1L3PA

Crystal structure of the functional domain of the major grass pollen allergen phl p 5b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Allergen
molecule keywords POLLEN ALLERGEN Phl p 5b
publication title Structure of the functional domain of the major grass-pollen allergen Phlp 5b.
pubmed doi rcsb
source organism Phleum pratense
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1l3pA00
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH superfamily
2IXMA 3NMKA 1L3PA 3JYYA 4OIQF 5A69A 3C8GA 2AP3A 3QW1A 2Q7RA 2KW3C 4L6RA 1EA8A 3WG7C 1MMNA 3SXKA 1HW2A 3A9CA 3NDBB 3AG2C 5KYXB 1ORSC 4J7YA 3RQFA 3W2WA 3ZVRA 3ZDLA 4FESA 2FGYA 4CDVA 3DXJF 3U0CA 1I4ZA 2XLEA 1VYKA 1KNYA 4HEAJ 1WOLA 4C7OA 4YT8A 4HFFB 5A6BD 2UUIA 3A11A 4I1MA 1O5HA 4W8PA 1R4TA 2FAPB 5COFA 5IY5C 3O39A 3CSKA 2BE5F 3QW0A 4N4WA 4OIPF 2OG2A 3QMKA 4DBRA 2XLDA 3I5PA 3L8JA 3LLKA 5JS5A 1Z3IX 4JJFA 3M15A 3NMIA 2WVOA 4BEMJ 3TQOA 5CIVA 4QI2A 2NG1A 3MBGA 4N6CA 3O10A 2DGJA 1WN0A 2Q3TA 4YT4A 4U5CE 5B1AC 1NU7D 2B0JA 3RKOF 1HMDA 4ZLDA 1GM5A 1QKRA 1W2WA 2A68F 1LI5A 3MFNA 4I3MA 1C17M 4JTDB 5BQGA 3U5SA 3V5XA 2Y3BA 2I15A 4AE4A 5EHHA 2YLGA 4RBNA 2VCAA 3S90A 256BA 1ZHZA 2EPNA 3S29A 1VB5A 1M56C 2KYHA 5A6BA 1YAUO 1AVOB 1FMVA 2H7BA 3UMIA 3OEOA 5DS4A 1Q0GA 3QVYA 2HS5A 3EPVA 3GM2A 1FFHA 3QZCA 2NSFA 3T6BA 4U9DA 4J30B 2CNWD 3DAFA 1BBHA 3OWTA 2L7AA 3L1MA 1D0ZA 5L0JA 1VMAA 2XXAA 1OCRC 2PP4A 3L34A 4DRJB 3I5QA 3TOMA 1HE9A 1NBBA 4LDKA 2WL8A 4KNVA 3W2VA 4IGGA 2GDCA 3NKEA 4YT5A 1C03A 2DB4A 3DD7A 3KYIA 4IAOA 2QNLA 4CS9C 1T6IA 2WVQA 2C04A 4N6HA 2TMVP 3SZRA 4Z9IA 1MNEA 2HJ3A 4Z9HA 5L0HA 1BR4A 1YJGA 3AJMA 1G4WR 1ZU4A 1JPNA 3K1IA 4RD9A 4CBEA 3E70C 3HNJA 1NU9C 5L0GA 1Q0DA 2J9BA 1G5ZA 2NUPB 3GEIA 3IQCA 5JP7A 4PJJA 5KYXA 1VLTA 3C62A 4U9EA 1A0BA 4Q5SF 1RJ9A 5DVWA 2CNWA 1ZHTA 1ZU5A 4YK5A 2QE9A 3EFOA 1T6QA 4F4BA 2UUHA 3AOUA 2GA0A 2YWAA 2ZXOA 1OXKA 3T9OA 3UNGC 2WB7A 3ZG1A 3GODA 3H2UA 3GWNA 1TFKB 5BUOA 4C3EA 2YQYA 4HE8D 4PJNA 1LVKA 5E2QA 4R32A 1WATA 2IOQA 2QY9A 1VYIA 1DOWA 2WZLA 3IHUA 4IWBA 3R7CA 4DXWA 3LS1A 1PD1A 1E84A 1Q0MA 2CYDA 2L81A 1FNTc 5KYUB 3PDMP 3O6XA 2G3VA 4JE9A 4YT2A 5L0IA 3FDQA 1ORJA 2PNOA 3ZTZA 3F47A 1CPRA 1D1CA 2J0XA 2VCBA 4XEKA 4BJ1A 1ZHYA 2ZPAA 1A7DA 4O6YA 3UGPA 1F1MA 3KMIA 5F28E 4QI0A 4G78A 2A6EF 4JEBA 1ORYA 2EILC 2Q9BA 4KNWA 4O79A 3NMJA 2Z15A 4WGZA 4YL1A 4BJ6A 4CSAC 4P9TA 3JTLO 4BJ5A 1VOMA 4FX5A 1OW7A 2NUTA 1OXBA 5L0DA 1T9KA 4MVUA 4LDQA 1V54C 3ZIBA 4EKWA 4PR9A 1WTYA 5HSWA 4AX2A 1QZXA 2HFIA 4ANJA 3ECSA 3U2MA 1SYQA 1Y4CA 2XLVA 3ABKC 3GWLA 4PFOA 4H4KC 3WODF 4CS8C 4ZLCA 2JPUA 2XLMA 2FFHA 2AWCA 3U9MA 1GGQA 2Y3DA 4XPXA 1K40A 1QLEC 3ZQYA 2RD9A 2V26A 4Q4ZF 2KQ9A 4U5EE 3CAXA 2YEVA 1Z23A 4IB4A 4K0DA 4UDVA 2EINC 1D0XA 3G50A 5JT4A 3VAYA 4BEJA 1NFNA 2NUPA 5JVEA 2R7QA 2W4MA 3HLZA 1IW7F 2ICWG 1Q0KA 2H7VC 2A0UA 3DMDA 4I1OB 3US6A 1S7ZA 3SEOA 4FWVA 5KYNA 4XPYA 2OEXA 4EWCA 1LIHA 4NY3A 3NKDA 4I44A 1I5NA 3X2QC 1QQ3A 2GFHA 2HJMA 4J7TA 4EUKB 1TWCA 5DS6A 4G7HF 1J8MF 1TWAA 3TK0A 3VRCA 2EIKC 3AGUA 5A6AA 2HV7A 3JSEO 3HNKA 4A4AA 3RW0A 2VCCA 1OW8A 2XSEA 4CX9A 1G4US 1LKXA 1TR2A 3TD7A 5KYUA 4D4XA 1EQ1A 5T1DB 1NG1A 4E18A 1ZHWA 3SXZA 3IQ5A 2P0NA 1GS9A 1ZW2A 3QVZA 4MTGA 2XS8A 1KTMA 1DOVA 3C7JA 1SZIA 1M6TA 4GQHA 4PJLA 3RQEA 2KJGA 3ASNC 3K6BA 4NCQA 4AL1A 3M4CA 3AG1C 4EHPA 3EG9B 2VC9A 3H65A 3LUTB 3N24A 3T4RA 1SR2A 4ER9A 4E7ZA 1OCZC 1U89A 1ST6A 3PMRA 2LCHA 3V7OA 4MQ9F 1PV3A 3RIPA 1RKEB 1JMWA 1D0YA 1E2XA 2Q4FA 4N06A 3GORA 3DI5A 1EI7A 1YYXA 2W9YA 4XWJA 3T6GB 5FCLA 5L3VA 3FVYA 2LP4A 5KYYB 2LFDA 4P9FA 4MVSA 4CSAA 3EGDB 4CS7A 1OQCA 3AG3C 4XEVA 4BG0A 5B3SC 2E87A 3VF0A 5AC5A 1JR8A 2Y39A 3R2PA 2L6FA 5JLIA 1PD0A 3TJ6A 2LSEA 4JKVA 5T3WA 4G0HA 4AL0A 2AU5A 2J9UA 2M64A 1G8XA 1BZ4A 1M2VA 1NZEA 1U6HA 2JD3A 2OCCC 3OA1A 4LLCA 5KYWB 3JRMO 2H7OA 1CGOA 3ZQVA 3H2VA 5B1BC 3SXMA 3VYWA 4CS8A 1H9GA 4CIHA 2R7WA 2EPMX 1O87A 2LK4A 3U9JA 2DYRC 3QTHA 3EGXB 3MYFA 2PX0A 1YARO 2KNHA 4LLEA 4LDRA 4DVYP 5L3QA 2LD6A 1NLXA 2HV6A 3TULA 5HV9A 3ITFA 1YA9A 3MLGA 2EIJC 1ZYRF 4FAPB 2YLIA 4YJWA 1YZCA 1KU2A 1ZZPA 4OIRF 5COGA 3U8PA 2XL4A 3V5ZA 2XM0A 2YHSA 1V4AA 1SF8A 2P61A 4CIPA 5AC4A 3VM6A 1FMWA 4E7SA 3ABMC 4G7OF 5DLJA 3EZIA 3HNLA 2IM8A 3DM9B 4E0IA 1UG7A 2YZSA 2CW0F 3RH3A 2J8WA 3EQLF 3M4BA 5F5HA 4KBLA 1OCCC 5BQIA 2L6GA 3N0TA 2YL1A 2YL3A 3C8GB 3FMSA 1XZPA 2WZGA 5E33A 4DJ9A 2A1DD 4QDLA 3ZC4A 4JRZA 1ZVZA 3IEEA 2R03A 4MS2A 3EHMA 4YL0A 3EJNA 4CJGA 1B68A 4Z9JA 2V3CC 1LM3B 1H7IA 3LAYA 2OJQA 4MVQA 4NTAA 3DM5A 3EG9A 4MNDA 1ZW3A 2VASA 2KSFA 2OOCA 3NYLA 4Q7CA 3X1OA 3TOLA 5DQTA 3GM3A 1TKNA 1RKEA 2R05A 4DOZA 4WJ0A 4XTKA 1U0BB 1T5OA 2YLDA 4HFKB 3V5YA 4C3DA 1JAFA 3UGOA 3GANA 1A7VA 1WWPA 3EH2A 3LNMB 2ZXWC 2GAQA 2VB6A 1OCOC 2HUJA 2J9WA 3EGDA 1LS4A 4NTFA 2R7RA 4D4NA 2P1AA 4OINF 3DWWA 3RYLA 5COMA 4EBJA 4GYTA 3DKAA 4MTFA 3LEVA 2MHRA 4JTAB 1Z5ZA 1O3UA 2R7TA 1YA7O 1ZHXA 1OR3A 2DYSC 5CI9A 5BQHA 3SP1A 3NG1A 1GQAA 3FAJA 1RXQA 1V74B 3JT1A 3S27A 4RDAA 2YL0A 4AE4B 2X0CA 2OJED 3KL4A 2F22A 2X51A 1K04A 3EZHA 2XL8A 3LNRA 2D4UA 2ZD9A 4PJMA 4CS9A 3NRHA 4ULVA 2ASRA 2Y3GA 2OQMA 1APCA 4X0RA 3WHNA 1NSGB 2XLHA 2Y3HA 1J8YF 2XXAB 4IAQA 1YYJA 4YN0B 2WVNA 4EIYA 4W8KA 4JTCB 3KH2A 3K1IC 1Z63A 1OW6A 2PFDA 5FZTA 4DVZA 3AQBA 3AG4C 2YL7A 2IXPA 2QTVA 4WGYA 1OKKD 3KYJA 1JOGA 4O6MA 3IQTA 4XLNF 2W45A 5L0FA 2VH3A 3B71A 2D5RB 5GPGB 1FR0A 1LI7A 1CGNA 1FFTC 3SYNA 1Z6AA 2IBFA 2PF4E 3S28A 1H9TA 2J0WA 3ATPA 3LESA 5E3CA 2EPLX 4C3BA 2LIGA 5A6KA 2ZXPA 2ETSA 5AGFA 1YVIA 3CZ6A 3K66A 2W4BA 4ULWA 3JRTA 1CGME 2R7VA 1RJ9B 3ABLC 4EBKA 3SXYA 2QLAA 1NFOA 2YRFA 4MW3A 2R7UA 3CEXA 3EFOB 1MMAA 2G62A 2BL2A 4M63A 2XL6A 2P7VA 1D1BA 3RF3A 1QSPA 2J7PD 4JEAA 3DE8A 3B0UX 5EGYA 3RQGA 3CQZA 5CI8A 3S0XA 2H8AA 1L7CA 1OKKA 3N2ZB 4JJGA 3T6JA 2HKVA 1T01A 1VTMP 4IJJA 1I4YA 1YDIA 1IZMA 1K05A 2R25A 1Q0FA 3JYHA 2XLOA 3HNIA 3K1HA 3PCVA 1E86A 2Q9CA 1WGWA 1HMOA 3L0IA 2J45A 4XLPF 3POVA 4U5FE 3DE9A 4OD4A 4MVMA 4KI2A 1XWJA 4BJ6C 2GWWA 1JPJA 3KKBA 4U5GA 4BJ5C 2HSBA 5B3IA 3W8HA 2EIMC 2OKUA 3G4XA 2RSEB 3J06A 1C02A 4MW8A 4JCZA 1HW1A 3NYMA 1JRAA 3C63A 3PHF2 2G3KA 3FHDA 3S9OA 4BJTA 4JC7A 4NC3A 3NYJA 2LFFA 3AQCA 3I4UA 4NQFA 3FXHA 2R7OA 3MX3A 4MVZA 5TJ5E 5DS5A 1S05A 2CGEA 2J7PA 2KK1A 2JX0A 3LS0A 3S84A 5T3TA 1A41A 2NUTB 2R7SA 3U8VA 4O6NA 3IPMO 1TFOB 3Q7LA 2Y69C 3U3BA 4MVOA 2BC5A 3ASOC 2C03A 1TWGA 3FOOA 1MQVA 4GEHA 3BEHA 3TJ5A 4K7BA 5D91A 1A7EA 2O9XA 4LACB 1MMDA 2PX3A 1H6GA 3K7DA 2HZ8A 1Y6DA 5F5FA 2KC3A 3O55A 3GM1A 3ZWIA 4CDYA 3JCUQ 2I8BA 4CJOA 5JRAA 4E0HA 3L8IA 2KGOA 5DQZA 2M4EA 1YZAA 3LLIA 4JVSA 2NSGA 1BDJB 5D92A 2AWYA 4IRUA 3JZ0A 4YWQA 2OU6A 3UMKA 4U5BE 3K33A 4XPWA 3W8IA 1LE4A 1WASA 1VLSA 1UFBA 3KPHA 3Q6MA 3M79A 4LERA 1EKYA 2XLWA 4J32B 3SNHA 1M57C 3B0PA 2WZFA 3UMHA 3HJCA 1M2OA 2Q9AA 4PFPA 1RCPA 2L6HA 2MYSA 2R9RB 3BRJA 4ONSA 4C7OB 3WAQA 1TQGA 1R5ID 4XQ1A 3W4YA 2IYLD 1N1CA 1MNDA 3G4ZA 3DZAA 4IARA 4AK9A 5JSLA 1RMVA 1BR1A 2EPKX 5KYYA 2A6HF 3B0VC 3HKKA 2CCYA 4U5HA 1CPQA 1TWHA 4EBBA 3HTKC 4H54A 4JZAA 2R7XA 2NPUA 1YLMA 3FOPA 3LJBA 4DRIB 3DAGA 2AVKA 4PK4A 4XEFA 3RVYA 1FAPB 1RKCA 3RFYA 3UR3C 3B9QA 2P6VA 1AUEA 4JW1A 1T6UA 3FAPB 4U5DE 5KYWA 1PCXA 2HMQA 2DI3A 2PBEA 3C8ZA 3DJNB 5L0CA 4CDAA 3E9VA 1E83A 5A6JA 3EH1A 2XS1A 4OIOF 1D1AA 4JURI 3C18A 4YL3A 1OR2A 1AEPA 4WABA 4G7ZF 3C8GD 2IXOA 3B29A 1V55C 1QVXA 2Q00A 3EGXA 3M1CB 1HE1A 2J46A 4O7GA 5K0IA 3IQ6A 2XRHA 5JUAA 2R02A 1HY5A 3DJUB 1E85A 2B0HA 4BPMA 2IXNA 2HMZA 2CDQA 2XM4A 4KC9A 1LE2A 2HSQA 1SMYF 2LQGA 3GEEA 3RVZA 2OEVA 2A69F 4MTOA 3U2LA 1VK5A 2EPOA 3ZTMA 2YKZA 3JSZA 4PACA 4E17A 1QPUA 2YVKA 4K1OA 4A2NB 3MYIA 3Q7GA 1Z7Qc 1MMGA 3Q6NA 4NTBA 3GEHA 2J9VA 2MWQA 3AGTA 4MVRA 2ZXRA 4DBQA 1LS1A 4JCHA 4JIOA 1XZQA 4OD5A 3ZSUA 4B6IA 3LEOA 4DRHB 1FTSA 5E3AA 5EK0A 1M2VB 2L9JA 3F46A 1BR2A 2QUPA 2A0BA 4P6IC 3EHNA 1LPEA 3U3FA
chains in the Genus database with same CATH topology
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1NLX A;  1L3P A; 
#chains in the Genus database with same CATH topology
 2IXM A;  3NMK A;  1L3P A;  3JYY A;  4OIQ F;  5A69 A;  3C8G A;  2AP3 A;  3QW1 A;  2Q7R A;  2KW3 C;  4L6R A;  1EA8 A;  3WG7 C;  1MMN A;  3SXK A;  1HW2 A;  3A9C A;  3NDB B;  3AG2 C;  5KYX B;  1ORS C;  4J7Y A;  3RQF A;  3W2W A;  3ZVR A;  3ZDL A;  4FES A;  2FGY A;  4CDV A;  3DXJ F;  3U0C A;  1I4Z A;  2XLE A;  1VYK A;  1KNY A;  4HEA J;  1WOL A;  4C7O A;  4YT8 A;  4HFF B;  5A6B D;  2UUI A;  3A11 A;  4I1M A;  1O5H A;  4W8P A;  1R4T A;  2FAP B;  5COF A;  5IY5 C;  3O39 A;  3CSK A;  2BE5 F;  3QW0 A;  4N4W A;  4OIP F;  2OG2 A;  3QMK A;  4DBR A;  2XLD A;  3I5P A;  3L8J A;  3LLK A;  5JS5 A;  1Z3I X;  4JJF A;  3M15 A;  3NMI A;  2WVO A;  4BEM J;  3TQO A;  5CIV A;  4QI2 A;  2NG1 A;  3MBG A;  4N6C A;  3O10 A;  2DGJ A;  1WN0 A;  2Q3T A;  4YT4 A;  4U5C E;  5B1A C;  1NU7 D;  2B0J A;  3RKO F;  1HMD A;  4ZLD A;  1GM5 A;  1QKR A;  1W2W A;  2A68 F;  1LI5 A;  3MFN A;  4I3M A;  1C17 M;  4JTD B;  5BQG A;  3U5S A;  3V5X A;  2Y3B A;  2I15 A;  4AE4 A;  5EHH A;  2YLG A;  4RBN A;  2VCA A;  3S90 A;  256B A;  1ZHZ A;  2EPN A;  3S29 A;  1VB5 A;  1M56 C;  2KYH A;  5A6B A;  1YAU O;  1AVO B;  1FMV A;  2H7B A;  3UMI A;  3OEO A;  5DS4 A;  1Q0G A;  3QVY A;  2HS5 A;  3EPV A;  3GM2 A;  1FFH A;  3QZC A;  2NSF A;  3T6B A;  4U9D A;  4J30 B;  2CNW D;  3DAF A;  1BBH A;  3OWT A;  2L7A A;  3L1M A;  1D0Z A;  5L0J A;  1VMA A;  2XXA A;  1OCR C;  2PP4 A;  3L34 A;  4DRJ B;  3I5Q A;  3TOM A;  1HE9 A;  1NBB A;  4LDK A;  2WL8 A;  4KNV A;  3W2V A;  4IGG A;  2GDC A;  3NKE A;  4YT5 A;  1C03 A;  2DB4 A;  3DD7 A;  3KYI A;  4IAO A;  2QNL A;  4CS9 C;  1T6I A;  2WVQ A;  2C04 A;  4N6H A;  2TMV P;  3SZR A;  4Z9I A;  1MNE A;  2HJ3 A;  4Z9H A;  5L0H A;  1BR4 A;  1YJG A;  3AJM A;  1G4W R;  1ZU4 A;  1JPN A;  3K1I A;  4RD9 A;  4CBE A;  3E70 C;  3HNJ A;  1NU9 C;  5L0G A;  1Q0D A;  2J9B A;  1G5Z A;  2NUP B;  3GEI A;  3IQC A;  5JP7 A;  4PJJ A;  5KYX A;  1VLT A;  3C62 A;  4U9E A;  1A0B A;  4Q5S F;  1RJ9 A;  5DVW A;  2CNW A;  1ZHT A;  1ZU5 A;  4YK5 A;  2QE9 A;  3EFO A;  1T6Q A;  4F4B A;  2UUH A;  3AOU A;  2GA0 A;  2YWA A;  2ZXO A;  1OXK A;  3T9O A;  3UNG C;  2WB7 A;  3ZG1 A;  3GOD A;  3H2U A;  3GWN A;  1TFK B;  5BUO A;  4C3E A;  2YQY A;  4HE8 D;  4PJN A;  1LVK A;  5E2Q A;  4R32 A;  1WAT A;  2IOQ A;  2QY9 A;  1VYI A;  1DOW A;  2WZL A;  3IHU A;  4IWB A;  3R7C A;  4DXW A;  3LS1 A;  1PD1 A;  1E84 A;  1Q0M A;  2CYD A;  2L81 A;  1FNT c;  5KYU B;  3PDM P;  3O6X A;  2G3V A;  4JE9 A;  4YT2 A;  5L0I A;  3FDQ A;  1ORJ A;  2PNO A;  3ZTZ A;  3F47 A;  1CPR A;  1D1C A;  2J0X A;  2VCB A;  4XEK A;  4BJ1 A;  1ZHY A;  2ZPA A;  1A7D A;  4O6Y A;  3UGP A;  1F1M A;  3KMI A;  5F28 E;  4QI0 A;  4G78 A;  2A6E F;  4JEB A;  1ORY A;  2EIL C;  2Q9B A;  4KNW A;  4O79 A;  3NMJ A;  2Z15 A;  4WGZ A;  4YL1 A;  4BJ6 A;  4CSA C;  4P9T A;  3JTL O;  4BJ5 A;  1VOM A;  4FX5 A;  1OW7 A;  2NUT A;  1OXB A;  5L0D A;  1T9K A;  4MVU A;  4LDQ A;  1V54 C;  3ZIB A;  4EKW A;  4PR9 A;  1WTY A;  5HSW A;  4AX2 A;  1QZX A;  2HFI A;  4ANJ A;  3ECS A;  3U2M A;  1SYQ A;  1Y4C A;  2XLV A;  3ABK C;  3GWL A;  4PFO A;  4H4K C;  3WOD F;  4CS8 C;  4ZLC A;  2JPU A;  2XLM A;  2FFH A;  2AWC A;  3U9M A;  1GGQ A;  2Y3D A;  4XPX A;  1K40 A;  1QLE C;  3ZQY A;  2RD9 A;  2V26 A;  4Q4Z F;  2KQ9 A;  4U5E E;  3CAX A;  2YEV A;  1Z23 A;  4IB4 A;  4K0D A;  4UDV A;  2EIN C;  1D0X A;  3G50 A;  5JT4 A;  3VAY A;  4BEJ A;  1NFN A;  2NUP A;  5JVE A;  2R7Q A;  2W4M A;  3HLZ A;  1IW7 F;  2ICW G;  1Q0K A;  2H7V C;  2A0U A;  3DMD A;  4I1O B;  3US6 A;  1S7Z A;  3SEO A;  4FWV A;  5KYN A;  4XPY A;  2OEX A;  4EWC A;  1LIH A;  4NY3 A;  3NKD A;  4I44 A;  1I5N A;  3X2Q C;  1QQ3 A;  2GFH A;  2HJM A;  4J7T A;  4EUK B;  1TWC A;  5DS6 A;  4G7H F;  1J8M F;  1TWA A;  3TK0 A;  3VRC A;  2EIK C;  3AGU A;  5A6A A;  2HV7 A;  3JSE O;  3HNK A;  4A4A A;  3RW0 A;  2VCC A;  1OW8 A;  2XSE A;  4CX9 A;  1G4U S;  1LKX A;  1TR2 A;  3TD7 A;  5KYU A;  4D4X A;  1EQ1 A;  5T1D B;  1NG1 A;  4E18 A;  1ZHW A;  3SXZ A;  3IQ5 A;  2P0N A;  1GS9 A;  1ZW2 A;  3QVZ A;  4MTG A;  2XS8 A;  1KTM A;  1DOV A;  3C7J A;  1SZI A;  1M6T A;  4GQH A;  4PJL A;  3RQE A;  2KJG A;  3ASN C;  3K6B A;  4NCQ A;  4AL1 A;  3M4C A;  3AG1 C;  4EHP A;  3EG9 B;  2VC9 A;  3H65 A;  3LUT B;  3N24 A;  3T4R A;  1SR2 A;  4ER9 A;  4E7Z A;  1OCZ C;  1U89 A;  1ST6 A;  3PMR A;  2LCH A;  3V7O A;  4MQ9 F;  1PV3 A;  3RIP A;  1RKE B;  1JMW A;  1D0Y A;  1E2X A;  2Q4F A;  4N06 A;  3GOR A;  3DI5 A;  1EI7 A;  1YYX A;  2W9Y A;  4XWJ A;  3T6G B;  5FCL A;  5L3V A;  3FVY A;  2LP4 A;  5KYY B;  2LFD A;  4P9F A;  4MVS A;  4CSA A;  3EGD B;  4CS7 A;  1OQC A;  3AG3 C;  4XEV A;  4BG0 A;  5B3S C;  2E87 A;  3VF0 A;  5AC5 A;  1JR8 A;  2Y39 A;  3R2P A;  2L6F A;  5JLI A;  1PD0 A;  3TJ6 A;  2LSE A;  4JKV A;  5T3W A;  4G0H A;  4AL0 A;  2AU5 A;  2J9U A;  2M64 A;  1G8X A;  1BZ4 A;  1M2V A;  1NZE A;  1U6H A;  2JD3 A;  2OCC C;  3OA1 A;  4LLC A;  5KYW B;  3JRM O;  2H7O A;  1CGO A;  3ZQV A;  3H2V A;  5B1B C;  3SXM A;  3VYW A;  4CS8 A;  1H9G A;  4CIH A;  2R7W A;  2EPM X;  1O87 A;  2LK4 A;  3U9J A;  2DYR C;  3QTH A;  3EGX B;  3MYF A;  2PX0 A;  1YAR O;  2KNH A;  4LLE A;  4LDR A;  4DVY P;  5L3Q A;  2LD6 A;  1NLX A;  2HV6 A;  3TUL A;  5HV9 A;  3ITF A;  1YA9 A;  3MLG A;  2EIJ C;  1ZYR F;  4FAP B;  2YLI A;  4YJW A;  1YZC A;  1KU2 A;  1ZZP A;  4OIR F;  5COG A;  3U8P A;  2XL4 A;  3V5Z A;  2XM0 A;  2YHS A;  1V4A A;  1SF8 A;  2P61 A;  4CIP A;  5AC4 A;  3VM6 A;  1FMW A;  4E7S A;  3ABM C;  4G7O F;  5DLJ A;  3EZI A;  3HNL A;  2IM8 A;  3DM9 B;  4E0I A;  1UG7 A;  2YZS A;  2CW0 F;  3RH3 A;  2J8W A;  3EQL F;  3M4B A;  5F5H A;  4KBL A;  1OCC C;  5BQI A;  2L6G A;  3N0T A;  2YL1 A;  2YL3 A;  3C8G B;  3FMS A;  1XZP A;  2WZG A;  5E33 A;  4DJ9 A;  2A1D D;  4QDL A;  3ZC4 A;  4JRZ A;  1ZVZ A;  3IEE A;  2R03 A;  4MS2 A;  3EHM A;  4YL0 A;  3EJN A;  4CJG A;  1B68 A;  4Z9J A;  2V3C C;  1LM3 B;  1H7I A;  3LAY A;  2OJQ A;  4MVQ A;  4NTA A;  3DM5 A;  3EG9 A;  4MND A;  1ZW3 A;  2VAS A;  2KSF A;  2OOC A;  3NYL A;  4Q7C A;  3X1O A;  3TOL A;  5DQT A;  3GM3 A;  1TKN A;  1RKE A;  2R05 A;  4DOZ A;  4WJ0 A;  4XTK A;  1U0B B;  1T5O A;  2YLD A;  4HFK B;  3V5Y A;  4C3D A;  1JAF A;  3UGO A;  3GAN A;  1A7V A;  1WWP A;  3EH2 A;  3LNM B;  2ZXW C;  2GAQ A;  2VB6 A;  1OCO C;  2HUJ A;  2J9W A;  3EGD A;  1LS4 A;  4NTF A;  2R7R A;  4D4N A;  2P1A A;  4OIN F;  3DWW A;  3RYL A;  5COM A;  4EBJ A;  4GYT A;  3DKA A;  4MTF A;  3LEV A;  2MHR A;  4JTA B;  1Z5Z A;  1O3U A;  2R7T A;  1YA7 O;  1ZHX A;  1OR3 A;  2DYS C;  5CI9 A;  5BQH A;  3SP1 A;  3NG1 A;  1GQA A;  3FAJ A;  1RXQ A;  1V74 B;  3JT1 A;  3S27 A;  4RDA A;  2YL0 A;  4AE4 B;  2X0C A;  2OJE D;  3KL4 A;  2F22 A;  2X51 A;  1K04 A;  3EZH A;  2XL8 A;  3LNR A;  2D4U A;  2ZD9 A;  4PJM A;  4CS9 A;  3NRH A;  4ULV A;  2ASR A;  2Y3G A;  2OQM A;  1APC A;  4X0R A;  3WHN A;  1NSG B;  2XLH A;  2Y3H A;  1J8Y F;  2XXA B;  4IAQ A;  1YYJ A;  4YN0 B;  2WVN A;  4EIY A;  4W8K A;  4JTC B;  3KH2 A;  3K1I C;  1Z63 A;  1OW6 A;  2PFD A;  5FZT A;  4DVZ A;  3AQB A;  3AG4 C;  2YL7 A;  2IXP A;  2QTV A;  4WGY A;  1OKK D;  3KYJ A;  1JOG A;  4O6M A;  3IQT A;  4XLN F;  2W45 A;  5L0F A;  2VH3 A;  3B71 A;  2D5R B;  5GPG B;  1FR0 A;  1LI7 A;  1CGN A;  1FFT C;  3SYN A;  1Z6A A;  2IBF A;  2PF4 E;  3S28 A;  1H9T A;  2J0W A;  3ATP A;  3LES A;  5E3C A;  2EPL X;  4C3B A;  2LIG A;  5A6K A;  2ZXP A;  2ETS A;  5AGF A;  1YVI A;  3CZ6 A;  3K66 A;  2W4B A;  4ULW A;  3JRT A;  1CGM E;  2R7V A;  1RJ9 B;  3ABL C;  4EBK A;  3SXY A;  2QLA A;  1NFO A;  2YRF A;  4MW3 A;  2R7U A;  3CEX A;  3EFO B;  1MMA A;  2G62 A;  2BL2 A;  4M63 A;  2XL6 A;  2P7V A;  1D1B A;  3RF3 A;  1QSP A;  2J7P D;  4JEA A;  3DE8 A;  3B0U X;  5EGY A;  3RQG A;  3CQZ A;  5CI8 A;  3S0X A;  2H8A A;  1L7C A;  1OKK A;  3N2Z B;  4JJG A;  3T6J A;  2HKV A;  1T01 A;  1VTM P;  4IJJ A;  1I4Y A;  1YDI A;  1IZM A;  1K05 A;  2R25 A;  1Q0F A;  3JYH A;  2XLO A;  3HNI A;  3K1H A;  3PCV A;  1E86 A;  2Q9C A;  1WGW A;  1HMO A;  3L0I A;  2J45 A;  4XLP F;  3POV A;  4U5F E;  3DE9 A;  4OD4 A;  4MVM A;  4KI2 A;  1XWJ A;  4BJ6 C;  2GWW A;  1JPJ A;  3KKB A;  4U5G A;  4BJ5 C;  2HSB A;  5B3I A;  3W8H A;  2EIM C;  2OKU A;  3G4X A;  2RSE B;  3J06 A;  1C02 A;  4MW8 A;  4JCZ A;  1HW1 A;  3NYM A;  1JRA A;  3C63 A;  3PHF 2;  2G3K A;  3FHD A;  3S9O A;  4BJT A;  4JC7 A;  4NC3 A;  3NYJ A;  2LFF A;  3AQC A;  3I4U A;  4NQF A;  3FXH A;  2R7O A;  3MX3 A;  4MVZ A;  5TJ5 E;  5DS5 A;  1S05 A;  2CGE A;  2J7P A;  2KK1 A;  2JX0 A;  3LS0 A;  3S84 A;  5T3T A;  1A41 A;  2NUT B;  2R7S A;  3U8V A;  4O6N A;  3IPM O;  1TFO B;  3Q7L A;  2Y69 C;  3U3B A;  4MVO A;  2BC5 A;  3ASO C;  2C03 A;  1TWG A;  3FOO A;  1MQV A;  4GEH A;  3BEH A;  3TJ5 A;  4K7B A;  5D91 A;  1A7E A;  2O9X A;  4LAC B;  1MMD A;  2PX3 A;  1H6G A;  3K7D A;  2HZ8 A;  1Y6D A;  5F5F A;  2KC3 A;  3O55 A;  3GM1 A;  3ZWI A;  4CDY A;  3JCU Q;  2I8B A;  4CJO A;  5JRA A;  4E0H A;  3L8I A;  2KGO A;  5DQZ A;  2M4E A;  1YZA A;  3LLI A;  4JVS A;  2NSG A;  1BDJ B;  5D92 A;  2AWY A;  4IRU A;  3JZ0 A;  4YWQ A;  2OU6 A;  3UMK A;  4U5B E;  3K33 A;  4XPW A;  3W8I A;  1LE4 A;  1WAS A;  1VLS A;  1UFB A;  3KPH A;  3Q6M A;  3M79 A;  4LER A;  1EKY A;  2XLW A;  4J32 B;  3SNH A;  1M57 C;  3B0P A;  2WZF A;  3UMH A;  3HJC A;  1M2O A;  2Q9A A;  4PFP A;  1RCP A;  2L6H A;  2MYS A;  2R9R B;  3BRJ A;  4ONS A;  4C7O B;  3WAQ A;  1TQG A;  1R5I D;  4XQ1 A;  3W4Y A;  2IYL D;  1N1C A;  1MND A;  3G4Z A;  3DZA A;  4IAR A;  4AK9 A;  5JSL A;  1RMV A;  1BR1 A;  2EPK X;  5KYY A;  2A6H F;  3B0V C;  3HKK A;  2CCY A;  4U5H A;  1CPQ A;  1TWH A;  4EBB A;  3HTK C;  4H54 A;  4JZA A;  2R7X A;  2NPU A;  1YLM A;  3FOP A;  3LJB A;  4DRI B;  3DAG A;  2AVK A;  4PK4 A;  4XEF A;  3RVY A;  1FAP B;  1RKC A;  3RFY A;  3UR3 C;  3B9Q A;  2P6V A;  1AUE A;  4JW1 A;  1T6U A;  3FAP B;  4U5D E;  5KYW A;  1PCX A;  2HMQ A;  2DI3 A;  2PBE A;  3C8Z A;  3DJN B;  5L0C A;  4CDA A;  3E9V A;  1E83 A;  5A6J A;  3EH1 A;  2XS1 A;  4OIO F;  1D1A A;  4JUR I;  3C18 A;  4YL3 A;  1OR2 A;  1AEP A;  4WAB A;  4G7Z F;  3C8G D;  2IXO A;  3B29 A;  1V55 C;  1QVX A;  2Q00 A;  3EGX A;  3M1C B;  1HE1 A;  2J46 A;  4O7G A;  5K0I A;  3IQ6 A;  2XRH A;  5JUA A;  2R02 A;  1HY5 A;  3DJU B;  1E85 A;  2B0H A;  4BPM A;  2IXN A;  2HMZ A;  2CDQ A;  2XM4 A;  4KC9 A;  1LE2 A;  2HSQ A;  1SMY F;  2LQG A;  3GEE A;  3RVZ A;  2OEV A;  2A69 F;  4MTO A;  3U2L A;  1VK5 A;  2EPO A;  3ZTM A;  2YKZ A;  3JSZ A;  4PAC A;  4E17 A;  1QPU A;  2YVK A;  4K1O A;  4A2N B;  3MYI A;  3Q7G A;  1Z7Q c;  1MMG A;  3Q6N A;  4NTB A;  3GEH A;  2J9V A;  2MWQ A;  3AGT A;  4MVR A;  2ZXR A;  4DBQ A;  1LS1 A;  4JCH A;  4JIO A;  1XZQ A;  4OD5 A;  3ZSU A;  4B6I A;  3LEO A;  4DRH B;  1FTS A;  5E3A A;  5EK0 A;  1M2V B;  2L9J A;  3F46 A;  1BR2 A;  2QUP A;  2A0B A;  4P6I C;  3EHN A;  1LPE A;  3U3F A; 
#chains in the Genus database with same CATH homology
 2M64 A;  1NLX A;  1L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...