1L3PA

Crystal structure of the functional domain of the major grass pollen allergen phl p 5b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLLEN ALLERGEN Phl p 5b
publication title Structure of the functional domain of the major grass-pollen allergen Phlp 5b.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1l3pA00
1NLXA 1L3PA 2M64A
chains in the Genus database with same CATH superfamily
1G4WR 4BEMJ 2KC3A 1HE9A 2P7VA 4CDAA 2CW0F 2L6HA 2Q4FA 5COFA 3X2QC 2NUTB 3CSKA 2HS5A 3O39A 2KW3C 1EA8A 2W45A 2X51A 1SMYF 5B3SC 4MVUA 1QKRA 1CGNA 3K7DA 1YJGA 3AGTA 2VH3A 3V7OA 5KYYB 2YHSA 4AE4B 1T6IA 3I5PA 4GYTA 1IW7F 4ANJA 1K04A 5KYYA 3G4ZA 4PACA 1QLEC 3B0PA 5CI8A 3ZSUA 4AE4A 2X0CA 4PK4A 1OCCC 3ASNC 4DBQA 1M2OA 1OCRC 1E86A 1LI7A 1GQAA 5B1BC 3LLKA 3L8JA 3PDMP 2DYSC 4EUKB 1U0BB 3B71A 3NG1A 4RD9A 2XLMA 3UMHA 5IY5C 3BRJA 1TWAA 3DXJF 3OEOA 3QVYA 3DM9B 3X1OA 4X0RA 3S27A 4CS9A 5JUAA 1NZEA 2VCAA 2WVOA 3QW1A 1SZIA 3DAFA 1ORJA 5DS6A 3S90A 5JVEA 3K1HA 1FMVA 1KTMA 3UNGC 4MVSA 4W8KA 1XWJA 2J9VA 4IAOA 3JSEO 3M4CA 2R9RB 3T6JA 3IHUA 4CDVA 2Y3BA 2B0HA 1JPJA 1U6HA 1ZU5A 2LP4A 1ZHZA 5E2QA 3U9MA 4YT5A 2I15A 4DRHB 3AJMA 4QDLA 4YWQA 5A6AA 3V5XA 1TR2A 5GPGB 1L3PA 2QTVA 2OQMA 3GWNA 3LESA 4DRIB 2CGEA 1RKCA 1HMOA 1XZQA 1YLMA 2IXPA 2NSGA 3AG1C 4J7YA 4JCHA 4MTGA 1ZU4A 4NCQA 2KNHA 3RF3A 2G62A 3KH2A 1M6TA 2XRHA 5L3QA 1OR2A 2CDQA 3U3FA 2IM8A 1QVXA 1MMNA 1OCOC 3DZAA 3HJCA 3ZG1A 4CJOA 1E2XA 2EPNA 5L0DA 2H7OA 3NDBB 2AWYA 4XEVA 4XPYA 3TD7A 3TK0A 2Y3DA 1HE1A 4G0HA 4OD5A 1FFHA 3WAQA 3JRMO 3H2UA 3UGOA 1T6QA 4C7OB 2J46A 1Q0KA 2NUPA 3EHMA 3EFOA 3FHDA 4MQ9F 1TWCA 2OU6A 2Y69C 4H4KC 3S29A 4CS7A 4EIYA 4U5DE 1DOVA 4NTBA 1ZHYA 5BUOA 3K33A 4JW1A 1A41A 2HUJA 3K1IA 4GEHA 2QNLA 4E7SA 4DBRA 2GAQA 1Z23A 2MHRA 1M57C 1E85A 2R7XA 3POVA 2GWWA 1NLXA 1QQ3A 1ZVZA 3M15A 3ABMC 1CGOA 3EPVA 4Q7CA 3FAPB 3JYYA 4CS8C 3E70C 4EBKA 2XL8A 1Q0FA 4D4NA 5EK0A 3ASOC 3U8PA 1E84A 1LIHA 4U5FE 3B0UX 3LAYA 4E7ZA 5DLJA 1VK5A 2LIGA 3RQGA 4OINF 3KL4A 5KYXA 1ZW3A 1MNDA 2YL7A 2GDCA 4EHPA 2UUIA 2A1DD 1UFBA 3LNMB 3GORA 1AVOB 3AGUA 1NFNA 3O6XA 4HFFB 3N0TA 4LLCA 4NQFA 3RVYA 1CGME 3NYLA 4OIRF 1K05A 3CAXA 4Z9IA 2W9YA 2HV7A 4O6YA 4PJJA 4H54A 2XM0A 3K6BA 2VB6A 1AUEA 2OKUA 1D1BA 1MQVA 3C8ZA 2J7PD 4ZLCA 5KYWB 4G78A 4CBEA 1F1MA 1O5HA 1S05A 2OOCA 3C18A 4RBNA 3L1MA 4AK9A 4E17A 4QI2A 3JZ0A 3LLIA 2QE9A 3GEIA 5KYWA 1C02A 3ZVRA 2FAPB 3EZIA 4XWJA 5COMA 3I4UA 5JP7A 4BPMA 2HKVA 2HSQA 4YT4A 3DMDA 3MX3A 1GGQA 1JAFA 3EH1A 5KYUB 3GM3A 4U5GA 3FVYA 3C7JA 5E33A 2NSFA 1APCA 1VYIA 1VLTA 3NMJA 3RQEA 3M4BA 2R7UA 4BJ6A 1CPRA 1WASA 2KGOA 3G50A 3GODA 1OKKA 2QLAA 2R7WA 2Q00A 2YL3A 1W2WA 2J9UA 1BR4A 1H9GA 4MNDA 2R7VA 1BBHA 1D0YA 4J7TA 4LERA 2J45A 2CNWA 1D0ZA 4LDQA 1V54C 2HJ3A 4Z9JA 3SXYA 5A69A 3B0VC 4MTOA 2MWQA 5BQIA 1RJ9B 3MYIA 2KSFA 3OA1A 2Q9AA 2YQYA 4LDRA 2XLWA 2ZXPA 3HNJA 1RJ9A 3W4YA 4FWVA 2GA0A 3F47A 4EKWA 4I3MA 3RQFA 3EH2A 2XM4A 3LEOA 4EBJA 2Y39A 5CIVA 5L0IA 4K0DA 2LFDA 4LACB 4N06A 4K7BA 4IWBA 2NUTA 1YARO 4BG0A 2VCCA 5DQZA 4IRUA 2R7SA 2L6FA 5FZTA 1VYKA 2C03A 3GEHA 4PR9A 5AC4A 1YZCA 5HSWA 3U8VA 3RH3A 4DXWA 3DD7A 4YT8A 4HEAJ 4MVRA 2TMVP 4JJFA 1QPUA 3FAJA 2ZPAA 2LK4A 3N24A 3T6BA 2YZSA 1H7IA 2OJED 3C8GD 4F4BA 2XXAB 2PNOA 3CZ6A 1Y4CA 1LE2A 3HLZA 1BR2A 2XXAA 4U5HA 3U3BA 2R25A 4D4XA 4G7ZF 1LPEA 3JRTA 3HNKA 4JEBA 4IAQA 1V55C 2F22A 2LQGA 3IPMO 4IB4A 3JYHA 3IQ6A 5T3WA 2EPKX 1HW2A 2KQ9A 3U2MA 2L6GA 4KI2A 2VC9A 1D1CA 1ZHXA 4ONSA 4GQHA 2YVKA 2P1AA 2WB7A 2JX0A 2YL1A 3EZHA 3PMRA 1FTSA 1QZXA 3SYNA 4J32B 1TFOB 1FR0A 5KYNA 1VOMA 1WTYA 2DGJA 4KBLA 3Q7GA 1FFTC 1TQGA 3K1IC 4G7HF 2OG2A 2ASRA 2EIKC 2CCYA 3S84A 3Q6NA 1BR1A 2QY9A 4ER9A 3NMIA 2PF4E 1E83A 2AVKA 2ZXWC 1L7CA 3U2LA 1GS9A 2KYHA 2W4BA 3SXKA 3W2VA 1PV3A 5JLIA 3UGPA 1H6GA 2J9WA 2WZFA 3B9QA 3V5ZA 5E3CA 1NSGB 1R4TA 4CDYA 5FCLA 2JD3A 4MTFA 1LS4A 3FXHA 3GM2A 3ATPA 2DB4A 3R7CA 4K1OA 2A69F 4BJTA 4MVQA 3S9OA 1Z5ZA 2L7AA 4C7OA 2LD6A 3MYFA 3W2WA 1EQ1A 1Q0GA 1Y6DA 1Z6AA 1LM3B 2IXNA 1VLSA 4U9DA 3ZQVA 2AU5A 2EILC 5DQTA 2NG1A 2EIMC 4KC9A 1DOWA 4JE9A 4BJ5A 1VMAA 2C04A 3O55A 4NY3A 1VTMP 3QTHA 4XPWA 4LLEA 3HKKA 3VM6A 3IQTA 4AL0A 2Z15A 2EINC 3H65A 2R7TA 1JOGA 1NU9C 2A0UA 2MYSA 3FOOA 4IARA 1Z3IX 4NTAA 5B3IA 1J8MF 1G5ZA 3Q7LA 1T9KA 3OWTA 1D0XA 5E3AA 2H8AA 5A6BA 4HE8D 3CQZA 2PX3A 2YLDA 4XQ1A 4BJ6C 4R32A 4JJGA 3GEEA 3H2VA 1JR8A 4EWCA 4CSAC 4ZLDA 3F46A 2YRFA 1ZYRF 1MNEA 3ECSA 2BC5A 3LS1A 2M4EA 3AG2C 3N2ZB 2R02A 4QI0A 2I8BA 1SR2A 2A6HF 2UUHA 3QZCA 1YDIA 5TJ5E 3UMIA 4G7OF 2XLDA 2PBEA 1SYQA 3LS0A 3T9OA 4I1MA 1PD1A 2P6VA 1HMDA 4P9FA 3SEOA 4N6CA 4CIHA 2YEVA 2FGYA 4JKVA 5DS5A 4EBBA 1HY5A 5A6KA 1OR3A 1WGWA 2PP4A 3MLGA 2BE5F 4NTFA 3FDQA 4Q5SF 4YL3A 3GM1A 2Q3TA 1LS1A 1HW1A 3A11A 4JURI 2L81A 1D1AA 4BJ1A 4XLNF 4PFPA 5KYUA 1VB5A 3KMIA 2D5RB 3EGXB 3M79A 3NYMA 1G4US 2J0XA 2OEXA 1V4AA 5F28E 3VAYA 5DVWA 2WVQA 2WVNA 2VCBA 3JCUQ 5EHHA 2ICWG 1M56C 1FMWA 3KKBA 4I44A 4Z9HA 4XLPF 4MVMA 1O87A 2YKZA 3HNLA 1T5OA 5T1DB 3E9VA 1TWHA 2FFHA 1WN0A 3NRHA 4NC3A 4CS9C 1BZ4A 3RFYA 2J0WA 4FAPB 2OJQA 3NMKA 4UDVA 1JMWA 3LNRA 4XEFA 4J30B 2R05A 3DE9A 4ULVA 2AP3A 2WL8A 1S7ZA 2R7OA 1ORYA 4PJLA 3I5QA 3JTLO 4JTCB 4ULWA 3WODF 1H9TA 4O79A 3RIPA 2O9XA 3ZTMA 5HV9A 3ABKC 2LSEA 3V5YA 4JCZA 3T6GB 5JS5A 2XLOA 4MW8A 3W8IA 2M64A 3EHNA 2G3KA 2QUPA 4KNVA 3UR3C 4A4AA 5JRAA 1NG1A 3EJNA 2D4UA 1J8YF 2RSEB 3SXZA 1C17M 5K0IA 4MW3A 256BA 2R7QA 3GANA 3TULA 2A68F 2VASA 2A0BA 3O10A 3QW0A 2HMZA 3A9CA 3RYLA 4AX2A 3S0XA 3MBGA 2J8WA 1OW8A 1IZMA 1KNYA 1BDJB 3JT1A 3UMKA 3SZRA 2HJMA 2XL4A 2XLVA 3U5SA 1K40A 2EIJC 4CIPA 3ZC4A 3SNHA 1WWPA 2GFHA 2Q9CA 1YYJA 3T4RA 3TJ5A 1QSPA 1V74B 2IXOA 2EPOA 3U9JA 3ZDLA 5AC5A 3AQBA 2H7BA 3ZWIA 5L0HA 1C03A 4JIOA 1LE4A 2B0JA 2Y3HA 2HFIA 3J06A 3DJUB 4DRJB 5L0FA 1ORSC 5EGYA 2JPUA 3PHF2 2R7RA 2ZXOA 4BEJA 4Q4ZF 4BJ5C 1JRAA 3W8HA 5L0JA 4U5BE 2P0NA 3QMKA 2CYDA 5JSLA 3FOPA 1A7DA 1T6UA 1EI7A 1B68A 4IJJA 1PD0A 1RKEB 5CI9A 4WGZA 1YA9A 4YJWA 4WABA 3TOMA 1YZAA 3SP1A 2E87A 4YK5A 1U89A 1OKKD 1RKEA 2BL2A 2IYLD 3IQ5A 4XEKA 2L9JA 4P9TA 4WJ0A 2J7PA 2AWCA 4E0IA 1RCPA 1AEPA 2HSBA 2HMQA 2HZ8A 3WG7C 2P61A 2Q7RA 4JEAA 3VF0A 2CNWD 3DE8A 4WGYA 5D91A 4DOZA 1Z63A 3RW0A 4C3EA 1A0BA 1XZPA 1TKNA 1M2VB 3JSZA 3L0IA 4O7GA 2NPUA 1FNTc 1EKYA 1I4YA 2WZLA 1MMAA 2V26A 3GWLA 1M2VA 2LFFA 3Q6MA 3NYJA 3EQLF 3U0CA 4U9EA 1OW6A 3C63A 1Z7Qc 2J9BA 5COGA 1NU7D 2XS1A 5JT4A 3L34A 1FAPB 3DWWA 4JC7A 3NKEA 3K66A 1MMGA 2OEVA 3EGDB 3IEEA 1NBBA 1R5ID 2Y3GA 4YT2A 5A6JA 2XL6A 4M63A 1I5NA 4IGGA 2H7VC 4O6MA 4DVZA 3EGDA 4E0HA 1ZW2A 4JRZA 2IOQA 1I4ZA 5L0CA 2KK1A 3ZQYA 4OD4A 3AQCA 4U5CE 1NFOA 4XTKA 2V3CC 1GM5A 5L3VA 2IXMA 2NUPB 3BEHA 2Q9BA 3EFOB 4HFKB 1OQCA 2WZGA 4L6RA 4YL0A 4C3BA 1ZHWA 4PFOA 3AG4C 4YL1A 3EG9B 5B1AC 4C3DA 4E18A 3PCVA 1LVKA 3HTKC 1YVIA 1SF8A 3C62A 3EG9A 4O6NA 3SXMA 2ZXRA 1ZHTA 4YN0B 2YL0A 4OIOF 1LKXA 1WOLA 2R03A 2YLGA 1PCXA 1Q0DA 2DYRC 3ITFA 4N6HA 2YWAA 5AGFA 3DM5A 5F5HA 4P6IC 5F5FA 2W4MA 2G3VA 1ST6A 3M1CB 4JVSA 3C8GB 4KNWA 2A6EF 4PJMA 1N1CA 2HV6A 4PJNA 2KJGA 3WHNA 3ZIBA 5KYXB 3C8GA 2ETSA 3VYWA 3DJNB 2LCHA 1TFKB 4DVYP 4I1OB 3LJBA 1WATA 3LEVA 3ZTZA 3RVZA 4JZAA 3KPHA 3TOLA 3VRCA 4CX9A 1YYXA 5BQGA 3ABLC 3FMSA 3S28A 1UG7A 4XPXA 3EGXA 4OIPF 2XLEA 1G8XA 3HNIA 1JPNA 3QVZA 2XSEA 4FESA 3R2PA 3DKAA 1OXKA 2ZD9A 3L8IA 3LUTB 3MFNA 5DS4A 2XS8A 5D92A 1TWGA 1OW7A 1A7VA 1O3UA 3RKOF 2OCCC 4FX5A 1A7EA 2YLIA 4JTAB 4CJGA 4MVOA 3CEXA 2IBFA 1YA7O 4W8PA 3US6A 4AL1A 1YAUO 2DI3A 1RXQA 4N4WA 4CS8A 3AG3C 4LDKA 2XLHA 4A2NB 4B6IA 1Q0MA 5BQHA 1KU2A 1MMDA 3TJ6A 1T01A 3DI5A 4JTDB 3NKDA 3IQCA 3KYIA 2EPMX 1OCZC 4U5EE 5T3TA 4MVZA 3AOUA 4RDAA 4OIQF 1LI5A 3TQOA 4DJ9A 4MS2A 4CSAA 3G4XA 1ZZPA 1CPQA 5L0GA 2EPLX 2PX0A 1RMVA 2RD9A 3DAGA 3KYJA 2PFDA 5A6BD 3B29A 1OXBA
chains in the Genus database with same CATH topology
1NLXA 1L3PA 2M64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLX A;  1L3P A;  2M64 A; 
#chains in the Genus database with same CATH topology
 1G4W R;  4BEM J;  2KC3 A;  1HE9 A;  2P7V A;  4CDA A;  2CW0 F;  2L6H A;  2Q4F A;  5COF A;  3X2Q C;  2NUT B;  3CSK A;  2HS5 A;  3O39 A;  2KW3 C;  1EA8 A;  2W45 A;  2X51 A;  1SMY F;  5B3S C;  4MVU A;  1QKR A;  1CGN A;  3K7D A;  1YJG A;  3AGT A;  2VH3 A;  3V7O A;  5KYY B;  2YHS A;  4AE4 B;  1T6I A;  3I5P A;  4GYT A;  1IW7 F;  4ANJ A;  1K04 A;  5KYY A;  3G4Z A;  4PAC A;  1QLE C;  3B0P A;  5CI8 A;  3ZSU A;  4AE4 A;  2X0C A;  4PK4 A;  1OCC C;  3ASN C;  4DBQ A;  1M2O A;  1OCR C;  1E86 A;  1LI7 A;  1GQA A;  5B1B C;  3LLK A;  3L8J A;  3PDM P;  2DYS C;  4EUK B;  1U0B B;  3B71 A;  3NG1 A;  4RD9 A;  2XLM A;  3UMH A;  5IY5 C;  3BRJ A;  1TWA A;  3DXJ F;  3OEO A;  3QVY A;  3DM9 B;  3X1O A;  4X0R A;  3S27 A;  4CS9 A;  5JUA A;  1NZE A;  2VCA A;  2WVO A;  3QW1 A;  1SZI A;  3DAF A;  1ORJ A;  5DS6 A;  3S90 A;  5JVE A;  3K1H A;  1FMV A;  1KTM A;  3UNG C;  4MVS A;  4W8K A;  1XWJ A;  2J9V A;  4IAO A;  3JSE O;  3M4C A;  2R9R B;  3T6J A;  3IHU A;  4CDV A;  2Y3B A;  2B0H A;  1JPJ A;  1U6H A;  1ZU5 A;  2LP4 A;  1ZHZ A;  5E2Q A;  3U9M A;  4YT5 A;  2I15 A;  4DRH B;  3AJM A;  4QDL A;  4YWQ A;  5A6A A;  3V5X A;  1TR2 A;  5GPG B;  1L3P A;  2QTV A;  2OQM A;  3GWN A;  3LES A;  4DRI B;  2CGE A;  1RKC A;  1HMO A;  1XZQ A;  1YLM A;  2IXP A;  2NSG A;  3AG1 C;  4J7Y A;  4JCH A;  4MTG A;  1ZU4 A;  4NCQ A;  2KNH A;  3RF3 A;  2G62 A;  3KH2 A;  1M6T A;  2XRH A;  5L3Q A;  1OR2 A;  2CDQ A;  3U3F A;  2IM8 A;  1QVX A;  1MMN A;  1OCO C;  3DZA A;  3HJC A;  3ZG1 A;  4CJO A;  1E2X A;  2EPN A;  5L0D A;  2H7O A;  3NDB B;  2AWY A;  4XEV A;  4XPY A;  3TD7 A;  3TK0 A;  2Y3D A;  1HE1 A;  4G0H A;  4OD5 A;  1FFH A;  3WAQ A;  3JRM O;  3H2U A;  3UGO A;  1T6Q A;  4C7O B;  2J46 A;  1Q0K A;  2NUP A;  3EHM A;  3EFO A;  3FHD A;  4MQ9 F;  1TWC A;  2OU6 A;  2Y69 C;  4H4K C;  3S29 A;  4CS7 A;  4EIY A;  4U5D E;  1DOV A;  4NTB A;  1ZHY A;  5BUO A;  3K33 A;  4JW1 A;  1A41 A;  2HUJ A;  3K1I A;  4GEH A;  2QNL A;  4E7S A;  4DBR A;  2GAQ A;  1Z23 A;  2MHR A;  1M57 C;  1E85 A;  2R7X A;  3POV A;  2GWW A;  1NLX A;  1QQ3 A;  1ZVZ A;  3M15 A;  3ABM C;  1CGO A;  3EPV A;  4Q7C A;  3FAP B;  3JYY A;  4CS8 C;  3E70 C;  4EBK A;  2XL8 A;  1Q0F A;  4D4N A;  5EK0 A;  3ASO C;  3U8P A;  1E84 A;  1LIH A;  4U5F E;  3B0U X;  3LAY A;  4E7Z A;  5DLJ A;  1VK5 A;  2LIG A;  3RQG A;  4OIN F;  3KL4 A;  5KYX A;  1ZW3 A;  1MND A;  2YL7 A;  2GDC A;  4EHP A;  2UUI A;  2A1D D;  1UFB A;  3LNM B;  3GOR A;  1AVO B;  3AGU A;  1NFN A;  3O6X A;  4HFF B;  3N0T A;  4LLC A;  4NQF A;  3RVY A;  1CGM E;  3NYL A;  4OIR F;  1K05 A;  3CAX A;  4Z9I A;  2W9Y A;  2HV7 A;  4O6Y A;  4PJJ A;  4H54 A;  2XM0 A;  3K6B A;  2VB6 A;  1AUE A;  2OKU A;  1D1B A;  1MQV A;  3C8Z A;  2J7P D;  4ZLC A;  5KYW B;  4G78 A;  4CBE A;  1F1M A;  1O5H A;  1S05 A;  2OOC A;  3C18 A;  4RBN A;  3L1M A;  4AK9 A;  4E17 A;  4QI2 A;  3JZ0 A;  3LLI A;  2QE9 A;  3GEI A;  5KYW A;  1C02 A;  3ZVR A;  2FAP B;  3EZI A;  4XWJ A;  5COM A;  3I4U A;  5JP7 A;  4BPM A;  2HKV A;  2HSQ A;  4YT4 A;  3DMD A;  3MX3 A;  1GGQ A;  1JAF A;  3EH1 A;  5KYU B;  3GM3 A;  4U5G A;  3FVY A;  3C7J A;  5E33 A;  2NSF A;  1APC A;  1VYI A;  1VLT A;  3NMJ A;  3RQE A;  3M4B A;  2R7U A;  4BJ6 A;  1CPR A;  1WAS A;  2KGO A;  3G50 A;  3GOD A;  1OKK A;  2QLA A;  2R7W A;  2Q00 A;  2YL3 A;  1W2W A;  2J9U A;  1BR4 A;  1H9G A;  4MND A;  2R7V A;  1BBH A;  1D0Y A;  4J7T A;  4LER A;  2J45 A;  2CNW A;  1D0Z A;  4LDQ A;  1V54 C;  2HJ3 A;  4Z9J A;  3SXY A;  5A69 A;  3B0V C;  4MTO A;  2MWQ A;  5BQI A;  1RJ9 B;  3MYI A;  2KSF A;  3OA1 A;  2Q9A A;  2YQY A;  4LDR A;  2XLW A;  2ZXP A;  3HNJ A;  1RJ9 A;  3W4Y A;  4FWV A;  2GA0 A;  3F47 A;  4EKW A;  4I3M A;  3RQF A;  3EH2 A;  2XM4 A;  3LEO A;  4EBJ A;  2Y39 A;  5CIV A;  5L0I A;  4K0D A;  2LFD A;  4LAC B;  4N06 A;  4K7B A;  4IWB A;  2NUT A;  1YAR O;  4BG0 A;  2VCC A;  5DQZ A;  4IRU A;  2R7S A;  2L6F A;  5FZT A;  1VYK A;  2C03 A;  3GEH A;  4PR9 A;  5AC4 A;  1YZC A;  5HSW A;  3U8V A;  3RH3 A;  4DXW A;  3DD7 A;  4YT8 A;  4HEA J;  4MVR A;  2TMV P;  4JJF A;  1QPU A;  3FAJ A;  2ZPA A;  2LK4 A;  3N24 A;  3T6B A;  2YZS A;  1H7I A;  2OJE D;  3C8G D;  4F4B A;  2XXA B;  2PNO A;  3CZ6 A;  1Y4C A;  1LE2 A;  3HLZ A;  1BR2 A;  2XXA A;  4U5H A;  3U3B A;  2R25 A;  4D4X A;  4G7Z F;  1LPE A;  3JRT A;  3HNK A;  4JEB A;  4IAQ A;  1V55 C;  2F22 A;  2LQG A;  3IPM O;  4IB4 A;  3JYH A;  3IQ6 A;  5T3W A;  2EPK X;  1HW2 A;  2KQ9 A;  3U2M A;  2L6G A;  4KI2 A;  2VC9 A;  1D1C A;  1ZHX A;  4ONS A;  4GQH A;  2YVK A;  2P1A A;  2WB7 A;  2JX0 A;  2YL1 A;  3EZH A;  3PMR A;  1FTS A;  1QZX A;  3SYN A;  4J32 B;  1TFO B;  1FR0 A;  5KYN A;  1VOM A;  1WTY A;  2DGJ A;  4KBL A;  3Q7G A;  1FFT C;  1TQG A;  3K1I C;  4G7H F;  2OG2 A;  2ASR A;  2EIK C;  2CCY A;  3S84 A;  3Q6N A;  1BR1 A;  2QY9 A;  4ER9 A;  3NMI A;  2PF4 E;  1E83 A;  2AVK A;  2ZXW C;  1L7C A;  3U2L A;  1GS9 A;  2KYH A;  2W4B A;  3SXK A;  3W2V A;  1PV3 A;  5JLI A;  3UGP A;  1H6G A;  2J9W A;  2WZF A;  3B9Q A;  3V5Z A;  5E3C A;  1NSG B;  1R4T A;  4CDY A;  5FCL A;  2JD3 A;  4MTF A;  1LS4 A;  3FXH A;  3GM2 A;  3ATP A;  2DB4 A;  3R7C A;  4K1O A;  2A69 F;  4BJT A;  4MVQ A;  3S9O A;  1Z5Z A;  2L7A A;  4C7O A;  2LD6 A;  3MYF A;  3W2W A;  1EQ1 A;  1Q0G A;  1Y6D A;  1Z6A A;  1LM3 B;  2IXN A;  1VLS A;  4U9D A;  3ZQV A;  2AU5 A;  2EIL C;  5DQT A;  2NG1 A;  2EIM C;  4KC9 A;  1DOW A;  4JE9 A;  4BJ5 A;  1VMA A;  2C04 A;  3O55 A;  4NY3 A;  1VTM P;  3QTH A;  4XPW A;  4LLE A;  3HKK A;  3VM6 A;  3IQT A;  4AL0 A;  2Z15 A;  2EIN C;  3H65 A;  2R7T A;  1JOG A;  1NU9 C;  2A0U A;  2MYS A;  3FOO A;  4IAR A;  1Z3I X;  4NTA A;  5B3I A;  1J8M F;  1G5Z A;  3Q7L A;  1T9K A;  3OWT A;  1D0X A;  5E3A A;  2H8A A;  5A6B A;  4HE8 D;  3CQZ A;  2PX3 A;  2YLD A;  4XQ1 A;  4BJ6 C;  4R32 A;  4JJG A;  3GEE A;  3H2V A;  1JR8 A;  4EWC A;  4CSA C;  4ZLD A;  3F46 A;  2YRF A;  1ZYR F;  1MNE A;  3ECS A;  2BC5 A;  3LS1 A;  2M4E A;  3AG2 C;  3N2Z B;  2R02 A;  4QI0 A;  2I8B A;  1SR2 A;  2A6H F;  2UUH A;  3QZC A;  1YDI A;  5TJ5 E;  3UMI A;  4G7O F;  2XLD A;  2PBE A;  1SYQ A;  3LS0 A;  3T9O A;  4I1M A;  1PD1 A;  2P6V A;  1HMD A;  4P9F A;  3SEO A;  4N6C A;  4CIH A;  2YEV A;  2FGY A;  4JKV A;  5DS5 A;  4EBB A;  1HY5 A;  5A6K A;  1OR3 A;  1WGW A;  2PP4 A;  3MLG A;  2BE5 F;  4NTF A;  3FDQ A;  4Q5S F;  4YL3 A;  3GM1 A;  2Q3T A;  1LS1 A;  1HW1 A;  3A11 A;  4JUR I;  2L81 A;  1D1A A;  4BJ1 A;  4XLN F;  4PFP A;  5KYU A;  1VB5 A;  3KMI A;  2D5R B;  3EGX B;  3M79 A;  3NYM A;  1G4U S;  2J0X A;  2OEX A;  1V4A A;  5F28 E;  3VAY A;  5DVW A;  2WVQ A;  2WVN A;  2VCB A;  3JCU Q;  5EHH A;  2ICW G;  1M56 C;  1FMW A;  3KKB A;  4I44 A;  4Z9H A;  4XLP F;  4MVM A;  1O87 A;  2YKZ A;  3HNL A;  1T5O A;  5T1D B;  3E9V A;  1TWH A;  2FFH A;  1WN0 A;  3NRH A;  4NC3 A;  4CS9 C;  1BZ4 A;  3RFY A;  2J0W A;  4FAP B;  2OJQ A;  3NMK A;  4UDV A;  1JMW A;  3LNR A;  4XEF A;  4J30 B;  2R05 A;  3DE9 A;  4ULV A;  2AP3 A;  2WL8 A;  1S7Z A;  2R7O A;  1ORY A;  4PJL A;  3I5Q A;  3JTL O;  4JTC B;  4ULW A;  3WOD F;  1H9T A;  4O79 A;  3RIP A;  2O9X A;  3ZTM A;  5HV9 A;  3ABK C;  2LSE A;  3V5Y A;  4JCZ A;  3T6G B;  5JS5 A;  2XLO A;  4MW8 A;  3W8I A;  2M64 A;  3EHN A;  2G3K A;  2QUP A;  4KNV A;  3UR3 C;  4A4A A;  5JRA A;  1NG1 A;  3EJN A;  2D4U A;  1J8Y F;  2RSE B;  3SXZ A;  1C17 M;  5K0I A;  4MW3 A;  256B A;  2R7Q A;  3GAN A;  3TUL A;  2A68 F;  2VAS A;  2A0B A;  3O10 A;  3QW0 A;  2HMZ A;  3A9C A;  3RYL A;  4AX2 A;  3S0X A;  3MBG A;  2J8W A;  1OW8 A;  1IZM A;  1KNY A;  1BDJ B;  3JT1 A;  3UMK A;  3SZR A;  2HJM A;  2XL4 A;  2XLV A;  3U5S A;  1K40 A;  2EIJ C;  4CIP A;  3ZC4 A;  3SNH A;  1WWP A;  2GFH A;  2Q9C A;  1YYJ A;  3T4R A;  3TJ5 A;  1QSP A;  1V74 B;  2IXO A;  2EPO A;  3U9J A;  3ZDL A;  5AC5 A;  3AQB A;  2H7B A;  3ZWI A;  5L0H A;  1C03 A;  4JIO A;  1LE4 A;  2B0J A;  2Y3H A;  2HFI A;  3J06 A;  3DJU B;  4DRJ B;  5L0F A;  1ORS C;  5EGY A;  2JPU A;  3PHF 2;  2R7R A;  2ZXO A;  4BEJ A;  4Q4Z F;  4BJ5 C;  1JRA A;  3W8H A;  5L0J A;  4U5B E;  2P0N A;  3QMK A;  2CYD A;  5JSL A;  3FOP A;  1A7D A;  1T6U A;  1EI7 A;  1B68 A;  4IJJ A;  1PD0 A;  1RKE B;  5CI9 A;  4WGZ A;  1YA9 A;  4YJW A;  4WAB A;  3TOM A;  1YZA A;  3SP1 A;  2E87 A;  4YK5 A;  1U89 A;  1OKK D;  1RKE A;  2BL2 A;  2IYL D;  3IQ5 A;  4XEK A;  2L9J A;  4P9T A;  4WJ0 A;  2J7P A;  2AWC A;  4E0I A;  1RCP A;  1AEP A;  2HSB A;  2HMQ A;  2HZ8 A;  3WG7 C;  2P61 A;  2Q7R A;  4JEA A;  3VF0 A;  2CNW D;  3DE8 A;  4WGY A;  5D91 A;  4DOZ A;  1Z63 A;  3RW0 A;  4C3E A;  1A0B A;  1XZP A;  1TKN A;  1M2V B;  3JSZ A;  3L0I A;  4O7G A;  2NPU A;  1FNT c;  1EKY A;  1I4Y A;  2WZL A;  1MMA A;  2V26 A;  3GWL A;  1M2V A;  2LFF A;  3Q6M A;  3NYJ A;  3EQL F;  3U0C A;  4U9E A;  1OW6 A;  3C63 A;  1Z7Q c;  2J9B A;  5COG A;  1NU7 D;  2XS1 A;  5JT4 A;  3L34 A;  1FAP B;  3DWW A;  4JC7 A;  3NKE A;  3K66 A;  1MMG A;  2OEV A;  3EGD B;  3IEE A;  1NBB A;  1R5I D;  2Y3G A;  4YT2 A;  5A6J A;  2XL6 A;  4M63 A;  1I5N A;  4IGG A;  2H7V C;  4O6M A;  4DVZ A;  3EGD A;  4E0H A;  1ZW2 A;  4JRZ A;  2IOQ A;  1I4Z A;  5L0C A;  2KK1 A;  3ZQY A;  4OD4 A;  3AQC A;  4U5C E;  1NFO A;  4XTK A;  2V3C C;  1GM5 A;  5L3V A;  2IXM A;  2NUP B;  3BEH A;  2Q9B A;  3EFO B;  4HFK B;  1OQC A;  2WZG A;  4L6R A;  4YL0 A;  4C3B A;  1ZHW A;  4PFO A;  3AG4 C;  4YL1 A;  3EG9 B;  5B1A C;  4C3D A;  4E18 A;  3PCV A;  1LVK A;  3HTK C;  1YVI A;  1SF8 A;  3C62 A;  3EG9 A;  4O6N A;  3SXM A;  2ZXR A;  1ZHT A;  4YN0 B;  2YL0 A;  4OIO F;  1LKX A;  1WOL A;  2R03 A;  2YLG A;  1PCX A;  1Q0D A;  2DYR C;  3ITF A;  4N6H A;  2YWA A;  5AGF A;  3DM5 A;  5F5H A;  4P6I C;  5F5F A;  2W4M A;  2G3V A;  1ST6 A;  3M1C B;  4JVS A;  3C8G B;  4KNW A;  2A6E F;  4PJM A;  1N1C A;  2HV6 A;  4PJN A;  2KJG A;  3WHN A;  3ZIB A;  5KYX B;  3C8G A;  2ETS A;  3VYW A;  3DJN B;  2LCH A;  1TFK B;  4DVY P;  4I1O B;  3LJB A;  1WAT A;  3LEV A;  3ZTZ A;  3RVZ A;  4JZA A;  3KPH A;  3TOL A;  3VRC A;  4CX9 A;  1YYX A;  5BQG A;  3ABL C;  3FMS A;  3S28 A;  1UG7 A;  4XPX A;  3EGX A;  4OIP F;  2XLE A;  1G8X A;  3HNI A;  1JPN A;  3QVZ A;  2XSE A;  4FES A;  3R2P A;  3DKA A;  1OXK A;  2ZD9 A;  3L8I A;  3LUT B;  3MFN A;  5DS4 A;  2XS8 A;  5D92 A;  1TWG A;  1OW7 A;  1A7V A;  1O3U A;  3RKO F;  2OCC C;  4FX5 A;  1A7E A;  2YLI A;  4JTA B;  4CJG A;  4MVO A;  3CEX A;  2IBF A;  1YA7 O;  4W8P A;  3US6 A;  4AL1 A;  1YAU O;  2DI3 A;  1RXQ A;  4N4W A;  4CS8 A;  3AG3 C;  4LDK A;  2XLH A;  4A2N B;  4B6I A;  1Q0M A;  5BQH A;  1KU2 A;  1MMD A;  3TJ6 A;  1T01 A;  3DI5 A;  4JTD B;  3NKD A;  3IQC A;  3KYI A;  2EPM X;  1OCZ C;  4U5E E;  5T3T A;  4MVZ A;  3AOU A;  4RDA A;  4OIQ F;  1LI5 A;  3TQO A;  4DJ9 A;  4MS2 A;  4CSA A;  3G4X A;  1ZZP A;  1CPQ A;  5L0G A;  2EPL X;  2PX0 A;  1RMV A;  2RD9 A;  3DAG A;  3KYJ A;  2PFD A;  5A6B D;  3B29 A;  1OXB A; 
#chains in the Genus database with same CATH homology
 1NLX A;  1L3P A;  2M64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...