1L3PA

Crystal structure of the functional domain of the major grass pollen allergen phl p 5b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
b'IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLLEN ALLERGEN Phl p 5b
publication title Structure of the functional domain of the major grass-pollen allergen Phlp 5b.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1l3pA00
1NLXA 1L3PA 2M64A
chains in the Genus database with same CATH superfamily
4E0IA 3A9CA 5E33A 1M56C 4BEMJ 3TJ6A 3Q7LA 2XS1A 1FMWA 1TFOB 1ZVZA 4OIOF 256BA 2R7RA 5T3TA 3DD7A 3S28A 3I5QA 1TQGA 1AVOB 4AE4A 3V5XA 1YVIA 1Y6DA 1VTMP 3RF3A 1E86A 1ORYA 1C02A 2J9VA 1J8YF 3AG4C 1MMDA 3HNLA 4XPWA 5JUAA 2OU6A 1TWGA 2Y3HA 4FAPB 5L0CA 4Q5SF 3JTLO 4PFOA 3UR3C 4JTCB 3X1OA 4OD4A 1FFHA 5AC4A 1H6GA 3K66A 1YA7O 5K0IA 1LPEA 4XEFA 1T01A 3U2LA 1M57C 2I8BA 5AC5A 1EA8A 4IRUA 4JRZA 3SXYA 1OW6A 1LM3B 2XM4A 5F28E 1ZYRF 3ZVRA 3JZ0A 1OCOC 3RQGA 3SYNA 1VK5A 3QVZA 3RW0A 3HTKC 4DBRA 2LQGA 2W4BA 3OA1A 3U8VA 3I5PA 1EKYA 5B1AC 3O6XA 2Q3TA 1AUEA 4PK4A 1BDJB 3G4ZA 2P1AA 2XLMA 1R5ID 1ZU5A 2OEVA 3DM5A 1J8MF 4P9FA 3IPMO 1N1CA 2OG2A 2W45A 3M4BA 2GDCA 1OR2A 2Q9CA 2YL1A 4MVOA 3EH2A 2B0HA 4I1OB 5T3WA 2BL2A 3IQ6A 2GA0A 3EG9A 2WZFA 4PJJA 3IQCA 1VOMA 1FTSA 4LERA 3NYLA 2CDQA 3LEOA 2KQ9A 5L0GA 3Q6MA 3U5SA 2XRHA 2CGEA 3UGPA 1E83A 1A0BA 5KYYB 3LLIA 1JPNA 4YT5A 1OCZC 1FAPB 1KTMA 2L6GA 1M2VA 2A0UA 3DM9B 4MS2A 1EQ1A 3U3BA 2ZXRA 1OKKD 3O55A 2M4EA 5KYUA 4P9TA 2J0XA 2L6HA 4HFKB 5A6BA 1T9KA 2V26A 3Q7GA 1G5ZA 2GAQA 5COMA 3AOUA 1T6UA 3DJUB 4LACB 5HSWA 2E87A 1D1CA 3KYJA 4EBKA 3RQFA 5F5HA 2IXNA 3AG2C 1U0BB 4KI2A 1OR3A 2HV6A 3L8IA 4CS8C 3C7JA 2AWYA 1UFBA 2LFDA 5JP7A 2CNWA 4P6IC 1RMVA 3K1IA 1ZZPA 2XXAA 4BEJA 2QUPA 3GWLA 3LS1A 4KNVA 4MTOA 4NTBA 2FGYA 4N4WA 1YJGA 2ETSA 4NTFA 4ANJA 3SP1A 1LIHA 3L0IA 1RJ9B 3J06A 3N0TA 4E18A 1D0ZA 4K0DA 4JE9A 2IBFA 2G62A 4B6IA 4DVYP 3CEXA 5COGA 5A6KA 2VCBA 3VAYA 1YDIA 2BC5A 1RCPA 3VM6A 4JEBA 4CSAC 1VLTA 3B29A 3WG7C 4D4NA 1ZHWA 4PJLA 4YL0A 2W4MA 3POVA 3OEOA 2HJMA 2D4UA 1FNTc 3RFYA 2R7QA 1TWHA 5DVWA 4WGYA 3RVZA 1BZ4A 1NU7D 1Q0KA 1JOGA 2XLVA 1OCRC 3N2ZB 1SMYF 2ZD9A 3NKEA 5DQTA 3RKOF 3GEIA 2AP3A 4CIPA 3OWTA 5JLIA 3WODF 2HSBA 2HFIA 2JD3A 1SYQA 2HV7A 2J46A 3EG9B 2KW3C 4IAOA 4N6HA 3X2QC 5HV9A 3L8JA 2JX0A 1Q0GA 2ZXOA 3W4YA 3QTHA 4JTDB 1QQ3A 3FVYA 1D0YA 2G3VA 4MVQA 4O6MA 3TD7A 3MFNA 5JS5A 2VASA 2YWAA 2J9UA 4YN0B 1L7CA 4IARA 2Y39A 4BG0A 4CS9C 2QLAA 3EFOA 4J7YA 1UG7A 4XEKA 4HEAJ 1PV3A 5BQGA 5KYUB 4K7BA 3ZWIA 4LDRA 3TK0A 2H7OA 3S9OA 4Z9HA 2MHRA 3ZSUA 1LE4A 3HNJA 2XL4A 1HW2A 4C7OA 4AX2A 2OQMA 3TULA 2VCAA 1K05A 3PDMP 5GPGB 4JIOA 1TKNA 5T1DB 1IZMA 2EPLX 3FAPB 4J32B 5JSLA 2PF4E 2LIGA 4LDKA 3QMKA 4GQHA 3RH3A 3RIPA 1XWJA 3SZRA 5DS4A 2L6FA 3F47A 2XXAB 1OCCC 3UMKA 1JPJA 2IYLD 4U5DE 4C3DA 4DRJB 2YLGA 3GODA 1CGOA 3K6BA 4E0HA 1BR2A 2NSGA 4IB4A 4QI0A 3U9MA 3ZQYA 2OJED 1E85A 5A6AA 4G7HF 4X0RA 4JKVA 3NMIA 4U5EE 3US6A 1DOVA 4Q7CA 3NRHA 3FDQA 2HSQA 4IAQA 1QPUA 3AGUA 1V55C 3IEEA 4G0HA 4NC3A 2BE5F 1A41A 2DI3A 4E7SA 3UGOA 2P0NA 3TOMA 3CZ6A 3FOOA 4AL0A 1OXBA 1MNEA 1HE9A 2VC9A 2EIMC 4MVZA 4FESA 2KYHA 4U5FE 4OINF 4CDYA 2AWCA 4RDAA 5KYWB 2A68F 5IY5C 1H9TA 3EGXA 4BJ6C 4U9EA 3WAQA 4MW8A 3R2PA 2R7XA 3HKKA 4F4BA 2V3CC 4U5BE 4AK9A 1H7IA 1JAFA 2FAPB 4FX5A 4J7TA 2EPKX 2LP4A 2DYRC 1NLXA 4KC9A 3KYIA 1Z5ZA 2Q00A 3MBGA 4NTAA 3U3FA 3ECSA 1NSGB 1VLSA 5FZTA 5DS6A 3NYMA 4CJOA 3K1HA 1Q0MA 2JPUA 2PBEA 3L1MA 5A69A 5L0JA 5L0HA 5KYNA 3FHDA 3IHUA 2B0JA 3EFOB 3LNRA 5TJ5E 1LE2A 1HW1A 1ZW2A 4AL1A 5E2QA 2H7VC 3NKDA 3JRTA 4EKWA 5JRAA 2XLOA 1Q0DA 4JJGA 2IM8A 2YQYA 2KJGA 2R9RB 3RVYA 1A7EA 1CGME 2DB4A 4QDLA 4C7OB 2PFDA 2PX3A 3DXJF 4CIHA 4EWCA 3ZTMA 5DS5A 3DJNB 2XLWA 2YZSA 3G4XA 4MNDA 3B0UX 3GANA 1PCXA 4NY3A 2A6EF 2KNHA 3MYIA 3E9VA 2A1DD 3AJMA 3PMRA 4PR9A 2C04A 4U5CE 1ORJA 1Y4CA 1Z3IX 2KK1A 2R25A 2YLDA 5L0FA 2R7WA 1Z7Qc 1OKKA 3AQBA 3UMHA 4N06A 4D4XA 3AQCA 3JYHA 3SXZA 1C17M 3T6JA 2R7OA 4A2NB 4U5GA 1RKCA 2Q7RA 4MQ9F 2Y3GA 3GM3A 3M1CB 1ZU4A 4XQ1A 2L9JA 4AE4B 5L3VA 3LNMB 3EPVA 4PJMA 4PJNA 3C18A 4MTGA 1KU2A 2EIKC 4OIRF 4CS8A 3ATPA 3H2UA 2QE9A 2LCHA 2QY9A 3GWNA 1T6IA 3EGDA 2XSEA 2L7AA 4WGZA 1LVKA 5EK0A 1IW7F 1OQCA 2MWQA 3B71A 3T6GB 1HMOA 4MVSA 4G7ZF 4GEHA 1GM5A 2CNWD 2ASRA 3EQLF 2P7VA 4IGGA 5D91A 3DAGA 4M63A 4YL3A 2DGJA 3GEEA 4YWQA 4C3BA 1ZHYA 2PP4A 4JCHA 2HUJA 1LS1A 1G4WR 2KC3A 3EGXB 4L6RA 1S05A 2M64A 2YLIA 1QLEC 1FFTC 1VMAA 2H8AA 1S7ZA 1PD0A 3EZIA 2EILC 2P6VA 2HJ3A 5CI9A 2Q9BA 4OIPF 1NU9C 3C63A 3KMIA 3T4RA 3ZG1A 5BUOA 2CW0F 1M2OA 4XWJA 3U8PA 4JVSA 4BJ5C 4DVZA 5B3SC 3T9OA 2OEXA 2ZXWC 3DAFA 2IXOA 2J45A 2Q9AA 3C8GA 1NG1A 1SR2A 3EJNA 5B3IA 4BJTA 4JCZA 1RXQA 3DKAA 3B0PA 3CQZA 3S0XA 3GM2A 2OJQA 3EHNA 1D1BA 1M2VB 4EBJA 2CYDA 2D5RB 2IOQA 1V74B 4MTFA 4JC7A 1I5NA 2XS8A 2YL3A 1Z6AA 3W2VA 3WHNA 1ZHXA 2HMZA 3LEVA 5CI8A 3AGTA 4CS9A 2J7PD 4CJGA 3GORA 3ZC4A 1YA9A 4PFPA 1ORSC 4MVUA 3LJBA 1T6QA 4DJ9A 4WJ0A 2CCYA 2WZLA 4EIYA 1O87A 3H2VA 1V54C 2YEVA 5BQHA 1E2XA 1FMVA 1XZQA 2H7BA 1BBHA 1GS9A 5AGFA 4IJJA 3T6BA 3BRJA 4UDVA 1WASA 3MYFA 1BR4A 3FAJA 1MMAA 1WOLA 4Z9IA 3KKBA 3QZCA 1T5OA 4QI2A 1RKEA 3UMIA 2XL8A 1Z63A 3BEHA 4DBQA 2R7UA 2G3KA 3JSZA 3V5ZA 1Z23A 3B9QA 2X0CA 1C03A 2AVKA 1ZHTA 2A69F 2KGOA 3EHMA 3KPHA 1K04A 3NMJA 3TOLA 4JW1A 1B68A 1WATA 2HMQA 2NSFA 2W9YA 1HE1A 2WL8A 2R7VA 4OD5A 2RSEB 3U9JA 4W8PA 1NFOA 5B1BC 4RBNA 2I15A 3O39A 2J9WA 3PHF2 1O3UA 1QVXA 2YVKA 2UUIA 3W8HA 2Y3DA 3JYYA 1JMWA 3ABKC 3FXHA 2P61A 2VH3A 1WTYA 4MW3A 4CDVA 3CSKA 2PX0A 3O10A 4ZLCA 1VYKA 2HS5A 4G78A 3QW1A 1QZXA 2R05A 4BJ6A 3C8GB 2AU5A 3HNKA 4JJFA 3RQEA 1PD1A 3DI5A 4A4AA 3JCUQ 4O6YA 1YYJA 3JRMO 1APCA 1MMGA 1RJ9A 4YL1A 3FOPA 3IQTA 2HKVA 4ONSA 1YZAA 2O9XA 2WVNA 1MNDA 4U5HA 3KL4A 1H9GA 1ZW3A 1QSPA 2HZ8A 3ABLC 1GGQA 2J9BA 2J8WA 2NUTA 3MLGA 4HE8D 4YT2A 1WN0A 4NQFA 4YT4A 4CBEA 2IXMA 2EIJC 2QNLA 3M79A 3U0CA 4XLPF 4ZLDA 1HY5A 3V5YA 2UUHA 3HJCA 2XL6A 1QKRA 4KBLA 1TR2A 3U2MA 2LFFA 5FCLA 5F5FA 1G8XA 3FMSA 1NFNA 4BPMA 3DMDA 4DRIB 3IQ5A 2IXPA 1L3PA 3G50A 3H65A 2NUPA 3S27A 1WGWA 4EUKB 5L0DA 2OKUA 2R02A 3HLZA 2X51A 3S29A 3F46A 4JEAA 4BJ1A 5KYXA 1W2WA 3I4UA 4YJWA 5E3AA 3SXMA 4I3MA 3GM1A 3LUTB 4EBBA 2LD6A 2R7TA 4EHPA 2EPOA 4H4KC 4G7OF 3S84A 1U6HA 1MMNA 4ULVA 5L0IA 1RKEB 2OOCA 2VCCA 3ABMC 2XLHA 3LESA 2LSEA 3MX3A 1BR1A 1OXKA 4O79A 5BQIA 5A6BD 3B0VC 4CS7A 1YYXA 3R7CA 2C03A 3AG1C 2QTVA 4HFFB 1LI7A 2MYSA 1D1AA 1I4YA 1GQAA 3KH2A 3C62A 4MVMA 3NDBB 3JSEO 2DYSC 4JZAA 5JT4A 3TQOA 4O7GA 4YK5A 4I44A 5JVEA 3DWWA 2Y69C 4O6NA 1NBBA 4LDQA 1MQVA 2XLDA 1FR0A 2YKZA 3C8ZA 4DXWA 1LS4A 1YZCA 3NMKA 4R32A 2YHSA 3K1IC 1A7VA 3ZIBA 2VB6A 5E3CA 2XLEA 4Q4ZF 2ICWG 4W8KA 4H54A 3VRCA 1YLMA 4CSAA 1JRAA 5CIVA 5EGYA 2R7SA 2Y3BA 2YL7A 1D0XA 2A6HF 2L81A 1G4US 3K7DA 2WVOA 1JR8A 3V7OA 5DQZA 1ST6A 5A6JA 4GYTA 3N24A 4KNWA 2EINC 3CAXA 3K33A 3ZQVA 2PNOA 1OW8A 3DE8A 5COFA 2KSFA 4OIQF 1OW7A 4N6CA 4ULWA 1VB5A 4RD9A 1HMDA 2EPNA 2NUTB 2WB7A 2OCCC 1CPRA 4E17A 3NYJA 4BJ5A 4LLCA 2Q4FA 1WWPA 3JT1A 1F1MA 2WZGA 3GEHA 1LI5A 3ASNC 3M4CA 1R4TA 1SF8A 1CGNA 1YARO 3VF0A 3SEOA 1I4ZA 2WVQA 1E84A 5EHHA 3DE9A 3L34A 4PACA 5L3QA 3RYLA 1CPQA 4I1MA 1LKXA 3DZAA 4XTKA 2YL0A 2NG1A 3TJ5A 2YRFA 1KNYA 3S90A 2TMVP 1DOWA 2NUPB 3C8GD 5KYWA 3W8IA 4JTAB 4IWBA 2GWWA 2LK4A 4FWVA 4NCQA 4XEVA 1V4AA 4Z9JA 1M6TA 4WABA 1EI7A 3HNIA 4CDAA 4K1OA 4CX9A 2EPMX 3ITFA 5KYXB 2R03A 2NPUA 4XLNF 1A7DA 1TWCA 2A0BA 4MVRA 3LAYA 3ASOC 3LLKA 4LLEA 2J7PA 3AG3C 4U9DA 5D92A 3SXKA 3LS0A 1TWAA 3A11A 3EH1A 1XZPA 3NG1A 3UNGC 4YT8A 3QVYA 5DLJA 1YAUO 1AEPA 2ZPAA 4XPYA 4J30B 3PCVA 3VYWA 1VYIA 2Z15A 1TFKB 3W2WA 2FFHA 1U89A 2RD9A 3EGDB 1Q0FA 3M15A 4XPXA 3ZTZA 1O5HA 4DOZA 4ER9A 5KYYA 1K40A 4DRHB 3SNHA 2F22A 2XM0A 2ZXPA 4E7ZA 2GFHA 1ZHZA 1SZIA 3Q6NA 3ZDLA 3QW0A 4C3EA 4JURI 2J0WA 3E70C 3EZHA 1NZEA
chains in the Genus database with same CATH topology
1NLXA 1L3PA 2M64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLX A;  1L3P A;  2M64 A; 
#chains in the Genus database with same CATH topology
 4E0I A;  3A9C A;  5E33 A;  1M56 C;  4BEM J;  3TJ6 A;  3Q7L A;  2XS1 A;  1FMW A;  1TFO B;  1ZVZ A;  4OIO F;  256B A;  2R7R A;  5T3T A;  3DD7 A;  3S28 A;  3I5Q A;  1TQG A;  1AVO B;  4AE4 A;  3V5X A;  1YVI A;  1Y6D A;  1VTM P;  3RF3 A;  1E86 A;  1ORY A;  1C02 A;  2J9V A;  1J8Y F;  3AG4 C;  1MMD A;  3HNL A;  4XPW A;  5JUA A;  2OU6 A;  1TWG A;  2Y3H A;  4FAP B;  5L0C A;  4Q5S F;  3JTL O;  4PFO A;  3UR3 C;  4JTC B;  3X1O A;  4OD4 A;  1FFH A;  5AC4 A;  1H6G A;  3K66 A;  1YA7 O;  5K0I A;  1LPE A;  4XEF A;  1T01 A;  3U2L A;  1M57 C;  2I8B A;  5AC5 A;  1EA8 A;  4IRU A;  4JRZ A;  3SXY A;  1OW6 A;  1LM3 B;  2XM4 A;  5F28 E;  1ZYR F;  3ZVR A;  3JZ0 A;  1OCO C;  3RQG A;  3SYN A;  1VK5 A;  3QVZ A;  3RW0 A;  3HTK C;  4DBR A;  2LQG A;  2W4B A;  3OA1 A;  3U8V A;  3I5P A;  1EKY A;  5B1A C;  3O6X A;  2Q3T A;  1AUE A;  4PK4 A;  1BDJ B;  3G4Z A;  2P1A A;  2XLM A;  1R5I D;  1ZU5 A;  2OEV A;  3DM5 A;  1J8M F;  4P9F A;  3IPM O;  1N1C A;  2OG2 A;  2W45 A;  3M4B A;  2GDC A;  1OR2 A;  2Q9C A;  2YL1 A;  4MVO A;  3EH2 A;  2B0H A;  4I1O B;  5T3W A;  2BL2 A;  3IQ6 A;  2GA0 A;  3EG9 A;  2WZF A;  4PJJ A;  3IQC A;  1VOM A;  1FTS A;  4LER A;  3NYL A;  2CDQ A;  3LEO A;  2KQ9 A;  5L0G A;  3Q6M A;  3U5S A;  2XRH A;  2CGE A;  3UGP A;  1E83 A;  1A0B A;  5KYY B;  3LLI A;  1JPN A;  4YT5 A;  1OCZ C;  1FAP B;  1KTM A;  2L6G A;  1M2V A;  2A0U A;  3DM9 B;  4MS2 A;  1EQ1 A;  3U3B A;  2ZXR A;  1OKK D;  3O55 A;  2M4E A;  5KYU A;  4P9T A;  2J0X A;  2L6H A;  4HFK B;  5A6B A;  1T9K A;  2V26 A;  3Q7G A;  1G5Z A;  2GAQ A;  5COM A;  3AOU A;  1T6U A;  3DJU B;  4LAC B;  5HSW A;  2E87 A;  1D1C A;  3KYJ A;  4EBK A;  3RQF A;  5F5H A;  2IXN A;  3AG2 C;  1U0B B;  4KI2 A;  1OR3 A;  2HV6 A;  3L8I A;  4CS8 C;  3C7J A;  2AWY A;  1UFB A;  2LFD A;  5JP7 A;  2CNW A;  4P6I C;  1RMV A;  3K1I A;  1ZZP A;  2XXA A;  4BEJ A;  2QUP A;  3GWL A;  3LS1 A;  4KNV A;  4MTO A;  4NTB A;  2FGY A;  4N4W A;  1YJG A;  2ETS A;  4NTF A;  4ANJ A;  3SP1 A;  1LIH A;  3L0I A;  1RJ9 B;  3J06 A;  3N0T A;  4E18 A;  1D0Z A;  4K0D A;  4JE9 A;  2IBF A;  2G62 A;  4B6I A;  4DVY P;  3CEX A;  5COG A;  5A6K A;  2VCB A;  3VAY A;  1YDI A;  2BC5 A;  1RCP A;  3VM6 A;  4JEB A;  4CSA C;  1VLT A;  3B29 A;  3WG7 C;  4D4N A;  1ZHW A;  4PJL A;  4YL0 A;  2W4M A;  3POV A;  3OEO A;  2HJM A;  2D4U A;  1FNT c;  3RFY A;  2R7Q A;  1TWH A;  5DVW A;  4WGY A;  3RVZ A;  1BZ4 A;  1NU7 D;  1Q0K A;  1JOG A;  2XLV A;  1OCR C;  3N2Z B;  1SMY F;  2ZD9 A;  3NKE A;  5DQT A;  3RKO F;  3GEI A;  2AP3 A;  4CIP A;  3OWT A;  5JLI A;  3WOD F;  2HSB A;  2HFI A;  2JD3 A;  1SYQ A;  2HV7 A;  2J46 A;  3EG9 B;  2KW3 C;  4IAO A;  4N6H A;  3X2Q C;  5HV9 A;  3L8J A;  2JX0 A;  1Q0G A;  2ZXO A;  3W4Y A;  3QTH A;  4JTD B;  1QQ3 A;  3FVY A;  1D0Y A;  2G3V A;  4MVQ A;  4O6M A;  3TD7 A;  3MFN A;  5JS5 A;  2VAS A;  2YWA A;  2J9U A;  4YN0 B;  1L7C A;  4IAR A;  2Y39 A;  4BG0 A;  4CS9 C;  2QLA A;  3EFO A;  4J7Y A;  1UG7 A;  4XEK A;  4HEA J;  1PV3 A;  5BQG A;  5KYU B;  4K7B A;  3ZWI A;  4LDR A;  3TK0 A;  2H7O A;  3S9O A;  4Z9H A;  2MHR A;  3ZSU A;  1LE4 A;  3HNJ A;  2XL4 A;  1HW2 A;  4C7O A;  4AX2 A;  2OQM A;  3TUL A;  2VCA A;  1K05 A;  3PDM P;  5GPG B;  4JIO A;  1TKN A;  5T1D B;  1IZM A;  2EPL X;  3FAP B;  4J32 B;  5JSL A;  2PF4 E;  2LIG A;  4LDK A;  3QMK A;  4GQH A;  3RH3 A;  3RIP A;  1XWJ A;  3SZR A;  5DS4 A;  2L6F A;  3F47 A;  2XXA B;  1OCC C;  3UMK A;  1JPJ A;  2IYL D;  4U5D E;  4C3D A;  4DRJ B;  2YLG A;  3GOD A;  1CGO A;  3K6B A;  4E0H A;  1BR2 A;  2NSG A;  4IB4 A;  4QI0 A;  3U9M A;  3ZQY A;  2OJE D;  1E85 A;  5A6A A;  4G7H F;  4X0R A;  4JKV A;  3NMI A;  4U5E E;  3US6 A;  1DOV A;  4Q7C A;  3NRH A;  3FDQ A;  2HSQ A;  4IAQ A;  1QPU A;  3AGU A;  1V55 C;  3IEE A;  4G0H A;  4NC3 A;  2BE5 F;  1A41 A;  2DI3 A;  4E7S A;  3UGO A;  2P0N A;  3TOM A;  3CZ6 A;  3FOO A;  4AL0 A;  1OXB A;  1MNE A;  1HE9 A;  2VC9 A;  2EIM C;  4MVZ A;  4FES A;  2KYH A;  4U5F E;  4OIN F;  4CDY A;  2AWC A;  4RDA A;  5KYW B;  2A68 F;  5IY5 C;  1H9T A;  3EGX A;  4BJ6 C;  4U9E A;  3WAQ A;  4MW8 A;  3R2P A;  2R7X A;  3HKK A;  4F4B A;  2V3C C;  4U5B E;  4AK9 A;  1H7I A;  1JAF A;  2FAP B;  4FX5 A;  4J7T A;  2EPK X;  2LP4 A;  2DYR C;  1NLX A;  4KC9 A;  3KYI A;  1Z5Z A;  2Q00 A;  3MBG A;  4NTA A;  3U3F A;  3ECS A;  1NSG B;  1VLS A;  5FZT A;  5DS6 A;  3NYM A;  4CJO A;  3K1H A;  1Q0M A;  2JPU A;  2PBE A;  3L1M A;  5A69 A;  5L0J A;  5L0H A;  5KYN A;  3FHD A;  3IHU A;  2B0J A;  3EFO B;  3LNR A;  5TJ5 E;  1LE2 A;  1HW1 A;  1ZW2 A;  4AL1 A;  5E2Q A;  2H7V C;  3NKD A;  3JRT A;  4EKW A;  5JRA A;  2XLO A;  1Q0D A;  4JJG A;  2IM8 A;  2YQY A;  2KJG A;  2R9R B;  3RVY A;  1A7E A;  1CGM E;  2DB4 A;  4QDL A;  4C7O B;  2PFD A;  2PX3 A;  3DXJ F;  4CIH A;  4EWC A;  3ZTM A;  5DS5 A;  3DJN B;  2XLW A;  2YZS A;  3G4X A;  4MND A;  3B0U X;  3GAN A;  1PCX A;  4NY3 A;  2A6E F;  2KNH A;  3MYI A;  3E9V A;  2A1D D;  3AJM A;  3PMR A;  4PR9 A;  2C04 A;  4U5C E;  1ORJ A;  1Y4C A;  1Z3I X;  2KK1 A;  2R25 A;  2YLD A;  5L0F A;  2R7W A;  1Z7Q c;  1OKK A;  3AQB A;  3UMH A;  4N06 A;  4D4X A;  3AQC A;  3JYH A;  3SXZ A;  1C17 M;  3T6J A;  2R7O A;  4A2N B;  4U5G A;  1RKC A;  2Q7R A;  4MQ9 F;  2Y3G A;  3GM3 A;  3M1C B;  1ZU4 A;  4XQ1 A;  2L9J A;  4AE4 B;  5L3V A;  3LNM B;  3EPV A;  4PJM A;  4PJN A;  3C18 A;  4MTG A;  1KU2 A;  2EIK C;  4OIR F;  4CS8 A;  3ATP A;  3H2U A;  2QE9 A;  2LCH A;  2QY9 A;  3GWN A;  1T6I A;  3EGD A;  2XSE A;  2L7A A;  4WGZ A;  1LVK A;  5EK0 A;  1IW7 F;  1OQC A;  2MWQ A;  3B71 A;  3T6G B;  1HMO A;  4MVS A;  4G7Z F;  4GEH A;  1GM5 A;  2CNW D;  2ASR A;  3EQL F;  2P7V A;  4IGG A;  5D91 A;  3DAG A;  4M63 A;  4YL3 A;  2DGJ A;  3GEE A;  4YWQ A;  4C3B A;  1ZHY A;  2PP4 A;  4JCH A;  2HUJ A;  1LS1 A;  1G4W R;  2KC3 A;  3EGX B;  4L6R A;  1S05 A;  2M64 A;  2YLI A;  1QLE C;  1FFT C;  1VMA A;  2H8A A;  1S7Z A;  1PD0 A;  3EZI A;  2EIL C;  2P6V A;  2HJ3 A;  5CI9 A;  2Q9B A;  4OIP F;  1NU9 C;  3C63 A;  3KMI A;  3T4R A;  3ZG1 A;  5BUO A;  2CW0 F;  1M2O A;  4XWJ A;  3U8P A;  4JVS A;  4BJ5 C;  4DVZ A;  5B3S C;  3T9O A;  2OEX A;  2ZXW C;  3DAF A;  2IXO A;  2J45 A;  2Q9A A;  3C8G A;  1NG1 A;  1SR2 A;  3EJN A;  5B3I A;  4BJT A;  4JCZ A;  1RXQ A;  3DKA A;  3B0P A;  3CQZ A;  3S0X A;  3GM2 A;  2OJQ A;  3EHN A;  1D1B A;  1M2V B;  4EBJ A;  2CYD A;  2D5R B;  2IOQ A;  1V74 B;  4MTF A;  4JC7 A;  1I5N A;  2XS8 A;  2YL3 A;  1Z6A A;  3W2V A;  3WHN A;  1ZHX A;  2HMZ A;  3LEV A;  5CI8 A;  3AGT A;  4CS9 A;  2J7P D;  4CJG A;  3GOR A;  3ZC4 A;  1YA9 A;  4PFP A;  1ORS C;  4MVU A;  3LJB A;  1T6Q A;  4DJ9 A;  4WJ0 A;  2CCY A;  2WZL A;  4EIY A;  1O87 A;  3H2V A;  1V54 C;  2YEV A;  5BQH A;  1E2X A;  1FMV A;  1XZQ A;  2H7B A;  1BBH A;  1GS9 A;  5AGF A;  4IJJ A;  3T6B A;  3BRJ A;  4UDV A;  1WAS A;  3MYF A;  1BR4 A;  3FAJ A;  1MMA A;  1WOL A;  4Z9I A;  3KKB A;  3QZC A;  1T5O A;  4QI2 A;  1RKE A;  3UMI A;  2XL8 A;  1Z63 A;  3BEH A;  4DBQ A;  2R7U A;  2G3K A;  3JSZ A;  3V5Z A;  1Z23 A;  3B9Q A;  2X0C A;  1C03 A;  2AVK A;  1ZHT A;  2A69 F;  2KGO A;  3EHM A;  3KPH A;  1K04 A;  3NMJ A;  3TOL A;  4JW1 A;  1B68 A;  1WAT A;  2HMQ A;  2NSF A;  2W9Y A;  1HE1 A;  2WL8 A;  2R7V A;  4OD5 A;  2RSE B;  3U9J A;  4W8P A;  1NFO A;  5B1B C;  4RBN A;  2I15 A;  3O39 A;  2J9W A;  3PHF 2;  1O3U A;  1QVX A;  2YVK A;  2UUI A;  3W8H A;  2Y3D A;  3JYY A;  1JMW A;  3ABK C;  3FXH A;  2P61 A;  2VH3 A;  1WTY A;  4MW3 A;  4CDV A;  3CSK A;  2PX0 A;  3O10 A;  4ZLC A;  1VYK A;  2HS5 A;  4G78 A;  3QW1 A;  1QZX A;  2R05 A;  4BJ6 A;  3C8G B;  2AU5 A;  3HNK A;  4JJF A;  3RQE A;  1PD1 A;  3DI5 A;  4A4A A;  3JCU Q;  4O6Y A;  1YYJ A;  3JRM O;  1APC A;  1MMG A;  1RJ9 A;  4YL1 A;  3FOP A;  3IQT A;  2HKV A;  4ONS A;  1YZA A;  2O9X A;  2WVN A;  1MND A;  4U5H A;  3KL4 A;  1H9G A;  1ZW3 A;  1QSP A;  2HZ8 A;  3ABL C;  1GGQ A;  2J9B A;  2J8W A;  2NUT A;  3MLG A;  4HE8 D;  4YT2 A;  1WN0 A;  4NQF A;  4YT4 A;  4CBE A;  2IXM A;  2EIJ C;  2QNL A;  3M79 A;  3U0C A;  4XLP F;  4ZLD A;  1HY5 A;  3V5Y A;  2UUH A;  3HJC A;  2XL6 A;  1QKR A;  4KBL A;  1TR2 A;  3U2M A;  2LFF A;  5FCL A;  5F5F A;  1G8X A;  3FMS A;  1NFN A;  4BPM A;  3DMD A;  4DRI B;  3IQ5 A;  2IXP A;  1L3P A;  3G50 A;  3H65 A;  2NUP A;  3S27 A;  1WGW A;  4EUK B;  5L0D A;  2OKU A;  2R02 A;  3HLZ A;  2X51 A;  3S29 A;  3F46 A;  4JEA A;  4BJ1 A;  5KYX A;  1W2W A;  3I4U A;  4YJW A;  5E3A A;  3SXM A;  4I3M A;  3GM1 A;  3LUT B;  4EBB A;  2LD6 A;  2R7T A;  4EHP A;  2EPO A;  4H4K C;  4G7O F;  3S84 A;  1U6H A;  1MMN A;  4ULV A;  5L0I A;  1RKE B;  2OOC A;  2VCC A;  3ABM C;  2XLH A;  3LES A;  2LSE A;  3MX3 A;  1BR1 A;  1OXK A;  4O79 A;  5BQI A;  5A6B D;  3B0V C;  4CS7 A;  1YYX A;  3R7C A;  2C03 A;  3AG1 C;  2QTV A;  4HFF B;  1LI7 A;  2MYS A;  1D1A A;  1I4Y A;  1GQA A;  3KH2 A;  3C62 A;  4MVM A;  3NDB B;  3JSE O;  2DYS C;  4JZA A;  5JT4 A;  3TQO A;  4O7G A;  4YK5 A;  4I44 A;  5JVE A;  3DWW A;  2Y69 C;  4O6N A;  1NBB A;  4LDQ A;  1MQV A;  2XLD A;  1FR0 A;  2YKZ A;  3C8Z A;  4DXW A;  1LS4 A;  1YZC A;  3NMK A;  4R32 A;  2YHS A;  3K1I C;  1A7V A;  3ZIB A;  2VB6 A;  5E3C A;  2XLE A;  4Q4Z F;  2ICW G;  4W8K A;  4H54 A;  3VRC A;  1YLM A;  4CSA A;  1JRA A;  5CIV A;  5EGY A;  2R7S A;  2Y3B A;  2YL7 A;  1D0X A;  2A6H F;  2L81 A;  1G4U S;  3K7D A;  2WVO A;  1JR8 A;  3V7O A;  5DQZ A;  1ST6 A;  5A6J A;  4GYT A;  3N24 A;  4KNW A;  2EIN C;  3CAX A;  3K33 A;  3ZQV A;  2PNO A;  1OW8 A;  3DE8 A;  5COF A;  2KSF A;  4OIQ F;  1OW7 A;  4N6C A;  4ULW A;  1VB5 A;  4RD9 A;  1HMD A;  2EPN A;  2NUT B;  2WB7 A;  2OCC C;  1CPR A;  4E17 A;  3NYJ A;  4BJ5 A;  4LLC A;  2Q4F A;  1WWP A;  3JT1 A;  1F1M A;  2WZG A;  3GEH A;  1LI5 A;  3ASN C;  3M4C A;  1R4T A;  1SF8 A;  1CGN A;  1YAR O;  3VF0 A;  3SEO A;  1I4Z A;  2WVQ A;  1E84 A;  5EHH A;  3DE9 A;  3L34 A;  4PAC A;  5L3Q A;  3RYL A;  1CPQ A;  4I1M A;  1LKX A;  3DZA A;  4XTK A;  2YL0 A;  2NG1 A;  3TJ5 A;  2YRF A;  1KNY A;  3S90 A;  2TMV P;  1DOW A;  2NUP B;  3C8G D;  5KYW A;  3W8I A;  4JTA B;  4IWB A;  2GWW A;  2LK4 A;  4FWV A;  4NCQ A;  4XEV A;  1V4A A;  4Z9J A;  1M6T A;  4WAB A;  1EI7 A;  3HNI A;  4CDA A;  4K1O A;  4CX9 A;  2EPM X;  3ITF A;  5KYX B;  2R03 A;  2NPU A;  4XLN F;  1A7D A;  1TWC A;  2A0B A;  4MVR A;  3LAY A;  3ASO C;  3LLK A;  4LLE A;  2J7P A;  3AG3 C;  4U9D A;  5D92 A;  3SXK A;  3LS0 A;  1TWA A;  3A11 A;  3EH1 A;  1XZP A;  3NG1 A;  3UNG C;  4YT8 A;  3QVY A;  5DLJ A;  1YAU O;  1AEP A;  2ZPA A;  4XPY A;  4J30 B;  3PCV A;  3VYW A;  1VYI A;  2Z15 A;  1TFK B;  3W2W A;  2FFH A;  1U89 A;  2RD9 A;  3EGD B;  1Q0F A;  3M15 A;  4XPX A;  3ZTZ A;  1O5H A;  4DOZ A;  4ER9 A;  5KYY A;  1K40 A;  4DRH B;  3SNH A;  2F22 A;  2XM0 A;  2ZXP A;  4E7Z A;  2GFH A;  1ZHZ A;  1SZI A;  3Q6N A;  3ZDL A;  3QW0 A;  4C3E A;  4JUR I;  2J0W A;  3E70 C;  3EZH A;  1NZE A; 
#chains in the Genus database with same CATH homology
 1NLX A;  1L3P A;  2M64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...