;  3Q6N A;  4CSA A;  4U5B E;  2IXP A;  3TJ6 A;  3JRM O;  1EA8 A;  1RKC A;  3L1M A;  2BC5 A;  3FVY A;  4FES A;  5A6J A;  2H8A A;  1NZE A;  3CSK A;  3LAY A;  1O3U A;  3C8G B;  1IW7 F;  4U5C E;  2YLG A;  4D4N A;  3ECS A;  3OEO A;  4CIH A;  1FNT c;  1TQG A;  4CS8 C;  5JUA A;  2EIM C;  3EHM A;  4XWJ A;  4CX9 A;  4YWQ A;  2D4U A;  4XQ1 A;  2LP4 A;  5E2Q A;  4E7Z A;  2XL8 A;  4DRH B;  3WG7 C;  5JLI A;  2IXN A;  5KYX A;  4MTF A;  2G3V A;  3AGT A;  2FAP B;  3EFO B;  2LIG A;  4ULW A;  1PD0 A;  4P9T A;  1I4Y A;  1YVI A;  4MVZ A;  1QLE C;  3MFN A;  4QDL A;  3NYJ A;  2Y3D A;  4GYT A;  2NUT A;  2KSF A;  3I4U A;  4AE4 B;  2XSE A;  2HV7 A;  1ST6 A;  3NRH A;  3QW0 A;  2IXO A;  4DJ9 A;  1Q0D A;  3HKK A;  4HFK B;  3BEH A;  1WWP A;  1QSP A;  2LQG A;  1RXQ A;  3GAN A;  3GM1 A;  5E33 A;  1NU9 C;  1BDJ B;  4JVS A;  3DI5 A;  4DVZ A;  4JC7 A;  2ICW G;  4XEF A;  3RW0 A;  4YT8 A;  1HMO A;  5L3Q A;  2QUP A;  2XLO A;  3O39 A;  3L34 A;  1OKK D;  2Z15 A;  3RKO F;  2AU5 A;  2P7V A;  4D4X A;  3I5Q A;  3ASN C;  1Q0M A;  3DJU B;  3AG3 C;  2M64 A;  4CIP A;  1T6I A;  4IAO A;  4CS9 C;  1GM5 A;  3V7O A;  5GPG B;  2YL0 A;  1TWH A;  2OJE D;  3DAG A;  1NFN A;  4KBL A;  3S29 A;  4IRU A;  1FMV A;  3EG9 B;  2YRF A;  2XLD A;  1ZVZ A;  2W45 A;  1MMG A;  3EJN A;  1FTS A;  2F22 A;  1WOL A;  3C62 A;  3U2L A;  4BJ5 A;  5B1A C;  2LD6 A;  4AL0 A;  1RMV A;  1YAU O;  1YA7 O;  2OOC A;  2ZD9 A;  2WL8 A;  5BQG A;  5KYX B;  4JKV A;  3QW1 A;  2HMZ A;  4IGG A;  4OIP F;  1TKN A;  3DM9 B;  3UR3 C;  3KMI A;  3LLI A;  4MVS A;  1YDI A;  2WB7 A;  3A11 A;  2CDQ A;  4I44 A;  1APC A;  1CGO A;  1YLM A;  4M63 A;  2WVN A;  3NMK A;  5L0I A;  3U5S A;  2XS1 A;  2HJ3 A;  4LAC B;  3EPV A;  1A7V A;  5B3S C;  1Z3I X;  2HFI A;  2VAS A;  4JIO A;  1EQ1 A;  2O9X A;  2OQM A;  3S90 A;  3KYI A;  3AG2 C;  1PV3 A;  1OCZ C;  3NYL A;  2DI3 A;  1HE1 A;  2R7Q A;  1FFT C;  1VYI A;  2AWY A;  2GWW A;  3ITF A;  3NKD A;  4MND A;  4O6N A;  3PCV A;  1EI7 A;  1U89 A;  2WVQ A;  3FXH A;  5COM A;  3RVZ A;  2DYR C;  2VCC A;  1Z5Z A;  1OW8 A;  2A68 F;  3HJC A;  2NUT B;  1NSG B;  1GGQ A;  2YZS A;  4L6R A;  5L0J A;  3B0U X;  2Y39 A;  2H7B A;  2I8B A;  3C18 A;  2L9J A;  3EFO A;  3K7D A;  3RVY A;  4OIQ F;  1ORY A;  4K7B A;  2QE9 A;  1OXB A;  3S0X A;  4YL0 A;  1RKE A;  1ZHY A;  4XEK A;  3SP1 A;  3CQZ A;  2NSG A;  2YWA A;  4LER A;  3N0T A;  3QVY A;  5KYU A;  4XEV A;  3H2V A;  2I15 A;  4G7H F;  4P9F A;  4PJJ A;  3HNJ A;  2PX0 A;  3JSZ A;  4GEH A;  3I5P A;  3U8V A;  4KNV A;  2HV6 A;  4CDV A;  5EGY A;  2PX3 A;  1VK5 A;  4E17 A;  4JW1 A;  3POV A;  1G8X A;  3MYI A;  1D1A A;  1H9G A;  2G3K A;  3JT1 A;  2PF4 E;  2G62 A;  256B A;  1SF8 A;  4MS2 A;  3G4X A;  3HLZ A;  3F46 A;  2YVK A;  3DKA A;  2VCA A;  4YL1 A;  1KNY A;  3EHN A;  1WN0 A;  3IQ5 A;  2OKU A;  4MQ9 F;  3RQG A;  3C8G D;  1H9T A;  3C8Z A;  4BJ6 C;  4C3E A;  1AUE A;  2CNW A;  2A0B A;  4CS8 A;  3ABM C;  1Z6A A;  2L6H A;  2PP4 A;  2Q9A A;  4YT5 A;  3VF0 A;  4XTK A;  3RYL A;  4AL1 A;  4ANJ A;  1A0B A;  3EH1 A;  1V55 C;  1JMW A;  4E0H A;  3O10 A;  3W8I A;  1LS4 A;  2OEV A;  1QZX A;  2IOQ A;  2MWQ A;  1M56 C;  2J7P A;  4ONS A;  1HE9 A;  4O6M A;  4IJJ A;  2YHS A;  1ZZP A;  2H7V C;  3ASO C;  3Q7G A;  3QMK A;  2DGJ A;  4KC9 A;  4QI0 A;  4EIY A;  2WZL A;  3NMJ A;  3CAX A;  1YZA A;  1ZHZ A;  2ASR A;  2Q9C A;  5T3W A;  4DRJ B;  5E3A A;  5CI8 A;  4U5G A;  1QQ3 A;  2TMV P;  1FR0 A;  4RBN A;  1LE2 A;  2XLM A;  3UMH A;  3ZVR A;  1ZW3 A;  5D91 A;  3TOL A;  3M79 A;  2R7W A;  4JTC B;  4Q5S F;  1CPR A;  4EBB A;  1Y4C A;  5FCL A;  2YL7 A;  3V5X A;  3B9Q A;  2M4E A;  4PFP A;  1T9K A;  3M15 A;  3SXM A;  1OCC C;  1SYQ A;  3U9J A;  4YN0 B;  1M2V A;  1M2O A;  1S7Z A;  5T3T A;  1RKE B;  4JE9 A;  4YT4 A;  3JRT A;  4BG0 A;  4H54 A;  3EZI A;  3DZA A;  4CS9 A;  2JD3 A;  3ZG1 A;  2FGY A;  2XM0 A;  5KYU B;  1ORS C;  4JTA B;  4WAB A;  2MHR A;  3KYJ A;  3FDQ A;  1LI5 A;  2XLW A;  4N6H A;  1O5H A;  3WAQ A;  1TWG A;  4O79 A;  3HTK C;  3ZC4 A;  2W4B A;  5JRA A;  4ZLD A;  1F1M A;  2KJG A;  1WAS A;  2KYH A;  4PFO A;  1MMD A;  1HMD A;  5BQH A;  1D0X A;  4G7O F;  1SZI A;  4JCZ A;  5AC5 A;  5DVW A;  4XLP F;  3IQ6 A;  2HS5 A;  3G50 A;  3VRC A;  3WHN A;  2IM8 A;  2VH3 A;  3PMR A;  4E7S A;  4A2N B;  4CSA C;  2R7X A;  1HY5 A;  1LM3 B;  4CDY A;  5KYN A;  2IYL D;  4U5H A;  1XZP A;  3U2M A;  3ZTM A;  3HNK A;  3LES A;  3GEI A;  4OD5 A;  5DS5 A;  3AGU A;  2ZXO A;  4EUK B;  5F5H A;  5EK0 A;  1TFO B;  2W4M A;  4I1M A;  3ZWI A;  1E84 A;  2H7O A;  1ZHX A;  2P6V A;  2EPM X;  2Y3H A;  3B0P A;  3LEV A;  2XL4 A;  4AX2 A;  4NTF A;  3K1I C;  2A69 F;  3FMS A;  4KNW A;  3R7C A;  1Z7Q c;  4JRZ A;  4ULV A;  1T01 A;  4LDQ A;  2J46 A;  4ZLC A;  1LI7 A;  2KQ9 A;  3DXJ F;  3V5Z A;  5JP7 A;  1LPE A;  3GM2 A;  3GEE A;  2LSE A;  1R4T A;  2WZF A;  4FWV A;  1MQV A;  3T9O A;  3GWL A;  4QI2 A;  3L0I A;  4CS7 A;  1FMW A;  1MMA A;  4E18 A;  3QTH A;  2YQY A;  3FAP B;  3U8P A;  1VTM P;  2J0W A;  1BR4 A;  1D1C A;  4LDK A;  2NUP A;  1I5N A;  3W2W A;  4U9D A;  3H65 A;  2CGE A;  3JSE O;  1VMA A;  2QNL A;  4EBK A;  3JZ0 A;  2YLD A;  1BZ4 A;  3KH2 A;  3OA1 A;  2V26 A;  3ABL C;  1FAP B;  2R03 A;  2EIN C;  3LUT B;  2L6G A;  2OU6 A;  1CPQ A;  1G4W R;  1M2V B;  3UMK A;  2HJM A;  5BQI A;  2R7S A;  3SXY A;  5JS5 A;  4IAR A;  4W8P A;  1H6G A; 
#chains in the Genus database with same CATH homology
 2QUP A;  2P61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...