5CI9A

Crystal structure of human tob in complex with inhibitor fragment 6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
116
structure length
116
Chain Sequence
HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/inhibitor
molecule keywords Protein Tob1
publication title Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5ci9A00
2Z15A 3E9VA 2D5RB 3DJUB 5CI8A 3DJNB 5CI9A
chains in the Genus database with same CATH superfamily
3RVZA 4J7TA 1XWJA 2CYDA 2OEVA 3L8IA 4HEAJ 4JTCB 4HFKB 5JUAA 3QTHA 1OW6A 1MMNA 1WASA 1TWGA 3DJUB 4LDQA 1AVOB 5L0CA 4AE4B 4N6CA 3NKDA 2ZD9A 3K1IC 4JZAA 2FGYA 3AOUA 3W8HA 1RKEA 2YL3A 4E0IA 4O6YA 3UNGC 2J8WA 1TFOB 2BL2A 4IAOA 3SZRA 1BZ4A 5DLJA 4ER9A 5L0GA 2NPUA 1IZMA 1T6UA 1BR1A 2AWCA 3Q6MA 5T1DB 3ZG1A 5D91A 1E86A 3SXYA 4XPXA 2IM8A 4LERA 5JLIA 2YLGA 1OW8A 2EPLX 5K0IA 2HZ8A 4I3MA 1QKRA 2LQGA 3MYIA 3AQBA 4JKVA 1U6HA 4MVMA 3GM1A 5B1BC 4JW1A 2JPUA 1UG7A 2B0HA 3MLGA 1ZYRF 1VLSA 1QPUA 4DVZA 3A9CA 2HKVA 4PACA 4C3BA 1FNTc 1A0BA 4WGYA 3GWLA 1KU2A 3O10A 2CCYA 1R4TA 4JJGA 3F46A 2ZXRA 3HNLA 3E70C 4DVYP 2JX0A 4JVSA 2ZXPA 2R05A 4OIPF 3G50A 2DB4A 3OWTA 2Y3DA 4KNWA 2JD3A 2LFDA 1NZEA 2WZFA 3U2MA 1ZHXA 2HV7A 3DM9B 3GEIA 5COFA 4GEHA 3CQZA 2A69F 4ZLCA 2AU5A 4A4AA 1YA7O 3L8JA 2GWWA 3WG7C 1HW2A 4RDAA 3SXKA 2HS5A 4MW8A 4EBKA 1NFOA 1ZZPA 4LDKA 1LM3B 2NUTA 4IJJA 2HUJA 4U5FE 5AC5A 3TJ5A 1Y6DA 4B6IA 3EJNA 4OINF 2EIKC 2EINC 3J06A 2CNWA 3V7OA 1K40A 1MMDA 2G62A 3EPVA 1OR2A 1SMYF 3C62A 1ZHZA 3IQCA 3NKEA 1V74B 1H9TA 4G78A 3AG2C 1XZPA 4PK4A 4K1OA 3ZDLA 1D0XA 3B29A 3U9MA 1ZHTA 4WGZA 4BJ5C 2KSFA 1VYIA 4MW3A 1NLXA 5CI9A 1E85A 2XLDA 3C18A 4AX2A 1J8MF 1RCPA 2EILC 4IGGA 3SXMA 2LCHA 2Q00A 2VC9A 1UFBA 4MVSA 3WODF 5F5FA 1OCZC 2OJQA 2GDCA 3JTLO 3UMHA 4FX5A 1V4AA 2QTVA 3DWWA 3ABMC 4PFOA 2FAPB 4KBLA 1VK5A 4CS8A 1NU9C 1TFKB 2YL0A 3K7DA 1Z7Qc 4LDRA 5AC4A 1SR2A 2CDQA 3HTKC 2XXAB 2J45A 3HNJA 2R7TA 1R5ID 1OW7A 1J8YF 1OXBA 1I5NA 3NG1A 5D92A 4GYTA 1CGME 1JRAA 4XWJA 2Y69C 4DBRA 3M15A 1BBHA 3S28A 2OG2A 3CEXA 4A2NB 2Q7RA 4EKWA 1TR2A 1JPJA 2J7PA 3HKKA 1VOMA 3NYLA 4HE8D 2OEXA 1Q0FA 1M2VB 2NSFA 1Z5ZA 2V3CC 4ANJA 3U8VA 1VYKA 4PFPA 2VCBA 2F22A 2A68F 4D4XA 1N1CA 5KYNA 2QUPA 3H65A 4PJNA 3ZQVA 4E7ZA 4PJMA 2J0XA 1OCOC 1QZXA 3T9OA 2D4UA 2D5RB 3FMSA 3B9QA 5JS5A 1A41A 1BDJB 4JE9A 3B0UX 1C02A 2CGEA 1YZAA 3AG1C 1XZQA 4G7HF 3OA1A 1VMAA 1M6TA 3SEOA 3N2ZB 4U5EE 4IRUA 4BJ6C 3K33A 2IXNA 1LIHA 2XLVA 3EGXA 1QSPA 2WB7A 4J30B 5DVWA 3ITFA 4CIHA 1C17M 5BQGA 2M4EA 3S84A 1V55C 4Q4ZF 1A7DA 3AG3C 3QVYA 3R2PA 2OU6A 1S7ZA 2G3VA 1A7EA 4GQHA 3W2WA 3FDQA 1U0BB 3LLIA 1Y4CA 2HV6A 3JCUQ 3K6BA 3LESA 3N0TA 4YL3A 3EGDA 3EHMA 4MQ9F 3RQEA 4XQ1A 2HMQA 2MWQA 2WL8A 1ZU4A 3K1IA 2EPOA 1Q0GA 4U9DA 4YL1A 1T5OA 5KYXB 3B71A 3G4ZA 4W8KA 2I8BA 1FFTC 2IOQA 2J9WA 5B1AC 3T6JA 3PHF2 1LI7A 1BR2A 1W2WA 1LE4A 1YVIA 5L3QA 1HMOA 2HSBA 3AGTA 1MQVA 3BEHA 4O79A 2HMZA 3MBGA 1LVKA 1LS1A 2R7VA 4I1MA 2HJ3A 2I15A 3SXZA 3LNRA 4LLCA 3IQ5A 1NFNA 1Q0KA 2XLWA 3F47A 4MVUA 4WABA 2J9BA 2YWAA 5T3TA 2Y3GA 5KYWB 3RQFA 1TQGA 4BG0A 1ORSC 1SF8A 2XSEA 2XLEA 3NMKA 1I4ZA 2AVKA 5KYYB 3K66A 3KMIA 3LLKA 3NDBB 3FHDA 2R7WA 5DS4A 3WHNA 3DXJF 5A6AA 3FOOA 4YJWA 3LS1A 5FZTA 3DAFA 2KW3C 2J9UA 4JIOA 2YLDA 1G5ZA 3M1CB 3QW0A 3RFYA 2VB6A 4DBQA 1HW1A 3EG9A 1QLEC 2G3KA 3H2VA 2YL7A 2XM4A 1U89A 3ZVRA 3GWNA 4NQFA 4YWQA 4W8PA 3A11A 1L7CA 2XLMA 3R7CA 3S27A 1JPNA 2E87A 2KK1A 3EZHA 4N4WA 4H54A 4ONSA 1SYQA 4DRHB 1L3PA 4BJ1A 3G4XA 2XS1A 2EPNA 1OKKA 1YYJA 2QNLA 4N6HA 4P6IC 4OIQF 1HE9A 1C03A 2B0JA 3AG4C 1E2XA 1ZW2A 2A0UA 2NUPB 2YZSA 3PDMP 4WJ0A 3IHUA 3ASNC 3V5ZA 3TK0A 3TOLA 4E0HA 4FESA 2R7QA 3C8GB 4NCQA 2C03A 5E3CA 2EPMX 3RKOF 3RQGA 4OIRF 3RIPA 5B3IA 2CW0F 2KQ9A 1E84A 3VRCA 4ZLDA 2QE9A 3CZ6A 4BJ5A 3TULA 2LFFA 2L6GA 1EKYA 4JEAA 4JURI 4JEBA 4C7OB 2UUIA 4E18A 3RVYA 2WVOA 5A6JA 1RXQA 1V54C 1ZW3A 3NYMA 4C3EA 4K7BA 3Q6NA 1ST6A 3O55A 4RBNA 1B68A 4BPMA 1EA8A 2O9XA 4RD9A 2TMVP 1QQ3A 5L0IA 1GGQA 3FAPB 5A69A 2R02A 3VF0A 3DKAA 5T3WA 1JOGA 1OR3A 1WWPA 3Q7LA 2Q9CA 1D0ZA 4EBJA 2A6EF 5KYUB 4C3DA 3BRJA 3DM5A 2Y3BA 3JT1A 4OD4A 3ZIBA 3SNHA 2GFHA 2H7VC 3TD7A 2R9RB 5L0DA 4NY3A 5FCLA 4ULWA 3UR3C 1VTMP 4JTDB 3EH2A 3HNIA 4U5DE 1CGOA 1OCRC 1CPRA 3PCVA 4HFFB 2ETSA 3VYWA 3ABKC 3I4UA 2L7AA 2L81A 2PX0A 4IWBA 4NTBA 3K1HA 3GEHA 3TOMA 2Y3HA 3NYJA 4AL1A 4JJFA 2WZLA 2EIJC 5COGA 5BQHA 4G7ZF 4DRJB 5EHHA 1WOLA 3EZIA 1YYXA 1LS4A 2ZXWC 3RW0A 3UGOA 3L34A 3LJBA 2OJED 2P7VA 3NMIA 3B0VC 2XXAA 4XLNF 2YVKA 4BJ6A 2R7UA 4K0DA 1FMVA 2VASA 3IEEA 2RD9A 3C8GD 3TJ6A 5DS6A 2IBFA 5A6BD 1RJ9A 3KYIA 3AGUA 1G8XA 3QZCA 3S9OA 1A7VA 2HSQA 5DQTA 2Y39A 1D1CA 2ZPAA 2P0NA 3U8PA 1HE1A 3AJMA 4YK5A 1M2VA 2DYRC 3FXHA 3NRHA 1JMWA 4KNVA 2NSGA 4Z9JA 1K05A 2QY9A 3LEOA 5E33A 3SP1A 2KGOA 4JRZA 3U9JA 4CBEA 4BJTA 3H2UA 3EFOB 2IXPA 3I5QA 5DQZA 5IY5C 3T6GB 3O39A 4I1OB 4XPYA 3ECSA 1YA9A 1WGWA 1MMGA 3ASOC 4JCHA 2HJMA 3T6BA 1WTYA 1ORYA 4XEVA 1TWHA 1PV3A 4O6MA 4FAPB 2DYSC 2V26A 1T6QA 4CX9A 1T6IA 1HMDA 1MNEA 5TJ5E 3S90A 4JCZA 2M64A 3KL4A 1VB5A 4M63A 3U2LA 4IB4A 1YAUO 4EIYA 2MYSA 4DXWA 1Q0DA 2ZXOA 3FVYA 2ICWG 2YLIA 2RSEB 4F4BA 2OQMA 3M4BA 3HJCA 3ZWIA 4P9FA 2W9YA 4J7YA 4QI0A 3JYYA 4YT5A 3DJNB 3L1MA 2AWYA 1OQCA 4CJGA 4UDVA 3HLZA 5KYXA 4G7OF 1LE2A 2BC5A 2HFIA 2LIGA 3DD7A 1PD0A 4CSAC 1GS9A 4CJOA 3GM2A 4E17A 2WVNA 3TQOA 1APCA 4AK9A 2PBEA 3FOPA 1RKEB 4CDYA 4BEJA 4MVRA 1TKNA 1Z6AA 2PP4A 1H6GA 3DI5A 3RF3A 4AE4A 3U0CA 2P1AA 2WVQA 1HY5A 1RKCA 1YZCA 2YEVA 3DAGA 3JSEO 4Q7CA 4XPWA 5CI8A 2J7PD 3GORA 4CS9C 2ASRA 3C63A 1KNYA 2VCAA 3JRTA 4YT4A 5DS5A 3UMIA 1VLTA 3X2QC 5KYWA 3MX3A 2YRFA 2J9VA 1SZIA 3C7JA 5EK0A 4DJ9A 2P61A 2XRHA 5KYYA 1DOWA 3U5SA 3POVA 3IPMO 3JYHA 4CDVA 2XLOA 4MTOA 3CAXA 4U5CE 2OOCA 2PNOA 5E3AA 1M57C 2KC3A 1QVXA 3E9VA 3EG9B 3IQ6A 4KI2A 5JRAA 2LP4A 3T4RA 4CS7A 4XEKA 4MTGA 5A6KA 1FR0A 1ORJA 4XLPF 1GM5A 2P6VA 5CIVA 2AP3A 2R03A 2Z15A 1AUEA 4U5BE 3W2VA 3UGPA 3ZQYA 3LAYA 1H9GA 3Q7GA 4MVZA 2XM0A 3UMKA 1Z3IX 2R7XA 2KJGA 1O3UA 5COMA 2EIMC 3OEOA 1IW7F 3EQLF 3DMDA 1K04A 4LACB 2A6HF 1BR4A 2Q4FA 2L6FA 3W8IA 2XL4A 4MNDA 3LEVA 1I4YA 4JC7A 4KC9A 4DOZA 1Z63A 4FWVA 4Z9IA 1PD1A 2Q9BA 5JSLA 3W4YA 2VH3A 2W45A 2NUPA 2IXMA 1S05A 4QDLA 5JVEA 2UUHA 3AQCA 1JR8A 3U3BA 1YARO 2YHSA 2L9JA 1D0YA 1M56C 4NC3A 3SYNA 1MNDA 2YQYA 3CSKA 3M79A 2L6HA 2NUTB 3GEEA 4DRIB 3C8GA 2GAQA 4Q5SF 5A6BA 2A1DD 1LI5A 3QMKA 3ZSUA 5BQIA 5GPGB 2NG1A 3DE9A 3HNKA 4YL0A 3US6A 4C7OA 4AL0A 2H8AA 1NSGB 1ZHWA 3JSZA 3L0IA 5HV9A 2VCCA 5L0FA 1FFHA 4LLEA 3LS0A 2WZGA 5L0HA 3X1OA 4U5GA 1O5HA 2R25A 2EPKX 4NTAA 5B3SC 1M2OA 1Q0MA 1FTSA 1NU7D 1PCXA 2XS8A 4PR9A 5JP7A 1CPQA 3GM3A 5L3VA 2BE5F 2DI3A 3C8ZA 1T01A 2R7OA 4MVQA 4PJJA 1EI7A 3V5YA 3KH2A 2MHRA 3O6XA 2PFDA 5KYUA 2Q9AA 3FAJA 3KYJA 4JTAB 4L6RA 1TWCA 4MTFA 1WATA 1Z23A 5F5HA 2YL1A 3WAQA 1YLMA 5F28E 1NBBA 3ZTMA 1OXKA 4ULVA 1DOVA 2H7BA 1OKKD 4IARA 3VAYA 2LK4A 3NMJA 1GQAA 2LD6A 2Q3TA 3ZTZA 4E7SA 4EHPA 4CIPA 3DZAA 3VM6A 4YN0B 3S0XA 2LSEA 2X51A 1LPEA 5E2QA 3ATPA 3EH1A 4MVOA 2KYHA 2R7RA 1D1AA 4P9TA 1RJ9B 1ZVZA 3QVZA 1AEPA 3JZ0A 3S29A 1E83A 3QW1A 4H4KC 1FAPB 4J32B 3EHNA 4N06A 1D1BA 2A0BA 4NTFA 4CS8C 2OKUA 5BUOA 4QI2A 1ZU5A 1WN0A 2W4BA 2XL8A 4OD5A 5AGFA 1RMVA 2CNWD 3DE8A 4I44A 2J0WA 2PF4E 1H7IA 4G0HA 1EQ1A 1O87A 1NG1A 5EGYA 4Z9HA 3LNMB 3EGXB 1F1MA 2PX3A 1G4US 2FFHA 4IAQA 3KKBA 1T9KA 1TWAA 3GODA 2OCCC 1OCCC 4CDAA 1FMWA 3EFOA 2C04A 4XTKA 4EBBA 4D4NA 4YT2A 4R32A 3EGDB 1YDIA 4EUKB 4O6NA 4OIOF 4CSAA 1JAFA 5HSWA 3U3FA 3PMRA 4EWCA 4YT8A 2IXOA 3MYFA 2XLHA 2H7OA 3RYLA 4BEMJ 1ZHYA 2R7SA 256BA 3V5XA 2KNHA 3ABLC 1YJGA 3N24A 4O7GA 4PJLA 1KTMA 4XEFA 1MMAA 2IYLD 2W4MA 2YKZA 4CS9A 3KPHA 3MFNA 1LKXA 4U9EA 3LUTB 1CGNA 5L0JA 3I5PA 2QLAA 2GA0A 3IQTA 2X0CA 4X0RA 4U5HA 1G4WR 3M4CA 3RH3A 3B0PA 2XL6A 3GANA 3ZC4A 4MS2A 3JRMO 2J46A 5JT4A 2DGJA
chains in the Genus database with same CATH topology
4HEAJ 4HFKB 1MMNA 1TWGA 3DJUB 4AE4B 3NKDA 3K1IC 4JZAA 2FGYA 3W8HA 4O6YA 3UNGC 4IAOA 3SZRA 5DLJA 1IZMA 3Q6MA 1BR1A 5T1DB 3ZG1A 5D91A 4LERA 4I3MA 3AQBA 5B1BC 4JW1A 3MLGA 1ZYRF 4DVZA 4C3BA 1KU2A 4JJGA 3F46A 2ZXRA 3E70C 4DVYP 4JVSA 4OIPF 2ZXPA 3OWTA 2Y3DA 4KNWA 2JD3A 1NZEA 2WZFA 1ZHXA 2HV7A 3DM9B 4GEHA 3CQZA 2A69F 4ZLCA 3WG7C 4RDAA 2NUTA 4IJJA 4U5FE 4B6IA 3EJNA 4OINF 2EIKC 2EINC 2CNWA 3V7OA 1MMDA 2G62A 3EPVA 1SMYF 1ZHZA 3NKEA 3AG2C 4PK4A 1D0XA 4BJ5C 1ZHTA 1VYIA 5CI9A 4AX2A 1J8MF 2EILC 5F5FA 3WODF 1OCZC 3UMHA 4FX5A 2QTVA 4PFOA 3ABMC 4KBLA 1VK5A 4CS8A 1NU9C 3K7DA 2CDQA 3HTKC 2XXAB 2J45A 2R7TA 5D92A 1J8YF 3NG1A 4GYTA 4XWJA 2Y69C 4DBRA 3S28A 2OG2A 4A2NB 1TR2A 1JPJA 2J7PA 3NYLA 1VOMA 4HE8D 1M2VB 2V3CC 1Z5ZA 4ANJA 1VYKA 4PFPA 5KYNA 2A68F 1N1CA 4PJNA 3H65A 4E7ZA 4PJMA 2J0XA 1OCOC 1QZXA 2D5RB 3B9QA 3B0UX 2CGEA 3AG1C 4G7HF 3OA1A 1VMAA 3SEOA 3N2ZB 4U5EE 4IRUA 4BJ6C 3K33A 2IXNA 3EGXA 5DVWA 2WB7A 4J30B 4Q4ZF 3ITFA 4CIHA 2M4EA 1V55C 3AG3C 1S7ZA 2G3VA 3W2WA 3FDQA 3LLIA 3K6BA 2HV6A 3JCUQ 3LESA 3N0TA 3EGDA 3EHMA 4MQ9F 2MWQA 2WL8A 1ZU4A 5KYXB 4W8KA 2I8BA 1FFTC 2IOQA 2J9WA 5B1AC 3T6JA 3PHF2 1BR2A 1W2WA 5L3QA 4O79A 1LVKA 1LS1A 2R7VA 4I1MA 3LNRA 4LLCA 3F47A 5T3TA 2Y3GA 5KYWB 4BG0A 1SF8A 2XSEA 5KYYB 3K66A 3KMIA 3LLKA 3NDBB 3FHDA 2R7WA 5DS4A 3DXJF 4YJWA 3LS1A 3DAFA 2KW3C 2J9UA 3M1CB 3RFYA 2VB6A 3EG9A 1QLEC 2G3KA 4YWQA 3ZVRA 3S27A 1JPNA 2E87A 3EZHA 5B3SC 4BJ1A 4P6IC 1OKKA 4OIQF 2B0JA 3AG4C 2NUPB 2YZSA 4WJ0A 3ASNC 4FESA 2R7QA 5E3CA 2C03A 3RKOF 4OIRF 3RIPA 2CW0F 2KQ9A 4ZLDA 4BJ5A 3CZ6A 4JURI 4C7OB 2WVOA 1V54C 3NYMA 4C3EA 4K7BA 3Q6NA 1ST6A 4RBNA 2O9XA 4RD9A 5T3WA 3Q7LA 2Q9CA 1D0ZA 2A6EF 5KYUB 4C3DA 3DM5A 4OD4A 2Y3BA 3JT1A 3ZIBA 3SNHA 2GFHA 2H7VC 3TD7A 4NY3A 5FCLA 4ULWA 3UR3C 3EH2A 4U5DE 1OCRC 4HFFB 3VYWA 3ABKC 3I4UA 2PX0A 2L81A 4IWBA 3K1HA 2Y3HA 3NYJA 4JJFA 2WZLA 2EIJC 4G7ZF 5EHHA 3EZIA 2ZXWC 3UGOA 3L34A 3LJBA 2P7VA 3B0VC 2XXAA 4XLNF 4BJ6A 2R7UA 4K0DA 1FMVA 2VASA 3IEEA 5DS6A 1RJ9A 1G8XA 3QZCA 5DQTA 2Y39A 1D1CA 2ZPAA 1M2VA 2DYRC 3NRHA 4KNVA 2QY9A 5E33A 3SP1A 2KGOA 4CBEA 4BJTA 3EFOB 2IXPA 3I5QA 5DQZA 5IY5C 3O39A 4I1OB 3ECSA 3ASOC 1WGWA 1MMGA 4JCHA 3T6BA 1TWHA 4O6MA 2DYSC 2V26A 1MNEA 3KL4A 4M63A 2MYSA 2ZXOA 3FVYA 4F4BA 3HJCA 2W9YA 4QI0A 4YT5A 3DJNB 3HLZA 5KYXA 4G7OF 3DD7A 1PD0A 4CSAC 2WVNA 4AK9A 4DBQA 4BEJA 1TKNA 1Z6AA 2PP4A 4AE4A 3DAGA 2WVQA 2YEVA 4Q7CA 5CI8A 2J7PD 4CS9C 3JRTA 4YT4A 5DS5A 3UMIA 3X2QC 5KYWA 3MX3A 2J9VA 1SZIA 2XRHA 5KYYA 3POVA 3JYHA 4U5CE 5E3AA 1M57C 4KI2A 3E9VA 3EG9B 3T4RA 4CS7A 4XLPF 2P6VA 2Z15A 4U5BE 3W2VA 3UGPA 3LAYA 3UMKA 3Q7GA 1Z3IX 2R7XA 2KJGA 2EIMC 3OEOA 1IW7F 3EQLF 3DMDA 4LACB 2A6HF 1BR4A 3W8IA 2XL4A 4MNDA 3LEVA 1Z63A 4KC9A 4DOZA 4FWVA 1PD1A 2Q9BA 2VH3A 2W45A 2NUPA 2IXMA 4QDLA 3AQCA 2YHSA 2L9JA 1D0YA 1M56C 3SYNA 1MNDA 3CSKA 2NUTB 4Q5SF 2A1DD 3QMKA 3ZSUA 2NG1A 4C7OA 1ZHWA 3JSZA 3L0IA 1FFHA 4LLEA 3LS0A 2WZGA 3X1OA 4U5GA 1O5HA 1M2OA 1FTSA 1NU7D 1PCXA 5L3VA 2BE5F 2R7OA 4PJJA 3KH2A 3O6XA 2PFDA 5KYUA 2Q9AA 3FAJA 1TWCA 1Z23A 5F5HA 2H7BA 1OKKD 3VAYA 2Q3TA 4E7SA 3DZAA 4YN0B 3S0XA 2LSEA 2X51A 5E2QA 3EH1A 2R7RA 1D1AA 1RJ9B 3S29A 4CS8C 4H4KC 4J32B 3EHNA 4N06A 1D1BA 5BUOA 4QI2A 1ZU5A 4OD5A 2W4BA 2CNWD 4I44A 2J0WA 2PF4E 4G0HA 1O87A 1NG1A 5EGYA 3EGXB 2PX3A 2FFHA 3KKBA 1TWAA 3GODA 2OCCC 1OCCC 1FMWA 3EFOA 2C04A 4XTKA 4EBBA 4YT2A 3EGDB 4O6NA 4OIOF 4CSAA 5HSWA 4EWCA 3PMRA 4YT8A 2IXOA 2H7OA 3RYLA 1ZHYA 2R7SA 2KNHA 3ABLC 3N24A 4O7GA 4PJLA 1MMAA 2IYLD 2W4MA 4CS9A 1LKXA 3I5PA 3RH3A 4X0RA 4U5HA 3ZC4A 3B0PA 3GANA 2J46A 2DGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z15 A;  3E9V A;  2D5R B;  3DJU B;  5CI8 A;  3DJN B;  5CI9 A; 
#chains in the Genus database with same CATH topology
 3RVZ A;  4J7T A;  1XWJ A;  2CYD A;  2OEV A;  3L8I A;  4HEA J;  4JTC B;  4HFK B;  5JUA A;  3QTH A;  1OW6 A;  1MMN A;  1WAS A;  1TWG A;  3DJU B;  4LDQ A;  1AVO B;  5L0C A;  4AE4 B;  4N6C A;  3NKD A;  2ZD9 A;  3K1I C;  4JZA A;  2FGY A;  3AOU A;  3W8H A;  1RKE A;  2YL3 A;  4E0I A;  4O6Y A;  3UNG C;  2J8W A;  1TFO B;  2BL2 A;  4IAO A;  3SZR A;  1BZ4 A;  5DLJ A;  4ER9 A;  5L0G A;  2NPU A;  1IZM A;  1T6U A;  1BR1 A;  2AWC A;  3Q6M A;  5T1D B;  3ZG1 A;  5D91 A;  1E86 A;  3SXY A;  4XPX A;  2IM8 A;  4LER A;  5JLI A;  2YLG A;  1OW8 A;  2EPL X;  5K0I A;  2HZ8 A;  4I3M A;  1QKR A;  2LQG A;  3MYI A;  3AQB A;  4JKV A;  1U6H A;  4MVM A;  3GM1 A;  5B1B C;  4JW1 A;  2JPU A;  1UG7 A;  2B0H A;  3MLG A;  1ZYR F;  1VLS A;  1QPU A;  4DVZ A;  3A9C A;  2HKV A;  4PAC A;  4C3B A;  1FNT c;  1A0B A;  4WGY A;  3GWL A;  1KU2 A;  3O10 A;  2CCY A;  1R4T A;  4JJG A;  3F46 A;  2ZXR A;  3HNL A;  3E70 C;  4DVY P;  2JX0 A;  4JVS A;  2ZXP A;  2R05 A;  4OIP F;  3G50 A;  2DB4 A;  3OWT A;  2Y3D A;  4KNW A;  2JD3 A;  2LFD A;  1NZE A;  2WZF A;  3U2M A;  1ZHX A;  2HV7 A;  3DM9 B;  3GEI A;  5COF A;  4GEH A;  3CQZ A;  2A69 F;  4ZLC A;  2AU5 A;  4A4A A;  1YA7 O;  3L8J A;  2GWW A;  3WG7 C;  1HW2 A;  4RDA A;  3SXK A;  2HS5 A;  4MW8 A;  4EBK A;  1NFO A;  1ZZP A;  4LDK A;  1LM3 B;  2NUT A;  4IJJ A;  2HUJ A;  4U5F E;  5AC5 A;  3TJ5 A;  1Y6D A;  4B6I A;  3EJN A;  4OIN F;  2EIK C;  2EIN C;  3J06 A;  2CNW A;  3V7O A;  1K40 A;  1MMD A;  2G62 A;  3EPV A;  1OR2 A;  1SMY F;  3C62 A;  1ZHZ A;  3IQC A;  3NKE A;  1V74 B;  1H9T A;  4G78 A;  3AG2 C;  1XZP A;  4PK4 A;  4K1O A;  3ZDL A;  1D0X A;  3B29 A;  3U9M A;  1ZHT A;  4WGZ A;  4BJ5 C;  2KSF A;  1VYI A;  4MW3 A;  1NLX A;  5CI9 A;  1E85 A;  2XLD A;  3C18 A;  4AX2 A;  1J8M F;  1RCP A;  2EIL C;  4IGG A;  3SXM A;  2LCH A;  2Q00 A;  2VC9 A;  1UFB A;  4MVS A;  3WOD F;  5F5F A;  1OCZ C;  2OJQ A;  2GDC A;  3JTL O;  3UMH A;  4FX5 A;  1V4A A;  2QTV A;  3DWW A;  3ABM C;  4PFO A;  2FAP B;  4KBL A;  1VK5 A;  4CS8 A;  1NU9 C;  1TFK B;  2YL0 A;  3K7D A;  1Z7Q c;  4LDR A;  5AC4 A;  1SR2 A;  2CDQ A;  3HTK C;  2XXA B;  2J45 A;  3HNJ A;  2R7T A;  1R5I D;  1OW7 A;  1J8Y F;  1OXB A;  1I5N A;  3NG1 A;  5D92 A;  4GYT A;  1CGM E;  1JRA A;  4XWJ A;  2Y69 C;  4DBR A;  3M15 A;  1BBH A;  3S28 A;  2OG2 A;  3CEX A;  4A2N B;  2Q7R A;  4EKW A;  1TR2 A;  1JPJ A;  2J7P A;  3HKK A;  1VOM A;  3NYL A;  4HE8 D;  2OEX A;  1Q0F A;  1M2V B;  2NSF A;  1Z5Z A;  2V3C C;  4ANJ A;  3U8V A;  1VYK A;  4PFP A;  2VCB A;  2F22 A;  2A68 F;  4D4X A;  1N1C A;  5KYN A;  2QUP A;  3H65 A;  4PJN A;  3ZQV A;  4E7Z A;  4PJM A;  2J0X A;  1OCO C;  1QZX A;  3T9O A;  2D4U A;  2D5R B;  3FMS A;  3B9Q A;  5JS5 A;  1A41 A;  1BDJ B;  4JE9 A;  3B0U X;  1C02 A;  2CGE A;  1YZA A;  3AG1 C;  1XZQ A;  4G7H F;  3OA1 A;  1VMA A;  1M6T A;  3SEO A;  3N2Z B;  4U5E E;  4IRU A;  4BJ6 C;  3K33 A;  2IXN A;  1LIH A;  2XLV A;  3EGX A;  1QSP A;  2WB7 A;  4J30 B;  5DVW A;  3ITF A;  4CIH A;  1C17 M;  5BQG A;  2M4E A;  3S84 A;  1V55 C;  4Q4Z F;  1A7D A;  3AG3 C;  3QVY A;  3R2P A;  2OU6 A;  1S7Z A;  2G3V A;  1A7E A;  4GQH A;  3W2W A;  3FDQ A;  1U0B B;  3LLI A;  1Y4C A;  2HV6 A;  3JCU Q;  3K6B A;  3LES A;  3N0T A;  4YL3 A;  3EGD A;  3EHM A;  4MQ9 F;  3RQE A;  4XQ1 A;  2HMQ A;  2MWQ A;  2WL8 A;  1ZU4 A;  3K1I A;  2EPO A;  1Q0G A;  4U9D A;  4YL1 A;  1T5O A;  5KYX B;  3B71 A;  3G4Z A;  4W8K A;  2I8B A;  1FFT C;  2IOQ A;  2J9W A;  5B1A C;  3T6J A;  3PHF 2;  1LI7 A;  1BR2 A;  1W2W A;  1LE4 A;  1YVI A;  5L3Q A;  1HMO A;  2HSB A;  3AGT A;  1MQV A;  3BEH A;  4O79 A;  2HMZ A;  3MBG A;  1LVK A;  1LS1 A;  2R7V A;  4I1M A;  2HJ3 A;  2I15 A;  3SXZ A;  3LNR A;  4LLC A;  3IQ5 A;  1NFN A;  1Q0K A;  2XLW A;  3F47 A;  4MVU A;  4WAB A;  2J9B A;  2YWA A;  5T3T A;  2Y3G A;  5KYW B;  3RQF A;  1TQG A;  4BG0 A;  1ORS C;  1SF8 A;  2XSE A;  2XLE A;  3NMK A;  1I4Z A;  2AVK A;  5KYY B;  3K66 A;  3KMI A;  3LLK A;  3NDB B;  3FHD A;  2R7W A;  5DS4 A;  3WHN A;  3DXJ F;  5A6A A;  3FOO A;  4YJW A;  3LS1 A;  5FZT A;  3DAF A;  2KW3 C;  2J9U A;  4JIO A;  2YLD A;  1G5Z A;  3M1C B;  3QW0 A;  3RFY A;  2VB6 A;  4DBQ A;  1HW1 A;  3EG9 A;  1QLE C;  2G3K A;  3H2V A;  2YL7 A;  2XM4 A;  1U89 A;  3ZVR A;  3GWN A;  4NQF A;  4YWQ A;  4W8P A;  3A11 A;  1L7C A;  2XLM A;  3R7C A;  3S27 A;  1JPN A;  2E87 A;  2KK1 A;  3EZH A;  4N4W A;  4H54 A;  4ONS A;  1SYQ A;  4DRH B;  1L3P A;  4BJ1 A;  3G4X A;  2XS1 A;  2EPN A;  1OKK A;  1YYJ A;  2QNL A;  4N6H A;  4P6I C;  4OIQ F;  1HE9 A;  1C03 A;  2B0J A;  3AG4 C;  1E2X A;  1ZW2 A;  2A0U A;  2NUP B;  2YZS A;  3PDM P;  4WJ0 A;  3IHU A;  3ASN C;  3V5Z A;  3TK0 A;  3TOL A;  4E0H A;  4FES A;  2R7Q A;  3C8G B;  4NCQ A;  2C03 A;  5E3C A;  2EPM X;  3RKO F;  3RQG A;  4OIR F;  3RIP A;  5B3I A;  2CW0 F;  2KQ9 A;  1E84 A;  3VRC A;  4ZLD A;  2QE9 A;  3CZ6 A;  4BJ5 A;  3TUL A;  2LFF A;  2L6G A;  1EKY A;  4JEA A;  4JUR I;  4JEB A;  4C7O B;  2UUI A;  4E18 A;  3RVY A;  2WVO A;  5A6J A;  1RXQ A;  1V54 C;  1ZW3 A;  3NYM A;  4C3E A;  4K7B A;  3Q6N A;  1ST6 A;  3O55 A;  4RBN A;  1B68 A;  4BPM A;  1EA8 A;  2O9X A;  4RD9 A;  2TMV P;  1QQ3 A;  5L0I A;  1GGQ A;  3FAP B;  5A69 A;  2R02 A;  3VF0 A;  3DKA A;  5T3W A;  1JOG A;  1OR3 A;  1WWP A;  3Q7L A;  2Q9C A;  1D0Z A;  4EBJ A;  2A6E F;  5KYU B;  4C3D A;  3BRJ A;  3DM5 A;  2Y3B A;  3JT1 A;  4OD4 A;  3ZIB A;  3SNH A;  2GFH A;  2H7V C;  3TD7 A;  2R9R B;  5L0D A;  4NY3 A;  5FCL A;  4ULW A;  3UR3 C;  1VTM P;  4JTD B;  3EH2 A;  3HNI A;  4U5D E;  1CGO A;  1OCR C;  1CPR A;  3PCV A;  4HFF B;  2ETS A;  3VYW A;  3ABK C;  3I4U A;  2L7A A;  2L81 A;  2PX0 A;  4IWB A;  4NTB A;  3K1H A;  3GEH A;  3TOM A;  2Y3H A;  3NYJ A;  4AL1 A;  4JJF A;  2WZL A;  2EIJ C;  5COG A;  5BQH A;  4G7Z F;  4DRJ B;  5EHH A;  1WOL A;  3EZI A;  1YYX A;  1LS4 A;  2ZXW C;  3RW0 A;  3UGO A;  3L34 A;  3LJB A;  2OJE D;  2P7V A;  3NMI A;  3B0V C;  2XXA A;  4XLN F;  2YVK A;  4BJ6 A;  2R7U A;  4K0D A;  1FMV A;  2VAS A;  3IEE A;  2RD9 A;  3C8G D;  3TJ6 A;  5DS6 A;  2IBF A;  5A6B D;  1RJ9 A;  3KYI A;  3AGU A;  1G8X A;  3QZC A;  3S9O A;  1A7V A;  2HSQ A;  5DQT A;  2Y39 A;  1D1C A;  2ZPA A;  2P0N A;  3U8P A;  1HE1 A;  3AJM A;  4YK5 A;  1M2V A;  2DYR C;  3FXH A;  3NRH A;  1JMW A;  4KNV A;  2NSG A;  4Z9J A;  1K05 A;  2QY9 A;  3LEO A;  5E33 A;  3SP1 A;  2KGO A;  4JRZ A;  3U9J A;  4CBE A;  4BJT A;  3H2U A;  3EFO B;  2IXP A;  3I5Q A;  5DQZ A;  5IY5 C;  3T6G B;  3O39 A;  4I1O B;  4XPY A;  3ECS A;  1YA9 A;  1WGW A;  1MMG A;  3ASO C;  4JCH A;  2HJM A;  3T6B A;  1WTY A;  1ORY A;  4XEV A;  1TWH A;  1PV3 A;  4O6M A;  4FAP B;  2DYS C;  2V26 A;  1T6Q A;  4CX9 A;  1T6I A;  1HMD A;  1MNE A;  5TJ5 E;  3S90 A;  4JCZ A;  2M64 A;  3KL4 A;  1VB5 A;  4M63 A;  3U2L A;  4IB4 A;  1YAU O;  4EIY A;  2MYS A;  4DXW A;  1Q0D A;  2ZXO A;  3FVY A;  2ICW G;  2YLI A;  2RSE B;  4F4B A;  2OQM A;  3M4B A;  3HJC A;  3ZWI A;  4P9F A;  2W9Y A;  4J7Y A;  4QI0 A;  3JYY A;  4YT5 A;  3DJN B;  3L1M A;  2AWY A;  1OQC A;  4CJG A;  4UDV A;  3HLZ A;  5KYX A;  4G7O F;  1LE2 A;  2BC5 A;  2HFI A;  2LIG A;  3DD7 A;  1PD0 A;  4CSA C;  1GS9 A;  4CJO A;  3GM2 A;  4E17 A;  2WVN A;  3TQO A;  1APC A;  4AK9 A;  2PBE A;  3FOP A;  1RKE B;  4CDY A;  4BEJ A;  4MVR A;  1TKN A;  1Z6A A;  2PP4 A;  1H6G A;  3DI5 A;  3RF3 A;  4AE4 A;  3U0C A;  2P1A A;  2WVQ A;  1HY5 A;  1RKC A;  1YZC A;  2YEV A;  3DAG A;  3JSE O;  4Q7C A;  4XPW A;  5CI8 A;  2J7P D;  3GOR A;  4CS9 C;  2ASR A;  3C63 A;  1KNY A;  2VCA A;  3JRT A;  4YT4 A;  5DS5 A;  3UMI A;  1VLT A;  3X2Q C;  5KYW A;  3MX3 A;  2YRF A;  2J9V A;  1SZI A;  3C7J A;  5EK0 A;  4DJ9 A;  2P61 A;  2XRH A;  5KYY A;  1DOW A;  3U5S A;  3POV A;  3IPM O;  3JYH A;  4CDV A;  2XLO A;  4MTO A;  3CAX A;  4U5C E;  2OOC A;  2PNO A;  5E3A A;  1M57 C;  2KC3 A;  1QVX A;  3E9V A;  3EG9 B;  3IQ6 A;  4KI2 A;  5JRA A;  2LP4 A;  3T4R A;  4CS7 A;  4XEK A;  4MTG A;  5A6K A;  1FR0 A;  1ORJ A;  4XLP F;  1GM5 A;  2P6V A;  5CIV A;  2AP3 A;  2R03 A;  2Z15 A;  1AUE A;  4U5B E;  3W2V A;  3UGP A;  3ZQY A;  3LAY A;  1H9G A;  3Q7G A;  4MVZ A;  2XM0 A;  3UMK A;  1Z3I X;  2R7X A;  2KJG A;  1O3U A;  5COM A;  2EIM C;  3OEO A;  1IW7 F;  3EQL F;  3DMD A;  1K04 A;  4LAC B;  2A6H F;  1BR4 A;  2Q4F A;  2L6F A;  3W8I A;  2XL4 A;  4MND A;  3LEV A;  1I4Y A;  4JC7 A;  4KC9 A;  4DOZ A;  1Z63 A;  4FWV A;  4Z9I A;  1PD1 A;  2Q9B A;  5JSL A;  3W4Y A;  2VH3 A;  2W45 A;  2NUP A;  2IXM A;  1S05 A;  4QDL A;  5JVE A;  2UUH A;  3AQC A;  1JR8 A;  3U3B A;  1YAR O;  2YHS A;  2L9J A;  1D0Y A;  1M56 C;  4NC3 A;  3SYN A;  1MND A;  2YQY A;  3CSK A;  3M79 A;  2L6H A;  2NUT B;  3GEE A;  4DRI B;  3C8G A;  2GAQ A;  4Q5S F;  5A6B A;  2A1D D;  1LI5 A;  3QMK A;  3ZSU A;  5BQI A;  5GPG B;  2NG1 A;  3DE9 A;  3HNK A;  4YL0 A;  3US6 A;  4C7O A;  4AL0 A;  2H8A A;  1NSG B;  1ZHW A;  3JSZ A;  3L0I A;  5HV9 A;  2VCC A;  5L0F A;  1FFH A;  4LLE A;  3LS0 A;  2WZG A;  5L0H A;  3X1O A;  4U5G A;  1O5H A;  2R25 A;  2EPK X;  4NTA A;  5B3S C;  1M2O A;  1Q0M A;  1FTS A;  1NU7 D;  1PCX A;  2XS8 A;  4PR9 A;  5JP7 A;  1CPQ A;  3GM3 A;  5L3V A;  2BE5 F;  2DI3 A;  3C8Z A;  1T01 A;  2R7O A;  4MVQ A;  4PJJ A;  1EI7 A;  3V5Y A;  3KH2 A;  2MHR A;  3O6X A;  2PFD A;  5KYU A;  2Q9A A;  3FAJ A;  3KYJ A;  4JTA B;  4L6R A;  1TWC A;  4MTF A;  1WAT A;  1Z23 A;  5F5H A;  2YL1 A;  3WAQ A;  1YLM A;  5F28 E;  1NBB A;  3ZTM A;  1OXK A;  4ULV A;  1DOV A;  2H7B A;  1OKK D;  4IAR A;  3VAY A;  2LK4 A;  3NMJ A;  1GQA A;  2LD6 A;  2Q3T A;  3ZTZ A;  4E7S A;  4EHP A;  4CIP A;  3DZA A;  3VM6 A;  4YN0 B;  3S0X A;  2LSE A;  2X51 A;  1LPE A;  5E2Q A;  3ATP A;  3EH1 A;  4MVO A;  2KYH A;  2R7R A;  1D1A A;  4P9T A;  1RJ9 B;  1ZVZ A;  3QVZ A;  1AEP A;  3JZ0 A;  3S29 A;  1E83 A;  3QW1 A;  4H4K C;  1FAP B;  4J32 B;  3EHN A;  4N06 A;  1D1B A;  2A0B A;  4NTF A;  4CS8 C;  2OKU A;  5BUO A;  4QI2 A;  1ZU5 A;  1WN0 A;  2W4B A;  2XL8 A;  4OD5 A;  5AGF A;  1RMV A;  2CNW D;  3DE8 A;  4I44 A;  2J0W A;  2PF4 E;  1H7I A;  4G0H A;  1EQ1 A;  1O87 A;  1NG1 A;  5EGY A;  4Z9H A;  3LNM B;  3EGX B;  1F1M A;  2PX3 A;  1G4U S;  2FFH A;  4IAQ A;  3KKB A;  1T9K A;  1TWA A;  3GOD A;  2OCC C;  1OCC C;  4CDA A;  1FMW A;  3EFO A;  2C04 A;  4XTK A;  4EBB A;  4D4N A;  4YT2 A;  4R32 A;  3EGD B;  1YDI A;  4EUK B;  4O6N A;  4OIO F;  4CSA A;  1JAF A;  5HSW A;  3U3F A;  3PMR A;  4EWC A;  4YT8 A;  2IXO A;  3MYF A;  2XLH A;  2H7O A;  3RYL A;  4BEM J;  1ZHY A;  2R7S A;  256B A;  3V5X A;  2KNH A;  3ABL C;  1YJG A;  3N24 A;  4O7G A;  4PJL A;  1KTM A;  4XEF A;  1MMA A;  2IYL D;  2W4M A;  2YKZ A;  4CS9 A;  3KPH A;  3MFN A;  1LKX A;  4U9E A;  3LUT B;  1CGN A;  5L0J A;  3I5P A;  2QLA A;  2GA0 A;  3IQT A;  2X0C A;  4X0R A;  4U5H A;  1G4W R;  3M4C A;  3RH3 A;  3B0P A;  2XL6 A;  3GAN A;  3ZC4 A;  4MS2 A;  3JRM O;  2J46 A;  5JT4 A;  2DGJ A; 
#chains in the Genus database with same CATH homology
 4HEA J;  4HFK B;  1MMN A;  1TWG A;  3DJU B;  4AE4 B;  3NKD A;  3K1I C;  4JZA A;  2FGY A;  3W8H A;  4O6Y A;  3UNG C;  4IAO A;  3SZR A;  5DLJ A;  1IZM A;  3Q6M A;  1BR1 A;  5T1D B;  3ZG1 A;  5D91 A;  4LER A;  4I3M A;  3AQB A;  5B1B C;  4JW1 A;  3MLG A;  1ZYR F;  4DVZ A;  4C3B A;  1KU2 A;  4JJG A;  3F46 A;  2ZXR A;  3E70 C;  4DVY P;  4JVS A;  4OIP F;  2ZXP A;  3OWT A;  2Y3D A;  4KNW A;  2JD3 A;  1NZE A;  2WZF A;  1ZHX A;  2HV7 A;  3DM9 B;  4GEH A;  3CQZ A;  2A69 F;  4ZLC A;  3WG7 C;  4RDA A;  2NUT A;  4IJJ A;  4U5F E;  4B6I A;  3EJN A;  4OIN F;  2EIK C;  2EIN C;  2CNW A;  3V7O A;  1MMD A;  2G62 A;  3EPV A;  1SMY F;  1ZHZ A;  3NKE A;  3AG2 C;  4PK4 A;  1D0X A;  4BJ5 C;  1ZHT A;  1VYI A;  5CI9 A;  4AX2 A;  1J8M F;  2EIL C;  5F5F A;  3WOD F;  1OCZ C;  3UMH A;  4FX5 A;  2QTV A;  4PFO A;  3ABM C;  4KBL A;  1VK5 A;  4CS8 A;  1NU9 C;  3K7D A;  2CDQ A;  3HTK C;  2XXA B;  2J45 A;  2R7T A;  5D92 A;  1J8Y F;  3NG1 A;  4GYT A;  4XWJ A;  2Y69 C;  4DBR A;  3S28 A;  2OG2 A;  4A2N B;  1TR2 A;  1JPJ A;  2J7P A;  3NYL A;  1VOM A;  4HE8 D;  1M2V B;  2V3C C;  1Z5Z A;  4ANJ A;  1VYK A;  4PFP A;  5KYN A;  2A68 F;  1N1C A;  4PJN A;  3H65 A;  4E7Z A;  4PJM A;  2J0X A;  1OCO C;  1QZX A;  2D5R B;  3B9Q A;  3B0U X;  2CGE A;  3AG1 C;  4G7H F;  3OA1 A;  1VMA A;  3SEO A;  3N2Z B;  4U5E E;  4IRU A;  4BJ6 C;  3K33 A;  2IXN A;  3EGX A;  5DVW A;  2WB7 A;  4J30 B;  4Q4Z F;  3ITF A;  4CIH A;  2M4E A;  1V55 C;  3AG3 C;  1S7Z A;  2G3V A;  3W2W A;  3FDQ A;  3LLI A;  3K6B A;  2HV6 A;  3JCU Q;  3LES A;  3N0T A;  3EGD A;  3EHM A;  4MQ9 F;  2MWQ A;  2WL8 A;  1ZU4 A;  5KYX B;  4W8K A;  2I8B A;  1FFT C;  2IOQ A;  2J9W A;  5B1A C;  3T6J A;  3PHF 2;  1BR2 A;  1W2W A;  5L3Q A;  4O79 A;  1LVK A;  1LS1 A;  2R7V A;  4I1M A;  3LNR A;  4LLC A;  3F47 A;  5T3T A;  2Y3G A;  5KYW B;  4BG0 A;  1SF8 A;  2XSE A;  5KYY B;  3K66 A;  3KMI A;  3LLK A;  3NDB B;  3FHD A;  2R7W A;  5DS4 A;  3DXJ F;  4YJW A;  3LS1 A;  3DAF A;  2KW3 C;  2J9U A;  3M1C B;  3RFY A;  2VB6 A;  3EG9 A;  1QLE C;  2G3K A;  4YWQ A;  3ZVR A;  3S27 A;  1JPN A;  2E87 A;  3EZH A;  5B3S C;  4BJ1 A;  4P6I C;  1OKK A;  4OIQ F;  2B0J A;  3AG4 C;  2NUP B;  2YZS A;  4WJ0 A;  3ASN C;  4FES A;  2R7Q A;  5E3C A;  2C03 A;  3RKO F;  4OIR F;  3RIP A;  2CW0 F;  2KQ9 A;  4ZLD A;  4BJ5 A;  3CZ6 A;  4JUR I;  4C7O B;  2WVO A;  1V54 C;  3NYM A;  4C3E A;  4K7B A;  3Q6N A;  1ST6 A;  4RBN A;  2O9X A;  4RD9 A;  5T3W A;  3Q7L A;  2Q9C A;  1D0Z A;  2A6E F;  5KYU B;  4C3D A;  3DM5 A;  4OD4 A;  2Y3B A;  3JT1 A;  3ZIB A;  3SNH A;  2GFH A;  2H7V C;  3TD7 A;  4NY3 A;  5FCL A;  4ULW A;  3UR3 C;  3EH2 A;  4U5D E;  1OCR C;  4HFF B;  3VYW A;  3ABK C;  3I4U A;  2PX0 A;  2L81 A;  4IWB A;  3K1H A;  2Y3H A;  3NYJ A;  4JJF A;  2WZL A;  2EIJ C;  4G7Z F;  5EHH A;  3EZI A;  2ZXW C;  3UGO A;  3L34 A;  3LJB A;  2P7V A;  3B0V C;  2XXA A;  4XLN F;  4BJ6 A;  2R7U A;  4K0D A;  1FMV A;  2VAS A;  3IEE A;  5DS6 A;  1RJ9 A;  1G8X A;  3QZC A;  5DQT A;  2Y39 A;  1D1C A;  2ZPA A;  1M2V A;  2DYR C;  3NRH A;  4KNV A;  2QY9 A;  5E33 A;  3SP1 A;  2KGO A;  4CBE A;  4BJT A;  3EFO B;  2IXP A;  3I5Q A;  5DQZ A;  5IY5 C;  3O39 A;  4I1O B;  3ECS A;  3ASO C;  1WGW A;  1MMG A;  4JCH A;  3T6B A;  1TWH A;  4O6M A;  2DYS C;  2V26 A;  1MNE A;  3KL4 A;  4M63 A;  2MYS A;  2ZXO A;  3FVY A;  4F4B A;  3HJC A;  2W9Y A;  4QI0 A;  4YT5 A;  3DJN B;  3HLZ A;  5KYX A;  4G7O F;  3DD7 A;  1PD0 A;  4CSA C;  2WVN A;  4AK9 A;  4DBQ A;  4BEJ A;  1TKN A;  1Z6A A;  2PP4 A;  4AE4 A;  3DAG A;  2WVQ A;  2YEV A;  4Q7C A;  5CI8 A;  2J7P D;  4CS9 C;  3JRT A;  4YT4 A;  5DS5 A;  3UMI A;  3X2Q C;  5KYW A;  3MX3 A;  2J9V A;  1SZI A;  2XRH A;  5KYY A;  3POV A;  3JYH A;  4U5C E;  5E3A A;  1M57 C;  4KI2 A;  3E9V A;  3EG9 B;  3T4R A;  4CS7 A;  4XLP F;  2P6V A;  2Z15 A;  4U5B E;  3W2V A;  3UGP A;  3LAY A;  3UMK A;  3Q7G A;  1Z3I X;  2R7X A;  2KJG A;  2EIM C;  3OEO A;  1IW7 F;  3EQL F;  3DMD A;  4LAC B;  2A6H F;  1BR4 A;  3W8I A;  2XL4 A;  4MND A;  3LEV A;  1Z63 A;  4KC9 A;  4DOZ A;  4FWV A;  1PD1 A;  2Q9B A;  2VH3 A;  2W45 A;  2NUP A;  2IXM A;  4QDL A;  3AQC A;  2YHS A;  2L9J A;  1D0Y A;  1M56 C;  3SYN A;  1MND A;  3CSK A;  2NUT B;  4Q5S F;  2A1D D;  3QMK A;  3ZSU A;  2NG1 A;  4C7O A;  1ZHW A;  3JSZ A;  3L0I A;  1FFH A;  4LLE A;  3LS0 A;  2WZG A;  3X1O A;  4U5G A;  1O5H A;  1M2O A;  1FTS A;  1NU7 D;  1PCX A;  5L3V A;  2BE5 F;  2R7O A;  4PJJ A;  3KH2 A;  3O6X A;  2PFD A;  5KYU A;  2Q9A A;  3FAJ A;  1TWC A;  1Z23 A;  5F5H A;  2H7B A;  1OKK D;  3VAY A;  2Q3T A;  4E7S A;  3DZA A;  4YN0 B;  3S0X A;  2LSE A;  2X51 A;  5E2Q A;  3EH1 A;  2R7R A;  1D1A A;  1RJ9 B;  3S29 A;  4CS8 C;  4H4K C;  4J32 B;  3EHN A;  4N06 A;  1D1B A;  5BUO A;  4QI2 A;  1ZU5 A;  4OD5 A;  2W4B A;  2CNW D;  4I44 A;  2J0W A;  2PF4 E;  4G0H A;  1O87 A;  1NG1 A;  5EGY A;  3EGX B;  2PX3 A;  2FFH A;  3KKB A;  1TWA A;  3GOD A;  2OCC C;  1OCC C;  1FMW A;  3EFO A;  2C04 A;  4XTK A;  4EBB A;  4YT2 A;  3EGD B;  4O6N A;  4OIO F;  4CSA A;  5HSW A;  4EWC A;  3PMR A;  4YT8 A;  2IXO A;  2H7O A;  3RYL A;  1ZHY A;  2R7S A;  2KNH A;  3ABL C;  3N24 A;  4O7G A;  4PJL A;  1MMA A;  2IYL D;  2W4M A;  4CS9 A;  1LKX A;  3I5P A;  3RH3 A;  4X0R A;  4U5H A;  3ZC4 A;  3B0P A;  3GAN A;  2J46 A;  2DGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...