5F5FA

X-ray structure of roquin roq domain in complex with a selex-derived hexa-loop rna motif
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
NPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 52
structure length 152
sequence length 152
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5fA00
5F5FA 4ZLCA 4ZLDA 4YWQA 4QI0A 5F5HA 4QI2A 3X1OA 4ULWA
chains in the Genus database with same CATH superfamily
2VCBA 3ASNC 2C04A 5L0CA 3FMSA 4MW3A 3K6BA 1M2VA 256BA 1Z3IX 2WZFA 3ABMC 4E7SA 2L6FA 2CCYA 3H65A 4U5GA 3U3BA 1T01A 5JVEA 1H7IA 2ETSA 1VOMA 3GM3A 4JTAB 3C8GB 3F47A 4HFFB 1BDJB 2Q00A 3NYLA 4MVOA 2G3VA 3ZSUA 3RH3A 4HFKB 3TK0A 1AUEA 2HV6A 2L6GA 2HJ3A 4GEHA 4E0IA 5BQIA 1VTMP 3T4RA 2JX0A 4YT8A 4JURI 3RF3A 4AX2A 1B68A 1BR4A 2NPUA 2DGJA 4J7YA 1GM5A 5A6JA 3G50A 5B3SC 2M4EA 2PX3A 2Y3GA 2AWCA 1JAFA 2ZXOA 4O6MA 3FAPB 5CI8A 4I1OB 4Z9JA 3RW0A 1G4WR 4G78A 1HMOA 3KYJA 3KYIA 4KI2A 5BQHA 1YYJA 2FFHA 2VB6A 2J45A 3NYJA 3ZQVA 1W2WA 4DRJB 2VCAA 3Q6NA 2AWYA 1RJ9B 2EIKC 5EK0A 4JKVA 4DJ9A 5DLJA 3S90A 3ABKC 3DJUB 5DQTA 1ORSC 1O87A 2OG2A 2R05A 3UGOA 2Q4FA 1NU7D 1ORYA 4JW1A 1DOWA 2P7VA 1E85A 1RJ9A 3K1HA 3EG9B 1PV3A 2CYDA 1WATA 2HUJA 3FAJA 2EIJC 5COGA 3UNGC 4CS8A 2R7TA 3HKKA 4E7ZA 2W4MA 2E87A 4EUKB 2WVNA 3U8PA 2X51A 1HE1A 2XLHA 3EGXB 2R7RA 5HSWA 2EPMX 2HSQA 3TD7A 1T6UA 3ZC4A 5COMA 4ZLCA 2BC5A 4ZLDA 3IQTA 1TWAA 1JMWA 2NG1A 1R4TA 3DXJF 2LSEA 2J0WA 3MYIA 3ATPA 4ULWA 2L81A 3L8IA 2EIMC 3E70C 4EBBA 3V5XA 2HJMA 2XLMA 2HSBA 2CNWD 1T9KA 3SXZA 4XEKA 1HMDA 3Q7GA 2P61A 4BJTA 2PP4A 1O3UA 2HMZA 4CSAA 2H7BA 2VH3A 3DAFA 3JTLO 1O5HA 2QY9A 4U5FE 2O9XA 1ZZPA 4MTFA 1GGQA 3VRCA 3PHF2 4CIPA 1CPQA 2PF4E 3B9QA 2XXAB 4XTKA 3M4BA 2GAQA 1Q0GA 2HKVA 3NKDA 1NG1A 2M64A 3L1MA 2R02A 4K1OA 2GWWA 2ZXWC 3ITFA 4P6IC 2TMVP 3LESA 3CZ6A 4KC9A 1OR3A 4IWBA 1WN0A 4PK4A 2R7SA 4IAOA 1TWHA 3I5QA 5T3WA 4BEMJ 4YWQA 3US6A 1XZPA 2XXAA 5KYYA 4JCZA 2J46A 3M15A 2J9VA 2D5RB 1Z5ZA 1LS4A 4YL1A 4G0HA 3C8ZA 4FWVA 4P9TA 1LI7A 4MVQA 1Y6DA 2Q9AA 5KYUB 1LE2A 1E83A 2UUIA 2NSFA 2LP4A 4LERA 2XLEA 2R7WA 1XZQA 3N24A 4PJMA 1NU9C 1ZW3A 3T6BA 4EWCA 1TFKB 3QTHA 1EI7A 4XLPF 1G8XA 2NUTB 4U9EA 4MVMA 3MBGA 1CGOA 1Z23A 3POVA 3NKEA 5KYUA 4JCHA 5E33A 3B71A 1VB5A 3RQGA 1BBHA 3ASOC 1LE4A 1KU2A 3F46A 4MVZA 4N6HA 1K05A 1FMWA 2A1DD 3AG4C 2WB7A 3K1IC 2VASA 3DKAA 4CS9C 3IQCA 2QLAA 1OQCA 4FAPB 3DD7A 1PD0A 3HNJA 1TKNA 1WTYA 1VLSA 1F1MA 1D0XA 4U5CE 3U9MA 1L3PA 3C18A 5BQGA 3B0VC 3R7CA 1D0YA 3MFNA 3OWTA 3VAYA 3RIPA 3ZIBA 1M56C 3UMIA 3EH2A 4GQHA 4MQ9F 5CIVA 4JTCB 1YVIA 2G3KA 4CX9A 4JRZA 4EKWA 3AQCA 2FGYA 3I4UA 4X0RA 1M57C 4DRHB 4IB4A 5L3QA 1MNDA 4JEBA 4YT5A 5A6BD 4O6YA 3JSZA 3C62A 3B0PA 2IM8A 1VMAA 3SNHA 1IZMA 3KKBA 3S84A 1I4ZA 2KGOA 2W4BA 3SXYA 1ZHZA 3U2LA 2A68F 3DI5A 4WJ0A 3ZWIA 4G7OF 1OCOC 3W2WA 3ZDLA 5L0FA 1OKKA 3C8GD 3RQFA 3U8VA 2YZSA 3EZHA 1WASA 3VF0A 2P6VA 2Y3HA 3GEHA 3M4CA 4DBQA 3GODA 4EIYA 3ABLC 5B1AC 4C3EA 4EBKA 4DBRA 3M1CB 2Q9CA 2KNHA 4XPYA 2L6HA 2LFDA 2J9UA 2L7AA 3ZQYA 2HV7A 1LKXA 3KPHA 4E0HA 1OXKA 2ZD9A 3SYNA 1JR8A 2BE5F 3U3FA 1ST6A 3G4XA 2HMQA 3RKOF 1G4US 4WGYA 1BZ4A 1JPNA 1MNEA 2CGEA 2GA0A 3UMHA 4C3BA 5JUAA 1IW7F 1Q0DA 1R5ID 3AG1C 4PJNA 4EHPA 4AL0A 5JRAA 2GFHA 5IY5C 1MQVA 1ZVZA 1I5NA 2A6HF 4NQFA 4WGZA 5F5FA 3JZ0A 3NYMA 3ZTZA 5A69A 3EJNA 4QI0A 5L0DA 4I3MA 1QVXA 5A6KA 1WWPA 3LS1A 4ONSA 1TR2A 1YA7O 3DZAA 4R32A 1D1BA 3EHNA 3JRTA 2CDQA 4BJ6C 5AC5A 2OJQA 3A11A 3IQ5A 2FAPB 1HW2A 1YYXA 3RVYA 3WAQA 1RKCA 3LNRA 4UDVA 1OW7A 1VLTA 2AU5A 2XLVA 4PFOA 1ZU5A 2PFDA 3ZVRA 1ORJA 2YLGA 4U5BE 3M79A 1A7EA 5KYWB 4Q7CA 1QPUA 3EGDB 2ASRA 2C03A 3EFOB 3FHDA 1AEPA 4GYTA 2HZ8A 4XWJA 4LLEA 5T3TA 2JD3A 3RVZA 3FVYA 3V5ZA 4BG0A 4PJLA 3S29A 2R7OA 5KYWA 3EGDA 1YJGA 2KW3C 3EFOA 4Q4ZF 3HTKC 2YL0A 2PNOA 3LJBA 4U5EE 1NLXA 4AK9A 5AC4A 3KL4A 5E3CA 2IXMA 1NFNA 3SZRA 2R7VA 2AP3A 2YL7A 1JRAA 4QI2A 1C02A 1TQGA 1V54C 1PCXA 2LD6A 1RXQA 2YL3A 3KMIA 3OEOA 2A69F 1WOLA 2DB4A 2B0HA 2YLDA 3L0IA 3SEOA 4BEJA 2J7PD 2OEVA 5B3IA 4AL1A 1FNTc 1Q0KA 5KYYB 4OIQF 2OU6A 4CDVA 1Y4CA 1ZU4A 4K0DA 1YAUO 3O6XA 3TOMA 1FFTC 5K0IA 2IXOA 2OJED 4Z9HA 4E18A 3NMKA 2V3CC 1SMYF 4JTDB 1J8MF 1JPJA 1SR2A 2DYSC 2YQYA 3GM2A 3GORA 5CI9A 2WVOA 2PX0A 4WABA 1YZCA 1A0BA 1NZEA 1CGME 4CIHA 2MWQA 4BPMA 4ANJA 2OKUA 3T9OA 4ER9A 5DQZA 3AOUA 3LNMB 2R03A 4A2NB 2XRHA 1E86A 1OCZC 2IXPA 4J30B 4H4KC 3TJ5A 1SZIA 4XPWA 1LM3B 1Q0MA 1NSGB 4CJOA 5DS6A 1FMVA 2CNWA 2NUPB 3W8IA 5DS4A 3S28A 2B0JA 3V5YA 2W9YA 3CQZA 3LEOA 2YVKA 3ECSA 4IGGA 5KYNA 1YDIA 3K33A 4YL3A 1CPRA 3U0CA 3HJCA 4CDYA 2KC3A 3QZCA 4N06A 3NMJA 3FDQA 3GANA 3EPVA 3AQBA 2NUPA 2Y39A 2R25A 2L9JA 5L0GA 2J9BA 1LVKA 3MX3A 2KQ9A 3SXKA 3ZTMA 3H2UA 5L0HA 4K7BA 3CSKA 5DS5A 4RD9A 2YL1A 4JZAA 3GM1A 5DVWA 4OIPF 1K40A 2H8AA 2Y3DA 1RKEA 1T5OA 2KK1A 4E17A 4C7OB 2WZLA 3JCUQ 3FXHA 4JJGA 1FFHA 3J06A 1D1AA 1PD1A 2XS1A 3WHNA 1EA8A 3LUTB 1DOVA 1S7ZA 3AGUA 3WG7C 4F4BA 1G5ZA 2PBEA 4O79A 4PACA 1Z6AA 4C3DA 4LDRA 2J9WA 1VK5A 3PCVA 2Q3TA 3DE9A 3K1IA 3AG3C 4CS9A 4D4XA 4C7OA 2LCHA 1MMNA 1YARO 4O6NA 1MMAA 2J0XA 1FAPB 1I4YA 3S0XA 1Z63A 2A6EF 1NBBA 5BUOA 1OCCC 1GS9A 1APCA 4YT4A 1HW1A 2EILC 3X1OA 2XLOA 2WL8A 5GPGB 2J8WA 2Y69C 2P0NA 2XS8A 4BJ5C 3ZG1A 1C03A 2MHRA 4J32B 4D4NA 1U89A 2I8BA 3DM5A 2KSFA 2QE9A 2R7XA 1HE9A 4IAQA 2W45A 3LS0A 1D0ZA 3K66A 3WODF 4OIOF 2CW0F 5D92A 3B0UX 3LLKA 3RYLA 3GEEA 4OIRF 5EHHA 4NCQA 1BR1A 3GEIA 1H6GA 1OR2A 2D4UA 1RCPA 4MTGA 4PJJA 3DMDA 3SP1A 4W8KA 1KTMA 1H9GA 4JVSA 4BJ5A 2OEXA 3HNKA 3LLIA 4I1MA 2BL2A 4A4AA 2V26A 4MVUA 2WZGA 3BRJA 4KNVA 2GDCA 5A6BA 1BR2A 2Y3BA 2YRFA 1LS1A 3B29A 3DM9B 3GWNA 5JS5A 2R7QA 1QQ3A 3PMRA 3RQEA 3TOLA 2IXNA 1OW8A 2LIGA 3GWLA 1GQAA 3Q7LA 1U6HA 1S05A 5L0IA 2YLIA 3BEHA 3T6JA 4PFPA 1MMGA 5L3VA 1NFOA 3JT1A 2ZXRA 1A41A 2X0CA 1SF8A 3C8GA 3O10A 2YEVA 5B1BC 4MS2A 4YT2A 5JLIA 4JE9A 3VM6A 4CS8C 3DAGA 3SXMA 3TJ6A 5F5HA 1JOGA 1MMDA 2IBFA 3H2VA 3NMIA 4XPXA 5AGFA 3C63A 5KYXB 2EPOA 2DYRC 4B6IA 4U5HA 2KJGA 4Q5SF 4ULVA 3JRMO 2LQGA 4XEVA 1VYIA 1FR0A 1N1CA 1QKRA 4HE8D 3JYYA 3HNLA 3V7OA 4BJ6A 5KYXA 2QUPA 4DVZA 2NSGA 3HNIA 3QVYA 2YHSA 5COFA 5E2QA 3UR3C 4JEAA 3MYFA 2XL4A 4AE4B 5JT4A 3JSEO 3PDMP 1L7CA 4CBEA 4DRIB 3DWWA 2IYLD 2WVQA 4LLCA 3S27A 2RSEB 1YA9A 1AVOB 3TQOA 2DI3A 2OOCA 1HY5A 2XL6A 4G7HF 1UFBA 4JIOA 4CSAC 4AE4A 3EZIA 1UG7A 2XLWA 3CAXA 3W8HA 5JSLA 2JPUA 2XSEA 3EG9A 4NY3A 4YL0A 1J8YF 1A7VA 4JC7A 3IEEA 3UGPA 4EBJA 2Z15A 2QNLA 3LEVA 4RBNA 3FOPA 3QW0A 3EGXA 4O7GA 4YK5A 3W4YA 5HV9A 3E9VA 1TWGA 3AGTA 2A0BA 2LK4A 2R9RB 4FX5A 1ZHWA 3L34A 2P1AA 4NTBA 2A0UA 2XL8A 1LIHA 2Q9BA 3CEXA 3MLGA 3AG2C 4YJWA 3QVZA 2I15A 3VYWA 5FCLA 1ZYRF 3A9CA 3IPMO 1C17M 4NTAA 3TULA 1LI5A 2Q7RA 1U0BB 2ICWG 4XQ1A 2RD9A 3C7JA 4J7TA 3JYHA 4YN0B 3S9OA 1SYQA 1QSPA 2OCCC 2XM4A 5T1DB 1A7DA 4BJ1A 3LAYA 4LDQA 1FTSA 2EINC 4OD5A 3L8JA 1QZXA 2UUHA 3OA1A 3U2MA 3EQLF 2MYSA 3EH1A 1ZHXA 4M63A 1T6QA 1V74B 4MVRA 4W8PA 1EKYA 4N6CA 1EQ1A 5JP7A 1M6TA 1OXBA 4JJFA 2EPNA 1Z7Qc 1WGWA 1V55C 3QW1A 1V4AA 2YWAA 4LACB 4DOZA 1RKEB 4H54A 3R2PA 4L6RA 2AVKA 4XLNF 2J7PA 3RFYA 1ZHTA 4RDAA 1QLEC 2F22A 2HS5A 2LFFA 4FESA 4KNWA 3NG1A 4MTOA 1LPEA 5D91A 3U9JA 4P9FA 3X2QC 4XEFA 2H7VC 1CGNA 1YZAA 2XLDA 3N2ZB 5L0JA 4MW8A 2VCCA 3HLZA 3DJNB 1ZW2A 2ZXPA 1T6IA 1XWJA 1OKKD 2YKZA 3EHMA 4I44A 1TWCA 4U5DE 1M2OA 4PR9A 3T6GB 4CDAA 4OD4A 1RMVA 4QDLA 1TFOB 2QTVA 3NRHA 3O55A 2NUTA 1D1CA 1OCRC 2EPKX 4U9DA 5FZTA 2XM0A 4N4WA 1E84A 3I5PA 2VC9A 4MNDA 3KH2A 3QMKA 5TJ5E 4OINF 2ZPAA 4G7ZF 4KBLA 3O39A 1OW6A 3IHUA 3W2VA 5A6AA 3FOOA 3K7DA 1ZHYA 4HEAJ 1K04A 4NTFA 3UMKA 5EGYA 1E2XA 1Q0FA 2G62A 3N0TA 4CJGA 4CS7A 1YLMA 4Z9IA 3NDBB 2H7OA 4DXWA 2HFIA 4IJJA 2OQMA 2IOQA 3Q6MA 3G4ZA 4NC3A 3IQ6A 1VYKA 1KNYA 4MVSA 5E3AA 2KYHA 4IRUA 3AJMA 3DE8A 1M2VB 2R7UA 4LDKA 3U5SA 5F28E 1H9TA 2EPLX 4IARA 4DVYP
chains in the Genus database with same CATH topology
3ASNC 2C04A 3K6BA 1M2VA 2WZFA 1Z3IX 3ABMC 4E7SA 3H65A 4U5GA 1VOMA 3F47A 4HFFB 3NYLA 2G3VA 3ZSUA 3RH3A 4HFKB 2HV6A 4GEHA 3T4RA 4YT8A 4JURI 4AX2A 1BR4A 2DGJA 5B3SC 2M4EA 2PX3A 2Y3GA 2ZXOA 4O6MA 5CI8A 4I1OB 4KI2A 2FFHA 2VB6A 2J45A 3NYJA 1W2WA 3Q6NA 1RJ9B 2EIKC 5DLJA 3ABKC 3DJUB 5DQTA 2OG2A 1O87A 1NU7D 4JW1A 2P7VA 1RJ9A 3K1HA 3EG9B 3FAJA 3UNGC 4CS8A 2EIJC 2R7TA 4E7ZA 2W4MA 2E87A 2WVNA 2X51A 3EGXB 2R7RA 5HSWA 3TD7A 3ZC4A 4ZLCA 4ZLDA 1TWAA 2NG1A 3DXJF 2LSEA 2J0WA 4ULWA 2L81A 2EIMC 3E70C 4EBBA 2CNWD 3Q7GA 4BJTA 2PP4A 4CSAA 2H7BA 2VH3A 3DAFA 1O5HA 2QY9A 4U5FE 2O9XA 3PHF2 2PF4E 3B9QA 2XXAB 4XTKA 3NKDA 1NG1A 2ZXWC 3ITFA 4P6IC 3LESA 3CZ6A 4KC9A 2R7SA 4IWBA 4PK4A 4IAOA 1TWHA 3I5QA 5T3WA 4YWQA 2XXAA 5KYYA 2J46A 2J9VA 2D5RB 1Z5ZA 4G0HA 4FWVA 2Q9AA 5KYUB 4LERA 2R7WA 3N24A 4PJMA 3T6BA 1NU9C 4EWCA 4XLPF 1G8XA 2NUTB 1Z23A 3POVA 3NKEA 5KYUA 4JCHA 5E33A 3ASOC 1KU2A 3F46A 1FMWA 2A1DD 3AG4C 2WB7A 3K1IC 2VASA 4CS9C 3DD7A 1PD0A 1TKNA 4U5CE 1D0XA 3B0VC 1D0YA 3OWTA 3VAYA 3RIPA 3ZIBA 1M56C 3UMIA 3EH2A 4MQ9F 2G3KA 3AQCA 2FGYA 3I4UA 4X0RA 1M57C 5L3QA 1MNDA 4YT5A 4O6YA 3JSZA 3B0PA 1VMAA 3SNHA 1IZMA 3KKBA 2KGOA 2W4BA 1ZHZA 2A68F 4WJ0A 4G7OF 1OCOC 3W2WA 1OKKA 2YZSA 3EZHA 2P6VA 2Y3HA 4DBQA 3GODA 3ABLC 5B1AC 4C3EA 4DBRA 3M1CB 2Q9CA 2KNHA 2J9UA 2HV7A 1LKXA 3SYNA 2BE5F 1ST6A 3RKOF 5FCLA 1JPNA 1MNEA 2CGEA 4C3BA 3UMHA 1IW7F 4PJNA 3AG1C 2GFHA 5IY5C 2A6HF 5F5FA 3NYMA 3EJNA 4QI0A 4I3MA 3LS1A 1TR2A 3DZAA 1D1BA 3EHNA 3JRTA 2CDQA 4BJ6C 3LNRA 4PFOA 3ZVRA 1ZU5A 2PFDA 4U5BE 5KYWB 4Q7CA 3EGDB 2C03A 3EFOB 3FHDA 4GYTA 4XWJA 4LLEA 5T3TA 2JD3A 3FVYA 4BG0A 4PJLA 3S29A 2R7OA 5KYWA 3EGDA 2KW3C 3EFOA 4Q4ZF 3HTKC 3LJBA 4U5EE 4AK9A 3KL4A 5E3CA 2IXMA 3SZRA 2R7VA 4QI2A 1V54C 1PCXA 3KMIA 3OEOA 2A69F 3L0IA 4BEJA 3SEOA 2J7PD 5KYYB 4OIQF 1ZU4A 4K0DA 3O6XA 1FFTC 2V3CC 2IXOA 1SMYF 1J8MF 1JPJA 2DYSC 5CI9A 2WVOA 2PX0A 1NZEA 4CIHA 2MWQA 4ANJA 5DQZA 4A2NB 2XRHA 1OCZC 2IXPA 4J30B 4H4KC 1SZIA 5DS6A 1FMVA 2CNWA 2NUPB 3W8IA 5DS4A 3S28A 2B0JA 2W9YA 3CQZA 3ECSA 5KYNA 3K33A 3HJCA 3QZCA 4N06A 3FDQA 3GANA 3EPVA 3AQBA 2NUPA 2Y39A 2L9JA 1LVKA 3MX3A 2KQ9A 4K7BA 3CSKA 5DS5A 4RD9A 4JZAA 5DVWA 4OIPF 2Y3DA 4C7OB 2WZLA 3JCUQ 4JJGA 1FFHA 1D1AA 1PD1A 1S7ZA 3WG7C 4F4BA 4O79A 1Z6AA 4C3DA 2J9WA 1VK5A 2Q3TA 3AG3C 4CS9A 4C7OA 1MMNA 4O6NA 1MMAA 2J0XA 3S0XA 1Z63A 2A6EF 5BUOA 1OCCC 4YT4A 2EILC 3X1OA 2WL8A 2Y69C 4BJ5C 4J32B 2I8BA 3DM5A 2R7XA 2W45A 3LS0A 1D0ZA 3K66A 3WODF 4OIOF 2CW0F 5D92A 3B0UX 3LLKA 3RYLA 5EHHA 4OIRF 1BR1A 4PJJA 3DMDA 3SP1A 4W8KA 4JVSA 4BJ5A 3LLIA 4I1MA 2V26A 2WZGA 4KNVA 1BR2A 2Y3BA 3DM9B 1LS1A 2R7QA 3PMRA 2IXNA 3Q7LA 3T6JA 4PFPA 1MMGA 5L3VA 3JT1A 2ZXRA 1SF8A 2YEVA 5B1BC 4YT2A 4CS8C 3DAGA 5F5HA 1MMDA 5KYXB 2DYRC 4B6IA 4U5HA 2KJGA 4Q5SF 1VYIA 1N1CA 4HE8D 3V7OA 4BJ6A 5KYXA 4DVZA 2YHSA 5E2QA 3UR3C 2XL4A 4AE4B 4CBEA 2IYLD 2WVQA 4LLCA 3S27A 4G7HF 4CSAC 4AE4A 3EZIA 3W8HA 2XSEA 3EG9A 4NY3A 1J8YF 3IEEA 3UGPA 2Z15A 3LEVA 4RBNA 3EGXA 4O7GA 3E9VA 1TWGA 4FX5A 1ZHWA 3L34A 2Q9BA 3MLGA 4YJWA 3VYWA 3AG2C 3UGOA 1ZYRF 3JYHA 4YN0B 2OCCC 5T1DB 4BJ1A 3LAYA 1FTSA 2EINC 4OD5A 1QZXA 3OA1A 3EQLF 2MYSA 3EH1A 1ZHXA 4M63A 4JJFA 1WGWA 1V55C 4LACB 4DOZA 3RFYA 4XLNF 2J7PA 1ZHTA 4RDAA 1QLEC 4FESA 4KNWA 3ZG1A 5D91A 3NG1A 3X2QC 2H7VC 3N2ZB 3HLZA 3DJNB 2ZXPA 1OKKD 3EHMA 4I44A 4U5DE 1TWCA 1M2OA 4OD4A 4QDLA 2QTVA 3NRHA 2NUTA 1D1CA 1OCRC 3I5PA 4MNDA 4OINF 3KH2A 3QMKA 4G7ZF 2ZPAA 4KBLA 3O39A 3W2VA 3K7DA 1ZHYA 4HEAJ 3UMKA 5EGYA 2G62A 3N0TA 4CS7A 3NDBB 2H7OA 4IJJA 2IOQA 3Q6MA 1VYKA 5E3AA 4IRUA 1M2VB 2R7UA 4DVYP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F5F A;  4ZLC A;  4ZLD A;  4YWQ A;  4QI0 A;  5F5H A;  4QI2 A;  3X1O A;  4ULW A; 
#chains in the Genus database with same CATH topology
 2VCB A;  3ASN C;  2C04 A;  5L0C A;  3FMS A;  4MW3 A;  3K6B A;  1M2V A;  256B A;  1Z3I X;  2WZF A;  3ABM C;  4E7S A;  2L6F A;  2CCY A;  3H65 A;  4U5G A;  3U3B A;  1T01 A;  5JVE A;  1H7I A;  2ETS A;  1VOM A;  3GM3 A;  4JTA B;  3C8G B;  3F47 A;  4HFF B;  1BDJ B;  2Q00 A;  3NYL A;  4MVO A;  2G3V A;  3ZSU A;  3RH3 A;  4HFK B;  3TK0 A;  1AUE A;  2HV6 A;  2L6G A;  2HJ3 A;  4GEH A;  4E0I A;  5BQI A;  1VTM P;  3T4R A;  2JX0 A;  4YT8 A;  4JUR I;  3RF3 A;  4AX2 A;  1B68 A;  1BR4 A;  2NPU A;  2DGJ A;  4J7Y A;  1GM5 A;  5A6J A;  3G50 A;  5B3S C;  2M4E A;  2PX3 A;  2Y3G A;  2AWC A;  1JAF A;  2ZXO A;  4O6M A;  3FAP B;  5CI8 A;  4I1O B;  4Z9J A;  3RW0 A;  1G4W R;  4G78 A;  1HMO A;  3KYJ A;  3KYI A;  4KI2 A;  5BQH A;  1YYJ A;  2FFH A;  2VB6 A;  2J45 A;  3NYJ A;  3ZQV A;  1W2W A;  4DRJ B;  2VCA A;  3Q6N A;  2AWY A;  1RJ9 B;  2EIK C;  5EK0 A;  4JKV A;  4DJ9 A;  5DLJ A;  3S90 A;  3ABK C;  3DJU B;  5DQT A;  1ORS C;  1O87 A;  2OG2 A;  2R05 A;  3UGO A;  2Q4F A;  1NU7 D;  1ORY A;  4JW1 A;  1DOW A;  2P7V A;  1E85 A;  1RJ9 A;  3K1H A;  3EG9 B;  1PV3 A;  2CYD A;  1WAT A;  2HUJ A;  3FAJ A;  2EIJ C;  5COG A;  3UNG C;  4CS8 A;  2R7T A;  3HKK A;  4E7Z A;  2W4M A;  2E87 A;  4EUK B;  2WVN A;  3U8P A;  2X51 A;  1HE1 A;  2XLH A;  3EGX B;  2R7R A;  5HSW A;  2EPM X;  2HSQ A;  3TD7 A;  1T6U A;  3ZC4 A;  5COM A;  4ZLC A;  2BC5 A;  4ZLD A;  3IQT A;  1TWA A;  1JMW A;  2NG1 A;  1R4T A;  3DXJ F;  2LSE A;  2J0W A;  3MYI A;  3ATP A;  4ULW A;  2L81 A;  3L8I A;  2EIM C;  3E70 C;  4EBB A;  3V5X A;  2HJM A;  2XLM A;  2HSB A;  2CNW D;  1T9K A;  3SXZ A;  4XEK A;  1HMD A;  3Q7G A;  2P61 A;  4BJT A;  2PP4 A;  1O3U A;  2HMZ A;  4CSA A;  2H7B A;  2VH3 A;  3DAF A;  3JTL O;  1O5H A;  2QY9 A;  4U5F E;  2O9X A;  1ZZP A;  4MTF A;  1GGQ A;  3VRC A;  3PHF 2;  4CIP A;  1CPQ A;  2PF4 E;  3B9Q A;  2XXA B;  4XTK A;  3M4B A;  2GAQ A;  1Q0G A;  2HKV A;  3NKD A;  1NG1 A;  2M64 A;  3L1M A;  2R02 A;  4K1O A;  2GWW A;  2ZXW C;  3ITF A;  4P6I C;  2TMV P;  3LES A;  3CZ6 A;  4KC9 A;  1OR3 A;  4IWB A;  1WN0 A;  4PK4 A;  2R7S A;  4IAO A;  1TWH A;  3I5Q A;  5T3W A;  4BEM J;  4YWQ A;  3US6 A;  1XZP A;  2XXA A;  5KYY A;  4JCZ A;  2J46 A;  3M15 A;  2J9V A;  2D5R B;  1Z5Z A;  1LS4 A;  4YL1 A;  4G0H A;  3C8Z A;  4FWV A;  4P9T A;  1LI7 A;  4MVQ A;  1Y6D A;  2Q9A A;  5KYU B;  1LE2 A;  1E83 A;  2UUI A;  2NSF A;  2LP4 A;  4LER A;  2XLE A;  2R7W A;  1XZQ A;  3N24 A;  4PJM A;  1NU9 C;  1ZW3 A;  3T6B A;  4EWC A;  1TFK B;  3QTH A;  1EI7 A;  4XLP F;  1G8X A;  2NUT B;  4U9E A;  4MVM A;  3MBG A;  1CGO A;  1Z23 A;  3POV A;  3NKE A;  5KYU A;  4JCH A;  5E33 A;  3B71 A;  1VB5 A;  3RQG A;  1BBH A;  3ASO C;  1LE4 A;  1KU2 A;  3F46 A;  4MVZ A;  4N6H A;  1K05 A;  1FMW A;  2A1D D;  3AG4 C;  2WB7 A;  3K1I C;  2VAS A;  3DKA A;  4CS9 C;  3IQC A;  2QLA A;  1OQC A;  4FAP B;  3DD7 A;  1PD0 A;  3HNJ A;  1TKN A;  1WTY A;  1VLS A;  1F1M A;  1D0X A;  4U5C E;  3U9M A;  1L3P A;  3C18 A;  5BQG A;  3B0V C;  3R7C A;  1D0Y A;  3MFN A;  3OWT A;  3VAY A;  3RIP A;  3ZIB A;  1M56 C;  3UMI A;  3EH2 A;  4GQH A;  4MQ9 F;  5CIV A;  4JTC B;  1YVI A;  2G3K A;  4CX9 A;  4JRZ A;  4EKW A;  3AQC A;  2FGY A;  3I4U A;  4X0R A;  1M57 C;  4DRH B;  4IB4 A;  5L3Q A;  1MND A;  4JEB A;  4YT5 A;  5A6B D;  4O6Y A;  3JSZ A;  3C62 A;  3B0P A;  2IM8 A;  1VMA A;  3SNH A;  1IZM A;  3KKB A;  3S84 A;  1I4Z A;  2KGO A;  2W4B A;  3SXY A;  1ZHZ A;  3U2L A;  2A68 F;  3DI5 A;  4WJ0 A;  3ZWI A;  4G7O F;  1OCO C;  3W2W A;  3ZDL A;  5L0F A;  1OKK A;  3C8G D;  3RQF A;  3U8V A;  2YZS A;  3EZH A;  1WAS A;  3VF0 A;  2P6V A;  2Y3H A;  3GEH A;  3M4C A;  4DBQ A;  3GOD A;  4EIY A;  3ABL C;  5B1A C;  4C3E A;  4EBK A;  4DBR A;  3M1C B;  2Q9C A;  2KNH A;  4XPY A;  2L6H A;  2LFD A;  2J9U A;  2L7A A;  3ZQY A;  2HV7 A;  1LKX A;  3KPH A;  4E0H A;  1OXK A;  2ZD9 A;  3SYN A;  1JR8 A;  2BE5 F;  3U3F A;  1ST6 A;  3G4X A;  2HMQ A;  3RKO F;  1G4U S;  4WGY A;  1BZ4 A;  1JPN A;  1MNE A;  2CGE A;  2GA0 A;  3UMH A;  4C3B A;  5JUA A;  1IW7 F;  1Q0D A;  1R5I D;  3AG1 C;  4PJN A;  4EHP A;  4AL0 A;  5JRA A;  2GFH A;  5IY5 C;  1MQV A;  1ZVZ A;  1I5N A;  2A6H F;  4NQF A;  4WGZ A;  5F5F A;  3JZ0 A;  3NYM A;  3ZTZ A;  5A69 A;  3EJN A;  4QI0 A;  5L0D A;  4I3M A;  1QVX A;  5A6K A;  1WWP A;  3LS1 A;  4ONS A;  1TR2 A;  1YA7 O;  3DZA A;  4R32 A;  1D1B A;  3EHN A;  3JRT A;  2CDQ A;  4BJ6 C;  5AC5 A;  2OJQ A;  3A11 A;  3IQ5 A;  2FAP B;  1HW2 A;  1YYX A;  3RVY A;  3WAQ A;  1RKC A;  3LNR A;  4UDV A;  1OW7 A;  1VLT A;  2AU5 A;  2XLV A;  4PFO A;  1ZU5 A;  2PFD A;  3ZVR A;  1ORJ A;  2YLG A;  4U5B E;  3M79 A;  1A7E A;  5KYW B;  4Q7C A;  1QPU A;  3EGD B;  2ASR A;  2C03 A;  3EFO B;  3FHD A;  1AEP A;  4GYT A;  2HZ8 A;  4XWJ A;  4LLE A;  5T3T A;  2JD3 A;  3RVZ A;  3FVY A;  3V5Z A;  4BG0 A;  4PJL A;  3S29 A;  2R7O A;  5KYW A;  3EGD A;  1YJG A;  2KW3 C;  3EFO A;  4Q4Z F;  3HTK C;  2YL0 A;  2PNO A;  3LJB A;  4U5E E;  1NLX A;  4AK9 A;  5AC4 A;  3KL4 A;  5E3C A;  2IXM A;  1NFN A;  3SZR A;  2R7V A;  2AP3 A;  2YL7 A;  1JRA A;  4QI2 A;  1C02 A;  1TQG A;  1V54 C;  1PCX A;  2LD6 A;  1RXQ A;  2YL3 A;  3KMI A;  3OEO A;  2A69 F;  1WOL A;  2DB4 A;  2B0H A;  2YLD A;  3L0I A;  3SEO A;  4BEJ A;  2J7P D;  2OEV A;  5B3I A;  4AL1 A;  1FNT c;  1Q0K A;  5KYY B;  4OIQ F;  2OU6 A;  4CDV A;  1Y4C A;  1ZU4 A;  4K0D A;  1YAU O;  3O6X A;  3TOM A;  1FFT C;  5K0I A;  2IXO A;  2OJE D;  4Z9H A;  4E18 A;  3NMK A;  2V3C C;  1SMY F;  4JTD B;  1J8M F;  1JPJ A;  1SR2 A;  2DYS C;  2YQY A;  3GM2 A;  3GOR A;  5CI9 A;  2WVO A;  2PX0 A;  4WAB A;  1YZC A;  1A0B A;  1NZE A;  1CGM E;  4CIH A;  2MWQ A;  4BPM A;  4ANJ A;  2OKU A;  3T9O A;  4ER9 A;  5DQZ A;  3AOU A;  3LNM B;  2R03 A;  4A2N B;  2XRH A;  1E86 A;  1OCZ C;  2IXP A;  4J30 B;  4H4K C;  3TJ5 A;  1SZI A;  4XPW A;  1LM3 B;  1Q0M A;  1NSG B;  4CJO A;  5DS6 A;  1FMV A;  2CNW A;  2NUP B;  3W8I A;  5DS4 A;  3S28 A;  2B0J A;  3V5Y A;  2W9Y A;  3CQZ A;  3LEO A;  2YVK A;  3ECS A;  4IGG A;  5KYN A;  1YDI A;  3K33 A;  4YL3 A;  1CPR A;  3U0C A;  3HJC A;  4CDY A;  2KC3 A;  3QZC A;  4N06 A;  3NMJ A;  3FDQ A;  3GAN A;  3EPV A;  3AQB A;  2NUP A;  2Y39 A;  2R25 A;  2L9J A;  5L0G A;  2J9B A;  1LVK A;  3MX3 A;  2KQ9 A;  3SXK A;  3ZTM A;  3H2U A;  5L0H A;  4K7B A;  3CSK A;  5DS5 A;  4RD9 A;  2YL1 A;  4JZA A;  3GM1 A;  5DVW A;  4OIP F;  1K40 A;  2H8A A;  2Y3D A;  1RKE A;  1T5O A;  2KK1 A;  4E17 A;  4C7O B;  2WZL A;  3JCU Q;  3FXH A;  4JJG A;  1FFH A;  3J06 A;  1D1A A;  1PD1 A;  2XS1 A;  3WHN A;  1EA8 A;  3LUT B;  1DOV A;  1S7Z A;  3AGU A;  3WG7 C;  4F4B A;  1G5Z A;  2PBE A;  4O79 A;  4PAC A;  1Z6A A;  4C3D A;  4LDR A;  2J9W A;  1VK5 A;  3PCV A;  2Q3T A;  3DE9 A;  3K1I A;  3AG3 C;  4CS9 A;  4D4X A;  4C7O A;  2LCH A;  1MMN A;  1YAR O;  4O6N A;  1MMA A;  2J0X A;  1FAP B;  1I4Y A;  3S0X A;  1Z63 A;  2A6E F;  1NBB A;  5BUO A;  1OCC C;  1GS9 A;  1APC A;  4YT4 A;  1HW1 A;  2EIL C;  3X1O A;  2XLO A;  2WL8 A;  5GPG B;  2J8W A;  2Y69 C;  2P0N A;  2XS8 A;  4BJ5 C;  3ZG1 A;  1C03 A;  2MHR A;  4J32 B;  4D4N A;  1U89 A;  2I8B A;  3DM5 A;  2KSF A;  2QE9 A;  2R7X A;  1HE9 A;  4IAQ A;  2W45 A;  3LS0 A;  1D0Z A;  3K66 A;  3WOD F;  4OIO F;  2CW0 F;  5D92 A;  3B0U X;  3LLK A;  3RYL A;  3GEE A;  4OIR F;  5EHH A;  4NCQ A;  1BR1 A;  3GEI A;  1H6G A;  1OR2 A;  2D4U A;  1RCP A;  4MTG A;  4PJJ A;  3DMD A;  3SP1 A;  4W8K A;  1KTM A;  1H9G A;  4JVS A;  4BJ5 A;  2OEX A;  3HNK A;  3LLI A;  4I1M A;  2BL2 A;  4A4A A;  2V26 A;  4MVU A;  2WZG A;  3BRJ A;  4KNV A;  2GDC A;  5A6B A;  1BR2 A;  2Y3B A;  2YRF A;  1LS1 A;  3B29 A;  3DM9 B;  3GWN A;  5JS5 A;  2R7Q A;  1QQ3 A;  3PMR A;  3RQE A;  3TOL A;  2IXN A;  1OW8 A;  2LIG A;  3GWL A;  1GQA A;  3Q7L A;  1U6H A;  1S05 A;  5L0I A;  2YLI A;  3BEH A;  3T6J A;  4PFP A;  1MMG A;  5L3V A;  1NFO A;  3JT1 A;  2ZXR A;  1A41 A;  2X0C A;  1SF8 A;  3C8G A;  3O10 A;  2YEV A;  5B1B C;  4MS2 A;  4YT2 A;  5JLI A;  4JE9 A;  3VM6 A;  4CS8 C;  3DAG A;  3SXM A;  3TJ6 A;  5F5H A;  1JOG A;  1MMD A;  2IBF A;  3H2V A;  3NMI A;  4XPX A;  5AGF A;  3C63 A;  5KYX B;  2EPO A;  2DYR C;  4B6I A;  4U5H A;  2KJG A;  4Q5S F;  4ULV A;  3JRM O;  2LQG A;  4XEV A;  1VYI A;  1FR0 A;  1N1C A;  1QKR A;  4HE8 D;  3JYY A;  3HNL A;  3V7O A;  4BJ6 A;  5KYX A;  2QUP A;  4DVZ A;  2NSG A;  3HNI A;  3QVY A;  2YHS A;  5COF A;  5E2Q A;  3UR3 C;  4JEA A;  3MYF A;  2XL4 A;  4AE4 B;  5JT4 A;  3JSE O;  3PDM P;  1L7C A;  4CBE A;  4DRI B;  3DWW A;  2IYL D;  2WVQ A;  4LLC A;  3S27 A;  2RSE B;  1YA9 A;  1AVO B;  3TQO A;  2DI3 A;  2OOC A;  1HY5 A;  2XL6 A;  4G7H F;  1UFB A;  4JIO A;  4CSA C;  4AE4 A;  3EZI A;  1UG7 A;  2XLW A;  3CAX A;  3W8H A;  5JSL A;  2JPU A;  2XSE A;  3EG9 A;  4NY3 A;  4YL0 A;  1J8Y F;  1A7V A;  4JC7 A;  3IEE A;  3UGP A;  4EBJ A;  2Z15 A;  2QNL A;  3LEV A;  4RBN A;  3FOP A;  3QW0 A;  3EGX A;  4O7G A;  4YK5 A;  3W4Y A;  5HV9 A;  3E9V A;  1TWG A;  3AGT A;  2A0B A;  2LK4 A;  2R9R B;  4FX5 A;  1ZHW A;  3L34 A;  2P1A A;  4NTB A;  2A0U A;  2XL8 A;  1LIH A;  2Q9B A;  3CEX A;  3MLG A;  3AG2 C;  4YJW A;  3QVZ A;  2I15 A;  3VYW A;  5FCL A;  1ZYR F;  3A9C A;  3IPM O;  1C17 M;  4NTA A;  3TUL A;  1LI5 A;  2Q7R A;  1U0B B;  2ICW G;  4XQ1 A;  2RD9 A;  3C7J A;  4J7T A;  3JYH A;  4YN0 B;  3S9O A;  1SYQ A;  1QSP A;  2OCC C;  2XM4 A;  5T1D B;  1A7D A;  4BJ1 A;  3LAY A;  4LDQ A;  1FTS A;  2EIN C;  4OD5 A;  3L8J A;  1QZX A;  2UUH A;  3OA1 A;  3U2M A;  3EQL F;  2MYS A;  3EH1 A;  1ZHX A;  4M63 A;  1T6Q A;  1V74 B;  4MVR A;  4W8P A;  1EKY A;  4N6C A;  1EQ1 A;  5JP7 A;  1M6T A;  1OXB A;  4JJF A;  2EPN A;  1Z7Q c;  1WGW A;  1V55 C;  3QW1 A;  1V4A A;  2YWA A;  4LAC B;  4DOZ A;  1RKE B;  4H54 A;  3R2P A;  4L6R A;  2AVK A;  4XLN F;  2J7P A;  3RFY A;  1ZHT A;  4RDA A;  1QLE C;  2F22 A;  2HS5 A;  2LFF A;  4FES A;  4KNW A;  3NG1 A;  4MTO A;  1LPE A;  5D91 A;  3U9J A;  4P9F A;  3X2Q C;  4XEF A;  2H7V C;  1CGN A;  1YZA A;  2XLD A;  3N2Z B;  5L0J A;  4MW8 A;  2VCC A;  3HLZ A;  3DJN B;  1ZW2 A;  2ZXP A;  1T6I A;  1XWJ A;  1OKK D;  2YKZ A;  3EHM A;  4I44 A;  1TWC A;  4U5D E;  1M2O A;  4PR9 A;  3T6G B;  4CDA A;  4OD4 A;  1RMV A;  4QDL A;  1TFO B;  2QTV A;  3NRH A;  3O55 A;  2NUT A;  1D1C A;  1OCR C;  2EPK X;  4U9D A;  5FZT A;  2XM0 A;  4N4W A;  1E84 A;  3I5P A;  2VC9 A;  4MND A;  3KH2 A;  3QMK A;  5TJ5 E;  4OIN F;  2ZPA A;  4G7Z F;  4KBL A;  3O39 A;  1OW6 A;  3IHU A;  3W2V A;  5A6A A;  3FOO A;  3K7D A;  1ZHY A;  4HEA J;  1K04 A;  4NTF A;  3UMK A;  5EGY A;  1E2X A;  1Q0F A;  2G62 A;  3N0T A;  4CJG A;  4CS7 A;  1YLM A;  4Z9I A;  3NDB B;  2H7O A;  4DXW A;  2HFI A;  4IJJ A;  2OQM A;  2IOQ A;  3Q6M A;  3G4Z A;  4NC3 A;  3IQ6 A;  1VYK A;  1KNY A;  4MVS A;  5E3A A;  2KYH A;  4IRU A;  3AJM A;  3DE8 A;  1M2V B;  2R7U A;  4LDK A;  3U5S A;  5F28 E;  1H9T A;  2EPL X;  4IAR A;  4DVY P; 
#chains in the Genus database with same CATH homology
 3ASN C;  2C04 A;  3K6B A;  1M2V A;  2WZF A;  1Z3I X;  3ABM C;  4E7S A;  3H65 A;  4U5G A;  1VOM A;  3F47 A;  4HFF B;  3NYL A;  2G3V A;  3ZSU A;  3RH3 A;  4HFK B;  2HV6 A;  4GEH A;  3T4R A;  4YT8 A;  4JUR I;  4AX2 A;  1BR4 A;  2DGJ A;  5B3S C;  2M4E A;  2PX3 A;  2Y3G A;  2ZXO A;  4O6M A;  5CI8 A;  4I1O B;  4KI2 A;  2FFH A;  2VB6 A;  2J45 A;  3NYJ A;  1W2W A;  3Q6N A;  1RJ9 B;  2EIK C;  5DLJ A;  3ABK C;  3DJU B;  5DQT A;  2OG2 A;  1O87 A;  1NU7 D;  4JW1 A;  2P7V A;  1RJ9 A;  3K1H A;  3EG9 B;  3FAJ A;  3UNG C;  4CS8 A;  2EIJ C;  2R7T A;  4E7Z A;  2W4M A;  2E87 A;  2WVN A;  2X51 A;  3EGX B;  2R7R A;  5HSW A;  3TD7 A;  3ZC4 A;  4ZLC A;  4ZLD A;  1TWA A;  2NG1 A;  3DXJ F;  2LSE A;  2J0W A;  4ULW A;  2L81 A;  2EIM C;  3E70 C;  4EBB A;  2CNW D;  3Q7G A;  4BJT A;  2PP4 A;  4CSA A;  2H7B A;  2VH3 A;  3DAF A;  1O5H A;  2QY9 A;  4U5F E;  2O9X A;  3PHF 2;  2PF4 E;  3B9Q A;  2XXA B;  4XTK A;  3NKD A;  1NG1 A;  2ZXW C;  3ITF A;  4P6I C;  3LES A;  3CZ6 A;  4KC9 A;  2R7S A;  4IWB A;  4PK4 A;  4IAO A;  1TWH A;  3I5Q A;  5T3W A;  4YWQ A;  2XXA A;  5KYY A;  2J46 A;  2J9V A;  2D5R B;  1Z5Z A;  4G0H A;  4FWV A;  2Q9A A;  5KYU B;  4LER A;  2R7W A;  3N24 A;  4PJM A;  3T6B A;  1NU9 C;  4EWC A;  4XLP F;  1G8X A;  2NUT B;  1Z23 A;  3POV A;  3NKE A;  5KYU A;  4JCH A;  5E33 A;  3ASO C;  1KU2 A;  3F46 A;  1FMW A;  2A1D D;  3AG4 C;  2WB7 A;  3K1I C;  2VAS A;  4CS9 C;  3DD7 A;  1PD0 A;  1TKN A;  4U5C E;  1D0X A;  3B0V C;  1D0Y A;  3OWT A;  3VAY A;  3RIP A;  3ZIB A;  1M56 C;  3UMI A;  3EH2 A;  4MQ9 F;  2G3K A;  3AQC A;  2FGY A;  3I4U A;  4X0R A;  1M57 C;  5L3Q A;  1MND A;  4YT5 A;  4O6Y A;  3JSZ A;  3B0P A;  1VMA A;  3SNH A;  1IZM A;  3KKB A;  2KGO A;  2W4B A;  1ZHZ A;  2A68 F;  4WJ0 A;  4G7O F;  1OCO C;  3W2W A;  1OKK A;  2YZS A;  3EZH A;  2P6V A;  2Y3H A;  4DBQ A;  3GOD A;  3ABL C;  5B1A C;  4C3E A;  4DBR A;  3M1C B;  2Q9C A;  2KNH A;  2J9U A;  2HV7 A;  1LKX A;  3SYN A;  2BE5 F;  1ST6 A;  3RKO F;  5FCL A;  1JPN A;  1MNE A;  2CGE A;  4C3B A;  3UMH A;  1IW7 F;  4PJN A;  3AG1 C;  2GFH A;  5IY5 C;  2A6H F;  5F5F A;  3NYM A;  3EJN A;  4QI0 A;  4I3M A;  3LS1 A;  1TR2 A;  3DZA A;  1D1B A;  3EHN A;  3JRT A;  2CDQ A;  4BJ6 C;  3LNR A;  4PFO A;  3ZVR A;  1ZU5 A;  2PFD A;  4U5B E;  5KYW B;  4Q7C A;  3EGD B;  2C03 A;  3EFO B;  3FHD A;  4GYT A;  4XWJ A;  4LLE A;  5T3T A;  2JD3 A;  3FVY A;  4BG0 A;  4PJL A;  3S29 A;  2R7O A;  5KYW A;  3EGD A;  2KW3 C;  3EFO A;  4Q4Z F;  3HTK C;  3LJB A;  4U5E E;  4AK9 A;  3KL4 A;  5E3C A;  2IXM A;  3SZR A;  2R7V A;  4QI2 A;  1V54 C;  1PCX A;  3KMI A;  3OEO A;  2A69 F;  3L0I A;  4BEJ A;  3SEO A;  2J7P D;  5KYY B;  4OIQ F;  1ZU4 A;  4K0D A;  3O6X A;  1FFT C;  2V3C C;  2IXO A;  1SMY F;  1J8M F;  1JPJ A;  2DYS C;  5CI9 A;  2WVO A;  2PX0 A;  1NZE A;  4CIH A;  2MWQ A;  4ANJ A;  5DQZ A;  4A2N B;  2XRH A;  1OCZ C;  2IXP A;  4J30 B;  4H4K C;  1SZI A;  5DS6 A;  1FMV A;  2CNW A;  2NUP B;  3W8I A;  5DS4 A;  3S28 A;  2B0J A;  2W9Y A;  3CQZ A;  3ECS A;  5KYN A;  3K33 A;  3HJC A;  3QZC A;  4N06 A;  3FDQ A;  3GAN A;  3EPV A;  3AQB A;  2NUP A;  2Y39 A;  2L9J A;  1LVK A;  3MX3 A;  2KQ9 A;  4K7B A;  3CSK A;  5DS5 A;  4RD9 A;  4JZA A;  5DVW A;  4OIP F;  2Y3D A;  4C7O B;  2WZL A;  3JCU Q;  4JJG A;  1FFH A;  1D1A A;  1PD1 A;  1S7Z A;  3WG7 C;  4F4B A;  4O79 A;  1Z6A A;  4C3D A;  2J9W A;  1VK5 A;  2Q3T A;  3AG3 C;  4CS9 A;  4C7O A;  1MMN A;  4O6N A;  1MMA A;  2J0X A;  3S0X A;  1Z63 A;  2A6E F;  5BUO A;  1OCC C;  4YT4 A;  2EIL C;  3X1O A;  2WL8 A;  2Y69 C;  4BJ5 C;  4J32 B;  2I8B A;  3DM5 A;  2R7X A;  2W45 A;  3LS0 A;  1D0Z A;  3K66 A;  3WOD F;  4OIO F;  2CW0 F;  5D92 A;  3B0U X;  3LLK A;  3RYL A;  5EHH A;  4OIR F;  1BR1 A;  4PJJ A;  3DMD A;  3SP1 A;  4W8K A;  4JVS A;  4BJ5 A;  3LLI A;  4I1M A;  2V26 A;  2WZG A;  4KNV A;  1BR2 A;  2Y3B A;  3DM9 B;  1LS1 A;  2R7Q A;  3PMR A;  2IXN A;  3Q7L A;  3T6J A;  4PFP A;  1MMG A;  5L3V A;  3JT1 A;  2ZXR A;  1SF8 A;  2YEV A;  5B1B C;  4YT2 A;  4CS8 C;  3DAG A;  5F5H A;  1MMD A;  5KYX B;  2DYR C;  4B6I A;  4U5H A;  2KJG A;  4Q5S F;  1VYI A;  1N1C A;  4HE8 D;  3V7O A;  4BJ6 A;  5KYX A;  4DVZ A;  2YHS A;  5E2Q A;  3UR3 C;  2XL4 A;  4AE4 B;  4CBE A;  2IYL D;  2WVQ A;  4LLC A;  3S27 A;  4G7H F;  4CSA C;  4AE4 A;  3EZI A;  3W8H A;  2XSE A;  3EG9 A;  4NY3 A;  1J8Y F;  3IEE A;  3UGP A;  2Z15 A;  3LEV A;  4RBN A;  3EGX A;  4O7G A;  3E9V A;  1TWG A;  4FX5 A;  1ZHW A;  3L34 A;  2Q9B A;  3MLG A;  4YJW A;  3VYW A;  3AG2 C;  3UGO A;  1ZYR F;  3JYH A;  4YN0 B;  2OCC C;  5T1D B;  4BJ1 A;  3LAY A;  1FTS A;  2EIN C;  4OD5 A;  1QZX A;  3OA1 A;  3EQL F;  2MYS A;  3EH1 A;  1ZHX A;  4M63 A;  4JJF A;  1WGW A;  1V55 C;  4LAC B;  4DOZ A;  3RFY A;  4XLN F;  2J7P A;  1ZHT A;  4RDA A;  1QLE C;  4FES A;  4KNW A;  3ZG1 A;  5D91 A;  3NG1 A;  3X2Q C;  2H7V C;  3N2Z B;  3HLZ A;  3DJN B;  2ZXP A;  1OKK D;  3EHM A;  4I44 A;  4U5D E;  1TWC A;  1M2O A;  4OD4 A;  4QDL A;  2QTV A;  3NRH A;  2NUT A;  1D1C A;  1OCR C;  3I5P A;  4MND A;  4OIN F;  3KH2 A;  3QMK A;  4G7Z F;  2ZPA A;  4KBL A;  3O39 A;  3W2V A;  3K7D A;  1ZHY A;  4HEA J;  3UMK A;  5EGY A;  2G62 A;  3N0T A;  4CS7 A;  3NDB B;  2H7O A;  4IJJ A;  2IOQ A;  3Q6M A;  1VYK A;  5E3A A;  4IRU A;  1M2V B;  2R7U A;  4DVY P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...