1L3PA

Crystal structure of the functional domain of the major grass pollen allergen phl p 5b
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
IPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKETTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLLEN ALLERGEN Phl p 5b
publication title Structure of the functional domain of the major grass-pollen allergen Phlp 5b.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2002-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1l3pA00
1L3PA 1NLXA 2M64A
chains in the Genus database with same CATH superfamily
4JEAA 4PJNA 2A0BA 2D4UA 3FHDA 3PMRA 3QMKA 3U2LA 3L8JA 3POVA 3PCVA 4JJFA 1FMVA 1TR2A 3OWTA 3JYYA 4G7HF 2WZFA 4O6MA 1FFTC 2X0CA 3RQFA 4RBNA 2NSGA 1RKEA 4MTFA 4U9EA 3S29A 1J8MF 1LPEA 2HZ8A 4IRUA 4PJLA 3NDBB 2XLDA 5D92A 2EPMX 2LCHA 3GEIA 1BZ4A 4N4WA 3R7CA 4P9TA 4A2NB 4Q5SF 1YZAA 5EK0A 2HMQA 1MMNA 1VYIA 3Q7GA 3U3BA 3LEOA 4N06A 2R7VA 1NG1A 2EIKC 2IXNA 2YHSA 3NYJA 4WGYA 5KYWB 5F5FA 2C04A 2YLGA 4U5GA 3PHF2 2XSEA 3T4RA 3E9VA 2HUJA 1Q0GA 1YZCA 2A69F 2KYHA 2ZXPA 2WVOA 3ZVRA 3A9CA 3DAGA 4O79A 3TK0A 4YT2A 4N6HA 2IXOA 3NYLA 3ZTMA 1OW7A 4PJMA 3S84A 1T9KA 2P1AA 3B0UX 1H9TA 5B1BC 1PCXA 4WJ0A 2FFHA 1BR1A 2EIMC 1RCPA 4U5HA 3RVZA 3EH1A 4EBKA 3MFNA 4LLCA 3VYWA 1H9GA 1OKKA 1YARO 4IWBA 1A41A 4NTBA 3S27A 4PR9A 1VLTA 2R25A 2CGEA 1TWHA 2KK1A 2PX3A 3HNLA 3VM6A 1OQCA 2QTVA 3ABLC 4PK4A 4IAOA 3TULA 3UGOA 1S05A 1NZEA 1CGOA 1OR2A 5KYXA 5TJ5E 3AOUA 4O7GA 1OCZC 2R03A 1Q0FA 2J0XA 1G4US 3ZSUA 5JUAA 2AWYA 2YWAA 3E70C 5BQHA 1YYJA 5KYXB 3HNJA 4YK5A 1Z3IX 2DB4A 1LM3B 1ZU5A 3GODA 3F46A 3AG4C 2R7TA 3AG3C 3AGUA 4K0DA 3C63A 3FOPA 2L81A 1FR0A 2GFHA 3SNHA 3EG9A 1BR4A 2HKVA 2OOCA 2XLHA 4JE9A 2JPUA 4XEFA 3B0PA 4DBQA 3KPHA 2QY9A 3JZ0A 3K7DA 3HJCA 1AEPA 4IARA 4MVSA 2Y3GA 4FX5A 2AWCA 3EGXB 3L1MA 3B0VC 3RQEA 2BE5F 2KQ9A 3FOOA 3GM1A 4MVQA 3RW0A 3DXJF 4CDAA 1YLMA 2M4EA 3BRJA 5GPGB 4EBJA 4JJGA 3ZDLA 3GORA 2MHRA 4JVSA 4F4BA 2BL2A 2AU5A 2OKUA 3UMHA 1G5ZA 1FMWA 2GAQA 5JRAA 4NTAA 2EINC 3U8PA 4HEAJ 2CCYA 1G4WR 4KI2A 2YLIA 3NKEA 1J8YF 4CS8C 2OJED 4JZAA 1ORYA 1XWJA 4LLEA 4LERA 5KYYB 4G7OF 2R7XA 5BQGA 4EIYA 3JTLO 1FAPB 4UDVA 1TWCA 3Q6NA 1A7EA 2LD6A 3FAJA 3RF3A 1QVXA 5L0FA 1YAUO 3FXHA 5DVWA 3X2QC 1JOGA 1OCRC 5JSLA 2V26A 3DM5A 2HJMA 3QZCA 5A6AA 1OKKD 3HNKA 3NYMA 1GGQA 2YL7A 5JP7A 1QZXA 1WASA 5A6KA 1BBHA 4JKVA 4CIHA 4EBBA 2CDQA 2WL8A 4KBLA 1UG7A 3EHNA 1V54C 4J30B 5AGFA 3Q6MA 4H4KC 3ASNC 1FNTc 4QI2A 4PFPA 4PACA 3QVYA 1ST6A 4XEKA 1PV3A 4G0HA 5FCLA 1VOMA 5COGA 2J46A 2Q9AA 2IYLD 2YQYA 1APCA 4DVZA 2V3CC 1E84A 3SZRA 2KJGA 1WOLA 1LS1A 2R9RB 2X51A 3UGPA 1NFOA 4J32B 4KC9A 1HE9A 4A4AA 5DQTA 3HNIA 2XRHA 4YWQA 4OIPF 3WG7C 1U0BB 2R05A 3BEHA 4I44A 3SYNA 3GEEA 4HFFB 2VB6A 4E17A 1WGWA 4K7BA 3TJ5A 3HTKC 1Z5ZA 3LUTB 5JLIA 3DE8A 2NPUA 1R5ID 1Q0MA 5BQIA 3DE9A 1ZHWA 3LS1A 1YA9A 5F28E 4OD4A 4BEMJ 1C17M 1NBBA 1VB5A 3DWWA 2J9BA 2ZXWC 1RKCA 3DMDA 3K1IA 1FFHA 4MS2A 1TWAA 2Q7RA 1K05A 3UNGC 3ZQVA 3V5ZA 1LI5A 2FGYA 3NKDA 2OEVA 3IQ5A 2KW3C 3K33A 5E2QA 5KYWA 2IM8A 3RFYA 3MYIA 3OEOA 4NCQA 4MVUA 4OD5A 5L0DA 5KYUB 2WZGA 4QDLA 1BR2A 1RMVA 1E86A 2XLVA 1JR8A 3CQZA 4E0HA 5E3CA 2JD3A 2OQMA 3RH3A 1MQVA 3ZTZA 4LDKA 3EZHA 1D1AA 1DOVA 2Y69C 3LAYA 1E2XA 2W45A 3JYHA 2A6HF 3LLKA 3O55A 2ZD9A 4ULVA 3T6BA 4C3DA 4MW8A 3LS0A 1SF8A 1ZW2A 1T5OA 3W4YA 3FAPB 4C3BA 1MMGA 3KYJA 256BA 1OR3A 1V55C 5E3AA 1ZHXA 4Z9IA 1VTMP 2G3VA 3SXMA 3QW0A 3AGTA 3NG1A 4BJ1A 1H7IA 4R32A 1V74B 2H7BA 4E0IA 2I15A 3EFOB 4DRHB 3DD7A 3ECSA 2R7OA 1KTMA 4YL3A 1OW6A 1MMAA 2EPOA 2DYSC 1A0BA 2D5RB 5A6BA 3N24A 2XXAA 1AVOB 4IGGA 4U9DA 4DRJB 1PD1A 2Y3HA 4BJ5C 2Q00A 2YL3A 4BJ6C 4C3EA 2Q3TA 4HE8D 4JURI 1QPUA 3WHNA 5L0CA 2XXAB 5EHHA 2PF4E 1SMYF 1XZQA 2UUHA 5COFA 1LVKA 1YYXA 2A1DD 1OXBA 3K66A 3ABMC 3C8ZA 2VASA 2YKZA 3LJBA 4JRZA 4JTDB 2JX0A 2R02A 5F5HA 2NUTB 2ZXRA 4AL0A 2YZSA 5L0IA 5DQZA 5DS6A 2R7RA 3FVYA 1QKRA 3UR3C 4CSAC 1VMAA 5E33A 4YJWA 1RJ9A 1KNYA 1T01A 2W9YA 4IJJA 1QSPA 2ZPAA 5EGYA 2L7AA 5CI9A 3C18A 3JRMO 2FAPB 3EGXA 4ULWA 1Z23A 1FTSA 1RJ9B 4LACB 2YL0A 2EPLX 3DI5A 2E87A 3ZQYA 3L0IA 1HW2A 4RDAA 3W8IA 2C03A 4OIQF 3TOLA 3EZIA 2MWQA 2XM4A 5CIVA 3DAFA 1GM5A 1MMDA 2ASRA 2NG1A 2B0JA 3SEOA 3VRCA 4EKWA 3S28A 1HW1A 3U9JA 2EIJC 1O5HA 4GEHA 4OINF 4JCZA 2ICWG 4XEVA 4FAPB 3W2VA 2DYRC 5KYYA 4CS9C 1D0XA 4WGZA 1Z6AA 2I8BA 3C8GB 2IXPA 4HFKB 4OIOF 3N0TA 4J7YA 2XS1A 4P6IC 4ANJA 3MYFA 5T1DB 4DBRA 4EWCA 2XL4A 2HJ3A 4RD9A 1M57C 5L0GA 1M2VB 3MX3A 4BG0A 5AC5A 3IPMO 2XLOA 2VCBA 3ZG1A 4C7OB 1TFKB 1WN0A 1ORSC 3CEXA 1ZZPA 2MYSA 4JTCB 3JSEO 4CJOA 5A6BD 4U5CE 5L0JA 1IZMA 4CJGA 4YT8A 3U0CA 1WWPA 2Z15A 4CS8A 4U5DE 1LS4A 1ZVZA 1VLSA 3QTHA 1AUEA 4J7TA 1K40A 5FZTA 2HFIA 1E83A 3ITFA 3H65A 2J45A 2HV7A 4NC3A 4Q4ZF 1ZHZA 4ONSA 1ZYRF 3GWNA 2HMZA 4JC7A 4XWJA 1JMWA 3EJNA 2P0NA 2J9WA 2XLWA 3IQCA 1HE1A 2LFFA 1DOWA 1T6IA 1SR2A 2J8WA 3GM3A 3VAYA 5IY5C 1C02A 4Z9JA 5T3WA 1LE2A 1MNDA 3IQ6A 4FWVA 4YT4A 3AQBA 1D0ZA 1MNEA 2OJQA 1RXQA 2DI3A 2QNLA 3JRTA 3OA1A 2G3KA 3LNRA 4MNDA 2OU6A 4NQFA 4W8KA 1T6QA 1NU9C 3TJ6A 4DRIB 3CZ6A 3M15A 2YLDA 2XLMA 1NFNA 5A69A 3TOMA 4YT5A 2AVKA 5B3SC 1Q0KA 2LFDA 4CBEA 1JPJA 2VH3A 3T6GB 2A0UA 4P9FA 3U3FA 2J7PD 3MLGA 3V5YA 2XL6A 1LIHA 3KL4A 4AE4A 3GWLA 4DXWA 3I5QA 2CW0F 4K1OA 4IAQA 5JT4A 1TQGA 2LP4A 3JSZA 4LDQA 3O39A 3LLIA 4MQ9F 4AX2A 3C7JA 3F47A 4KNVA 5L3VA 4G7ZF 5KYUA 2Q4FA 3RKOF 1R4TA 4G78A 4MVMA 3ZIBA 3EH2A 1HMOA 4CDVA 2ETSA 4U5FE 3C62A 2B0HA 1HMDA 2HSQA 4JTAB 3EGDB 4NY3A 1F1MA 2OG2A 2XLEA 2TMVP 1IW7F 3AG2C 2J0WA 4JCHA 1E85A 3PDMP 1CGNA 1CPRA 1SZIA 2WB7A 2WVNA 4I1OB 3S0XA 3AG1C 2QE9A 3G50A 4MTOA 2NSFA 2UUIA 1BDJB 2Q9CA 4OIRF 3T6JA 1Q0DA 1I4YA 3T9OA 5BUOA 3RVYA 5KYNA 2PBEA 3EFOA 4IB4A 4XPWA 3EHMA 5T3TA 3IQTA 3ZC4A 3HKKA 1RKEB 4EUKB 3TD7A 2L6GA 3GEHA 1WTYA 2LK4A 3M4BA 4XLNF 3FDQA 2YL1A 3B71A 3EQLF 4YN0B 5K0IA 1CGME 4JIOA 4YL1A 3WODF 2CYDA 2XL8A 1H6GA 1YVIA 1M2OA 2PP4A 2A6EF 1C03A 3JCUQ 4MVRA 4MVZA 4PFOA 4KNWA 3MBGA 2Y3DA 4W8PA 3W8HA 2AP3A 3NMJA 4Q7CA 3WAQA 3X1OA 4E7SA 2H7VC 1M6TA 2KGOA 3H2VA 2EPKX 5COMA 3R2PA 3QW1A 2NUTA 4O6NA 2GDCA 2P61A 2P7VA 2OCCC 3K1HA 3N2ZB 3VF0A 5DS4A 4FESA 2A68F 3DKAA 5A6JA 2PNOA 3I4UA 4I1MA 4BEJA 3DM9B 1EKYA 1QLEC 3AQCA 4AE4B 4B6IA 1CPQA 1YDIA 3IEEA 3US6A 4BJ5A 4BJ6A 3V5XA 3NRHA 1A7DA 4GQHA 1LE4A 1U89A 1Z7Qc 1ZHYA 3L34A 4D4NA 5HV9A 1V4AA 2WZLA 3DJUB 2CNWA 1D0YA 3S9OA 5JVEA 2QUPA 3KKBA 2L6FA 1WATA 1TWGA 4MVOA 2VC9A 3A11A 5AC4A 3GANA 1EQ1A 1LI7A 1YJGA 2LQGA 2Y3BA 2GA0A 3CAXA 4CSAA 5DS5A 2EPNA 3DZAA 1LKXA 2VCAA 2W4BA 2Y39A 2IXMA 4O6YA 1K04A 2M64A 3SP1A 4EHPA 4H54A 2IBFA 1EI7A 3C8GA 1QQ3A 4D4XA 2EILC 1OXKA 1VYKA 2L9JA 3U8VA 4CIPA 5L0HA 3I5PA 4CDYA 4QI0A 2R7QA 4XLPF 1VK5A 5B3IA 1D1BA 2J7PA 1Y6DA 1OCOC 3QVZA 3SXYA 4ER9A 1M2VA 3EG9B 3KYIA 4U5EE 1D1CA 1TFOB 1PD0A 3L8IA 3M1CB 4C7OA 3G4ZA 4XPXA 3LESA 1O87A 3LNMB 3O6XA 3HLZA 2KC3A 2YRFA 1O3UA 2Q9BA 1JPNA 1M56C 3CSKA 1I4ZA 5CI8A 3ZWIA 5DLJA 3U5SA 1UFBA 2HV6A 2J9VA 4Z9HA 3EPVA 1ORJA 2YVKA 4PJJA 3U9MA 4XQ1A 3W2WA 1NLXA 1Y4CA 4M63A 2YEVA 4CS9A 1W2WA 2DGJA 1T6UA 4ZLCA 3H2UA 3J06A 3ATPA 4DOZA 2R7WA 2QLAA 1I5NA 2KNHA 1ZHTA 5L3QA 1U6HA 4DJ9A 2BC5A 5B1AC 1ZU4A 3NMIA 3O10A 3RQGA 4DVYP 2VCCA 2PFDA 2RD9A 4CX9A 2KSFA 1JAFA 4NTFA 1L3PA 1S7ZA 2G62A 3DJNB 3M4CA 3NMKA 4JEBA 1A7VA 4AL1A 5D91A 3UMKA 4WABA 5JS5A 2R7SA 4X0RA 1ZW3A 1Z63A 4JW1A 1B68A 4I3MA 2OEXA 1OW8A 3U2MA 3LEVA 5HSWA 4GYTA 1HY5A 3SXKA 2GWWA 1NSGB 2LIGA 2F22A 4L6RA 2H8AA 3KMIA 2ZXOA 1GS9A 4LDRA 4MW3A 3M79A 4YL0A 3SXZA 3TQOA 4AK9A 4ZLDA 3KH2A 3RIPA 2IOQA 2WVQA 3RYLA 2NUPA 2CNWD 4MTGA 1NU7D 2P6VA 3AJMA 3G4XA 1EA8A 4XPYA 1SYQA 2NUPB 2RSEB 1GQAA 1KU2A 3K6BA 3Q7LA 1XZPA 4BJTA 2XM0A 2L6HA 1L7CA 2PX0A 4XTKA 4E18A 2R7UA 2HS5A 3ABKC 3IHUA 2W4MA 3UMIA 4CS7A 1N1CA 4N6CA 2O9XA 2LSEA 3JT1A 3V7OA 3S90A 2HSBA 2J9UA 3C8GD 4BPMA 3B9QA 3K1IC 1YA7O 3EGDA 2XS8A 4U5BE 1OCCC 3B29A 4E7ZA 3FMSA 1G8XA 3ASOC 3GM2A 1TKNA 1JRAA 2H7OA
chains in the Genus database with same CATH topology
1L3PA 1NLXA 2M64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3P A;  1NLX A;  2M64 A; 
#chains in the Genus database with same CATH topology
 4JEA A;  4PJN A;  2A0B A;  2D4U A;  3FHD A;  3PMR A;  3QMK A;  3U2L A;  3L8J A;  3POV A;  3PCV A;  4JJF A;  1FMV A;  1TR2 A;  3OWT A;  3JYY A;  4G7H F;  2WZF A;  4O6M A;  1FFT C;  2X0C A;  3RQF A;  4RBN A;  2NSG A;  1RKE A;  4MTF A;  4U9E A;  3S29 A;  1J8M F;  1LPE A;  2HZ8 A;  4IRU A;  4PJL A;  3NDB B;  2XLD A;  5D92 A;  2EPM X;  2LCH A;  3GEI A;  1BZ4 A;  4N4W A;  3R7C A;  4P9T A;  4A2N B;  4Q5S F;  1YZA A;  5EK0 A;  2HMQ A;  1MMN A;  1VYI A;  3Q7G A;  3U3B A;  3LEO A;  4N06 A;  2R7V A;  1NG1 A;  2EIK C;  2IXN A;  2YHS A;  3NYJ A;  4WGY A;  5KYW B;  5F5F A;  2C04 A;  2YLG A;  4U5G A;  3PHF 2;  2XSE A;  3T4R A;  3E9V A;  2HUJ A;  1Q0G A;  1YZC A;  2A69 F;  2KYH A;  2ZXP A;  2WVO A;  3ZVR A;  3A9C A;  3DAG A;  4O79 A;  3TK0 A;  4YT2 A;  4N6H A;  2IXO A;  3NYL A;  3ZTM A;  1OW7 A;  4PJM A;  3S84 A;  1T9K A;  2P1A A;  3B0U X;  1H9T A;  5B1B C;  1PCX A;  4WJ0 A;  2FFH A;  1BR1 A;  2EIM C;  1RCP A;  4U5H A;  3RVZ A;  3EH1 A;  4EBK A;  3MFN A;  4LLC A;  3VYW A;  1H9G A;  1OKK A;  1YAR O;  4IWB A;  1A41 A;  4NTB A;  3S27 A;  4PR9 A;  1VLT A;  2R25 A;  2CGE A;  1TWH A;  2KK1 A;  2PX3 A;  3HNL A;  3VM6 A;  1OQC A;  2QTV A;  3ABL C;  4PK4 A;  4IAO A;  3TUL A;  3UGO A;  1S05 A;  1NZE A;  1CGO A;  1OR2 A;  5KYX A;  5TJ5 E;  3AOU A;  4O7G A;  1OCZ C;  2R03 A;  1Q0F A;  2J0X A;  1G4U S;  3ZSU A;  5JUA A;  2AWY A;  2YWA A;  3E70 C;  5BQH A;  1YYJ A;  5KYX B;  3HNJ A;  4YK5 A;  1Z3I X;  2DB4 A;  1LM3 B;  1ZU5 A;  3GOD A;  3F46 A;  3AG4 C;  2R7T A;  3AG3 C;  3AGU A;  4K0D A;  3C63 A;  3FOP A;  2L81 A;  1FR0 A;  2GFH A;  3SNH A;  3EG9 A;  1BR4 A;  2HKV A;  2OOC A;  2XLH A;  4JE9 A;  2JPU A;  4XEF A;  3B0P A;  4DBQ A;  3KPH A;  2QY9 A;  3JZ0 A;  3K7D A;  3HJC A;  1AEP A;  4IAR A;  4MVS A;  2Y3G A;  4FX5 A;  2AWC A;  3EGX B;  3L1M A;  3B0V C;  3RQE A;  2BE5 F;  2KQ9 A;  3FOO A;  3GM1 A;  4MVQ A;  3RW0 A;  3DXJ F;  4CDA A;  1YLM A;  2M4E A;  3BRJ A;  5GPG B;  4EBJ A;  4JJG A;  3ZDL A;  3GOR A;  2MHR A;  4JVS A;  4F4B A;  2BL2 A;  2AU5 A;  2OKU A;  3UMH A;  1G5Z A;  1FMW A;  2GAQ A;  5JRA A;  4NTA A;  2EIN C;  3U8P A;  4HEA J;  2CCY A;  1G4W R;  4KI2 A;  2YLI A;  3NKE A;  1J8Y F;  4CS8 C;  2OJE D;  4JZA A;  1ORY A;  1XWJ A;  4LLE A;  4LER A;  5KYY B;  4G7O F;  2R7X A;  5BQG A;  4EIY A;  3JTL O;  1FAP B;  4UDV A;  1TWC A;  3Q6N A;  1A7E A;  2LD6 A;  3FAJ A;  3RF3 A;  1QVX A;  5L0F A;  1YAU O;  3FXH A;  5DVW A;  3X2Q C;  1JOG A;  1OCR C;  5JSL A;  2V26 A;  3DM5 A;  2HJM A;  3QZC A;  5A6A A;  1OKK D;  3HNK A;  3NYM A;  1GGQ A;  2YL7 A;  5JP7 A;  1QZX A;  1WAS A;  5A6K A;  1BBH A;  4JKV A;  4CIH A;  4EBB A;  2CDQ A;  2WL8 A;  4KBL A;  1UG7 A;  3EHN A;  1V54 C;  4J30 B;  5AGF A;  3Q6M A;  4H4K C;  3ASN C;  1FNT c;  4QI2 A;  4PFP A;  4PAC A;  3QVY A;  1ST6 A;  4XEK A;  1PV3 A;  4G0H A;  5FCL A;  1VOM A;  5COG A;  2J46 A;  2Q9A A;  2IYL D;  2YQY A;  1APC A;  4DVZ A;  2V3C C;  1E84 A;  3SZR A;  2KJG A;  1WOL A;  1LS1 A;  2R9R B;  2X51 A;  3UGP A;  1NFO A;  4J32 B;  4KC9 A;  1HE9 A;  4A4A A;  5DQT A;  3HNI A;  2XRH A;  4YWQ A;  4OIP F;  3WG7 C;  1U0B B;  2R05 A;  3BEH A;  4I44 A;  3SYN A;  3GEE A;  4HFF B;  2VB6 A;  4E17 A;  1WGW A;  4K7B A;  3TJ5 A;  3HTK C;  1Z5Z A;  3LUT B;  5JLI A;  3DE8 A;  2NPU A;  1R5I D;  1Q0M A;  5BQI A;  3DE9 A;  1ZHW A;  3LS1 A;  1YA9 A;  5F28 E;  4OD4 A;  4BEM J;  1C17 M;  1NBB A;  1VB5 A;  3DWW A;  2J9B A;  2ZXW C;  1RKC A;  3DMD A;  3K1I A;  1FFH A;  4MS2 A;  1TWA A;  2Q7R A;  1K05 A;  3UNG C;  3ZQV A;  3V5Z A;  1LI5 A;  2FGY A;  3NKD A;  2OEV A;  3IQ5 A;  2KW3 C;  3K33 A;  5E2Q A;  5KYW A;  2IM8 A;  3RFY A;  3MYI A;  3OEO A;  4NCQ A;  4MVU A;  4OD5 A;  5L0D A;  5KYU B;  2WZG A;  4QDL A;  1BR2 A;  1RMV A;  1E86 A;  2XLV A;  1JR8 A;  3CQZ A;  4E0H A;  5E3C A;  2JD3 A;  2OQM A;  3RH3 A;  1MQV A;  3ZTZ A;  4LDK A;  3EZH A;  1D1A A;  1DOV A;  2Y69 C;  3LAY A;  1E2X A;  2W45 A;  3JYH A;  2A6H F;  3LLK A;  3O55 A;  2ZD9 A;  4ULV A;  3T6B A;  4C3D A;  4MW8 A;  3LS0 A;  1SF8 A;  1ZW2 A;  1T5O A;  3W4Y A;  3FAP B;  4C3B A;  1MMG A;  3KYJ A;  256B A;  1OR3 A;  1V55 C;  5E3A A;  1ZHX A;  4Z9I A;  1VTM P;  2G3V A;  3SXM A;  3QW0 A;  3AGT A;  3NG1 A;  4BJ1 A;  1H7I A;  4R32 A;  1V74 B;  2H7B A;  4E0I A;  2I15 A;  3EFO B;  4DRH B;  3DD7 A;  3ECS A;  2R7O A;  1KTM A;  4YL3 A;  1OW6 A;  1MMA A;  2EPO A;  2DYS C;  1A0B A;  2D5R B;  5A6B A;  3N24 A;  2XXA A;  1AVO B;  4IGG A;  4U9D A;  4DRJ B;  1PD1 A;  2Y3H A;  4BJ5 C;  2Q00 A;  2YL3 A;  4BJ6 C;  4C3E A;  2Q3T A;  4HE8 D;  4JUR I;  1QPU A;  3WHN A;  5L0C A;  2XXA B;  5EHH A;  2PF4 E;  1SMY F;  1XZQ A;  2UUH A;  5COF A;  1LVK A;  1YYX A;  2A1D D;  1OXB A;  3K66 A;  3ABM C;  3C8Z A;  2VAS A;  2YKZ A;  3LJB A;  4JRZ A;  4JTD B;  2JX0 A;  2R02 A;  5F5H A;  2NUT B;  2ZXR A;  4AL0 A;  2YZS A;  5L0I A;  5DQZ A;  5DS6 A;  2R7R A;  3FVY A;  1QKR A;  3UR3 C;  4CSA C;  1VMA A;  5E33 A;  4YJW A;  1RJ9 A;  1KNY A;  1T01 A;  2W9Y A;  4IJJ A;  1QSP A;  2ZPA A;  5EGY A;  2L7A A;  5CI9 A;  3C18 A;  3JRM O;  2FAP B;  3EGX A;  4ULW A;  1Z23 A;  1FTS A;  1RJ9 B;  4LAC B;  2YL0 A;  2EPL X;  3DI5 A;  2E87 A;  3ZQY A;  3L0I A;  1HW2 A;  4RDA A;  3W8I A;  2C03 A;  4OIQ F;  3TOL A;  3EZI A;  2MWQ A;  2XM4 A;  5CIV A;  3DAF A;  1GM5 A;  1MMD A;  2ASR A;  2NG1 A;  2B0J A;  3SEO A;  3VRC A;  4EKW A;  3S28 A;  1HW1 A;  3U9J A;  2EIJ C;  1O5H A;  4GEH A;  4OIN F;  4JCZ A;  2ICW G;  4XEV A;  4FAP B;  3W2V A;  2DYR C;  5KYY A;  4CS9 C;  1D0X A;  4WGZ A;  1Z6A A;  2I8B A;  3C8G B;  2IXP A;  4HFK B;  4OIO F;  3N0T A;  4J7Y A;  2XS1 A;  4P6I C;  4ANJ A;  3MYF A;  5T1D B;  4DBR A;  4EWC A;  2XL4 A;  2HJ3 A;  4RD9 A;  1M57 C;  5L0G A;  1M2V B;  3MX3 A;  4BG0 A;  5AC5 A;  3IPM O;  2XLO A;  2VCB A;  3ZG1 A;  4C7O B;  1TFK B;  1WN0 A;  1ORS C;  3CEX A;  1ZZP A;  2MYS A;  4JTC B;  3JSE O;  4CJO A;  5A6B D;  4U5C E;  5L0J A;  1IZM A;  4CJG A;  4YT8 A;  3U0C A;  1WWP A;  2Z15 A;  4CS8 A;  4U5D E;  1LS4 A;  1ZVZ A;  1VLS A;  3QTH A;  1AUE A;  4J7T A;  1K40 A;  5FZT A;  2HFI A;  1E83 A;  3ITF A;  3H65 A;  2J45 A;  2HV7 A;  4NC3 A;  4Q4Z F;  1ZHZ A;  4ONS A;  1ZYR F;  3GWN A;  2HMZ A;  4JC7 A;  4XWJ A;  1JMW A;  3EJN A;  2P0N A;  2J9W A;  2XLW A;  3IQC A;  1HE1 A;  2LFF A;  1DOW A;  1T6I A;  1SR2 A;  2J8W A;  3GM3 A;  3VAY A;  5IY5 C;  1C02 A;  4Z9J A;  5T3W A;  1LE2 A;  1MND A;  3IQ6 A;  4FWV A;  4YT4 A;  3AQB A;  1D0Z A;  1MNE A;  2OJQ A;  1RXQ A;  2DI3 A;  2QNL A;  3JRT A;  3OA1 A;  2G3K A;  3LNR A;  4MND A;  2OU6 A;  4NQF A;  4W8K A;  1T6Q A;  1NU9 C;  3TJ6 A;  4DRI B;  3CZ6 A;  3M15 A;  2YLD A;  2XLM A;  1NFN A;  5A69 A;  3TOM A;  4YT5 A;  2AVK A;  5B3S C;  1Q0K A;  2LFD A;  4CBE A;  1JPJ A;  2VH3 A;  3T6G B;  2A0U A;  4P9F A;  3U3F A;  2J7P D;  3MLG A;  3V5Y A;  2XL6 A;  1LIH A;  3KL4 A;  4AE4 A;  3GWL A;  4DXW A;  3I5Q A;  2CW0 F;  4K1O A;  4IAQ A;  5JT4 A;  1TQG A;  2LP4 A;  3JSZ A;  4LDQ A;  3O39 A;  3LLI A;  4MQ9 F;  4AX2 A;  3C7J A;  3F47 A;  4KNV A;  5L3V A;  4G7Z F;  5KYU A;  2Q4F A;  3RKO F;  1R4T A;  4G78 A;  4MVM A;  3ZIB A;  3EH2 A;  1HMO A;  4CDV A;  2ETS A;  4U5F E;  3C62 A;  2B0H A;  1HMD A;  2HSQ A;  4JTA B;  3EGD B;  4NY3 A;  1F1M A;  2OG2 A;  2XLE A;  2TMV P;  1IW7 F;  3AG2 C;  2J0W A;  4JCH A;  1E85 A;  3PDM P;  1CGN A;  1CPR A;  1SZI A;  2WB7 A;  2WVN A;  4I1O B;  3S0X A;  3AG1 C;  2QE9 A;  3G50 A;  4MTO A;  2NSF A;  2UUI A;  1BDJ B;  2Q9C A;  4OIR F;  3T6J A;  1Q0D A;  1I4Y A;  3T9O A;  5BUO A;  3RVY A;  5KYN A;  2PBE A;  3EFO A;  4IB4 A;  4XPW A;  3EHM A;  5T3T A;  3IQT A;  3ZC4 A;  3HKK A;  1RKE B;  4EUK B;  3TD7 A;  2L6G A;  3GEH A;  1WTY A;  2LK4 A;  3M4B A;  4XLN F;  3FDQ A;  2YL1 A;  3B71 A;  3EQL F;  4YN0 B;  5K0I A;  1CGM E;  4JIO A;  4YL1 A;  3WOD F;  2CYD A;  2XL8 A;  1H6G A;  1YVI A;  1M2O A;  2PP4 A;  2A6E F;  1C03 A;  3JCU Q;  4MVR A;  4MVZ A;  4PFO A;  4KNW A;  3MBG A;  2Y3D A;  4W8P A;  3W8H A;  2AP3 A;  3NMJ A;  4Q7C A;  3WAQ A;  3X1O A;  4E7S A;  2H7V C;  1M6T A;  2KGO A;  3H2V A;  2EPK X;  5COM A;  3R2P A;  3QW1 A;  2NUT A;  4O6N A;  2GDC A;  2P61 A;  2P7V A;  2OCC C;  3K1H A;  3N2Z B;  3VF0 A;  5DS4 A;  4FES A;  2A68 F;  3DKA A;  5A6J A;  2PNO A;  3I4U A;  4I1M A;  4BEJ A;  3DM9 B;  1EKY A;  1QLE C;  3AQC A;  4AE4 B;  4B6I A;  1CPQ A;  1YDI A;  3IEE A;  3US6 A;  4BJ5 A;  4BJ6 A;  3V5X A;  3NRH A;  1A7D A;  4GQH A;  1LE4 A;  1U89 A;  1Z7Q c;  1ZHY A;  3L34 A;  4D4N A;  5HV9 A;  1V4A A;  2WZL A;  3DJU B;  2CNW A;  1D0Y A;  3S9O A;  5JVE A;  2QUP A;  3KKB A;  2L6F A;  1WAT A;  1TWG A;  4MVO A;  2VC9 A;  3A11 A;  5AC4 A;  3GAN A;  1EQ1 A;  1LI7 A;  1YJG A;  2LQG A;  2Y3B A;  2GA0 A;  3CAX A;  4CSA A;  5DS5 A;  2EPN A;  3DZA A;  1LKX A;  2VCA A;  2W4B A;  2Y39 A;  2IXM A;  4O6Y A;  1K04 A;  2M64 A;  3SP1 A;  4EHP A;  4H54 A;  2IBF A;  1EI7 A;  3C8G A;  1QQ3 A;  4D4X A;  2EIL C;  1OXK A;  1VYK A;  2L9J A;  3U8V A;  4CIP A;  5L0H A;  3I5P A;  4CDY A;  4QI0 A;  2R7Q A;  4XLP F;  1VK5 A;  5B3I A;  1D1B A;  2J7P A;  1Y6D A;  1OCO C;  3QVZ A;  3SXY A;  4ER9 A;  1M2V A;  3EG9 B;  3KYI A;  4U5E E;  1D1C A;  1TFO B;  1PD0 A;  3L8I A;  3M1C B;  4C7O A;  3G4Z A;  4XPX A;  3LES A;  1O87 A;  3LNM B;  3O6X A;  3HLZ A;  2KC3 A;  2YRF A;  1O3U A;  2Q9B A;  1JPN A;  1M56 C;  3CSK A;  1I4Z A;  5CI8 A;  3ZWI A;  5DLJ A;  3U5S A;  1UFB A;  2HV6 A;  2J9V A;  4Z9H A;  3EPV A;  1ORJ A;  2YVK A;  4PJJ A;  3U9M A;  4XQ1 A;  3W2W A;  1NLX A;  1Y4C A;  4M63 A;  2YEV A;  4CS9 A;  1W2W A;  2DGJ A;  1T6U A;  4ZLC A;  3H2U A;  3J06 A;  3ATP A;  4DOZ A;  2R7W A;  2QLA A;  1I5N A;  2KNH A;  1ZHT A;  5L3Q A;  1U6H A;  4DJ9 A;  2BC5 A;  5B1A C;  1ZU4 A;  3NMI A;  3O10 A;  3RQG A;  4DVY P;  2VCC A;  2PFD A;  2RD9 A;  4CX9 A;  2KSF A;  1JAF A;  4NTF A;  1L3P A;  1S7Z A;  2G62 A;  3DJN B;  3M4C A;  3NMK A;  4JEB A;  1A7V A;  4AL1 A;  5D91 A;  3UMK A;  4WAB A;  5JS5 A;  2R7S A;  4X0R A;  1ZW3 A;  1Z63 A;  4JW1 A;  1B68 A;  4I3M A;  2OEX A;  1OW8 A;  3U2M A;  3LEV A;  5HSW A;  4GYT A;  1HY5 A;  3SXK A;  2GWW A;  1NSG B;  2LIG A;  2F22 A;  4L6R A;  2H8A A;  3KMI A;  2ZXO A;  1GS9 A;  4LDR A;  4MW3 A;  3M79 A;  4YL0 A;  3SXZ A;  3TQO A;  4AK9 A;  4ZLD A;  3KH2 A;  3RIP A;  2IOQ A;  2WVQ A;  3RYL A;  2NUP A;  2CNW D;  4MTG A;  1NU7 D;  2P6V A;  3AJM A;  3G4X A;  1EA8 A;  4XPY A;  1SYQ A;  2NUP B;  2RSE B;  1GQA A;  1KU2 A;  3K6B A;  3Q7L A;  1XZP A;  4BJT A;  2XM0 A;  2L6H A;  1L7C A;  2PX0 A;  4XTK A;  4E18 A;  2R7U A;  2HS5 A;  3ABK C;  3IHU A;  2W4M A;  3UMI A;  4CS7 A;  1N1C A;  4N6C A;  2O9X A;  2LSE A;  3JT1 A;  3V7O A;  3S90 A;  2HSB A;  2J9U A;  3C8G D;  4BPM A;  3B9Q A;  3K1I C;  1YA7 O;  3EGD A;  2XS8 A;  4U5B E;  1OCC C;  3B29 A;  4E7Z A;  3FMS A;  1G8X A;  3ASO C;  3GM2 A;  1TKN A;  1JRA A;  2H7O A; 
#chains in the Genus database with same CATH homology
 1L3P A;  1NLX A;  2M64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...