4AE4A

The ubap1 subunit of escrt-i interacts with ubiquitin via a novel souba domain
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
114
structure length
114
Chain Sequence
SHMSPSERQCVETVVNMGYSYECVLRAMKAAGANIEQILDYLFAHGQLCEKGFDPLLVEEALEMHQCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN-ASSOCIATED PROTEIN 1
publication title The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 33
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2012-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1920 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ae4A00
4AE4B 4AE4A
chains in the Genus database with same CATH superfamily
1ZHZA 3ABMC 3K1IA 1Z3IX 1HMDA 3EHNA 4KBLA 1QZXA 4BG0A 2JPUA 4G7HF 4IGGA 3LNRA 3U9JA 4LLCA 3HTKC 1UG7A 3AJMA 4WGYA 3O10A 4YL0A 4JE9A 2VB6A 4JEBA 4BJ6C 1M2VB 3GANA 2CNWD 3US6A 5DQZA 3EGDA 2V26A 2Y3DA 3SP1A 4MTFA 5A6BA 1I5NA 3E9VA 4JEAA 3LS1A 2MHRA 3ZDLA 5HV9A 2YLDA 3PHF2 1ST6A 5B3SC 1LKXA 3F47A 1QSPA 3EGXB 3G4ZA 3NDBB 2KW3C 5CI9A 2LSEA 5KYUA 1G4WR 3R2PA 2YQYA 4AX2A 2NUPB 3LJBA 3JYHA 3EQLF 2AWCA 2PP4A 3RKOF 1K40A 1O87A 2W45A 2XLMA 3ZSUA 2DGJA 3LEOA 4N6HA 2P0NA 1J8MF 1WWPA 4JTDB 1ZHWA 5JP7A 2A1DD 2FFHA 4NC3A 1G8XA 3GM2A 1LI7A 2J9UA 1A0BA 4LACB 4HFKB 4MS2A 1A7EA 1RKEB 4KC9A 3ZTMA 3M4BA 2CW0F 1F1MA 1RJ9B 3W2VA 4CX9A 4NTAA 2ETSA 3SYNA 1LI5A 1YZAA 3T6JA 3W8IA 2L6HA 2PX3A 5EK0A 2YZSA 1SMYF 4EBKA 2GAQA 2G3VA 5TJ5E 5BQIA 3LUTB 3EG9B 3HNLA 3VM6A 4AL0A 2DI3A 1ZVZA 2A6EF 2W4BA 3O39A 1Z5ZA 1LPEA 256BA 2YKZA 5D92A 1V74B 2EILC 4JW1A 5A6BD 2EPKX 2LD6A 1K04A 5L0GA 2Z15A 1ZU4A 2LP4A 2YEVA 2PNOA 4FX5A 5AC5A 4DRIB 2YL3A 2UUHA 3WG7C 1U0BB 2D5RB 4OD5A 3UMKA 3U0CA 4PACA 1OCRC 3U3FA 2IOQA 2QNLA 1SZIA 4MVOA 3L8IA 3U3BA 2XM4A 1IW7F 1ORSC 3UGPA 1C03A 3DE9A 4G78A 4GEHA 1NLXA 1Q0FA 4ULWA 4XEFA 4N06A 5L0DA 4HEAJ 1VTMP 3GEIA 2FGYA 2HZ8A 3JYYA 5K0IA 1YARO 2F22A 4NTFA 2GFHA 2Y3BA 3KH2A 1E86A 1BR1A 5JVEA 4C3DA 5COFA 1M2VA 1C02A 2A69F 2A0BA 3NYJA 2P1AA 1HMOA 1VMAA 4Q4ZF 3RYLA 2OQMA 4RDAA 2JD3A 5E2QA 5HSWA 3BRJA 5D91A 5T3WA 3EGXA 2BE5F 1G4US 1FMVA 4F4BA 1ORJA 3B9QA 2A0UA 2Q3TA 2R7XA 3LLIA 1N1CA 3N2ZB 5DLJA 1E2XA 2L9JA 1L7CA 1SYQA 1E85A 4BJ5C 1DOVA 1JAFA 2B0HA 2ZD9A 1VYIA 2ASRA 4G0HA 4MVUA 2ZXRA 2Q7RA 5F5HA 2ICWG 2YL7A 4XEVA 1OKKA 4MVSA 1YJGA 2A68F 2BL2A 1R4TA 3U2MA 5EGYA 5JS5A 3LEVA 3KKBA 1TQGA 3O6XA 3QW0A 4R32A 1FFHA 4BJTA 1HW1A 1J8YF 2KGOA 2QLAA 3DE8A 4XLNF 4BEMJ 1YA9A 3DAGA 3L8JA 2ZXWC 3QTHA 4MQ9F 1WASA 2V3CC 5L3QA 1LE4A 4P9FA 2P6VA 2YHSA 1HY5A 3LS0A 4MTGA 3G4XA 3NRHA 3RFYA 1MNEA 3EZIA 1JOGA 4ZLCA 4ULVA 3U2LA 1NU7D 4PJNA 3V7OA 2C03A 2Q00A 1TWCA 3U9MA 3ZG1A 5F5FA 3GORA 3IHUA 3S0XA 3JZ0A 3WHNA 1Y6DA 5FCLA 5L0CA 4OIQF 1A41A 3QMKA 4ER9A 1EKYA 5AGFA 5EHHA 3Q6MA 3I4UA 3K66A 2H7OA 3KYIA 1YA7O 2KQ9A 1QKRA 2VASA 2Y39A 3RW0A 2EPMX 3TJ6A 5DQTA 3JSEO 5E33A 4AK9A 4EKWA 3K1IC 3OWTA 3T4RA 3UR3C 1OKKD 4YN0B 4ONSA 1ZYRF 4MVMA 3SEOA 3S84A 2L6FA 4O6MA 1D1CA 1BDJB 4N4WA 2WVNA 1FTSA 2C04A 3CQZA 2Y3HA 1ZU5A 3ASNC 3M1CB 3QW1A 4GYTA 3Q6NA 1XZPA 3GWLA 5T1DB 3TOLA 4A2NB 3ZTZA 4XPYA 2W9YA 1V54C 2WZFA 2XRHA 3VRCA 2XL4A 4A4AA 1VLTA 1CPRA 3TULA 2YVKA 2OU6A 1EI7A 2YLIA 1DOWA 2AU5A 4IWBA 3B0UX 3MBGA 4X0RA 2GDCA 2WZGA 3ASOC 4KNWA 4U5GA 4CS8C 1U6HA 3MYFA 4CBEA 1KNYA 3MLGA 5DVWA 1T9KA 4ZLDA 1OW7A 3PMRA 2VC9A 3T6BA 1CGOA 3N24A 3K7DA 4QDLA 4DXWA 1D1AA 1V55C 2RD9A 3GM1A 2OEVA 2J46A 4CS7A 2DYRC 4IB4A 1AEPA 1APCA 1ORYA 1WGWA 3KYJA 4J7TA 1OW8A 4P6IC 4PJJA 3DAFA 3L0IA 5F28E 2VCBA 1BBHA 1E83A 4WJ0A 3LESA 3AQCA 4P9TA 4NY3A 1BR4A 2YWAA 3MX3A 2OKUA 3B0PA 1KU2A 4N6CA 1TR2A 2EIMC 3RH3A 3UMIA 4CIHA 4PJMA 3WODF 3M4CA 4DRHB 1MQVA 3GEEA 1TKNA 2HV6A 3H2UA 3HLZA 3LAYA 3V5XA 3X1OA 4QI2A 3NYMA 3PCVA 2XSEA 1H9GA 2PBEA 3ABLC 3FXHA 2Q9AA 3MYIA 4XWJA 1K05A 3CEXA 3SXMA 4W8KA 3RQEA 2HSBA 3VF0A 3IEEA 2IXMA 1WOLA 1A7DA 1QLEC 3DI5A 3I5QA 4MW8A 2NSGA 5B3IA 3DWWA 4J32B 4CDVA 3EHMA 4U5BE 3C8ZA 3CSKA 1JPNA 3KL4A 4K0DA 3H65A 2LFDA 4JURI 2WVQA 3GODA 2WB7A 3JSZA 4I1MA 1EQ1A 3IQCA 2RSEB 3DZAA 4LLEA 1C17M 3N0TA 5JSLA 2AWYA 4XQ1A 5L0JA 3T9OA 3NMIA 1XZQA 2EPNA 3K1HA 5L0FA 3GM3A 5A69A 1JRAA 2I8BA 2W4MA 3JT1A 3MFNA 2LCHA 4QI0A 4PK4A 4U9EA 1T6QA 2VCCA 4B6IA 2DYSC 2YRFA 2H7VC 1Z23A 5BUOA 2R02A 4NQFA 5B1BC 4YL1A 4M63A 3TQOA 4DVZA 4CSAA 4OIPF 1FR0A 2MWQA 4HFFB 4G7OF 1WTYA 3C8GD 1GM5A 2NUTB 3ZIBA 2WL8A 1W2WA 3OEOA 1H7IA 4WGZA 5IY5C 3RQFA 3NKDA 2GA0A 4DBRA 4BJ1A 1MMGA 4BPMA 3QVZA 4J7YA 4YT5A 1Q0MA 5COMA 3POVA 1O5HA 2X51A 4EUKB 2L7AA 1M57C 4U5HA 2L81A 2YL0A 3JRTA 3C7JA 5KYYA 3AG1C 2R7OA 3HJCA 4U5DE 3S90A 4MVRA 3B29A 5KYNA 1RMVA 5AC4A 2WVOA 3HNJA 2AVKA 2HS5A 2L6GA 3SZRA 1PV3A 1XWJA 4ANJA 3TOMA 4YWQA 1NFOA 5COGA 2R9RB 2XLOA 4E0HA 3S27A 2VH3A 1A7VA 4Q7CA 2O9XA 1LM3B 2G62A 4EIYA 2G3KA 5JT4A 1AUEA 2R7TA 2J7PA 4Z9IA 5DS5A 4JCHA 2HFIA 3J06A 4DOZA 2XL8A 2R7WA 3UMHA 2UUIA 3C63A 3C8GB 4RD9A 1YZCA 1H9TA 1OXBA 3FOPA 3TD7A 4LERA 4KI2A 4H4KC 4I44A 2I15A 1NZEA 2XM0A 5E3AA 4C7OA 4C3EA 5L3VA 1NFNA 2XS8A 3M79A 2M4EA 2H7BA 1LS1A 2YL1A 3F46A 4NCQA 4YT4A 5KYWA 3ECSA 4LDQA 1S05A 4JJFA 3AGUA 2Y69C 2OCCC 1TFOB 2X0CA 1HE9A 1MMNA 4L6RA 1OCZC 3ABKC 3EH2A 1NBBA 3JCUQ 1OCOC 3EJNA 4BJ5A 4YT8A 1ZZPA 1S7ZA 2J8WA 3GWNA 2ZPAA 2R7UA 2WZLA 4U5FE 1RXQA 5GPGB 3EFOB 2QE9A 1ZW2A 2KC3A 3T6GB 4WABA 2VCAA 2LQGA 3NG1A 4PFPA 2NUTA 2HKVA 3I5PA 2R7QA 3A9CA 3Q7LA 4G7ZF 2J7PD 3ZQYA 2IXPA 4CDAA 5DS4A 1D0ZA 2Q4FA 4U5EE 2BC5A 3RQGA 4E7ZA 4D4XA 4EBBA 2HUJA 2MYSA 2LK4A 4FWVA 3TJ5A 2NSFA 1WATA 4AE4A 3AG3C 1YYXA 2OJQA 3L1MA 2OJED 2IXNA 3HKKA 4JZAA 4C3BA 3U8VA 4CS9A 2Q9BA 4DVYP 3O55A 3DM5A 2A6HF 1D0XA 1OCCC 3S28A 3IQ5A 5BQGA 2EIJC 1WN0A 3L34A 4Z9JA 3IQTA 4K7BA 1T6IA 1JMWA 3DJNB 1LIHA 2QY9A 1GQAA 3B71A 3OA1A 3M15A 3HNIA 3V5ZA 3VAYA 2HMQA 2XLWA 4KNVA 4JC7A 5BQHA 2PFDA 1NG1A 1M6TA 1T01A 3LLKA 5T3TA 3ZC4A 4U5CE 4YT2A 4Q5SF 3VYWA 3WAQA 1ZW3A 3C62A 2R25A 1ZHXA 4JRZA 4OIRF 3B0VC 4DRJB 2IM8A 1OR2A 4E0IA 1TFKB 4XPXA 3AOUA 5E3CA 2GWWA 1YVIA 2CYDA 3FHDA 3C8GA 4BEJA 5A6KA 1D0YA 1Z7Qc 1VYKA 4UDVA 3UGOA 2JX0A 2KNHA 3NMKA 3V5YA 3AG4C 3NYLA 3EZHA 3RVZA 3ITFA 1Z63A 4JCZA 1GGQA 2HV7A 4AL1A 3X2QC 1E84A 2TMVP 3W8HA 2EIKC 1T6UA 4EBJA 2J9VA 1O3UA 2PX0A 4K1OA 4YK5A 1HE1A 4BJ6A 2KJGA 4CS8A 4FAPB 5KYYB 4C7OB 2AP3A 1U89A 2DB4A 3RIPA 1Q0KA 3S29A 3W4YA 5KYXB 4NTBA 2J0WA 4D4NA 5KYWB 5FZTA 3HNKA 1I4YA 3JTLO 2J9WA 1V4AA 1R5ID 3EH1A 4I3MA 3NMJA 4JKVA 3FDQA 3EFOA 3KPHA 4CSAC 2P61A 4XPWA 3DD7A 4O6NA 2HMZA 3CZ6A 3ZQVA 3FMSA 2QUPA 3PDMP 4JIOA 3DM9B 3FAPB 2P7VA 1OW6A 2R05A 2B0JA 3FOOA 4H54A 2XLHA 4O7GA 4PJLA 3FAJA 4YJWA 1MMAA 4OIOF 4LDRA 2XXAA 1T5OA 1KTMA 2EPLX 1M56C 3JRMO 1OR3A 4O6YA 3R7CA 3W2WA 1ZHTA 2CCYA 2OOCA 3IQ6A 4MTOA 1PD1A 5A6JA 4JTCB 2H8AA 2OEXA 1RKCA 1LS4A 2XS1A 1D1BA 1I4ZA 1SR2A 2M64A 3E70C 4XTKA 4DBQA 3DJUB 2XLEA 5DS6A 2HJ3A 4FESA 4DJ9A 1YYJA 4AE4B 2E87A 4Z9HA 2XLDA 1VK5A 2KYHA 2ZXPA 3IPMO 4YL3A 1TWGA 2EINC 2J45A 3SXYA 5B1AC 1RCPA 3CAXA 2NG1A 2Y3GA 1VOMA 5A6AA 2KSFA 4CJGA 1GS9A 2HJMA 1OQCA 4RBNA 3UNGC 1Q0DA 3K33A 3RF3A 3KMIA 1CGME 1B68A 4CJOA 4IAQA 3EPVA 2OG2A 2J0XA 2XL6A 1FMWA 1Y4CA 4U9DA 2IBFA 2NPUA 4J30B 1LVKA 4E18A 2IYLD 3U8PA 3G50A 4GQHA 1QVXA 2YLGA 2LFFA 1TWAA 3H2VA 1JPJA 3EGDB 3Q7GA 4MNDA 5L0IA 4MVZA 4PFOA 2NUPA 1VB5A 2CGEA 5JLIA 5KYXA 4XLPF 1M2OA 3DMDA 4OINF 4JTAB 1Z6AA 2LIGA 3RVYA 5KYUB 1ZHYA 1FFTC 1YLMA 3GEHA 1MMDA 4LDKA 1RKEA 1PD0A 3ZVRA 1UFBA 1MNDA 1CPQA 3ATPA 2R7RA 1BZ4A 1RJ9A 2R7VA 4OD4A 1YDIA 1LE2A 3FVYA 3S9OA 4E17A 4E7SA 5CI8A 2IXOA 2PF4E 1YAUO 4PR9A 2CDQA 5CIVA 1HW2A 3K6BA 1Q0GA 1AVOB 2EPOA 2D4UA 3EG9A 3BEHA 4MVQA 1NSGB 4XEKA 3U5SA 1L3PA 4MW3A 4I1OB 3AGTA 4W8PA 5L0HA 4CS9C 3C18A 2KK1A 3SNHA 4CDYA 2CNWA 4IRUA 1JR8A 3AQBA 3QVYA 3A11A 1SF8A 1PCXA 2XXAB 3ZWIA 1NU9C 5JUAA 3NKEA 3SXKA 2QTVA 4CIPA 1H6GA 4HE8D 4IARA 1G5ZA 3DKAA 1FAPB 4JJGA 4IAOA 3DXJF 1QPUA 2Q9CA 2XLVA 1EA8A 1TWHA 1BR2A 4EHPA 3TK0A 3SXZA 4EWCA 2FAPB 5JRAA 4IJJA 1QQ3A 4JVSA 1IZMA 2R7SA 1VLSA 4O79A 2ZXOA 2HSQA 2J9BA 3AG2C 1FNTc 1OXKA 1CGNA 3QZCA 2R03A 3LNMB
chains in the Genus database with same CATH topology
1ZHZA 3ABMC 4KBLA 1Z3IX 3EHNA 4BG0A 1QZXA 4G7HF 3LNRA 4LLCA 3HTKC 2VB6A 4BJ6C 1M2VB 3GANA 2CNWD 5DQZA 3EGDA 2V26A 2Y3DA 3SP1A 3E9VA 3LS1A 3PHF2 1ST6A 5B3SC 1LKXA 3F47A 3EGXB 3NDBB 2KW3C 5CI9A 2LSEA 5KYUA 4AX2A 2NUPB 3LJBA 3JYHA 3EQLF 2PP4A 3RKOF 1O87A 2W45A 3ZSUA 2DGJA 1J8MF 1ZHWA 2A1DD 2FFHA 1G8XA 2J9UA 4LACB 4HFKB 4KC9A 2CW0F 1RJ9B 3W2VA 3SYNA 3W8IA 3T6JA 2PX3A 2YZSA 1SMYF 2G3VA 3EG9B 2A6EF 2W4BA 3O39A 1Z5ZA 5D92A 2EILC 4JW1A 2Z15A 1ZU4A 2YEVA 4FX5A 3WG7C 2D5RB 4OD5A 3UMKA 1OCRC 2IOQA 1SZIA 1IW7F 3UGPA 4GEHA 4ULWA 4HEAJ 2FGYA 2GFHA 2Y3BA 3KH2A 1BR1A 4C3DA 1M2VA 2A69F 3NYJA 1VMAA 4Q4ZF 3RYLA 4RDAA 2JD3A 5E2QA 5HSWA 5D91A 5T3WA 3EGXA 2BE5F 1FMVA 4F4BA 3B9QA 2Q3TA 2R7XA 3LLIA 1N1CA 3N2ZB 5DLJA 2L9JA 4BJ5C 4G0HA 1VYIA 5F5HA 4C3BA 5KYUB 2ZXRA 1OKKA 2A68F 5EGYA 3LEVA 3KKBA 3O6XA 1FFHA 4BJTA 1J8YF 2KGOA 4XLNF 3DAGA 2ZXWC 4MQ9F 2V3CC 5L3QA 2P6VA 2YHSA 3LS0A 3RFYA 3NRHA 3EZIA 1MNEA 4ZLCA 3V7OA 1NU7D 4PJNA 2C03A 1TWCA 3ZG1A 5F5FA 3S0XA 5FCLA 4OIQF 3QMKA 5EHHA 3Q6MA 3I4UA 3K66A 2H7OA 2KQ9A 2Y39A 2VASA 5DQTA 5E33A 4AK9A 3K1IC 3OWTA 3T4RA 3UR3C 1OKKD 4YN0B 1ZYRF 3SEOA 4O6MA 1D1CA 2WVNA 1FTSA 2C04A 3CQZA 2Y3HA 1ZU5A 3ASNC 3M1CB 4GYTA 3Q6NA 5T1DB 4A2NB 2W9YA 1V54C 2WZFA 2XRHA 2XL4A 4IWBA 3B0UX 4X0RA 2WZGA 3ASOC 4KNWA 4U5GA 4CS8C 4CBEA 3MLGA 5DVWA 4ZLDA 3PMRA 3T6BA 3N24A 3K7DA 4QDLA 1D1AA 1V55C 2J46A 4CS7A 2DYRC 4PJJA 4P6IC 1WGWA 3DAFA 3L0IA 4WJ0A 3LESA 3AQCA 4NY3A 1BR4A 3MX3A 3B0PA 1KU2A 1TR2A 2EIMC 3RH3A 3UMIA 4CIHA 4PJMA 3WODF 3HLZA 4QI2A 1TKNA 2HV6A 3LAYA 3X1OA 3NYMA 2XSEA 4XWJA 3ABLC 2Q9AA 4W8KA 3IEEA 2IXMA 3I5QA 1QLEC 4J32B 3EHMA 4U5BE 3CSKA 1JPNA 3KL4A 4K0DA 3H65A 4JURI 4N06A 2WVQA 3GODA 2WB7A 3JSZA 4I1MA 3DZAA 4LLEA 3N0TA 3K1HA 2I8BA 2W4MA 3JT1A 4QI0A 4PK4A 4B6IA 2DYSC 2H7VC 1Z23A 5BUOA 5B1BC 4OIPF 4M63A 4CSAA 4DVZA 2MWQA 4HFFB 4G7OF 2NUTB 3ZIBA 2WL8A 1W2WA 3OEOA 5IY5C 3NKDA 4DBRA 4BJ1A 1MMGA 4YT5A 3POVA 1O5HA 2X51A 1M57C 4U5HA 2L81A 3JRTA 5KYYA 3AG1C 2R7OA 3HJCA 4U5DE 5KYNA 2WVOA 3SZRA 4ANJA 4YWQA 3S27A 2VH3A 4Q7CA 2O9XA 2G62A 2G3KA 2R7TA 2J7PA 5DS5A 4JCHA 4DOZA 2R7WA 3UMHA 4RD9A 4KI2A 3TD7A 4LERA 4H4KC 4I44A 1NZEA 4C7OA 5E3AA 4C3EA 5L3VA 2M4EA 2H7BA 1LS1A 3F46A 4YT4A 5KYWA 3ECSA 4JJFA 2Y69C 2OCCC 1MMNA 1OCZC 3ABKC 3EH2A 3JCUQ 1OCOC 3EJNA 4BJ5A 4YT8A 1S7ZA 2R7UA 2ZPAA 2WZLA 4U5FE 3EFOB 3NG1A 4PFPA 2NUTA 3I5PA 2R7QA 3Q7LA 4G7ZF 2J7PD 2IXPA 5DS4A 1D0ZA 4E7ZA 4EBBA 4FWVA 2MYSA 4AE4A 3AG3C 4CS9A 2IXNA 4JZAA 4DVYP 2Q9BA 3DM5A 2A6HF 1D0XA 1OCCC 3S28A 2EIJC 3L34A 4K7BA 3DJNB 4U5EE 5KYYB 2QY9A 3OA1A 3VAYA 4KNVA 2PFDA 1NG1A 5T3TA 3LLKA 3ZC4A 4U5CE 4YT2A 4Q5SF 3VYWA 4OIRF 3B0VC 1ZHXA 5E3CA 3FHDA 4BEJA 1D0YA 1VYKA 3UGOA 2KNHA 3AG4C 3NYLA 3EZHA 1Z63A 3ITFA 2HV7A 3X2QC 3W8HA 2EIKC 2J9VA 2PX0A 4BJ6A 2KJGA 4CS8A 4C7OB 3RIPA 3S29A 5KYXB 2J0WA 5KYWB 2J9WA 3EH1A 4I3MA 3FDQA 3EFOA 4CSAC 3DD7A 4O6NA 3CZ6A 3DM9B 2P7VA 4PJLA 2B0JA 4O7GA 4YJWA 3FAJA 1MMAA 4OIOF 2XXAA 1M56C 3W2WA 4O6YA 1ZHTA 1PD1A 1D1BA 3E70C 4XTKA 4DBQA 3DJUB 5DS6A 4FESA 4AE4B 2E87A 1VK5A 2ZXPA 1TWGA 2EINC 2J45A 5B1AC 2NG1A 2Y3GA 1VOMA 4RBNA 3UNGC 3K33A 3KMIA 3EPVA 2OG2A 2J0XA 1FMWA 4J30B 1LVKA 2IYLD 3Q7GA 4MNDA 1TWAA 1JPJA 3EGDB 4PFOA 2NUPA 2CGEA 5KYXA 4XLPF 1M2OA 3DMDA 4OINF 1Z6AA 1ZHYA 1FFTC 1MMDA 1PD0A 3ZVRA 1MNDA 2R7RA 1RJ9A 2R7VA 4OD4A 3FVYA 4E7SA 5CI8A 2IXOA 2PF4E 2CDQA 3K6BA 3EG9A 4I1OB 4CS9C 3SNHA 2CNWA 4IRUA 3AQBA 1SF8A 1PCXA 2XXAB 1NU9C 3NKEA 2QTVA 4HE8D 4JJGA 4IAOA 3DXJF 2Q9CA 1TWHA 1BR2A 4EWCA 4IJJA 4JVSA 1IZMA 2R7SA 4O79A 2ZXOA 3AG2C 3QZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AE4 B;  4AE4 A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  3ABM C;  3K1I A;  1Z3I X;  1HMD A;  3EHN A;  4KBL A;  1QZX A;  4BG0 A;  2JPU A;  4G7H F;  4IGG A;  3LNR A;  3U9J A;  4LLC A;  3HTK C;  1UG7 A;  3AJM A;  4WGY A;  3O10 A;  4YL0 A;  4JE9 A;  2VB6 A;  4JEB A;  4BJ6 C;  1M2V B;  3GAN A;  2CNW D;  3US6 A;  5DQZ A;  3EGD A;  2V26 A;  2Y3D A;  3SP1 A;  4MTF A;  5A6B A;  1I5N A;  3E9V A;  4JEA A;  3LS1 A;  2MHR A;  3ZDL A;  5HV9 A;  2YLD A;  3PHF 2;  1ST6 A;  5B3S C;  1LKX A;  3F47 A;  1QSP A;  3EGX B;  3G4Z A;  3NDB B;  2KW3 C;  5CI9 A;  2LSE A;  5KYU A;  1G4W R;  3R2P A;  2YQY A;  4AX2 A;  2NUP B;  3LJB A;  3JYH A;  3EQL F;  2AWC A;  2PP4 A;  3RKO F;  1K40 A;  1O87 A;  2W45 A;  2XLM A;  3ZSU A;  2DGJ A;  3LEO A;  4N6H A;  2P0N A;  1J8M F;  1WWP A;  4JTD B;  1ZHW A;  5JP7 A;  2A1D D;  2FFH A;  4NC3 A;  1G8X A;  3GM2 A;  1LI7 A;  2J9U A;  1A0B A;  4LAC B;  4HFK B;  4MS2 A;  1A7E A;  1RKE B;  4KC9 A;  3ZTM A;  3M4B A;  2CW0 F;  1F1M A;  1RJ9 B;  3W2V A;  4CX9 A;  4NTA A;  2ETS A;  3SYN A;  1LI5 A;  1YZA A;  3T6J A;  3W8I A;  2L6H A;  2PX3 A;  5EK0 A;  2YZS A;  1SMY F;  4EBK A;  2GAQ A;  2G3V A;  5TJ5 E;  5BQI A;  3LUT B;  3EG9 B;  3HNL A;  3VM6 A;  4AL0 A;  2DI3 A;  1ZVZ A;  2A6E F;  2W4B A;  3O39 A;  1Z5Z A;  1LPE A;  256B A;  2YKZ A;  5D92 A;  1V74 B;  2EIL C;  4JW1 A;  5A6B D;  2EPK X;  2LD6 A;  1K04 A;  5L0G A;  2Z15 A;  1ZU4 A;  2LP4 A;  2YEV A;  2PNO A;  4FX5 A;  5AC5 A;  4DRI B;  2YL3 A;  2UUH A;  3WG7 C;  1U0B B;  2D5R B;  4OD5 A;  3UMK A;  3U0C A;  4PAC A;  1OCR C;  3U3F A;  2IOQ A;  2QNL A;  1SZI A;  4MVO A;  3L8I A;  3U3B A;  2XM4 A;  1IW7 F;  1ORS C;  3UGP A;  1C03 A;  3DE9 A;  4G78 A;  4GEH A;  1NLX A;  1Q0F A;  4ULW A;  4XEF A;  4N06 A;  5L0D A;  4HEA J;  1VTM P;  3GEI A;  2FGY A;  2HZ8 A;  3JYY A;  5K0I A;  1YAR O;  2F22 A;  4NTF A;  2GFH A;  2Y3B A;  3KH2 A;  1E86 A;  1BR1 A;  5JVE A;  4C3D A;  5COF A;  1M2V A;  1C02 A;  2A69 F;  2A0B A;  3NYJ A;  2P1A A;  1HMO A;  1VMA A;  4Q4Z F;  3RYL A;  2OQM A;  4RDA A;  2JD3 A;  5E2Q A;  5HSW A;  3BRJ A;  5D91 A;  5T3W A;  3EGX A;  2BE5 F;  1G4U S;  1FMV A;  4F4B A;  1ORJ A;  3B9Q A;  2A0U A;  2Q3T A;  2R7X A;  3LLI A;  1N1C A;  3N2Z B;  5DLJ A;  1E2X A;  2L9J A;  1L7C A;  1SYQ A;  1E85 A;  4BJ5 C;  1DOV A;  1JAF A;  2B0H A;  2ZD9 A;  1VYI A;  2ASR A;  4G0H A;  4MVU A;  2ZXR A;  2Q7R A;  5F5H A;  2ICW G;  2YL7 A;  4XEV A;  1OKK A;  4MVS A;  1YJG A;  2A68 F;  2BL2 A;  1R4T A;  3U2M A;  5EGY A;  5JS5 A;  3LEV A;  3KKB A;  1TQG A;  3O6X A;  3QW0 A;  4R32 A;  1FFH A;  4BJT A;  1HW1 A;  1J8Y F;  2KGO A;  2QLA A;  3DE8 A;  4XLN F;  4BEM J;  1YA9 A;  3DAG A;  3L8J A;  2ZXW C;  3QTH A;  4MQ9 F;  1WAS A;  2V3C C;  5L3Q A;  1LE4 A;  4P9F A;  2P6V A;  2YHS A;  1HY5 A;  3LS0 A;  4MTG A;  3G4X A;  3NRH A;  3RFY A;  1MNE A;  3EZI A;  1JOG A;  4ZLC A;  4ULV A;  3U2L A;  1NU7 D;  4PJN A;  3V7O A;  2C03 A;  2Q00 A;  1TWC A;  3U9M A;  3ZG1 A;  5F5F A;  3GOR A;  3IHU A;  3S0X A;  3JZ0 A;  3WHN A;  1Y6D A;  5FCL A;  5L0C A;  4OIQ F;  1A41 A;  3QMK A;  4ER9 A;  1EKY A;  5AGF A;  5EHH A;  3Q6M A;  3I4U A;  3K66 A;  2H7O A;  3KYI A;  1YA7 O;  2KQ9 A;  1QKR A;  2VAS A;  2Y39 A;  3RW0 A;  2EPM X;  3TJ6 A;  5DQT A;  3JSE O;  5E33 A;  4AK9 A;  4EKW A;  3K1I C;  3OWT A;  3T4R A;  3UR3 C;  1OKK D;  4YN0 B;  4ONS A;  1ZYR F;  4MVM A;  3SEO A;  3S84 A;  2L6F A;  4O6M A;  1D1C A;  1BDJ B;  4N4W A;  2WVN A;  1FTS A;  2C04 A;  3CQZ A;  2Y3H A;  1ZU5 A;  3ASN C;  3M1C B;  3QW1 A;  4GYT A;  3Q6N A;  1XZP A;  3GWL A;  5T1D B;  3TOL A;  4A2N B;  3ZTZ A;  4XPY A;  2W9Y A;  1V54 C;  2WZF A;  2XRH A;  3VRC A;  2XL4 A;  4A4A A;  1VLT A;  1CPR A;  3TUL A;  2YVK A;  2OU6 A;  1EI7 A;  2YLI A;  1DOW A;  2AU5 A;  4IWB A;  3B0U X;  3MBG A;  4X0R A;  2GDC A;  2WZG A;  3ASO C;  4KNW A;  4U5G A;  4CS8 C;  1U6H A;  3MYF A;  4CBE A;  1KNY A;  3MLG A;  5DVW A;  1T9K A;  4ZLD A;  1OW7 A;  3PMR A;  2VC9 A;  3T6B A;  1CGO A;  3N24 A;  3K7D A;  4QDL A;  4DXW A;  1D1A A;  1V55 C;  2RD9 A;  3GM1 A;  2OEV A;  2J46 A;  4CS7 A;  2DYR C;  4IB4 A;  1AEP A;  1APC A;  1ORY A;  1WGW A;  3KYJ A;  4J7T A;  1OW8 A;  4P6I C;  4PJJ A;  3DAF A;  3L0I A;  5F28 E;  2VCB A;  1BBH A;  1E83 A;  4WJ0 A;  3LES A;  3AQC A;  4P9T A;  4NY3 A;  1BR4 A;  2YWA A;  3MX3 A;  2OKU A;  3B0P A;  1KU2 A;  4N6C A;  1TR2 A;  2EIM C;  3RH3 A;  3UMI A;  4CIH A;  4PJM A;  3WOD F;  3M4C A;  4DRH B;  1MQV A;  3GEE A;  1TKN A;  2HV6 A;  3H2U A;  3HLZ A;  3LAY A;  3V5X A;  3X1O A;  4QI2 A;  3NYM A;  3PCV A;  2XSE A;  1H9G A;  2PBE A;  3ABL C;  3FXH A;  2Q9A A;  3MYI A;  4XWJ A;  1K05 A;  3CEX A;  3SXM A;  4W8K A;  3RQE A;  2HSB A;  3VF0 A;  3IEE A;  2IXM A;  1WOL A;  1A7D A;  1QLE C;  3DI5 A;  3I5Q A;  4MW8 A;  2NSG A;  5B3I A;  3DWW A;  4J32 B;  4CDV A;  3EHM A;  4U5B E;  3C8Z A;  3CSK A;  1JPN A;  3KL4 A;  4K0D A;  3H65 A;  2LFD A;  4JUR I;  2WVQ A;  3GOD A;  2WB7 A;  3JSZ A;  4I1M A;  1EQ1 A;  3IQC A;  2RSE B;  3DZA A;  4LLE A;  1C17 M;  3N0T A;  5JSL A;  2AWY A;  4XQ1 A;  5L0J A;  3T9O A;  3NMI A;  1XZQ A;  2EPN A;  3K1H A;  5L0F A;  3GM3 A;  5A69 A;  1JRA A;  2I8B A;  2W4M A;  3JT1 A;  3MFN A;  2LCH A;  4QI0 A;  4PK4 A;  4U9E A;  1T6Q A;  2VCC A;  4B6I A;  2DYS C;  2YRF A;  2H7V C;  1Z23 A;  5BUO A;  2R02 A;  4NQF A;  5B1B C;  4YL1 A;  4M63 A;  3TQO A;  4DVZ A;  4CSA A;  4OIP F;  1FR0 A;  2MWQ A;  4HFF B;  4G7O F;  1WTY A;  3C8G D;  1GM5 A;  2NUT B;  3ZIB A;  2WL8 A;  1W2W A;  3OEO A;  1H7I A;  4WGZ A;  5IY5 C;  3RQF A;  3NKD A;  2GA0 A;  4DBR A;  4BJ1 A;  1MMG A;  4BPM A;  3QVZ A;  4J7Y A;  4YT5 A;  1Q0M A;  5COM A;  3POV A;  1O5H A;  2X51 A;  4EUK B;  2L7A A;  1M57 C;  4U5H A;  2L81 A;  2YL0 A;  3JRT A;  3C7J A;  5KYY A;  3AG1 C;  2R7O A;  3HJC A;  4U5D E;  3S90 A;  4MVR A;  3B29 A;  5KYN A;  1RMV A;  5AC4 A;  2WVO A;  3HNJ A;  2AVK A;  2HS5 A;  2L6G A;  3SZR A;  1PV3 A;  1XWJ A;  4ANJ A;  3TOM A;  4YWQ A;  1NFO A;  5COG A;  2R9R B;  2XLO A;  4E0H A;  3S27 A;  2VH3 A;  1A7V A;  4Q7C A;  2O9X A;  1LM3 B;  2G62 A;  4EIY A;  2G3K A;  5JT4 A;  1AUE A;  2R7T A;  2J7P A;  4Z9I A;  5DS5 A;  4JCH A;  2HFI A;  3J06 A;  4DOZ A;  2XL8 A;  2R7W A;  3UMH A;  2UUI A;  3C63 A;  3C8G B;  4RD9 A;  1YZC A;  1H9T A;  1OXB A;  3FOP A;  3TD7 A;  4LER A;  4KI2 A;  4H4K C;  4I44 A;  2I15 A;  1NZE A;  2XM0 A;  5E3A A;  4C7O A;  4C3E A;  5L3V A;  1NFN A;  2XS8 A;  3M79 A;  2M4E A;  2H7B A;  1LS1 A;  2YL1 A;  3F46 A;  4NCQ A;  4YT4 A;  5KYW A;  3ECS A;  4LDQ A;  1S05 A;  4JJF A;  3AGU A;  2Y69 C;  2OCC C;  1TFO B;  2X0C A;  1HE9 A;  1MMN A;  4L6R A;  1OCZ C;  3ABK C;  3EH2 A;  1NBB A;  3JCU Q;  1OCO C;  3EJN A;  4BJ5 A;  4YT8 A;  1ZZP A;  1S7Z A;  2J8W A;  3GWN A;  2ZPA A;  2R7U A;  2WZL A;  4U5F E;  1RXQ A;  5GPG B;  3EFO B;  2QE9 A;  1ZW2 A;  2KC3 A;  3T6G B;  4WAB A;  2VCA A;  2LQG A;  3NG1 A;  4PFP A;  2NUT A;  2HKV A;  3I5P A;  2R7Q A;  3A9C A;  3Q7L A;  4G7Z F;  2J7P D;  3ZQY A;  2IXP A;  4CDA A;  5DS4 A;  1D0Z A;  2Q4F A;  4U5E E;  2BC5 A;  3RQG A;  4E7Z A;  4D4X A;  4EBB A;  2HUJ A;  2MYS A;  2LK4 A;  4FWV A;  3TJ5 A;  2NSF A;  1WAT A;  4AE4 A;  3AG3 C;  1YYX A;  2OJQ A;  3L1M A;  2OJE D;  2IXN A;  3HKK A;  4JZA A;  4C3B A;  3U8V A;  4CS9 A;  2Q9B A;  4DVY P;  3O55 A;  3DM5 A;  2A6H F;  1D0X A;  1OCC C;  3S28 A;  3IQ5 A;  5BQG A;  2EIJ C;  1WN0 A;  3L34 A;  4Z9J A;  3IQT A;  4K7B A;  1T6I A;  1JMW A;  3DJN B;  1LIH A;  2QY9 A;  1GQA A;  3B71 A;  3OA1 A;  3M15 A;  3HNI A;  3V5Z A;  3VAY A;  2HMQ A;  2XLW A;  4KNV A;  4JC7 A;  5BQH A;  2PFD A;  1NG1 A;  1M6T A;  1T01 A;  3LLK A;  5T3T A;  3ZC4 A;  4U5C E;  4YT2 A;  4Q5S F;  3VYW A;  3WAQ A;  1ZW3 A;  3C62 A;  2R25 A;  1ZHX A;  4JRZ A;  4OIR F;  3B0V C;  4DRJ B;  2IM8 A;  1OR2 A;  4E0I A;  1TFK B;  4XPX A;  3AOU A;  5E3C A;  2GWW A;  1YVI A;  2CYD A;  3FHD A;  3C8G A;  4BEJ A;  5A6K A;  1D0Y A;  1Z7Q c;  1VYK A;  4UDV A;  3UGO A;  2JX0 A;  2KNH A;  3NMK A;  3V5Y A;  3AG4 C;  3NYL A;  3EZH A;  3RVZ A;  3ITF A;  1Z63 A;  4JCZ A;  1GGQ A;  2HV7 A;  4AL1 A;  3X2Q C;  1E84 A;  2TMV P;  3W8H A;  2EIK C;  1T6U A;  4EBJ A;  2J9V A;  1O3U A;  2PX0 A;  4K1O A;  4YK5 A;  1HE1 A;  4BJ6 A;  2KJG A;  4CS8 A;  4FAP B;  5KYY B;  4C7O B;  2AP3 A;  1U89 A;  2DB4 A;  3RIP A;  1Q0K A;  3S29 A;  3W4Y A;  5KYX B;  4NTB A;  2J0W A;  4D4N A;  5KYW B;  5FZT A;  3HNK A;  1I4Y A;  3JTL O;  2J9W A;  1V4A A;  1R5I D;  3EH1 A;  4I3M A;  3NMJ A;  4JKV A;  3FDQ A;  3EFO A;  3KPH A;  4CSA C;  2P61 A;  4XPW A;  3DD7 A;  4O6N A;  2HMZ A;  3CZ6 A;  3ZQV A;  3FMS A;  2QUP A;  3PDM P;  4JIO A;  3DM9 B;  3FAP B;  2P7V A;  1OW6 A;  2R05 A;  2B0J A;  3FOO A;  4H54 A;  2XLH A;  4O7G A;  4PJL A;  3FAJ A;  4YJW A;  1MMA A;  4OIO F;  4LDR A;  2XXA A;  1T5O A;  1KTM A;  2EPL X;  1M56 C;  3JRM O;  1OR3 A;  4O6Y A;  3R7C A;  3W2W A;  1ZHT A;  2CCY A;  2OOC A;  3IQ6 A;  4MTO A;  1PD1 A;  5A6J A;  4JTC B;  2H8A A;  2OEX A;  1RKC A;  1LS4 A;  2XS1 A;  1D1B A;  1I4Z A;  1SR2 A;  2M64 A;  3E70 C;  4XTK A;  4DBQ A;  3DJU B;  2XLE A;  5DS6 A;  2HJ3 A;  4FES A;  4DJ9 A;  1YYJ A;  4AE4 B;  2E87 A;  4Z9H A;  2XLD A;  1VK5 A;  2KYH A;  2ZXP A;  3IPM O;  4YL3 A;  1TWG A;  2EIN C;  2J45 A;  3SXY A;  5B1A C;  1RCP A;  3CAX A;  2NG1 A;  2Y3G A;  1VOM A;  5A6A A;  2KSF A;  4CJG A;  1GS9 A;  2HJM A;  1OQC A;  4RBN A;  3UNG C;  1Q0D A;  3K33 A;  3RF3 A;  3KMI A;  1CGM E;  1B68 A;  4CJO A;  4IAQ A;  3EPV A;  2OG2 A;  2J0X A;  2XL6 A;  1FMW A;  1Y4C A;  4U9D A;  2IBF A;  2NPU A;  4J30 B;  1LVK A;  4E18 A;  2IYL D;  3U8P A;  3G50 A;  4GQH A;  1QVX A;  2YLG A;  2LFF A;  1TWA A;  3H2V A;  1JPJ A;  3EGD B;  3Q7G A;  4MND A;  5L0I A;  4MVZ A;  4PFO A;  2NUP A;  1VB5 A;  2CGE A;  5JLI A;  5KYX A;  4XLP F;  1M2O A;  3DMD A;  4OIN F;  4JTA B;  1Z6A A;  2LIG A;  3RVY A;  5KYU B;  1ZHY A;  1FFT C;  1YLM A;  3GEH A;  1MMD A;  4LDK A;  1RKE A;  1PD0 A;  3ZVR A;  1UFB A;  1MND A;  1CPQ A;  3ATP A;  2R7R A;  1BZ4 A;  1RJ9 A;  2R7V A;  4OD4 A;  1YDI A;  1LE2 A;  3FVY A;  3S9O A;  4E17 A;  4E7S A;  5CI8 A;  2IXO A;  2PF4 E;  1YAU O;  4PR9 A;  2CDQ A;  5CIV A;  1HW2 A;  3K6B A;  1Q0G A;  1AVO B;  2EPO A;  2D4U A;  3EG9 A;  3BEH A;  4MVQ A;  1NSG B;  4XEK A;  3U5S A;  1L3P A;  4MW3 A;  4I1O B;  3AGT A;  4W8P A;  5L0H A;  4CS9 C;  3C18 A;  2KK1 A;  3SNH A;  4CDY A;  2CNW A;  4IRU A;  1JR8 A;  3AQB A;  3QVY A;  3A11 A;  1SF8 A;  1PCX A;  2XXA B;  3ZWI A;  1NU9 C;  5JUA A;  3NKE A;  3SXK A;  2QTV A;  4CIP A;  1H6G A;  4HE8 D;  4IAR A;  1G5Z A;  3DKA A;  1FAP B;  4JJG A;  4IAO A;  3DXJ F;  1QPU A;  2Q9C A;  2XLV A;  1EA8 A;  1TWH A;  1BR2 A;  4EHP A;  3TK0 A;  3SXZ A;  4EWC A;  2FAP B;  5JRA A;  4IJJ A;  1QQ3 A;  4JVS A;  1IZM A;  2R7S A;  1VLS A;  4O79 A;  2ZXO A;  2HSQ A;  2J9B A;  3AG2 C;  1FNT c;  1OXK A;  1CGN A;  3QZC A;  2R03 A;  3LNM B; 
#chains in the Genus database with same CATH homology
 1ZHZ A;  3ABM C;  4KBL A;  1Z3I X;  3EHN A;  4BG0 A;  1QZX A;  4G7H F;  3LNR A;  4LLC A;  3HTK C;  2VB6 A;  4BJ6 C;  1M2V B;  3GAN A;  2CNW D;  5DQZ A;  3EGD A;  2V26 A;  2Y3D A;  3SP1 A;  3E9V A;  3LS1 A;  3PHF 2;  1ST6 A;  5B3S C;  1LKX A;  3F47 A;  3EGX B;  3NDB B;  2KW3 C;  5CI9 A;  2LSE A;  5KYU A;  4AX2 A;  2NUP B;  3LJB A;  3JYH A;  3EQL F;  2PP4 A;  3RKO F;  1O87 A;  2W45 A;  3ZSU A;  2DGJ A;  1J8M F;  1ZHW A;  2A1D D;  2FFH A;  1G8X A;  2J9U A;  4LAC B;  4HFK B;  4KC9 A;  2CW0 F;  1RJ9 B;  3W2V A;  3SYN A;  3W8I A;  3T6J A;  2PX3 A;  2YZS A;  1SMY F;  2G3V A;  3EG9 B;  2A6E F;  2W4B A;  3O39 A;  1Z5Z A;  5D92 A;  2EIL C;  4JW1 A;  2Z15 A;  1ZU4 A;  2YEV A;  4FX5 A;  3WG7 C;  2D5R B;  4OD5 A;  3UMK A;  1OCR C;  2IOQ A;  1SZI A;  1IW7 F;  3UGP A;  4GEH A;  4ULW A;  4HEA J;  2FGY A;  2GFH A;  2Y3B A;  3KH2 A;  1BR1 A;  4C3D A;  1M2V A;  2A69 F;  3NYJ A;  1VMA A;  4Q4Z F;  3RYL A;  4RDA A;  2JD3 A;  5E2Q A;  5HSW A;  5D91 A;  5T3W A;  3EGX A;  2BE5 F;  1FMV A;  4F4B A;  3B9Q A;  2Q3T A;  2R7X A;  3LLI A;  1N1C A;  3N2Z B;  5DLJ A;  2L9J A;  4BJ5 C;  4G0H A;  1VYI A;  5F5H A;  4C3B A;  5KYU B;  2ZXR A;  1OKK A;  2A68 F;  5EGY A;  3LEV A;  3KKB A;  3O6X A;  1FFH A;  4BJT A;  1J8Y F;  2KGO A;  4XLN F;  3DAG A;  2ZXW C;  4MQ9 F;  2V3C C;  5L3Q A;  2P6V A;  2YHS A;  3LS0 A;  3RFY A;  3NRH A;  3EZI A;  1MNE A;  4ZLC A;  3V7O A;  1NU7 D;  4PJN A;  2C03 A;  1TWC A;  3ZG1 A;  5F5F A;  3S0X A;  5FCL A;  4OIQ F;  3QMK A;  5EHH A;  3Q6M A;  3I4U A;  3K66 A;  2H7O A;  2KQ9 A;  2Y39 A;  2VAS A;  5DQT A;  5E33 A;  4AK9 A;  3K1I C;  3OWT A;  3T4R A;  3UR3 C;  1OKK D;  4YN0 B;  1ZYR F;  3SEO A;  4O6M A;  1D1C A;  2WVN A;  1FTS A;  2C04 A;  3CQZ A;  2Y3H A;  1ZU5 A;  3ASN C;  3M1C B;  4GYT A;  3Q6N A;  5T1D B;  4A2N B;  2W9Y A;  1V54 C;  2WZF A;  2XRH A;  2XL4 A;  4IWB A;  3B0U X;  4X0R A;  2WZG A;  3ASO C;  4KNW A;  4U5G A;  4CS8 C;  4CBE A;  3MLG A;  5DVW A;  4ZLD A;  3PMR A;  3T6B A;  3N24 A;  3K7D A;  4QDL A;  1D1A A;  1V55 C;  2J46 A;  4CS7 A;  2DYR C;  4PJJ A;  4P6I C;  1WGW A;  3DAF A;  3L0I A;  4WJ0 A;  3LES A;  3AQC A;  4NY3 A;  1BR4 A;  3MX3 A;  3B0P A;  1KU2 A;  1TR2 A;  2EIM C;  3RH3 A;  3UMI A;  4CIH A;  4PJM A;  3WOD F;  3HLZ A;  4QI2 A;  1TKN A;  2HV6 A;  3LAY A;  3X1O A;  3NYM A;  2XSE A;  4XWJ A;  3ABL C;  2Q9A A;  4W8K A;  3IEE A;  2IXM A;  3I5Q A;  1QLE C;  4J32 B;  3EHM A;  4U5B E;  3CSK A;  1JPN A;  3KL4 A;  4K0D A;  3H65 A;  4JUR I;  4N06 A;  2WVQ A;  3GOD A;  2WB7 A;  3JSZ A;  4I1M A;  3DZA A;  4LLE A;  3N0T A;  3K1H A;  2I8B A;  2W4M A;  3JT1 A;  4QI0 A;  4PK4 A;  4B6I A;  2DYS C;  2H7V C;  1Z23 A;  5BUO A;  5B1B C;  4OIP F;  4M63 A;  4CSA A;  4DVZ A;  2MWQ A;  4HFF B;  4G7O F;  2NUT B;  3ZIB A;  2WL8 A;  1W2W A;  3OEO A;  5IY5 C;  3NKD A;  4DBR A;  4BJ1 A;  1MMG A;  4YT5 A;  3POV A;  1O5H A;  2X51 A;  1M57 C;  4U5H A;  2L81 A;  3JRT A;  5KYY A;  3AG1 C;  2R7O A;  3HJC A;  4U5D E;  5KYN A;  2WVO A;  3SZR A;  4ANJ A;  4YWQ A;  3S27 A;  2VH3 A;  4Q7C A;  2O9X A;  2G62 A;  2G3K A;  2R7T A;  2J7P A;  5DS5 A;  4JCH A;  4DOZ A;  2R7W A;  3UMH A;  4RD9 A;  4KI2 A;  3TD7 A;  4LER A;  4H4K C;  4I44 A;  1NZE A;  4C7O A;  5E3A A;  4C3E A;  5L3V A;  2M4E A;  2H7B A;  1LS1 A;  3F46 A;  4YT4 A;  5KYW A;  3ECS A;  4JJF A;  2Y69 C;  2OCC C;  1MMN A;  1OCZ C;  3ABK C;  3EH2 A;  3JCU Q;  1OCO C;  3EJN A;  4BJ5 A;  4YT8 A;  1S7Z A;  2R7U A;  2ZPA A;  2WZL A;  4U5F E;  3EFO B;  3NG1 A;  4PFP A;  2NUT A;  3I5P A;  2R7Q A;  3Q7L A;  4G7Z F;  2J7P D;  2IXP A;  5DS4 A;  1D0Z A;  4E7Z A;  4EBB A;  4FWV A;  2MYS A;  4AE4 A;  3AG3 C;  4CS9 A;  2IXN A;  4JZA A;  4DVY P;  2Q9B A;  3DM5 A;  2A6H F;  1D0X A;  1OCC C;  3S28 A;  2EIJ C;  3L34 A;  4K7B A;  3DJN B;  4U5E E;  5KYY B;  2QY9 A;  3OA1 A;  3VAY A;  4KNV A;  2PFD A;  1NG1 A;  5T3T A;  3LLK A;  3ZC4 A;  4U5C E;  4YT2 A;  4Q5S F;  3VYW A;  4OIR F;  3B0V C;  1ZHX A;  5E3C A;  3FHD A;  4BEJ A;  1D0Y A;  1VYK A;  3UGO A;  2KNH A;  3AG4 C;  3NYL A;  3EZH A;  1Z63 A;  3ITF A;  2HV7 A;  3X2Q C;  3W8H A;  2EIK C;  2J9V A;  2PX0 A;  4BJ6 A;  2KJG A;  4CS8 A;  4C7O B;  3RIP A;  3S29 A;  5KYX B;  2J0W A;  5KYW B;  2J9W A;  3EH1 A;  4I3M A;  3FDQ A;  3EFO A;  4CSA C;  3DD7 A;  4O6N A;  3CZ6 A;  3DM9 B;  2P7V A;  4PJL A;  2B0J A;  4O7G A;  4YJW A;  3FAJ A;  1MMA A;  4OIO F;  2XXA A;  1M56 C;  3W2W A;  4O6Y A;  1ZHT A;  1PD1 A;  1D1B A;  3E70 C;  4XTK A;  4DBQ A;  3DJU B;  5DS6 A;  4FES A;  4AE4 B;  2E87 A;  1VK5 A;  2ZXP A;  1TWG A;  2EIN C;  2J45 A;  5B1A C;  2NG1 A;  2Y3G A;  1VOM A;  4RBN A;  3UNG C;  3K33 A;  3KMI A;  3EPV A;  2OG2 A;  2J0X A;  1FMW A;  4J30 B;  1LVK A;  2IYL D;  3Q7G A;  4MND A;  1TWA A;  1JPJ A;  3EGD B;  4PFO A;  2NUP A;  2CGE A;  5KYX A;  4XLP F;  1M2O A;  3DMD A;  4OIN F;  1Z6A A;  1ZHY A;  1FFT C;  1MMD A;  1PD0 A;  3ZVR A;  1MND A;  2R7R A;  1RJ9 A;  2R7V A;  4OD4 A;  3FVY A;  4E7S A;  5CI8 A;  2IXO A;  2PF4 E;  2CDQ A;  3K6B A;  3EG9 A;  4I1O B;  4CS9 C;  3SNH A;  2CNW A;  4IRU A;  3AQB A;  1SF8 A;  1PCX A;  2XXA B;  1NU9 C;  3NKE A;  2QTV A;  4HE8 D;  4JJG A;  4IAO A;  3DXJ F;  2Q9C A;  1TWH A;  1BR2 A;  4EWC A;  4IJJ A;  4JVS A;  1IZM A;  2R7S A;  4O79 A;  2ZXO A;  3AG2 C;  3QZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...