3BRJA

Crystal structure of mannitol operon repressor (mtlr) from vibrio parahaemolyticus rimd 2210633
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
NESEIIERLNSAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQDSGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNHLNSDASDYEFTDPNILEPIKKLHLVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Mannitol operon repressor
publication title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria.
pubmed doi rcsb
source organism Vibrio parahaemolyticus rimd 2210633
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05068 MtlR Mannitol repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3brjA00
5F28E 1QVXA 3C8GB 4XEVA 3K7DA 1OW8A 2Q00A 3U0CA 3S9OA 1WWPA 1WOLA 2PBEA 2HSBA 2LK4A 3RQFA 1K40A 1K04A 3TULA 1JOGA 3AJMA 2YWAA 3B71A 1K05A 4NQFA 2KK1A 2JPUA 1OW6A 3C8GD 3JZ0A 1WTYA 1O3UA 3C8GA 3L8JA 3L8IA 1KNYA 4XEKA 4EBJA 3RQEA 1V4AA 3GM2A 2L6FA 3C18A 3GM1A 3JYYA 4XEFA 1UFBA 3RQGA 1PV3A 3GM3A 3BRJA 1OW7A 1ZZPA 4R32A 2L6GA 3O10A 2JX0A 1KTMA 3U3FA 4EBKA 3MFNA 2L6HA
chains in the Genus database with same CATH superfamily
3UNGC 2PF4E 2XL8A 4MVSA 4H4KC 3K7DA 3M79A 3CSKA 4UDVA 2H7OA 4OINF 3S9OA 3DKAA 5T1DB 5AGFA 5L0GA 1DOWA 1PD0A 3UGOA 1ZHTA 5CI9A 5FZTA 5KYXA 4ZLDA 5D91A 4PFPA 1L3PA 5CIVA 1N1CA 1WGWA 2KW3C 1RJ9A 3L0IA 3UMHA 3WODF 1HE1A 4E0IA 1VYKA 4MVZA 1TWGA 3BEHA 3EGDB 2PNOA 1JRAA 4XWJA 1Z3IX 4CX9A 4G7OF 4U5HA 3UGPA 3GM2A 3EGXB 2R7UA 1OW7A 2PFDA 3IEEA 4YT5A 3OWTA 1FMVA 5E2QA 3K66A 2X0CA 1BZ4A 3MYFA 2MYSA 3QMKA 5KYUA 1ZW3A 3I5PA 3LNRA 1QVXA 4MVOA 2QY9A 1SMYF 3SNHA 4BJ6C 3EG9A 5A6BD 1HW2A 3U0CA 2HKVA 2IXPA 5K0IA 2UUHA 1APCA 1OQCA 2XSEA 4LDKA 3RYLA 2HV7A 3DE9A 1D1BA 4YT2A 1XWJA 1Q0MA 1QSPA 1BDJB 1ORJA 2R05A 3ABKC 4YL0A 1UG7A 2O9XA 5JVEA 2YRFA 4NQFA 3LLKA 3NDBB 1VYIA 2Y3BA 3PMRA 2J46A 1U6HA 3JCUQ 3US6A 1O3UA 5B1BC 4DOZA 3W2WA 1KNYA 1G5ZA 5DQTA 2W4BA 2Z15A 2NG1A 2RD9A 2OKUA 2LD6A 1YYXA 3KYIA 2OOCA 2PX3A 2XL4A 4FAPB 3N24A 5DQZA 2DYSC 3G4ZA 3Q7GA 3U9JA 1TFOB 3JYHA 3I5QA 5COMA 3DXJF 2GDCA 256BA 2ICWG 4DRJB 4DRIB 3FDQA 2CGEA 4PR9A 3AGTA 3ZIBA 4DVYP 4O79A 2BL2A 3ZTMA 2WZLA 1HY5A 3KL4A 2EILC 1RXQA 2XLWA 1J8MF 4I1OB 1E83A 1MNEA 2J7PA 1Q0FA 4C7OA 2OEXA 4QI2A 2HJMA 3S84A 1QPUA 3V5YA 1LI7A 3R7CA 2HMZA 2J0WA 2EIJC 4IARA 5BQIA 3K33A 5GPGB 4DJ9A 3ZTZA 2Y3GA 2F22A 2GA0A 2DI3A 1SYQA 3HNJA 4JZAA 1OR3A 2Q7RA 1C02A 4G78A 3RIPA 3U2MA 1HMDA 2J9WA 1ZZPA 3Q6NA 1OKKA 2IXOA 4CJGA 5EHHA 5L3QA 2J8WA 1R5ID 3GEHA 4ANJA 3U3FA 2Y3HA 4AE4A 1Q0DA 2HUJA 2I15A 4P9FA 3MFNA 4N6CA 2HV6A 3POVA 2WB7A 4MNDA 4O7GA 3O6XA 3B0VC 4OIQF 4U5EE 4J32B 1RKEA 4LERA 3TJ5A 3ATPA 4NC3A 4AK9A 1NU7D 3JTLO 4GEHA 5JLIA 3LLIA 1NBBA 4IAOA 2A69F 4OIRF 3IPMO 4WJ0A 3RW0A 3K1HA 1WATA 1Z63A 2YLIA 3IQ5A 1Z7Qc 4JVSA 3HNIA 3NG1A 4F4BA 2NUTB 3AG3C 3EHNA 1YARO 1CPQA 1MMDA 1GGQA 1VLSA 1A7EA 2VCCA 1TWCA 1I4ZA 1YYJA 3RF3A 4PJJA 1ST6A 1CGME 1D1AA 1LI5A 2CNWA 3H65A 1M2OA 1G8XA 2P61A 3EFOB 1TR2A 3TJ6A 1M57C 4J7TA 2OCCC 1CPRA 3ZG1A 4CDAA 4HE8D 1T6IA 2C03A 2EPKX 3X2QC 2HSQA 3MBGA 3ZQYA 4YT4A 4D4NA 2VCAA 2UUIA 1G4US 3ASOC 5KYWA 1FFTC 3T6GB 4GYTA 3W4YA 3WAQA 1EQ1A 2ZXWC 4O6NA 1T5OA 4BEJA 3MYIA 4CBEA 3TOMA 1FR0A 2YLGA 1NU9C 3LEVA 3DJUB 3DMDA 3SXKA 4CJOA 2BE5F 2XS8A 3EH1A 3IQ6A 1W2WA 3SP1A 1A0BA 4Z9JA 2L6FA 4L6RA 3S29A 2P0NA 2KGOA 3RQGA 2EPNA 2VB6A 4H54A 4MVQA 4DRHB 3ASNC 2C04A 4ONSA 2YL1A 4JTCB 2GWWA 2XLOA 3JT1A 3NRHA 1FTSA 3EGDA 4HEAJ 1JAFA 1JR8A 3HNLA 4B6IA 4P6IC 1O5HA 2AWYA 3AGUA 3FVYA 5D92A 3FXHA 2LP4A 3N0TA 2EPOA 3EGXA 4QDLA 1ZVZA 5CI8A 3U2LA 2ZD9A 2WVQA 4KNVA 2PBEA 2HSBA 3GEEA 5E33A 1D0YA 1A41A 1K04A 3M4CA 5EK0A 3K1IA 1SF8A 2HMQA 3E9VA 3OA1A 3TULA 3DM9B 2XXAB 2V26A 3B71A 4N6HA 4PJLA 1ZHYA 3V7OA 3KYJA 1LE4A 1ZHZA 1VB5A 1OW6A 2KQ9A 4YL1A 4EBJA 5L0CA 3L8IA 3ABLC 4EBBA 1OXKA 3GM1A 3J06A 1YVIA 4IGGA 5DS4A 3S28A 3T9OA 3ZSUA 1OCZC 1ORYA 4NTAA 2L9JA 2CYDA 3ITFA 4J30B 1WN0A 1M2VB 1LS4A 3HLZA 3NKDA 3C8ZA 1EA8A 4MTFA 4U5GA 3QW0A 4IRUA 5HSWA 2L6HA 1MMAA 2JD3A 3JRMO 3AG1C 2E87A 1QZXA 1YA9A 1ZHXA 1YA7O 5BQGA 5L0IA 2KC3A 2XLMA 3V5ZA 3OEOA 1IW7F 4E0HA 3FMSA 1AEPA 4ER9A 4D4XA 4JTDB 4U5FE 5DVWA 1HE9A 2A6EF 2LSEA 2XM4A 3B0PA 4NTBA 5BUOA 3JSEO 3L8JA 1AUEA 3ABMC 1Z6AA 5B1AC 4M63A 2ZXOA 1V4AA 2R03A 1LIHA 4OD4A 3W8IA 3C18A 1C17M 4K1OA 1IZMA 3W2VA 2VH3A 1O87A 1BR1A 4CDYA 1MMNA 1NFOA 3DZAA 3X1OA 5KYXB 1GM5A 4CS8C 4EKWA 1A7DA 1H6GA 1RJ9B 4EBKA 1VK5A 2FGYA 4CS9C 4WGYA 2H7VC 2GAQA 4X0RA 2P6VA 4LDQA 4XEVA 4AX2A 3SZRA 1OW8A 3T6JA 1Y4CA 2A0UA 4NTFA 4ULVA 1TKNA 1HMOA 2A68F 1VOMA 4N4WA 3RH3A 4BJ6A 3UMIA 3NYJA 2D5RB 5DS5A 3U8PA 4DXWA 4YT8A 3CAXA 1RKCA 2FFHA 5COGA 2H8AA 2KNHA 4PACA 2MWQA 4EWCA 3AQCA 4IB4A 4E7SA 3RQEA 3UR3C 1EKYA 3M15A 4FX5A 4HFFB 4I1MA 4MQ9F 1ZU5A 2PP4A 3JYYA 3LUTB 2AU5A 4NY3A 4U9DA 5A6KA 3B0UX 3EHMA 1OCRC 2NPUA 3MLGA 3VM6A 3KH2A 3EJNA 2L6GA 3H2UA 2EIKC 3TQOA 2R7WA 4JC7A 1M56C 3AOUA 3VF0A 1LVKA 2NUTA 2L7AA 5KYYB 1VTMP 2QNLA 4XQ1A 1Q0GA 1I4YA 3GWNA 4FESA 1JPJA 4AL1A 2P1AA 4IWBA 3LAYA 2VC9A 1C03A 3H2VA 4JCHA 2NUPA 2L81A 4IAQA 4KBLA 2HJ3A 3EFOA 2YWAA 2VASA 3DJNB 3IQTA 5JRAA 3EH2A 1U89A 5E3AA 4N06A 1LPEA 3UMKA 5A6JA 5EGYA 3C8GA 1LKXA 2B0HA 4PFOA 1Y6DA 3AQBA 1G4WR 2YLDA 4GQHA 1LE2A 3JSZA 1JPNA 3DWWA 3ZDLA 5A69A 1BR4A 4A4AA 2Q9CA 4CIHA 2Y39A 1D0ZA 2ETSA 2EPLX 2IYLD 2LIGA 3CQZA 3LS0A 4KC9A 5A6BA 4RDAA 3QTHA 1GQAA 4O6MA 1CGNA 4CS7A 4EHPA 1AVOB 1E86A 2J9BA 3EZIA 1CGOA 1WWPA 3B9QA 2R7RA 1H7IA 5AC5A 2LCHA 1D0XA 2YEVA 3M4BA 2PX0A 2HFIA 1E85A 1PCXA 2YKZA 1R4TA 2Q9BA 4AE4B 1D1CA 1T9KA 2WL8A 4OIPF 4OD5A 3DM5A 1B68A 3F46A 3ZQVA 5JP7A 2W45A 1F1MA 5T3WA 4PK4A 3I4UA 2NSFA 1ZW2A 5JT4A 4C3BA 3M1CB 3QVZA 4Q7CA 2Y69C 4R32A 2XXAA 1YJGA 3E70C 3SEOA 4FWVA 4HFKB 3NKEA 3NMJA 3U5SA 5F5HA 3TOLA 2M64A 3G4XA 1M6TA 4P9TA 3CZ6A 5T3TA 3WHNA 3JRTA 3NMKA 4U9EA 4JRZA 5L0HA 4MVUA 2GFHA 1KU2A 4KI2A 5F5FA 1MNDA 3A9CA 1HW1A 3QVYA 1PD1A 1K40A 4NCQA 3RQFA 1TWAA 3S90A 3PDMP 1JMWA 1V54C 2J7PD 3AJMA 1M2VA 1XZQA 2EINC 4G0HA 2DGJA 1NZEA 4I44A 1FAPB 2I8BA 2OG2A 4JCZA 4YK5A 4MTGA 2IM8A 2Q3TA 1OCOC 2AWCA 1QQ3A 5L0JA 3BRJA 2R7SA 3U9MA 3C62A 3L1MA 1TWHA 1OKKD 2OJQA 3O10A 2IXNA 1FFHA 4EIYA 2YL3A 1EI7A 2JX0A 2P7VA 4YN0B 1V55C 3GEIA 2B0JA 2W4MA 3RVZA 2XRHA 3F47A 4RBNA 5L0DA 5L3VA 2AVKA 4MW8A 4AL0A 3C63A 3LNMB 3T4RA 4RD9A 4WGZA 1QKRA 2OEVA 2XLDA 1FNTc 2OU6A 1T01A 2YZSA 1SZIA 2LFDA 4BPMA 1ZU4A 2M4EA 3HTKC 3WG7C 1S7ZA 1JOGA 4XLNF 2J0XA 3FHDA 1ZHWA 1ZYRF 3DAGA 4ULWA 3MX3A 2XLHA 4CSAC 1NSGB 4BEMJ 2BC5A 2JPUA 1QLEC 3C8GD 5JUAA 4XEKA 4O6YA 2ZPAA 4PJNA 1YLMA 5JSLA 1Z5ZA 4Z9IA 4MTOA 3LJBA 1PV3A 3W8HA 3FAPB 3T6BA 2R7XA 4XTKA 1YZAA 1BBHA 2J45A 2KYHA 2WZGA 2CNWD 4LDRA 5DS6A 1Z23A 3QZCA 3ECSA 5HV9A 3O39A 5F28E 4QI0A 2WVOA 4MVRA 4IJJA 3SXMA 3FOOA 3DE8A 1TFKB 2KJGA 2R7OA 4JKVA 3RVYA 3N2ZB 2QUPA 2YL0A 3GANA 4XPWA 3ZWIA 3O55A 3G50A 5KYYA 1NFNA 2R02A 2NSGA 4LLCA 2WZFA 1VMAA 1BR2A 3KMIA 5KYUB 4CSAA 1WASA 2CW0F 2G3VA 2A0BA 3EG9B 4Z9HA 4XEFA 3SXZA 3U8VA 4Q4ZF 1V74B 2H7BA 2Y3DA 4WABA 4OIOF 5AC4A 2YHSA 1A7VA 4Q5SF 5BQHA 4YJWA 1YZCA 3TK0A 2W9YA 3EQLF 5B3SC 1FMWA 4LACB 1H9TA 2XS1A 1RMVA 4E7ZA 2VCBA 3HNKA 2R7QA 3NMIA 4CS8A 3A11A 3C7JA 3K6BA 2Q00A 4JTAB 3U3BA 1YAUO 2G62A 5TJ5E 3S0XA 4MW3A 3RFYA 3TD7A 3LS1A 3FOPA 4CS9A 3FAJA 2WVNA 2DB4A 1H9GA 4U5BE 2D4UA 4BJTA 4DBQA 3GWLA 4K7BA 4G7ZF 2CCYA 3ZVRA 2ZXPA 4C3EA 5A6AA 3QW1A 1WTYA 4JE9A 2R25A 4BJ5C 1L7CA 2X51A 4YWQA 2DYRC 1J8YF 3Q7LA 3ZC4A 1Q0KA 1UFBA 4JJGA 5FCLA 4XLPF 4JW1A 3SXYA 4G7HF 2ZXRA 3LEOA 4XPYA 4A2NB 2J9VA 4CDVA 5L0FA 4C7OB 2Q9AA 4JURI 5B3IA 2RSEB 2EIMC 4EUKB 2HS5A 2YL7A 2R7TA 2XLEA 1S05A 2G3KA 2LFFA 2YQYA 4E17A 1LS1A 2YVKA 1OR2A 3Q6MA 2R7VA 2IBFA 2HZ8A 1DOVA 4K0DA 3S27A 3HJCA 3VAYA 2MHRA 2LK4A 2OQMA 3HKKA 4W8PA 4ZLCA 4CIPA 1T6UA 1K05A 2QTVA 3V5XA 2KK1A 2Q4FA 3JZ0A 5E3CA 3DI5A 2KSFA 3LESA 3B29A 1RKEB 3EZHA 1ORSC 3GM3A 5COFA 4BJ5A 4DVZA 4E18A 2NUPB 1LM3B 1YDIA 1I5NA 3RKOF 4BG0A 3NYMA 2A1DD 3CEXA 2AP3A 3L34A 1NLXA 4JJFA 5IY5C 3DAFA 3AG4C 3DD7A 4JEBA 3C8GB 3K1IC 4KNWA 1MQVA 2IXMA 4U5CE 1T6QA 2V3CC 1WOLA 3EPVA 3VYWA 3NYLA 4C3DA 3PHF2 4XPXA 2ASRA 1MMGA 1GS9A 5KYNA 1U0BB 2XM0A 4JIOA 2QLAA 4BJ1A 3KKBA 1TQGA 4J7YA 5JS5A 4JEAA 2IOQA 2XL6A 3GODA 4U5DE 2A6HF 2CDQA 2EPMX 3PCVA 1E2XA 3GORA 1XZPA 3KPHA 4I3MA 1E84A 4W8KA 2LQGA 2XLVA 4MVMA 4DBRA 3VRCA 5DLJA 1OCCC 1RCPA 3AG2C 5KYWB 2FAPB 4MS2A 3IHUA 3R2PA 3IQCA 1NG1A 1SR2A 4LLEA 2OJED 4PJMA 1KTMA 2J9UA 1OXBA 2R9RB 1VLTA 2QE9A 2TMVP 4YL3A 3SYNA
chains in the Genus database with same CATH topology
5F28E 1QVXA 3C8GB 4XEVA 3K7DA 1OW8A 2Q00A 3U0CA 3S9OA 1WWPA 1WOLA 2PBEA 2HSBA 2LK4A 3RQFA 1K40A 1K04A 3TULA 1JOGA 3AJMA 2YWAA 3B71A 1K05A 4NQFA 2KK1A 2JPUA 1OW6A 3C8GD 3JZ0A 1WTYA 1O3UA 3C8GA 3L8JA 3L8IA 1KNYA 4XEKA 4EBJA 3RQEA 1V4AA 3GM2A 2L6FA 3C18A 3GM1A 3JYYA 4XEFA 1UFBA 3RQGA 1PV3A 3GM3A 3BRJA 1OW7A 1ZZPA 4R32A 2L6GA 3O10A 2JX0A 1KTMA 3U3FA 4EBKA 3MFNA 2L6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F28 E;  1QVX A;  3C8G B;  4XEV A;  3K7D A;  1OW8 A;  2Q00 A;  3U0C A;  3S9O A;  1WWP A;  1WOL A;  2PBE A;  2HSB A;  2LK4 A;  3RQF A;  1K40 A;  1K04 A;  3TUL A;  1JOG A;  3AJM A;  2YWA A;  3B71 A;  1K05 A;  4NQF A;  2KK1 A;  2JPU A;  1OW6 A;  3C8G D;  3JZ0 A;  1WTY A;  1O3U A;  3C8G A;  3L8J A;  3L8I A;  1KNY A;  4XEK A;  4EBJ A;  3RQE A;  1V4A A;  3GM2 A;  2L6F A;  3C18 A;  3GM1 A;  3JYY A;  4XEF A;  1UFB A;  3RQG A;  1PV3 A;  3GM3 A;  3BRJ A;  1OW7 A;  1ZZP A;  4R32 A;  2L6G A;  3O10 A;  2JX0 A;  1KTM A;  3U3F A;  4EBK A;  3MFN A;  2L6H A; 
#chains in the Genus database with same CATH topology
 3UNG C;  2PF4 E;  2XL8 A;  4MVS A;  4H4K C;  3K7D A;  3M79 A;  3CSK A;  4UDV A;  2H7O A;  4OIN F;  3S9O A;  3DKA A;  5T1D B;  5AGF A;  5L0G A;  1DOW A;  1PD0 A;  3UGO A;  1ZHT A;  5CI9 A;  5FZT A;  5KYX A;  4ZLD A;  5D91 A;  4PFP A;  1L3P A;  5CIV A;  1N1C A;  1WGW A;  2KW3 C;  1RJ9 A;  3L0I A;  3UMH A;  3WOD F;  1HE1 A;  4E0I A;  1VYK A;  4MVZ A;  1TWG A;  3BEH A;  3EGD B;  2PNO A;  1JRA A;  4XWJ A;  1Z3I X;  4CX9 A;  4G7O F;  4U5H A;  3UGP A;  3GM2 A;  3EGX B;  2R7U A;  1OW7 A;  2PFD A;  3IEE A;  4YT5 A;  3OWT A;  1FMV A;  5E2Q A;  3K66 A;  2X0C A;  1BZ4 A;  3MYF A;  2MYS A;  3QMK A;  5KYU A;  1ZW3 A;  3I5P A;  3LNR A;  1QVX A;  4MVO A;  2QY9 A;  1SMY F;  3SNH A;  4BJ6 C;  3EG9 A;  5A6B D;  1HW2 A;  3U0C A;  2HKV A;  2IXP A;  5K0I A;  2UUH A;  1APC A;  1OQC A;  2XSE A;  4LDK A;  3RYL A;  2HV7 A;  3DE9 A;  1D1B A;  4YT2 A;  1XWJ A;  1Q0M A;  1QSP A;  1BDJ B;  1ORJ A;  2R05 A;  3ABK C;  4YL0 A;  1UG7 A;  2O9X A;  5JVE A;  2YRF A;  4NQF A;  3LLK A;  3NDB B;  1VYI A;  2Y3B A;  3PMR A;  2J46 A;  1U6H A;  3JCU Q;  3US6 A;  1O3U A;  5B1B C;  4DOZ A;  3W2W A;  1KNY A;  1G5Z A;  5DQT A;  2W4B A;  2Z15 A;  2NG1 A;  2RD9 A;  2OKU A;  2LD6 A;  1YYX A;  3KYI A;  2OOC A;  2PX3 A;  2XL4 A;  4FAP B;  3N24 A;  5DQZ A;  2DYS C;  3G4Z A;  3Q7G A;  3U9J A;  1TFO B;  3JYH A;  3I5Q A;  5COM A;  3DXJ F;  2GDC A;  256B A;  2ICW G;  4DRJ B;  4DRI B;  3FDQ A;  2CGE A;  4PR9 A;  3AGT A;  3ZIB A;  4DVY P;  4O79 A;  2BL2 A;  3ZTM A;  2WZL A;  1HY5 A;  3KL4 A;  2EIL C;  1RXQ A;  2XLW A;  1J8M F;  4I1O B;  1E83 A;  1MNE A;  2J7P A;  1Q0F A;  4C7O A;  2OEX A;  4QI2 A;  2HJM A;  3S84 A;  1QPU A;  3V5Y A;  1LI7 A;  3R7C A;  2HMZ A;  2J0W A;  2EIJ C;  4IAR A;  5BQI A;  3K33 A;  5GPG B;  4DJ9 A;  3ZTZ A;  2Y3G A;  2F22 A;  2GA0 A;  2DI3 A;  1SYQ A;  3HNJ A;  4JZA A;  1OR3 A;  2Q7R A;  1C02 A;  4G78 A;  3RIP A;  3U2M A;  1HMD A;  2J9W A;  1ZZP A;  3Q6N A;  1OKK A;  2IXO A;  4CJG A;  5EHH A;  5L3Q A;  2J8W A;  1R5I D;  3GEH A;  4ANJ A;  3U3F A;  2Y3H A;  4AE4 A;  1Q0D A;  2HUJ A;  2I15 A;  4P9F A;  3MFN A;  4N6C A;  2HV6 A;  3POV A;  2WB7 A;  4MND A;  4O7G A;  3O6X A;  3B0V C;  4OIQ F;  4U5E E;  4J32 B;  1RKE A;  4LER A;  3TJ5 A;  3ATP A;  4NC3 A;  4AK9 A;  1NU7 D;  3JTL O;  4GEH A;  5JLI A;  3LLI A;  1NBB A;  4IAO A;  2A69 F;  4OIR F;  3IPM O;  4WJ0 A;  3RW0 A;  3K1H A;  1WAT A;  1Z63 A;  2YLI A;  3IQ5 A;  1Z7Q c;  4JVS A;  3HNI A;  3NG1 A;  4F4B A;  2NUT B;  3AG3 C;  3EHN A;  1YAR O;  1CPQ A;  1MMD A;  1GGQ A;  1VLS A;  1A7E A;  2VCC A;  1TWC A;  1I4Z A;  1YYJ A;  3RF3 A;  4PJJ A;  1ST6 A;  1CGM E;  1D1A A;  1LI5 A;  2CNW A;  3H65 A;  1M2O A;  1G8X A;  2P61 A;  3EFO B;  1TR2 A;  3TJ6 A;  1M57 C;  4J7T A;  2OCC C;  1CPR A;  3ZG1 A;  4CDA A;  4HE8 D;  1T6I A;  2C03 A;  2EPK X;  3X2Q C;  2HSQ A;  3MBG A;  3ZQY A;  4YT4 A;  4D4N A;  2VCA A;  2UUI A;  1G4U S;  3ASO C;  5KYW A;  1FFT C;  3T6G B;  4GYT A;  3W4Y A;  3WAQ A;  1EQ1 A;  2ZXW C;  4O6N A;  1T5O A;  4BEJ A;  3MYI A;  4CBE A;  3TOM A;  1FR0 A;  2YLG A;  1NU9 C;  3LEV A;  3DJU B;  3DMD A;  3SXK A;  4CJO A;  2BE5 F;  2XS8 A;  3EH1 A;  3IQ6 A;  1W2W A;  3SP1 A;  1A0B A;  4Z9J A;  2L6F A;  4L6R A;  3S29 A;  2P0N A;  2KGO A;  3RQG A;  2EPN A;  2VB6 A;  4H54 A;  4MVQ A;  4DRH B;  3ASN C;  2C04 A;  4ONS A;  2YL1 A;  4JTC B;  2GWW A;  2XLO A;  3JT1 A;  3NRH A;  1FTS A;  3EGD A;  4HEA J;  1JAF A;  1JR8 A;  3HNL A;  4B6I A;  4P6I C;  1O5H A;  2AWY A;  3AGU A;  3FVY A;  5D92 A;  3FXH A;  2LP4 A;  3N0T A;  2EPO A;  3EGX A;  4QDL A;  1ZVZ A;  5CI8 A;  3U2L A;  2ZD9 A;  2WVQ A;  4KNV A;  2PBE A;  2HSB A;  3GEE A;  5E33 A;  1D0Y A;  1A41 A;  1K04 A;  3M4C A;  5EK0 A;  3K1I A;  1SF8 A;  2HMQ A;  3E9V A;  3OA1 A;  3TUL A;  3DM9 B;  2XXA B;  2V26 A;  3B71 A;  4N6H A;  4PJL A;  1ZHY A;  3V7O A;  3KYJ A;  1LE4 A;  1ZHZ A;  1VB5 A;  1OW6 A;  2KQ9 A;  4YL1 A;  4EBJ A;  5L0C A;  3L8I A;  3ABL C;  4EBB A;  1OXK A;  3GM1 A;  3J06 A;  1YVI A;  4IGG A;  5DS4 A;  3S28 A;  3T9O A;  3ZSU A;  1OCZ C;  1ORY A;  4NTA A;  2L9J A;  2CYD A;  3ITF A;  4J30 B;  1WN0 A;  1M2V B;  1LS4 A;  3HLZ A;  3NKD A;  3C8Z A;  1EA8 A;  4MTF A;  4U5G A;  3QW0 A;  4IRU A;  5HSW A;  2L6H A;  1MMA A;  2JD3 A;  3JRM O;  3AG1 C;  2E87 A;  1QZX A;  1YA9 A;  1ZHX A;  1YA7 O;  5BQG A;  5L0I A;  2KC3 A;  2XLM A;  3V5Z A;  3OEO A;  1IW7 F;  4E0H A;  3FMS A;  1AEP A;  4ER9 A;  4D4X A;  4JTD B;  4U5F E;  5DVW A;  1HE9 A;  2A6E F;  2LSE A;  2XM4 A;  3B0P A;  4NTB A;  5BUO A;  3JSE O;  3L8J A;  1AUE A;  3ABM C;  1Z6A A;  5B1A C;  4M63 A;  2ZXO A;  1V4A A;  2R03 A;  1LIH A;  4OD4 A;  3W8I A;  3C18 A;  1C17 M;  4K1O A;  1IZM A;  3W2V A;  2VH3 A;  1O87 A;  1BR1 A;  4CDY A;  1MMN A;  1NFO A;  3DZA A;  3X1O A;  5KYX B;  1GM5 A;  4CS8 C;  4EKW A;  1A7D A;  1H6G A;  1RJ9 B;  4EBK A;  1VK5 A;  2FGY A;  4CS9 C;  4WGY A;  2H7V C;  2GAQ A;  4X0R A;  2P6V A;  4LDQ A;  4XEV A;  4AX2 A;  3SZR A;  1OW8 A;  3T6J A;  1Y4C A;  2A0U A;  4NTF A;  4ULV A;  1TKN A;  1HMO A;  2A68 F;  1VOM A;  4N4W A;  3RH3 A;  4BJ6 A;  3UMI A;  3NYJ A;  2D5R B;  5DS5 A;  3U8P A;  4DXW A;  4YT8 A;  3CAX A;  1RKC A;  2FFH A;  5COG A;  2H8A A;  2KNH A;  4PAC A;  2MWQ A;  4EWC A;  3AQC A;  4IB4 A;  4E7S A;  3RQE A;  3UR3 C;  1EKY A;  3M15 A;  4FX5 A;  4HFF B;  4I1M A;  4MQ9 F;  1ZU5 A;  2PP4 A;  3JYY A;  3LUT B;  2AU5 A;  4NY3 A;  4U9D A;  5A6K A;  3B0U X;  3EHM A;  1OCR C;  2NPU A;  3MLG A;  3VM6 A;  3KH2 A;  3EJN A;  2L6G A;  3H2U A;  2EIK C;  3TQO A;  2R7W A;  4JC7 A;  1M56 C;  3AOU A;  3VF0 A;  1LVK A;  2NUT A;  2L7A A;  5KYY B;  1VTM P;  2QNL A;  4XQ1 A;  1Q0G A;  1I4Y A;  3GWN A;  4FES A;  1JPJ A;  4AL1 A;  2P1A A;  4IWB A;  3LAY A;  2VC9 A;  1C03 A;  3H2V A;  4JCH A;  2NUP A;  2L81 A;  4IAQ A;  4KBL A;  2HJ3 A;  3EFO A;  2YWA A;  2VAS A;  3DJN B;  3IQT A;  5JRA A;  3EH2 A;  1U89 A;  5E3A A;  4N06 A;  1LPE A;  3UMK A;  5A6J A;  5EGY A;  3C8G A;  1LKX A;  2B0H A;  4PFO A;  1Y6D A;  3AQB A;  1G4W R;  2YLD A;  4GQH A;  1LE2 A;  3JSZ A;  1JPN A;  3DWW A;  3ZDL A;  5A69 A;  1BR4 A;  4A4A A;  2Q9C A;  4CIH A;  2Y39 A;  1D0Z A;  2ETS A;  2EPL X;  2IYL D;  2LIG A;  3CQZ A;  3LS0 A;  4KC9 A;  5A6B A;  4RDA A;  3QTH A;  1GQA A;  4O6M A;  1CGN A;  4CS7 A;  4EHP A;  1AVO B;  1E86 A;  2J9B A;  3EZI A;  1CGO A;  1WWP A;  3B9Q A;  2R7R A;  1H7I A;  5AC5 A;  2LCH A;  1D0X A;  2YEV A;  3M4B A;  2PX0 A;  2HFI A;  1E85 A;  1PCX A;  2YKZ A;  1R4T A;  2Q9B A;  4AE4 B;  1D1C A;  1T9K A;  2WL8 A;  4OIP F;  4OD5 A;  3DM5 A;  1B68 A;  3F46 A;  3ZQV A;  5JP7 A;  2W45 A;  1F1M A;  5T3W A;  4PK4 A;  3I4U A;  2NSF A;  1ZW2 A;  5JT4 A;  4C3B A;  3M1C B;  3QVZ A;  4Q7C A;  2Y69 C;  4R32 A;  2XXA A;  1YJG A;  3E70 C;  3SEO A;  4FWV A;  4HFK B;  3NKE A;  3NMJ A;  3U5S A;  5F5H A;  3TOL A;  2M64 A;  3G4X A;  1M6T A;  4P9T A;  3CZ6 A;  5T3T A;  3WHN A;  3JRT A;  3NMK A;  4U9E A;  4JRZ A;  5L0H A;  4MVU A;  2GFH A;  1KU2 A;  4KI2 A;  5F5F A;  1MND A;  3A9C A;  1HW1 A;  3QVY A;  1PD1 A;  1K40 A;  4NCQ A;  3RQF A;  1TWA A;  3S90 A;  3PDM P;  1JMW A;  1V54 C;  2J7P D;  3AJM A;  1M2V A;  1XZQ A;  2EIN C;  4G0H A;  2DGJ A;  1NZE A;  4I44 A;  1FAP B;  2I8B A;  2OG2 A;  4JCZ A;  4YK5 A;  4MTG A;  2IM8 A;  2Q3T A;  1OCO C;  2AWC A;  1QQ3 A;  5L0J A;  3BRJ A;  2R7S A;  3U9M A;  3C62 A;  3L1M A;  1TWH A;  1OKK D;  2OJQ A;  3O10 A;  2IXN A;  1FFH A;  4EIY A;  2YL3 A;  1EI7 A;  2JX0 A;  2P7V A;  4YN0 B;  1V55 C;  3GEI A;  2B0J A;  2W4M A;  3RVZ A;  2XRH A;  3F47 A;  4RBN A;  5L0D A;  5L3V A;  2AVK A;  4MW8 A;  4AL0 A;  3C63 A;  3LNM B;  3T4R A;  4RD9 A;  4WGZ A;  1QKR A;  2OEV A;  2XLD A;  1FNT c;  2OU6 A;  1T01 A;  2YZS A;  1SZI A;  2LFD A;  4BPM A;  1ZU4 A;  2M4E A;  3HTK C;  3WG7 C;  1S7Z A;  1JOG A;  4XLN F;  2J0X A;  3FHD A;  1ZHW A;  1ZYR F;  3DAG A;  4ULW A;  3MX3 A;  2XLH A;  4CSA C;  1NSG B;  4BEM J;  2BC5 A;  2JPU A;  1QLE C;  3C8G D;  5JUA A;  4XEK A;  4O6Y A;  2ZPA A;  4PJN A;  1YLM A;  5JSL A;  1Z5Z A;  4Z9I A;  4MTO A;  3LJB A;  1PV3 A;  3W8H A;  3FAP B;  3T6B A;  2R7X A;  4XTK A;  1YZA A;  1BBH A;  2J45 A;  2KYH A;  2WZG A;  2CNW D;  4LDR A;  5DS6 A;  1Z23 A;  3QZC A;  3ECS A;  5HV9 A;  3O39 A;  5F28 E;  4QI0 A;  2WVO A;  4MVR A;  4IJJ A;  3SXM A;  3FOO A;  3DE8 A;  1TFK B;  2KJG A;  2R7O A;  4JKV A;  3RVY A;  3N2Z B;  2QUP A;  2YL0 A;  3GAN A;  4XPW A;  3ZWI A;  3O55 A;  3G50 A;  5KYY A;  1NFN A;  2R02 A;  2NSG A;  4LLC A;  2WZF A;  1VMA A;  1BR2 A;  3KMI A;  5KYU B;  4CSA A;  1WAS A;  2CW0 F;  2G3V A;  2A0B A;  3EG9 B;  4Z9H A;  4XEF A;  3SXZ A;  3U8V A;  4Q4Z F;  1V74 B;  2H7B A;  2Y3D A;  4WAB A;  4OIO F;  5AC4 A;  2YHS A;  1A7V A;  4Q5S F;  5BQH A;  4YJW A;  1YZC A;  3TK0 A;  2W9Y A;  3EQL F;  5B3S C;  1FMW A;  4LAC B;  1H9T A;  2XS1 A;  1RMV A;  4E7Z A;  2VCB A;  3HNK A;  2R7Q A;  3NMI A;  4CS8 A;  3A11 A;  3C7J A;  3K6B A;  2Q00 A;  4JTA B;  3U3B A;  1YAU O;  2G62 A;  5TJ5 E;  3S0X A;  4MW3 A;  3RFY A;  3TD7 A;  3LS1 A;  3FOP A;  4CS9 A;  3FAJ A;  2WVN A;  2DB4 A;  1H9G A;  4U5B E;  2D4U A;  4BJT A;  4DBQ A;  3GWL A;  4K7B A;  4G7Z F;  2CCY A;  3ZVR A;  2ZXP A;  4C3E A;  5A6A A;  3QW1 A;  1WTY A;  4JE9 A;  2R25 A;  4BJ5 C;  1L7C A;  2X51 A;  4YWQ A;  2DYR C;  1J8Y F;  3Q7L A;  3ZC4 A;  1Q0K A;  1UFB A;  4JJG A;  5FCL A;  4XLP F;  4JW1 A;  3SXY A;  4G7H F;  2ZXR A;  3LEO A;  4XPY A;  4A2N B;  2J9V A;  4CDV A;  5L0F A;  4C7O B;  2Q9A A;  4JUR I;  5B3I A;  2RSE B;  2EIM C;  4EUK B;  2HS5 A;  2YL7 A;  2R7T A;  2XLE A;  1S05 A;  2G3K A;  2LFF A;  2YQY A;  4E17 A;  1LS1 A;  2YVK A;  1OR2 A;  3Q6M A;  2R7V A;  2IBF A;  2HZ8 A;  1DOV A;  4K0D A;  3S27 A;  3HJC A;  3VAY A;  2MHR A;  2LK4 A;  2OQM A;  3HKK A;  4W8P A;  4ZLC A;  4CIP A;  1T6U A;  1K05 A;  2QTV A;  3V5X A;  2KK1 A;  2Q4F A;  3JZ0 A;  5E3C A;  3DI5 A;  2KSF A;  3LES A;  3B29 A;  1RKE B;  3EZH A;  1ORS C;  3GM3 A;  5COF A;  4BJ5 A;  4DVZ A;  4E18 A;  2NUP B;  1LM3 B;  1YDI A;  1I5N A;  3RKO F;  4BG0 A;  3NYM A;  2A1D D;  3CEX A;  2AP3 A;  3L34 A;  1NLX A;  4JJF A;  5IY5 C;  3DAF A;  3AG4 C;  3DD7 A;  4JEB A;  3C8G B;  3K1I C;  4KNW A;  1MQV A;  2IXM A;  4U5C E;  1T6Q A;  2V3C C;  1WOL A;  3EPV A;  3VYW A;  3NYL A;  4C3D A;  3PHF 2;  4XPX A;  2ASR A;  1MMG A;  1GS9 A;  5KYN A;  1U0B B;  2XM0 A;  4JIO A;  2QLA A;  4BJ1 A;  3KKB A;  1TQG A;  4J7Y A;  5JS5 A;  4JEA A;  2IOQ A;  2XL6 A;  3GOD A;  4U5D E;  2A6H F;  2CDQ A;  2EPM X;  3PCV A;  1E2X A;  3GOR A;  1XZP A;  3KPH A;  4I3M A;  1E84 A;  4W8K A;  2LQG A;  2XLV A;  4MVM A;  4DBR A;  3VRC A;  5DLJ A;  1OCC C;  1RCP A;  3AG2 C;  5KYW B;  2FAP B;  4MS2 A;  3IHU A;  3R2P A;  3IQC A;  1NG1 A;  1SR2 A;  4LLE A;  2OJE D;  4PJM A;  1KTM A;  2J9U A;  1OXB A;  2R9R B;  1VLT A;  2QE9 A;  2TMV P;  4YL3 A;  3SYN A; 
#chains in the Genus database with same CATH homology
 5F28 E;  1QVX A;  3C8G B;  4XEV A;  3K7D A;  1OW8 A;  2Q00 A;  3U0C A;  3S9O A;  1WWP A;  1WOL A;  2PBE A;  2HSB A;  2LK4 A;  3RQF A;  1K40 A;  1K04 A;  3TUL A;  1JOG A;  3AJM A;  2YWA A;  3B71 A;  1K05 A;  4NQF A;  2KK1 A;  2JPU A;  1OW6 A;  3C8G D;  3JZ0 A;  1WTY A;  1O3U A;  3C8G A;  3L8J A;  3L8I A;  1KNY A;  4XEK A;  4EBJ A;  3RQE A;  1V4A A;  3GM2 A;  2L6F A;  3C18 A;  3GM1 A;  3JYY A;  4XEF A;  1UFB A;  3RQG A;  1PV3 A;  3GM3 A;  3BRJ A;  1OW7 A;  1ZZP A;  4R32 A;  2L6G A;  3O10 A;  2JX0 A;  1KTM A;  3U3F A;  4EBK A;  3MFN A;  2L6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...