4AE4A

The ubap1 subunit of escrt-i interacts with ubiquitin via a novel souba domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
SHMSPSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords UBIQUITIN-ASSOCIATED PROTEIN 1
publication title The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ae4A00
4AE4A 4AE4B
chains in the Genus database with same CATH superfamily
1WN0A 2OJQA 2BE5F 5K0IA 3I4UA 2Q9CA 4OD5A 1RKCA 2XLDA 3EG9A 4IRUA 2NSFA 1AEPA 3GEHA 3TJ5A 4DRIB 1YVIA 1UG7A 3NMIA 2DYRC 3K33A 3C8GD 3E70C 4KNVA 5L0HA 4Q5SF 2OJED 3M4BA 3QW1A 2D4UA 4DRHB 4AE4B 3W2WA 2HKVA 2ZXWC 4JZAA 4AL1A 1LE4A 2WVOA 2HJ3A 2J9UA 4HFKB 2QE9A 2KW3C 3DI5A 3T6GB 1JOGA 3QVZA 1VYKA 2KJGA 4JJGA 4U5HA 4JCHA 4WABA 1QZXA 2XLOA 4JC7A 2W45A 3DAGA 3EJNA 3KMIA 4A2NB 2D5RB 2G3KA 3HNLA 3T6JA 5FCLA 5CI9A 4XWJA 1OXBA 2EILC 1IZMA 2OU6A 1U89A 3CSKA 3DE8A 3HNKA 3K66A 3OWTA 1NBBA 2XLHA 3B71A 3JRTA 2KYHA 3JTLO 4J7TA 4K1OA 4MNDA 4O6NA 4U5EE 4PJLA 1JAFA 1LI7A 2KC3A 3OEOA 3LESA 3WAQA 1WOLA 3C8ZA 4CJGA 4G0HA 1WASA 2AP3A 2CW0F 2L9JA 3V5YA 4BJ1A 4I44A 1LE2A 1HE1A 2C03A 3EH2A 4PFOA 3M15A 2X0CA 2XL4A 4BJ6C 1TKNA 4MVSA 3IHUA 1Q0FA 1RJ9B 2JX0A 2WVNA 4LLCA 1Q0DA 4JW1A 3JRMO 3O6XA 2YL7A 1YARO 4YT2A 5BUOA 3AQCA 2J9VA 5E3AA 1V4AA 2R7SA 2R7VA 3ATPA 1ORSC 4BJ6A 2A69F 2XXAB 3UGOA 1YAUO 1Z63A 2PX0A 4EBKA 3ZTZA 5KYYB 2I8BA 3ITFA 2OQMA 2KSFA 4IARA 1SYQA 4DJ9A 4QI2A 4JRZA 2Y39A 2YKZA 4BG0A 4U5GA 3I5QA 2NG1A 3JT1A 5L3VA 4C7OA 4KC9A 1RMVA 1S7ZA 3JZ0A 4GQHA 3RVZA 3EH1A 3I5PA 2HJMA 1NFOA 1M57C 1ZHZA 2H7BA 2O9XA 3AG2C 5AGFA 1GM5A 4KI2A 1C02A 2OEXA 3RQEA 3EQLF 4GEHA 3B0UX 3FOPA 3DWWA 1SR2A 2J7PA 2KK1A 1ZVZA 1NLXA 2PNOA 1H6GA 1R5ID 3SXZA 1AUEA 4CS8C 4JTAB 1J8MF 2KNHA 2WZGA 3L8IA 1XZQA 2J8WA 2LFDA 5B3IA 2R7TA 3DE9A 2IBFA 1DOVA 4CS8A 3SYNA 5KYWB 3G4XA 1BBHA 1BR1A 2ZPAA 4JURI 3KH2A 2MHRA 3UNGC 3SP1A 3JSEO 3LUTB 4K0DA 4RDAA 2J9WA 3ZQYA 3RIPA 3U9JA 3KYJA 1E83A 1Z3IX 3Q6MA 2YLGA 1ORYA 4UDVA 2CNWA 3EFOA 1R4TA 3RFYA 1KNYA 1O87A 2BC5A 3G4ZA 3JYHA 1H9TA 1D1CA 1RXQA 3SXKA 1G4WR 3FXHA 3Q6NA 3A11A 1OR3A 1FFHA 2HUJA 2PX3A 1C03A 2W4MA 3EGXA 1CGOA 3HJCA 4O79A 5B1BC 3MX3A 1BR4A 3DZAA 4DBQA 1ORJA 2R9RB 5L0FA 1RKEA 1GQAA 3RF3A 2KGOA 1YYJA 2YLIA 2GFHA 3B0PA 3DAFA 2YZSA 2G62A 4H4KC 2YQYA 2CNWD 5COMA 5KYXA 3M1CB 3NDBB 3G50A 3GM2A 2XL8A 3QW0A 4MVUA 1CPRA 3V5ZA 1G8XA 4EKWA 1NG1A 2KQ9A 4JTCB 1OW8A 3ABKC 3EZIA 4B6IA 1YJGA 1O3UA 3U8VA 1Q0MA 3X2QC 2AU5A 1VK5A 5A6BD 4HEAJ 3O39A 1T6IA 3PCVA 4LERA 5GPGB 1LIHA 1YLMA 2VCBA 1YA7O 1HMDA 2XRHA 3IPMO 3QZCA 3UR3C 3J06A 3C63A 5L0JA 2R7WA 3H65A 3LS1A 4LACB 1HY5A 4I1OB 4O6YA 3UMIA 3AGTA 4C3EA 4MTGA 3U2LA 5KYUA 4JVSA 4J30B 3S27A 5D92A 1K40A 3NMKA 2A0UA 3U5SA 2XLEA 3AG3C 1YZCA 2UUHA 3K6BA 1FMWA 4DVYP 4EIYA 2PFDA 5D91A 4IGGA 4FAPB 4E7ZA 2WVQA 3L34A 4O6MA 4NTBA 1WTYA 3L8JA 3LS0A 1YA9A 1I4YA 2A0BA 4PJNA 1OQCA 2ZXOA 2Q4FA 2JD3A 5CI8A 3VYWA 2LCHA 2NUPA 3V5XA 4CDYA 3NKEA 1GS9A 1MMNA 1ST6A 3A9CA 5JT4A 1S05A 4C7OB 3GANA 2YWAA 5IY5C 4XLPF 3VM6A 2CCYA 5L0IA 5DVWA 3HTKC 5DS5A 1FMVA 3LAYA 3ZC4A 4CDVA 2OG2A 4CBEA 3RVYA 3ZTMA 2B0JA 2JPUA 1CGNA 4NTAA 2UUIA 5EK0A 1C17M 1L7CA 1M2VB 3LLIA 5T3TA 2Q9AA 3IEEA 3ZVRA 4BPMA 2VH3A 2EIMC 2VCCA 5BQGA 1VYIA 2DYSC 2R25A 3DMDA 1Z6AA 3DKAA 4U9EA 4XLNF 4WGZA 3AOUA 1WGWA 5FZTA 2IXNA 3ZSUA 2Y69C 3VF0A 4NQFA 4YL3A 5JSLA 4XPWA 2NUTA 3NYJA 3N2ZB 2A1DD 1A7DA 1HW2A 1Y4CA 2ZXRA 4CDAA 2GWWA 1BDJB 2B0HA 3W8IA 4W8PA 3ZDLA 5JUAA 2R7RA 3EPVA 3JCUQ 2ZD9A 3T6BA 3AJMA 2IXMA 2W9YA 3LNMB 4PK4A 3W2VA 3R2PA 3IQTA 4HFFB 3ZQVA 5A6KA 5E3CA 5A69A 1YZAA 1WATA 2MWQA 2V3CC 4BJTA 2OKUA 1TWAA 5COGA 3BEHA 3EGDA 1WWPA 1OKKA 4EBJA 1E2XA 1HMOA 4JEBA 3DM5A 3W4YA 4YT4A 2WZFA 2J0WA 3BRJA 5E2QA 4CIPA 2HMQA 4MW8A 3N0TA 4CJOA 4RBNA 2HS5A 2P7VA 3EHNA 3LEVA 4BEJA 2XLWA 1SMYF 4MQ9F 3KKBA 2Y3HA 3L0IA 4ZLDA 1MQVA 3POVA 3NKDA 4JTDB 1ZW3A 4HE8D 4W8KA 3U2MA 1GGQA 1TFOB 2P1AA 1AVOB 4JJFA 1O5HA 2EPKX 1BZ4A 3U0CA 1VTMP 2IM8A 4OIRF 4WGYA 2W4BA 1TWGA 4YT5A 2YLDA 4P9TA 1UFBA 2VB6A 1D1AA 3RW0A 3TJ6A 1QVXA 4U9DA 4QDLA 1A0BA 1MNEA 1HE9A 2WB7A 1ZHTA 1APCA 1ZHWA 2HV7A 3S29A 3GODA 1MMAA 3H2VA 2J7PD 4D4XA 2FFHA 1CPQA 2G3VA 2IXPA 4OD4A 1PD1A 3ASNC 2L7AA 4L6RA 4PJJA 2ICWG 3IQCA 1J8YF 1T6UA 1LS4A 5DS4A 5B1AC 1W2WA 1ZU5A 2ZXPA 3KPHA 1E85A 5EGYA 3LEOA 4PACA 4NTFA 4F4BA 2H7VC 2OOCA 2GA0A 1EKYA 2M4EA 3EG9B 4MVOA 1M56C 1QQ3A 1TR2A 1LM3B 5L3QA 5JS5A 4OIPF 2QY9A 3UMHA 1N1CA 2LFFA 4FWVA 2GAQA 4MVZA 2QNLA 2QTVA 2J9BA 3WG7C 2ASRA 4AL0A 4CS9C 1LKXA 3PHF2 3DD7A 2A6EF 4KNWA 4XEFA 4C3DA 2Z15A 1D0XA 4E0HA 3WODF 2A6HF 1M2OA 2VASA 4QI0A 4E18A 4CS9A 2XS1A 1NU7D 4G7HF 4OIOF 2R7OA 3FDQA 1VB5A 2HFIA 2P6VA 4E7SA 2NUTB 3Q7GA 5L0DA 3KYIA 4C3BA 4E0IA 5E33A 4ER9A 3CEXA 3F47A 3IQ6A 4I1MA 4XTKA 1ZU4A 1RJ9A 3TOMA 1G5ZA 4XPYA 2FGYA 4BJ5C 3O55A 5KYNA 4R32A 5T1DB 3PMRA 2L81A 1ZYRF 1EI7A 4YT8A 1NFNA 2R7UA 1U6HA 3CZ6A 2Q7RA 1VLSA 1F1MA 4NCQA 2Y3DA 3MYIA 3K1IC 3LJBA 4MVRA 4BJ5A 2OCCC 1NZEA 1T6QA 4FESA 4H54A 1V74B 5DQZA 4OIQF 5KYYA 2VCAA 3MBGA 2YL0A 1FAPB 2XL6A 4MTFA 3SEOA 4CX9A 3K1IA 1ZHYA 2RD9A 1FR0A 4J32B 2HSQA 4LDQA 4U5FE 4OINF 3FAPB 1I4ZA 4XEVA 3MLGA 3AG4C 2Y3GA 4N6HA 3U3BA 4P6IC 5TJ5E 5CIVA 4ZLCA 5A6JA 5HV9A 1T9KA 3ABMC 3OA1A 4CIHA 3NG1A 3ZG1A 2XLMA 4I3MA 4IAOA 4A4AA 2YHSA 4Q7CA 5F28E 2AVKA 3HNIA 3O10A 3QVYA 1EQ1A 5T3WA 3B9QA 1IW7F 1OCZC 3FHDA 1A41A 3K7DA 3C18A 4IWBA 3VRCA 2L6GA 5JLIA 5KYWA 1E84A 4DVZA 2LQGA 1YDIA 4DOZA 3JSZA 3NRHA 4M63A 1Z7Qc 3UGPA 2RSEB 1BR2A 4E17A 1FTSA 2WZLA 2NPUA 2R02A 4G78A 3MFNA 3C8GA 3GEIA 3ASOC 3KL4A 3RKOF 4Z9IA 3S28A 1JMWA 1L3PA 1HW1A 3NYMA 3DJNB 1LPEA 3R7CA 1K04A 4ONSA 3H2UA 4ULWA 3S9OA 4LLEA 1U0BB 2XM4A 4K7BA 4MVMA 3CAXA 2EPNA 4NY3A 4U5BE 4RD9A 3TOLA 1Z5ZA 2PP4A 3C7JA 3B29A 3PDMP 1CGME 5F5FA 2EIJC 3EFOB 1B68A 2LIGA 2XS8A 3FAJA 3FMSA 4D4NA 3Q7LA 1JPNA 3B0VC 2DI3A 2BL2A 2AWYA 2H7OA 3EGXB 1QKRA 3ABLC 4ULVA 3GWLA 3U9MA 256BA 2F22A 4J7YA 2GDCA 2NSGA 5JVEA 3NMJA 1RKEB 2CDQA 4JKVA 4LDRA 3US6A 2L6FA 3DXJF 4JCZA 1TFKB 4EBBA 5KYXB 1TWHA 4XPXA 1V54C 4EWCA 2OEVA 1VLTA 1JPJA 2R03A 4CS7A 1TQGA 2PBEA 1OKKD 2Q3TA 3GORA 3K1HA 5JP7A 3U3FA 5BQIA 3CQZA 3L1MA 2Q00A 2VC9A 1OCRC 2H8AA 1LVKA 1LS1A 2IXOA 4FX5A 4AK9A 3AQBA 1V55C 1D0ZA 1FNTc 2DB4A 3RQGA 3M4CA 4U5CE 4JEAA 1T01A 2HMZA 3S90A 4Q4ZF 1VOMA 4Z9HA 1KTMA 3TULA 5JRAA 5KYUB 3UMKA 2Q9BA 1QSPA 2HV6A 2HSBA 5F5HA 2P0NA 4YL1A 2EPLX 1MMDA 4JE9A 1DOWA 3FVYA 2CYDA 3WHNA 3IQ5A 2EPMX 1T5OA 3U8PA 4YK5A 3FOOA 3QTHA 3S0XA 2XSEA 3MYFA 4MW3A 3GEEA 2R7QA 2L6HA 4IB4A 2LK4A 3ECSA 3JYYA 2P61A 2CGEA 2R05A 4YJWA 1KU2A 1TWCA 2IOQA 2NUPB 4KBLA 3TK0A 4DBRA 3RYLA 4LDKA 4AE4A 5L0GA 1A7EA 4MTOA 2YVKA 3AG1C 1M2VA 4PR9A 2LSEA 5L0CA 3TQOA 4XQ1A 2EPOA 3HLZA 4DRJB 2AWCA 2M64A 3N24A 2J45A 4YL0A 4Z9JA 1OCOC 4X0RA 1PD0A 2J0XA 1MNDA 1XZPA 2J46A 3AGUA 4N6CA 5DS6A 5A6AA 3W8HA 2V26A 5EHHA 4IJJA 2YEVA 4BEMJ 4N4WA 2YL1A 1LI5A 1MMGA 1SF8A 5HSWA 2LD6A 1QLEC 3C8GB 3GM3A 3NYLA 2X51A 1NSGB 1K05A 1ZZPA 4JIOA 1A7VA 3F46A 5DLJA 1PV3A 1Y6DA 3DJUB 3SNHA 3S84A 2YRFA 3RQFA 4DXWA 1OXKA 3E9VA 2EINC 2TMVP 3QMKA 3VAYA 1D0YA 2EIKC 1OW6A 3GM1A 4G7OF 4GYTA 5A6BA 5DQTA 3GWNA 4YWQA 3EZHA 4PJMA 1OR2A 1E86A 2WL8A 2YL3A 4IAQA 2XXAA 5BQHA 1QPUA 3LLKA 3M79A 2QUPA 3EGDB 3EHMA 1JR8A 2MYSA 3HNJA 5AC4A 1Q0KA 1YYXA 2ETSA 2Y3BA 4AX2A 3SZRA 3V7OA 2XM0A 1H9GA 1G4US 2A68F 2FAPB 4O7GA 2PF4E 3TD7A 1ZHXA 4N06A 1OCCC 2E87A 4P9FA 4EUKB 3RH3A 2DGJA 4PFPA 4YN0B 1PCXA 2QLAA 1XWJA 4XEKA 3ZIBA 4NC3A 2R7XA 1Z23A 3SXMA 4EHPA 1OW7A 3C62A 1NU9C 4WJ0A 1FFTC 3LNRA 1VMAA 2I15A 1I5NA 2IYLD 3ZWIA 2HZ8A 1ZW2A 3T4RA 4G7ZF 1JRAA 2LP4A 4U5DE 3X1OA 2C04A 4CSAC 1Q0GA 5B3SC 1M6TA 2XLVA 1SZIA 1D1BA 5COFA 4MS2A 3DM9B 3T9OA 1EA8A 3HKKA 1RCPA 1H7IA 4MVQA 4ANJA 3SXYA 4CSAA 5AC5A
chains in the Genus database with same CATH topology
2BE5F 3I4UA 2Q9CA 4OD5A 4IRUA 3EG9A 4KNVA 2DYRC 3K33A 4Q5SF 3E70C 4AE4B 3W2WA 2ZXWC 4JZAA 2WVOA 2J9UA 4HFKB 2KW3C 1VYKA 2KJGA 4JJGA 4U5HA 4JCHA 1QZXA 2W45A 3DAGA 3EJNA 3KMIA 4A2NB 2D5RB 2G3KA 3T6JA 5FCLA 5CI9A 4XWJA 3OWTA 2EILC 1IZMA 3CSKA 3K66A 4K7BA 3JRTA 4MNDA 4O6NA 4U5EE 4PJLA 3OEOA 3LESA 4G0HA 4BJ1A 2CW0F 2L9JA 4I44A 2C03A 3EH2A 4YT2A 4PFOA 4BJ6C 2XL4A 1TKNA 4DBQA 1RJ9B 2WVNA 4LLCA 4JW1A 3O6XA 5BUOA 3AQCA 2J9VA 5E3AA 2R7SA 2R7VA 4BJ6A 2A69F 2XXAB 3UGOA 1Z63A 2PX0A 5KYYB 2I8BA 3ITFA 4QI2A 2Y39A 4BG0A 4C7OA 4U5GA 3I5QA 2NG1A 3JT1A 5L3VA 4KC9A 1S7ZA 3EH1A 3I5PA 1ZHZA 1M57C 2H7BA 2O9XA 3AG2C 4KI2A 3B0UX 3EQLF 4GEHA 2J7PA 4CS8C 1J8MF 2KNHA 2WZGA 2R7TA 4CS8A 5KYWB 3SYNA 1BR1A 2ZPAA 4JURI 3KH2A 3UNGC 3SP1A 4K0DA 4RDAA 2J9WA 3RIPA 1Z3IX 3Q6MA 2CNWA 3EFOA 3RFYA 1O87A 3JYHA 1D1CA 4XTKA 3Q6NA 3EGXA 1FFHA 2PX3A 2W4MA 4O79A 3HJCA 5DS4A 5B1BC 3MX3A 1BR4A 3DZAA 2KGOA 2GFHA 3B0PA 3DAFA 2YZSA 2G62A 4H4KC 5KYXA 2CNWD 3NDBB 3M1CB 1G8XA 1NG1A 2KQ9A 3ABKC 3EZIA 4B6IA 3X2QC 1VK5A 4HEAJ 3O39A 4LERA 2XRHA 3UR3C 3QZCA 2R7WA 3H65A 3LS1A 4LACB 4O6YA 4I1OB 3UMIA 4C3EA 5KYUA 4JVSA 4J30B 3S27A 5D92A 3AG3C 3K6BA 4DVYP 1FMWA 2PFDA 5D91A 4E7ZA 2WVQA 3L34A 4O6MA 3LS0A 4PJNA 2ZXOA 5CI8A 2JD3A 3VYWA 2NUPA 3NKEA 1MMNA 1ST6A 4C7OB 3GANA 5IY5C 4XLPF 5DVWA 3HTKC 5DS5A 1FMVA 3LAYA 3ZC4A 2OG2A 4CBEA 2B0JA 3LLIA 1M2VB 5T3TA 2Q9AA 3IEEA 3ZVRA 2VH3A 2EIMC 1VYIA 2DYSC 3DMDA 1Z6AA 4XLNF 1WGWA 3ZSUA 2IXNA 2Y69C 2NUTA 3NYJA 3N2ZB 2A1DD 2ZXRA 2R7RA 3W8IA 3EPVA 3JCUQ 3T6BA 4PK4A 2IXMA 2W9YA 3W2VA 4HFFB 5E3CA 2MWQA 2V3CC 4BJTA 1TWAA 3EGDA 1OKKA 4YT4A 3DM5A 2WZFA 2J0WA 5E2QA 3N0TA 4RBNA 3EHNA 2P7VA 3LEVA 4BEJA 1SMYF 4MQ9F 3KKBA 2Y3HA 3L0IA 4ZLDA 3POVA 3NKDA 4HE8D 4W8KA 4JJFA 1O5HA 4OIRF 2W4BA 1TWGA 4YT5A 2VB6A 1D1AA 4QDLA 1MNEA 2WB7A 1ZHTA 1ZHWA 2HV7A 3S29A 3GODA 1MMAA 2J7PD 2FFHA 2G3VA 2IXPA 4OD4A 1PD1A 3ASNC 4PJJA 1J8YF 5B1AC 1W2WA 1ZU5A 2ZXPA 5EGYA 4F4BA 2H7VC 2M4EA 3EG9B 1M56C 1TR2A 5L3QA 4OIPF 2QY9A 3UMHA 1N1CA 4FWVA 2QTVA 3WG7C 4CS9C 1LKXA 3PHF2 3DD7A 2A6EF 4KNWA 4C3DA 2Z15A 1D0XA 3WODF 2A6HF 1M2OA 2VASA 4QI0A 4G7HF 4CS9A 1NU7D 4OIOF 2R7OA 3FDQA 4E7SA 2P6VA 2NUTB 3Q7GA 4C3BA 5E33A 3F47A 4I1MA 1ZU4A 1RJ9A 2FGYA 4BJ5C 5T1DB 3PMRA 2L81A 1ZYRF 4YT8A 2R7UA 3CZ6A 2Y3DA 3K1IC 3LJBA 4BJ5A 2OCCC 1NZEA 4FESA 5DQZA 4OIQF 5KYYA 3SEOA 1ZHYA 4J32B 4U5FE 4OINF 3MLGA 3AG4C 2Y3GA 4P6IC 4ZLCA 3ABMC 3OA1A 4CIHA 3NG1A 3ZG1A 4I3MA 4IAOA 2YHSA 4Q7CA 5T3WA 3B9QA 1IW7F 1OCZC 3FHDA 3K7DA 4IWBA 5KYWA 4DVZA 4DOZA 3JSZA 3NRHA 4M63A 3UGPA 1BR2A 1FTSA 2WZLA 3ASOC 3KL4A 3RKOF 3S28A 3NYMA 3DJNB 4ULWA 4LLEA 4U5BE 4NY3A 4RD9A 1Z5ZA 2PP4A 5F5FA 2EIJC 3EFOB 3FAJA 3Q7LA 1JPNA 3B0VC 2H7OA 3EGXB 3ABLC 2CDQA 3DXJF 5KYXB 4EBBA 1TWHA 1V54C 4EWCA 1JPJA 4CS7A 1OKKD 2Q3TA 3K1HA 3CQZA 1OCRC 1LVKA 1LS1A 2IXOA 4FX5A 4AK9A 3AQBA 1V55C 1D0ZA 4U5CE 4Q4ZF 1VOMA 5KYUB 3UMKA 2Q9BA 2HV6A 5F5HA 1MMDA 3FVYA 3S0XA 2XSEA 2R7QA 3ECSA 2CGEA 4YJWA 1KU2A 1TWCA 2IOQA 2NUPB 4KBLA 4DBRA 3RYLA 4AE4A 3AG1C 1M2VA 2LSEA 3HLZA 3N24A 2J45A 1OCOC 4X0RA 1PD0A 2J0XA 1MNDA 2J46A 5DS6A 3W8HA 2V26A 5EHHA 4IJJA 2YEVA 1MMGA 1SF8A 5HSWA 3NYLA 1QLEC 2X51A 5DLJA 3F46A 3DJUB 3SNHA 3E9VA 2EINC 3QMKA 3VAYA 1D0YA 2EIKC 4G7OF 4GYTA 5DQTA 4YWQA 3EZHA 4PJMA 2WL8A 2XXAA 3LLKA 3EGDB 3EHMA 2MYSA 2Y3BA 4AX2A 3SZRA 3V7OA 2A68F 4O7GA 2PF4E 3TD7A 1ZHXA 4N06A 1OCCC 2E87A 3RH3A 2DGJA 4PFPA 4YN0B 1PCXA 3ZIBA 2R7XA 1Z23A 1NU9C 4WJ0A 1FFTC 3LNRA 1VMAA 2IYLD 3T4RA 4G7ZF 4U5DE 3X1OA 2C04A 4CSAC 5B3SC 1SZIA 1D1BA 3DM9B 4ANJA 4CSAA 5KYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AE4 A;  4AE4 B; 
#chains in the Genus database with same CATH topology
 1WN0 A;  2OJQ A;  2BE5 F;  5K0I A;  3I4U A;  2Q9C A;  4OD5 A;  1RKC A;  2XLD A;  3EG9 A;  4IRU A;  2NSF A;  1AEP A;  3GEH A;  3TJ5 A;  4DRI B;  1YVI A;  1UG7 A;  3NMI A;  2DYR C;  3K33 A;  3C8G D;  3E70 C;  4KNV A;  5L0H A;  4Q5S F;  2OJE D;  3M4B A;  3QW1 A;  2D4U A;  4DRH B;  4AE4 B;  3W2W A;  2HKV A;  2ZXW C;  4JZA A;  4AL1 A;  1LE4 A;  2WVO A;  2HJ3 A;  2J9U A;  4HFK B;  2QE9 A;  2KW3 C;  3DI5 A;  3T6G B;  1JOG A;  3QVZ A;  1VYK A;  2KJG A;  4JJG A;  4U5H A;  4JCH A;  4WAB A;  1QZX A;  2XLO A;  4JC7 A;  2W45 A;  3DAG A;  3EJN A;  3KMI A;  4A2N B;  2D5R B;  2G3K A;  3HNL A;  3T6J A;  5FCL A;  5CI9 A;  4XWJ A;  1OXB A;  2EIL C;  1IZM A;  2OU6 A;  1U89 A;  3CSK A;  3DE8 A;  3HNK A;  3K66 A;  3OWT A;  1NBB A;  2XLH A;  3B71 A;  3JRT A;  2KYH A;  3JTL O;  4J7T A;  4K1O A;  4MND A;  4O6N A;  4U5E E;  4PJL A;  1JAF A;  1LI7 A;  2KC3 A;  3OEO A;  3LES A;  3WAQ A;  1WOL A;  3C8Z A;  4CJG A;  4G0H A;  1WAS A;  2AP3 A;  2CW0 F;  2L9J A;  3V5Y A;  4BJ1 A;  4I44 A;  1LE2 A;  1HE1 A;  2C03 A;  3EH2 A;  4PFO A;  3M15 A;  2X0C A;  2XL4 A;  4BJ6 C;  1TKN A;  4MVS A;  3IHU A;  1Q0F A;  1RJ9 B;  2JX0 A;  2WVN A;  4LLC A;  1Q0D A;  4JW1 A;  3JRM O;  3O6X A;  2YL7 A;  1YAR O;  4YT2 A;  5BUO A;  3AQC A;  2J9V A;  5E3A A;  1V4A A;  2R7S A;  2R7V A;  3ATP A;  1ORS C;  4BJ6 A;  2A69 F;  2XXA B;  3UGO A;  1YAU O;  1Z63 A;  2PX0 A;  4EBK A;  3ZTZ A;  5KYY B;  2I8B A;  3ITF A;  2OQM A;  2KSF A;  4IAR A;  1SYQ A;  4DJ9 A;  4QI2 A;  4JRZ A;  2Y39 A;  2YKZ A;  4BG0 A;  4U5G A;  3I5Q A;  2NG1 A;  3JT1 A;  5L3V A;  4C7O A;  4KC9 A;  1RMV A;  1S7Z A;  3JZ0 A;  4GQH A;  3RVZ A;  3EH1 A;  3I5P A;  2HJM A;  1NFO A;  1M57 C;  1ZHZ A;  2H7B A;  2O9X A;  3AG2 C;  5AGF A;  1GM5 A;  4KI2 A;  1C02 A;  2OEX A;  3RQE A;  3EQL F;  4GEH A;  3B0U X;  3FOP A;  3DWW A;  1SR2 A;  2J7P A;  2KK1 A;  1ZVZ A;  1NLX A;  2PNO A;  1H6G A;  1R5I D;  3SXZ A;  1AUE A;  4CS8 C;  4JTA B;  1J8M F;  2KNH A;  2WZG A;  3L8I A;  1XZQ A;  2J8W A;  2LFD A;  5B3I A;  2R7T A;  3DE9 A;  2IBF A;  1DOV A;  4CS8 A;  3SYN A;  5KYW B;  3G4X A;  1BBH A;  1BR1 A;  2ZPA A;  4JUR I;  3KH2 A;  2MHR A;  3UNG C;  3SP1 A;  3JSE O;  3LUT B;  4K0D A;  4RDA A;  2J9W A;  3ZQY A;  3RIP A;  3U9J A;  3KYJ A;  1E83 A;  1Z3I X;  3Q6M A;  2YLG A;  1ORY A;  4UDV A;  2CNW A;  3EFO A;  1R4T A;  3RFY A;  1KNY A;  1O87 A;  2BC5 A;  3G4Z A;  3JYH A;  1H9T A;  1D1C A;  1RXQ A;  3SXK A;  1G4W R;  3FXH A;  3Q6N A;  3A11 A;  1OR3 A;  1FFH A;  2HUJ A;  2PX3 A;  1C03 A;  2W4M A;  3EGX A;  1CGO A;  3HJC A;  4O79 A;  5B1B C;  3MX3 A;  1BR4 A;  3DZA A;  4DBQ A;  1ORJ A;  2R9R B;  5L0F A;  1RKE A;  1GQA A;  3RF3 A;  2KGO A;  1YYJ A;  2YLI A;  2GFH A;  3B0P A;  3DAF A;  2YZS A;  2G62 A;  4H4K C;  2YQY A;  2CNW D;  5COM A;  5KYX A;  3M1C B;  3NDB B;  3G50 A;  3GM2 A;  2XL8 A;  3QW0 A;  4MVU A;  1CPR A;  3V5Z A;  1G8X A;  4EKW A;  1NG1 A;  2KQ9 A;  4JTC B;  1OW8 A;  3ABK C;  3EZI A;  4B6I A;  1YJG A;  1O3U A;  3U8V A;  1Q0M A;  3X2Q C;  2AU5 A;  1VK5 A;  5A6B D;  4HEA J;  3O39 A;  1T6I A;  3PCV A;  4LER A;  5GPG B;  1LIH A;  1YLM A;  2VCB A;  1YA7 O;  1HMD A;  2XRH A;  3IPM O;  3QZC A;  3UR3 C;  3J06 A;  3C63 A;  5L0J A;  2R7W A;  3H65 A;  3LS1 A;  4LAC B;  1HY5 A;  4I1O B;  4O6Y A;  3UMI A;  3AGT A;  4C3E A;  4MTG A;  3U2L A;  5KYU A;  4JVS A;  4J30 B;  3S27 A;  5D92 A;  1K40 A;  3NMK A;  2A0U A;  3U5S A;  2XLE A;  3AG3 C;  1YZC A;  2UUH A;  3K6B A;  1FMW A;  4DVY P;  4EIY A;  2PFD A;  5D91 A;  4IGG A;  4FAP B;  4E7Z A;  2WVQ A;  3L34 A;  4O6M A;  4NTB A;  1WTY A;  3L8J A;  3LS0 A;  1YA9 A;  1I4Y A;  2A0B A;  4PJN A;  1OQC A;  2ZXO A;  2Q4F A;  2JD3 A;  5CI8 A;  3VYW A;  2LCH A;  2NUP A;  3V5X A;  4CDY A;  3NKE A;  1GS9 A;  1MMN A;  1ST6 A;  3A9C A;  5JT4 A;  1S05 A;  4C7O B;  3GAN A;  2YWA A;  5IY5 C;  4XLP F;  3VM6 A;  2CCY A;  5L0I A;  5DVW A;  3HTK C;  5DS5 A;  1FMV A;  3LAY A;  3ZC4 A;  4CDV A;  2OG2 A;  4CBE A;  3RVY A;  3ZTM A;  2B0J A;  2JPU A;  1CGN A;  4NTA A;  2UUI A;  5EK0 A;  1C17 M;  1L7C A;  1M2V B;  3LLI A;  5T3T A;  2Q9A A;  3IEE A;  3ZVR A;  4BPM A;  2VH3 A;  2EIM C;  2VCC A;  5BQG A;  1VYI A;  2DYS C;  2R25 A;  3DMD A;  1Z6A A;  3DKA A;  4U9E A;  4XLN F;  4WGZ A;  3AOU A;  1WGW A;  5FZT A;  2IXN A;  3ZSU A;  2Y69 C;  3VF0 A;  4NQF A;  4YL3 A;  5JSL A;  4XPW A;  2NUT A;  3NYJ A;  3N2Z B;  2A1D D;  1A7D A;  1HW2 A;  1Y4C A;  2ZXR A;  4CDA A;  2GWW A;  1BDJ B;  2B0H A;  3W8I A;  4W8P A;  3ZDL A;  5JUA A;  2R7R A;  3EPV A;  3JCU Q;  2ZD9 A;  3T6B A;  3AJM A;  2IXM A;  2W9Y A;  3LNM B;  4PK4 A;  3W2V A;  3R2P A;  3IQT A;  4HFF B;  3ZQV A;  5A6K A;  5E3C A;  5A69 A;  1YZA A;  1WAT A;  2MWQ A;  2V3C C;  4BJT A;  2OKU A;  1TWA A;  5COG A;  3BEH A;  3EGD A;  1WWP A;  1OKK A;  4EBJ A;  1E2X A;  1HMO A;  4JEB A;  3DM5 A;  3W4Y A;  4YT4 A;  2WZF A;  2J0W A;  3BRJ A;  5E2Q A;  4CIP A;  2HMQ A;  4MW8 A;  3N0T A;  4CJO A;  4RBN A;  2HS5 A;  2P7V A;  3EHN A;  3LEV A;  4BEJ A;  2XLW A;  1SMY F;  4MQ9 F;  3KKB A;  2Y3H A;  3L0I A;  4ZLD A;  1MQV A;  3POV A;  3NKD A;  4JTD B;  1ZW3 A;  4HE8 D;  4W8K A;  3U2M A;  1GGQ A;  1TFO B;  2P1A A;  1AVO B;  4JJF A;  1O5H A;  2EPK X;  1BZ4 A;  3U0C A;  1VTM P;  2IM8 A;  4OIR F;  4WGY A;  2W4B A;  1TWG A;  4YT5 A;  2YLD A;  4P9T A;  1UFB A;  2VB6 A;  1D1A A;  3RW0 A;  3TJ6 A;  1QVX A;  4U9D A;  4QDL A;  1A0B A;  1MNE A;  1HE9 A;  2WB7 A;  1ZHT A;  1APC A;  1ZHW A;  2HV7 A;  3S29 A;  3GOD A;  1MMA A;  3H2V A;  2J7P D;  4D4X A;  2FFH A;  1CPQ A;  2G3V A;  2IXP A;  4OD4 A;  1PD1 A;  3ASN C;  2L7A A;  4L6R A;  4PJJ A;  2ICW G;  3IQC A;  1J8Y F;  1T6U A;  1LS4 A;  5DS4 A;  5B1A C;  1W2W A;  1ZU5 A;  2ZXP A;  3KPH A;  1E85 A;  5EGY A;  3LEO A;  4PAC A;  4NTF A;  4F4B A;  2H7V C;  2OOC A;  2GA0 A;  1EKY A;  2M4E A;  3EG9 B;  4MVO A;  1M56 C;  1QQ3 A;  1TR2 A;  1LM3 B;  5L3Q A;  5JS5 A;  4OIP F;  2QY9 A;  3UMH A;  1N1C A;  2LFF A;  4FWV A;  2GAQ A;  4MVZ A;  2QNL A;  2QTV A;  2J9B A;  3WG7 C;  2ASR A;  4AL0 A;  4CS9 C;  1LKX A;  3PHF 2;  3DD7 A;  2A6E F;  4KNW A;  4XEF A;  4C3D A;  2Z15 A;  1D0X A;  4E0H A;  3WOD F;  2A6H F;  1M2O A;  2VAS A;  4QI0 A;  4E18 A;  4CS9 A;  2XS1 A;  1NU7 D;  4G7H F;  4OIO F;  2R7O A;  3FDQ A;  1VB5 A;  2HFI A;  2P6V A;  4E7S A;  2NUT B;  3Q7G A;  5L0D A;  3KYI A;  4C3B A;  4E0I A;  5E33 A;  4ER9 A;  3CEX A;  3F47 A;  3IQ6 A;  4I1M A;  4XTK A;  1ZU4 A;  1RJ9 A;  3TOM A;  1G5Z A;  4XPY A;  2FGY A;  4BJ5 C;  3O55 A;  5KYN A;  4R32 A;  5T1D B;  3PMR A;  2L81 A;  1ZYR F;  1EI7 A;  4YT8 A;  1NFN A;  2R7U A;  1U6H A;  3CZ6 A;  2Q7R A;  1VLS A;  1F1M A;  4NCQ A;  2Y3D A;  3MYI A;  3K1I C;  3LJB A;  4MVR A;  4BJ5 A;  2OCC C;  1NZE A;  1T6Q A;  4FES A;  4H54 A;  1V74 B;  5DQZ A;  4OIQ F;  5KYY A;  2VCA A;  3MBG A;  2YL0 A;  1FAP B;  2XL6 A;  4MTF A;  3SEO A;  4CX9 A;  3K1I A;  1ZHY A;  2RD9 A;  1FR0 A;  4J32 B;  2HSQ A;  4LDQ A;  4U5F E;  4OIN F;  3FAP B;  1I4Z A;  4XEV A;  3MLG A;  3AG4 C;  2Y3G A;  4N6H A;  3U3B A;  4P6I C;  5TJ5 E;  5CIV A;  4ZLC A;  5A6J A;  5HV9 A;  1T9K A;  3ABM C;  3OA1 A;  4CIH A;  3NG1 A;  3ZG1 A;  2XLM A;  4I3M A;  4IAO A;  4A4A A;  2YHS A;  4Q7C A;  5F28 E;  2AVK A;  3HNI A;  3O10 A;  3QVY A;  1EQ1 A;  5T3W A;  3B9Q A;  1IW7 F;  1OCZ C;  3FHD A;  1A41 A;  3K7D A;  3C18 A;  4IWB A;  3VRC A;  2L6G A;  5JLI A;  5KYW A;  1E84 A;  4DVZ A;  2LQG A;  1YDI A;  4DOZ A;  3JSZ A;  3NRH A;  4M63 A;  1Z7Q c;  3UGP A;  2RSE B;  1BR2 A;  4E17 A;  1FTS A;  2WZL A;  2NPU A;  2R02 A;  4G78 A;  3MFN A;  3C8G A;  3GEI A;  3ASO C;  3KL4 A;  3RKO F;  4Z9I A;  3S28 A;  1JMW A;  1L3P A;  1HW1 A;  3NYM A;  3DJN B;  1LPE A;  3R7C A;  1K04 A;  4ONS A;  3H2U A;  4ULW A;  3S9O A;  4LLE A;  1U0B B;  2XM4 A;  4K7B A;  4MVM A;  3CAX A;  2EPN A;  4NY3 A;  4U5B E;  4RD9 A;  3TOL A;  1Z5Z A;  2PP4 A;  3C7J A;  3B29 A;  3PDM P;  1CGM E;  5F5F A;  2EIJ C;  3EFO B;  1B68 A;  2LIG A;  2XS8 A;  3FAJ A;  3FMS A;  4D4N A;  3Q7L A;  1JPN A;  3B0V C;  2DI3 A;  2BL2 A;  2AWY A;  2H7O A;  3EGX B;  1QKR A;  3ABL C;  4ULV A;  3GWL A;  3U9M A;  256B A;  2F22 A;  4J7Y A;  2GDC A;  2NSG A;  5JVE A;  3NMJ A;  1RKE B;  2CDQ A;  4JKV A;  4LDR A;  3US6 A;  2L6F A;  3DXJ F;  4JCZ A;  1TFK B;  4EBB A;  5KYX B;  1TWH A;  4XPX A;  1V54 C;  4EWC A;  2OEV A;  1VLT A;  1JPJ A;  2R03 A;  4CS7 A;  1TQG A;  2PBE A;  1OKK D;  2Q3T A;  3GOR A;  3K1H A;  5JP7 A;  3U3F A;  5BQI A;  3CQZ A;  3L1M A;  2Q00 A;  2VC9 A;  1OCR C;  2H8A A;  1LVK A;  1LS1 A;  2IXO A;  4FX5 A;  4AK9 A;  3AQB A;  1V55 C;  1D0Z A;  1FNT c;  2DB4 A;  3RQG A;  3M4C A;  4U5C E;  4JEA A;  1T01 A;  2HMZ A;  3S90 A;  4Q4Z F;  1VOM A;  4Z9H A;  1KTM A;  3TUL A;  5JRA A;  5KYU B;  3UMK A;  2Q9B A;  1QSP A;  2HV6 A;  2HSB A;  5F5H A;  2P0N A;  4YL1 A;  2EPL X;  1MMD A;  4JE9 A;  1DOW A;  3FVY A;  2CYD A;  3WHN A;  3IQ5 A;  2EPM X;  1T5O A;  3U8P A;  4YK5 A;  3FOO A;  3QTH A;  3S0X A;  2XSE A;  3MYF A;  4MW3 A;  3GEE A;  2R7Q A;  2L6H A;  4IB4 A;  2LK4 A;  3ECS A;  3JYY A;  2P61 A;  2CGE A;  2R05 A;  4YJW A;  1KU2 A;  1TWC A;  2IOQ A;  2NUP B;  4KBL A;  3TK0 A;  4DBR A;  3RYL A;  4LDK A;  4AE4 A;  5L0G A;  1A7E A;  4MTO A;  2YVK A;  3AG1 C;  1M2V A;  4PR9 A;  2LSE A;  5L0C A;  3TQO A;  4XQ1 A;  2EPO A;  3HLZ A;  4DRJ B;  2AWC A;  2M64 A;  3N24 A;  2J45 A;  4YL0 A;  4Z9J A;  1OCO C;  4X0R A;  1PD0 A;  2J0X A;  1MND A;  1XZP A;  2J46 A;  3AGU A;  4N6C A;  5DS6 A;  5A6A A;  3W8H A;  2V26 A;  5EHH A;  4IJJ A;  2YEV A;  4BEM J;  4N4W A;  2YL1 A;  1LI5 A;  1MMG A;  1SF8 A;  5HSW A;  2LD6 A;  1QLE C;  3C8G B;  3GM3 A;  3NYL A;  2X51 A;  1NSG B;  1K05 A;  1ZZP A;  4JIO A;  1A7V A;  3F46 A;  5DLJ A;  1PV3 A;  1Y6D A;  3DJU B;  3SNH A;  3S84 A;  2YRF A;  3RQF A;  4DXW A;  1OXK A;  3E9V A;  2EIN C;  2TMV P;  3QMK A;  3VAY A;  1D0Y A;  2EIK C;  1OW6 A;  3GM1 A;  4G7O F;  4GYT A;  5A6B A;  5DQT A;  3GWN A;  4YWQ A;  3EZH A;  4PJM A;  1OR2 A;  1E86 A;  2WL8 A;  2YL3 A;  4IAQ A;  2XXA A;  5BQH A;  1QPU A;  3LLK A;  3M79 A;  2QUP A;  3EGD B;  3EHM A;  1JR8 A;  2MYS A;  3HNJ A;  5AC4 A;  1Q0K A;  1YYX A;  2ETS A;  2Y3B A;  4AX2 A;  3SZR A;  3V7O A;  2XM0 A;  1H9G A;  1G4U S;  2A68 F;  2FAP B;  4O7G A;  2PF4 E;  3TD7 A;  1ZHX A;  4N06 A;  1OCC C;  2E87 A;  4P9F A;  4EUK B;  3RH3 A;  2DGJ A;  4PFP A;  4YN0 B;  1PCX A;  2QLA A;  1XWJ A;  4XEK A;  3ZIB A;  4NC3 A;  2R7X A;  1Z23 A;  3SXM A;  4EHP A;  1OW7 A;  3C62 A;  1NU9 C;  4WJ0 A;  1FFT C;  3LNR A;  1VMA A;  2I15 A;  1I5N A;  2IYL D;  3ZWI A;  2HZ8 A;  1ZW2 A;  3T4R A;  4G7Z F;  1JRA A;  2LP4 A;  4U5D E;  3X1O A;  2C04 A;  4CSA C;  1Q0G A;  5B3S C;  1M6T A;  2XLV A;  1SZI A;  1D1B A;  5COF A;  4MS2 A;  3DM9 B;  3T9O A;  1EA8 A;  3HKK A;  1RCP A;  1H7I A;  4MVQ A;  4ANJ A;  3SXY A;  4CSA A;  5AC5 A; 
#chains in the Genus database with same CATH homology
 2BE5 F;  3I4U A;  2Q9C A;  4OD5 A;  4IRU A;  3EG9 A;  4KNV A;  2DYR C;  3K33 A;  4Q5S F;  3E70 C;  4AE4 B;  3W2W A;  2ZXW C;  4JZA A;  2WVO A;  2J9U A;  4HFK B;  2KW3 C;  1VYK A;  2KJG A;  4JJG A;  4U5H A;  4JCH A;  1QZX A;  2W45 A;  3DAG A;  3EJN A;  3KMI A;  4A2N B;  2D5R B;  2G3K A;  3T6J A;  5FCL A;  5CI9 A;  4XWJ A;  3OWT A;  2EIL C;  1IZM A;  3CSK A;  3K66 A;  4K7B A;  3JRT A;  4MND A;  4O6N A;  4U5E E;  4PJL A;  3OEO A;  3LES A;  4G0H A;  4BJ1 A;  2CW0 F;  2L9J A;  4I44 A;  2C03 A;  3EH2 A;  4YT2 A;  4PFO A;  4BJ6 C;  2XL4 A;  1TKN A;  4DBQ A;  1RJ9 B;  2WVN A;  4LLC A;  4JW1 A;  3O6X A;  5BUO A;  3AQC A;  2J9V A;  5E3A A;  2R7S A;  2R7V A;  4BJ6 A;  2A69 F;  2XXA B;  3UGO A;  1Z63 A;  2PX0 A;  5KYY B;  2I8B A;  3ITF A;  4QI2 A;  2Y39 A;  4BG0 A;  4C7O A;  4U5G A;  3I5Q A;  2NG1 A;  3JT1 A;  5L3V A;  4KC9 A;  1S7Z A;  3EH1 A;  3I5P A;  1ZHZ A;  1M57 C;  2H7B A;  2O9X A;  3AG2 C;  4KI2 A;  3B0U X;  3EQL F;  4GEH A;  2J7P A;  4CS8 C;  1J8M F;  2KNH A;  2WZG A;  2R7T A;  4CS8 A;  5KYW B;  3SYN A;  1BR1 A;  2ZPA A;  4JUR I;  3KH2 A;  3UNG C;  3SP1 A;  4K0D A;  4RDA A;  2J9W A;  3RIP A;  1Z3I X;  3Q6M A;  2CNW A;  3EFO A;  3RFY A;  1O87 A;  3JYH A;  1D1C A;  4XTK A;  3Q6N A;  3EGX A;  1FFH A;  2PX3 A;  2W4M A;  4O79 A;  3HJC A;  5DS4 A;  5B1B C;  3MX3 A;  1BR4 A;  3DZA A;  2KGO A;  2GFH A;  3B0P A;  3DAF A;  2YZS A;  2G62 A;  4H4K C;  5KYX A;  2CNW D;  3NDB B;  3M1C B;  1G8X A;  1NG1 A;  2KQ9 A;  3ABK C;  3EZI A;  4B6I A;  3X2Q C;  1VK5 A;  4HEA J;  3O39 A;  4LER A;  2XRH A;  3UR3 C;  3QZC A;  2R7W A;  3H65 A;  3LS1 A;  4LAC B;  4O6Y A;  4I1O B;  3UMI A;  4C3E A;  5KYU A;  4JVS A;  4J30 B;  3S27 A;  5D92 A;  3AG3 C;  3K6B A;  4DVY P;  1FMW A;  2PFD A;  5D91 A;  4E7Z A;  2WVQ A;  3L34 A;  4O6M A;  3LS0 A;  4PJN A;  2ZXO A;  5CI8 A;  2JD3 A;  3VYW A;  2NUP A;  3NKE A;  1MMN A;  1ST6 A;  4C7O B;  3GAN A;  5IY5 C;  4XLP F;  5DVW A;  3HTK C;  5DS5 A;  1FMV A;  3LAY A;  3ZC4 A;  2OG2 A;  4CBE A;  2B0J A;  3LLI A;  1M2V B;  5T3T A;  2Q9A A;  3IEE A;  3ZVR A;  2VH3 A;  2EIM C;  1VYI A;  2DYS C;  3DMD A;  1Z6A A;  4XLN F;  1WGW A;  3ZSU A;  2IXN A;  2Y69 C;  2NUT A;  3NYJ A;  3N2Z B;  2A1D D;  2ZXR A;  2R7R A;  3W8I A;  3EPV A;  3JCU Q;  3T6B A;  4PK4 A;  2IXM A;  2W9Y A;  3W2V A;  4HFF B;  5E3C A;  2MWQ A;  2V3C C;  4BJT A;  1TWA A;  3EGD A;  1OKK A;  4YT4 A;  3DM5 A;  2WZF A;  2J0W A;  5E2Q A;  3N0T A;  4RBN A;  3EHN A;  2P7V A;  3LEV A;  4BEJ A;  1SMY F;  4MQ9 F;  3KKB A;  2Y3H A;  3L0I A;  4ZLD A;  3POV A;  3NKD A;  4HE8 D;  4W8K A;  4JJF A;  1O5H A;  4OIR F;  2W4B A;  1TWG A;  4YT5 A;  2VB6 A;  1D1A A;  4QDL A;  1MNE A;  2WB7 A;  1ZHT A;  1ZHW A;  2HV7 A;  3S29 A;  3GOD A;  1MMA A;  2J7P D;  2FFH A;  2G3V A;  2IXP A;  4OD4 A;  1PD1 A;  3ASN C;  4PJJ A;  1J8Y F;  5B1A C;  1W2W A;  1ZU5 A;  2ZXP A;  5EGY A;  4F4B A;  2H7V C;  2M4E A;  3EG9 B;  1M56 C;  1TR2 A;  5L3Q A;  4OIP F;  2QY9 A;  3UMH A;  1N1C A;  4FWV A;  2QTV A;  3WG7 C;  4CS9 C;  1LKX A;  3PHF 2;  3DD7 A;  2A6E F;  4KNW A;  4C3D A;  2Z15 A;  1D0X A;  3WOD F;  2A6H F;  1M2O A;  2VAS A;  4QI0 A;  4G7H F;  4CS9 A;  1NU7 D;  4OIO F;  2R7O A;  3FDQ A;  4E7S A;  2P6V A;  2NUT B;  3Q7G A;  4C3B A;  5E33 A;  3F47 A;  4I1M A;  1ZU4 A;  1RJ9 A;  2FGY A;  4BJ5 C;  5T1D B;  3PMR A;  2L81 A;  1ZYR F;  4YT8 A;  2R7U A;  3CZ6 A;  2Y3D A;  3K1I C;  3LJB A;  4BJ5 A;  2OCC C;  1NZE A;  4FES A;  5DQZ A;  4OIQ F;  5KYY A;  3SEO A;  1ZHY A;  4J32 B;  4U5F E;  4OIN F;  3MLG A;  3AG4 C;  2Y3G A;  4P6I C;  4ZLC A;  3ABM C;  3OA1 A;  4CIH A;  3NG1 A;  3ZG1 A;  4I3M A;  4IAO A;  2YHS A;  4Q7C A;  5T3W A;  3B9Q A;  1IW7 F;  1OCZ C;  3FHD A;  3K7D A;  4IWB A;  5KYW A;  4DVZ A;  4DOZ A;  3JSZ A;  3NRH A;  4M63 A;  3UGP A;  1BR2 A;  1FTS A;  2WZL A;  3ASO C;  3KL4 A;  3RKO F;  3S28 A;  3NYM A;  3DJN B;  4ULW A;  4LLE A;  4U5B E;  4NY3 A;  4RD9 A;  1Z5Z A;  2PP4 A;  5F5F A;  2EIJ C;  3EFO B;  3FAJ A;  3Q7L A;  1JPN A;  3B0V C;  2H7O A;  3EGX B;  3ABL C;  2CDQ A;  3DXJ F;  5KYX B;  4EBB A;  1TWH A;  1V54 C;  4EWC A;  1JPJ A;  4CS7 A;  1OKK D;  2Q3T A;  3K1H A;  3CQZ A;  1OCR C;  1LVK A;  1LS1 A;  2IXO A;  4FX5 A;  4AK9 A;  3AQB A;  1V55 C;  1D0Z A;  4U5C E;  4Q4Z F;  1VOM A;  5KYU B;  3UMK A;  2Q9B A;  2HV6 A;  5F5H A;  1MMD A;  3FVY A;  3S0X A;  2XSE A;  2R7Q A;  3ECS A;  2CGE A;  4YJW A;  1KU2 A;  1TWC A;  2IOQ A;  2NUP B;  4KBL A;  4DBR A;  3RYL A;  4AE4 A;  3AG1 C;  1M2V A;  2LSE A;  3HLZ A;  3N24 A;  2J45 A;  1OCO C;  4X0R A;  1PD0 A;  2J0X A;  1MND A;  2J46 A;  5DS6 A;  3W8H A;  2V26 A;  5EHH A;  4IJJ A;  2YEV A;  1MMG A;  1SF8 A;  5HSW A;  3NYL A;  1QLE C;  2X51 A;  5DLJ A;  3F46 A;  3DJU B;  3SNH A;  3E9V A;  2EIN C;  3QMK A;  3VAY A;  1D0Y A;  2EIK C;  4G7O F;  4GYT A;  5DQT A;  4YWQ A;  3EZH A;  4PJM A;  2WL8 A;  2XXA A;  3LLK A;  3EGD B;  3EHM A;  2MYS A;  2Y3B A;  4AX2 A;  3SZR A;  3V7O A;  2A68 F;  4O7G A;  2PF4 E;  3TD7 A;  1ZHX A;  4N06 A;  1OCC C;  2E87 A;  3RH3 A;  2DGJ A;  4PFP A;  4YN0 B;  1PCX A;  3ZIB A;  2R7X A;  1Z23 A;  1NU9 C;  4WJ0 A;  1FFT C;  3LNR A;  1VMA A;  2IYL D;  3T4R A;  4G7Z F;  4U5D E;  3X1O A;  2C04 A;  4CSA C;  5B3S C;  1SZI A;  1D1B A;  3DM9 B;  4ANJ A;  4CSA A;  5KYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...