3BRJA

Crystal structure of mannitol operon repressor (mtlr) from vibrio parahaemolyticus rimd 2210633
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
NESEIIERLNSAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQDSGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNHLNSDASDYEFTDPNILEPIKKLHLVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol operon repressor
publication title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria.
pubmed doi rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transcription
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05068 MtlR Mannitol repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3brjA00
4XEFA 1JOGA 1O3UA 4NQFA 3C8GD 3O10A 1WTYA 3BRJA 1KNYA 5F28E 4EBJA 2Q00A 1OW8A 2JPUA 3U0CA 3L8IA 3B71A 2YWAA 2HSBA 1OW7A 3JYYA 3GM2A 4XEVA 1K40A 1K05A 2L6HA 3JZ0A 1PV3A 2LK4A 3AJMA 4EBKA 1OW6A 3U3FA 3TULA 3K7DA 3GM3A 2KK1A 3RQFA 3MFNA 3RQGA 4XEKA 1K04A 2PBEA 3C18A 3C8GA 1WWPA 4R32A 1KTMA 1UFBA 2L6FA 2JX0A 1WOLA 3S9OA 2L6GA 1QVXA 3RQEA 3C8GB 1V4AA 3L8JA 3GM1A 1ZZPA
chains in the Genus database with same CATH superfamily
1A41A 4N06A 5FZTA 1WTYA 3ABLC 2A6HF 4MVQA 1T6IA 1WN0A 3KYJA 4F4BA 1LI7A 2OEVA 4P9FA 5D92A 1PD1A 4JKVA 4JC7A 2PF4E 4MTFA 4Q7CA 3NKDA 4BJ6A 1K40A 3EHMA 3FAJA 2L7AA 5KYNA 2E87A 1M2OA 1OW6A 1AEPA 3ZTMA 5JLIA 3NYJA 3K33A 2VCAA 4CJOA 3TK0A 5JT4A 2EPKX 3LLKA 3W8HA 3EJNA 4XLPF 2NG1A 3C8GA 5JSLA 3V7OA 2EPOA 4DRHB 4MW8A 2CDQA 5E33A 2NPUA 3T9OA 4MVUA 4D4XA 3G4XA 4N6CA 4NQFA 3ZSUA 4QI2A 3O10A 4ZLCA 3HTKC 4BJ5A 3QVYA 3EHNA 5T3TA 4AL1A 4LDKA 1M2VB 3IEEA 4BEJA 1B68A 2MHRA 3B71A 2QTVA 4HEAJ 3JYYA 3RKOF 2CYDA 4P6IC 1M57C 1ORJA 4U5DE 3DXJF 3BEHA 1VLSA 2R7OA 5DS5A 3H2VA 4ONSA 3DAGA 3IQ6A 3M4CA 3GM3A 4JE9A 2KK1A 4FAPB 2R03A 1E85A 4LDRA 4I1MA 4MVZA 4BPMA 2OOCA 2HMZA 3N2ZB 4G0HA 4E7SA 3WAQA 3FMSA 256BA 1RJ9A 1CPQA 1JPNA 2EILC 2QUPA 2FFHA 3AQCA 1OR2A 3AG3C 3DJNB 1MMGA 4YT2A 3LAYA 4H54A 3FDQA 4PJJA 2XLWA 1VOMA 4MVMA 3T6BA 2R7QA 5JVEA 5IY5C 3GANA 2A0BA 2IXMA 3H65A 1Q0MA 3EG9B 3U8VA 4PFPA 4ZLDA 3C8ZA 4UDVA 5D91A 3GORA 1Z63A 5TJ5E 2L81A 4CIPA 4AX2A 3NYMA 4H4KC 3K66A 3EFOB 2AWYA 1PV3A 1YVIA 2NSFA 2XSEA 2TMVP 1HY5A 1OQCA 2LSEA 4BJ1A 4PFOA 2ZXPA 2NUTB 2OQMA 1MMNA 1NFOA 1ZHZA 4PR9A 2XXAB 2HV6A 3LLIA 4FX5A 4OINF 4AE4A 5L0IA 3ZTZA 1WOLA 4O79A 3NMIA 4DBQA 1TFKB 3DE8A 3E70C 4MQ9F 1YYXA 3JYHA 5B3SC 2YEVA 1Z23A 1E83A 5EK0A 3FOOA 2YZSA 1Q0GA 2CW0F 2Y3HA 3ATPA 4JEBA 3E9VA 4W8KA 5B1BC 3UMHA 4AL0A 1DOWA 1MMAA 3POVA 2F22A 3QVZA 1C17M 1QKRA 2J0WA 2J7PD 3ASOC 3RVZA 2YWAA 3S29A 2R7WA 4NC3A 1IW7F 1FFTC 2R05A 3AG1C 3B29A 5L0DA 5CI9A 3JZ0A 3AJMA 5COGA 1U0BB 1SF8A 1NSGB 1RKEB 2NUPB 2CNWD 2KSFA 3RQFA 3EZIA 2Q9AA 4RDAA 2KC3A 4DVZA 1QQ3A 3KL4A 3CSKA 1Z3IX 2W4BA 2V26A 5KYWA 3S90A 5L0FA 2HKVA 1E2XA 1RKCA 3X1OA 1H9GA 3HNIA 3RVYA 3OWTA 1JR8A 3I5QA 3VM6A 3EGXB 1O87A 1E84A 4XEFA 4E18A 2YKZA 3QMKA 2HMQA 3A11A 3DI5A 4JCZA 1LI5A 4O6YA 4CS8C 3N0TA 4C7OB 1APCA 1M2VA 4BJTA 2QNLA 2BL2A 5L0GA 5F28E 2Q00A 1YLMA 3K1IC 1OXBA 3GEEA 3MLGA 4WGYA 2YLGA 3US6A 1GGQA 3CQZA 4NTAA 4G78A 1EA8A 1K05A 4DOZA 1CPRA 1G5ZA 3A9CA 1AVOB 3DJUB 2IBFA 3UR3C 2DI3A 4EBKA 3EH2A 1H6GA 1M56C 3FOPA 3TQOA 2R7SA 5L0JA 3U8PA 1JPJA 1L7CA 2KGOA 2R9RB 2ZXRA 3C18A 2OJED 4GEHA 4U9DA 5AC5A 1ZHXA 3L34A 5CI8A 2KJGA 2OCCC 5FCLA 1C03A 1SZIA 5KYYA 1LM3B 5K0IA 4CSAC 1ZZPA 1VLTA 2PNOA 1H7IA 1QLEC 4K7BA 2ICWG 1LS1A 1D1CA 3EG9A 3BRJA 1OR3A 2PX0A 3K1HA 4I3MA 3QZCA 1LE2A 3T6GB 3ITFA 2HUJA 3ABKC 1TWAA 3DZAA 3KKBA 2HSQA 1QSPA 1EI7A 4YJWA 4C3DA 4L6RA 3EFOA 4JRZA 3GM2A 5KYXA 2WB7A 2ETSA 3TD7A 1NLXA 2NUTA 3ZWIA 3IPMO 2XXAA 2R02A 2WL8A 2KNHA 1A7VA 4LLCA 3VYWA 2R7XA 4IARA 3S84A 4KBLA 4XEKA 1OCRC 1TR2A 2P7VA 3CEXA 2VCBA 3M79A 4CS7A 3CAXA 5E3AA 3W4YA 1QVXA 2HZ8A 1F1MA 3L8JA 4O7GA 2H7OA 2J7PA 5A69A 3NMKA 2J9WA 2DGJA 2KYHA 2WVOA 3C7JA 4Q5SF 2XL8A 4IB4A 1D0YA 1V55C 1I5NA 1NZEA 2GA0A 3LEOA 3RFYA 4YL1A 1GM5A 3V5XA 1NFNA 4PK4A 3V5ZA 1UG7A 2CNWA 2LP4A 2G3VA 1LKXA 1N1CA 4PJLA 5F5FA 4U5EE 2WVQA 5B1AC 3RW0A 2W4MA 3VRCA 1FMWA 4ER9A 2YL1A 3IHUA 4YL0A 5E3CA 3HKKA 3QW0A 1T9KA 5E2QA 5KYUB 4IWBA 4WABA 1NBBA 3KPHA 2Q4FA 3MYFA 4X0RA 1K04A 3ZC4A 4MTOA 4IJJA 4R32A 1LIHA 2WZGA 3SXZA 2CCYA 3EGXA 3JSZA 3RF3A 2LCHA 4XTKA 4W8PA 2LFDA 2EPNA 4Q4ZF 4MNDA 4C7OA 3PMRA 2EIKC 4YT5A 1TWHA 3VF0A 2XLMA 2LFFA 3EGDB 4DRJB 3DE9A 2V3CC 4G7HF 3KMIA 1OXKA 2HV7A 3L8IA 2H7BA 3R7CA 2HSBA 4EBBA 1RCPA 4DBRA 1BR4A 1FFHA 3UMKA 2XLOA 3WG7C 4O6NA 2CGEA 4Z9JA 5EGYA 2XLVA 2XLDA 1FR0A 3KH2A 3M1CB 2XS8A 3AG2C 1YDIA 3HNJA 3IQCA 1BZ4A 3K7DA 4JURI 3MBGA 3T6JA 2XLHA 2O9XA 4CSAA 2X0CA 4OIRF 1Z7Qc 4EKWA 1A0BA 2YRFA 1EQ1A 2Y3GA 2L6GA 2DB4A 4C3BA 1D1AA 3AGUA 5A6KA 4YWQA 3W8IA 2H8AA 2J46A 2L9JA 1WASA 1U6HA 1R4TA 1JOGA 1O3UA 1XZPA 1ZU4A 3C62A 4KI2A 3TOMA 1SYQA 1QZXA 1KNYA 2A1DD 4J7TA 4E0IA 2Y69C 3TJ5A 1SR2A 2EINC 3F46A 4AK9A 5EHHA 2R7VA 1D0ZA 2XLEA 1KU2A 1YA9A 1LPEA 3L0IA 5BQIA 3S0XA 1SMYF 1FAPB 2IXOA 2LK4A 3TULA 2AVKA 4MVSA 3RYLA 1BDJB 4XWJA 2A0UA 1A7EA 3IQ5A 4MVRA 2KW3C 2VH3A 2J9BA 2ASRA 2RSEB 3EH1A 3MFNA 5HV9A 3ASNC 4YN0B 2HJ3A 4U5FE 1TFOB 4A4AA 1CGME 4RD9A 2VCCA 2IYLD 1T01A 2R7TA 4OIPF 1NU7D 4LACB 4U9EA 2OG2A 1QPUA 2YL7A 3N24A 3NMJA 4IAOA 1YZAA 3GEIA 3LUTB 3SZRA 4GYTA 2WVNA 1RMVA 4M63A 3LS1A 1G4WR 2JPUA 2UUIA 4HFKB 4J7YA 2HFIA 3M4BA 1NU9C 1V74B 1ORYA 4BJ5C 2L6HA 4BG0A 3W2WA 3LNMB 5KYUA 3U2LA 1Q0DA 3LJBA 3O39A 3SNHA 2IXPA 2RD9A 3ECSA 3Q6NA 3DD7A 2DYSC 2P61A 4IAQA 1JAFA 4KNWA 1U89A 4HFFB 4JZAA 1J8MF 3LESA 4KNVA 4CBEA 2IXNA 2XRHA 3RQEA 1RJ9B 2YVKA 4NCQA 1VMAA 3JCUQ 3S28A 3UNGC 4U5HA 3WODF 5L3VA 1CGOA 4NY3A 2YHSA 2Z15A 1NG1A 2XS1A 2D5RB 2C04A 2A69F 2MYSA 3JT1A 5L0CA 4A2NB 4LDQA 1YAUO 2Q9BA 4WJ0A 1Y6DA 4D4NA 3U0CA 4CS9C 3O6XA 4CJGA 2GWWA 3PDMP 2ZPAA 3DMDA 4EWCA 1BBHA 5AC4A 1R5ID 5DVWA 2Y3DA 5L0HA 5CIVA 4G7ZF 1PCXA 4LERA 4NTBA 1H9TA 1YA7O 5GPGB 1M6TA 4EHPA 1EKYA 1ST6A 4G7OF 3L1MA 3CZ6A 1O5HA 3DM9B 3FHDA 3I4UA 1FNTc 1L3PA 3AOUA 1IZMA 2KQ9A 4JW1A 4RBNA 5DS6A 3IQTA 1T6QA 4LLEA 1HW1A 1VYIA 4MTGA 4AE4B 2X51A 2ZXOA 3KYIA 4B6IA 3B0VC 4XPWA 2XL4A 2GFHA 1OCCC 1HE9A 3VAYA 4U5CE 4NTFA 3X2QC 3U5SA 2WZFA 4ULWA 2I8BA 4JTAB 4EBJA 3QTHA 4PJNA 4DVYP 1ZVZA 3LS0A 3JTLO 3GEHA 4E7ZA 2PP4A 5JRAA 2LIGA 4FWVA 4KC9A 1RKEA 5A6JA 2NUPA 2HS5A 1GS9A 3J06A 2B0JA 1S7ZA 4MVOA 3UMIA 4J30B 3TJ6A 2YLIA 3EQLF 3WHNA 2OJQA 4BEMJ 1KTMA 3K6BA 5DQZA 4YK5A 2PX3A 3GWLA 4CS8A 5KYWB 3I5PA 4PACA 2J45A 4Z9IA 3T4RA 1JRAA 2P0NA 1BR1A 3GWNA 4YL3A 3EPVA 3GM1A 4ULVA 3K1IA 5A6BA 1ZW2A 2IM8A 2LD6A 4U5BE 2ZXWC 3SP1A 4OIQF 3G50A 3HNKA 5AGFA 2QLAA 4XLNF 1Z5ZA 1OKKA 2Q9CA 4K0DA 5DLJA 4ANJA 1LE4A 5DQTA 4OIOF 3R2PA 1ZYRF 5COMA 2JD3A 1HE1A 1VYKA 3AG4C 2M4EA 1MNDA 2DYRC 2WZLA 1OCOC 2Y3BA 3FXHA 4XEVA 3DKAA 3UGOA 2ZD9A 1T5OA 4CDVA 3O55A 3HLZA 5BQGA 3ZVRA 1ZU5A 3PHF2 3SYNA 5T3WA 4CDAA 2EPLX 2Q7RA 2PFDA 3LNRA 3RQGA 3NG1A 1TWGA 2J9UA 3SXYA 4JJGA 1WGWA 1FMVA 3S9OA 2VASA 1ZHTA 2B0HA 4WGZA 4JVSA 1HMDA 4OD4A 2QY9A 4P9TA 5KYYB 1Y4CA 4CS9A 3H2UA 4EUKB 4N6HA 2AWCA 2EPMX 2C03A 3HNLA 2VB6A 3GODA 3MYIA 3OEOA 1HW2A 2UUHA 3B0PA 3M15A 1WATA 1MMDA 2XM4A 3C63A 4XPXA 5DS4A 2GDCA 1OCZC 4IGGA 4I44A 4J32B 3Q7GA 1OW7A 3RH3A 1XZQA 4Z9HA 1MQVA 1ORSC 2AU5A 3F47A 4MW3A 4U5GA 3Q6MA 4QDLA 3U2MA 5KYXB 2VC9A 3U3FA 3HJCA 3SEOA 2R7UA 3FAPB 3ZQYA 2D4UA 4DJ9A 1VK5A 4I1OB 3SXMA 4YT8A 3DM5A 3W2VA 4BJ6C 1VTMP 1S05A 3U9JA 2J9VA 2YLDA 4O6MA 3NRHA 2L6FA 1ZW3A 4QI0A 4CDYA 1RXQA 3QW1A 4JIOA 3C8GB 5T1DB 4DXWA 2J8WA 4K1OA 1YYJA 2I15A 2MWQA 1D0XA 2G3KA 4YT4A 2YQYA 3SXKA 4JJFA 3C8GD 3JRTA 1XWJA 3B0UX 3U3BA 1V54C 2GAQA 1T6UA 4N4WA 4XQ1A 3JRMO 1TQGA 1I4YA 1OW8A 3OA1A 1I4ZA 3NDBB 4EIYA 1VB5A 2G62A 3AQBA 1ZHYA 5JP7A 2W45A 1D1BA 4OD5A 5A6BD 2A6EF 1J8YF 2FGYA 3ZIBA 4JEAA 1FTSA 2R7RA 4GQHA 5HSWA 3ZG1A 2YL3A 1ZHWA 4E17A 1OKKD 2P6VA 4HE8D 3Q7LA 1JMWA 3TOLA 5B3IA 3FVYA 2Y39A 2AP3A 1WWPA 3S27A 2W9YA 1G8XA 2JX0A 1YJGA 1BR2A 1PD0A 4CIHA 1E86A 5BUOA 1W2WA 3JSEO 1LS4A 1TKNA 3LEVA 2YL0A 3ZDLA 1TWCA 1AUEA 3EGDA 2EIJC 1Q0KA 3ABMC 1Z6AA 2IOQA 3RIPA 4E0HA 1DOVA 2QE9A 5F5HA 2A68F 2LQGA 3PCVA 3G4ZA 5L3QA 3DAFA 3DWWA 1HMOA 4CX9A 3MX3A 1G4US 3ZQVA 1CGNA 3NKEA 2OKUA 3NYLA 3V5YA 3UGPA 4JTCB 1LVKA 4IRUA 2R25A 2NSGA 4C3EA 1Q0FA 1YZCA 4FESA 5BQHA 1C02A 3B9QA 1A7DA 2XM0A 2OU6A 2OEXA 2P1AA 2Q3TA 2EIMC 2PBEA 4XPYA 2BE5F 5COFA 4PJMA 1YARO 1UFBA 4DRIB 4JCHA 2BC5A 2FAPB 4JTDB 3U9MA 3EZHA 1GQAA 5JUAA 2HJMA 4MS2A 1V4AA 2H7VC 2M64A 3AGTA 2XL6A 5A6AA 5JS5A 2J0XA 1MNEA
chains in the Genus database with same CATH topology
4XEFA 1JOGA 1O3UA 4NQFA 3C8GD 3O10A 1WTYA 3BRJA 1KNYA 5F28E 4EBJA 2Q00A 1OW8A 2JPUA 3U0CA 3L8IA 3B71A 2YWAA 2HSBA 1OW7A 3JYYA 3GM2A 4XEVA 1K40A 1K05A 2L6HA 3JZ0A 1PV3A 2LK4A 3AJMA 4EBKA 1OW6A 3U3FA 3TULA 3K7DA 3GM3A 2KK1A 3RQFA 3MFNA 3RQGA 4XEKA 1K04A 2PBEA 3C18A 3C8GA 1WWPA 4R32A 1KTMA 1UFBA 2L6FA 2JX0A 1WOLA 3S9OA 2L6GA 1QVXA 3RQEA 3C8GB 1V4AA 3L8JA 3GM1A 1ZZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEF A;  1JOG A;  1O3U A;  4NQF A;  3C8G D;  3O10 A;  1WTY A;  3BRJ A;  1KNY A;  5F28 E;  4EBJ A;  2Q00 A;  1OW8 A;  2JPU A;  3U0C A;  3L8I A;  3B71 A;  2YWA A;  2HSB A;  1OW7 A;  3JYY A;  3GM2 A;  4XEV A;  1K40 A;  1K05 A;  2L6H A;  3JZ0 A;  1PV3 A;  2LK4 A;  3AJM A;  4EBK A;  1OW6 A;  3U3F A;  3TUL A;  3K7D A;  3GM3 A;  2KK1 A;  3RQF A;  3MFN A;  3RQG A;  4XEK A;  1K04 A;  2PBE A;  3C18 A;  3C8G A;  1WWP A;  4R32 A;  1KTM A;  1UFB A;  2L6F A;  2JX0 A;  1WOL A;  3S9O A;  2L6G A;  1QVX A;  3RQE A;  3C8G B;  1V4A A;  3L8J A;  3GM1 A;  1ZZP A; 
#chains in the Genus database with same CATH topology
 1A41 A;  4N06 A;  5FZT A;  1WTY A;  3ABL C;  2A6H F;  4MVQ A;  1T6I A;  1WN0 A;  3KYJ A;  4F4B A;  1LI7 A;  2OEV A;  4P9F A;  5D92 A;  1PD1 A;  4JKV A;  4JC7 A;  2PF4 E;  4MTF A;  4Q7C A;  3NKD A;  4BJ6 A;  1K40 A;  3EHM A;  3FAJ A;  2L7A A;  5KYN A;  2E87 A;  1M2O A;  1OW6 A;  1AEP A;  3ZTM A;  5JLI A;  3NYJ A;  3K33 A;  2VCA A;  4CJO A;  3TK0 A;  5JT4 A;  2EPK X;  3LLK A;  3W8H A;  3EJN A;  4XLP F;  2NG1 A;  3C8G A;  5JSL A;  3V7O A;  2EPO A;  4DRH B;  4MW8 A;  2CDQ A;  5E33 A;  2NPU A;  3T9O A;  4MVU A;  4D4X A;  3G4X A;  4N6C A;  4NQF A;  3ZSU A;  4QI2 A;  3O10 A;  4ZLC A;  3HTK C;  4BJ5 A;  3QVY A;  3EHN A;  5T3T A;  4AL1 A;  4LDK A;  1M2V B;  3IEE A;  4BEJ A;  1B68 A;  2MHR A;  3B71 A;  2QTV A;  4HEA J;  3JYY A;  3RKO F;  2CYD A;  4P6I C;  1M57 C;  1ORJ A;  4U5D E;  3DXJ F;  3BEH A;  1VLS A;  2R7O A;  5DS5 A;  3H2V A;  4ONS A;  3DAG A;  3IQ6 A;  3M4C A;  3GM3 A;  4JE9 A;  2KK1 A;  4FAP B;  2R03 A;  1E85 A;  4LDR A;  4I1M A;  4MVZ A;  4BPM A;  2OOC A;  2HMZ A;  3N2Z B;  4G0H A;  4E7S A;  3WAQ A;  3FMS A;  256B A;  1RJ9 A;  1CPQ A;  1JPN A;  2EIL C;  2QUP A;  2FFH A;  3AQC A;  1OR2 A;  3AG3 C;  3DJN B;  1MMG A;  4YT2 A;  3LAY A;  4H54 A;  3FDQ A;  4PJJ A;  2XLW A;  1VOM A;  4MVM A;  3T6B A;  2R7Q A;  5JVE A;  5IY5 C;  3GAN A;  2A0B A;  2IXM A;  3H65 A;  1Q0M A;  3EG9 B;  3U8V A;  4PFP A;  4ZLD A;  3C8Z A;  4UDV A;  5D91 A;  3GOR A;  1Z63 A;  5TJ5 E;  2L81 A;  4CIP A;  4AX2 A;  3NYM A;  4H4K C;  3K66 A;  3EFO B;  2AWY A;  1PV3 A;  1YVI A;  2NSF A;  2XSE A;  2TMV P;  1HY5 A;  1OQC A;  2LSE A;  4BJ1 A;  4PFO A;  2ZXP A;  2NUT B;  2OQM A;  1MMN A;  1NFO A;  1ZHZ A;  4PR9 A;  2XXA B;  2HV6 A;  3LLI A;  4FX5 A;  4OIN F;  4AE4 A;  5L0I A;  3ZTZ A;  1WOL A;  4O79 A;  3NMI A;  4DBQ A;  1TFK B;  3DE8 A;  3E70 C;  4MQ9 F;  1YYX A;  3JYH A;  5B3S C;  2YEV A;  1Z23 A;  1E83 A;  5EK0 A;  3FOO A;  2YZS A;  1Q0G A;  2CW0 F;  2Y3H A;  3ATP A;  4JEB A;  3E9V A;  4W8K A;  5B1B C;  3UMH A;  4AL0 A;  1DOW A;  1MMA A;  3POV A;  2F22 A;  3QVZ A;  1C17 M;  1QKR A;  2J0W A;  2J7P D;  3ASO C;  3RVZ A;  2YWA A;  3S29 A;  2R7W A;  4NC3 A;  1IW7 F;  1FFT C;  2R05 A;  3AG1 C;  3B29 A;  5L0D A;  5CI9 A;  3JZ0 A;  3AJM A;  5COG A;  1U0B B;  1SF8 A;  1NSG B;  1RKE B;  2NUP B;  2CNW D;  2KSF A;  3RQF A;  3EZI A;  2Q9A A;  4RDA A;  2KC3 A;  4DVZ A;  1QQ3 A;  3KL4 A;  3CSK A;  1Z3I X;  2W4B A;  2V26 A;  5KYW A;  3S90 A;  5L0F A;  2HKV A;  1E2X A;  1RKC A;  3X1O A;  1H9G A;  3HNI A;  3RVY A;  3OWT A;  1JR8 A;  3I5Q A;  3VM6 A;  3EGX B;  1O87 A;  1E84 A;  4XEF A;  4E18 A;  2YKZ A;  3QMK A;  2HMQ A;  3A11 A;  3DI5 A;  4JCZ A;  1LI5 A;  4O6Y A;  4CS8 C;  3N0T A;  4C7O B;  1APC A;  1M2V A;  4BJT A;  2QNL A;  2BL2 A;  5L0G A;  5F28 E;  2Q00 A;  1YLM A;  3K1I C;  1OXB A;  3GEE A;  3MLG A;  4WGY A;  2YLG A;  3US6 A;  1GGQ A;  3CQZ A;  4NTA A;  4G78 A;  1EA8 A;  1K05 A;  4DOZ A;  1CPR A;  1G5Z A;  3A9C A;  1AVO B;  3DJU B;  2IBF A;  3UR3 C;  2DI3 A;  4EBK A;  3EH2 A;  1H6G A;  1M56 C;  3FOP A;  3TQO A;  2R7S A;  5L0J A;  3U8P A;  1JPJ A;  1L7C A;  2KGO A;  2R9R B;  2ZXR A;  3C18 A;  2OJE D;  4GEH A;  4U9D A;  5AC5 A;  1ZHX A;  3L34 A;  5CI8 A;  2KJG A;  2OCC C;  5FCL A;  1C03 A;  1SZI A;  5KYY A;  1LM3 B;  5K0I A;  4CSA C;  1ZZP A;  1VLT A;  2PNO A;  1H7I A;  1QLE C;  4K7B A;  2ICW G;  1LS1 A;  1D1C A;  3EG9 A;  3BRJ A;  1OR3 A;  2PX0 A;  3K1H A;  4I3M A;  3QZC A;  1LE2 A;  3T6G B;  3ITF A;  2HUJ A;  3ABK C;  1TWA A;  3DZA A;  3KKB A;  2HSQ A;  1QSP A;  1EI7 A;  4YJW A;  4C3D A;  4L6R A;  3EFO A;  4JRZ A;  3GM2 A;  5KYX A;  2WB7 A;  2ETS A;  3TD7 A;  1NLX A;  2NUT A;  3ZWI A;  3IPM O;  2XXA A;  2R02 A;  2WL8 A;  2KNH A;  1A7V A;  4LLC A;  3VYW A;  2R7X A;  4IAR A;  3S84 A;  4KBL A;  4XEK A;  1OCR C;  1TR2 A;  2P7V A;  3CEX A;  2VCB A;  3M79 A;  4CS7 A;  3CAX A;  5E3A A;  3W4Y A;  1QVX A;  2HZ8 A;  1F1M A;  3L8J A;  4O7G A;  2H7O A;  2J7P A;  5A69 A;  3NMK A;  2J9W A;  2DGJ A;  2KYH A;  2WVO A;  3C7J A;  4Q5S F;  2XL8 A;  4IB4 A;  1D0Y A;  1V55 C;  1I5N A;  1NZE A;  2GA0 A;  3LEO A;  3RFY A;  4YL1 A;  1GM5 A;  3V5X A;  1NFN A;  4PK4 A;  3V5Z A;  1UG7 A;  2CNW A;  2LP4 A;  2G3V A;  1LKX A;  1N1C A;  4PJL A;  5F5F A;  4U5E E;  2WVQ A;  5B1A C;  3RW0 A;  2W4M A;  3VRC A;  1FMW A;  4ER9 A;  2YL1 A;  3IHU A;  4YL0 A;  5E3C A;  3HKK A;  3QW0 A;  1T9K A;  5E2Q A;  5KYU B;  4IWB A;  4WAB A;  1NBB A;  3KPH A;  2Q4F A;  3MYF A;  4X0R A;  1K04 A;  3ZC4 A;  4MTO A;  4IJJ A;  4R32 A;  1LIH A;  2WZG A;  3SXZ A;  2CCY A;  3EGX A;  3JSZ A;  3RF3 A;  2LCH A;  4XTK A;  4W8P A;  2LFD A;  2EPN A;  4Q4Z F;  4MND A;  4C7O A;  3PMR A;  2EIK C;  4YT5 A;  1TWH A;  3VF0 A;  2XLM A;  2LFF A;  3EGD B;  4DRJ B;  3DE9 A;  2V3C C;  4G7H F;  3KMI A;  1OXK A;  2HV7 A;  3L8I A;  2H7B A;  3R7C A;  2HSB A;  4EBB A;  1RCP A;  4DBR A;  1BR4 A;  1FFH A;  3UMK A;  2XLO A;  3WG7 C;  4O6N A;  2CGE A;  4Z9J A;  5EGY A;  2XLV A;  2XLD A;  1FR0 A;  3KH2 A;  3M1C B;  2XS8 A;  3AG2 C;  1YDI A;  3HNJ A;  3IQC A;  1BZ4 A;  3K7D A;  4JUR I;  3MBG A;  3T6J A;  2XLH A;  2O9X A;  4CSA A;  2X0C A;  4OIR F;  1Z7Q c;  4EKW A;  1A0B A;  2YRF A;  1EQ1 A;  2Y3G A;  2L6G A;  2DB4 A;  4C3B A;  1D1A A;  3AGU A;  5A6K A;  4YWQ A;  3W8I A;  2H8A A;  2J46 A;  2L9J A;  1WAS A;  1U6H A;  1R4T A;  1JOG A;  1O3U A;  1XZP A;  1ZU4 A;  3C62 A;  4KI2 A;  3TOM A;  1SYQ A;  1QZX A;  1KNY A;  2A1D D;  4J7T A;  4E0I A;  2Y69 C;  3TJ5 A;  1SR2 A;  2EIN C;  3F46 A;  4AK9 A;  5EHH A;  2R7V A;  1D0Z A;  2XLE A;  1KU2 A;  1YA9 A;  1LPE A;  3L0I A;  5BQI A;  3S0X A;  1SMY F;  1FAP B;  2IXO A;  2LK4 A;  3TUL A;  2AVK A;  4MVS A;  3RYL A;  1BDJ B;  4XWJ A;  2A0U A;  1A7E A;  3IQ5 A;  4MVR A;  2KW3 C;  2VH3 A;  2J9B A;  2ASR A;  2RSE B;  3EH1 A;  3MFN A;  5HV9 A;  3ASN C;  4YN0 B;  2HJ3 A;  4U5F E;  1TFO B;  4A4A A;  1CGM E;  4RD9 A;  2VCC A;  2IYL D;  1T01 A;  2R7T A;  4OIP F;  1NU7 D;  4LAC B;  4U9E A;  2OG2 A;  1QPU A;  2YL7 A;  3N24 A;  3NMJ A;  4IAO A;  1YZA A;  3GEI A;  3LUT B;  3SZR A;  4GYT A;  2WVN A;  1RMV A;  4M63 A;  3LS1 A;  1G4W R;  2JPU A;  2UUI A;  4HFK B;  4J7Y A;  2HFI A;  3M4B A;  1NU9 C;  1V74 B;  1ORY A;  4BJ5 C;  2L6H A;  4BG0 A;  3W2W A;  3LNM B;  5KYU A;  3U2L A;  1Q0D A;  3LJB A;  3O39 A;  3SNH A;  2IXP A;  2RD9 A;  3ECS A;  3Q6N A;  3DD7 A;  2DYS C;  2P61 A;  4IAQ A;  1JAF A;  4KNW A;  1U89 A;  4HFF B;  4JZA A;  1J8M F;  3LES A;  4KNV A;  4CBE A;  2IXN A;  2XRH A;  3RQE A;  1RJ9 B;  2YVK A;  4NCQ A;  1VMA A;  3JCU Q;  3S28 A;  3UNG C;  4U5H A;  3WOD F;  5L3V A;  1CGO A;  4NY3 A;  2YHS A;  2Z15 A;  1NG1 A;  2XS1 A;  2D5R B;  2C04 A;  2A69 F;  2MYS A;  3JT1 A;  5L0C A;  4A2N B;  4LDQ A;  1YAU O;  2Q9B A;  4WJ0 A;  1Y6D A;  4D4N A;  3U0C A;  4CS9 C;  3O6X A;  4CJG A;  2GWW A;  3PDM P;  2ZPA A;  3DMD A;  4EWC A;  1BBH A;  5AC4 A;  1R5I D;  5DVW A;  2Y3D A;  5L0H A;  5CIV A;  4G7Z F;  1PCX A;  4LER A;  4NTB A;  1H9T A;  1YA7 O;  5GPG B;  1M6T A;  4EHP A;  1EKY A;  1ST6 A;  4G7O F;  3L1M A;  3CZ6 A;  1O5H A;  3DM9 B;  3FHD A;  3I4U A;  1FNT c;  1L3P A;  3AOU A;  1IZM A;  2KQ9 A;  4JW1 A;  4RBN A;  5DS6 A;  3IQT A;  1T6Q A;  4LLE A;  1HW1 A;  1VYI A;  4MTG A;  4AE4 B;  2X51 A;  2ZXO A;  3KYI A;  4B6I A;  3B0V C;  4XPW A;  2XL4 A;  2GFH A;  1OCC C;  1HE9 A;  3VAY A;  4U5C E;  4NTF A;  3X2Q C;  3U5S A;  2WZF A;  4ULW A;  2I8B A;  4JTA B;  4EBJ A;  3QTH A;  4PJN A;  4DVY P;  1ZVZ A;  3LS0 A;  3JTL O;  3GEH A;  4E7Z A;  2PP4 A;  5JRA A;  2LIG A;  4FWV A;  4KC9 A;  1RKE A;  5A6J A;  2NUP A;  2HS5 A;  1GS9 A;  3J06 A;  2B0J A;  1S7Z A;  4MVO A;  3UMI A;  4J30 B;  3TJ6 A;  2YLI A;  3EQL F;  3WHN A;  2OJQ A;  4BEM J;  1KTM A;  3K6B A;  5DQZ A;  4YK5 A;  2PX3 A;  3GWL A;  4CS8 A;  5KYW B;  3I5P A;  4PAC A;  2J45 A;  4Z9I A;  3T4R A;  1JRA A;  2P0N A;  1BR1 A;  3GWN A;  4YL3 A;  3EPV A;  3GM1 A;  4ULV A;  3K1I A;  5A6B A;  1ZW2 A;  2IM8 A;  2LD6 A;  4U5B E;  2ZXW C;  3SP1 A;  4OIQ F;  3G50 A;  3HNK A;  5AGF A;  2QLA A;  4XLN F;  1Z5Z A;  1OKK A;  2Q9C A;  4K0D A;  5DLJ A;  4ANJ A;  1LE4 A;  5DQT A;  4OIO F;  3R2P A;  1ZYR F;  5COM A;  2JD3 A;  1HE1 A;  1VYK A;  3AG4 C;  2M4E A;  1MND A;  2DYR C;  2WZL A;  1OCO C;  2Y3B A;  3FXH A;  4XEV A;  3DKA A;  3UGO A;  2ZD9 A;  1T5O A;  4CDV A;  3O55 A;  3HLZ A;  5BQG A;  3ZVR A;  1ZU5 A;  3PHF 2;  3SYN A;  5T3W A;  4CDA A;  2EPL X;  2Q7R A;  2PFD A;  3LNR A;  3RQG A;  3NG1 A;  1TWG A;  2J9U A;  3SXY A;  4JJG A;  1WGW A;  1FMV A;  3S9O A;  2VAS A;  1ZHT A;  2B0H A;  4WGZ A;  4JVS A;  1HMD A;  4OD4 A;  2QY9 A;  4P9T A;  5KYY B;  1Y4C A;  4CS9 A;  3H2U A;  4EUK B;  4N6H A;  2AWC A;  2EPM X;  2C03 A;  3HNL A;  2VB6 A;  3GOD A;  3MYI A;  3OEO A;  1HW2 A;  2UUH A;  3B0P A;  3M15 A;  1WAT A;  1MMD A;  2XM4 A;  3C63 A;  4XPX A;  5DS4 A;  2GDC A;  1OCZ C;  4IGG A;  4I44 A;  4J32 B;  3Q7G A;  1OW7 A;  3RH3 A;  1XZQ A;  4Z9H A;  1MQV A;  1ORS C;  2AU5 A;  3F47 A;  4MW3 A;  4U5G A;  3Q6M A;  4QDL A;  3U2M A;  5KYX B;  2VC9 A;  3U3F A;  3HJC A;  3SEO A;  2R7U A;  3FAP B;  3ZQY A;  2D4U A;  4DJ9 A;  1VK5 A;  4I1O B;  3SXM A;  4YT8 A;  3DM5 A;  3W2V A;  4BJ6 C;  1VTM P;  1S05 A;  3U9J A;  2J9V A;  2YLD A;  4O6M A;  3NRH A;  2L6F A;  1ZW3 A;  4QI0 A;  4CDY A;  1RXQ A;  3QW1 A;  4JIO A;  3C8G B;  5T1D B;  4DXW A;  2J8W A;  4K1O A;  1YYJ A;  2I15 A;  2MWQ A;  1D0X A;  2G3K A;  4YT4 A;  2YQY A;  3SXK A;  4JJF A;  3C8G D;  3JRT A;  1XWJ A;  3B0U X;  3U3B A;  1V54 C;  2GAQ A;  1T6U A;  4N4W A;  4XQ1 A;  3JRM O;  1TQG A;  1I4Y A;  1OW8 A;  3OA1 A;  1I4Z A;  3NDB B;  4EIY A;  1VB5 A;  2G62 A;  3AQB A;  1ZHY A;  5JP7 A;  2W45 A;  1D1B A;  4OD5 A;  5A6B D;  2A6E F;  1J8Y F;  2FGY A;  3ZIB A;  4JEA A;  1FTS A;  2R7R A;  4GQH A;  5HSW A;  3ZG1 A;  2YL3 A;  1ZHW A;  4E17 A;  1OKK D;  2P6V A;  4HE8 D;  3Q7L A;  1JMW A;  3TOL A;  5B3I A;  3FVY A;  2Y39 A;  2AP3 A;  1WWP A;  3S27 A;  2W9Y A;  1G8X A;  2JX0 A;  1YJG A;  1BR2 A;  1PD0 A;  4CIH A;  1E86 A;  5BUO A;  1W2W A;  3JSE O;  1LS4 A;  1TKN A;  3LEV A;  2YL0 A;  3ZDL A;  1TWC A;  1AUE A;  3EGD A;  2EIJ C;  1Q0K A;  3ABM C;  1Z6A A;  2IOQ A;  3RIP A;  4E0H A;  1DOV A;  2QE9 A;  5F5H A;  2A68 F;  2LQG A;  3PCV A;  3G4Z A;  5L3Q A;  3DAF A;  3DWW A;  1HMO A;  4CX9 A;  3MX3 A;  1G4U S;  3ZQV A;  1CGN A;  3NKE A;  2OKU A;  3NYL A;  3V5Y A;  3UGP A;  4JTC B;  1LVK A;  4IRU A;  2R25 A;  2NSG A;  4C3E A;  1Q0F A;  1YZC A;  4FES A;  5BQH A;  1C02 A;  3B9Q A;  1A7D A;  2XM0 A;  2OU6 A;  2OEX A;  2P1A A;  2Q3T A;  2EIM C;  2PBE A;  4XPY A;  2BE5 F;  5COF A;  4PJM A;  1YAR O;  1UFB A;  4DRI B;  4JCH A;  2BC5 A;  2FAP B;  4JTD B;  3U9M A;  3EZH A;  1GQA A;  5JUA A;  2HJM A;  4MS2 A;  1V4A A;  2H7V C;  2M64 A;  3AGT A;  2XL6 A;  5A6A A;  5JS5 A;  2J0X A;  1MNE A; 
#chains in the Genus database with same CATH homology
 4XEF A;  1JOG A;  1O3U A;  4NQF A;  3C8G D;  3O10 A;  1WTY A;  3BRJ A;  1KNY A;  5F28 E;  4EBJ A;  2Q00 A;  1OW8 A;  2JPU A;  3U0C A;  3L8I A;  3B71 A;  2YWA A;  2HSB A;  1OW7 A;  3JYY A;  3GM2 A;  4XEV A;  1K40 A;  1K05 A;  2L6H A;  3JZ0 A;  1PV3 A;  2LK4 A;  3AJM A;  4EBK A;  1OW6 A;  3U3F A;  3TUL A;  3K7D A;  3GM3 A;  2KK1 A;  3RQF A;  3MFN A;  3RQG A;  4XEK A;  1K04 A;  2PBE A;  3C18 A;  3C8G A;  1WWP A;  4R32 A;  1KTM A;  1UFB A;  2L6F A;  2JX0 A;  1WOL A;  3S9O A;  2L6G A;  1QVX A;  3RQE A;  3C8G B;  1V4A A;  3L8J A;  3GM1 A;  1ZZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...