5CI9A

Crystal structure of human tob in complex with inhibitor fragment 6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
116
structure length
116
Chain Sequence
b'HMQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Tob1
publication title Structural basis for inhibition of the Tob-CNOT7 interaction by a fragment screening approach
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/inhibitor
total genus 38
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2015-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07742 BTG BTG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1120 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5ci9A00
5CI9A 5CI8A 3DJUB 3E9VA 2D5RB 2Z15A 3DJNB
chains in the Genus database with same CATH superfamily
1VOMA 5B3SC 3B0VC 1AVOB 3AG3C 3R2PA 3BEHA 5JT4A 3C63A 2KW3C 3QVZA 1E2XA 3GWNA 1U89A 1H6GA 3RIPA 1MNDA 4U5GA 3BRJA 2HZ8A 2Q9CA 4MVSA 3VAYA 1N1CA 1YYJA 4CSAA 2YL0A 4NC3A 1QPUA 1W2WA 3FXHA 2Q3TA 2ZXOA 3RF3A 4CBEA 1YA9A 3S84A 2KNHA 2OKUA 4CS7A 2G3VA 3NKEA 2HS5A 2HKVA 5L3VA 1WTYA 2BE5F 5JS5A 4XLNF 4I1MA 1NU9C 2V26A 5COMA 4EWCA 1SF8A 2P1AA 4OIQF 5COFA 1IZMA 2QTVA 3M15A 4MVOA 2X0CA 1ZZPA 3EFOA 3W2WA 3G50A 1OQCA 3TJ6A 1KTMA 1R5ID 1ORJA 4JE9A 4I1OB 3RYLA 4DXWA 3ECSA 3S9OA 4CS9C 2IXNA 2JD3A 1UFBA 3IQCA 1JMWA 2HFIA 3F46A 1BR4A 4HFFB 4E17A 5D92A 4OIOF 1A0BA 3JSZA 3U3FA 3NMKA 2Y39A 2I15A 5L0GA 1Q0MA 2MYSA 2ZXRA 2Q9AA 1TFKB 4J7TA 1NFOA 1T6UA 3EFOB 3C62A 3CQZA 2J9UA 2IM8A 2NSGA 3DD7A 2W9YA 1ZU4A 2XM0A 4G0HA 1G8XA 3U9MA 2R25A 4W8PA 4PJLA 4ZLCA 3RW0A 1T6IA 3ZWIA 3EH2A 1I4ZA 1PCXA 4XEFA 1O5HA 1B68A 1WN0A 3DXJF 4YL0A 4PFPA 4Z9HA 2XL4A 2YLIA 4YL1A 4FX5A 3I5PA 1GS9A 4XWJA 2YZSA 4NQFA 5CI9A 2PX0A 2QY9A 5CI8A 3QZCA 3W2VA 4N06A 1MMDA 1Z3IX 1QLEC 2R05A 4LLCA 4DRHB 1XWJA 4IGGA 1DOVA 2EPOA 4AL1A 3K1IA 4MVRA 4CIHA 5F28E 2XLMA 2AWYA 2Z15A 1TWGA 2ICWG 3C8ZA 3M4BA 4J32B 4XEKA 1MMAA 2KYHA 3U8VA 2DI3A 3OWTA 5L0DA 2GWWA 2R7WA 4ONSA 3U2LA 4P9FA 2J9WA 2LCHA 3CZ6A 5KYUA 1MMGA 1T9KA 3EHMA 4IAOA 3ATPA 3TOMA 2DGJA 2BC5A 2EINC 4H54A 3NMJA 4FAPB 1NLXA 2QNLA 4O6YA 3V5XA 3ZVRA 1M2VA 3ZQYA 5A6JA 1A7DA 3K1HA 2WVOA 1ZW3A 3GORA 1OCCC 2W45A 2XLVA 4LDKA 1E84A 4YL3A 2J8WA 4YT8A 2R7UA 4XQ1A 4U5DE 3PMRA 5COGA 5DQTA 4GQHA 1HE9A 2CCYA 4IRUA 4JTDB 1OCZC 5KYUB 1Q0KA 2EPKX 4YT2A 3EHNA 1AUEA 1FTSA 1TR2A 3SNHA 1MQVA 2LP4A 3AGUA 2Y3GA 2PFDA 3DM9B 2KGOA 1ZHWA 1Z23A 3ZG1A 2XL6A 4CJOA 4MTGA 3AG1C 2WZLA 3LUTB 3C8GB 4MVZA 5T3WA 5DS6A 4AL0A 5A6AA 4MTFA 4N6CA 1YZAA 2G62A 1S05A 1GQAA 4J7YA 2YEVA 4Q5SF 2XXAA 5L0FA 2ASRA 3S28A 3HLZA 2AVKA 4O79A 5DS4A 4JCHA 4EBKA 3WODF 4C3BA 2L81A 1LIHA 4LLEA 4CX9A 1AEPA 4U9EA 1Z6AA 5F5HA 1YLMA 2A6HF 3UR3C 4E0IA 5A6KA 3POVA 5DS5A 5A6BA 5JRAA 4U5FE 1Z5ZA 4PR9A 3DZAA 1LVKA 4KNVA 2XXAB 2HJMA 2ZD9A 3NYLA 3UMHA 1D1BA 1M2OA 1V54C 2OCCC 4XLPF 2PBEA 1I4YA 4IARA 3T6BA 4LDRA 3QTHA 2DYSC 3RFYA 2J0WA 4CS9A 2L7AA 3PCVA 2R02A 1VLTA 1U0BB 1LKXA 1ZVZA 5E3CA 4PJJA 2LSEA 3I5QA 3DKAA 3VM6A 3KL4A 3H2UA 1ZU5A 4A4AA 4D4NA 3EH1A 4MVUA 5B1BC 5HSWA 1O3UA 2VC9A 1OKKA 1QZXA 2ETSA 3C18A 1JPNA 3DAFA 3IQ6A 3MYFA 3T6JA 3AGTA 2XS1A 4GEHA 3L0IA 2OEVA 2VCAA 1J8MF 2P61A 4EIYA 1LE2A 4DBQA 1YYXA 2R7VA 4L6RA 4E7ZA 1FFTC 1MNEA 3ASOC 4G78A 3RKOF 2QE9A 2W4MA 2FAPB 4E18A 3QW0A 5BQIA 3FOOA 4G7OF 1JOGA 2CNWA 3KKBA 5L0CA 1G4US 2DB4A 3EQLF 5JUAA 2XS8A 5JP7A 2EPMX 3EG9A 4BJ1A 2X51A 5KYYA 2AU5A 2DYRC 2IXPA 2LFDA 1E86A 1T6QA 2WZGA 2HV6A 1VMAA 4JCZA 4CIPA 1RMVA 2UUIA 3GM1A 3Q7GA 2OOCA 2P0NA 1HW1A 1TQGA 3FVYA 3IHUA 3JZ0A 1FMVA 2YQYA 2GAQA 2PX3A 4AK9A 3O55A 1H9GA 1RCPA 2KQ9A 3AQBA 4KC9A 4E7SA 4G7HF 2A68F 3EG9B 4OD4A 4Z9IA 4C3DA 2I8BA 1WGWA 2Y3BA 4PACA 1F1MA 4JTAB 5DLJA 5KYYB 3OEOA 3M4CA 3NYMA 4CDYA 3NMIA 3GM2A 5BUOA 3LLIA 3U3BA 1VK5A 1FAPB 3O6XA 3SXKA 2XLOA 5EK0A 4EHPA 4J30B 2XRHA 2GA0A 2LK4A 1QKRA 4BEMJ 1BZ4A 4MNDA 1XZPA 4LDQA 4O6NA 3EPVA 3K66A 4JKVA 5FCLA 4CJGA 3JYYA 4MW3A 4JIOA 3L8JA 1FNTc 1OXKA 1RKCA 3GODA 1HW2A 2Q7RA 1YZCA 1E85A 2IOQA 1DOWA 1NBBA 5E33A 3MYIA 1EQ1A 1OW7A 1BR2A 2ZXPA 3CEXA 4FWVA 3GM3A 3UMKA 4OIRF 1D0ZA 2R03A 1PD0A 2H7VC 2FFHA 2J7PA 3M79A 2GDCA 4W8KA 1CGME 3L34A 2YRFA 2EIKC 2JX0A 3G4XA 3DM5A 3TQOA 4BPMA 1CGNA 256BA 2HV7A 3FDQA 2VH3A 3C8GD 4ANJA 4I44A 1UG7A 1TFOB 5L0IA 1WASA 1RJ9A 1SMYF 2AWCA 3I4UA 1WOLA 1TWCA 4YK5A 3KYIA 3NYJA 3AJMA 3SZRA 2AP3A 3CAXA 3IQTA 4Z9JA 2L6HA 2OJED 2FGYA 1NU7D 1Q0FA 3MLGA 4N6HA 4DRJB 2O9XA 1H9TA 3FAJA 3PDMP 1YDIA 1A7VA 2H8AA 3DE9A 4P6IC 4JW1A 2Q4FA 2HMZA 3LS0A 3EGDA 3IQ5A 3WAQA 2PNOA 1RJ9B 2NSFA 3DWWA 2NUTA 4BJ5C 1D1AA 3B0PA 4YT4A 3IPMO 3NG1A 1LS4A 3RQEA 1FR0A 3DE8A 3QW1A 1ZW2A 4JJFA 1K04A 1JPJA 1KNYA 4CS8C 1C02A 3FHDA 4ULWA 1M2VB 3T9OA 4DJ9A 4ZLDA 5JSLA 3CSKA 3K7DA 3IEEA 4GYTA 1BBHA 5GPGB 3SXYA 4JRZA 1HMDA 1VYKA 1ZHZA 2NUTB 3WHNA 4PJNA 1JR8A 2XSEA 4MW8A 2OQMA 3J06A 3X1OA 1V55C 2CDQA 4JEBA 1HMOA 1A7EA 2J9VA 4IWBA 4U5BE 2NUPA 4X0RA 3R7CA 3AG2C 3U8PA 3H2VA 3ABMC 3Q6NA 1LI5A 1L3PA 3E9VA 2OEXA 2IBFA 3RQGA 4BEJA 1JRAA 3MX3A 1OKKD 2F22A 1GM5A 1Q0GA 2PF4E 3DJUB 3EZHA 3L1MA 3U0CA 1FFHA 3A9CA 4PK4A 2D5RB 4MQ9F 2A69F 3VRCA 4LERA 4CDAA 2NUPB 3W8HA 1JAFA 2M4EA 3O39A 4BJ6C 3DMDA 3T6GB 2EIMC 1K40A 2RD9A 3HNJA 1SR2A 4DVYP 4ER9A 3V5ZA 2WB7A 1QVXA 3GWLA 1FMWA 2IYLD 3AQCA 3LNMB 2Y3DA 3MFNA 4XTKA 3W8IA 2R7SA 2VASA 3GEEA 4JTCB 1SZIA 1APCA 5T3TA 4C7OA 5T1DB 3LJBA 3Q7LA 4E0HA 3JSEO 1EI7A 4RD9A 3N24A 1M56C 3T4RA 4QDLA 3VF0A 4JJGA 1XZQA 1OW6A 2R7OA 3ABKC 1L7CA 1VYIA 3JCUQ 1EA8A 1Y4CA 4WGZA 2NG1A 4U9DA 3ZSUA 2A6EF 2H7OA 1ORYA 2LFFA 2R7RA 5JLIA 4EUKB 4C7OB 4M63A 1D0YA 3GEHA 4JVSA 3FMSA 3S0XA 1K05A 3GANA 2YLGA 1D0XA 1GGQA 3MBGA 1PD1A 3KYJA 3TK0A 1YJGA 3ASNC 5L0HA 3L8IA 3JT1A 2MHRA 4K0DA 2G3KA 1ZHYA 2IXMA 2PP4A 2Y3HA 4JC7A 4BG0A 4KI2A 5KYWA 3RQFA 1OCOC 4K7BA 2Q00A 4IAQA 4P9TA 4QI0A 2CW0F 4AX2A 3ITFA 4JZAA 3W4YA 2Q9BA 3KH2A 3N0TA 3WG7C 1D1CA 3K6BA 1OW8A 1PV3A 4G7ZF 4JURI 2NPUA 4DRIB 3AG4C 2MWQA 4Q7CA 4PFOA 4OIPF 5E3AA 3V7OA 5KYWB 4C3EA 2J7PD 2WVQA 1HE1A 3U2MA 1G4WR 4BJ5A 2EPNA 5EGYA 2C03A 1T01A 4DVZA 2OU6A 1O87A 3TULA 5HV9A 3QMKA 1V74B 2CGEA 2C04A 2XM4A 2XLEA 1YA7O 4BJTA 3GEIA 4F4BA 1BR1A 4CS8A 1I5NA 5AGFA 3LS1A 3O10A 1TWHA 3HTKC 3V5YA 2RSEB 2W4BA 2EILC 1C17M 3HNIA 4OD5A 5BQGA 3B0UX 2XL8A 4U5CE 3X2QC 2XLDA 1OR2A 5KYXA 4MTOA 4A2NB 2B0HA 3SYNA 5B1AC 1ST6A 2YL1A 3RVYA 4MVMA 1LS1A 1QQ3A 3LAYA 1U6HA 1RKEA 2IXOA 4IJJA 2WL8A 4NY3A 3SEOA 3NKDA 4EKWA 1Z63A 1KU2A 1TKNA 2LIGA 3TOLA 4DBRA 1LE4A 3DI5A 1T5OA 3B71A 2YL3A 1Y6DA 4ULVA 5KYXB 1LM3B 2KJGA 3S27A 3ZC4A 2LQGA 2R9RB 4XPXA 3NDBB 1VLSA 4FESA 4EBBA 2HJ3A 2YKZA 3JRTA 4WGYA 2VCCA 4BJ6A 5AC5A 2EPLX 1RKEB 2KSFA 3RVZA 4CSAC 1NG1A 1R4TA 4WJ0A 3AOUA 3EZIA 4IB4A 2R7XA 4NCQA 1VTMP 3EGXA 3ABLC 2HMQA 1C03A 4N4WA 3LNRA 1LI7A 1YARO 2JPUA 1V4AA 3ZIBA 1TWAA 2HSQA 1YAUO 3HNLA 5F5FA 2E87A 2WVNA 3Q6MA 5FZTA 1S7ZA 3SP1A 3KMIA 4YWQA 3H65A 3RH3A 4Q4ZF 2YL7A 1H7IA 2ZXWC 2EIJC 3DAGA 4PJMA 1G5ZA 1ZHTA 2YLDA 3EGDB 3NRHA 1VB5A 4LACB 5A6BD 2J45A 1A41A 4MS2A 2J0XA 5KYNA 3EGXB 3S29A 3ZDLA 3SXZA 1NFNA 2H7BA 3JRMO 4NTFA 2QUPA 2XLWA 3C8GA 4K1OA 3B29A 3ZTMA 4YJWA 4CDVA 2OG2A 2R7TA 2GFHA 5JVEA 3LEVA 3QVYA 2Y69C 1CGOA 3DJNB 4XPYA 1ZHXA 3ZTZA 3E70C 4I3MA 2P6VA 2WZFA 2M64A 3US6A 4DOZA 2YHSA 3JYHA 5DQZA 3PHF2 2KK1A 2P7VA 2VB6A 4NTAA 1NZEA 5B3IA 2TMVP 2J46A 4YT5A 4HE8D 3HJCA 2L6FA 2HUJA 3C7JA 3KPHA 4U5EE 2QLAA 2VCBA 2R7QA 3N2ZB 1OXBA 4O7GA 5CIVA 3UMIA 3OA1A 4O6MA 4NTBA 5IY5C 1M6TA 5L0JA 5AC4A 5D91A 5BQHA 3UGPA 2B0JA 3JTLO 3TD7A 1CPRA 2A1DD 5L3QA 4KNWA 3U5SA 1Z7Qc 1ZYRF 4HFKB 4U5HA 3TJ5A 3VYWA 2BL2A 2CNWD 3ZQVA 2UUHA 3LEOA 2V3CC 4QI2A 3K1IC 3UGOA 4XPWA 4H4KC 5DVWA 2A0BA 3A11A 3EJNA 2OJQA 1J8YF 1MMNA 1HY5A 2J9BA 2YWAA 2YVKA 3K33A 1ORSC 4R32A 4XEVA 2A0UA 4HEAJ 4YN0B 3U9JA 2D4UA 3UNGC 4UDVA 4RBNA 3G4ZA 1EKYA 1CPQA 2HSBA 3HKKA 3LLKA 3FOPA 3FAPB 4JEAA 4B6IA 2L6GA 1BDJB 2L9JA 5E2QA 5A69A 3S90A 1E83A 4WABA 2XLHA 4EBJA 4AE4A 2ZPAA 4MVQA 1WATA 3B9QA 2KC3A 1IW7F 4KBLA 2CYDA 4RDAA 1OR3A 1M57C 4OINF 1OCRC 5EHHA 3F47A 3LESA 4D4XA 1RXQA 1WWPA 1LPEA 1YVIA 3SXMA 1Q0DA 1QSPA 2LD6A 3M1CB 1NSGB 5K0IA 1SYQA 3HNKA 4AE4B 5TJ5E
chains in the Genus database with same CATH topology
1VOMA 5B3SC 3B0VC 3AG3C 2KW3C 3RIPA 1MNDA 4U5GA 2Q9CA 3VAYA 1N1CA 4CSAA 1W2WA 4CBEA 2Q3TA 2ZXOA 2KNHA 4CS7A 2G3VA 3NKEA 5L3VA 2BE5F 4XLNF 4I1MA 1NU9C 2V26A 4EWCA 1SF8A 4OIQF 1IZMA 2QTVA 3EFOA 3W2WA 4I1OB 3RYLA 3ECSA 4CS9C 2IXNA 2JD3A 4HFFB 3F46A 1BR4A 5D92A 3JSZA 2Y39A 2MYSA 2ZXRA 2Q9AA 3EFOB 3CQZA 2J9UA 3DD7A 2W9YA 1ZU4A 4G0HA 1G8XA 4PJLA 4ZLCA 3EH2A 1PCXA 1O5HA 3DXJF 4PFPA 2XL4A 4FX5A 3I5PA 4XWJA 2YZSA 5CI9A 2PX0A 2QY9A 5CI8A 3QZCA 3W2VA 4N06A 1MMDA 1Z3IX 1QLEC 4LLCA 4CIHA 2Z15A 1TWGA 4J32B 1MMAA 3OWTA 2R7WA 2J9WA 3CZ6A 5KYUA 1MMGA 3EHMA 4IAOA 2DGJA 2EINC 4O6YA 3ZVRA 1M2VA 3K1HA 2WVOA 1OCCC 2W45A 4YT8A 2R7UA 4U5DE 3PMRA 5DQTA 4IRUA 1OCZC 5KYUB 4YT2A 3EHNA 1TR2A 1FTSA 3SNHA 3PHF2 3DM9B 4OIOF 2Y3GA 2PFDA 2KGOA 1ZHWA 1Z23A 3ZG1A 5T3WA 3AG1C 2WZLA 5DS6A 2G62A 4Q5SF 2YEVA 2XXAA 3S28A 3HLZA 4O79A 5DS4A 4JCHA 3WODF 4C3BA 2L81A 4LLEA 1Z6AA 5F5HA 3POVA 2A6HF 3UR3C 5DS5A 4U5FE 1Z5ZA 3DZAA 1LVKA 4KNVA 2XXAB 3UMHA 3NYLA 1D1BA 1M2OA 1V54C 2OCCC 4XLPF 3T6BA 2DYSC 3RFYA 2J0WA 4CS9A 1LKXA 5E3CA 4PJJA 2LSEA 3I5QA 3KL4A 1ZU5A 3EH1A 5B1BC 5HSWA 1OKKA 1QZXA 1JPNA 3DAFA 3T6JA 4GEHA 3L0IA 4DBQA 1J8MF 2R7VA 4E7ZA 1FFTC 1MNEA 3ASOC 3RKOF 2W4MA 4G7OF 2CNWA 3KKBA 3EQLF 3EG9A 4BJ1A 2X51A 5KYYA 2DYRC 2IXPA 2WZGA 2HV6A 1VMAA 3Q7GA 3FVYA 1FMVA 4AK9A 2PX3A 2KQ9A 3AQBA 4KC9A 4E7SA 4G7HF 2A68F 3EG9B 4OD4A 4C3DA 2I8BA 1WGWA 2Y3BA 5KYYB 5DLJA 3OEOA 3NYMA 5BUOA 3LLIA 1VK5A 3O6XA 4J30B 2XRHA 4MNDA 4O6NA 3EPVA 3K66A 5FCLA 3GODA 2IOQA 5E33A 1BR2A 2ZXPA 4FWVA 3UMKA 4OIRF 1D0ZA 1PD0A 2H7VC 2FFHA 2J7PA 4W8KA 3L34A 2EIKC 3DM5A 2HV7A 3FDQA 2VH3A 4ANJA 4I44A 1RJ9A 1SMYF 3I4UA 1TWCA 3NYJA 3SZRA 3MLGA 2FGYA 1NU7D 2O9XA 3FAJA 4P6IC 4JW1A 3LS0A 3EGDA 1RJ9B 2NUTA 4BJ5C 1D1AA 3B0PA 4YT4A 3NG1A 4JJFA 1JPJA 4CS8C 4ULWA 3FHDA 4ZLDA 1M2VB 3CSKA 3K7DA 3IEEA 4GYTA 1VYKA 1ZHZA 2NUTB 4PJNA 2XSEA 3X1OA 1V55C 2CDQA 4IWBA 2J9VA 4U5BE 2NUPA 4X0RA 3AG2C 3ABMC 3Q6NA 3E9VA 4BEJA 3MX3A 1OKKD 2PF4E 3DJUB 3EZHA 1FFHA 4PK4A 2D5RB 4MQ9F 2A69F 4LERA 2NUPB 3W8HA 2M4EA 3O39A 4BJ6C 3DMDA 2EIMC 4DVYP 2WB7A 1FMWA 2IYLD 3AQCA 4XTKA 2Y3DA 3W8IA 2R7SA 2VASA 4C7OA 1SZIA 5T3TA 5T1DB 3LJBA 3Q7LA 4RD9A 3N24A 1M56C 3T4RA 4QDLA 4JJGA 2R7OA 3ABKC 1VYIA 3JCUQ 2NG1A 3ZSUA 2A6EF 2H7OA 2R7RA 4C7OB 4M63A 1D0YA 4JVSA 3S0XA 3GANA 1D0XA 1PD1A 3ASNC 4K0DA 3JT1A 2G3KA 1ZHYA 2IXMA 2PP4A 2Y3HA 4BG0A 4KI2A 5KYWA 1OCOC 4K7BA 4QI0A 2CW0F 4AX2A 3ITFA 4JZAA 2Q9BA 3KH2A 3N0TA 3WG7C 1D1CA 3K6BA 4G7ZF 4JURI 3AG4C 2MWQA 4Q7CA 4PFOA 4OIPF 5E3AA 3V7OA 5KYWB 4C3EA 2J7PD 2WVQA 4BJ5A 5EGYA 2C03A 4DVZA 1O87A 3QMKA 2CGEA 2C04A 4BJTA 4F4BA 1BR1A 4CS8A 3LS1A 1TWHA 3HTKC 2W4BA 2EILC 4OD5A 3B0UX 4U5CE 3X2QC 5KYXA 4A2NB 3SYNA 5B1AC 1ST6A 1LS1A 4IJJA 3LAYA 2IXOA 4NY3A 2WL8A 3SEOA 3NKDA 1Z63A 1KU2A 1TKNA 4DBRA 5KYXB 2KJGA 3ZC4A 3S27A 3NDBB 4FESA 4EBBA 3JRTA 4BJ6A 4CSAC 1NG1A 4WJ0A 3EZIA 2R7XA 3EGXA 3ABLC 3LNRA 3ZIBA 1TWAA 5F5FA 2E87A 2WVNA 3Q6MA 1S7ZA 3SP1A 3KMIA 4YWQA 3H65A 3RH3A 4Q4ZF 2ZXWC 2EIJC 3DAGA 4PJMA 1ZHTA 3NRHA 3EGDB 4LACB 2J45A 2J0XA 5KYNA 3EGXB 3S29A 2H7BA 4YJWA 2OG2A 2R7TA 2GFHA 3LEVA 2Y69C 3DJNB 1ZHXA 3E70C 4I3MA 2P6VA 2WZFA 4DOZA 2YHSA 3JYHA 5DQZA 2P7VA 2VB6A 1NZEA 2J46A 4YT5A 4HE8D 3HJCA 4U5EE 4O7GA 2R7QA 3N2ZB 3UMIA 3OA1A 4O6MA 5IY5C 5D91A 3UGPA 2B0JA 3TD7A 2A1DD 5L3QA 4KNWA 3VYWA 1ZYRF 4HFKB 4U5HA 4QI2A 2CNWD 2V3CC 3K1IC 3UGOA 5DVWA 4H4KC 3EJNA 1MMNA 1J8YF 3K33A 4YN0B 4HEAJ 3UNGC 4RBNA 3LLKA 4B6IA 2L9JA 5E2QA 4AE4A 2ZPAA 3B9QA 4KBLA 1IW7F 4RDAA 1M57C 4OINF 1OCRC 5EHHA 3F47A 3LESA 3M1CB 4AE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CI9 A;  5CI8 A;  3DJU B;  3E9V A;  2D5R B;  2Z15 A;  3DJN B; 
#chains in the Genus database with same CATH topology
 1VOM A;  5B3S C;  3B0V C;  1AVO B;  3AG3 C;  3R2P A;  3BEH A;  5JT4 A;  3C63 A;  2KW3 C;  3QVZ A;  1E2X A;  3GWN A;  1U89 A;  1H6G A;  3RIP A;  1MND A;  4U5G A;  3BRJ A;  2HZ8 A;  2Q9C A;  4MVS A;  3VAY A;  1N1C A;  1YYJ A;  4CSA A;  2YL0 A;  4NC3 A;  1QPU A;  1W2W A;  3FXH A;  2Q3T A;  2ZXO A;  3RF3 A;  4CBE A;  1YA9 A;  3S84 A;  2KNH A;  2OKU A;  4CS7 A;  2G3V A;  3NKE A;  2HS5 A;  2HKV A;  5L3V A;  1WTY A;  2BE5 F;  5JS5 A;  4XLN F;  4I1M A;  1NU9 C;  2V26 A;  5COM A;  4EWC A;  1SF8 A;  2P1A A;  4OIQ F;  5COF A;  1IZM A;  2QTV A;  3M15 A;  4MVO A;  2X0C A;  1ZZP A;  3EFO A;  3W2W A;  3G50 A;  1OQC A;  3TJ6 A;  1KTM A;  1R5I D;  1ORJ A;  4JE9 A;  4I1O B;  3RYL A;  4DXW A;  3ECS A;  3S9O A;  4CS9 C;  2IXN A;  2JD3 A;  1UFB A;  3IQC A;  1JMW A;  2HFI A;  3F46 A;  1BR4 A;  4HFF B;  4E17 A;  5D92 A;  4OIO F;  1A0B A;  3JSZ A;  3U3F A;  3NMK A;  2Y39 A;  2I15 A;  5L0G A;  1Q0M A;  2MYS A;  2ZXR A;  2Q9A A;  1TFK B;  4J7T A;  1NFO A;  1T6U A;  3EFO B;  3C62 A;  3CQZ A;  2J9U A;  2IM8 A;  2NSG A;  3DD7 A;  2W9Y A;  1ZU4 A;  2XM0 A;  4G0H A;  1G8X A;  3U9M A;  2R25 A;  4W8P A;  4PJL A;  4ZLC A;  3RW0 A;  1T6I A;  3ZWI A;  3EH2 A;  1I4Z A;  1PCX A;  4XEF A;  1O5H A;  1B68 A;  1WN0 A;  3DXJ F;  4YL0 A;  4PFP A;  4Z9H A;  2XL4 A;  2YLI A;  4YL1 A;  4FX5 A;  3I5P A;  1GS9 A;  4XWJ A;  2YZS A;  4NQF A;  5CI9 A;  2PX0 A;  2QY9 A;  5CI8 A;  3QZC A;  3W2V A;  4N06 A;  1MMD A;  1Z3I X;  1QLE C;  2R05 A;  4LLC A;  4DRH B;  1XWJ A;  4IGG A;  1DOV A;  2EPO A;  4AL1 A;  3K1I A;  4MVR A;  4CIH A;  5F28 E;  2XLM A;  2AWY A;  2Z15 A;  1TWG A;  2ICW G;  3C8Z A;  3M4B A;  4J32 B;  4XEK A;  1MMA A;  2KYH A;  3U8V A;  2DI3 A;  3OWT A;  5L0D A;  2GWW A;  2R7W A;  4ONS A;  3U2L A;  4P9F A;  2J9W A;  2LCH A;  3CZ6 A;  5KYU A;  1MMG A;  1T9K A;  3EHM A;  4IAO A;  3ATP A;  3TOM A;  2DGJ A;  2BC5 A;  2EIN C;  4H54 A;  3NMJ A;  4FAP B;  1NLX A;  2QNL A;  4O6Y A;  3V5X A;  3ZVR A;  1M2V A;  3ZQY A;  5A6J A;  1A7D A;  3K1H A;  2WVO A;  1ZW3 A;  3GOR A;  1OCC C;  2W45 A;  2XLV A;  4LDK A;  1E84 A;  4YL3 A;  2J8W A;  4YT8 A;  2R7U A;  4XQ1 A;  4U5D E;  3PMR A;  5COG A;  5DQT A;  4GQH A;  1HE9 A;  2CCY A;  4IRU A;  4JTD B;  1OCZ C;  5KYU B;  1Q0K A;  2EPK X;  4YT2 A;  3EHN A;  1AUE A;  1FTS A;  1TR2 A;  3SNH A;  1MQV A;  2LP4 A;  3AGU A;  2Y3G A;  2PFD A;  3DM9 B;  2KGO A;  1ZHW A;  1Z23 A;  3ZG1 A;  2XL6 A;  4CJO A;  4MTG A;  3AG1 C;  2WZL A;  3LUT B;  3C8G B;  4MVZ A;  5T3W A;  5DS6 A;  4AL0 A;  5A6A A;  4MTF A;  4N6C A;  1YZA A;  2G62 A;  1S05 A;  1GQA A;  4J7Y A;  2YEV A;  4Q5S F;  2XXA A;  5L0F A;  2ASR A;  3S28 A;  3HLZ A;  2AVK A;  4O79 A;  5DS4 A;  4JCH A;  4EBK A;  3WOD F;  4C3B A;  2L81 A;  1LIH A;  4LLE A;  4CX9 A;  1AEP A;  4U9E A;  1Z6A A;  5F5H A;  1YLM A;  2A6H F;  3UR3 C;  4E0I A;  5A6K A;  3POV A;  5DS5 A;  5A6B A;  5JRA A;  4U5F E;  1Z5Z A;  4PR9 A;  3DZA A;  1LVK A;  4KNV A;  2XXA B;  2HJM A;  2ZD9 A;  3NYL A;  3UMH A;  1D1B A;  1M2O A;  1V54 C;  2OCC C;  4XLP F;  2PBE A;  1I4Y A;  4IAR A;  3T6B A;  4LDR A;  3QTH A;  2DYS C;  3RFY A;  2J0W A;  4CS9 A;  2L7A A;  3PCV A;  2R02 A;  1VLT A;  1U0B B;  1LKX A;  1ZVZ A;  5E3C A;  4PJJ A;  2LSE A;  3I5Q A;  3DKA A;  3VM6 A;  3KL4 A;  3H2U A;  1ZU5 A;  4A4A A;  4D4N A;  3EH1 A;  4MVU A;  5B1B C;  5HSW A;  1O3U A;  2VC9 A;  1OKK A;  1QZX A;  2ETS A;  3C18 A;  1JPN A;  3DAF A;  3IQ6 A;  3MYF A;  3T6J A;  3AGT A;  2XS1 A;  4GEH A;  3L0I A;  2OEV A;  2VCA A;  1J8M F;  2P61 A;  4EIY A;  1LE2 A;  4DBQ A;  1YYX A;  2R7V A;  4L6R A;  4E7Z A;  1FFT C;  1MNE A;  3ASO C;  4G78 A;  3RKO F;  2QE9 A;  2W4M A;  2FAP B;  4E18 A;  3QW0 A;  5BQI A;  3FOO A;  4G7O F;  1JOG A;  2CNW A;  3KKB A;  5L0C A;  1G4U S;  2DB4 A;  3EQL F;  5JUA A;  2XS8 A;  5JP7 A;  2EPM X;  3EG9 A;  4BJ1 A;  2X51 A;  5KYY A;  2AU5 A;  2DYR C;  2IXP A;  2LFD A;  1E86 A;  1T6Q A;  2WZG A;  2HV6 A;  1VMA A;  4JCZ A;  4CIP A;  1RMV A;  2UUI A;  3GM1 A;  3Q7G A;  2OOC A;  2P0N A;  1HW1 A;  1TQG A;  3FVY A;  3IHU A;  3JZ0 A;  1FMV A;  2YQY A;  2GAQ A;  2PX3 A;  4AK9 A;  3O55 A;  1H9G A;  1RCP A;  2KQ9 A;  3AQB A;  4KC9 A;  4E7S A;  4G7H F;  2A68 F;  3EG9 B;  4OD4 A;  4Z9I A;  4C3D A;  2I8B A;  1WGW A;  2Y3B A;  4PAC A;  1F1M A;  4JTA B;  5DLJ A;  5KYY B;  3OEO A;  3M4C A;  3NYM A;  4CDY A;  3NMI A;  3GM2 A;  5BUO A;  3LLI A;  3U3B A;  1VK5 A;  1FAP B;  3O6X A;  3SXK A;  2XLO A;  5EK0 A;  4EHP A;  4J30 B;  2XRH A;  2GA0 A;  2LK4 A;  1QKR A;  4BEM J;  1BZ4 A;  4MND A;  1XZP A;  4LDQ A;  4O6N A;  3EPV A;  3K66 A;  4JKV A;  5FCL A;  4CJG A;  3JYY A;  4MW3 A;  4JIO A;  3L8J A;  1FNT c;  1OXK A;  1RKC A;  3GOD A;  1HW2 A;  2Q7R A;  1YZC A;  1E85 A;  2IOQ A;  1DOW A;  1NBB A;  5E33 A;  3MYI A;  1EQ1 A;  1OW7 A;  1BR2 A;  2ZXP A;  3CEX A;  4FWV A;  3GM3 A;  3UMK A;  4OIR F;  1D0Z A;  2R03 A;  1PD0 A;  2H7V C;  2FFH A;  2J7P A;  3M79 A;  2GDC A;  4W8K A;  1CGM E;  3L34 A;  2YRF A;  2EIK C;  2JX0 A;  3G4X A;  3DM5 A;  3TQO A;  4BPM A;  1CGN A;  256B A;  2HV7 A;  3FDQ A;  2VH3 A;  3C8G D;  4ANJ A;  4I44 A;  1UG7 A;  1TFO B;  5L0I A;  1WAS A;  1RJ9 A;  1SMY F;  2AWC A;  3I4U A;  1WOL A;  1TWC A;  4YK5 A;  3KYI A;  3NYJ A;  3AJM A;  3SZR A;  2AP3 A;  3CAX A;  3IQT A;  4Z9J A;  2L6H A;  2OJE D;  2FGY A;  1NU7 D;  1Q0F A;  3MLG A;  4N6H A;  4DRJ B;  2O9X A;  1H9T A;  3FAJ A;  3PDM P;  1YDI A;  1A7V A;  2H8A A;  3DE9 A;  4P6I C;  4JW1 A;  2Q4F A;  2HMZ A;  3LS0 A;  3EGD A;  3IQ5 A;  3WAQ A;  2PNO A;  1RJ9 B;  2NSF A;  3DWW A;  2NUT A;  4BJ5 C;  1D1A A;  3B0P A;  4YT4 A;  3IPM O;  3NG1 A;  1LS4 A;  3RQE A;  1FR0 A;  3DE8 A;  3QW1 A;  1ZW2 A;  4JJF A;  1K04 A;  1JPJ A;  1KNY A;  4CS8 C;  1C02 A;  3FHD A;  4ULW A;  1M2V B;  3T9O A;  4DJ9 A;  4ZLD A;  5JSL A;  3CSK A;  3K7D A;  3IEE A;  4GYT A;  1BBH A;  5GPG B;  3SXY A;  4JRZ A;  1HMD A;  1VYK A;  1ZHZ A;  2NUT B;  3WHN A;  4PJN A;  1JR8 A;  2XSE A;  4MW8 A;  2OQM A;  3J06 A;  3X1O A;  1V55 C;  2CDQ A;  4JEB A;  1HMO A;  1A7E A;  2J9V A;  4IWB A;  4U5B E;  2NUP A;  4X0R A;  3R7C A;  3AG2 C;  3U8P A;  3H2V A;  3ABM C;  3Q6N A;  1LI5 A;  1L3P A;  3E9V A;  2OEX A;  2IBF A;  3RQG A;  4BEJ A;  1JRA A;  3MX3 A;  1OKK D;  2F22 A;  1GM5 A;  1Q0G A;  2PF4 E;  3DJU B;  3EZH A;  3L1M A;  3U0C A;  1FFH A;  3A9C A;  4PK4 A;  2D5R B;  4MQ9 F;  2A69 F;  3VRC A;  4LER A;  4CDA A;  2NUP B;  3W8H A;  1JAF A;  2M4E A;  3O39 A;  4BJ6 C;  3DMD A;  3T6G B;  2EIM C;  1K40 A;  2RD9 A;  3HNJ A;  1SR2 A;  4DVY P;  4ER9 A;  3V5Z A;  2WB7 A;  1QVX A;  3GWL A;  1FMW A;  2IYL D;  3AQC A;  3LNM B;  2Y3D A;  3MFN A;  4XTK A;  3W8I A;  2R7S A;  2VAS A;  3GEE A;  4JTC B;  1SZI A;  1APC A;  5T3T A;  4C7O A;  5T1D B;  3LJB A;  3Q7L A;  4E0H A;  3JSE O;  1EI7 A;  4RD9 A;  3N24 A;  1M56 C;  3T4R A;  4QDL A;  3VF0 A;  4JJG A;  1XZQ A;  1OW6 A;  2R7O A;  3ABK C;  1L7C A;  1VYI A;  3JCU Q;  1EA8 A;  1Y4C A;  4WGZ A;  2NG1 A;  4U9D A;  3ZSU A;  2A6E F;  2H7O A;  1ORY A;  2LFF A;  2R7R A;  5JLI A;  4EUK B;  4C7O B;  4M63 A;  1D0Y A;  3GEH A;  4JVS A;  3FMS A;  3S0X A;  1K05 A;  3GAN A;  2YLG A;  1D0X A;  1GGQ A;  3MBG A;  1PD1 A;  3KYJ A;  3TK0 A;  1YJG A;  3ASN C;  5L0H A;  3L8I A;  3JT1 A;  2MHR A;  4K0D A;  2G3K A;  1ZHY A;  2IXM A;  2PP4 A;  2Y3H A;  4JC7 A;  4BG0 A;  4KI2 A;  5KYW A;  3RQF A;  1OCO C;  4K7B A;  2Q00 A;  4IAQ A;  4P9T A;  4QI0 A;  2CW0 F;  4AX2 A;  3ITF A;  4JZA A;  3W4Y A;  2Q9B A;  3KH2 A;  3N0T A;  3WG7 C;  1D1C A;  3K6B A;  1OW8 A;  1PV3 A;  4G7Z F;  4JUR I;  2NPU A;  4DRI B;  3AG4 C;  2MWQ A;  4Q7C A;  4PFO A;  4OIP F;  5E3A A;  3V7O A;  5KYW B;  4C3E A;  2J7P D;  2WVQ A;  1HE1 A;  3U2M A;  1G4W R;  4BJ5 A;  2EPN A;  5EGY A;  2C03 A;  1T01 A;  4DVZ A;  2OU6 A;  1O87 A;  3TUL A;  5HV9 A;  3QMK A;  1V74 B;  2CGE A;  2C04 A;  2XM4 A;  2XLE A;  1YA7 O;  4BJT A;  3GEI A;  4F4B A;  1BR1 A;  4CS8 A;  1I5N A;  5AGF A;  3LS1 A;  3O10 A;  1TWH A;  3HTK C;  3V5Y A;  2RSE B;  2W4B A;  2EIL C;  1C17 M;  3HNI A;  4OD5 A;  5BQG A;  3B0U X;  2XL8 A;  4U5C E;  3X2Q C;  2XLD A;  1OR2 A;  5KYX A;  4MTO A;  4A2N B;  2B0H A;  3SYN A;  5B1A C;  1ST6 A;  2YL1 A;  3RVY A;  4MVM A;  1LS1 A;  1QQ3 A;  3LAY A;  1U6H A;  1RKE A;  2IXO A;  4IJJ A;  2WL8 A;  4NY3 A;  3SEO A;  3NKD A;  4EKW A;  1Z63 A;  1KU2 A;  1TKN A;  2LIG A;  3TOL A;  4DBR A;  1LE4 A;  3DI5 A;  1T5O A;  3B71 A;  2YL3 A;  1Y6D A;  4ULV A;  5KYX B;  1LM3 B;  2KJG A;  3S27 A;  3ZC4 A;  2LQG A;  2R9R B;  4XPX A;  3NDB B;  1VLS A;  4FES A;  4EBB A;  2HJ3 A;  2YKZ A;  3JRT A;  4WGY A;  2VCC A;  4BJ6 A;  5AC5 A;  2EPL X;  1RKE B;  2KSF A;  3RVZ A;  4CSA C;  1NG1 A;  1R4T A;  4WJ0 A;  3AOU A;  3EZI A;  4IB4 A;  2R7X A;  4NCQ A;  1VTM P;  3EGX A;  3ABL C;  2HMQ A;  1C03 A;  4N4W A;  3LNR A;  1LI7 A;  1YAR O;  2JPU A;  1V4A A;  3ZIB A;  1TWA A;  2HSQ A;  1YAU O;  3HNL A;  5F5F A;  2E87 A;  2WVN A;  3Q6M A;  5FZT A;  1S7Z A;  3SP1 A;  3KMI A;  4YWQ A;  3H65 A;  3RH3 A;  4Q4Z F;  2YL7 A;  1H7I A;  2ZXW C;  2EIJ C;  3DAG A;  4PJM A;  1G5Z A;  1ZHT A;  2YLD A;  3EGD B;  3NRH A;  1VB5 A;  4LAC B;  5A6B D;  2J45 A;  1A41 A;  4MS2 A;  2J0X A;  5KYN A;  3EGX B;  3S29 A;  3ZDL A;  3SXZ A;  1NFN A;  2H7B A;  3JRM O;  4NTF A;  2QUP A;  2XLW A;  3C8G A;  4K1O A;  3B29 A;  3ZTM A;  4YJW A;  4CDV A;  2OG2 A;  2R7T A;  2GFH A;  5JVE A;  3LEV A;  3QVY A;  2Y69 C;  1CGO A;  3DJN B;  4XPY A;  1ZHX A;  3ZTZ A;  3E70 C;  4I3M A;  2P6V A;  2WZF A;  2M64 A;  3US6 A;  4DOZ A;  2YHS A;  3JYH A;  5DQZ A;  3PHF 2;  2KK1 A;  2P7V A;  2VB6 A;  4NTA A;  1NZE A;  5B3I A;  2TMV P;  2J46 A;  4YT5 A;  4HE8 D;  3HJC A;  2L6F A;  2HUJ A;  3C7J A;  3KPH A;  4U5E E;  2QLA A;  2VCB A;  2R7Q A;  3N2Z B;  1OXB A;  4O7G A;  5CIV A;  3UMI A;  3OA1 A;  4O6M A;  4NTB A;  5IY5 C;  1M6T A;  5L0J A;  5AC4 A;  5D91 A;  5BQH A;  3UGP A;  2B0J A;  3JTL O;  3TD7 A;  1CPR A;  2A1D D;  5L3Q A;  4KNW A;  3U5S A;  1Z7Q c;  1ZYR F;  4HFK B;  4U5H A;  3TJ5 A;  3VYW A;  2BL2 A;  2CNW D;  3ZQV A;  2UUH A;  3LEO A;  2V3C C;  4QI2 A;  3K1I C;  3UGO A;  4XPW A;  4H4K C;  5DVW A;  2A0B A;  3A11 A;  3EJN A;  2OJQ A;  1J8Y F;  1MMN A;  1HY5 A;  2J9B A;  2YWA A;  2YVK A;  3K33 A;  1ORS C;  4R32 A;  4XEV A;  2A0U A;  4HEA J;  4YN0 B;  3U9J A;  2D4U A;  3UNG C;  4UDV A;  4RBN A;  3G4Z A;  1EKY A;  1CPQ A;  2HSB A;  3HKK A;  3LLK A;  3FOP A;  3FAP B;  4JEA A;  4B6I A;  2L6G A;  1BDJ B;  2L9J A;  5E2Q A;  5A69 A;  3S90 A;  1E83 A;  4WAB A;  2XLH A;  4EBJ A;  4AE4 A;  2ZPA A;  4MVQ A;  1WAT A;  3B9Q A;  2KC3 A;  1IW7 F;  4KBL A;  2CYD A;  4RDA A;  1OR3 A;  1M57 C;  4OIN F;  1OCR C;  5EHH A;  3F47 A;  3LES A;  4D4X A;  1RXQ A;  1WWP A;  1LPE A;  1YVI A;  3SXM A;  1Q0D A;  1QSP A;  2LD6 A;  3M1C B;  1NSG B;  5K0I A;  1SYQ A;  3HNK A;  4AE4 B;  5TJ5 E; 
#chains in the Genus database with same CATH homology
 1VOM A;  5B3S C;  3B0V C;  3AG3 C;  2KW3 C;  3RIP A;  1MND A;  4U5G A;  2Q9C A;  3VAY A;  1N1C A;  4CSA A;  1W2W A;  4CBE A;  2Q3T A;  2ZXO A;  2KNH A;  4CS7 A;  2G3V A;  3NKE A;  5L3V A;  2BE5 F;  4XLN F;  4I1M A;  1NU9 C;  2V26 A;  4EWC A;  1SF8 A;  4OIQ F;  1IZM A;  2QTV A;  3EFO A;  3W2W A;  4I1O B;  3RYL A;  3ECS A;  4CS9 C;  2IXN A;  2JD3 A;  4HFF B;  3F46 A;  1BR4 A;  5D92 A;  3JSZ A;  2Y39 A;  2MYS A;  2ZXR A;  2Q9A A;  3EFO B;  3CQZ A;  2J9U A;  3DD7 A;  2W9Y A;  1ZU4 A;  4G0H A;  1G8X A;  4PJL A;  4ZLC A;  3EH2 A;  1PCX A;  1O5H A;  3DXJ F;  4PFP A;  2XL4 A;  4FX5 A;  3I5P A;  4XWJ A;  2YZS A;  5CI9 A;  2PX0 A;  2QY9 A;  5CI8 A;  3QZC A;  3W2V A;  4N06 A;  1MMD A;  1Z3I X;  1QLE C;  4LLC A;  4CIH A;  2Z15 A;  1TWG A;  4J32 B;  1MMA A;  3OWT A;  2R7W A;  2J9W A;  3CZ6 A;  5KYU A;  1MMG A;  3EHM A;  4IAO A;  2DGJ A;  2EIN C;  4O6Y A;  3ZVR A;  1M2V A;  3K1H A;  2WVO A;  1OCC C;  2W45 A;  4YT8 A;  2R7U A;  4U5D E;  3PMR A;  5DQT A;  4IRU A;  1OCZ C;  5KYU B;  4YT2 A;  3EHN A;  1TR2 A;  1FTS A;  3SNH A;  3PHF 2;  3DM9 B;  4OIO F;  2Y3G A;  2PFD A;  2KGO A;  1ZHW A;  1Z23 A;  3ZG1 A;  5T3W A;  3AG1 C;  2WZL A;  5DS6 A;  2G62 A;  4Q5S F;  2YEV A;  2XXA A;  3S28 A;  3HLZ A;  4O79 A;  5DS4 A;  4JCH A;  3WOD F;  4C3B A;  2L81 A;  4LLE A;  1Z6A A;  5F5H A;  3POV A;  2A6H F;  3UR3 C;  5DS5 A;  4U5F E;  1Z5Z A;  3DZA A;  1LVK A;  4KNV A;  2XXA B;  3UMH A;  3NYL A;  1D1B A;  1M2O A;  1V54 C;  2OCC C;  4XLP F;  3T6B A;  2DYS C;  3RFY A;  2J0W A;  4CS9 A;  1LKX A;  5E3C A;  4PJJ A;  2LSE A;  3I5Q A;  3KL4 A;  1ZU5 A;  3EH1 A;  5B1B C;  5HSW A;  1OKK A;  1QZX A;  1JPN A;  3DAF A;  3T6J A;  4GEH A;  3L0I A;  4DBQ A;  1J8M F;  2R7V A;  4E7Z A;  1FFT C;  1MNE A;  3ASO C;  3RKO F;  2W4M A;  4G7O F;  2CNW A;  3KKB A;  3EQL F;  3EG9 A;  4BJ1 A;  2X51 A;  5KYY A;  2DYR C;  2IXP A;  2WZG A;  2HV6 A;  1VMA A;  3Q7G A;  3FVY A;  1FMV A;  4AK9 A;  2PX3 A;  2KQ9 A;  3AQB A;  4KC9 A;  4E7S A;  4G7H F;  2A68 F;  3EG9 B;  4OD4 A;  4C3D A;  2I8B A;  1WGW A;  2Y3B A;  5KYY B;  5DLJ A;  3OEO A;  3NYM A;  5BUO A;  3LLI A;  1VK5 A;  3O6X A;  4J30 B;  2XRH A;  4MND A;  4O6N A;  3EPV A;  3K66 A;  5FCL A;  3GOD A;  2IOQ A;  5E33 A;  1BR2 A;  2ZXP A;  4FWV A;  3UMK A;  4OIR F;  1D0Z A;  1PD0 A;  2H7V C;  2FFH A;  2J7P A;  4W8K A;  3L34 A;  2EIK C;  3DM5 A;  2HV7 A;  3FDQ A;  2VH3 A;  4ANJ A;  4I44 A;  1RJ9 A;  1SMY F;  3I4U A;  1TWC A;  3NYJ A;  3SZR A;  3MLG A;  2FGY A;  1NU7 D;  2O9X A;  3FAJ A;  4P6I C;  4JW1 A;  3LS0 A;  3EGD A;  1RJ9 B;  2NUT A;  4BJ5 C;  1D1A A;  3B0P A;  4YT4 A;  3NG1 A;  4JJF A;  1JPJ A;  4CS8 C;  4ULW A;  3FHD A;  4ZLD A;  1M2V B;  3CSK A;  3K7D A;  3IEE A;  4GYT A;  1VYK A;  1ZHZ A;  2NUT B;  4PJN A;  2XSE A;  3X1O A;  1V55 C;  2CDQ A;  4IWB A;  2J9V A;  4U5B E;  2NUP A;  4X0R A;  3AG2 C;  3ABM C;  3Q6N A;  3E9V A;  4BEJ A;  3MX3 A;  1OKK D;  2PF4 E;  3DJU B;  3EZH A;  1FFH A;  4PK4 A;  2D5R B;  4MQ9 F;  2A69 F;  4LER A;  2NUP B;  3W8H A;  2M4E A;  3O39 A;  4BJ6 C;  3DMD A;  2EIM C;  4DVY P;  2WB7 A;  1FMW A;  2IYL D;  3AQC A;  4XTK A;  2Y3D A;  3W8I A;  2R7S A;  2VAS A;  4C7O A;  1SZI A;  5T3T A;  5T1D B;  3LJB A;  3Q7L A;  4RD9 A;  3N24 A;  1M56 C;  3T4R A;  4QDL A;  4JJG A;  2R7O A;  3ABK C;  1VYI A;  3JCU Q;  2NG1 A;  3ZSU A;  2A6E F;  2H7O A;  2R7R A;  4C7O B;  4M63 A;  1D0Y A;  4JVS A;  3S0X A;  3GAN A;  1D0X A;  1PD1 A;  3ASN C;  4K0D A;  3JT1 A;  2G3K A;  1ZHY A;  2IXM A;  2PP4 A;  2Y3H A;  4BG0 A;  4KI2 A;  5KYW A;  1OCO C;  4K7B A;  4QI0 A;  2CW0 F;  4AX2 A;  3ITF A;  4JZA A;  2Q9B A;  3KH2 A;  3N0T A;  3WG7 C;  1D1C A;  3K6B A;  4G7Z F;  4JUR I;  3AG4 C;  2MWQ A;  4Q7C A;  4PFO A;  4OIP F;  5E3A A;  3V7O A;  5KYW B;  4C3E A;  2J7P D;  2WVQ A;  4BJ5 A;  5EGY A;  2C03 A;  4DVZ A;  1O87 A;  3QMK A;  2CGE A;  2C04 A;  4BJT A;  4F4B A;  1BR1 A;  4CS8 A;  3LS1 A;  1TWH A;  3HTK C;  2W4B A;  2EIL C;  4OD5 A;  3B0U X;  4U5C E;  3X2Q C;  5KYX A;  4A2N B;  3SYN A;  5B1A C;  1ST6 A;  1LS1 A;  4IJJ A;  3LAY A;  2IXO A;  4NY3 A;  2WL8 A;  3SEO A;  3NKD A;  1Z63 A;  1KU2 A;  1TKN A;  4DBR A;  5KYX B;  2KJG A;  3ZC4 A;  3S27 A;  3NDB B;  4FES A;  4EBB A;  3JRT A;  4BJ6 A;  4CSA C;  1NG1 A;  4WJ0 A;  3EZI A;  2R7X A;  3EGX A;  3ABL C;  3LNR A;  3ZIB A;  1TWA A;  5F5F A;  2E87 A;  2WVN A;  3Q6M A;  1S7Z A;  3SP1 A;  3KMI A;  4YWQ A;  3H65 A;  3RH3 A;  4Q4Z F;  2ZXW C;  2EIJ C;  3DAG A;  4PJM A;  1ZHT A;  3NRH A;  3EGD B;  4LAC B;  2J45 A;  2J0X A;  5KYN A;  3EGX B;  3S29 A;  2H7B A;  4YJW A;  2OG2 A;  2R7T A;  2GFH A;  3LEV A;  2Y69 C;  3DJN B;  1ZHX A;  3E70 C;  4I3M A;  2P6V A;  2WZF A;  4DOZ A;  2YHS A;  3JYH A;  5DQZ A;  2P7V A;  2VB6 A;  1NZE A;  2J46 A;  4YT5 A;  4HE8 D;  3HJC A;  4U5E E;  4O7G A;  2R7Q A;  3N2Z B;  3UMI A;  3OA1 A;  4O6M A;  5IY5 C;  5D91 A;  3UGP A;  2B0J A;  3TD7 A;  2A1D D;  5L3Q A;  4KNW A;  3VYW A;  1ZYR F;  4HFK B;  4U5H A;  4QI2 A;  2CNW D;  2V3C C;  3K1I C;  3UGO A;  5DVW A;  4H4K C;  3EJN A;  1MMN A;  1J8Y F;  3K33 A;  4YN0 B;  4HEA J;  3UNG C;  4RBN A;  3LLK A;  4B6I A;  2L9J A;  5E2Q A;  4AE4 A;  2ZPA A;  3B9Q A;  4KBL A;  1IW7 F;  4RDA A;  1M57 C;  4OIN F;  1OCR C;  5EHH A;  3F47 A;  3LES A;  3M1C B;  4AE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...