1L3PA

Crystal structure of the functional domain of the major grass pollen allergen phl p 5b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the functional domain of the major grass-pollen allergen Phlp 5b.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
molecule keywords POLLEN ALLERGEN Phl p 5b
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1l3pA00
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH superfamily
1D1CA 4KI2A 3RF3A 5A6AA 2R7WA 4BJ6C 3FXHA 3EGXB 3I5PA 2XXAB 3EH1A 2TMVP 4K7BA 1KNYA 2A68F 2H7VC 1ZYRF 2CYDA 2J7PD 2J0WA 2YKZA 3DXJF 3QMKA 4J30B 3G50A 2L6HA 1ZHYA 3IQTA 2YLDA 3KL4A 3U3BA 2B0HA 1VMAA 4AK9A 1OW6A 2P1AA 3X2QC 2XL8A 4C7OA 1QVXA 1E83A 4O6MA 1NLXA 4DBRA 1WGWA 2DB4A 2KSFA 3C8GB 3CQZA 3U0CA 1HE9A 4QI0A 1TFOB 3W2WA 1QKRA 2OQMA 1NFNA 2WZLA 2QLAA 3NYJA 3VAYA 1O5HA 2GFHA 3EJNA 5GPGB 1NBBA 1XZQA 5AC4A 2CCYA 4CJOA 2W45A 3RYLA 3H2UA 2ZXOA 2NUPA 1VK5A 2WB7A 1S05A 2HZ8A 1FNTc 1TFKB 2EPOA 1MMDA 2OU6A 1RXQA 4E17A 4OINF 3DD7A 3HNJA 3NMKA 3JCUQ 5JVEA 3JSZA 3C8GA 4OIQF 3EGDA 1WN0A 2L6GA 2G62A 1T6IA 1ZZPA 2UUHA 1Z7Qc 4XLPF 3M79A 1A7DA 4YJWA 3VM6A 4XQ1A 2JPUA 3K7DA 3IQ5A 3POVA 3MX3A 4CSAC 3I5QA 1OCRC 4PFOA 2H8AA 2XXAA 1AVOB 2Z15A 4EBKA 2YRFA 2XLWA 4XPXA 1SZIA 1WOLA 2CDQA 4YT8A 3O39A 2HMQA 2OEXA 4P9TA 1ORYA 4ZLCA 2EINC 3L1MA 2FFHA 1MNEA 5HSWA 3NMJA 3T9OA 3U3FA 4JKVA 1FTSA 3U8PA 2BE5F 4JE9A 3DE9A 2YL0A 1LI5A 3G4ZA 2YLIA 4FWVA 2AU5A 2EPNA 4A4AA 5KYYB 2OG2A 1LS4A 1WASA 4XEKA 2MHRA 4BJ5C 1MNDA 1PD1A 5CI9A 1Z5ZA 2YHSA 4WGZA 3FDQA 1QZXA 256BA 4YL1A 3C63A 2NPUA 4IGGA 1PCXA 1OQCA 3EZIA 3LEOA 3S9OA 4AL0A 2XLMA 4WABA 4MVUA 5JLIA 1M6TA 3E70C 2ZXPA 4JJFA 3TOMA 1A7EA 4JTCB 3RQFA 3W8HA 5KYUB 2AWCA 3DMDA 5A69A 3EFOB 1FAPB 1V55C 3EHNA 1ZHTA 2OCCC 3U2LA 3SXYA 2Y3BA 4MVOA 4DVZA 4DBQA 4AE4A 2XM4A 3EH2A 5B1BC 1K40A 4CX9A 2D4UA 3C7JA 4NTBA 3HJCA 4U5FE 2H7BA 3FAJA 4CS9C 4FAPB 3J06A 1CGNA 1EI7A 4LLCA 3TOLA 2HFIA 4NC3A 2D5RB 1YLMA 2YQYA 4YL0A 3ZWIA 3UMKA 3HNKA 5L3QA 3PHF2 4JJGA 2L9JA 3EG9A 4HEAJ 2ICWG 3FOPA 3KPHA 3LS0A 3U5SA 1RKCA 3MBGA 2HV7A 1T01A 1Q0GA 3KMIA 2E87A 5JSLA 4ER9A 2G3KA 1TWAA 2F22A 2G3VA 4LLEA 2CNWA 1VYKA 4U5GA 1NZEA 3QW1A 2LK4A 3US6A 3EG9B 5BQIA 2VCCA 4WGYA 1GGQA 1VLTA 2WVQA 1HE1A 1R4TA 3ASOC 3WHNA 1YAUO 3LLIA 3QTHA 4YT5A 1D0XA 2DYSC 4KNVA 4QDLA 3TK0A 1RKEA 5E33A 5A6JA 1ZHWA 2LQGA 4PFPA 2PX3A 2DGJA 4XTKA 4BJ5A 5L0IA 1D0ZA 4LDQA 1JPJA 1YYJA 2EIKC 3IHUA 1R5ID 4EUKB 2R7UA 4M63A 2GA0A 3M4CA 3V5XA 1CPQA 5FZTA 3NDBB 2GDCA 2MYSA 1A0BA 3GEHA 5DVWA 5K0IA 1OR2A 2HJMA 4JTAB 1OCCC 4QI2A 1SYQA 1YZCA 3TJ5A 3C62A 2P6VA 3DAGA 2R7QA 1Q0MA 2XL6A 2VASA 2A0UA 4AE4B 1G8XA 1N1CA 4EHPA 5KYUA 4MQ9F 1C17M 1H6GA 2WZFA 3HTKC 3W4YA 2J7PA 1SMYF 3AOUA 2YWAA 2IM8A 4PACA 1Y4CA 2IXNA 2QNLA 3FVYA 3O10A 1JMWA 1CGME 3AQCA 1LPEA 5L3VA 3ABMC 2NSGA 2R05A 3NRHA 1G5ZA 4XEVA 3F47A 5CI8A 4OIRF 3AG3C 3FHDA 4HFFB 3SXZA 2XLOA 2QTVA 4MTGA 4PJNA 1V74B 3DM9B 4MVZA 2LP4A 5DS4A 2LFFA 4C7OB 3K1HA 1QSPA 3JT1A 3H2VA 4EIYA 2O9XA 1MMAA 3UNGC 4JVSA 4C3BA 5JS5A 3C18A 2Q4FA 2Y39A 3C8GD 2VH3A 5T1DB 4U5EE 5D92A 3EGXA 2LD6A 3JYHA 3HLZA 1O87A 2VC9A 1J8MF 1YA7O 3DE8A 4LERA 3JRTA 5L0JA 4JIOA 1OCOC 4JCZA 2PP4A 4BJ1A 2X0CA 1CPRA 2ASRA 4GEHA 4U5CE 4GQHA 4H54A 3RW0A 3U9MA 3B0PA 3JTLO 4BJ6A 3ZTZA 1BR1A 5COGA 4DRHB 4RD9A 1CGOA 3O55A 2Q7RA 4DVYP 2XLVA 2LFDA 1M2VA 1TKNA 3N2ZB 3LNRA 4E18A 5AGFA 3QW0A 2PBEA 3ECSA 3JRMO 2Y69C 5L0CA 3TQOA 2KQ9A 3LLKA 1LS1A 2PFDA 3A11A 4EKWA 5JT4A 2KK1A 1U0BB 5DQTA 1JPNA 3F46A 3T6JA 3GANA 4XPWA 2QY9A 1FFTC 1NSGB 3M1CB 4AL1A 1UFBA 3IPMO 1JOGA 4N6HA 1WWPA 1M2VB 2EPMX 4CS8A 4YT4A 3V5YA 1C03A 1F1MA 2Y3DA 1QQ3A 1OXKA 4CBEA 5DLJA 4J7TA 2Y3GA 2R7XA 2R7SA 4BJTA 2J45A 2YVKA 3L0IA 1H9TA 1HMDA 2RSEB 4EWCA 4I1MA 2YLGA 3I4UA 4CDAA 5D91A 4DRIB 1ZU5A 1B68A 1MMGA 2J46A 2Q9AA 2XLDA 4BG0A 1J8YF 1MMNA 5BQGA 2B0JA 4FX5A 3TULA 1T5OA 2CW0F 2ETSA 3B0UX 2IBFA 2IOQA 1VB5A 2A6HF 4PR9A 1JRAA 1LVKA 3DAFA 4I3MA 1ZHZA 3V7OA 4E7ZA 1V4AA 3EPVA 4MVQA 5T3TA 4BEJA 2ZXWC 2L81A 1I5NA 1NG1A 3GODA 1WATA 2QE9A 2RD9A 1S7ZA 5EGYA 2CNWD 1YYXA 1VTMP 1AEPA 3GM1A 3VF0A 1A41A 4Q5SF 4G7OF 5A6BA 3HNLA 4CDYA 4D4XA 5COFA 2KYHA 3C8ZA 3AQBA 3VRCA 4MTFA 3M4BA 2DYRC 1RKEB 2PNOA 3E9VA 3K1IA 1QLEC 3SNHA 2FGYA 5COMA 4KNWA 3SZRA 1OXBA 1BBHA 4AX2A 3LESA 2EILC 2HMZA 4JZAA 1I4ZA 3ABLC 4ZLDA 3DI5A 2HSQA 2W4MA 5DS6A 3JZ0A 1L3PA 4BPMA 3IQCA 3DZAA 1H7IA 3CSKA 4G7HF 1O3UA 4OD5A 1VYIA 2IYLD 2P0NA 2YL1A 4C3DA 3KH2A 4E0IA 2P7VA 3GEIA 3T6BA 2NSFA 1TWHA 4MVSA 4NCQA 4Z9JA 2KGOA 1ZW2A 4CIPA 2Q9CA 3OWTA 4IJJA 2J9VA 4W8KA 4J7YA 3UMIA 1EQ1A 2X51A 4D4NA 4HFKB 2PX0A 1TWGA 4K0DA 3S0XA 1RCPA 4PJLA 4MVMA 1FR0A 3RQEA 4H4KC 2A0BA 4XEFA 1E84A 2XL4A 3R2PA 4ULVA 1D1BA 1LI7A 1RJ9B 3N24A 3S28A 1YA9A 2MWQA 3O6XA 1TR2A 3MLGA 4G78A 3QZCA 3SP1A 2R7TA 2Y3HA 1ZW3A 2ZPAA 1M2OA 3GEEA 4MNDA 1FFHA 4PK4A 3Q7LA 4RDAA 3TD7A 3UMHA 2IXMA 2WZGA 1E2XA 3QVYA 4JEBA 1Q0KA 4IB4A 1HY5A 3IEEA 2OJQA 4NTAA 2XRHA 1MQVA 2EPKX 1D1AA 1NU7D 3JYYA 1Z63A 1OCZC 4O79A 3MFNA 5JUAA 1BR4A 3K1IC 4JEAA 3ZTMA 3EQLF 3KYJA 3ABKC 3S84A 1KU2A 3K33A 4G0HA 1GM5A 3T6GB 1FMVA 1LM3B 2XM0A 5E3CA 1SR2A 1Z6AA 2M64A 4CSAA 4PJMA 3FOOA 1C02A 2YL7A 4EBBA 2KJGA 3LEVA 2M4EA 4J32B 4X0RA 2NUTA 3RH3A 2LIGA 4LDRA 1PV3A 2XS1A 2VB6A 2WVNA 3PMRA 2AP3A 3UGPA 5JRAA 3ITFA 4CJGA 2YL3A 4XPYA 1G4WR 1K04A 1NU9C 3B29A 2BL2A 3WG7C 3ZIBA 5KYWA 5KYXB 1IW7F 2HS5A 1Z3IX 1DOWA 2XSEA 3NG1A 2BC5A 4IWBA 1YJGA 5E2QA 3BRJA 3L8JA 1OW8A 3GM3A 4ONSA 1KTMA 3NYLA 3NYMA 4R32A 1TQGA 4RBNA 2R7RA 3U8VA 1L7CA 1ORSC 2EPLX 3LUTB 3M15A 4NY3A 1XWJA 4BEMJ 5L0GA 2R25A 3FMSA 2HSBA 5KYWB 3DM5A 3A9CA 1T9KA 3B71A 3K66A 3RQGA 5HV9A 3NKEA 3W2VA 3Q6MA 3L8IA 4IAQA 1XZPA 3PDMP 2Q9BA 4NTFA 3S29A 4CS8C 1LKXA 1T6QA 2NUTB 3VYWA 3ZSUA 1ZVZA 3SXMA 2L7AA 1PD0A 2ZD9A 4JW1A 3DKAA 3DJUB 2R9RB 2EIMC 3ATPA 2UUIA 1BDJB 3UGOA 3MYIA 4IRUA 3GORA 4DOZA 4G7ZF 2J0XA 4K1OA 1YDIA 4Z9HA 3RKOF 3ZG1A 3ZQYA 2R7OA 3BEHA 3AGUA 3HKKA 1JAFA 4P6IC 1E85A 3S90A 3EFOA 2V26A 4NQFA 4MW8A 2I8BA 1QPUA 5B3IA 3LJBA 2DI3A 3Q7GA 3CEXA 3K6BA 4JRZA 4EBJA 1OKKD 2KC3A 2XLEA 3EHMA 1RMVA 4E0HA 1G4US 4N06A 3JSEO 2KW3C 2R02A 4JTDB 5B1AC 2J9BA 3RVYA 5BQHA 5F28E 4LDKA 2A1DD 2PF4E 4MVRA 1UG7A 5A6KA 5A6BD 3OEOA 4I44A 5IY5C 1OKKA 1Y6DA 3OA1A 5KYXA 4I1OB 5FCLA 1WTYA 4UDVA 2V3CC 2I15A 2W9YA 2WVOA 3ZDLA 4E7SA 2A69F 4O6YA 2WL8A 2Q3TA 4MW3A 5JP7A 4JCHA 1D0YA 2HV6A 2P61A 3AG1C 4IARA 4FESA 1VLSA 2L6FA 4O6NA 3GM2A 3S27A 4B6IA 5DQZA 5CIVA 5L0DA 1ZU4A 3WODF 2HKVA 2NG1A 3U2MA 3UR3C 4CIHA 4KC9A 3RVZA 1YARO 3LAYA 1OW7A 3SXKA 4N6CA 1GQAA 2J8WA 3H65A 3HNIA 1YVIA 2AVKA 1OR3A 3NMIA 1SF8A 1GS9A 3SEOA 4U5BE 3GWNA 3TJ6A 3X1OA 2JD3A 2AWYA 1U6HA 4JC7A 4CS7A 1RJ9A 4ULWA 3QVZA 5L0FA 2Q00A 3CZ6A 3IQ6A 5BUOA 2YZSA 2OEVA 4WJ0A 3U9JA 3DJNB 1APCA 4CDVA 2LCHA 4OIOF 2CGEA 1HMOA 4YL3A 1HW2A 1VOMA 1Z23A 1I4YA 2YEVA 2GWWA 3Q6NA 1BZ4A 3KKBA 4YN0B 3T4RA 3W8IA 2R03A 4U5DE 4A2NB 1Q0FA 2HJ3A 3B0VC 2W4BA 1IZMA 1LIHA 3RFYA 3AG2C 1A7VA 3KYIA 4IAOA 3LS1A 3PCVA 1H9GA 2HUJA 2H7OA 1LE4A 3WAQA 1V54C 2OOCA 3EGDB 4MS2A 1Q0DA 1NFOA 2C04A 4U9DA 1FMWA 5DS5A 4KBLA 3ZQVA 3N0TA 3SYNA 2ZXRA 2C03A 2VCAA 3LNMB 1ST6A 1E86A 2J9UA 3ZC4A 2NUPB 4HE8D 1JR8A 1EA8A 3FAPB 4Z9IA 4DRJB 2QUPA 3L34A 3V5ZA 4PJJA 2R7VA 4OD4A 3MYFA 2KNHA 4YK5A 4Q4ZF 2LSEA 1ORJA 5KYNA 3R7CA 1W2WA 3GWLA 4L6RA 2IXPA 1DOVA 2OJED 2GAQA 4XWJA 1AUEA 3NKDA 5F5FA 4CS9A 4YWQA 1HW1A 1YZAA 4LACB 5L0HA 3DWWA 5EK0A 5F5HA 2A6EF 3ASNC 3G4XA 4DXWA 2JX0A 4O7GA 5B3SC 1ZHXA 4C3EA 1EKYA 1LE2A 1K05A 1U89A 4GYTA 4JURI 4U9EA 1T6UA 2FAPB 2IXOA 3ZVRA 1M56C 4P9FA 4Q7CA 5EHHA 2VCBA 4F4BA 1M57C 3B9QA 2XS8A 4XLNF 3RIPA 4ANJA 4W8PA 1TWCA 2XLHA 3CAXA 2OKUA 5KYYA 3AJMA 4N4WA 5TJ5E 1BR2A 3EZHA 3AGTA 4DJ9A 4OIPF 5E3AA 4U5HA 5T3WA 4YT2A 5AC5A 2EIJC 2J9WA 4MTOA 3AG4C
chains in the Genus database with same CATH topology
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1NLX A;  1L3P A; 
#chains in the Genus database with same CATH topology
 1D1C A;  4KI2 A;  3RF3 A;  5A6A A;  2R7W A;  4BJ6 C;  3FXH A;  3EGX B;  3I5P A;  2XXA B;  3EH1 A;  2TMV P;  4K7B A;  1KNY A;  2A68 F;  2H7V C;  1ZYR F;  2CYD A;  2J7P D;  2J0W A;  2YKZ A;  3DXJ F;  3QMK A;  4J30 B;  3G50 A;  2L6H A;  1ZHY A;  3IQT A;  2YLD A;  3KL4 A;  3U3B A;  2B0H A;  1VMA A;  4AK9 A;  1OW6 A;  2P1A A;  3X2Q C;  2XL8 A;  4C7O A;  1QVX A;  1E83 A;  4O6M A;  1NLX A;  4DBR A;  1WGW A;  2DB4 A;  2KSF A;  3C8G B;  3CQZ A;  3U0C A;  1HE9 A;  4QI0 A;  1TFO B;  3W2W A;  1QKR A;  2OQM A;  1NFN A;  2WZL A;  2QLA A;  3NYJ A;  3VAY A;  1O5H A;  2GFH A;  3EJN A;  5GPG B;  1NBB A;  1XZQ A;  5AC4 A;  2CCY A;  4CJO A;  2W45 A;  3RYL A;  3H2U A;  2ZXO A;  2NUP A;  1VK5 A;  2WB7 A;  1S05 A;  2HZ8 A;  1FNT c;  1TFK B;  2EPO A;  1MMD A;  2OU6 A;  1RXQ A;  4E17 A;  4OIN F;  3DD7 A;  3HNJ A;  3NMK A;  3JCU Q;  5JVE A;  3JSZ A;  3C8G A;  4OIQ F;  3EGD A;  1WN0 A;  2L6G A;  2G62 A;  1T6I A;  1ZZP A;  2UUH A;  1Z7Q c;  4XLP F;  3M79 A;  1A7D A;  4YJW A;  3VM6 A;  4XQ1 A;  2JPU A;  3K7D A;  3IQ5 A;  3POV A;  3MX3 A;  4CSA C;  3I5Q A;  1OCR C;  4PFO A;  2H8A A;  2XXA A;  1AVO B;  2Z15 A;  4EBK A;  2YRF A;  2XLW A;  4XPX A;  1SZI A;  1WOL A;  2CDQ A;  4YT8 A;  3O39 A;  2HMQ A;  2OEX A;  4P9T A;  1ORY A;  4ZLC A;  2EIN C;  3L1M A;  2FFH A;  1MNE A;  5HSW A;  3NMJ A;  3T9O A;  3U3F A;  4JKV A;  1FTS A;  3U8P A;  2BE5 F;  4JE9 A;  3DE9 A;  2YL0 A;  1LI5 A;  3G4Z A;  2YLI A;  4FWV A;  2AU5 A;  2EPN A;  4A4A A;  5KYY B;  2OG2 A;  1LS4 A;  1WAS A;  4XEK A;  2MHR A;  4BJ5 C;  1MND A;  1PD1 A;  5CI9 A;  1Z5Z A;  2YHS A;  4WGZ A;  3FDQ A;  1QZX A;  256B A;  4YL1 A;  3C63 A;  2NPU A;  4IGG A;  1PCX A;  1OQC A;  3EZI A;  3LEO A;  3S9O A;  4AL0 A;  2XLM A;  4WAB A;  4MVU A;  5JLI A;  1M6T A;  3E70 C;  2ZXP A;  4JJF A;  3TOM A;  1A7E A;  4JTC B;  3RQF A;  3W8H A;  5KYU B;  2AWC A;  3DMD A;  5A69 A;  3EFO B;  1FAP B;  1V55 C;  3EHN A;  1ZHT A;  2OCC C;  3U2L A;  3SXY A;  2Y3B A;  4MVO A;  4DVZ A;  4DBQ A;  4AE4 A;  2XM4 A;  3EH2 A;  5B1B C;  1K40 A;  4CX9 A;  2D4U A;  3C7J A;  4NTB A;  3HJC A;  4U5F E;  2H7B A;  3FAJ A;  4CS9 C;  4FAP B;  3J06 A;  1CGN A;  1EI7 A;  4LLC A;  3TOL A;  2HFI A;  4NC3 A;  2D5R B;  1YLM A;  2YQY A;  4YL0 A;  3ZWI A;  3UMK A;  3HNK A;  5L3Q A;  3PHF 2;  4JJG A;  2L9J A;  3EG9 A;  4HEA J;  2ICW G;  3FOP A;  3KPH A;  3LS0 A;  3U5S A;  1RKC A;  3MBG A;  2HV7 A;  1T01 A;  1Q0G A;  3KMI A;  2E87 A;  5JSL A;  4ER9 A;  2G3K A;  1TWA A;  2F22 A;  2G3V A;  4LLE A;  2CNW A;  1VYK A;  4U5G A;  1NZE A;  3QW1 A;  2LK4 A;  3US6 A;  3EG9 B;  5BQI A;  2VCC A;  4WGY A;  1GGQ A;  1VLT A;  2WVQ A;  1HE1 A;  1R4T A;  3ASO C;  3WHN A;  1YAU O;  3LLI A;  3QTH A;  4YT5 A;  1D0X A;  2DYS C;  4KNV A;  4QDL A;  3TK0 A;  1RKE A;  5E33 A;  5A6J A;  1ZHW A;  2LQG A;  4PFP A;  2PX3 A;  2DGJ A;  4XTK A;  4BJ5 A;  5L0I A;  1D0Z A;  4LDQ A;  1JPJ A;  1YYJ A;  2EIK C;  3IHU A;  1R5I D;  4EUK B;  2R7U A;  4M63 A;  2GA0 A;  3M4C A;  3V5X A;  1CPQ A;  5FZT A;  3NDB B;  2GDC A;  2MYS A;  1A0B A;  3GEH A;  5DVW A;  5K0I A;  1OR2 A;  2HJM A;  4JTA B;  1OCC C;  4QI2 A;  1SYQ A;  1YZC A;  3TJ5 A;  3C62 A;  2P6V A;  3DAG A;  2R7Q A;  1Q0M A;  2XL6 A;  2VAS A;  2A0U A;  4AE4 B;  1G8X A;  1N1C A;  4EHP A;  5KYU A;  4MQ9 F;  1C17 M;  1H6G A;  2WZF A;  3HTK C;  3W4Y A;  2J7P A;  1SMY F;  3AOU A;  2YWA A;  2IM8 A;  4PAC A;  1Y4C A;  2IXN A;  2QNL A;  3FVY A;  3O10 A;  1JMW A;  1CGM E;  3AQC A;  1LPE A;  5L3V A;  3ABM C;  2NSG A;  2R05 A;  3NRH A;  1G5Z A;  4XEV A;  3F47 A;  5CI8 A;  4OIR F;  3AG3 C;  3FHD A;  4HFF B;  3SXZ A;  2XLO A;  2QTV A;  4MTG A;  4PJN A;  1V74 B;  3DM9 B;  4MVZ A;  2LP4 A;  5DS4 A;  2LFF A;  4C7O B;  3K1H A;  1QSP A;  3JT1 A;  3H2V A;  4EIY A;  2O9X A;  1MMA A;  3UNG C;  4JVS A;  4C3B A;  5JS5 A;  3C18 A;  2Q4F A;  2Y39 A;  3C8G D;  2VH3 A;  5T1D B;  4U5E E;  5D92 A;  3EGX A;  2LD6 A;  3JYH A;  3HLZ A;  1O87 A;  2VC9 A;  1J8M F;  1YA7 O;  3DE8 A;  4LER A;  3JRT A;  5L0J A;  4JIO A;  1OCO C;  4JCZ A;  2PP4 A;  4BJ1 A;  2X0C A;  1CPR A;  2ASR A;  4GEH A;  4U5C E;  4GQH A;  4H54 A;  3RW0 A;  3U9M A;  3B0P A;  3JTL O;  4BJ6 A;  3ZTZ A;  1BR1 A;  5COG A;  4DRH B;  4RD9 A;  1CGO A;  3O55 A;  2Q7R A;  4DVY P;  2XLV A;  2LFD A;  1M2V A;  1TKN A;  3N2Z B;  3LNR A;  4E18 A;  5AGF A;  3QW0 A;  2PBE A;  3ECS A;  3JRM O;  2Y69 C;  5L0C A;  3TQO A;  2KQ9 A;  3LLK A;  1LS1 A;  2PFD A;  3A11 A;  4EKW A;  5JT4 A;  2KK1 A;  1U0B B;  5DQT A;  1JPN A;  3F46 A;  3T6J A;  3GAN A;  4XPW A;  2QY9 A;  1FFT C;  1NSG B;  3M1C B;  4AL1 A;  1UFB A;  3IPM O;  1JOG A;  4N6H A;  1WWP A;  1M2V B;  2EPM X;  4CS8 A;  4YT4 A;  3V5Y A;  1C03 A;  1F1M A;  2Y3D A;  1QQ3 A;  1OXK A;  4CBE A;  5DLJ A;  4J7T A;  2Y3G A;  2R7X A;  2R7S A;  4BJT A;  2J45 A;  2YVK A;  3L0I A;  1H9T A;  1HMD A;  2RSE B;  4EWC A;  4I1M A;  2YLG A;  3I4U A;  4CDA A;  5D91 A;  4DRI B;  1ZU5 A;  1B68 A;  1MMG A;  2J46 A;  2Q9A A;  2XLD A;  4BG0 A;  1J8Y F;  1MMN A;  5BQG A;  2B0J A;  4FX5 A;  3TUL A;  1T5O A;  2CW0 F;  2ETS A;  3B0U X;  2IBF A;  2IOQ A;  1VB5 A;  2A6H F;  4PR9 A;  1JRA A;  1LVK A;  3DAF A;  4I3M A;  1ZHZ A;  3V7O A;  4E7Z A;  1V4A A;  3EPV A;  4MVQ A;  5T3T A;  4BEJ A;  2ZXW C;  2L81 A;  1I5N A;  1NG1 A;  3GOD A;  1WAT A;  2QE9 A;  2RD9 A;  1S7Z A;  5EGY A;  2CNW D;  1YYX A;  1VTM P;  1AEP A;  3GM1 A;  3VF0 A;  1A41 A;  4Q5S F;  4G7O F;  5A6B A;  3HNL A;  4CDY A;  4D4X A;  5COF A;  2KYH A;  3C8Z A;  3AQB A;  3VRC A;  4MTF A;  3M4B A;  2DYR C;  1RKE B;  2PNO A;  3E9V A;  3K1I A;  1QLE C;  3SNH A;  2FGY A;  5COM A;  4KNW A;  3SZR A;  1OXB A;  1BBH A;  4AX2 A;  3LES A;  2EIL C;  2HMZ A;  4JZA A;  1I4Z A;  3ABL C;  4ZLD A;  3DI5 A;  2HSQ A;  2W4M A;  5DS6 A;  3JZ0 A;  1L3P A;  4BPM A;  3IQC A;  3DZA A;  1H7I A;  3CSK A;  4G7H F;  1O3U A;  4OD5 A;  1VYI A;  2IYL D;  2P0N A;  2YL1 A;  4C3D A;  3KH2 A;  4E0I A;  2P7V A;  3GEI A;  3T6B A;  2NSF A;  1TWH A;  4MVS A;  4NCQ A;  4Z9J A;  2KGO A;  1ZW2 A;  4CIP A;  2Q9C A;  3OWT A;  4IJJ A;  2J9V A;  4W8K A;  4J7Y A;  3UMI A;  1EQ1 A;  2X51 A;  4D4N A;  4HFK B;  2PX0 A;  1TWG A;  4K0D A;  3S0X A;  1RCP A;  4PJL A;  4MVM A;  1FR0 A;  3RQE A;  4H4K C;  2A0B A;  4XEF A;  1E84 A;  2XL4 A;  3R2P A;  4ULV A;  1D1B A;  1LI7 A;  1RJ9 B;  3N24 A;  3S28 A;  1YA9 A;  2MWQ A;  3O6X A;  1TR2 A;  3MLG A;  4G78 A;  3QZC A;  3SP1 A;  2R7T A;  2Y3H A;  1ZW3 A;  2ZPA A;  1M2O A;  3GEE A;  4MND A;  1FFH A;  4PK4 A;  3Q7L A;  4RDA A;  3TD7 A;  3UMH A;  2IXM A;  2WZG A;  1E2X A;  3QVY A;  4JEB A;  1Q0K A;  4IB4 A;  1HY5 A;  3IEE A;  2OJQ A;  4NTA A;  2XRH A;  1MQV A;  2EPK X;  1D1A A;  1NU7 D;  3JYY A;  1Z63 A;  1OCZ C;  4O79 A;  3MFN A;  5JUA A;  1BR4 A;  3K1I C;  4JEA A;  3ZTM A;  3EQL F;  3KYJ A;  3ABK C;  3S84 A;  1KU2 A;  3K33 A;  4G0H A;  1GM5 A;  3T6G B;  1FMV A;  1LM3 B;  2XM0 A;  5E3C A;  1SR2 A;  1Z6A A;  2M64 A;  4CSA A;  4PJM A;  3FOO A;  1C02 A;  2YL7 A;  4EBB A;  2KJG A;  3LEV A;  2M4E A;  4J32 B;  4X0R A;  2NUT A;  3RH3 A;  2LIG A;  4LDR A;  1PV3 A;  2XS1 A;  2VB6 A;  2WVN A;  3PMR A;  2AP3 A;  3UGP A;  5JRA A;  3ITF A;  4CJG A;  2YL3 A;  4XPY A;  1G4W R;  1K04 A;  1NU9 C;  3B29 A;  2BL2 A;  3WG7 C;  3ZIB A;  5KYW A;  5KYX B;  1IW7 F;  2HS5 A;  1Z3I X;  1DOW A;  2XSE A;  3NG1 A;  2BC5 A;  4IWB A;  1YJG A;  5E2Q A;  3BRJ A;  3L8J A;  1OW8 A;  3GM3 A;  4ONS A;  1KTM A;  3NYL A;  3NYM A;  4R32 A;  1TQG A;  4RBN A;  2R7R A;  3U8V A;  1L7C A;  1ORS C;  2EPL X;  3LUT B;  3M15 A;  4NY3 A;  1XWJ A;  4BEM J;  5L0G A;  2R25 A;  3FMS A;  2HSB A;  5KYW B;  3DM5 A;  3A9C A;  1T9K A;  3B71 A;  3K66 A;  3RQG A;  5HV9 A;  3NKE A;  3W2V A;  3Q6M A;  3L8I A;  4IAQ A;  1XZP A;  3PDM P;  2Q9B A;  4NTF A;  3S29 A;  4CS8 C;  1LKX A;  1T6Q A;  2NUT B;  3VYW A;  3ZSU A;  1ZVZ A;  3SXM A;  2L7A A;  1PD0 A;  2ZD9 A;  4JW1 A;  3DKA A;  3DJU B;  2R9R B;  2EIM C;  3ATP A;  2UUI A;  1BDJ B;  3UGO A;  3MYI A;  4IRU A;  3GOR A;  4DOZ A;  4G7Z F;  2J0X A;  4K1O A;  1YDI A;  4Z9H A;  3RKO F;  3ZG1 A;  3ZQY A;  2R7O A;  3BEH A;  3AGU A;  3HKK A;  1JAF A;  4P6I C;  1E85 A;  3S90 A;  3EFO A;  2V26 A;  4NQF A;  4MW8 A;  2I8B A;  1QPU A;  5B3I A;  3LJB A;  2DI3 A;  3Q7G A;  3CEX A;  3K6B A;  4JRZ A;  4EBJ A;  1OKK D;  2KC3 A;  2XLE A;  3EHM A;  1RMV A;  4E0H A;  1G4U S;  4N06 A;  3JSE O;  2KW3 C;  2R02 A;  4JTD B;  5B1A C;  2J9B A;  3RVY A;  5BQH A;  5F28 E;  4LDK A;  2A1D D;  2PF4 E;  4MVR A;  1UG7 A;  5A6K A;  5A6B D;  3OEO A;  4I44 A;  5IY5 C;  1OKK A;  1Y6D A;  3OA1 A;  5KYX A;  4I1O B;  5FCL A;  1WTY A;  4UDV A;  2V3C C;  2I15 A;  2W9Y A;  2WVO A;  3ZDL A;  4E7S A;  2A69 F;  4O6Y A;  2WL8 A;  2Q3T A;  4MW3 A;  5JP7 A;  4JCH A;  1D0Y A;  2HV6 A;  2P61 A;  3AG1 C;  4IAR A;  4FES A;  1VLS A;  2L6F A;  4O6N A;  3GM2 A;  3S27 A;  4B6I A;  5DQZ A;  5CIV A;  5L0D A;  1ZU4 A;  3WOD F;  2HKV A;  2NG1 A;  3U2M A;  3UR3 C;  4CIH A;  4KC9 A;  3RVZ A;  1YAR O;  3LAY A;  1OW7 A;  3SXK A;  4N6C A;  1GQA A;  2J8W A;  3H65 A;  3HNI A;  1YVI A;  2AVK A;  1OR3 A;  3NMI A;  1SF8 A;  1GS9 A;  3SEO A;  4U5B E;  3GWN A;  3TJ6 A;  3X1O A;  2JD3 A;  2AWY A;  1U6H A;  4JC7 A;  4CS7 A;  1RJ9 A;  4ULW A;  3QVZ A;  5L0F A;  2Q00 A;  3CZ6 A;  3IQ6 A;  5BUO A;  2YZS A;  2OEV A;  4WJ0 A;  3U9J A;  3DJN B;  1APC A;  4CDV A;  2LCH A;  4OIO F;  2CGE A;  1HMO A;  4YL3 A;  1HW2 A;  1VOM A;  1Z23 A;  1I4Y A;  2YEV A;  2GWW A;  3Q6N A;  1BZ4 A;  3KKB A;  4YN0 B;  3T4R A;  3W8I A;  2R03 A;  4U5D E;  4A2N B;  1Q0F A;  2HJ3 A;  3B0V C;  2W4B A;  1IZM A;  1LIH A;  3RFY A;  3AG2 C;  1A7V A;  3KYI A;  4IAO A;  3LS1 A;  3PCV A;  1H9G A;  2HUJ A;  2H7O A;  1LE4 A;  3WAQ A;  1V54 C;  2OOC A;  3EGD B;  4MS2 A;  1Q0D A;  1NFO A;  2C04 A;  4U9D A;  1FMW A;  5DS5 A;  4KBL A;  3ZQV A;  3N0T A;  3SYN A;  2ZXR A;  2C03 A;  2VCA A;  3LNM B;  1ST6 A;  1E86 A;  2J9U A;  3ZC4 A;  2NUP B;  4HE8 D;  1JR8 A;  1EA8 A;  3FAP B;  4Z9I A;  4DRJ B;  2QUP A;  3L34 A;  3V5Z A;  4PJJ A;  2R7V A;  4OD4 A;  3MYF A;  2KNH A;  4YK5 A;  4Q4Z F;  2LSE A;  1ORJ A;  5KYN A;  3R7C A;  1W2W A;  3GWL A;  4L6R A;  2IXP A;  1DOV A;  2OJE D;  2GAQ A;  4XWJ A;  1AUE A;  3NKD A;  5F5F A;  4CS9 A;  4YWQ A;  1HW1 A;  1YZA A;  4LAC B;  5L0H A;  3DWW A;  5EK0 A;  5F5H A;  2A6E F;  3ASN C;  3G4X A;  4DXW A;  2JX0 A;  4O7G A;  5B3S C;  1ZHX A;  4C3E A;  1EKY A;  1LE2 A;  1K05 A;  1U89 A;  4GYT A;  4JUR I;  4U9E A;  1T6U A;  2FAP B;  2IXO A;  3ZVR A;  1M56 C;  4P9F A;  4Q7C A;  5EHH A;  2VCB A;  4F4B A;  1M57 C;  3B9Q A;  2XS8 A;  4XLN F;  3RIP A;  4ANJ A;  4W8P A;  1TWC A;  2XLH A;  3CAX A;  2OKU A;  5KYY A;  3AJM A;  4N4W A;  5TJ5 E;  1BR2 A;  3EZH A;  3AGT A;  4DJ9 A;  4OIP F;  5E3A A;  4U5H A;  5T3W A;  4YT2 A;  5AC5 A;  2EIJ C;  2J9W A;  4MTO A;  3AG4 C; 
#chains in the Genus database with same CATH homology
 2M64 A;  1NLX A;  1L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...