3BRJA

Crystal structure of mannitol operon repressor (mtlr) from vibrio parahaemolyticus rimd 2210633
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
167
structure length
167
Chain Sequence
b'NESEIIERLNSAPSVRGFFIATVDVFNESIDGLIQRIFRKDNFAVQSVVGPLLQDSGPLGDLSVRLKLLFGLGVLPDDIYHDIEDIIKLKNHLNSDASDYEFTDPNILEPIKKLHLVKKMGMVQLEVNEPDDDIDLEFYQLQLQRQQQIIKSGLSLAIVEICNELGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannitol operon repressor
publication title The mannitol operon repressor MtlR belongs to a new class of transcription regulators in bacteria.
pubmed doi rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Transcription
total genus 57
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05068 MtlR Mannitol repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3brjA00
3AJMA 2KK1A 2LK4A 1O3UA 3RQGA 3RQEA 2YWAA 3JZ0A 4XEVA 3C8GA 4XEKA 3S9OA 3GM2A 2L6FA 5F28E 3C8GB 3L8IA 4EBKA 3GM3A 1KTMA 3L8JA 1KNYA 3C8GD 1OW7A 1WWPA 4R32A 3JYYA 3TULA 1UFBA 1K40A 4NQFA 1WOLA 2JX0A 1PV3A 1JOGA 2HSBA 3K7DA 3BRJA 2L6HA 3B71A 3RQFA 4XEFA 3GM1A 1K05A 2PBEA 4EBJA 1WTYA 3U0CA 3O10A 2Q00A 3MFNA 2JPUA 1ZZPA 1QVXA 3U3FA 1OW8A 2L6GA 1V4AA 3C18A 1K04A 1OW6A
chains in the Genus database with same CATH superfamily
2J7PD 2P1AA 2HKVA 2KGOA 3E70C 4O79A 1QLEC 3ZDLA 2PF4E 1SMYF 1ST6A 1Y6DA 2XLHA 5E2QA 4KI2A 1I4YA 4XEKA 1A7DA 1E86A 3BEHA 1R5ID 3L8IA 2CYDA 2GDCA 1ZW2A 3LLIA 3GM3A 5E33A 2A0UA 4EWCA 1KNYA 1D1BA 3U9MA 4J7TA 2D5RB 1NBBA 2WZFA 1U0BB 2EPLX 4LDQA 2NSFA 4DJ9A 2XXAB 4LERA 1ZU4A 1JAFA 1YVIA 2LSEA 4OIRF 5K0IA 2XL8A 2YZSA 3MYIA 1T9KA 4IJJA 4PACA 2YL1A 4U9EA 1V55C 3EGXB 1WASA 4GQHA 2H7OA 4EKWA 2BC5A 4JIOA 5A6KA 3O10A 5KYWB 4YWQA 1VLTA 1HW2A 4J7YA 1V54C 2A0BA 3EG9B 3IEEA 3EHNA 1ORJA 1OW6A 2J0WA 1XZPA 1S05A 2AU5A 2QLAA 4JRZA 3ZSUA 2R7SA 2EPMX 1TQGA 2EPKX 1SR2A 2AWYA 3ZTZA 1NSGB 3DAGA 4U9DA 3K33A 3CSKA 1G4US 4K7BA 4MVZA 2UUHA 4P9FA 1NU7D 3LEOA 2HMQA 3NRHA 2BL2A 3O55A 3PCVA 4QI0A 2OJQA 1H7IA 1JRAA 1OCRC 2A6EF 1QSPA 1WWPA 2R05A 3HNKA 4DXWA 4Q4ZF 1VMAA 3OEOA 1D0XA 4I1OB 4AE4A 5CIVA 3ASOC 4A4AA 4Q7CA 5BQGA 1A7EA 3T6BA 1AUEA 4E0HA 1EI7A 3BRJA 2IOQA 3JCUQ 3T9OA 3W8IA 3LNRA 2LQGA 3X2QC 5L0HA 2WVNA 2HUJA 4DVYP 4FAPB 4CIHA 1VTMP 3GEIA 2IYLD 3JRTA 2IXMA 4E17A 4O6NA 3U2MA 4CSAA 4P6IC 1E2XA 5CI9A 4JCZA 4BJ5C 1TWCA 3QVZA 1QQ3A 3S27A 3MYFA 2LCHA 5KYXA 3GORA 4ER9A 2EPOA 2YVKA 3ECSA 4JEBA 2I8BA 1I5NA 2UUIA 3LAYA 4I3MA 2HFIA 2R7UA 4DBQA 3ABKC 4XTKA 3ZIBA 5HV9A 4U5DE 2YL7A 5A6JA 1FAPB 3SXZA 2RD9A 2XLOA 2OJED 4KBLA 4G7OF 5A6BD 4C7OA 4KNWA 3DKAA 1UFBA 2W4MA 2Y3HA 5AC4A 3IQ6A 2Q3TA 3EH1A 4C3EA 1MMAA 4PJNA 3B71A 1Q0FA 1SYQA 2J0XA 4U5BE 2VCCA 5E3CA 2ZXOA 5EGYA 1YLMA 1GGQA 3N2ZB 1IW7F 1HMOA 1A41A 1O87A 2G3KA 1MNDA 1FTSA 3LJBA 4OD4A 3VRCA 1QZXA 2Q00A 3HTKC 1RJ9A 1CPQA 3FXHA 2NG1A 1PD0A 2WZLA 1V74B 3C7JA 4N6CA 3C18A 5D91A 2CNWD 1A7VA 3EGXA 4DOZA 4C3DA 3WODF 3RKOF 2Q7RA 5AC5A 4IGGA 2R7VA 5KYWA 3TOMA 1H9TA 2XS8A 2X51A 4EBKA 3EZHA 1XWJA 3U9JA 3AG3C 2A69F 3H2VA 3EQLF 3JYYA 4OIQF 1ORYA 2LD6A 2GWWA 3HNJA 2HSQA 3U2LA 3AGUA 4AK9A 4YT8A 3CEXA 1J8MF 4YL0A 4CS8C 3DD7A 1OXKA 2L6HA 2V26A 1M56C 4IAQA 2XS1A 2Y3BA 3GEEA 4XLNF 2KJGA 3ZVRA 4CJOA 4DRIB 5JVEA 4O7GA 1CGME 1ZHXA 3TOLA 5L0IA 4JTDB 4CDAA 1DOVA 1MQVA 2J7PA 2AVKA 1TFKB 3HLZA 3ZG1A 3K1IA 1C03A 1NZEA 1H9GA 1Q0MA 4WJ0A 3WHNA 3SXMA 4CBEA 2A68F 3MLGA 1BR1A 4P9TA 1CGOA 4CX9A 2LFDA 1FNTc 1Z7Qc 1LE4A 4OIOF 4NTFA 3QW0A 2OQMA 3JZ0A 3NMKA 3GM2A 4PFOA 4FX5A 4AE4B 1HE9A 1KTMA 2IXOA 2Y3DA 3MBGA 1OQCA 3JSEO 5AGFA 2YHSA 4OD5A 2GA0A 2QE9A 1WOLA 2HMZA 3QZCA 3HNIA 2HJMA 1T6IA 4MTFA 4XEFA 1PCXA 3CQZA 4CDVA 2PBEA 3I4UA 3IPMO 3S29A 3FVYA 3W2VA 5KYXB 1BDJB 2J9VA 1QPUA 2W4BA 2FFHA 1MNEA 3W2WA 3L1MA 1R4TA 3JTLO 2L6GA 3O6XA 2J45A 1K04A 1JPNA 2EPNA 3A9CA 5DS5A 2OU6A 3TQOA 5L0DA 3SYNA 3SZRA 4DRJB 2YEVA 3FHDA 5B3IA 2P6VA 3RYLA 2IXPA 1LPEA 2QUPA 2VH3A 4MW3A 5JS5A 4PK4A 2J8WA 2O9XA 1ZHTA 2H8AA 3TJ5A 4HE8D 1EA8A 1NU9C 2AP3A 2HZ8A 3ZQVA 4NTBA 2J9WA 4MNDA 4IB4A 3WAQA 1VYIA 3K7DA 5DVWA 1ZU5A 1RJ9B 2H7BA 1Q0KA 2I15A 3OWTA 1TWGA 2C03A 4AL0A 2P7VA 3AG1C 2XLVA 3JYHA 3UMKA 3FAJA 3QW1A 3JSZA 4IWBA 1ZW3A 4G7HF 3K6BA 3JT1A 2E87A 1E83A 1RKCA 2ZD9A 3KMIA 5CI8A 2VASA 2KK1A 5HSWA 2VC9A 1O3UA 3EZIA 1D0YA 5L0CA 1Z63A 2VCAA 4RDAA 3KL4A 4WGYA 5BQIA 1LM3B 2GFHA 5B1BC 1T6UA 3LUTB 1OR3A 3NKEA 5COGA 2EIJC 3SXYA 5A6BA 1MMNA 4BJ6A 4C3BA 2YKZA 1FMVA 1PD1A 2VCBA 3FMSA 4R32A 1MMDA 2Q4FA 2ZPAA 4N6HA 3B9QA 3NMJA 5JLIA 4ZLCA 1ZYRF 3B0PA 1J8YF 3RVZA 3S28A 1E84A 1T01A 1O5HA 1TKNA 2OCCC 3F47A 3RQFA 1OKKD 3ZWIA 2XM0A 4MS2A 4J30B 1RKEA 4EBJA 3G4XA 3K66A 5T3WA 1AVOB 2R7XA 2CNWA 3FOOA 3O39A 4JE9A 1ORSC 2G62A 1TWHA 4D4XA 1FFHA 3U3FA 3V5YA 4G0HA 5DLJA 1HE1A 1M2VA 3DM5A 2P61A 1CGNA 2FAPB 2OEVA 2JD3A 2ZXWC 1U6HA 3RQGA 5TJ5E 4DBRA 2L9JA 3VF0A 2HJ3A 3M15A 5JT4A 2QTVA 3DE9A 2Q9BA 4NC3A 5EK0A 3NYMA 1GS9A 1NG1A 2L6FA 3DJUB 2VB6A 4HEAJ 3PDMP 1HMDA 5JP7A 5F5HA 4CJGA 4E7SA 2M4EA 1WGWA 3DMDA 2XLMA 3L8JA 4WGZA 4BEMJ 2R7QA 2XLEA 3HKKA 1AEPA 1M57C 3RVYA 5DS6A 3RIPA 5T3TA 1RXQA 3IQ5A 3B0UX 1K40A 1VB5A 4YJWA 5KYYB 2CDQA 2XLDA 2ZXRA 4IARA 3CAXA 1Q0DA 2LP4A 4MTOA 1D1AA 4MVQA 1YJGA 5GPGB 3V5XA 4JW1A 1Y4CA 1WTYA 2X0CA 4JJGA 4EBBA 4EHPA 4FESA 4BJ5A 5EHHA 3FOPA 1FFTC 4CS9C 1Z3IX 3FAPB 1LVKA 1Z6AA 4U5GA 1Q0GA 3EPVA 1U89A 1ZHWA 4M63A 3LESA 3N24A 4Q5SF 3GODA 4OINF 1LKXA 2ZXPA 1YA9A 3CZ6A 4GEHA 1YZCA 2XL6A 1BR2A 2EIKC 3ATPA 4XPXA 3S90A 4E0IA 3ZTMA 3VAYA 1PV3A 1G8XA 1DOWA 4W8PA 1BBHA 2WVOA 2XLWA 2XRHA 2MYSA 3TK0A 2YL3A 1SZIA 2DYSC 5FCLA 1YYXA 2Q9CA 1JPJA 3C8ZA 5JRAA 2YL0A 2OKUA 4C7OB 3ASNC 4MVOA 5T1DB 2CW0F 3WG7C 4BEJA 4E7ZA 3EHMA 1HY5A 4PFPA 1RCPA 1OXBA 2CCYA 3TD7A 3UNGC 2XM4A 3AGTA 3R2PA 4G78A 3UMHA 3H65A 3M79A 2YLIA 4XEVA 5COFA 2HV7A 2MWQA 3LEVA 4AL1A 4NTAA 5F28E 5A69A 3ABMC 2NUTA 3C8GD 4BPMA 4JCHA 2P0NA 3QMKA 2YRFA 5L3VA 3NKDA 1RKEB 3LS1A 4XLPF 1LS1A 3AQCA 3POVA 4NCQA 4CS8A 3L0IA 4ZLDA 1M2VB 1JR8A 256BA 4ANJA 4IAOA 4YT5A 4X0RA 2B0JA 3A11A 4CDYA 3DXJF 1YA7O 3MFNA 2IXNA 5KYYA 3LLKA 1QVXA 3S84A 2QNLA 5L0JA 1B68A 3ZQYA 3LS0A 4MQ9F 1D1CA 4HFKB 2EIMC 4NY3A 1QKRA 1T5OA 2MHRA 3GWLA 3UGOA 2YWAA 2B0HA 3ZC4A 3IHUA 3JRMO 3RF3A 2ETSA 3KYJA 3HJCA 1BR4A 2LIGA 2DYRC 2NUPB 3Q7GA 3EGDB 2PX3A 4NQFA 1OKKA 2JX0A 2YLDA 4A2NB 3EH2A 1N1CA 2W45A 2HV6A 4BJTA 4CS7A 1TR2A 1W2WA 3R7CA 3U0CA 4JVSA 5BQHA 2WVQA 4U5CE 5B3SC 4Z9HA 4PJJA 5KYUA 1L7CA 3U8VA 4EUKB 3T6GB 3J06A 3TJ6A 3VYWA 1WN0A 1M2OA 3Q6NA 1LI5A 3DAFA 3GEHA 3KKBA 1TFOB 3K1HA 1OR2A 3M1CB 3RQEA 2M64A 2Y3GA 2R7TA 3NMIA 2OG2A 1L3PA 4BJ6C 3HNLA 2F22A 1C17M 3NYJA 3B0VC 3PHF2 4UDVA 4U5EE 4KC9A 4MVUA 1Z23A 1YAUO 5D92A 4H54A 2Q9AA 2YQYA 2H7VC 2WL8A 4MW8A 2KNHA 1S7ZA 4MVSA 4CSAC 3G4ZA 2WB7A 4IRUA 1KU2A 3MX3A 4K1OA 1LI7A 1YARO 5BUOA 4L6RA 2WZGA 1IZMA 4MVRA 4ONSA 4YN0B 3US6A 3AQBA 4U5HA 4YT4A 3EFOA 2JPUA 3U8PA 3E9VA 4D4NA 1V4AA 2G3VA 1VOMA 3GWNA 3V5ZA 2FGYA 4MVMA 2EINC 4QDLA 2NUTB 3DJNB 3M4BA 3ABLC 3NG1A 2J9BA 2Y39A 2PP4A 4KNVA 2IBFA 4YL3A 1LE2A 2C04A 2HS5A 2NPUA 2R02A 3NYLA 3RFYA 3V7OA 3L34A 4I44A 1XZQA 2A1DD 3AG2C 2V3CC 1VLSA 5JUAA 2R9RB 4JZAA 3GANA 3TULA 5F5FA 4H4KC 1NLXA 3I5PA 1JOGA 1OCZC 2D4UA 2HSBA 4W8KA 3DM9B 4FWVA 2NUPA 3T4RA 3EGDA 4BG0A 4YK5A 4F4BA 3T6JA 1GM5A 4PJLA 1G5ZA 2LFFA 4LLCA 5JSLA 1OCCC 5B1AC 2Y69C 3Q7LA 1I4ZA 1ZHYA 4XPWA 2ICWG 2DB4A 4JJFA 4LACB 4LLEA 2RSEB 3AJMA 5DQTA 3UMIA 2EILC 3EJNA 4N06A 3W8HA 4RBNA 1LIHA 4WABA 2YLGA 4XPYA 3C8GA 2XL4A 4XWJA 1G4WR 4QI2A 2R7OA 3DI5A 4JC7A 1EQ1A 1CPRA 3ITFA 4JEAA 5DQZA 1H6GA 2AWCA 2KW3C 2NSGA 3IQCA 4DRHB 4PJMA 5L0GA 1C02A 1UG7A 3F46A 1WATA 3S0XA 4RD9A 3GM1A 5KYUB 1K05A 5A6AA 2KYHA 2XXAA 3H2UA 4G7ZF 2R25A 4U5FE 4JURI 3SNHA 1Z5ZA 3UGPA 1HW1A 5COMA 3K1IC 3C63A 2Z15A 1OW8A 1NFNA 1F1MA 1LS4A 1YYJA 1TWAA 5E3AA 4AX2A 4BJ1A 4CS9A 4E18A 2LK4A 4ULWA 1T6QA 3B29A 4J32B 3W4YA 2R7RA 3C62A 1JMWA 4JTAB 4ULVA 5FZTA 3N0TA 3EG9A 3S9OA 2DGJA 2W9YA 3SXKA 4DVZA 2PFDA 3RH3A 4LDKA 1SF8A 3Q6MA 3QVYA 4GYTA 1OW7A 1D0ZA 3PMRA 2TMVP 2ASRA 3IQTA 1VYKA 2OOCA 3EFOB 3VM6A 4Z9IA 3LNMB 2R7WA 5KYNA 1EKYA 1YZAA 4PR9A 3SP1A 3AOUA 4HFFB 4JTCB 2DI3A 3OA1A 3QTHA 4JKVA 3SEOA 5L0FA 1FMWA 4EIYA 4Z9JA 3DZAA 5IY5C 2CGEA 2KQ9A 4MTGA 4CIPA 1RMVA 3KPHA 1FR0A 2KC3A 3UR3C 2L7AA 3NDBB 1NFOA 1GQAA 4LDRA 4YL1A 1E85A 2OEXA 1YDIA 3DE8A 4O6MA 5DS4A 4I1MA 2J46A 1MMGA 1VK5A 2J9UA 2KSFA 2PX0A 3M4CA 4K0DA 1ZHZA 3KYIA 4YT2A 1ZVZA 2A6HF 3I5QA 2IM8A 2QY9A 3DWWA 3FDQA 1A0BA 3G50A 4N4WA 2XSEA 4O6YA 3U3BA 5L3QA 2R03A 1BZ4A 1OCOC 3KH2A 2L81A 2BE5F 3AG4C 4OIPF 2GAQA 1M6TA 3U5SA 3RW0A 1ZZPA 2PNOA 1APCA 4B6IA 3X1OA 3C8GB 4XQ1A
chains in the Genus database with same CATH topology
3AJMA 2KK1A 2LK4A 1O3UA 3RQGA 3RQEA 2YWAA 3JZ0A 4XEVA 3C8GA 4XEKA 3S9OA 3GM2A 2L6FA 5F28E 3C8GB 3L8IA 4EBKA 3GM3A 1KTMA 3L8JA 1KNYA 3C8GD 1OW7A 1WWPA 4R32A 3JYYA 3TULA 1UFBA 1K40A 4NQFA 1WOLA 2JX0A 1PV3A 1JOGA 2HSBA 3K7DA 3BRJA 2L6HA 3B71A 3RQFA 4XEFA 3GM1A 1K05A 2PBEA 4EBJA 1WTYA 3U0CA 3O10A 2Q00A 3MFNA 2JPUA 1ZZPA 1QVXA 3U3FA 1OW8A 2L6GA 1V4AA 3C18A 1K04A 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJM A;  2KK1 A;  2LK4 A;  1O3U A;  3RQG A;  3RQE A;  2YWA A;  3JZ0 A;  4XEV A;  3C8G A;  4XEK A;  3S9O A;  3GM2 A;  2L6F A;  5F28 E;  3C8G B;  3L8I A;  4EBK A;  3GM3 A;  1KTM A;  3L8J A;  1KNY A;  3C8G D;  1OW7 A;  1WWP A;  4R32 A;  3JYY A;  3TUL A;  1UFB A;  1K40 A;  4NQF A;  1WOL A;  2JX0 A;  1PV3 A;  1JOG A;  2HSB A;  3K7D A;  3BRJ A;  2L6H A;  3B71 A;  3RQF A;  4XEF A;  3GM1 A;  1K05 A;  2PBE A;  4EBJ A;  1WTY A;  3U0C A;  3O10 A;  2Q00 A;  3MFN A;  2JPU A;  1ZZP A;  1QVX A;  3U3F A;  1OW8 A;  2L6G A;  1V4A A;  3C18 A;  1K04 A;  1OW6 A; 
#chains in the Genus database with same CATH topology
 2J7P D;  2P1A A;  2HKV A;  2KGO A;  3E70 C;  4O79 A;  1QLE C;  3ZDL A;  2PF4 E;  1SMY F;  1ST6 A;  1Y6D A;  2XLH A;  5E2Q A;  4KI2 A;  1I4Y A;  4XEK A;  1A7D A;  1E86 A;  3BEH A;  1R5I D;  3L8I A;  2CYD A;  2GDC A;  1ZW2 A;  3LLI A;  3GM3 A;  5E33 A;  2A0U A;  4EWC A;  1KNY A;  1D1B A;  3U9M A;  4J7T A;  2D5R B;  1NBB A;  2WZF A;  1U0B B;  2EPL X;  4LDQ A;  2NSF A;  4DJ9 A;  2XXA B;  4LER A;  1ZU4 A;  1JAF A;  1YVI A;  2LSE A;  4OIR F;  5K0I A;  2XL8 A;  2YZS A;  3MYI A;  1T9K A;  4IJJ A;  4PAC A;  2YL1 A;  4U9E A;  1V55 C;  3EGX B;  1WAS A;  4GQH A;  2H7O A;  4EKW A;  2BC5 A;  4JIO A;  5A6K A;  3O10 A;  5KYW B;  4YWQ A;  1VLT A;  1HW2 A;  4J7Y A;  1V54 C;  2A0B A;  3EG9 B;  3IEE A;  3EHN A;  1ORJ A;  1OW6 A;  2J0W A;  1XZP A;  1S05 A;  2AU5 A;  2QLA A;  4JRZ A;  3ZSU A;  2R7S A;  2EPM X;  1TQG A;  2EPK X;  1SR2 A;  2AWY A;  3ZTZ A;  1NSG B;  3DAG A;  4U9D A;  3K33 A;  3CSK A;  1G4U S;  4K7B A;  4MVZ A;  2UUH A;  4P9F A;  1NU7 D;  3LEO A;  2HMQ A;  3NRH A;  2BL2 A;  3O55 A;  3PCV A;  4QI0 A;  2OJQ A;  1H7I A;  1JRA A;  1OCR C;  2A6E F;  1QSP A;  1WWP A;  2R05 A;  3HNK A;  4DXW A;  4Q4Z F;  1VMA A;  3OEO A;  1D0X A;  4I1O B;  4AE4 A;  5CIV A;  3ASO C;  4A4A A;  4Q7C A;  5BQG A;  1A7E A;  3T6B A;  1AUE A;  4E0H A;  1EI7 A;  3BRJ A;  2IOQ A;  3JCU Q;  3T9O A;  3W8I A;  3LNR A;  2LQG A;  3X2Q C;  5L0H A;  2WVN A;  2HUJ A;  4DVY P;  4FAP B;  4CIH A;  1VTM P;  3GEI A;  2IYL D;  3JRT A;  2IXM A;  4E17 A;  4O6N A;  3U2M A;  4CSA A;  4P6I C;  1E2X A;  5CI9 A;  4JCZ A;  4BJ5 C;  1TWC A;  3QVZ A;  1QQ3 A;  3S27 A;  3MYF A;  2LCH A;  5KYX A;  3GOR A;  4ER9 A;  2EPO A;  2YVK A;  3ECS A;  4JEB A;  2I8B A;  1I5N A;  2UUI A;  3LAY A;  4I3M A;  2HFI A;  2R7U A;  4DBQ A;  3ABK C;  4XTK A;  3ZIB A;  5HV9 A;  4U5D E;  2YL7 A;  5A6J A;  1FAP B;  3SXZ A;  2RD9 A;  2XLO A;  2OJE D;  4KBL A;  4G7O F;  5A6B D;  4C7O A;  4KNW A;  3DKA A;  1UFB A;  2W4M A;  2Y3H A;  5AC4 A;  3IQ6 A;  2Q3T A;  3EH1 A;  4C3E A;  1MMA A;  4PJN A;  3B71 A;  1Q0F A;  1SYQ A;  2J0X A;  4U5B E;  2VCC A;  5E3C A;  2ZXO A;  5EGY A;  1YLM A;  1GGQ A;  3N2Z B;  1IW7 F;  1HMO A;  1A41 A;  1O87 A;  2G3K A;  1MND A;  1FTS A;  3LJB A;  4OD4 A;  3VRC A;  1QZX A;  2Q00 A;  3HTK C;  1RJ9 A;  1CPQ A;  3FXH A;  2NG1 A;  1PD0 A;  2WZL A;  1V74 B;  3C7J A;  4N6C A;  3C18 A;  5D91 A;  2CNW D;  1A7V A;  3EGX A;  4DOZ A;  4C3D A;  3WOD F;  3RKO F;  2Q7R A;  5AC5 A;  4IGG A;  2R7V A;  5KYW A;  3TOM A;  1H9T A;  2XS8 A;  2X51 A;  4EBK A;  3EZH A;  1XWJ A;  3U9J A;  3AG3 C;  2A69 F;  3H2V A;  3EQL F;  3JYY A;  4OIQ F;  1ORY A;  2LD6 A;  2GWW A;  3HNJ A;  2HSQ A;  3U2L A;  3AGU A;  4AK9 A;  4YT8 A;  3CEX A;  1J8M F;  4YL0 A;  4CS8 C;  3DD7 A;  1OXK A;  2L6H A;  2V26 A;  1M56 C;  4IAQ A;  2XS1 A;  2Y3B A;  3GEE A;  4XLN F;  2KJG A;  3ZVR A;  4CJO A;  4DRI B;  5JVE A;  4O7G A;  1CGM E;  1ZHX A;  3TOL A;  5L0I A;  4JTD B;  4CDA A;  1DOV A;  1MQV A;  2J7P A;  2AVK A;  1TFK B;  3HLZ A;  3ZG1 A;  3K1I A;  1C03 A;  1NZE A;  1H9G A;  1Q0M A;  4WJ0 A;  3WHN A;  3SXM A;  4CBE A;  2A68 F;  3MLG A;  1BR1 A;  4P9T A;  1CGO A;  4CX9 A;  2LFD A;  1FNT c;  1Z7Q c;  1LE4 A;  4OIO F;  4NTF A;  3QW0 A;  2OQM A;  3JZ0 A;  3NMK A;  3GM2 A;  4PFO A;  4FX5 A;  4AE4 B;  1HE9 A;  1KTM A;  2IXO A;  2Y3D A;  3MBG A;  1OQC A;  3JSE O;  5AGF A;  2YHS A;  4OD5 A;  2GA0 A;  2QE9 A;  1WOL A;  2HMZ A;  3QZC A;  3HNI A;  2HJM A;  1T6I A;  4MTF A;  4XEF A;  1PCX A;  3CQZ A;  4CDV A;  2PBE A;  3I4U A;  3IPM O;  3S29 A;  3FVY A;  3W2V A;  5KYX B;  1BDJ B;  2J9V A;  1QPU A;  2W4B A;  2FFH A;  1MNE A;  3W2W A;  3L1M A;  1R4T A;  3JTL O;  2L6G A;  3O6X A;  2J45 A;  1K04 A;  1JPN A;  2EPN A;  3A9C A;  5DS5 A;  2OU6 A;  3TQO A;  5L0D A;  3SYN A;  3SZR A;  4DRJ B;  2YEV A;  3FHD A;  5B3I A;  2P6V A;  3RYL A;  2IXP A;  1LPE A;  2QUP A;  2VH3 A;  4MW3 A;  5JS5 A;  4PK4 A;  2J8W A;  2O9X A;  1ZHT A;  2H8A A;  3TJ5 A;  4HE8 D;  1EA8 A;  1NU9 C;  2AP3 A;  2HZ8 A;  3ZQV A;  4NTB A;  2J9W A;  4MND A;  4IB4 A;  3WAQ A;  1VYI A;  3K7D A;  5DVW A;  1ZU5 A;  1RJ9 B;  2H7B A;  1Q0K A;  2I15 A;  3OWT A;  1TWG A;  2C03 A;  4AL0 A;  2P7V A;  3AG1 C;  2XLV A;  3JYH A;  3UMK A;  3FAJ A;  3QW1 A;  3JSZ A;  4IWB A;  1ZW3 A;  4G7H F;  3K6B A;  3JT1 A;  2E87 A;  1E83 A;  1RKC A;  2ZD9 A;  3KMI A;  5CI8 A;  2VAS A;  2KK1 A;  5HSW A;  2VC9 A;  1O3U A;  3EZI A;  1D0Y A;  5L0C A;  1Z63 A;  2VCA A;  4RDA A;  3KL4 A;  4WGY A;  5BQI A;  1LM3 B;  2GFH A;  5B1B C;  1T6U A;  3LUT B;  1OR3 A;  3NKE A;  5COG A;  2EIJ C;  3SXY A;  5A6B A;  1MMN A;  4BJ6 A;  4C3B A;  2YKZ A;  1FMV A;  1PD1 A;  2VCB A;  3FMS A;  4R32 A;  1MMD A;  2Q4F A;  2ZPA A;  4N6H A;  3B9Q A;  3NMJ A;  5JLI A;  4ZLC A;  1ZYR F;  3B0P A;  1J8Y F;  3RVZ A;  3S28 A;  1E84 A;  1T01 A;  1O5H A;  1TKN A;  2OCC C;  3F47 A;  3RQF A;  1OKK D;  3ZWI A;  2XM0 A;  4MS2 A;  4J30 B;  1RKE A;  4EBJ A;  3G4X A;  3K66 A;  5T3W A;  1AVO B;  2R7X A;  2CNW A;  3FOO A;  3O39 A;  4JE9 A;  1ORS C;  2G62 A;  1TWH A;  4D4X A;  1FFH A;  3U3F A;  3V5Y A;  4G0H A;  5DLJ A;  1HE1 A;  1M2V A;  3DM5 A;  2P61 A;  1CGN A;  2FAP B;  2OEV A;  2JD3 A;  2ZXW C;  1U6H A;  3RQG A;  5TJ5 E;  4DBR A;  2L9J A;  3VF0 A;  2HJ3 A;  3M15 A;  5JT4 A;  2QTV A;  3DE9 A;  2Q9B A;  4NC3 A;  5EK0 A;  3NYM A;  1GS9 A;  1NG1 A;  2L6F A;  3DJU B;  2VB6 A;  4HEA J;  3PDM P;  1HMD A;  5JP7 A;  5F5H A;  4CJG A;  4E7S A;  2M4E A;  1WGW A;  3DMD A;  2XLM A;  3L8J A;  4WGZ A;  4BEM J;  2R7Q A;  2XLE A;  3HKK A;  1AEP A;  1M57 C;  3RVY A;  5DS6 A;  3RIP A;  5T3T A;  1RXQ A;  3IQ5 A;  3B0U X;  1K40 A;  1VB5 A;  4YJW A;  5KYY B;  2CDQ A;  2XLD A;  2ZXR A;  4IAR A;  3CAX A;  1Q0D A;  2LP4 A;  4MTO A;  1D1A A;  4MVQ A;  1YJG A;  5GPG B;  3V5X A;  4JW1 A;  1Y4C A;  1WTY A;  2X0C A;  4JJG A;  4EBB A;  4EHP A;  4FES A;  4BJ5 A;  5EHH A;  3FOP A;  1FFT C;  4CS9 C;  1Z3I X;  3FAP B;  1LVK A;  1Z6A A;  4U5G A;  1Q0G A;  3EPV A;  1U89 A;  1ZHW A;  4M63 A;  3LES A;  3N24 A;  4Q5S F;  3GOD A;  4OIN F;  1LKX A;  2ZXP A;  1YA9 A;  3CZ6 A;  4GEH A;  1YZC A;  2XL6 A;  1BR2 A;  2EIK C;  3ATP A;  4XPX A;  3S90 A;  4E0I A;  3ZTM A;  3VAY A;  1PV3 A;  1G8X A;  1DOW A;  4W8P A;  1BBH A;  2WVO A;  2XLW A;  2XRH A;  2MYS A;  3TK0 A;  2YL3 A;  1SZI A;  2DYS C;  5FCL A;  1YYX A;  2Q9C A;  1JPJ A;  3C8Z A;  5JRA A;  2YL0 A;  2OKU A;  4C7O B;  3ASN C;  4MVO A;  5T1D B;  2CW0 F;  3WG7 C;  4BEJ A;  4E7Z A;  3EHM A;  1HY5 A;  4PFP A;  1RCP A;  1OXB A;  2CCY A;  3TD7 A;  3UNG C;  2XM4 A;  3AGT A;  3R2P A;  4G78 A;  3UMH A;  3H65 A;  3M79 A;  2YLI A;  4XEV A;  5COF A;  2HV7 A;  2MWQ A;  3LEV A;  4AL1 A;  4NTA A;  5F28 E;  5A69 A;  3ABM C;  2NUT A;  3C8G D;  4BPM A;  4JCH A;  2P0N A;  3QMK A;  2YRF A;  5L3V A;  3NKD A;  1RKE B;  3LS1 A;  4XLP F;  1LS1 A;  3AQC A;  3POV A;  4NCQ A;  4CS8 A;  3L0I A;  4ZLD A;  1M2V B;  1JR8 A;  256B A;  4ANJ A;  4IAO A;  4YT5 A;  4X0R A;  2B0J A;  3A11 A;  4CDY A;  3DXJ F;  1YA7 O;  3MFN A;  2IXN A;  5KYY A;  3LLK A;  1QVX A;  3S84 A;  2QNL A;  5L0J A;  1B68 A;  3ZQY A;  3LS0 A;  4MQ9 F;  1D1C A;  4HFK B;  2EIM C;  4NY3 A;  1QKR A;  1T5O A;  2MHR A;  3GWL A;  3UGO A;  2YWA A;  2B0H A;  3ZC4 A;  3IHU A;  3JRM O;  3RF3 A;  2ETS A;  3KYJ A;  3HJC A;  1BR4 A;  2LIG A;  2DYR C;  2NUP B;  3Q7G A;  3EGD B;  2PX3 A;  4NQF A;  1OKK A;  2JX0 A;  2YLD A;  4A2N B;  3EH2 A;  1N1C A;  2W45 A;  2HV6 A;  4BJT A;  4CS7 A;  1TR2 A;  1W2W A;  3R7C A;  3U0C A;  4JVS A;  5BQH A;  2WVQ A;  4U5C E;  5B3S C;  4Z9H A;  4PJJ A;  5KYU A;  1L7C A;  3U8V A;  4EUK B;  3T6G B;  3J06 A;  3TJ6 A;  3VYW A;  1WN0 A;  1M2O A;  3Q6N A;  1LI5 A;  3DAF A;  3GEH A;  3KKB A;  1TFO B;  3K1H A;  1OR2 A;  3M1C B;  3RQE A;  2M64 A;  2Y3G A;  2R7T A;  3NMI A;  2OG2 A;  1L3P A;  4BJ6 C;  3HNL A;  2F22 A;  1C17 M;  3NYJ A;  3B0V C;  3PHF 2;  4UDV A;  4U5E E;  4KC9 A;  4MVU A;  1Z23 A;  1YAU O;  5D92 A;  4H54 A;  2Q9A A;  2YQY A;  2H7V C;  2WL8 A;  4MW8 A;  2KNH A;  1S7Z A;  4MVS A;  4CSA C;  3G4Z A;  2WB7 A;  4IRU A;  1KU2 A;  3MX3 A;  4K1O A;  1LI7 A;  1YAR O;  5BUO A;  4L6R A;  2WZG A;  1IZM A;  4MVR A;  4ONS A;  4YN0 B;  3US6 A;  3AQB A;  4U5H A;  4YT4 A;  3EFO A;  2JPU A;  3U8P A;  3E9V A;  4D4N A;  1V4A A;  2G3V A;  1VOM A;  3GWN A;  3V5Z A;  2FGY A;  4MVM A;  2EIN C;  4QDL A;  2NUT B;  3DJN B;  3M4B A;  3ABL C;  3NG1 A;  2J9B A;  2Y39 A;  2PP4 A;  4KNV A;  2IBF A;  4YL3 A;  1LE2 A;  2C04 A;  2HS5 A;  2NPU A;  2R02 A;  3NYL A;  3RFY A;  3V7O A;  3L34 A;  4I44 A;  1XZQ A;  2A1D D;  3AG2 C;  2V3C C;  1VLS A;  5JUA A;  2R9R B;  4JZA A;  3GAN A;  3TUL A;  5F5F A;  4H4K C;  1NLX A;  3I5P A;  1JOG A;  1OCZ C;  2D4U A;  2HSB A;  4W8K A;  3DM9 B;  4FWV A;  2NUP A;  3T4R A;  3EGD A;  4BG0 A;  4YK5 A;  4F4B A;  3T6J A;  1GM5 A;  4PJL A;  1G5Z A;  2LFF A;  4LLC A;  5JSL A;  1OCC C;  5B1A C;  2Y69 C;  3Q7L A;  1I4Z A;  1ZHY A;  4XPW A;  2ICW G;  2DB4 A;  4JJF A;  4LAC B;  4LLE A;  2RSE B;  3AJM A;  5DQT A;  3UMI A;  2EIL C;  3EJN A;  4N06 A;  3W8H A;  4RBN A;  1LIH A;  4WAB A;  2YLG A;  4XPY A;  3C8G A;  2XL4 A;  4XWJ A;  1G4W R;  4QI2 A;  2R7O A;  3DI5 A;  4JC7 A;  1EQ1 A;  1CPR A;  3ITF A;  4JEA A;  5DQZ A;  1H6G A;  2AWC A;  2KW3 C;  2NSG A;  3IQC A;  4DRH B;  4PJM A;  5L0G A;  1C02 A;  1UG7 A;  3F46 A;  1WAT A;  3S0X A;  4RD9 A;  3GM1 A;  5KYU B;  1K05 A;  5A6A A;  2KYH A;  2XXA A;  3H2U A;  4G7Z F;  2R25 A;  4U5F E;  4JUR I;  3SNH A;  1Z5Z A;  3UGP A;  1HW1 A;  5COM A;  3K1I C;  3C63 A;  2Z15 A;  1OW8 A;  1NFN A;  1F1M A;  1LS4 A;  1YYJ A;  1TWA A;  5E3A A;  4AX2 A;  4BJ1 A;  4CS9 A;  4E18 A;  2LK4 A;  4ULW A;  1T6Q A;  3B29 A;  4J32 B;  3W4Y A;  2R7R A;  3C62 A;  1JMW A;  4JTA B;  4ULV A;  5FZT A;  3N0T A;  3EG9 A;  3S9O A;  2DGJ A;  2W9Y A;  3SXK A;  4DVZ A;  2PFD A;  3RH3 A;  4LDK A;  1SF8 A;  3Q6M A;  3QVY A;  4GYT A;  1OW7 A;  1D0Z A;  3PMR A;  2TMV P;  2ASR A;  3IQT A;  1VYK A;  2OOC A;  3EFO B;  3VM6 A;  4Z9I A;  3LNM B;  2R7W A;  5KYN A;  1EKY A;  1YZA A;  4PR9 A;  3SP1 A;  3AOU A;  4HFF B;  4JTC B;  2DI3 A;  3OA1 A;  3QTH A;  4JKV A;  3SEO A;  5L0F A;  1FMW A;  4EIY A;  4Z9J A;  3DZA A;  5IY5 C;  2CGE A;  2KQ9 A;  4MTG A;  4CIP A;  1RMV A;  3KPH A;  1FR0 A;  2KC3 A;  3UR3 C;  2L7A A;  3NDB B;  1NFO A;  1GQA A;  4LDR A;  4YL1 A;  1E85 A;  2OEX A;  1YDI A;  3DE8 A;  4O6M A;  5DS4 A;  4I1M A;  2J46 A;  1MMG A;  1VK5 A;  2J9U A;  2KSF A;  2PX0 A;  3M4C A;  4K0D A;  1ZHZ A;  3KYI A;  4YT2 A;  1ZVZ A;  2A6H F;  3I5Q A;  2IM8 A;  2QY9 A;  3DWW A;  3FDQ A;  1A0B A;  3G50 A;  4N4W A;  2XSE A;  4O6Y A;  3U3B A;  5L3Q A;  2R03 A;  1BZ4 A;  1OCO C;  3KH2 A;  2L81 A;  2BE5 F;  3AG4 C;  4OIP F;  2GAQ A;  1M6T A;  3U5S A;  3RW0 A;  1ZZP A;  2PNO A;  1APC A;  4B6I A;  3X1O A;  3C8G B;  4XQ1 A; 
#chains in the Genus database with same CATH homology
 3AJM A;  2KK1 A;  2LK4 A;  1O3U A;  3RQG A;  3RQE A;  2YWA A;  3JZ0 A;  4XEV A;  3C8G A;  4XEK A;  3S9O A;  3GM2 A;  2L6F A;  5F28 E;  3C8G B;  3L8I A;  4EBK A;  3GM3 A;  1KTM A;  3L8J A;  1KNY A;  3C8G D;  1OW7 A;  1WWP A;  4R32 A;  3JYY A;  3TUL A;  1UFB A;  1K40 A;  4NQF A;  1WOL A;  2JX0 A;  1PV3 A;  1JOG A;  2HSB A;  3K7D A;  3BRJ A;  2L6H A;  3B71 A;  3RQF A;  4XEF A;  3GM1 A;  1K05 A;  2PBE A;  4EBJ A;  1WTY A;  3U0C A;  3O10 A;  2Q00 A;  3MFN A;  2JPU A;  1ZZP A;  1QVX A;  3U3F A;  1OW8 A;  2L6G A;  1V4A A;  3C18 A;  1K04 A;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...