3BRJA

Crystal structure of mannitol operon repressor (mtlr) from vibrio parahaemolyticus rimd 2210633
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
NESEIIERLNSAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQDSGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNHLNSDASDYEFTDPNILEPIKKLHLVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol operon repressor
publication title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria.
pubmed doi rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transcription
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05068 MtlR Mannitol repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3brjA00
1KTMA 3GM2A 4R32A 3JZ0A 1PV3A 1WTYA 3K7DA 4XEVA 1OW7A 1K05A 2HSBA 4EBKA 1O3UA 2Q00A 3MFNA 4EBJA 3BRJA 3TULA 2YWAA 2JPUA 1UFBA 3L8JA 1WWPA 4XEKA 2L6HA 3RQGA 3C8GD 3C18A 2KK1A 3S9OA 2PBEA 3C8GB 3L8IA 5F28E 3U3FA 1OW6A 1KNYA 2JX0A 3O10A 1WOLA 3JYYA 4NQFA 3U0CA 2LK4A 2L6GA 4XEFA 1V4AA 1ZZPA 1JOGA 2L6FA 1K40A 3C8GA 3RQEA 3RQFA 1QVXA 3GM3A 1OW8A 3B71A 1K04A 3GM1A 3AJMA
chains in the Genus database with same CATH superfamily
3NDBB 1KTMA 3GODA 3JZ0A 1E2XA 3LESA 3SP1A 3FMSA 5JT4A 1T9KA 3ZSUA 4GQHA 2XLOA 1OKKD 2XRHA 2XLEA 3TULA 2QLAA 4I1OB 1A41A 1D1AA 1YA9A 4E7SA 2G3VA 1ZW2A 4GYTA 4PACA 1CGNA 1HE9A 4U5HA 4ZLDA 1MMNA 1T6IA 4MTOA 3EG9B 4Q7CA 1NZEA 1RXQA 1PD0A 4XPXA 3LS0A 4OINF 2A69F 5AC5A 2L9JA 4L6RA 1Z7Qc 3FXHA 3K1IA 3QW0A 3RQEA 1V74B 1XZPA 2YL0A 3FAPB 5AC4A 2RSEB 1FFHA 1EI7A 1T6UA 2R02A 1M57C 1NSGB 3O6XA 4JC7A 4C7OA 3N0TA 4MW3A 5COFA 3PHF2 3AGUA 2YL3A 5T3WA 2EINC 5EHHA 2IBFA 3CSKA 3WODF 4FWVA 4U5EE 3I4UA 4H54A 4C3BA 4K7BA 2EILC 3BEHA 3MYFA 1FFTC 1YJGA 5L3QA 4JTCB 4JVSA 1RJ9A 3U3FA 3U5SA 1XWJA 1CPRA 3EHNA 2EPLX 3LLIA 4O6YA 2VCCA 2CNWD 4DVZA 3UNGC 3L1MA 2J8WA 2MHRA 2NUTB 2QNLA 1M56C 3F46A 4BJ5A 3UGOA 4C7OB 1D0XA 1H7IA 5JVEA 2AWYA 4KNVA 2M64A 4JTAB 3X1OA 2MWQA 2OOCA 1OQCA 1RKCA 1R4TA 5B1AC 3AQCA 3QVYA 3U2LA 3M1CB 3L0IA 3WAQA 1L3PA 1VLTA 2B0JA 2XXAB 3C8ZA 3VM6A 1YDIA 3VYWA 5DS6A 1RJ9B 1QQ3A 2ASRA 3SXMA 4B6IA 2HV6A 2NG1A 3ASOC 5E3CA 1NU7D 4DJ9A 3QW1A 1WASA 3I5QA 3TOLA 4DBRA 3DD7A 3DWWA 2I8BA 4HEAJ 4IRUA 4MVQA 3GWLA 1ZU5A 3B9QA 1C03A 4LDKA 3VAYA 4CS8C 2UUIA 3M4BA 4MVZA 1VB5A 2EIKC 4HFFB 3AG3C 1M6TA 1JPNA 1YVIA 4D4XA 5KYYA 2WZGA 2CCYA 3L34A 1CGOA 3EZHA 4K1OA 1OCRC 5EGYA 4JTDB 5L0FA 2Y3DA 3EJNA 3TJ6A 3VF0A 4BJTA 4Q4ZF 4N6CA 4KNWA 3RQFA 3UR3C 4YK5A 5L3VA 2GA0A 4MVOA 3V5XA 2BE5F 3GM2A 2ZXPA 2R7RA 2YL1A 1HW2A 2A1DD 5KYYB 1YYJA 3DJNB 2P1AA 3S27A 1ST6A 4YWQA 3IQCA 1RCPA 4J30B 1IW7F 3ZC4A 4IARA 5L0GA 3C18A 2RD9A 2AVKA 4JKVA 1QKRA 2OCCC 2JD3A 3A11A 3DMDA 3KYIA 4DOZA 2IM8A 4DVYP 5KYXA 4CSAC 1FMWA 1OW6A 4JRZA 4I44A 4A4AA 3JRMO 4KC9A 1PD1A 4YL0A 4Z9HA 5E3AA 3B29A 1E86A 1TFOB 2YEVA 1ORJA 5DS5A 2L6GA 3E70C 1RKEA 2X51A 3LJBA 4IAOA 5GPGB 4CJOA 2R7VA 1IZMA 4QI0A 1H9TA 4G7ZF 1VMAA 2HMZA 1J8YF 3FOPA 1ZYRF 4NY3A 4E0HA 4LLEA 2NSGA 1FR0A 3DE8A 1PV3A 3W8HA 5KYXB 1TWAA 2J9VA 3UMHA 3G4ZA 2H7BA 1AVOB 4AL0A 4G7HF 1MMGA 4PJJA 5D92A 1LS4A 3ABLC 3HLZA 2NPUA 4MVSA 1Z3IX 1WWPA 3RH3A 4J7TA 3JT1A 4U5DE 5A6BD 4QI2A 1RKEB 2FGYA 4PR9A 5T3TA 2LQGA 2DGJA 1A7VA 2XL8A 2Y3GA 2ZD9A 3I5PA 4Q5SF 3O39A 1G5ZA 3DE9A 4LLCA 3EPVA 2DYSC 3R2PA 2R7OA 3DKAA 4IGGA 3EHMA 4E0IA 3MX3A 1D1BA 5DQTA 2L7AA 4XEFA 1PCXA 2OJQA 4NTFA 1O87A 4E7ZA 2V26A 2J9UA 3KL4A 3NRHA 2J0WA 3NMJA 3POVA 1OCOC 2GWWA 2XM4A 3AG1C 2YZSA 2WL8A 3ASNC 2EPKX 3CZ6A 2I15A 1Q0KA 5COGA 4XEVA 2PNOA 1Q0FA 1YZCA 4XPWA 3G50A 3H2VA 3IPMO 4AE4A 4CS9C 2GAQA 1QLEC 3O55A 4I3MA 1LIHA 1E84A 4UDVA 4J7YA 4LDRA 2WZFA 4XWJA 3U9MA 3J06A 3W2WA 2KW3C 2W4MA 5BQGA 1GQAA 4OIQF 2AU5A 1QSPA 3PDMP 3DZAA 4PK4A 1C02A 3L8IA 2CYDA 1QZXA 2FAPB 3JYYA 3AOUA 2LCHA 3IEEA 4FAPB 1OR3A 2LP4A 2W4BA 4IJJA 4NTAA 5A6JA 4YL3A 1EQ1A 1C17M 4AE4B 4U9DA 4CS8A 4JJGA 3C8GA 3C63A 5DS4A 4ZLCA 1MMAA 1QVXA 4XTKA 2D5RB 2IXOA 4WGYA 1K04A 5HSWA 3F47A 3A9CA 2EPNA 2W45A 4ER9A 2EIJC 3LNRA 1U6HA 1BR4A 3GANA 4DRHB 2PFDA 3MFNA 1FAPB 1HMDA 4XEKA 4DXWA 1FTSA 2XLVA 1SF8A 1YARO 2HJMA 2J46A 1M2VA 2M4EA 3DAFA 2EPMX 1JAFA 3C8GB 2AWCA 5BQHA 2YLDA 3ZG1A 1EA8A 3S0XA 1MMDA 4XPYA 1ORYA 2J7PA 3NMKA 3NYMA 3U0CA 3GORA 1LPEA 1OXBA 5L0IA 3X2QC 2ZXRA 1ORSC 4H4KC 4CSAA 1NFNA 2EPOA 2H8AA 2OQMA 2PX3A 3OWTA 1OCCC 2UUHA 3IQTA 1H6GA 2PF4E 4O7GA 3LLKA 2F22A 1G4US 1M2VB 1ZHXA 2XL4A 3ECSA 4NC3A 4R32A 5KYWB 2R7WA 1WTYA 3GEEA 1BZ4A 3QZCA 5A69A 2R7TA 2HS5A 3RIPA 2Q9AA 2ZXWC 4HFKB 4EBKA 1L7CA 3SXZA 4NCQA 2IOQA 5FCLA 3SXKA 2A6EF 3KKBA 4YL1A 1BBHA 1XZQA 3W2VA 1S7ZA 4MTFA 2KK1A 1SYQA 2ZPAA 3T6GB 3B0VC 3ZQVA 3LUTB 3HNLA 4JW1A 2XLWA 1ZHYA 1VK5A 2YRFA 3HKKA 5K0IA 4U5GA 2OEVA 1OKKA 1YA7O 3K33A 3SEOA 4G7OF 1Z63A 1DOVA 1WGWA 2XLHA 2L6FA 1K40A 1NU9C 3N24A 4YJWA 1J8MF 2ICWG 3T4RA 4JIOA 4NTBA 3JTLO 1K05A 2OKUA 2A6HF 3CAXA 1WN0A 3ZVRA 1T01A 4C3DA 1MNEA 5DQZA 4OIRF 3HNKA 4BPMA 1Q0DA 2BC5A 4BEJA 4BJ6C 4YT4A 3E9VA 3ABKC 4KI2A 3M79A 2VCAA 5JSLA 4C3EA 2R7XA 4CS9A 3SXYA 4ONSA 2TMVP 4U5CE 5JP7A 4ULVA 4JEBA 3R7CA 2VB6A 3CQZA 3RVYA 3U3BA 4OIPF 2GDCA 1E85A 1YYXA 4JEAA 1FMVA 3NKDA 2WVQA 3U8VA 2ZXOA 4IWBA 2P6VA 4FX5A 5DVWA 2P7VA 2O9XA 1KU2A 1Q0MA 2CNWA 5B1BC 2IXPA 4WJ0A 1YLMA 2YHSA 4P9FA 4Z9JA 1G4WR 2G3KA 3JSZA 3MBGA 1YZAA 2R25A 4ULWA 2J9BA 4MVRA 3L8JA 1B68A 3JYHA 2IXNA 3JSEO 4CX9A 5JUAA 2R9RB 2WB7A 3KPHA 2QY9A 4PJNA 4DBQA 2NUPA 3FAJA 1A7DA 3Q7GA 4HE8D 3TJ5A 2YLGA 5F28E 4CS7A 4D4NA 1E83A 2JX0A 5CI9A 4K0DA 2HFIA 2P0NA 2LK4A 3DAGA 4EUKB 1TFKB 1AUEA 2A0UA 4CBEA 1OXKA 3ABMC 1Z23A 1D1CA 3ZTZA 5DLJA 4BJ1A 1LVKA 5KYUA 4PJMA 5E33A 2ETSA 3NKEA 2KJGA 1U89A 3AJMA 4O79A 1N1CA 2E87A 4QDLA 4XLNF 3IQ6A 2KSFA 3UMIA 2NUPB 4EWCA 2Q7RA 2DB4A 2KQ9A 2LFDA 2Q00A 3AGTA 3T6JA 1U0BB 3BRJA 5CI8A 3FHDA 3UMKA 4DRIB 1Y4CA 2CW0F 3V5YA 1HMOA 2AP3A 3DI5A 2XM0A 3V7OA 1KNYA 3WHNA 2B0HA 4JE9A 5B3IA 1I4YA 2QUPA 2FFHA 4FESA 4NQFA 2X0CA 2KYHA 2YKZA 4U5BE 2LFFA 2HZ8A 2R7SA 2HSQA 3RYLA 1CGME 1GGQA 2IYLD 2Y39A 4AL1A 3EGXA 3LAYA 5F5FA 5E2QA 3US6A 2KGOA 3KH2A 2OU6A 4O6NA 2VC9A 2YQYA 3NYLA 2XXAA 4IB4A 1TQGA 2G62A 4CIPA 1VTMP 1I5NA 4MNDA 3H65A 4MVMA 5A6KA 3RFYA 3ZWIA 3AQBA 3ZIBA 3MYIA 2HJ3A 5KYWA 1DOWA 1TWGA 1OR2A 3TK0A 2XSEA 2XS8A 4KBLA 3EGXB 4WABA 2CDQA 4W8PA 3SNHA 2HV7A 4IAQA 1O5HA 2OG2A 3HTKC 1MQVA 3EFOA 3CEXA 3LNMB 4G0HA 1WOLA 2VH3A 3RW0A 3T6BA 5B3SC 3JRTA 5L0HA 2V3CC 3DJUB 4BJ6A 1OCZC 1CPQA 4N4WA 2J45A 2Y3BA 2Q4FA 3M15A 2VASA 4LERA 2LIGA 3DM9B 2QTVA 3EZIA 3GWNA 4GEHA 1ZU4A 3TOMA 4YT8A 1JR8A 4PFOA 3GM3A 3OEOA 5A6BA 2MYSA 2PX0A 1LI7A 2NUTA 4DRJB 4JZAA 2KC3A 1LE2A 3TQOA 1ZVZA 2J9WA 3K7DA 1S05A 3M4CA 3QTHA 1OW7A 1TWHA 4MS2A 2C04A 4RDAA 1Y6DA 2C03A 4JCZA 3U9JA 3S84A 3EFOB 3NG1A 1RMVA 1GS9A 1JMWA 3Q6MA 3IQ5A 2W9YA 2JPUA 2YWAA 5TJ5E 1V55C 3ZQYA 2WVNA 3SZRA 1FNTc 3NYJA 2LSEA 4CDYA 4LACB 1EKYA 2XS1A 3RKOF 2XLDA 3GEHA 3UGPA 1V54C 2YL7A 1T5OA 2GFHA 1LM3B 2R7QA 4XLPF 1QPUA 2WVOA 4JCHA 3ITFA 3B0PA 4CDAA 2QE9A 3TD7A 2YLIA 2LD6A 2DI3A 4M63A 4YN0B 2Q9CA 4W8KA 2R05A 2Z15A 5BQIA 1Z6AA 2OEXA 2R03A 3S90A 5JRAA 4O6MA 4PJLA 4EIYA 3QVZA 3LEVA 3G4XA 4RBNA 2HSBA 4Z9IA 5A6AA 1M2OA 1ZHWA 1LKXA 1O3UA 2HMQA 3C62A 3IHUA 4LDQA 4MTGA 3WG7C 2H7OA 3Q7LA 1HE1A 4AK9A 4P9TA 5HV9A 4E18A 4U5FE 4U9EA 3W8IA 4RD9A 4CIHA 4WGZA 5FZTA 1NG1A 3K1HA 1APCA 2VCBA 3K1IC 3QMKA 1SMYF 5L0JA 1NBBA 4X0RA 1BR2A 3B0UX 2H7VC 2IXMA 5L0DA 4PFPA 3HJCA 1F1MA 3N2ZB 4J32B 1TKNA 1VYIA 4MVUA 3W4YA 1UG7A 2NSFA 1A7EA 3Q6NA 3B71A 5T1DB 4BEMJ 4E17A 3NMIA 3FOOA 2OJED 3GM1A 2R7UA 2A68F 4ANJA 4G78A 1TR2A 1G8XA 256BA 1LI5A 3DM5A 2L81A 3SYNA 3GEIA 1I4ZA 3U2MA 5BUOA 3VRCA 1ZHTA 4EBJA 1A0BA 1BR1A 4A2NB 1NFOA 3LS1A 3RF3A 3RVZA 4MW8A 3C7JA 2L6HA 2D4UA 4I1MA 1VOMA 3C8GD 4P6IC 2J0XA 3HNIA 2PP4A 4JURI 3RQGA 4BJ5C 3AG2C 4F4BA 1LS1A 3LEOA 2PBEA 3EGDA 1HW1A 3ATPA 3DXJF 5COMA 5D91A 3ZDLA 4BG0A 1SR2A 2P61A 5CIVA 1AEPA 4OD4A 1H9GA 1D0YA 5L0CA 2XLMA 5AGFA 1LE4A 2HUJA 3V5ZA 5JLIA 1R5ID 5JS5A 3KMIA 3H2UA 3EH2A 1W2WA 2Y3HA 2CGEA 3T9OA 3U8PA 3AG4C 5KYNA 1VYKA 3EGDB 3EH1A 2HKVA 1ZW3A 2J7PD 4MQ9F 4XQ1A 4AX2A 1Q0GA 4CDVA 4CJGA 1Z5ZA 3EQLF 4YT5A 1D0ZA 1JRAA 2BL2A 1JPJA 1UFBA 2Q9BA 1TWCA 2A0BA 3PMRA 3K66A 2DYRC 3S9OA 1ZHZA 2XL6A 1T6QA 2Y69C 4N06A 3O10A 1SZIA 4EBBA 5IY5C 4OIOF 1BDJB 3S29A 4EKWA 3HNJA 5KYUB 4EHPA 5F5HA 4YT2A 1MNDA 3OA1A 2YVKA 4JJFA 1V4AA 3KYJA 2KNHA 4OD5A 1YAUO 1ZZPA 3JCUQ 3K6BA 1JOGA 2EIMC 2WZLA 3EG9A 3PCVA 3S28A 3FVYA 3ZTMA 1GM5A 1NLXA 1VLSA 1WATA 3MLGA 1OW8A 1HY5A 2Q3TA 4N6HA 3FDQA 5EK0A
chains in the Genus database with same CATH topology
1KTMA 3GM2A 4R32A 3JZ0A 1PV3A 1WTYA 3K7DA 4XEVA 1OW7A 1K05A 2HSBA 4EBKA 1O3UA 2Q00A 3MFNA 4EBJA 3BRJA 3TULA 2YWAA 2JPUA 1UFBA 3L8JA 1WWPA 4XEKA 2L6HA 3RQGA 3C8GD 3C18A 2KK1A 3S9OA 2PBEA 3C8GB 3L8IA 5F28E 3U3FA 1OW6A 1KNYA 2JX0A 3O10A 1WOLA 3JYYA 4NQFA 3U0CA 2LK4A 2L6GA 4XEFA 1V4AA 1ZZPA 1JOGA 2L6FA 1K40A 3C8GA 3RQEA 3RQFA 1QVXA 3GM3A 1OW8A 3B71A 1K04A 3GM1A 3AJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTM A;  3GM2 A;  4R32 A;  3JZ0 A;  1PV3 A;  1WTY A;  3K7D A;  4XEV A;  1OW7 A;  1K05 A;  2HSB A;  4EBK A;  1O3U A;  2Q00 A;  3MFN A;  4EBJ A;  3BRJ A;  3TUL A;  2YWA A;  2JPU A;  1UFB A;  3L8J A;  1WWP A;  4XEK A;  2L6H A;  3RQG A;  3C8G D;  3C18 A;  2KK1 A;  3S9O A;  2PBE A;  3C8G B;  3L8I A;  5F28 E;  3U3F A;  1OW6 A;  1KNY A;  2JX0 A;  3O10 A;  1WOL A;  3JYY A;  4NQF A;  3U0C A;  2LK4 A;  2L6G A;  4XEF A;  1V4A A;  1ZZP A;  1JOG A;  2L6F A;  1K40 A;  3C8G A;  3RQE A;  3RQF A;  1QVX A;  3GM3 A;  1OW8 A;  3B71 A;  1K04 A;  3GM1 A;  3AJM A; 
#chains in the Genus database with same CATH topology
 3NDB B;  1KTM A;  3GOD A;  3JZ0 A;  1E2X A;  3LES A;  3SP1 A;  3FMS A;  5JT4 A;  1T9K A;  3ZSU A;  4GQH A;  2XLO A;  1OKK D;  2XRH A;  2XLE A;  3TUL A;  2QLA A;  4I1O B;  1A41 A;  1D1A A;  1YA9 A;  4E7S A;  2G3V A;  1ZW2 A;  4GYT A;  4PAC A;  1CGN A;  1HE9 A;  4U5H A;  4ZLD A;  1MMN A;  1T6I A;  4MTO A;  3EG9 B;  4Q7C A;  1NZE A;  1RXQ A;  1PD0 A;  4XPX A;  3LS0 A;  4OIN F;  2A69 F;  5AC5 A;  2L9J A;  4L6R A;  1Z7Q c;  3FXH A;  3K1I A;  3QW0 A;  3RQE A;  1V74 B;  1XZP A;  2YL0 A;  3FAP B;  5AC4 A;  2RSE B;  1FFH A;  1EI7 A;  1T6U A;  2R02 A;  1M57 C;  1NSG B;  3O6X A;  4JC7 A;  4C7O A;  3N0T A;  4MW3 A;  5COF A;  3PHF 2;  3AGU A;  2YL3 A;  5T3W A;  2EIN C;  5EHH A;  2IBF A;  3CSK A;  3WOD F;  4FWV A;  4U5E E;  3I4U A;  4H54 A;  4C3B A;  4K7B A;  2EIL C;  3BEH A;  3MYF A;  1FFT C;  1YJG A;  5L3Q A;  4JTC B;  4JVS A;  1RJ9 A;  3U3F A;  3U5S A;  1XWJ A;  1CPR A;  3EHN A;  2EPL X;  3LLI A;  4O6Y A;  2VCC A;  2CNW D;  4DVZ A;  3UNG C;  3L1M A;  2J8W A;  2MHR A;  2NUT B;  2QNL A;  1M56 C;  3F46 A;  4BJ5 A;  3UGO A;  4C7O B;  1D0X A;  1H7I A;  5JVE A;  2AWY A;  4KNV A;  2M64 A;  4JTA B;  3X1O A;  2MWQ A;  2OOC A;  1OQC A;  1RKC A;  1R4T A;  5B1A C;  3AQC A;  3QVY A;  3U2L A;  3M1C B;  3L0I A;  3WAQ A;  1L3P A;  1VLT A;  2B0J A;  2XXA B;  3C8Z A;  3VM6 A;  1YDI A;  3VYW A;  5DS6 A;  1RJ9 B;  1QQ3 A;  2ASR A;  3SXM A;  4B6I A;  2HV6 A;  2NG1 A;  3ASO C;  5E3C A;  1NU7 D;  4DJ9 A;  3QW1 A;  1WAS A;  3I5Q A;  3TOL A;  4DBR A;  3DD7 A;  3DWW A;  2I8B A;  4HEA J;  4IRU A;  4MVQ A;  3GWL A;  1ZU5 A;  3B9Q A;  1C03 A;  4LDK A;  3VAY A;  4CS8 C;  2UUI A;  3M4B A;  4MVZ A;  1VB5 A;  2EIK C;  4HFF B;  3AG3 C;  1M6T A;  1JPN A;  1YVI A;  4D4X A;  5KYY A;  2WZG A;  2CCY A;  3L34 A;  1CGO A;  3EZH A;  4K1O A;  1OCR C;  5EGY A;  4JTD B;  5L0F A;  2Y3D A;  3EJN A;  3TJ6 A;  3VF0 A;  4BJT A;  4Q4Z F;  4N6C A;  4KNW A;  3RQF A;  3UR3 C;  4YK5 A;  5L3V A;  2GA0 A;  4MVO A;  3V5X A;  2BE5 F;  3GM2 A;  2ZXP A;  2R7R A;  2YL1 A;  1HW2 A;  2A1D D;  5KYY B;  1YYJ A;  3DJN B;  2P1A A;  3S27 A;  1ST6 A;  4YWQ A;  3IQC A;  1RCP A;  4J30 B;  1IW7 F;  3ZC4 A;  4IAR A;  5L0G A;  3C18 A;  2RD9 A;  2AVK A;  4JKV A;  1QKR A;  2OCC C;  2JD3 A;  3A11 A;  3DMD A;  3KYI A;  4DOZ A;  2IM8 A;  4DVY P;  5KYX A;  4CSA C;  1FMW A;  1OW6 A;  4JRZ A;  4I44 A;  4A4A A;  3JRM O;  4KC9 A;  1PD1 A;  4YL0 A;  4Z9H A;  5E3A A;  3B29 A;  1E86 A;  1TFO B;  2YEV A;  1ORJ A;  5DS5 A;  2L6G A;  3E70 C;  1RKE A;  2X51 A;  3LJB A;  4IAO A;  5GPG B;  4CJO A;  2R7V A;  1IZM A;  4QI0 A;  1H9T A;  4G7Z F;  1VMA A;  2HMZ A;  1J8Y F;  3FOP A;  1ZYR F;  4NY3 A;  4E0H A;  4LLE A;  2NSG A;  1FR0 A;  3DE8 A;  1PV3 A;  3W8H A;  5KYX B;  1TWA A;  2J9V A;  3UMH A;  3G4Z A;  2H7B A;  1AVO B;  4AL0 A;  4G7H F;  1MMG A;  4PJJ A;  5D92 A;  1LS4 A;  3ABL C;  3HLZ A;  2NPU A;  4MVS A;  1Z3I X;  1WWP A;  3RH3 A;  4J7T A;  3JT1 A;  4U5D E;  5A6B D;  4QI2 A;  1RKE B;  2FGY A;  4PR9 A;  5T3T A;  2LQG A;  2DGJ A;  1A7V A;  2XL8 A;  2Y3G A;  2ZD9 A;  3I5P A;  4Q5S F;  3O39 A;  1G5Z A;  3DE9 A;  4LLC A;  3EPV A;  2DYS C;  3R2P A;  2R7O A;  3DKA A;  4IGG A;  3EHM A;  4E0I A;  3MX3 A;  1D1B A;  5DQT A;  2L7A A;  4XEF A;  1PCX A;  2OJQ A;  4NTF A;  1O87 A;  4E7Z A;  2V26 A;  2J9U A;  3KL4 A;  3NRH A;  2J0W A;  3NMJ A;  3POV A;  1OCO C;  2GWW A;  2XM4 A;  3AG1 C;  2YZS A;  2WL8 A;  3ASN C;  2EPK X;  3CZ6 A;  2I15 A;  1Q0K A;  5COG A;  4XEV A;  2PNO A;  1Q0F A;  1YZC A;  4XPW A;  3G50 A;  3H2V A;  3IPM O;  4AE4 A;  4CS9 C;  2GAQ A;  1QLE C;  3O55 A;  4I3M A;  1LIH A;  1E84 A;  4UDV A;  4J7Y A;  4LDR A;  2WZF A;  4XWJ A;  3U9M A;  3J06 A;  3W2W A;  2KW3 C;  2W4M A;  5BQG A;  1GQA A;  4OIQ F;  2AU5 A;  1QSP A;  3PDM P;  3DZA A;  4PK4 A;  1C02 A;  3L8I A;  2CYD A;  1QZX A;  2FAP B;  3JYY A;  3AOU A;  2LCH A;  3IEE A;  4FAP B;  1OR3 A;  2LP4 A;  2W4B A;  4IJJ A;  4NTA A;  5A6J A;  4YL3 A;  1EQ1 A;  1C17 M;  4AE4 B;  4U9D A;  4CS8 A;  4JJG A;  3C8G A;  3C63 A;  5DS4 A;  4ZLC A;  1MMA A;  1QVX A;  4XTK A;  2D5R B;  2IXO A;  4WGY A;  1K04 A;  5HSW A;  3F47 A;  3A9C A;  2EPN A;  2W45 A;  4ER9 A;  2EIJ C;  3LNR A;  1U6H A;  1BR4 A;  3GAN A;  4DRH B;  2PFD A;  3MFN A;  1FAP B;  1HMD A;  4XEK A;  4DXW A;  1FTS A;  2XLV A;  1SF8 A;  1YAR O;  2HJM A;  2J46 A;  1M2V A;  2M4E A;  3DAF A;  2EPM X;  1JAF A;  3C8G B;  2AWC A;  5BQH A;  2YLD A;  3ZG1 A;  1EA8 A;  3S0X A;  1MMD A;  4XPY A;  1ORY A;  2J7P A;  3NMK A;  3NYM A;  3U0C A;  3GOR A;  1LPE A;  1OXB A;  5L0I A;  3X2Q C;  2ZXR A;  1ORS C;  4H4K C;  4CSA A;  1NFN A;  2EPO A;  2H8A A;  2OQM A;  2PX3 A;  3OWT A;  1OCC C;  2UUH A;  3IQT A;  1H6G A;  2PF4 E;  4O7G A;  3LLK A;  2F22 A;  1G4U S;  1M2V B;  1ZHX A;  2XL4 A;  3ECS A;  4NC3 A;  4R32 A;  5KYW B;  2R7W A;  1WTY A;  3GEE A;  1BZ4 A;  3QZC A;  5A69 A;  2R7T A;  2HS5 A;  3RIP A;  2Q9A A;  2ZXW C;  4HFK B;  4EBK A;  1L7C A;  3SXZ A;  4NCQ A;  2IOQ A;  5FCL A;  3SXK A;  2A6E F;  3KKB A;  4YL1 A;  1BBH A;  1XZQ A;  3W2V A;  1S7Z A;  4MTF A;  2KK1 A;  1SYQ A;  2ZPA A;  3T6G B;  3B0V C;  3ZQV A;  3LUT B;  3HNL A;  4JW1 A;  2XLW A;  1ZHY A;  1VK5 A;  2YRF A;  3HKK A;  5K0I A;  4U5G A;  2OEV A;  1OKK A;  1YA7 O;  3K33 A;  3SEO A;  4G7O F;  1Z63 A;  1DOV A;  1WGW A;  2XLH A;  2L6F A;  1K40 A;  1NU9 C;  3N24 A;  4YJW A;  1J8M F;  2ICW G;  3T4R A;  4JIO A;  4NTB A;  3JTL O;  1K05 A;  2OKU A;  2A6H F;  3CAX A;  1WN0 A;  3ZVR A;  1T01 A;  4C3D A;  1MNE A;  5DQZ A;  4OIR F;  3HNK A;  4BPM A;  1Q0D A;  2BC5 A;  4BEJ A;  4BJ6 C;  4YT4 A;  3E9V A;  3ABK C;  4KI2 A;  3M79 A;  2VCA A;  5JSL A;  4C3E A;  2R7X A;  4CS9 A;  3SXY A;  4ONS A;  2TMV P;  4U5C E;  5JP7 A;  4ULV A;  4JEB A;  3R7C A;  2VB6 A;  3CQZ A;  3RVY A;  3U3B A;  4OIP F;  2GDC A;  1E85 A;  1YYX A;  4JEA A;  1FMV A;  3NKD A;  2WVQ A;  3U8V A;  2ZXO A;  4IWB A;  2P6V A;  4FX5 A;  5DVW A;  2P7V A;  2O9X A;  1KU2 A;  1Q0M A;  2CNW A;  5B1B C;  2IXP A;  4WJ0 A;  1YLM A;  2YHS A;  4P9F A;  4Z9J A;  1G4W R;  2G3K A;  3JSZ A;  3MBG A;  1YZA A;  2R25 A;  4ULW A;  2J9B A;  4MVR A;  3L8J A;  1B68 A;  3JYH A;  2IXN A;  3JSE O;  4CX9 A;  5JUA A;  2R9R B;  2WB7 A;  3KPH A;  2QY9 A;  4PJN A;  4DBQ A;  2NUP A;  3FAJ A;  1A7D A;  3Q7G A;  4HE8 D;  3TJ5 A;  2YLG A;  5F28 E;  4CS7 A;  4D4N A;  1E83 A;  2JX0 A;  5CI9 A;  4K0D A;  2HFI A;  2P0N A;  2LK4 A;  3DAG A;  4EUK B;  1TFK B;  1AUE A;  2A0U A;  4CBE A;  1OXK A;  3ABM C;  1Z23 A;  1D1C A;  3ZTZ A;  5DLJ A;  4BJ1 A;  1LVK A;  5KYU A;  4PJM A;  5E33 A;  2ETS A;  3NKE A;  2KJG A;  1U89 A;  3AJM A;  4O79 A;  1N1C A;  2E87 A;  4QDL A;  4XLN F;  3IQ6 A;  2KSF A;  3UMI A;  2NUP B;  4EWC A;  2Q7R A;  2DB4 A;  2KQ9 A;  2LFD A;  2Q00 A;  3AGT A;  3T6J A;  1U0B B;  3BRJ A;  5CI8 A;  3FHD A;  3UMK A;  4DRI B;  1Y4C A;  2CW0 F;  3V5Y A;  1HMO A;  2AP3 A;  3DI5 A;  2XM0 A;  3V7O A;  1KNY A;  3WHN A;  2B0H A;  4JE9 A;  5B3I A;  1I4Y A;  2QUP A;  2FFH A;  4FES A;  4NQF A;  2X0C A;  2KYH A;  2YKZ A;  4U5B E;  2LFF A;  2HZ8 A;  2R7S A;  2HSQ A;  3RYL A;  1CGM E;  1GGQ A;  2IYL D;  2Y39 A;  4AL1 A;  3EGX A;  3LAY A;  5F5F A;  5E2Q A;  3US6 A;  2KGO A;  3KH2 A;  2OU6 A;  4O6N A;  2VC9 A;  2YQY A;  3NYL A;  2XXA A;  4IB4 A;  1TQG A;  2G62 A;  4CIP A;  1VTM P;  1I5N A;  4MND A;  3H65 A;  4MVM A;  5A6K A;  3RFY A;  3ZWI A;  3AQB A;  3ZIB A;  3MYI A;  2HJ3 A;  5KYW A;  1DOW A;  1TWG A;  1OR2 A;  3TK0 A;  2XSE A;  2XS8 A;  4KBL A;  3EGX B;  4WAB A;  2CDQ A;  4W8P A;  3SNH A;  2HV7 A;  4IAQ A;  1O5H A;  2OG2 A;  3HTK C;  1MQV A;  3EFO A;  3CEX A;  3LNM B;  4G0H A;  1WOL A;  2VH3 A;  3RW0 A;  3T6B A;  5B3S C;  3JRT A;  5L0H A;  2V3C C;  3DJU B;  4BJ6 A;  1OCZ C;  1CPQ A;  4N4W A;  2J45 A;  2Y3B A;  2Q4F A;  3M15 A;  2VAS A;  4LER A;  2LIG A;  3DM9 B;  2QTV A;  3EZI A;  3GWN A;  4GEH A;  1ZU4 A;  3TOM A;  4YT8 A;  1JR8 A;  4PFO A;  3GM3 A;  3OEO A;  5A6B A;  2MYS A;  2PX0 A;  1LI7 A;  2NUT A;  4DRJ B;  4JZA A;  2KC3 A;  1LE2 A;  3TQO A;  1ZVZ A;  2J9W A;  3K7D A;  1S05 A;  3M4C A;  3QTH A;  1OW7 A;  1TWH A;  4MS2 A;  2C04 A;  4RDA A;  1Y6D A;  2C03 A;  4JCZ A;  3U9J A;  3S84 A;  3EFO B;  3NG1 A;  1RMV A;  1GS9 A;  1JMW A;  3Q6M A;  3IQ5 A;  2W9Y A;  2JPU A;  2YWA A;  5TJ5 E;  1V55 C;  3ZQY A;  2WVN A;  3SZR A;  1FNT c;  3NYJ A;  2LSE A;  4CDY A;  4LAC B;  1EKY A;  2XS1 A;  3RKO F;  2XLD A;  3GEH A;  3UGP A;  1V54 C;  2YL7 A;  1T5O A;  2GFH A;  1LM3 B;  2R7Q A;  4XLP F;  1QPU A;  2WVO A;  4JCH A;  3ITF A;  3B0P A;  4CDA A;  2QE9 A;  3TD7 A;  2YLI A;  2LD6 A;  2DI3 A;  4M63 A;  4YN0 B;  2Q9C A;  4W8K A;  2R05 A;  2Z15 A;  5BQI A;  1Z6A A;  2OEX A;  2R03 A;  3S90 A;  5JRA A;  4O6M A;  4PJL A;  4EIY A;  3QVZ A;  3LEV A;  3G4X A;  4RBN A;  2HSB A;  4Z9I A;  5A6A A;  1M2O A;  1ZHW A;  1LKX A;  1O3U A;  2HMQ A;  3C62 A;  3IHU A;  4LDQ A;  4MTG A;  3WG7 C;  2H7O A;  3Q7L A;  1HE1 A;  4AK9 A;  4P9T A;  5HV9 A;  4E18 A;  4U5F E;  4U9E A;  3W8I A;  4RD9 A;  4CIH A;  4WGZ A;  5FZT A;  1NG1 A;  3K1H A;  1APC A;  2VCB A;  3K1I C;  3QMK A;  1SMY F;  5L0J A;  1NBB A;  4X0R A;  1BR2 A;  3B0U X;  2H7V C;  2IXM A;  5L0D A;  4PFP A;  3HJC A;  1F1M A;  3N2Z B;  4J32 B;  1TKN A;  1VYI A;  4MVU A;  3W4Y A;  1UG7 A;  2NSF A;  1A7E A;  3Q6N A;  3B71 A;  5T1D B;  4BEM J;  4E17 A;  3NMI A;  3FOO A;  2OJE D;  3GM1 A;  2R7U A;  2A68 F;  4ANJ A;  4G78 A;  1TR2 A;  1G8X A;  256B A;  1LI5 A;  3DM5 A;  2L81 A;  3SYN A;  3GEI A;  1I4Z A;  3U2M A;  5BUO A;  3VRC A;  1ZHT A;  4EBJ A;  1A0B A;  1BR1 A;  4A2N B;  1NFO A;  3LS1 A;  3RF3 A;  3RVZ A;  4MW8 A;  3C7J A;  2L6H A;  2D4U A;  4I1M A;  1VOM A;  3C8G D;  4P6I C;  2J0X A;  3HNI A;  2PP4 A;  4JUR I;  3RQG A;  4BJ5 C;  3AG2 C;  4F4B A;  1LS1 A;  3LEO A;  2PBE A;  3EGD A;  1HW1 A;  3ATP A;  3DXJ F;  5COM A;  5D91 A;  3ZDL A;  4BG0 A;  1SR2 A;  2P61 A;  5CIV A;  1AEP A;  4OD4 A;  1H9G A;  1D0Y A;  5L0C A;  2XLM A;  5AGF A;  1LE4 A;  2HUJ A;  3V5Z A;  5JLI A;  1R5I D;  5JS5 A;  3KMI A;  3H2U A;  3EH2 A;  1W2W A;  2Y3H A;  2CGE A;  3T9O A;  3U8P A;  3AG4 C;  5KYN A;  1VYK A;  3EGD B;  3EH1 A;  2HKV A;  1ZW3 A;  2J7P D;  4MQ9 F;  4XQ1 A;  4AX2 A;  1Q0G A;  4CDV A;  4CJG A;  1Z5Z A;  3EQL F;  4YT5 A;  1D0Z A;  1JRA A;  2BL2 A;  1JPJ A;  1UFB A;  2Q9B A;  1TWC A;  2A0B A;  3PMR A;  3K66 A;  2DYR C;  3S9O A;  1ZHZ A;  2XL6 A;  1T6Q A;  2Y69 C;  4N06 A;  3O10 A;  1SZI A;  4EBB A;  5IY5 C;  4OIO F;  1BDJ B;  3S29 A;  4EKW A;  3HNJ A;  5KYU B;  4EHP A;  5F5H A;  4YT2 A;  1MND A;  3OA1 A;  2YVK A;  4JJF A;  1V4A A;  3KYJ A;  2KNH A;  4OD5 A;  1YAU O;  1ZZP A;  3JCU Q;  3K6B A;  1JOG A;  2EIM C;  2WZL A;  3EG9 A;  3PCV A;  3S28 A;  3FVY A;  3ZTM A;  1GM5 A;  1NLX A;  1VLS A;  1WAT A;  3MLG A;  1OW8 A;  1HY5 A;  2Q3T A;  4N6H A;  3FDQ A;  5EK0 A; 
#chains in the Genus database with same CATH homology
 1KTM A;  3GM2 A;  4R32 A;  3JZ0 A;  1PV3 A;  1WTY A;  3K7D A;  4XEV A;  1OW7 A;  1K05 A;  2HSB A;  4EBK A;  1O3U A;  2Q00 A;  3MFN A;  4EBJ A;  3BRJ A;  3TUL A;  2YWA A;  2JPU A;  1UFB A;  3L8J A;  1WWP A;  4XEK A;  2L6H A;  3RQG A;  3C8G D;  3C18 A;  2KK1 A;  3S9O A;  2PBE A;  3C8G B;  3L8I A;  5F28 E;  3U3F A;  1OW6 A;  1KNY A;  2JX0 A;  3O10 A;  1WOL A;  3JYY A;  4NQF A;  3U0C A;  2LK4 A;  2L6G A;  4XEF A;  1V4A A;  1ZZP A;  1JOG A;  2L6F A;  1K40 A;  3C8G A;  3RQE A;  3RQF A;  1QVX A;  3GM3 A;  1OW8 A;  3B71 A;  1K04 A;  3GM1 A;  3AJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...