5F5FA

X-ray structure of roquin roq domain in complex with a selex-derived hexa-loop rna motif
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
152
structure length
152
Chain Sequence
NPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-1
publication title Roquin recognizes a non-canonical hexaloop structure in the 3'-UTR of Ox40.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 152
sequence length 152
chains with identical sequence C, E, G
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2015-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5f5fA00
3X1OA 5F5FA 4YWQA 4ZLDA 5F5HA 4QI0A 4ZLCA 4ULWA 4QI2A
chains in the Genus database with same CATH superfamily
4LERA 3L1MA 2ASRA 1YARO 3ABKC 4J7TA 3A9CA 3M79A 3U9JA 4J30B 1MMDA 5L0JA 3L0IA 2R7OA 4YT4A 4XEKA 3NYLA 4RD9A 1PCXA 1LPEA 3FAPB 2VCAA 1OR3A 2CNWD 4BJ1A 4CSAC 2J46A 2QLAA 3WAQA 1MMNA 2R7WA 4EBKA 4NC3A 1H9GA 2WVQA 3T6BA 4PACA 2HKVA 4O6MA 4OINF 1Z63A 3V5XA 2YRFA 2VCBA 3LNMB 4MW3A 2VB6A 3FAJA 4WGZA 4BG0A 2YWAA 1EQ1A 2HUJA 2WZFA 1KU2A 1HMOA 1QQ3A 4G0HA 3UMHA 4AL0A 3S84A 1SF8A 2OEXA 2LCHA 3M1CB 3OEOA 4MS2A 2J7PD 4DBRA 1VLSA 1T6UA 3DE9A 2L6GA 3G4XA 1H9TA 4YN0B 3FMSA 5E33A 3IQ6A 2R7SA 5A6AA 2HSQA 2E87A 4U5CE 2NUTB 3NMJA 2UUHA 4DJ9A 2NSGA 2EIJC 3ZC4A 4ER9A 5T3TA 2YL0A 4LACB 2EPOA 3KKBA 1RJ9B 1TR2A 1A7EA 3S0XA 1JAFA 5KYNA 3G50A 1CGME 3JT1A 3AOUA 4XEFA 1K04A 1JPJA 3CAXA 4AE4B 2J9BA 3AQBA 4DRJB 3WODF 5L0FA 3HJCA 4O6YA 3FXHA 1UG7A 2FFHA 5CI9A 2CDQA 2IXMA 3TJ5A 1BBHA 4BEMJ 4C3EA 1O87A 1Z7Qc 2G3VA 1Q0FA 4HEAJ 4N6HA 3ZTMA 1V55C 5L3VA 3ASOC 2G62A 3X2QC 4G7HF 4PFPA 1AUEA 2IXNA 3C8ZA 1Q0KA 3NRHA 1SZIA 4KNVA 5COGA 3JSZA 1D0XA 4XQ1A 3EGDA 4NY3A 1LI5A 4DOZA 3QMKA 2KGOA 5E2QA 1IW7F 1LVKA 3ASNC 3G4ZA 5EHHA 3AQCA 3DM5A 4LDKA 3T9OA 2X0CA 1WN0A 2OG2A 1TKNA 4O6NA 4JW1A 2YHSA 1HW2A 2YLIA 2JX0A 2AP3A 4H4KC 2CW0F 2KYHA 1M2VB 4XLPF 1G4WR 1YA9A 4JRZA 1T01A 3L8JA 4BJTA 2WB7A 4JVSA 2J7PA 1NU9C 1SMYF 2R25A 4LDRA 3US6A 4XPWA 2KK1A 4U5EE 5KYUA 3UNGC 3VF0A 1OQCA 1LI7A 3LAYA 2A68F 3RW0A 3NKDA 4BJ5C 4GYTA 2XM4A 1C02A 2HMQA 3VYWA 3U2LA 1C17M 3B0VC 2R7XA 4BPMA 1VTMP 4JTAB 1SYQA 3RYLA 1NBBA 2LIGA 5BUOA 2LFDA 1D0ZA 5A69A 2Z15A 3C62A 3GM1A 3RQGA 2C03A 3N2ZB 4LDQA 3JRTA 1RCPA 1NSGB 2B0JA 2HMZA 2FAPB 2QTVA 2RD9A 1ZVZA 2VC9A 4GQHA 4U9DA 5HV9A 1RXQA 2HZ8A 3CSKA 3EHMA 3ZIBA 1K05A 4MVOA 4YK5A 3SXKA 2MYSA 4EIYA 3QW1A 2HV6A 2XLDA 3MBGA 1D1CA 2WZGA 3MLGA 1DOVA 4O79A 4OD5A 3A11A 2OCCC 4NTFA 4YL3A 4CX9A 5B3IA 2ICWG 1I5NA 3AG3C 1IZMA 2IXPA 4CS8A 3U9MA 4JTCB 4PJNA 1G5ZA 2WVOA 3UMIA 4FX5A 5JS5A 2L9JA 4NQFA 1JR8A 5L0IA 3GANA 3L34A 3ZSUA 3WHNA 3S27A 5D91A 1L3PA 2YVKA 5F5HA 4JCZA 4MTOA 4EUKB 1TWCA 3C7JA 3QVYA 4CDVA 4Q5SF 4IRUA 1QZXA 5F5FA 1YJGA 1OXBA 1RKCA 3B29A 4N06A 4PFOA 3RIPA 3S28A 3DAFA 4U5GA 1ZHTA 3F46A 1NFOA 1V4AA 3ZDLA 2XLEA 1E86A 4DBQA 3HNIA 5KYUB 3TD7A 4OIPF 3KMIA 5B3SC 1OCCC 2PX0A 3K7DA 4MVSA 3L8IA 4OIOF 5T1DB 2W45A 2PFDA 4LLEA 5JT4A 4KBLA 1WATA 2CGEA 4J32B 3N0TA 4E0IA 4RDAA 2HS5A 1ORYA 2AWCA 3ZTZA 1BR1A 3SEOA 2GFHA 4JEAA 1LE2A 1M2OA 3DJNB 4MQ9F 4ONSA 1CPRA 3M15A 4MVZA 3W8HA 3SXZA 3U8VA 4Z9JA 2PBEA 1JRAA 1QKRA 3HKKA 4DVZA 3MYIA 1E2XA 4B6IA 1WASA 5FZTA 2ZD9A 3AGTA 3B71A 1YAUO 5COFA 3DXJF 2J0WA 3K33A 3LS0A 4HFFB 4E17A 2EPLX 5D92A 3V5YA 2FGYA 3RF3A 2PNOA 3IQ5A 1U6HA 3PHF2 4YT5A 2MWQA 2OU6A 4NCQA 3ZG1A 1Z5ZA 3RQEA 1VYKA 1VOMA 2EPMX 2HSBA 2MHRA 2XLVA 1KNYA 2GWWA 3C8GA 4M63A 4ULWA 1N1CA 1ORSC 3RKOF 4U5BE 3DJUB 2BL2A 2DB4A 5EGYA 3K6BA 1APCA 2A6EF 2XM0A 1Z3IX 1G8XA 3AG2C 2CYDA 5JLIA 3NMKA 4IAOA 2Q4FA 4QDLA 4IB4A 4E0HA 2NG1A 3DM9B 3PMRA 2YEVA 2V26A 4DRIB 2CCYA 3FDQA 2EINC 1D0YA 1Q0GA 2XLOA 2AU5A 2IOQA 2YZSA 3PCVA 5KYWB 3GEHA 2TMVP 3B0PA 4C7OB 1KTMA 3EG9B 3M4CA 1M6TA 1FTSA 3EGXA 4HFKB 3R7CA 1FMWA 5JSLA 1OW7A 4N6CA 1CGNA 3HLZA 3T4RA 3ZVRA 2M4EA 3AG4C 3LUTB 5EK0A 2YLGA 4PJMA 4WJ0A 4Q4ZF 3ZQYA 5K0IA 5DVWA 2Q9AA 1HY5A 1QLEC 3S9OA 1TFKB 3K66A 4IJJA 3C63A 4KI2A 1TFOB 2Y39A 2W9YA 3DAGA 2PF4E 1LE4A 5BQGA 4CJGA 4X0RA 2HJMA 1OKKA 1DOWA 4R32A 2KNHA 3DZAA 2R7RA 2I8BA 1TQGA 2IM8A 4QI0A 1B68A 2PX3A 3IQTA 4RBNA 4ZLCA 4JURI 1S05A 3TOLA 4DRHB 4MNDA 4W8PA 2M64A 3ABMC 3RH3A 4YWQA 1OW6A 1YA7O 1D1AA 3DMDA 4P9FA 4XTKA 4I44A 4H54A 4CDYA 3W2VA 2Y69C 5KYXA 4XPYA 5T3WA 1T9KA 1MMAA 2UUIA 1C03A 1A7VA 1YDIA 3I5QA 2R9RB 3JYHA 1NU7D 1T6IA 3EFOA 1QPUA 1HE1A 2J9UA 3N24A 4BJ5A 5JVEA 2AVKA 1Q0DA 1JPNA 2DI3A 3R2PA 4UDVA 3U2MA 1TWHA 2LP4A 1U0BB 5L0GA 4BJ6A 1A0BA 3NKEA 3VM6A 3RQFA 3M4BA 4CIHA 4JE9A 3KYJA 1PD1A 3EJNA 4JJGA 5COMA 1WTYA 2L7AA 3H65A 5GPGB 5AC5A 4MTGA 4ANJA 3EGXB 3NDBB 1AEPA 4XWJA 2L81A 1V74B 4P9TA 5DS6A 3SYNA 2Q7RA 3W2WA 1JMWA 3SXYA 1YLMA 2B0HA 1ZZPA 2PP4A 4EBJA 1TWGA 1NG1A 4CS9A 5KYYA 2OQMA 4E7ZA 4IAQA 2IXOA 2WZLA 3EGDB 1Y6DA 2LQGA 1MMGA 2IBFA 1BR4A 2IYLD 3TOMA 1AVOB 3C8GD 3T6GB 3AG1C 1XZQA 1LM3B 1RMVA 2A0UA 2JD3A 4CS7A 4E7SA 3LLKA 1LIHA 2P6VA 4JJFA 1W2WA 2V3CC 1ZU4A 1H7IA 4KNWA 4ULVA 2H7BA 2XS1A 4L6RA 5B1AC 1L7CA 5BQHA 3K1IC 5DQZA 2KW3C 4Q7CA 4CS8C 3LESA 3POVA 1D1BA 4U5HA 5L0CA 2D4UA 3WG7C 2YL1A 1JOGA 4MW8A 5KYXB 2YL3A 3ZQVA 5DLJA 4HE8D 3NG1A 4O7GA 4Z9HA 3GWNA 5JRAA 3UGOA 4AX2A 2HFIA 3ECSA 1GQAA 3QZCA 3U8PA 3EFOB 2ETSA 2JPUA 2KQ9A 2R7VA 5DS5A 1A41A 1LKXA 1RJ9A 1VK5A 4BEJA 2XSEA 1HE9A 1ST6A 1F1MA 3HTKC 5TJ5E 4EKWA 1VB5A 4K7BA 3B0UX 2KC3A 2NSFA 2NUPA 4AE4A 5A6BD 2X51A 3RVYA 4CDAA 1YYXA 3KL4A 2Q3TA 3NMIA 1O3UA 1OKKD 4W8KA 4CSAA 2R7UA 1OW8A 2AWYA 2ZXOA 2OKUA 1FFTC 5FCLA 4EWCA 1T5OA 3J06A 1Q0MA 1BZ4A 2ZXRA 3LNRA 5HSWA 4OIQF 3U0CA 3B9QA 4C3DA 2OEVA 2DYSC 2Q9CA 3Q6NA 4IWBA 2W4BA 4YJWA 5E3CA 3SP1A 2VH3A 1CPQA 4C3BA 3DKAA 4YT8A 5KYYB 4F4BA 3O39A 1QVXA 1Z6AA 3FOOA 2F22A 1ZU5A 3LEVA 3W8IA 4DVYP 3JSEO 4MVQA 1NZEA 5JP7A 2YL7A 3JTLO 4PR9A 4OIRF 3GEIA 4FWVA 4MTFA 5L0HA 2XLMA 4CIPA 1GM5A 4A2NB 4EHPA 2Y3GA 5A6KA 2VCCA 1U89A 1WWPA 1UFBA 3V7OA 4G78A 2EIKC 2EPNA 4N4WA 1M2VA 2DGJA 2LD6A 2Y3BA 1HW1A 3IHUA 1ZHWA 1YYJA 1CGOA 2R05A 2OJQA 2P61A 3CQZA 1FNTc 3Q6MA 3EH1A 3PDMP 2R7QA 3S90A 2L6HA 1FMVA 2Y3DA 2XRHA 3OA1A 1XWJA 3BEHA 3CEXA 4GEHA 4YL1A 2A69F 1VLTA 1ZHXA 3Q7GA 4JZAA 2EILC 2J45A 3JYYA 2ZXWC 1SR2A 2L6FA 4LLCA 4XLNF 1YZCA 1LS1A 4U5DE 3RVZA 1Y4CA 2P7VA 4E18A 5A6BA 2QY9A 1NLXA 2NUPB 5L0DA 5F28E 1H6GA 1NFNA 3W4YA 3ZWIA 1M56C 1RKEA 2QUPA 2HV7A 2R02A 4I3MA 3U3FA 2XL6A 2LK4A 4U9EA 4NTBA 4AL1A 3DD7A 3RFYA 2YKZA 3K1HA 4JTDB 4PJJA 2D5RB 3VAYA 1GGQA 3DI5A 3NYJA 1Z23A 3S29A 5BQIA 3JCUQ 1HMDA 3MFNA 1R5ID 3E9VA 5A6JA 1E85A 2WVNA 2Y3HA 4YT2A 1J8YF 1EA8A 3ATPA 4MVRA 1WGWA 4D4XA 3TQOA 1J8MF 4EBBA 1T6QA 3C8GB 1I4ZA 3IPMO 2CNWA 3MX3A 4K0DA 1S7ZA 2BC5A 2EPKX 3H2UA 4YL0A 5L3QA 2GAQA 4XPXA 2XLHA 3QTHA 1R4TA 1VYIA 2I15A 3GODA 2KJGA 4JEBA 3V5ZA 5DS4A 2C04A 5AGFA 3LEOA 5E3AA 3NYMA 2XLWA 3QW0A 2NPUA 3I4UA 1E83A 4AK9A 2A0BA 5JUAA 4IGGA 3EZHA 2Q00A 4DXWA 2XXAA 3LS1A 3I5PA 1E84A 2J0XA 256BA 4JC7A 2A1DD 2J8WA 1O5HA 2BE5F 3F47A 2XL8A 3KYIA 3EZIA 4PK4A 1WOLA 4OD4A 2QE9A 4CBEA 5CI8A 5CIVA 2XS8A 1K40A 4FAPB 2LFFA 1TWAA 3U5SA 1ORJA 2J9WA 1GS9A 3LJBA 4JCHA 3E70C 3O10A 2GA0A 2EIMC 4IARA 3JZ0A 1A7DA 2G3KA 4BJ6C 3O55A 3HNJA 1BDJB 3IEEA 1EKYA 2DYRC 1V54C 2WL8A 3GORA 4U5FE 1ZYRF 3FOPA 4D4NA 1I4YA 4MVUA 1FFHA 1OXKA 1EI7A 4MVMA 4XEVA 1RKEB 2OJED 2GDCA 4I1OB 4J7YA 1ZHYA 3AGUA 3TJ6A 3OWTA 3KPHA 5AC4A 2Q9BA 2VASA 3FHDA 4P6IC 4A4AA 1M57C 1MNEA 5B1BC 3U3BA 5DQTA 3QVZA 4PJLA 1YVIA 4QI2A 3X1OA 1XZPA 2P0NA 2H8AA 2P1AA 3GM2A 4CS9C 3TULA 4G7OF 3BRJA 1OCOC 3EPVA 5IY5C 2HJ3A 3K1IA 3KH2A 1YZAA 2RSEB 1LS4A 3C18A 1OCZC 1ZW3A 1MNDA 2KSFA 4CJOA 2XL4A 1ZW2A 3VRCA 3DE8A 3GM3A 4FESA 3CZ6A 4Z9IA 1BR2A 1PV3A 2ZPAA 3EHNA 2A6HF 3O6XA 2NUTA 2OOCA 4ZLDA 2W4MA 3GEEA 2YLDA 2J9VA 3HNLA 1QSPA 3JRMO 4K1OA 3EH2A 3SNHA 1ZHZA 2XXAB 2R03A 3HNKA 2O9XA 1MQVA 2QNLA 3Q7LA 3SXMA 3ABLC 3FVYA 1FAPB 2YQYA 3LLIA 4NTAA 1OCRC 3TK0A 4KC9A 2ZXPA 4WABA 3GWLA 3EQLF 2R7TA 4JIOA 1OR2A 3UMKA 3DWWA 5KYWA 1G4US 3UGPA 4JKVA 4G7ZF 1VMAA 3IQCA 2H7VC 4WGYA 1FR0A 4C7OA 4I1MA 3EG9A 1PD0A 3SZRA 3H2VA 2LSEA 2H7OA 3AJMA 3ITFA 3MYFA 3UR3C 3T6JA
chains in the Genus database with same CATH topology
4LERA 3ABKC 4J30B 1MMDA 3L0IA 2R7OA 4YT4A 3NYLA 4RD9A 1PCXA 2CNWD 4BJ1A 4CSAC 2J46A 1MMNA 2R7WA 2WVQA 3T6BA 1Z63A 4O6MA 4OINF 2VB6A 3FAJA 4BG0A 2WZFA 4G0HA 1KU2A 3UMHA 1SF8A 3M1CB 3OEOA 4DBRA 2J7PD 2R7SA 4YN0B 5E33A 2E87A 4U5CE 2NUTB 2EIJC 3ZC4A 5T3TA 4LACB 3KKBA 1RJ9B 1TR2A 3S0XA 5KYNA 3JT1A 1JPJA 4AE4B 3AQBA 3WODF 3HJCA 4O6YA 4C3EA 5CI9A 2FFHA 2CDQA 2IXMA 1O87A 2G3VA 4HEAJ 1V55C 5L3VA 3ASOC 2G62A 3X2QC 4G7HF 4PFPA 2IXNA 3NRHA 1SZIA 4KNVA 3JSZA 1D0XA 3EGDA 4NY3A 4DOZA 3QMKA 2KGOA 5E2QA 1IW7F 1LVKA 3ASNC 5EHHA 3AQCA 3DM5A 2OG2A 1TKNA 4O6NA 4JW1A 2YHSA 4H4KC 2CW0F 4XLPF 1M2VB 4BJTA 2WB7A 4JVSA 2J7PA 1NU9C 1SMYF 4U5EE 5KYUA 3UNGC 3LAYA 2A68F 3NKDA 4BJ5C 4GYTA 3VYWA 3B0VC 2R7XA 3RYLA 5BUOA 1D0ZA 2Z15A 2C03A 3N2ZB 3JRTA 2B0JA 2QTVA 3CSKA 3EHMA 3ZIBA 2MYSA 2HV6A 4OD5A 1D1CA 2WZGA 3MLGA 4O79A 2OCCC 3AG3C 1IZMA 2IXPA 4CS8A 4PJNA 2WVOA 3UMIA 4FX5A 2L9JA 3GANA 3L34A 3ZSUA 3S27A 5D91A 5F5HA 1TWCA 4Q5SF 4IRUA 1QZXA 5F5FA 4N06A 4PFOA 3RIPA 3S28A 3DAFA 4U5GA 1ZHTA 3F46A 4DBQA 5KYUB 3TD7A 4OIPF 3KMIA 5B3SC 1OCCC 2PX0A 3K7DA 4OIOF 5T1DB 2W45A 2PFDA 4LLEA 4KBLA 2CGEA 4J32B 3N0TA 4RDAA 1BR1A 3SEOA 2GFHA 4MQ9F 1M2OA 3DJNB 3W8HA 4DVZA 4B6IA 3DXJF 2J0WA 3K33A 3LS0A 4HFFB 5D92A 2FGYA 3PHF2 4YT5A 2MWQA 3ZG1A 1Z5ZA 1VYKA 1VOMA 4M63A 4ULWA 1N1CA 3RKOF 4U5BE 3DJUB 5EGYA 3K6BA 2A6EF 3AG2C 1Z3IX 1G8XA 4IAOA 4QDLA 2NG1A 3DM9B 3PMRA 2YEVA 2V26A 3FDQA 2EINC 1D0YA 2YZSA 5KYWB 2IOQA 3B0PA 4C7OB 3EG9B 1FTSA 3EGXA 4HFKB 1FMWA 3HLZA 3T4RA 3ZVRA 2M4EA 3AG4C 4PJMA 4WJ0A 4Q4ZF 5DVWA 2Q9AA 1QLEC 3K66A 4IJJA 4KI2A 2Y39A 2W9YA 3DAGA 2PF4E 4X0RA 1OKKA 2KNHA 3DZAA 2R7RA 2I8BA 4QI0A 4ZLCA 2PX3A 4RBNA 4JURI 4MNDA 3RH3A 3ABMC 4YWQA 1D1AA 3DMDA 4XTKA 4I44A 3W2VA 2Y69C 5KYXA 5T3WA 1MMAA 3I5QA 3JYHA 1NU7D 3EFOA 3N24A 2J9UA 4BJ5A 1JPNA 1TWHA 4BJ6A 3NKEA 4CIHA 1PD1A 3EJNA 4JJGA 3H65A 4ANJA 3EGXB 3NDBB 4XWJA 2L81A 5DS6A 3SYNA 3W2WA 2PP4A 1TWGA 1NG1A 4CS9A 5KYYA 4E7ZA 2IXOA 2WZLA 3EGDB 1MMGA 1BR4A 2IYLD 3AG1C 2JD3A 4CS7A 4E7SA 3LLKA 2P6VA 4JJFA 1W2WA 2V3CC 1ZU4A 4KNWA 5B1AC 2H7BA 3K1IC 5DQZA 2KW3C 4Q7CA 4CS8C 3LESA 3POVA 1D1BA 4U5HA 3WG7C 5KYXB 5DLJA 4HE8D 3NG1A 4O7GA 3UGOA 4AX2A 3ECSA 3QZCA 3EFOB 2KQ9A 2R7VA 5DS5A 4BEJA 1LKXA 1RJ9A 1VK5A 2XSEA 1ST6A 3HTKC 3B0UX 4K7BA 2NUPA 4AE4A 2X51A 3KL4A 2Q3TA 4CSAA 4W8KA 1OKKD 2R7UA 2ZXOA 1FFTC 5FCLA 4EWCA 2ZXRA 3LNRA 5HSWA 4OIQF 3B9QA 4C3DA 4YJWA 2DYSC 2Q9CA 3Q6NA 4IWBA 2W4BA 5E3CA 3SP1A 4C3BA 2VH3A 4YT8A 5KYYB 4F4BA 3O39A 1Z6AA 3W8IA 3LEVA 1ZU5A 4DVYP 1NZEA 4OIRF 4FWVA 4A2NB 2Y3GA 3V7OA 2EIKC 1M2VA 2DGJA 2Y3BA 1ZHWA 3CQZA 3Q6MA 3EH1A 2R7QA 2Y3DA 1FMVA 2XRHA 3OA1A 4GEHA 2A69F 1ZHXA 3Q7GA 4JZAA 2EILC 2J45A 2ZXWC 4LLCA 4XLNF 1LS1A 4U5DE 2P7VA 2QY9A 2NUPB 1M56C 2HV7A 4I3MA 3DD7A 3RFYA 3K1HA 3VAYA 4PJJA 2D5RB 3NYJA 1Z23A 3S29A 3JCUQ 3E9VA 2WVNA 2Y3HA 4YT2A 1J8YF 1WGWA 1J8MF 4EBBA 2CNWA 3MX3A 4K0DA 1S7ZA 5L3QA 1VYIA 3GODA 2KJGA 5DS4A 2C04A 5E3AA 3NYMA 3I4UA 4AK9A 2XXAA 3EZHA 3LS1A 3I5PA 2J0XA 2A1DD 1O5HA 2BE5F 3F47A 3EZIA 4PK4A 4OD4A 4CBEA 5CI8A 1TWAA 3LJBA 2J9WA 4JCHA 3E70C 2EIMC 2G3KA 4BJ6C 3IEEA 2DYRC 1V54C 2WL8A 4U5FE 1ZYRF 1FFHA 4I1OB 1ZHYA 3OWTA 2Q9BA 2VASA 3FHDA 4P6IC 1M57C 1MNEA 5B1BC 5DQTA 4PJLA 4QI2A 3X1OA 4CS9C 4G7OF 1OCOC 3EPVA 5IY5C 3KH2A 1OCZC 1MNDA 2XL4A 4FESA 3CZ6A 1BR2A 2ZPAA 3EHNA 2A6HF 3O6XA 2NUTA 4ZLDA 2W4MA 2J9VA 3EH2A 3SNHA 1ZHZA 2XXAB 2O9XA 3Q7LA 3ABLC 3FVYA 3LLIA 1OCRC 4KC9A 2ZXPA 3EQLF 2R7TA 5KYWA 3UMKA 3UGPA 4G7ZF 1VMAA 2H7VC 4C7OA 4I1MA 3EG9A 1PD0A 3SZRA 2LSEA 2H7OA 3ITFA 3UR3C 3T6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  5F5F A;  4YWQ A;  4ZLD A;  5F5H A;  4QI0 A;  4ZLC A;  4ULW A;  4QI2 A; 
#chains in the Genus database with same CATH topology
 4LER A;  3L1M A;  2ASR A;  1YAR O;  3ABK C;  4J7T A;  3A9C A;  3M79 A;  3U9J A;  4J30 B;  1MMD A;  5L0J A;  3L0I A;  2R7O A;  4YT4 A;  4XEK A;  3NYL A;  4RD9 A;  1PCX A;  1LPE A;  3FAP B;  2VCA A;  1OR3 A;  2CNW D;  4BJ1 A;  4CSA C;  2J46 A;  2QLA A;  3WAQ A;  1MMN A;  2R7W A;  4EBK A;  4NC3 A;  1H9G A;  2WVQ A;  3T6B A;  4PAC A;  2HKV A;  4O6M A;  4OIN F;  1Z63 A;  3V5X A;  2YRF A;  2VCB A;  3LNM B;  4MW3 A;  2VB6 A;  3FAJ A;  4WGZ A;  4BG0 A;  2YWA A;  1EQ1 A;  2HUJ A;  2WZF A;  1KU2 A;  1HMO A;  1QQ3 A;  4G0H A;  3UMH A;  4AL0 A;  3S84 A;  1SF8 A;  2OEX A;  2LCH A;  3M1C B;  3OEO A;  4MS2 A;  2J7P D;  4DBR A;  1VLS A;  1T6U A;  3DE9 A;  2L6G A;  3G4X A;  1H9T A;  4YN0 B;  3FMS A;  5E33 A;  3IQ6 A;  2R7S A;  5A6A A;  2HSQ A;  2E87 A;  4U5C E;  2NUT B;  3NMJ A;  2UUH A;  4DJ9 A;  2NSG A;  2EIJ C;  3ZC4 A;  4ER9 A;  5T3T A;  2YL0 A;  4LAC B;  2EPO A;  3KKB A;  1RJ9 B;  1TR2 A;  1A7E A;  3S0X A;  1JAF A;  5KYN A;  3G50 A;  1CGM E;  3JT1 A;  3AOU A;  4XEF A;  1K04 A;  1JPJ A;  3CAX A;  4AE4 B;  2J9B A;  3AQB A;  4DRJ B;  3WOD F;  5L0F A;  3HJC A;  4O6Y A;  3FXH A;  1UG7 A;  2FFH A;  5CI9 A;  2CDQ A;  2IXM A;  3TJ5 A;  1BBH A;  4BEM J;  4C3E A;  1O87 A;  1Z7Q c;  2G3V A;  1Q0F A;  4HEA J;  4N6H A;  3ZTM A;  1V55 C;  5L3V A;  3ASO C;  2G62 A;  3X2Q C;  4G7H F;  4PFP A;  1AUE A;  2IXN A;  3C8Z A;  1Q0K A;  3NRH A;  1SZI A;  4KNV A;  5COG A;  3JSZ A;  1D0X A;  4XQ1 A;  3EGD A;  4NY3 A;  1LI5 A;  4DOZ A;  3QMK A;  2KGO A;  5E2Q A;  1IW7 F;  1LVK A;  3ASN C;  3G4Z A;  5EHH A;  3AQC A;  3DM5 A;  4LDK A;  3T9O A;  2X0C A;  1WN0 A;  2OG2 A;  1TKN A;  4O6N A;  4JW1 A;  2YHS A;  1HW2 A;  2YLI A;  2JX0 A;  2AP3 A;  4H4K C;  2CW0 F;  2KYH A;  1M2V B;  4XLP F;  1G4W R;  1YA9 A;  4JRZ A;  1T01 A;  3L8J A;  4BJT A;  2WB7 A;  4JVS A;  2J7P A;  1NU9 C;  1SMY F;  2R25 A;  4LDR A;  3US6 A;  4XPW A;  2KK1 A;  4U5E E;  5KYU A;  3UNG C;  3VF0 A;  1OQC A;  1LI7 A;  3LAY A;  2A68 F;  3RW0 A;  3NKD A;  4BJ5 C;  4GYT A;  2XM4 A;  1C02 A;  2HMQ A;  3VYW A;  3U2L A;  1C17 M;  3B0V C;  2R7X A;  4BPM A;  1VTM P;  4JTA B;  1SYQ A;  3RYL A;  1NBB A;  2LIG A;  5BUO A;  2LFD A;  1D0Z A;  5A69 A;  2Z15 A;  3C62 A;  3GM1 A;  3RQG A;  2C03 A;  3N2Z B;  4LDQ A;  3JRT A;  1RCP A;  1NSG B;  2B0J A;  2HMZ A;  2FAP B;  2QTV A;  2RD9 A;  1ZVZ A;  2VC9 A;  4GQH A;  4U9D A;  5HV9 A;  1RXQ A;  2HZ8 A;  3CSK A;  3EHM A;  3ZIB A;  1K05 A;  4MVO A;  4YK5 A;  3SXK A;  2MYS A;  4EIY A;  3QW1 A;  2HV6 A;  2XLD A;  3MBG A;  1D1C A;  2WZG A;  3MLG A;  1DOV A;  4O79 A;  4OD5 A;  3A11 A;  2OCC C;  4NTF A;  4YL3 A;  4CX9 A;  5B3I A;  2ICW G;  1I5N A;  3AG3 C;  1IZM A;  2IXP A;  4CS8 A;  3U9M A;  4JTC B;  4PJN A;  1G5Z A;  2WVO A;  3UMI A;  4FX5 A;  5JS5 A;  2L9J A;  4NQF A;  1JR8 A;  5L0I A;  3GAN A;  3L34 A;  3ZSU A;  3WHN A;  3S27 A;  5D91 A;  1L3P A;  2YVK A;  5F5H A;  4JCZ A;  4MTO A;  4EUK B;  1TWC A;  3C7J A;  3QVY A;  4CDV A;  4Q5S F;  4IRU A;  1QZX A;  5F5F A;  1YJG A;  1OXB A;  1RKC A;  3B29 A;  4N06 A;  4PFO A;  3RIP A;  3S28 A;  3DAF A;  4U5G A;  1ZHT A;  3F46 A;  1NFO A;  1V4A A;  3ZDL A;  2XLE A;  1E86 A;  4DBQ A;  3HNI A;  5KYU B;  3TD7 A;  4OIP F;  3KMI A;  5B3S C;  1OCC C;  2PX0 A;  3K7D A;  4MVS A;  3L8I A;  4OIO F;  5T1D B;  2W45 A;  2PFD A;  4LLE A;  5JT4 A;  4KBL A;  1WAT A;  2CGE A;  4J32 B;  3N0T A;  4E0I A;  4RDA A;  2HS5 A;  1ORY A;  2AWC A;  3ZTZ A;  1BR1 A;  3SEO A;  2GFH A;  4JEA A;  1LE2 A;  1M2O A;  3DJN B;  4MQ9 F;  4ONS A;  1CPR A;  3M15 A;  4MVZ A;  3W8H A;  3SXZ A;  3U8V A;  4Z9J A;  2PBE A;  1JRA A;  1QKR A;  3HKK A;  4DVZ A;  3MYI A;  1E2X A;  4B6I A;  1WAS A;  5FZT A;  2ZD9 A;  3AGT A;  3B71 A;  1YAU O;  5COF A;  3DXJ F;  2J0W A;  3K33 A;  3LS0 A;  4HFF B;  4E17 A;  2EPL X;  5D92 A;  3V5Y A;  2FGY A;  3RF3 A;  2PNO A;  3IQ5 A;  1U6H A;  3PHF 2;  4YT5 A;  2MWQ A;  2OU6 A;  4NCQ A;  3ZG1 A;  1Z5Z A;  3RQE A;  1VYK A;  1VOM A;  2EPM X;  2HSB A;  2MHR A;  2XLV A;  1KNY A;  2GWW A;  3C8G A;  4M63 A;  4ULW A;  1N1C A;  1ORS C;  3RKO F;  4U5B E;  3DJU B;  2BL2 A;  2DB4 A;  5EGY A;  3K6B A;  1APC A;  2A6E F;  2XM0 A;  1Z3I X;  1G8X A;  3AG2 C;  2CYD A;  5JLI A;  3NMK A;  4IAO A;  2Q4F A;  4QDL A;  4IB4 A;  4E0H A;  2NG1 A;  3DM9 B;  3PMR A;  2YEV A;  2V26 A;  4DRI B;  2CCY A;  3FDQ A;  2EIN C;  1D0Y A;  1Q0G A;  2XLO A;  2AU5 A;  2IOQ A;  2YZS A;  3PCV A;  5KYW B;  3GEH A;  2TMV P;  3B0P A;  4C7O B;  1KTM A;  3EG9 B;  3M4C A;  1M6T A;  1FTS A;  3EGX A;  4HFK B;  3R7C A;  1FMW A;  5JSL A;  1OW7 A;  4N6C A;  1CGN A;  3HLZ A;  3T4R A;  3ZVR A;  2M4E A;  3AG4 C;  3LUT B;  5EK0 A;  2YLG A;  4PJM A;  4WJ0 A;  4Q4Z F;  3ZQY A;  5K0I A;  5DVW A;  2Q9A A;  1HY5 A;  1QLE C;  3S9O A;  1TFK B;  3K66 A;  4IJJ A;  3C63 A;  4KI2 A;  1TFO B;  2Y39 A;  2W9Y A;  3DAG A;  2PF4 E;  1LE4 A;  5BQG A;  4CJG A;  4X0R A;  2HJM A;  1OKK A;  1DOW A;  4R32 A;  2KNH A;  3DZA A;  2R7R A;  2I8B A;  1TQG A;  2IM8 A;  4QI0 A;  1B68 A;  2PX3 A;  3IQT A;  4RBN A;  4ZLC A;  4JUR I;  1S05 A;  3TOL A;  4DRH B;  4MND A;  4W8P A;  2M64 A;  3ABM C;  3RH3 A;  4YWQ A;  1OW6 A;  1YA7 O;  1D1A A;  3DMD A;  4P9F A;  4XTK A;  4I44 A;  4H54 A;  4CDY A;  3W2V A;  2Y69 C;  5KYX A;  4XPY A;  5T3W A;  1T9K A;  1MMA A;  2UUI A;  1C03 A;  1A7V A;  1YDI A;  3I5Q A;  2R9R B;  3JYH A;  1NU7 D;  1T6I A;  3EFO A;  1QPU A;  1HE1 A;  2J9U A;  3N24 A;  4BJ5 A;  5JVE A;  2AVK A;  1Q0D A;  1JPN A;  2DI3 A;  3R2P A;  4UDV A;  3U2M A;  1TWH A;  2LP4 A;  1U0B B;  5L0G A;  4BJ6 A;  1A0B A;  3NKE A;  3VM6 A;  3RQF A;  3M4B A;  4CIH A;  4JE9 A;  3KYJ A;  1PD1 A;  3EJN A;  4JJG A;  5COM A;  1WTY A;  2L7A A;  3H65 A;  5GPG B;  5AC5 A;  4MTG A;  4ANJ A;  3EGX B;  3NDB B;  1AEP A;  4XWJ A;  2L81 A;  1V74 B;  4P9T A;  5DS6 A;  3SYN A;  2Q7R A;  3W2W A;  1JMW A;  3SXY A;  1YLM A;  2B0H A;  1ZZP A;  2PP4 A;  4EBJ A;  1TWG A;  1NG1 A;  4CS9 A;  5KYY A;  2OQM A;  4E7Z A;  4IAQ A;  2IXO A;  2WZL A;  3EGD B;  1Y6D A;  2LQG A;  1MMG A;  2IBF A;  1BR4 A;  2IYL D;  3TOM A;  1AVO B;  3C8G D;  3T6G B;  3AG1 C;  1XZQ A;  1LM3 B;  1RMV A;  2A0U A;  2JD3 A;  4CS7 A;  4E7S A;  3LLK A;  1LIH A;  2P6V A;  4JJF A;  1W2W A;  2V3C C;  1ZU4 A;  1H7I A;  4KNW A;  4ULV A;  2H7B A;  2XS1 A;  4L6R A;  5B1A C;  1L7C A;  5BQH A;  3K1I C;  5DQZ A;  2KW3 C;  4Q7C A;  4CS8 C;  3LES A;  3POV A;  1D1B A;  4U5H A;  5L0C A;  2D4U A;  3WG7 C;  2YL1 A;  1JOG A;  4MW8 A;  5KYX B;  2YL3 A;  3ZQV A;  5DLJ A;  4HE8 D;  3NG1 A;  4O7G A;  4Z9H A;  3GWN A;  5JRA A;  3UGO A;  4AX2 A;  2HFI A;  3ECS A;  1GQA A;  3QZC A;  3U8P A;  3EFO B;  2ETS A;  2JPU A;  2KQ9 A;  2R7V A;  5DS5 A;  1A41 A;  1LKX A;  1RJ9 A;  1VK5 A;  4BEJ A;  2XSE A;  1HE9 A;  1ST6 A;  1F1M A;  3HTK C;  5TJ5 E;  4EKW A;  1VB5 A;  4K7B A;  3B0U X;  2KC3 A;  2NSF A;  2NUP A;  4AE4 A;  5A6B D;  2X51 A;  3RVY A;  4CDA A;  1YYX A;  3KL4 A;  2Q3T A;  3NMI A;  1O3U A;  1OKK D;  4W8K A;  4CSA A;  2R7U A;  1OW8 A;  2AWY A;  2ZXO A;  2OKU A;  1FFT C;  5FCL A;  4EWC A;  1T5O A;  3J06 A;  1Q0M A;  1BZ4 A;  2ZXR A;  3LNR A;  5HSW A;  4OIQ F;  3U0C A;  3B9Q A;  4C3D A;  2OEV A;  2DYS C;  2Q9C A;  3Q6N A;  4IWB A;  2W4B A;  4YJW A;  5E3C A;  3SP1 A;  2VH3 A;  1CPQ A;  4C3B A;  3DKA A;  4YT8 A;  5KYY B;  4F4B A;  3O39 A;  1QVX A;  1Z6A A;  3FOO A;  2F22 A;  1ZU5 A;  3LEV A;  3W8I A;  4DVY P;  3JSE O;  4MVQ A;  1NZE A;  5JP7 A;  2YL7 A;  3JTL O;  4PR9 A;  4OIR F;  3GEI A;  4FWV A;  4MTF A;  5L0H A;  2XLM A;  4CIP A;  1GM5 A;  4A2N B;  4EHP A;  2Y3G A;  5A6K A;  2VCC A;  1U89 A;  1WWP A;  1UFB A;  3V7O A;  4G78 A;  2EIK C;  2EPN A;  4N4W A;  1M2V A;  2DGJ A;  2LD6 A;  2Y3B A;  1HW1 A;  3IHU A;  1ZHW A;  1YYJ A;  1CGO A;  2R05 A;  2OJQ A;  2P61 A;  3CQZ A;  1FNT c;  3Q6M A;  3EH1 A;  3PDM P;  2R7Q A;  3S90 A;  2L6H A;  1FMV A;  2Y3D A;  2XRH A;  3OA1 A;  1XWJ A;  3BEH A;  3CEX A;  4GEH A;  4YL1 A;  2A69 F;  1VLT A;  1ZHX A;  3Q7G A;  4JZA A;  2EIL C;  2J45 A;  3JYY A;  2ZXW C;  1SR2 A;  2L6F A;  4LLC A;  4XLN F;  1YZC A;  1LS1 A;  4U5D E;  3RVZ A;  1Y4C A;  2P7V A;  4E18 A;  5A6B A;  2QY9 A;  1NLX A;  2NUP B;  5L0D A;  5F28 E;  1H6G A;  1NFN A;  3W4Y A;  3ZWI A;  1M56 C;  1RKE A;  2QUP A;  2HV7 A;  2R02 A;  4I3M A;  3U3F A;  2XL6 A;  2LK4 A;  4U9E A;  4NTB A;  4AL1 A;  3DD7 A;  3RFY A;  2YKZ A;  3K1H A;  4JTD B;  4PJJ A;  2D5R B;  3VAY A;  1GGQ A;  3DI5 A;  3NYJ A;  1Z23 A;  3S29 A;  5BQI A;  3JCU Q;  1HMD A;  3MFN A;  1R5I D;  3E9V A;  5A6J A;  1E85 A;  2WVN A;  2Y3H A;  4YT2 A;  1J8Y F;  1EA8 A;  3ATP A;  4MVR A;  1WGW A;  4D4X A;  3TQO A;  1J8M F;  4EBB A;  1T6Q A;  3C8G B;  1I4Z A;  3IPM O;  2CNW A;  3MX3 A;  4K0D A;  1S7Z A;  2BC5 A;  2EPK X;  3H2U A;  4YL0 A;  5L3Q A;  2GAQ A;  4XPX A;  2XLH A;  3QTH A;  1R4T A;  1VYI A;  2I15 A;  3GOD A;  2KJG A;  4JEB A;  3V5Z A;  5DS4 A;  2C04 A;  5AGF A;  3LEO A;  5E3A A;  3NYM A;  2XLW A;  3QW0 A;  2NPU A;  3I4U A;  1E83 A;  4AK9 A;  2A0B A;  5JUA A;  4IGG A;  3EZH A;  2Q00 A;  4DXW A;  2XXA A;  3LS1 A;  3I5P A;  1E84 A;  2J0X A;  256B A;  4JC7 A;  2A1D D;  2J8W A;  1O5H A;  2BE5 F;  3F47 A;  2XL8 A;  3KYI A;  3EZI A;  4PK4 A;  1WOL A;  4OD4 A;  2QE9 A;  4CBE A;  5CI8 A;  5CIV A;  2XS8 A;  1K40 A;  4FAP B;  2LFF A;  1TWA A;  3U5S A;  1ORJ A;  2J9W A;  1GS9 A;  3LJB A;  4JCH A;  3E70 C;  3O10 A;  2GA0 A;  2EIM C;  4IAR A;  3JZ0 A;  1A7D A;  2G3K A;  4BJ6 C;  3O55 A;  3HNJ A;  1BDJ B;  3IEE A;  1EKY A;  2DYR C;  1V54 C;  2WL8 A;  3GOR A;  4U5F E;  1ZYR F;  3FOP A;  4D4N A;  1I4Y A;  4MVU A;  1FFH A;  1OXK A;  1EI7 A;  4MVM A;  4XEV A;  1RKE B;  2OJE D;  2GDC A;  4I1O B;  4J7Y A;  1ZHY A;  3AGU A;  3TJ6 A;  3OWT A;  3KPH A;  5AC4 A;  2Q9B A;  2VAS A;  3FHD A;  4P6I C;  4A4A A;  1M57 C;  1MNE A;  5B1B C;  3U3B A;  5DQT A;  3QVZ A;  4PJL A;  1YVI A;  4QI2 A;  3X1O A;  1XZP A;  2P0N A;  2H8A A;  2P1A A;  3GM2 A;  4CS9 C;  3TUL A;  4G7O F;  3BRJ A;  1OCO C;  3EPV A;  5IY5 C;  2HJ3 A;  3K1I A;  3KH2 A;  1YZA A;  2RSE B;  1LS4 A;  3C18 A;  1OCZ C;  1ZW3 A;  1MND A;  2KSF A;  4CJO A;  2XL4 A;  1ZW2 A;  3VRC A;  3DE8 A;  3GM3 A;  4FES A;  3CZ6 A;  4Z9I A;  1BR2 A;  1PV3 A;  2ZPA A;  3EHN A;  2A6H F;  3O6X A;  2NUT A;  2OOC A;  4ZLD A;  2W4M A;  3GEE A;  2YLD A;  2J9V A;  3HNL A;  1QSP A;  3JRM O;  4K1O A;  3EH2 A;  3SNH A;  1ZHZ A;  2XXA B;  2R03 A;  3HNK A;  2O9X A;  1MQV A;  2QNL A;  3Q7L A;  3SXM A;  3ABL C;  3FVY A;  1FAP B;  2YQY A;  3LLI A;  4NTA A;  1OCR C;  3TK0 A;  4KC9 A;  2ZXP A;  4WAB A;  3GWL A;  3EQL F;  2R7T A;  4JIO A;  1OR2 A;  3UMK A;  3DWW A;  5KYW A;  1G4U S;  3UGP A;  4JKV A;  4G7Z F;  1VMA A;  3IQC A;  2H7V C;  4WGY A;  1FR0 A;  4C7O A;  4I1M A;  3EG9 A;  1PD0 A;  3SZR A;  3H2V A;  2LSE A;  2H7O A;  3AJM A;  3ITF A;  3MYF A;  3UR3 C;  3T6J A; 
#chains in the Genus database with same CATH homology
 4LER A;  3ABK C;  4J30 B;  1MMD A;  3L0I A;  2R7O A;  4YT4 A;  3NYL A;  4RD9 A;  1PCX A;  2CNW D;  4BJ1 A;  4CSA C;  2J46 A;  1MMN A;  2R7W A;  2WVQ A;  3T6B A;  1Z63 A;  4O6M A;  4OIN F;  2VB6 A;  3FAJ A;  4BG0 A;  2WZF A;  4G0H A;  1KU2 A;  3UMH A;  1SF8 A;  3M1C B;  3OEO A;  4DBR A;  2J7P D;  2R7S A;  4YN0 B;  5E33 A;  2E87 A;  4U5C E;  2NUT B;  2EIJ C;  3ZC4 A;  5T3T A;  4LAC B;  3KKB A;  1RJ9 B;  1TR2 A;  3S0X A;  5KYN A;  3JT1 A;  1JPJ A;  4AE4 B;  3AQB A;  3WOD F;  3HJC A;  4O6Y A;  4C3E A;  5CI9 A;  2FFH A;  2CDQ A;  2IXM A;  1O87 A;  2G3V A;  4HEA J;  1V55 C;  5L3V A;  3ASO C;  2G62 A;  3X2Q C;  4G7H F;  4PFP A;  2IXN A;  3NRH A;  1SZI A;  4KNV A;  3JSZ A;  1D0X A;  3EGD A;  4NY3 A;  4DOZ A;  3QMK A;  2KGO A;  5E2Q A;  1IW7 F;  1LVK A;  3ASN C;  5EHH A;  3AQC A;  3DM5 A;  2OG2 A;  1TKN A;  4O6N A;  4JW1 A;  2YHS A;  4H4K C;  2CW0 F;  4XLP F;  1M2V B;  4BJT A;  2WB7 A;  4JVS A;  2J7P A;  1NU9 C;  1SMY F;  4U5E E;  5KYU A;  3UNG C;  3LAY A;  2A68 F;  3NKD A;  4BJ5 C;  4GYT A;  3VYW A;  3B0V C;  2R7X A;  3RYL A;  5BUO A;  1D0Z A;  2Z15 A;  2C03 A;  3N2Z B;  3JRT A;  2B0J A;  2QTV A;  3CSK A;  3EHM A;  3ZIB A;  2MYS A;  2HV6 A;  4OD5 A;  1D1C A;  2WZG A;  3MLG A;  4O79 A;  2OCC C;  3AG3 C;  1IZM A;  2IXP A;  4CS8 A;  4PJN A;  2WVO A;  3UMI A;  4FX5 A;  2L9J A;  3GAN A;  3L34 A;  3ZSU A;  3S27 A;  5D91 A;  5F5H A;  1TWC A;  4Q5S F;  4IRU A;  1QZX A;  5F5F A;  4N06 A;  4PFO A;  3RIP A;  3S28 A;  3DAF A;  4U5G A;  1ZHT A;  3F46 A;  4DBQ A;  5KYU B;  3TD7 A;  4OIP F;  3KMI A;  5B3S C;  1OCC C;  2PX0 A;  3K7D A;  4OIO F;  5T1D B;  2W45 A;  2PFD A;  4LLE A;  4KBL A;  2CGE A;  4J32 B;  3N0T A;  4RDA A;  1BR1 A;  3SEO A;  2GFH A;  4MQ9 F;  1M2O A;  3DJN B;  3W8H A;  4DVZ A;  4B6I A;  3DXJ F;  2J0W A;  3K33 A;  3LS0 A;  4HFF B;  5D92 A;  2FGY A;  3PHF 2;  4YT5 A;  2MWQ A;  3ZG1 A;  1Z5Z A;  1VYK A;  1VOM A;  4M63 A;  4ULW A;  1N1C A;  3RKO F;  4U5B E;  3DJU B;  5EGY A;  3K6B A;  2A6E F;  3AG2 C;  1Z3I X;  1G8X A;  4IAO A;  4QDL A;  2NG1 A;  3DM9 B;  3PMR A;  2YEV A;  2V26 A;  3FDQ A;  2EIN C;  1D0Y A;  2YZS A;  5KYW B;  2IOQ A;  3B0P A;  4C7O B;  3EG9 B;  1FTS A;  3EGX A;  4HFK B;  1FMW A;  3HLZ A;  3T4R A;  3ZVR A;  2M4E A;  3AG4 C;  4PJM A;  4WJ0 A;  4Q4Z F;  5DVW A;  2Q9A A;  1QLE C;  3K66 A;  4IJJ A;  4KI2 A;  2Y39 A;  2W9Y A;  3DAG A;  2PF4 E;  4X0R A;  1OKK A;  2KNH A;  3DZA A;  2R7R A;  2I8B A;  4QI0 A;  4ZLC A;  2PX3 A;  4RBN A;  4JUR I;  4MND A;  3RH3 A;  3ABM C;  4YWQ A;  1D1A A;  3DMD A;  4XTK A;  4I44 A;  3W2V A;  2Y69 C;  5KYX A;  5T3W A;  1MMA A;  3I5Q A;  3JYH A;  1NU7 D;  3EFO A;  3N24 A;  2J9U A;  4BJ5 A;  1JPN A;  1TWH A;  4BJ6 A;  3NKE A;  4CIH A;  1PD1 A;  3EJN A;  4JJG A;  3H65 A;  4ANJ A;  3EGX B;  3NDB B;  4XWJ A;  2L81 A;  5DS6 A;  3SYN A;  3W2W A;  2PP4 A;  1TWG A;  1NG1 A;  4CS9 A;  5KYY A;  4E7Z A;  2IXO A;  2WZL A;  3EGD B;  1MMG A;  1BR4 A;  2IYL D;  3AG1 C;  2JD3 A;  4CS7 A;  4E7S A;  3LLK A;  2P6V A;  4JJF A;  1W2W A;  2V3C C;  1ZU4 A;  4KNW A;  5B1A C;  2H7B A;  3K1I C;  5DQZ A;  2KW3 C;  4Q7C A;  4CS8 C;  3LES A;  3POV A;  1D1B A;  4U5H A;  3WG7 C;  5KYX B;  5DLJ A;  4HE8 D;  3NG1 A;  4O7G A;  3UGO A;  4AX2 A;  3ECS A;  3QZC A;  3EFO B;  2KQ9 A;  2R7V A;  5DS5 A;  4BEJ A;  1LKX A;  1RJ9 A;  1VK5 A;  2XSE A;  1ST6 A;  3HTK C;  3B0U X;  4K7B A;  2NUP A;  4AE4 A;  2X51 A;  3KL4 A;  2Q3T A;  4CSA A;  4W8K A;  1OKK D;  2R7U A;  2ZXO A;  1FFT C;  5FCL A;  4EWC A;  2ZXR A;  3LNR A;  5HSW A;  4OIQ F;  3B9Q A;  4C3D A;  4YJW A;  2DYS C;  2Q9C A;  3Q6N A;  4IWB A;  2W4B A;  5E3C A;  3SP1 A;  4C3B A;  2VH3 A;  4YT8 A;  5KYY B;  4F4B A;  3O39 A;  1Z6A A;  3W8I A;  3LEV A;  1ZU5 A;  4DVY P;  1NZE A;  4OIR F;  4FWV A;  4A2N B;  2Y3G A;  3V7O A;  2EIK C;  1M2V A;  2DGJ A;  2Y3B A;  1ZHW A;  3CQZ A;  3Q6M A;  3EH1 A;  2R7Q A;  2Y3D A;  1FMV A;  2XRH A;  3OA1 A;  4GEH A;  2A69 F;  1ZHX A;  3Q7G A;  4JZA A;  2EIL C;  2J45 A;  2ZXW C;  4LLC A;  4XLN F;  1LS1 A;  4U5D E;  2P7V A;  2QY9 A;  2NUP B;  1M56 C;  2HV7 A;  4I3M A;  3DD7 A;  3RFY A;  3K1H A;  3VAY A;  4PJJ A;  2D5R B;  3NYJ A;  1Z23 A;  3S29 A;  3JCU Q;  3E9V A;  2WVN A;  2Y3H A;  4YT2 A;  1J8Y F;  1WGW A;  1J8M F;  4EBB A;  2CNW A;  3MX3 A;  4K0D A;  1S7Z A;  5L3Q A;  1VYI A;  3GOD A;  2KJG A;  5DS4 A;  2C04 A;  5E3A A;  3NYM A;  3I4U A;  4AK9 A;  2XXA A;  3EZH A;  3LS1 A;  3I5P A;  2J0X A;  2A1D D;  1O5H A;  2BE5 F;  3F47 A;  3EZI A;  4PK4 A;  4OD4 A;  4CBE A;  5CI8 A;  1TWA A;  3LJB A;  2J9W A;  4JCH A;  3E70 C;  2EIM C;  2G3K A;  4BJ6 C;  3IEE A;  2DYR C;  1V54 C;  2WL8 A;  4U5F E;  1ZYR F;  1FFH A;  4I1O B;  1ZHY A;  3OWT A;  2Q9B A;  2VAS A;  3FHD A;  4P6I C;  1M57 C;  1MNE A;  5B1B C;  5DQT A;  4PJL A;  4QI2 A;  3X1O A;  4CS9 C;  4G7O F;  1OCO C;  3EPV A;  5IY5 C;  3KH2 A;  1OCZ C;  1MND A;  2XL4 A;  4FES A;  3CZ6 A;  1BR2 A;  2ZPA A;  3EHN A;  2A6H F;  3O6X A;  2NUT A;  4ZLD A;  2W4M A;  2J9V A;  3EH2 A;  3SNH A;  1ZHZ A;  2XXA B;  2O9X A;  3Q7L A;  3ABL C;  3FVY A;  3LLI A;  1OCR C;  4KC9 A;  2ZXP A;  3EQL F;  2R7T A;  5KYW A;  3UMK A;  3UGP A;  4G7Z F;  1VMA A;  2H7V C;  4C7O A;  4I1M A;  3EG9 A;  1PD0 A;  3SZR A;  2LSE A;  2H7O A;  3ITF A;  3UR3 C;  3T6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...