2L7AA

Solution structure of the talin vbs2b domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
GIDPFTAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Talin-1
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2l7aA00
1ZW2A 3MYIA 3VF0A 1SYQA 2IBFA 1ZW3A 3H2UA 3RF3A 2X0CA 4K1OA 1XWJA 5L0IA 1RKEA 4IGGA 5L0GA 3S90A 4W8PA 3ZDLA 5L0JA 2GDCA 4EHPA 1RKEB 1ST6A 2L7AA 4ONSA 1DOVA 4E17A 2GWWA 3T6GB 2LQGA 1U6HA 3TJ5A 4DJ9A 1ZVZA 1H6GA 1U89A 1RKCA 5L0CA 1YDIA 4P9TA 5L0FA 3TJ6A 1QKRA 3H2VA 2B0HA 5L0DA 1TR2A 2HSQA 4PR9A 5FZTA 1L7CA 5L0HA 1T01A 4E18A 1DOWA
chains in the Genus database with same CATH superfamily
5DS6A 2YWAA 3W8IA 5KYNA 4XTKA 3PHF2 2KYHA 4DRJB 4ZLCA 4IAQA 2H7OA 2IXOA 1HMOA 1VMAA 2X0CA 4D4NA 2Q7RA 1H9GA 5HV9A 1LI5A 3AQBA 2R7XA 4YL0A 1O87A 3DD7A 2R03A 1Q0GA 1Y4CA 3AG1C 3DJUB 4RBNA 3UGOA 3HNLA 1NU7D 2QNLA 1VLTA 4YN0B 4JTDB 2A6EF 3HNKA 3JYYA 2YEVA 2L9JA 2XRHA 3US6A 4DVZA 4CDVA 4FAPB 2YRFA 2HUJA 2OEVA 4K0DA 5AGFA 2Y69C 4CS8C 3WODF 1WOLA 4P9TA 4YK5A 3U9JA 1APCA 1FFHA 1IZMA 2Q00A 2FGYA 1Z63A 2YL7A 3QW1A 3WG7C 3JRMO 3ITFA 2V26A 4NTAA 4BJ6C 4MVQA 3MYFA 2ZXPA 4O6NA 4GEHA 3TK0A 2HMZA 3C8GB 4QDLA 4HFFB 5DS5A 4B6IA 2JX0A 4MW8A 4O79A 2IBFA 3H2UA 3KH2A 4IB4A 4U5GA 4YT5A 3RF3A 1OXBA 3V5XA 2P7VA 4K1OA 3S29A 5F28E 3NRHA 3U9MA 3C8GA 2BC5A 3K1IC 3FMSA 2A68F 1E86A 1HW2A 4PJJA 1ZHWA 3G50A 4JZAA 3IPMO 3T9OA 4BJ5C 3J06A 3RIPA 5KYYB 1IW7F 2IYLD 4CS9C 1FFTC 1SMYF 2G3VA 4J7YA 5FCLA 1NFOA 2H7VC 2A0UA 4ER9A 1DOVA 3RKOF 1T5OA 2J7PD 2OJQA 2VH3A 3Q6NA 3NG1A 1U89A 2R7SA 1RKCA 2JPUA 2P6VA 2W4BA 1OKKA 4P9FA 3V5YA 5L0FA 4OIPF 3ZWIA 2B0HA 4BJTA 3GWNA 3K33A 1J8MF 3O55A 2CYDA 3IEEA 5BQIA 2HZ8A 2GAQA 5L0HA 3L8JA 4LDQA 3M4BA 3VAYA 3W4YA 4AX2A 1T6IA 5A6KA 5JS5A 3UNGC 4WGZA 4BEMJ 5AC5A 4CS8A 2MHRA 3FOPA 4QI2A 3RQEA 4RDAA 4M63A 3KL4A 2YQYA 1V4AA 2OOCA 3E9VA 1ZYRF 3K1HA 4JEAA 4PFOA 3RH3A 4DRIB 1G4US 1UG7A 2NSGA 3EPVA 1BR1A 4ULWA 2HKVA 2Q9CA 2IOQA 5L3QA 2Y3HA 1A7DA 2J0WA 2I15A 4U5FE 4YL1A 4KI2A 4WABA 1SF8A 4LACB 1L3PA 2KSFA 4MTOA 2PNOA 5EGYA 3DKAA 4KNVA 4OIOF 2EPMX 3LS0A 3SZRA 2R02A 2KC3A 3RQGA 3RYLA 3TOMA 4AE4B 4CS9A 1MQVA 4LERA 3RFYA 3ZSUA 3C8ZA 3U5SA 1YYXA 4JJGA 3FDQA 1NBBA 2J9BA 3FOOA 1TQGA 4XPYA 1OXKA 3B0UX 1D1CA 5KYXA 3DE8A 2NSFA 5E33A 4UDVA 2TMVP 1GS9A 2W45A 4JTCB 4Q5SF 4R32A 5T3TA 2J45A 4DBQA 2D4UA 4U5CE 3FVYA 4OIQF 1CPRA 3K7DA 3GM1A 3LLIA 2WVNA 2XM0A 5JLIA 4J32B 1OW6A 1H7IA 4MTFA 3UR3C 1WWPA 3H2VA 1GQAA 1TR2A 3RQFA 3MFNA 5COGA 4DVYP 3DWWA 2C03A 3JSEO 4E0HA 3AG3C 5B1AC 4QI0A 1H9TA 3HNIA 4CSAA 2VASA 1PD0A 2VB6A 5GPGB 2KK1A 2DYRC 1CGOA 3U3BA 3DZAA 1OW7A 2ASRA 2WZFA 4LLEA 2EINC 2NUTA 3SXMA 5DLJA 1PCXA 4XPXA 2M4EA 4NTBA 1QLEC 4YT8A 4CDAA 5A69A 1O5HA 2WB7A 1JR8A 1EQ1A 4KNWA 4H4KC 1TFOB 2VCBA 4MVMA 4IJJA 4ONSA 4JVSA 4E17A 3L8IA 2NUPA 2GFHA 5KYYA 3E70C 2DI3A 2X51A 5L0CA 1E85A 3VYWA 2V3CC 4JIOA 1JRAA 1ZZPA 2WVQA 2XLVA 4EIYA 2JD3A 1RCPA 2O9XA 2QUPA 2AWYA 2OJED 3QZCA 4N6CA 5BQGA 3KMIA 2XS8A 1ORYA 3B9QA 4LLCA 5K0IA 2XXAB 2HJMA 3O10A 4G7ZF 1LPEA 1KU2A 5DQZA 4N6HA 1EKYA 3HKKA 5KYXB 1TWCA 3NKDA 2XXAA 2LCHA 2R25A 1VK5A 2Y39A 3GEEA 4MVOA 4U5EE 1M6TA 3ZQYA 3UMHA 2Z15A 4OD5A 1VLSA 5T3WA 3C63A 1D1BA 1G8XA 2YL0A 1A7VA 2QY9A 2P61A 2Y3DA 3GORA 3IQ6A 4IARA 2H8AA 3GEHA 4JKVA 2J0XA 4PACA 3SXYA 3T6JA 4DXWA 4JCHA 2L81A 2M64A 1ZHXA 2Q9BA 5A6BA 1WASA 4HFKB 1VB5A 1OCRC 3I5PA 1GGQA 2EIMC 3OA1A 4JJFA 2HMQA 5T1DB 5CIVA 1YVIA 2NUTB 1TWAA 3SNHA 1OR2A 3C62A 3DM9B 2AU5A 1PV3A 4PJMA 2XL4A 3I4UA 1ZW3A 3Q6MA 3T6BA 5IY5C 2OKUA 1OCZC 4PJLA 3NDBB 1K05A 2XS1A 3S84A 1YYJA 1A41A 3QW0A 4U5HA 1GM5A 1M2VB 1HW1A 1W2WA 1LS1A 1MMNA 256BA 3HTKC 3LUTB 4PFPA 4AL1A 1S05A 4OINF 5KYUB 1TKNA 2OG2A 1ZU4A 2YHSA 1Z7Qc 2WVOA 1LKXA 3CSKA 3WAQA 5KYUA 1EI7A 2PX0A 4YWQA 1Y6DA 3ASOC 3TULA 3ABKC 3B0PA 2PBEA 5E3AA 5TJ5E 4MNDA 3NYJA 3IQ5A 1DOWA 5EK0A 2DYSC 3ECSA 2ZXOA 3C7JA 3O39A 3W2VA 3X1OA 1D1AA 3ABMC 2YL1A 1MMDA 1XZPA 4LDRA 1WN0A 2AWCA 3HJCA 3BRJA 1RKEA 3A9CA 1WATA 3EJNA 4XEFA 3PCVA 2LFDA 4O6MA 3JZ0A 4LDKA 5L0JA 2GDCA 4EHPA 1V74B 4EUKB 2QE9A 3LJBA 2ICWG 2HV7A 4WGYA 4F4BA 3M1CB 3KYIA 3ZG1A 4CS7A 3T6GB 2W9YA 1SR2A 4DJ9A 2W4MA 4JC7A 3F46A 1QSPA 4KC9A 2KNHA 3JT1A 3LEOA 2LIGA 5FZTA 4MW3A 5DVWA 2EIKC 3NMIA 1NZEA 1M56C 1OQCA 1QZXA 3RVYA 4BPMA 1Q0KA 5E3CA 1T6QA 1FAPB 1CPQA 1RMVA 1EA8A 4DBRA 4GQHA 2ZXRA 2J9VA 2WZGA 1O3UA 2OU6A 5L0IA 1JAFA 1U0BB 4G78A 4U9EA 2KW3C 3HLZA 3C8GD 2RSEB 2VC9A 2HS5A 2MYSA 5E2QA 3ZTZA 3ZIBA 3B71A 2CDQA 2PX3A 3FHDA 4CIHA 1ZHYA 4PJNA 2ETSA 1R5ID 1CGME 4BJ6A 4C7OB 2YLIA 3C18A 2C04A 5JP7A 4CIPA 5L0DA 1YJGA 1K04A 2XLDA 1NLXA 3ZTMA 4Q7CA 1Z6AA 1YA9A 3Q7LA 3TQOA 1YA7O 1NFNA 1AVOB 2CW0F 1C17M 1Z3IX 1SYQA 1YARO 4N4WA 4I1OB 4H54A 2Q9AA 5D92A 4DRHB 2L6FA 4EBJA 4OIRF 5JVEA 4NY3A 3FAPB 1KTMA 3IQCA 1OCOC 5F5FA 3EZIA 2FAPB 3AQCA 1S7ZA 1QVXA 1WGWA 3DJNB 3MBGA 4FWVA 3S28A 3UMIA 1M2VA 5HSWA 2ZD9A 1YLMA 4BJ1A 4E7ZA 5F5HA 2XLHA 4MVSA 3AGTA 2J46A 5CI8A 3JCUQ 1MMAA 1RXQA 3LS1A 1WTYA 1VYIA 2RD9A 1LS4A 3ATPA 3LEVA 1L7CA 4ULVA 2CNWA 5A6AA 3JTLO 2YLGA 3SXKA 3NYLA 3DM5A 3KYJA 4MVRA 2MWQA 3M4CA 1ZHTA 4G0HA 2BL2A 3VF0A 4C3EA 3B0VC 1FMVA 2NPUA 3U2LA 2KQ9A 1BR4A 4E0IA 3DAFA 3EGDB 1FNTc 3LAYA 3UMKA 3AG4C 5A6JA 1FR0A 2EPOA 5JT4A 1FTSA 3VRCA 1RKEB 1RJ9A 3AGUA 3GM3A 2IM8A 3SYNA 3M79A 4G7OF 1HE9A 2L7AA 5EHHA 2D5RB 4XQ1A 1I4YA 4XEKA 3SP1A 1OKKD 1JOGA 1I4ZA 1SZIA 4ANJA 5COMA 4N06A 3RW0A 4E7SA 5D91A 1LIHA 4MVZA 4OD4A 2ZPAA 3ZVRA 3U0CA 1JPNA 1Q0FA 3EH2A 2L6GA 3ASNC 4XPWA 1TWHA 2Y3BA 4XWJA 3U3FA 2VCCA 1BR2A 4MVUA 2EPLX 4FX5A 2VCAA 3N24A 1VOMA 4W8KA 4YJWA 3DXJF 1XWJA 2DB4A 2EPNA 3QVYA 4IAOA 1FMWA 4JE9A 4JW1A 4HE8D 4IGGA 4O7GA 4I1MA 2E87A 5L0GA 1TWGA 2PP4A 4Z9JA 2CCYA 3JYHA 3L34A 2NG1A 1M2OA 2XLEA 2LP4A 1J8YF 2G3KA 3G4XA 2G62A 4KBLA 3TJ5A 4AL0A 2R7VA 5AC4A 1N1CA 1JPJA 3EQLF 5DQTA 1YDIA 1OR3A 3H65A 2DGJA 1D0XA 5B1BC 3EFOA 1LVKA 1F1MA 1OW8A 4HEAJ 4CBEA 3K6BA 2EIJC 3EHNA 4CSAC 4J30B 4U5DE 4C7OA 1LE2A 4WJ0A 1LM3B 3GODA 4GYTA 2OEXA 3EHMA 5L3VA 1BBHA 2CGEA 1ZHZA 5B3IA 4YT4A 5CI9A 1AEPA 1OCCC 5KYWA 2IXPA 1E2XA 3GANA 3GWLA 3ZC4A 3S90A 2B0JA 2YL3A 3U8VA 4EWCA 1JMWA 1ST6A 3U8PA 2R7TA 4NCQA 4BG0A 4A2NB 2L6HA 1NG1A 1LI7A 2GWWA 1U6HA 3F47A 3HNJA 3V7OA 3W8HA 4CJGA 4X0RA 1HE1A 2PF4E 3QTHA 3TOLA 1V55C 3DMDA 3DAGA 3EGXA 3X2QC 1CGNA 1D0ZA 2LD6A 4O6YA 4EBBA 3WHNA 1QPUA 3TD7A 4CX9A 4ZLDA 3A11A 3JRTA 3PMRA 2A69F 2EILC 2OCCC 1T01A 4I44A 1E84A 4K7BA 2P1AA 3N0TA 3LNRA 4E18A 2R7OA 3LLKA 2WZLA 3QMKA 3MYIA 3CEXA 2LFFA 2A0BA 2KJGA 2Q4FA 3R2PA 3I5QA 4JTAB 4NQFA 1A7EA 2R7RA 3G4ZA 2J9WA 4A4AA 2XL8A 3LESA 1Z23A 3LNMB 4C3DA 1ZU5A 1YZCA 3ZDLA 3SXZA 1MNDA 3S27A 3AJMA 3EFOB 1E83A 1G5ZA 3EGDA 3QVZA 2H7BA 1M57C 2OQMA 2QTVA 3Q7GA 4MTGA 2LQGA 3ZQVA 1LE4A 1I5NA 3OWTA 1ZVZA 1VYKA 1H6GA 3NMKA 1BDJB 2LSEA 1QKRA 4JCZA 2IXNA 3KKBA 2Q3TA 2HSQA 4PR9A 1HMDA 2R9RB 2HFIA 3NYMA 5KYWB 2YLDA 1G4WR 3DI5A 3ABLC 3IHUA 1Q0MA 1MMGA 1T9KA 3EH1A 1AUEA 4DOZA 3NKEA 1BZ4A 1YZAA 1T6UA 3AG2C 2IXMA 4JEBA 2XM4A 4D4XA 3CZ6A 1B68A 4XEVA 3S9OA 4EKWA 2R7WA 2R7UA 3POVA 1R4TA 1A0BA 4J7TA 3OEOA 2PFDA 2R05A 3V5ZA 4C3BA 3PDMP 1HY5A 2HJ3A 4MQ9F 1K40A 4NC3A 4U9DA 3L0IA 4L6RA 4AE4A 5DS4A 3R7CA 1VTMP 4XLPF 4IRUA 4U5BE 3RVZA 3EG9B 2AP3A 3T4RA 4G7HF 1ORSC 1MNEA 1XZQA 1ORJA 1TFKB 2BE5F 4NTFA 4EBKA 4RD9A 5A6BD 2AVKA 3EG9A 4P6IC 4IWBA 2YVKA 3EZHA 3KPHA 2XL6A 4MS2A 3AOUA 3VM6A 3GM2A 5JSLA 4Z9IA 1UFBA 2HV6A 2J7PA 3IQTA 3JSZA 3K66A 2P0NA 3SEOA 4Q4ZF 2XSEA 2I8BA 1C03A 3CQZA 3L1MA 1NSGB 2XLMA 5COFA 1PD1A 3S0XA 1D0YA 2J9UA 2Y3GA 1ZW2A 2GA0A 3GEIA 3MX3A 3W2WA 4FESA 2J8WA 2UUIA 4BEJA 2XLOA 1RJ9B 1QQ3A 2CNWD 3U2MA 1KNYA 5BUOA 4Z9HA 2XLWA 4JURI 4CJOA 4YT2A 2LK4A 2EPKX 3B29A 1YAUO 4W8PA 1V54C 2WL8A 1Z5ZA 2KGOA 3BEHA 3FXHA 2HSBA 5B3SC 1C02A 3N2ZB 4YL3A 2A6HF 4AK9A 2A1DD 3MLGA 4XLNF 3K1IA 4I3MA 2YZSA 3DE9A 2QLAA 1NU9C 4BJ5A 3UGPA 2ZXWC 2FFHA 4PK4A 2UUHA 3TJ6A 2F22A 3NMJA 3O6XA 2R7QA 4JRZA 2YKZA 4CDYA 2NUPB 5JRAA 3FAJA 3EGXB 5JUAA 5BQHA 3CAXA 3M15A 1Q0DA
chains in the Genus database with same CATH topology
1ZW2A 3MYIA 3VF0A 1SYQA 2IBFA 1ZW3A 3H2UA 3RF3A 2X0CA 4K1OA 1XWJA 5L0IA 1RKEA 4IGGA 5L0GA 3S90A 4W8PA 3ZDLA 5L0JA 2GDCA 4EHPA 1RKEB 1ST6A 2L7AA 4ONSA 1DOVA 4E17A 2GWWA 3T6GB 2LQGA 1U6HA 3TJ5A 4DJ9A 1ZVZA 1H6GA 1U89A 1RKCA 5L0CA 1YDIA 4P9TA 5L0FA 3TJ6A 1QKRA 3H2VA 2B0HA 5L0DA 1TR2A 2HSQA 4PR9A 5FZTA 1L7CA 5L0HA 1T01A 4E18A 1DOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW2 A;  3MYI A;  3VF0 A;  1SYQ A;  2IBF A;  1ZW3 A;  3H2U A;  3RF3 A;  2X0C A;  4K1O A;  1XWJ A;  5L0I A;  1RKE A;  4IGG A;  5L0G A;  3S90 A;  4W8P A;  3ZDL A;  5L0J A;  2GDC A;  4EHP A;  1RKE B;  1ST6 A;  2L7A A;  4ONS A;  1DOV A;  4E17 A;  2GWW A;  3T6G B;  2LQG A;  1U6H A;  3TJ5 A;  4DJ9 A;  1ZVZ A;  1H6G A;  1U89 A;  1RKC A;  5L0C A;  1YDI A;  4P9T A;  5L0F A;  3TJ6 A;  1QKR A;  3H2V A;  2B0H A;  5L0D A;  1TR2 A;  2HSQ A;  4PR9 A;  5FZT A;  1L7C A;  5L0H A;  1T01 A;  4E18 A;  1DOW A; 
#chains in the Genus database with same CATH topology
 5DS6 A;  2YWA A;  3W8I A;  5KYN A;  4XTK A;  3PHF 2;  2KYH A;  4DRJ B;  4ZLC A;  4IAQ A;  2H7O A;  2IXO A;  1HMO A;  1VMA A;  2X0C A;  4D4N A;  2Q7R A;  1H9G A;  5HV9 A;  1LI5 A;  3AQB A;  2R7X A;  4YL0 A;  1O87 A;  3DD7 A;  2R03 A;  1Q0G A;  1Y4C A;  3AG1 C;  3DJU B;  4RBN A;  3UGO A;  3HNL A;  1NU7 D;  2QNL A;  1VLT A;  4YN0 B;  4JTD B;  2A6E F;  3HNK A;  3JYY A;  2YEV A;  2L9J A;  2XRH A;  3US6 A;  4DVZ A;  4CDV A;  4FAP B;  2YRF A;  2HUJ A;  2OEV A;  4K0D A;  5AGF A;  2Y69 C;  4CS8 C;  3WOD F;  1WOL A;  4P9T A;  4YK5 A;  3U9J A;  1APC A;  1FFH A;  1IZM A;  2Q00 A;  2FGY A;  1Z63 A;  2YL7 A;  3QW1 A;  3WG7 C;  3JRM O;  3ITF A;  2V26 A;  4NTA A;  4BJ6 C;  4MVQ A;  3MYF A;  2ZXP A;  4O6N A;  4GEH A;  3TK0 A;  2HMZ A;  3C8G B;  4QDL A;  4HFF B;  5DS5 A;  4B6I A;  2JX0 A;  4MW8 A;  4O79 A;  2IBF A;  3H2U A;  3KH2 A;  4IB4 A;  4U5G A;  4YT5 A;  3RF3 A;  1OXB A;  3V5X A;  2P7V A;  4K1O A;  3S29 A;  5F28 E;  3NRH A;  3U9M A;  3C8G A;  2BC5 A;  3K1I C;  3FMS A;  2A68 F;  1E86 A;  1HW2 A;  4PJJ A;  1ZHW A;  3G50 A;  4JZA A;  3IPM O;  3T9O A;  4BJ5 C;  3J06 A;  3RIP A;  5KYY B;  1IW7 F;  2IYL D;  4CS9 C;  1FFT C;  1SMY F;  2G3V A;  4J7Y A;  5FCL A;  1NFO A;  2H7V C;  2A0U A;  4ER9 A;  1DOV A;  3RKO F;  1T5O A;  2J7P D;  2OJQ A;  2VH3 A;  3Q6N A;  3NG1 A;  1U89 A;  2R7S A;  1RKC A;  2JPU A;  2P6V A;  2W4B A;  1OKK A;  4P9F A;  3V5Y A;  5L0F A;  4OIP F;  3ZWI A;  2B0H A;  4BJT A;  3GWN A;  3K33 A;  1J8M F;  3O55 A;  2CYD A;  3IEE A;  5BQI A;  2HZ8 A;  2GAQ A;  5L0H A;  3L8J A;  4LDQ A;  3M4B A;  3VAY A;  3W4Y A;  4AX2 A;  1T6I A;  5A6K A;  5JS5 A;  3UNG C;  4WGZ A;  4BEM J;  5AC5 A;  4CS8 A;  2MHR A;  3FOP A;  4QI2 A;  3RQE A;  4RDA A;  4M63 A;  3KL4 A;  2YQY A;  1V4A A;  2OOC A;  3E9V A;  1ZYR F;  3K1H A;  4JEA A;  4PFO A;  3RH3 A;  4DRI B;  1G4U S;  1UG7 A;  2NSG A;  3EPV A;  1BR1 A;  4ULW A;  2HKV A;  2Q9C A;  2IOQ A;  5L3Q A;  2Y3H A;  1A7D A;  2J0W A;  2I15 A;  4U5F E;  4YL1 A;  4KI2 A;  4WAB A;  1SF8 A;  4LAC B;  1L3P A;  2KSF A;  4MTO A;  2PNO A;  5EGY A;  3DKA A;  4KNV A;  4OIO F;  2EPM X;  3LS0 A;  3SZR A;  2R02 A;  2KC3 A;  3RQG A;  3RYL A;  3TOM A;  4AE4 B;  4CS9 A;  1MQV A;  4LER A;  3RFY A;  3ZSU A;  3C8Z A;  3U5S A;  1YYX A;  4JJG A;  3FDQ A;  1NBB A;  2J9B A;  3FOO A;  1TQG A;  4XPY A;  1OXK A;  3B0U X;  1D1C A;  5KYX A;  3DE8 A;  2NSF A;  5E33 A;  4UDV A;  2TMV P;  1GS9 A;  2W45 A;  4JTC B;  4Q5S F;  4R32 A;  5T3T A;  2J45 A;  4DBQ A;  2D4U A;  4U5C E;  3FVY A;  4OIQ F;  1CPR A;  3K7D A;  3GM1 A;  3LLI A;  2WVN A;  2XM0 A;  5JLI A;  4J32 B;  1OW6 A;  1H7I A;  4MTF A;  3UR3 C;  1WWP A;  3H2V A;  1GQA A;  1TR2 A;  3RQF A;  3MFN A;  5COG A;  4DVY P;  3DWW A;  2C03 A;  3JSE O;  4E0H A;  3AG3 C;  5B1A C;  4QI0 A;  1H9T A;  3HNI A;  4CSA A;  2VAS A;  1PD0 A;  2VB6 A;  5GPG B;  2KK1 A;  2DYR C;  1CGO A;  3U3B A;  3DZA A;  1OW7 A;  2ASR A;  2WZF A;  4LLE A;  2EIN C;  2NUT A;  3SXM A;  5DLJ A;  1PCX A;  4XPX A;  2M4E A;  4NTB A;  1QLE C;  4YT8 A;  4CDA A;  5A69 A;  1O5H A;  2WB7 A;  1JR8 A;  1EQ1 A;  4KNW A;  4H4K C;  1TFO B;  2VCB A;  4MVM A;  4IJJ A;  4ONS A;  4JVS A;  4E17 A;  3L8I A;  2NUP A;  2GFH A;  5KYY A;  3E70 C;  2DI3 A;  2X51 A;  5L0C A;  1E85 A;  3VYW A;  2V3C C;  4JIO A;  1JRA A;  1ZZP A;  2WVQ A;  2XLV A;  4EIY A;  2JD3 A;  1RCP A;  2O9X A;  2QUP A;  2AWY A;  2OJE D;  3QZC A;  4N6C A;  5BQG A;  3KMI A;  2XS8 A;  1ORY A;  3B9Q A;  4LLC A;  5K0I A;  2XXA B;  2HJM A;  3O10 A;  4G7Z F;  1LPE A;  1KU2 A;  5DQZ A;  4N6H A;  1EKY A;  3HKK A;  5KYX B;  1TWC A;  3NKD A;  2XXA A;  2LCH A;  2R25 A;  1VK5 A;  2Y39 A;  3GEE A;  4MVO A;  4U5E E;  1M6T A;  3ZQY A;  3UMH A;  2Z15 A;  4OD5 A;  1VLS A;  5T3W A;  3C63 A;  1D1B A;  1G8X A;  2YL0 A;  1A7V A;  2QY9 A;  2P61 A;  2Y3D A;  3GOR A;  3IQ6 A;  4IAR A;  2H8A A;  3GEH A;  4JKV A;  2J0X A;  4PAC A;  3SXY A;  3T6J A;  4DXW A;  4JCH A;  2L81 A;  2M64 A;  1ZHX A;  2Q9B A;  5A6B A;  1WAS A;  4HFK B;  1VB5 A;  1OCR C;  3I5P A;  1GGQ A;  2EIM C;  3OA1 A;  4JJF A;  2HMQ A;  5T1D B;  5CIV A;  1YVI A;  2NUT B;  1TWA A;  3SNH A;  1OR2 A;  3C62 A;  3DM9 B;  2AU5 A;  1PV3 A;  4PJM A;  2XL4 A;  3I4U A;  1ZW3 A;  3Q6M A;  3T6B A;  5IY5 C;  2OKU A;  1OCZ C;  4PJL A;  3NDB B;  1K05 A;  2XS1 A;  3S84 A;  1YYJ A;  1A41 A;  3QW0 A;  4U5H A;  1GM5 A;  1M2V B;  1HW1 A;  1W2W A;  1LS1 A;  1MMN A;  256B A;  3HTK C;  3LUT B;  4PFP A;  4AL1 A;  1S05 A;  4OIN F;  5KYU B;  1TKN A;  2OG2 A;  1ZU4 A;  2YHS A;  1Z7Q c;  2WVO A;  1LKX A;  3CSK A;  3WAQ A;  5KYU A;  1EI7 A;  2PX0 A;  4YWQ A;  1Y6D A;  3ASO C;  3TUL A;  3ABK C;  3B0P A;  2PBE A;  5E3A A;  5TJ5 E;  4MND A;  3NYJ A;  3IQ5 A;  1DOW A;  5EK0 A;  2DYS C;  3ECS A;  2ZXO A;  3C7J A;  3O39 A;  3W2V A;  3X1O A;  1D1A A;  3ABM C;  2YL1 A;  1MMD A;  1XZP A;  4LDR A;  1WN0 A;  2AWC A;  3HJC A;  3BRJ A;  1RKE A;  3A9C A;  1WAT A;  3EJN A;  4XEF A;  3PCV A;  2LFD A;  4O6M A;  3JZ0 A;  4LDK A;  5L0J A;  2GDC A;  4EHP A;  1V74 B;  4EUK B;  2QE9 A;  3LJB A;  2ICW G;  2HV7 A;  4WGY A;  4F4B A;  3M1C B;  3KYI A;  3ZG1 A;  4CS7 A;  3T6G B;  2W9Y A;  1SR2 A;  4DJ9 A;  2W4M A;  4JC7 A;  3F46 A;  1QSP A;  4KC9 A;  2KNH A;  3JT1 A;  3LEO A;  2LIG A;  5FZT A;  4MW3 A;  5DVW A;  2EIK C;  3NMI A;  1NZE A;  1M56 C;  1OQC A;  1QZX A;  3RVY A;  4BPM A;  1Q0K A;  5E3C A;  1T6Q A;  1FAP B;  1CPQ A;  1RMV A;  1EA8 A;  4DBR A;  4GQH A;  2ZXR A;  2J9V A;  2WZG A;  1O3U A;  2OU6 A;  5L0I A;  1JAF A;  1U0B B;  4G78 A;  4U9E A;  2KW3 C;  3HLZ A;  3C8G D;  2RSE B;  2VC9 A;  2HS5 A;  2MYS A;  5E2Q A;  3ZTZ A;  3ZIB A;  3B71 A;  2CDQ A;  2PX3 A;  3FHD A;  4CIH A;  1ZHY A;  4PJN A;  2ETS A;  1R5I D;  1CGM E;  4BJ6 A;  4C7O B;  2YLI A;  3C18 A;  2C04 A;  5JP7 A;  4CIP A;  5L0D A;  1YJG A;  1K04 A;  2XLD A;  1NLX A;  3ZTM A;  4Q7C A;  1Z6A A;  1YA9 A;  3Q7L A;  3TQO A;  1YA7 O;  1NFN A;  1AVO B;  2CW0 F;  1C17 M;  1Z3I X;  1SYQ A;  1YAR O;  4N4W A;  4I1O B;  4H54 A;  2Q9A A;  5D92 A;  4DRH B;  2L6F A;  4EBJ A;  4OIR F;  5JVE A;  4NY3 A;  3FAP B;  1KTM A;  3IQC A;  1OCO C;  5F5F A;  3EZI A;  2FAP B;  3AQC A;  1S7Z A;  1QVX A;  1WGW A;  3DJN B;  3MBG A;  4FWV A;  3S28 A;  3UMI A;  1M2V A;  5HSW A;  2ZD9 A;  1YLM A;  4BJ1 A;  4E7Z A;  5F5H A;  2XLH A;  4MVS A;  3AGT A;  2J46 A;  5CI8 A;  3JCU Q;  1MMA A;  1RXQ A;  3LS1 A;  1WTY A;  1VYI A;  2RD9 A;  1LS4 A;  3ATP A;  3LEV A;  1L7C A;  4ULV A;  2CNW A;  5A6A A;  3JTL O;  2YLG A;  3SXK A;  3NYL A;  3DM5 A;  3KYJ A;  4MVR A;  2MWQ A;  3M4C A;  1ZHT A;  4G0H A;  2BL2 A;  3VF0 A;  4C3E A;  3B0V C;  1FMV A;  2NPU A;  3U2L A;  2KQ9 A;  1BR4 A;  4E0I A;  3DAF A;  3EGD B;  1FNT c;  3LAY A;  3UMK A;  3AG4 C;  5A6J A;  1FR0 A;  2EPO A;  5JT4 A;  1FTS A;  3VRC A;  1RKE B;  1RJ9 A;  3AGU A;  3GM3 A;  2IM8 A;  3SYN A;  3M79 A;  4G7O F;  1HE9 A;  2L7A A;  5EHH A;  2D5R B;  4XQ1 A;  1I4Y A;  4XEK A;  3SP1 A;  1OKK D;  1JOG A;  1I4Z A;  1SZI A;  4ANJ A;  5COM A;  4N06 A;  3RW0 A;  4E7S A;  5D91 A;  1LIH A;  4MVZ A;  4OD4 A;  2ZPA A;  3ZVR A;  3U0C A;  1JPN A;  1Q0F A;  3EH2 A;  2L6G A;  3ASN C;  4XPW A;  1TWH A;  2Y3B A;  4XWJ A;  3U3F A;  2VCC A;  1BR2 A;  4MVU A;  2EPL X;  4FX5 A;  2VCA A;  3N24 A;  1VOM A;  4W8K A;  4YJW A;  3DXJ F;  1XWJ A;  2DB4 A;  2EPN A;  3QVY A;  4IAO A;  1FMW A;  4JE9 A;  4JW1 A;  4HE8 D;  4IGG A;  4O7G A;  4I1M A;  2E87 A;  5L0G A;  1TWG A;  2PP4 A;  4Z9J A;  2CCY A;  3JYH A;  3L34 A;  2NG1 A;  1M2O A;  2XLE A;  2LP4 A;  1J8Y F;  2G3K A;  3G4X A;  2G62 A;  4KBL A;  3TJ5 A;  4AL0 A;  2R7V A;  5AC4 A;  1N1C A;  1JPJ A;  3EQL F;  5DQT A;  1YDI A;  1OR3 A;  3H65 A;  2DGJ A;  1D0X A;  5B1B C;  3EFO A;  1LVK A;  1F1M A;  1OW8 A;  4HEA J;  4CBE A;  3K6B A;  2EIJ C;  3EHN A;  4CSA C;  4J30 B;  4U5D E;  4C7O A;  1LE2 A;  4WJ0 A;  1LM3 B;  3GOD A;  4GYT A;  2OEX A;  3EHM A;  5L3V A;  1BBH A;  2CGE A;  1ZHZ A;  5B3I A;  4YT4 A;  5CI9 A;  1AEP A;  1OCC C;  5KYW A;  2IXP A;  1E2X A;  3GAN A;  3GWL A;  3ZC4 A;  3S90 A;  2B0J A;  2YL3 A;  3U8V A;  4EWC A;  1JMW A;  1ST6 A;  3U8P A;  2R7T A;  4NCQ A;  4BG0 A;  4A2N B;  2L6H A;  1NG1 A;  1LI7 A;  2GWW A;  1U6H A;  3F47 A;  3HNJ A;  3V7O A;  3W8H A;  4CJG A;  4X0R A;  1HE1 A;  2PF4 E;  3QTH A;  3TOL A;  1V55 C;  3DMD A;  3DAG A;  3EGX A;  3X2Q C;  1CGN A;  1D0Z A;  2LD6 A;  4O6Y A;  4EBB A;  3WHN A;  1QPU A;  3TD7 A;  4CX9 A;  4ZLD A;  3A11 A;  3JRT A;  3PMR A;  2A69 F;  2EIL C;  2OCC C;  1T01 A;  4I44 A;  1E84 A;  4K7B A;  2P1A A;  3N0T A;  3LNR A;  4E18 A;  2R7O A;  3LLK A;  2WZL A;  3QMK A;  3MYI A;  3CEX A;  2LFF A;  2A0B A;  2KJG A;  2Q4F A;  3R2P A;  3I5Q A;  4JTA B;  4NQF A;  1A7E A;  2R7R A;  3G4Z A;  2J9W A;  4A4A A;  2XL8 A;  3LES A;  1Z23 A;  3LNM B;  4C3D A;  1ZU5 A;  1YZC A;  3ZDL A;  3SXZ A;  1MND A;  3S27 A;  3AJM A;  3EFO B;  1E83 A;  1G5Z A;  3EGD A;  3QVZ A;  2H7B A;  1M57 C;  2OQM A;  2QTV A;  3Q7G A;  4MTG A;  2LQG A;  3ZQV A;  1LE4 A;  1I5N A;  3OWT A;  1ZVZ A;  1VYK A;  1H6G A;  3NMK A;  1BDJ B;  2LSE A;  1QKR A;  4JCZ A;  2IXN A;  3KKB A;  2Q3T A;  2HSQ A;  4PR9 A;  1HMD A;  2R9R B;  2HFI A;  3NYM A;  5KYW B;  2YLD A;  1G4W R;  3DI5 A;  3ABL C;  3IHU A;  1Q0M A;  1MMG A;  1T9K A;  3EH1 A;  1AUE A;  4DOZ A;  3NKE A;  1BZ4 A;  1YZA A;  1T6U A;  3AG2 C;  2IXM A;  4JEB A;  2XM4 A;  4D4X A;  3CZ6 A;  1B68 A;  4XEV A;  3S9O A;  4EKW A;  2R7W A;  2R7U A;  3POV A;  1R4T A;  1A0B A;  4J7T A;  3OEO A;  2PFD A;  2R05 A;  3V5Z A;  4C3B A;  3PDM P;  1HY5 A;  2HJ3 A;  4MQ9 F;  1K40 A;  4NC3 A;  4U9D A;  3L0I A;  4L6R A;  4AE4 A;  5DS4 A;  3R7C A;  1VTM P;  4XLP F;  4IRU A;  4U5B E;  3RVZ A;  3EG9 B;  2AP3 A;  3T4R A;  4G7H F;  1ORS C;  1MNE A;  1XZQ A;  1ORJ A;  1TFK B;  2BE5 F;  4NTF A;  4EBK A;  4RD9 A;  5A6B D;  2AVK A;  3EG9 A;  4P6I C;  4IWB A;  2YVK A;  3EZH A;  3KPH A;  2XL6 A;  4MS2 A;  3AOU A;  3VM6 A;  3GM2 A;  5JSL A;  4Z9I A;  1UFB A;  2HV6 A;  2J7P A;  3IQT A;  3JSZ A;  3K66 A;  2P0N A;  3SEO A;  4Q4Z F;  2XSE A;  2I8B A;  1C03 A;  3CQZ A;  3L1M A;  1NSG B;  2XLM A;  5COF A;  1PD1 A;  3S0X A;  1D0Y A;  2J9U A;  2Y3G A;  1ZW2 A;  2GA0 A;  3GEI A;  3MX3 A;  3W2W A;  4FES A;  2J8W A;  2UUI A;  4BEJ A;  2XLO A;  1RJ9 B;  1QQ3 A;  2CNW D;  3U2M A;  1KNY A;  5BUO A;  4Z9H A;  2XLW A;  4JUR I;  4CJO A;  4YT2 A;  2LK4 A;  2EPK X;  3B29 A;  1YAU O;  4W8P A;  1V54 C;  2WL8 A;  1Z5Z A;  2KGO A;  3BEH A;  3FXH A;  2HSB A;  5B3S C;  1C02 A;  3N2Z B;  4YL3 A;  2A6H F;  4AK9 A;  2A1D D;  3MLG A;  4XLN F;  3K1I A;  4I3M A;  2YZS A;  3DE9 A;  2QLA A;  1NU9 C;  4BJ5 A;  3UGP A;  2ZXW C;  2FFH A;  4PK4 A;  2UUH A;  3TJ6 A;  2F22 A;  3NMJ A;  3O6X A;  2R7Q A;  4JRZ A;  2YKZ A;  4CDY A;  2NUP B;  5JRA A;  3FAJ A;  3EGX B;  5JUA A;  5BQH A;  3CAX A;  3M15 A;  1Q0D A; 
#chains in the Genus database with same CATH homology
 1ZW2 A;  3MYI A;  3VF0 A;  1SYQ A;  2IBF A;  1ZW3 A;  3H2U A;  3RF3 A;  2X0C A;  4K1O A;  1XWJ A;  5L0I A;  1RKE A;  4IGG A;  5L0G A;  3S90 A;  4W8P A;  3ZDL A;  5L0J A;  2GDC A;  4EHP A;  1RKE B;  1ST6 A;  2L7A A;  4ONS A;  1DOV A;  4E17 A;  2GWW A;  3T6G B;  2LQG A;  1U6H A;  3TJ5 A;  4DJ9 A;  1ZVZ A;  1H6G A;  1U89 A;  1RKC A;  5L0C A;  1YDI A;  4P9T A;  5L0F A;  3TJ6 A;  1QKR A;  3H2V A;  2B0H A;  5L0D A;  1TR2 A;  2HSQ A;  4PR9 A;  5FZT A;  1L7C A;  5L0H A;  1T01 A;  4E18 A;  1DOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...