2L7AA

Solution structure of the talin vbs2b domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
GIDPFTAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2l7aA00
1TR2A 3H2VA 1QKRA 3S90A 2HSQA 4W8PA 1H6GA 1T01A 4P9TA 4ONSA 1U89A 2X0CA 3TJ5A 3MYIA 2GDCA 5L0HA 1DOVA 5L0JA 4E18A 3H2UA 3VF0A 2GWWA 4IGGA 3ZDLA 1SYQA 1RKEB 2B0HA 5L0GA 3RF3A 2L7AA 4E17A 5L0IA 2LQGA 1L7CA 1YDIA 1DOWA 1RKEA 5L0FA 1XWJA 3T6GB 4PR9A 1ZW3A 5L0CA 1ZW2A 4DJ9A 1ST6A 5FZTA 1ZVZA 3TJ6A 2IBFA 1U6HA 4K1OA 5L0DA 4EHPA 1RKCA
chains in the Genus database with same CATH superfamily
4U5BE 2J0XA 3AGUA 3ZG1A 1AUEA 1VYIA 3U8VA 2QUPA 3CAXA 3EQLF 3T9OA 1TR2A 3S90A 1H9TA 4W8PA 2V3CC 1W2WA 3K1IA 3X2QC 2HS5A 3B0UX 3U0CA 1M56C 4C7OA 3IQ5A 4ULWA 3VRCA 1E86A 2HFIA 3B71A 4JE9A 3RQGA 5F5FA 5CI8A 4WGZA 3NMKA 2J9BA 3JRMO 4YJWA 4DRJB 2J9VA 1RJ9A 2WVQA 4P6IC 2YEVA 2YZSA 2YRFA 4E17A 1D1CA 3KH2A 3L34A 3AQCA 2MHRA 5A6BD 3JSEO 2LFFA 3UNGC 2X51A 1T6UA 3EGXA 4YT5A 2XSEA 2P7VA 2HV6A 3VYWA 2A6EF 2M4EA 1LS1A 2CCYA 5TJ5E 2H7VC 3WG7C 2CGEA 3S84A 3NDBB 1U0BB 1B68A 4O7GA 4BPMA 2PF4E 1D1BA 1CGME 3DKAA 3ASOC 1Y6DA 1D1AA 1LE4A 4CS9A 4Q7CA 4MTOA 2OU6A 1J8YF 1T9KA 2KNHA 1FFTC 3T6JA 1OW8A 3SXYA 3V5ZA 4E18A 3SEOA 2GWWA 4IGGA 1APCA 3I5QA 2MWQA 2WL8A 3CZ6A 4Z9IA 2PX3A 2JX0A 2YL0A 3SYNA 3GODA 2IXMA 1WOLA 5L0IA 4GEHA 1ORYA 4XWJA 3T6GB 3EFOA 3S28A 1ZW2A 2NUPA 5JS5A 3W8HA 3KYJA 2YL1A 4NCQA 3RQEA 3AQBA 4HFFB 4C3DA 1SR2A 1ORSC 4K7BA 2J0WA 3U3FA 1JR8A 2J45A 1OCZC 1RKCA 3C8ZA 4IARA 3QW0A 4A4AA 1CGNA 4EWCA 4IRUA 1CPQA 2BL2A 3KKBA 4CBEA 2HSQA 4A2NB 5KYYB 2FGYA 3T6BA 3ZVRA 3U3BA 3L1MA 3ZIBA 3FMSA 1EA8A 1MNDA 2EINC 4YN0B 2XRHA 3WHNA 1E2XA 4LLEA 5L3VA 2G3VA 2PP4A 4XTKA 1A0BA 1BBHA 2Z15A 2G3KA 4JIOA 1NU7D 3C8GB 4RBNA 2XL6A 3JZ0A 1CPRA 2HJMA 4QI0A 5BQHA 3E9VA 1L7CA 1OKKA 3CQZA 4ZLDA 5A6AA 3C7JA 2AVKA 4KC9A 4O6YA 4PR9A 2DYSC 2XL4A 3ZC4A 2KQ9A 1HW2A 3RFYA 2ZXRA 4DXWA 3AOUA 4PJNA 1LI5A 1Q0GA 2VC9A 2LIGA 5KYNA 1YA7O 3N24A 3FVYA 3GEHA 1H9GA 3EHNA 3DZAA 4CJGA 4X0RA 4DVYP 5T1DB 3DE9A 4U5HA 2NG1A 1H7IA 3A11A 5CIVA 4R32A 4H54A 1VB5A 2ETSA 4GYTA 4O6MA 1BR1A 3IQ6A 2AWCA 4AL0A 4BEMJ 3AJMA 4CDVA 4PJLA 4D4XA 3GM1A 1YYJA 4LACB 2YQYA 4PJJA 4U5CE 4U5DE 5COMA 4YL3A 4XEFA 4YWQA 3PHF2 4OD5A 3EH1A 1A7DA 3HTKC 1I4ZA 3AGTA 4LERA 4K1OA 3U9MA 2V26A 5COFA 3JYYA 1LIHA 3KPHA 2B0HA 2R7UA 2CW0F 1HW1A 2H7BA 5DS6A 2A1DD 1OCOC 1G4WR 2O9XA 3IPMO 4C3EA 1WATA 3GORA 4CJOA 4DBQA 2R7XA 1SMYF 5KYYA 2PNOA 1EQ1A 1DOVA 3TULA 1FAPB 3U2LA 1TWAA 2ZXWC 3ABLC 3FAJA 1Q0KA 1QZXA 1ZZPA 3EHMA 2RD9A 2L7AA 3PDMP 4OIPF 3HNKA 3LAYA 4XPWA 1DOWA 5IY5C 3J06A 3C8GA 3O39A 1XWJA 2I15A 3QMKA 3X1OA 4B6IA 3F46A 1EKYA 4CS8C 3PCVA 4CIHA 1TFOB 4U5EE 5KYXB 3V7OA 2JD3A 1SF8A 2PX0A 3K66A 4MVUA 3DWWA 3EGDA 4J32B 4HE8D 4AK9A 1M2VB 1FTSA 1BR2A 2XXAB 4IJJA 3SZRA 3AG4C 1XZPA 1J8MF 3TK0A 3O6XA 4YL0A 4IAOA 1MQVA 1V4AA 3K6BA 2Q7RA 1YYXA 2W9YA 5L0HA 3L8IA 5L0JA 1S7ZA 3LNMB 1OKKD 2GA0A 1RKEB 4U5FE 1XZQA 3BEHA 2CDQA 1LE2A 2WVOA 2ZPAA 3GWLA 3US6A 5DQZA 4CIPA 3QW1A 2R03A 2YLDA 3LLIA 5DQTA 2TMVP 4I1OB 3NYMA 3QZCA 4DRHB 2WZGA 1V54C 2NSFA 2Q00A 3Q7GA 4ZLCA 2ZD9A 1G5ZA 1U6HA 1EI7A 1MMAA 5L0DA 1LM3B 4BJ1A 1A41A 1JPJA 4H4KC 1VOMA 4WJ0A 4G7OF 2AWYA 2J46A 4XEVA 3SXKA 1QKRA 2AU5A 5BQIA 1Q0DA 5F5HA 5KYUB 3LLKA 5HV9A 4OINF 3EJNA 3POVA 1GGQA 2Y39A 4D4NA 2XL8A 4KNWA 4EIYA 4PACA 5T3WA 2KK1A 3K1IC 3TQOA 1MMNA 2HV7A 1F1MA 4P9FA 3MFNA 3TD7A 4MNDA 2A68F 4CDYA 3RVYA 2EPLX 3GM2A 2Y3GA 5F28E 5A6KA 2IOQA 3Q7LA 2EIKC 4LLCA 5BQGA 3HNJA 5E3CA 3W2WA 3ZTMA 3W2VA 2CYDA 3EG9B 3TOMA 3EZIA 4DJ9A 3UMKA 3RVZA 2R02A 2Q9AA 1PCXA 1TWCA 3DD7A 3WODF 2MYSA 3CEXA 3RYLA 3K1HA 2R7OA 3QTHA 5JP7A 1JAFA 2JPUA 1OCCC 5DVWA 1G4US 1PV3A 4KI2A 4I44A 1KNYA 2W4MA 1JOGA 4CX9A 3LESA 4OD4A 1D0ZA 4NC3A 2ZXOA 1Y4CA 3E70C 2QY9A 3OA1A 3B0VC 2L6HA 2XLVA 4ONSA 2F22A 2HMZA 4AX2A 2XXAA 1QVXA 4FESA 1C02A 4N06A 5E33A 1TFKB 3QVZA 1JMWA 2P0NA 3MLGA 2D5RB 3FAPB 2OJED 3VF0A 4CS9C 1NG1A 2EPKX 1MMDA 4J7YA 2R25A 2EIMC 3ZQYA 4BJ6A 4JEBA 3FDQA 1RKEA 4MW8A 4XEKA 3GEEA 1UG7A 2KGOA 2VB6A 3ABMC 2G62A 4N4WA 1HE9A 3U2MA 4M63A 1ST6A 1Z7Qc 2DI3A 1FFHA 1NSGB 2XS1A 3FOOA 4J30B 2WVNA 3HKKA 5DS4A 1T6IA 3PMRA 2OEVA 2VH3A 4EHPA 1NZEA 3MBGA 1AEPA 2E87A 2OG2A 2ZXPA 2OKUA 1C17M 1LS4A 1OXKA 3C63A 1GS9A 3JSZA 4JTDB 5COGA 4CSAC 1H6GA 2J9UA 2QLAA 4OIRF 3RIPA 4JRZA 4G7HF 2ASRA 1ZHTA 1T6QA 3JTLO 3O10A 3NRHA 3I4UA 4AL1A 2NUTB 3ZSUA 2KC3A 3ZDLA 1SYQA 2WZLA 2AP3A 4GQHA 4EBJA 5CI9A 5D91A 5JUAA 4DBRA 3NG1A 1M6TA 4O6NA 2XM0A 3UMHA 4MW3A 1D0YA 3LUTB 2HMQA 2EIJC 5A6BA 1NU9C 1WN0A 1LKXA 4G78A 3S0XA 1A7VA 1YJGA 1A7EA 3ABKC 3EG9A 3G4ZA 4JCHA 4EKWA 1Q0FA 3R2PA 1JRAA 3NKDA 1TWGA 3FOPA 4C7OB 3L0IA 3EZHA 3SP1A 5AC4A 4NTAA 4Q5SF 1HMOA 1E84A 4LDKA 4E7ZA 3KL4A 5B3IA 4Q4ZF 1FR0A 2YVKA 3FHDA 2DB4A 1RXQA 4MQ9F 4JVSA 2GDCA 2KYHA 2LK4A 2R05A 3JCUQ 1YAUO 4JKVA 1Z6AA 2W4BA 2VCBA 2C03A 4HFKB 3DAGA 3K33A 3NMJA 1VYKA 3HJCA 4QDLA 3U9JA 2OOCA 1WWPA 2A0BA 2J7PA 3AG1C 1NFNA 1IW7F 2LSEA 2C04A 1S05A 5EGYA 2XLMA 4NTBA 4KNVA 3Q6NA 1GQAA 3EH2A 4BJTA 4JC7A 2PBEA 1NBBA 3B0PA 1TQGA 4FWVA 5JT4A 1OR2A 1Q0MA 2BE5F 5JVEA 4E7SA 1PD1A 1Z23A 3RQFA 3IEEA 3SNHA 1IZMA 2OCCC 1UFBA 3T4RA 2BC5A 4F4BA 4E0IA 3N0TA 3UGOA 2A6HF 1FNTc 3NMIA 3SXMA 2A0UA 2R7RA 1BR4A 4MS2A 1U89A 1VLSA 4EBKA 1I5NA 3ECSA 2Q3TA 2FFHA 3B9QA 3GANA 1BDJB 3JT1A 2Y3HA 4MVSA 4U9EA 3DE8A 1WGWA 2ICWG 3ASNC 4YT8A 5BUOA 3UGPA 3M1CB 1SZIA 1O3UA 1PD0A 2XM4A 2DYRC 3EFOB 5AGFA 1Z3IX 3LS0A 2NUTA 2NUPB 4EBBA 1QSPA 4BG0A 4DVZA 3G50A 3F47A 4BJ5C 5FCLA 3ZTZA 1ZU4A 2LFDA 3JYHA 1K40A 4XPYA 4U9DA 5GPGB 4IWBA 2EPMX 1K04A 2QE9A 1OXBA 1YVIA 2Q9BA 1CGOA 2IXPA 4MVMA 2HSBA 4JCZA 3UR3C 2D4UA 4CS7A 3CSKA 2OEXA 1QLEC 1BZ4A 1VMAA 4P9TA 2KJGA 3V5XA 4J7TA 2RSEB 1KTMA 2YWAA 3AG3C 4ULVA 3UMIA 3HLZA 4OIOF 1YARO 2DGJA 3A9CA 1O87A 3VM6A 4AE4B 3I5PA 1AVOB 1MMGA 1OCRC 4ER9A 3MX3A 256BA 2R9RB 3S9OA 2OQMA 1YDIA 4O79A 2M64A 2OJQA 3IQCA 3DAFA 4PJMA 5L0FA 3GM3A 2IXNA 3BRJA 1K05A 1FMWA 4JURI 3KMIA 2L6GA 2VASA 4XQ1A 5A6JA 4XLPF 2CNWA 1D0XA 1OW7A 1WTYA 2I8BA 3DJNB 1R4TA 2Y3BA 2XS8A 5FZTA 3WAQA 5AC5A 5A69A 2EPOA 2Q9CA 3L8JA 2GAQA 5L3QA 3JRTA 4LDRA 5KYWB 1OQCA 4JZAA 2HJ3A 4XLNF 1O5HA 5KYXA 4E0HA 2R7VA 1M2OA 4JJGA 1I4YA 2LCHA 4Z9HA 4C3BA 4OIQF 3NYLA 4G0HA 3Q6MA 2KSFA 1Z5ZA 2QNLA 3TJ5A 1M2VA 3TOLA 3ZQVA 2J7PD 4PK4A 3W8IA 4BEJA 5JRAA 1G8XA 4MVRA 3C8GD 1ORJA 2HZ8A 3M4CA 1ZHXA 3W4YA 3G4XA 4N6CA 3B29A 3ZWIA 2QTVA 1LPEA 4CSAA 2R7WA 2H8AA 4MVOA 2EILC 1VK5A 4NTFA 3SXZA 2IXOA 5DS5A 1GM5A 1ZHWA 3HNIA 3IHUA 1N1CA 2YLGA 5EHHA 1ZU5A 2L9JA 4UDVA 4EUKB 3M4BA 1YA9A 5E3AA 3M15A 1HE1A 1LI7A 2A69F 2GFHA 2YLIA 4U5GA 5KYUA 2HUJA 4FAPB 4MVZA 2KW3C 4MTGA 2H7OA 2FAPB 2Q4FA 4WABA 3RKOF 2VCAA 3LS1A 1YZCA 4RDAA 2HKVA 4AE4A 1HMDA 3OEOA 2B0JA 3DI5A 1RMVA 1YLMA 4PFPA 3H65A 3EGDB 4MTFA 2W45A 3S29A 3MYFA 5DLJA 3V5YA 4CDAA 1ZVZA 3TJ6A 4BJ6C 1FMVA 4I1MA 3LEOA 3KYIA 1WASA 2PFDA 4W8KA 4N6HA 4YL1A 5T3TA 1KU2A 1Z63A 2R7TA 2J8WA 4KBLA 2UUHA 1T5OA 1TKNA 2VCCA 2WB7A 2Y69C 1TWHA 4L6RA 5KYWA 4DOZA 1VTMP 3ITFA 4IAQA 2L6FA 2X0CA 1LVKA 2LD6A 4YT4A 2IYLD 3EPVA 1ZYRF 1V55C 3MYIA 1RJ9B 3DM5A 3HNLA 2P6VA 5HSWA 5K0IA 3N2ZB 3NKEA 2YKZA 3S27A 5L0GA 1M57C 1RCPA 2WZFA 2CNWD 3RF3A 4CS8A 2YHSA 1YZAA 3EGXB 3FXHA 2R7QA 2YL7A 3M79A 4Z9JA 2IM8A 1ZW3A 1HY5A 5E2QA 1OW6A 4I3MA 1L3PA 5JLIA 4DRIB 3ATPA 3U5SA 5B3SC 1E83A 1ZHZA 3IQTA 3AG2C 1NLXA 1VLTA 2J9WA 3LJBA 3U8PA 4QI2A 2XLDA 4JTAB 3RW0A 2UUIA 3OWTA 4JJFA 4IB4A 2NSGA 3H2VA 4NQFA 1QPUA 1ZHYA 4FX5A 4JW1A 1T01A 2XLHA 3K7DA 4NY3A 5B1AC 3RH3A 2XLWA 2XLOA 2EPNA 4PFOA 4ANJA 2P61A 4JTCB 2R7SA 2NPUA 2P1AA 3GWNA 1C03A 1QQ3A 4MVQA 4G7ZF 1V74B 3C62A 4WGYA 4RD9A 1R5ID 3H2UA 3LEVA 4LDQA 2YL3A 5EK0A 3R7CA 4BJ5A 1NFOA 4K0DA 3VAYA 3QVYA 4JEAA 3NYJA 4YK5A 2LQGA 2LP4A 3C18A 3GEIA 3DJUB 3O55A 3DXJF 1E85A 1MNEA 5L0CA 4XPXA 5JSLA 1OR3A 2Y3DA 5B1BC 1JPNA 2IBFA 3LNRA 2XLEA 5D92A 3DM9B 4HEAJ 2L81A 4YT2A 3DMDA
chains in the Genus database with same CATH topology
1TR2A 3H2VA 1QKRA 3S90A 2HSQA 4W8PA 1H6GA 1T01A 4P9TA 4ONSA 1U89A 2X0CA 3TJ5A 3MYIA 2GDCA 5L0HA 1DOVA 5L0JA 4E18A 3H2UA 3VF0A 2GWWA 4IGGA 3ZDLA 1SYQA 1RKEB 2B0HA 5L0GA 3RF3A 2L7AA 4E17A 5L0IA 2LQGA 1L7CA 1YDIA 1DOWA 1RKEA 5L0FA 1XWJA 3T6GB 4PR9A 1ZW3A 5L0CA 1ZW2A 4DJ9A 1ST6A 5FZTA 1ZVZA 3TJ6A 2IBFA 1U6HA 4K1OA 5L0DA 4EHPA 1RKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR2 A;  3H2V A;  1QKR A;  3S90 A;  2HSQ A;  4W8P A;  1H6G A;  1T01 A;  4P9T A;  4ONS A;  1U89 A;  2X0C A;  3TJ5 A;  3MYI A;  2GDC A;  5L0H A;  1DOV A;  5L0J A;  4E18 A;  3H2U A;  3VF0 A;  2GWW A;  4IGG A;  3ZDL A;  1SYQ A;  1RKE B;  2B0H A;  5L0G A;  3RF3 A;  2L7A A;  4E17 A;  5L0I A;  2LQG A;  1L7C A;  1YDI A;  1DOW A;  1RKE A;  5L0F A;  1XWJ A;  3T6G B;  4PR9 A;  1ZW3 A;  5L0C A;  1ZW2 A;  4DJ9 A;  1ST6 A;  5FZT A;  1ZVZ A;  3TJ6 A;  2IBF A;  1U6H A;  4K1O A;  5L0D A;  4EHP A;  1RKC A; 
#chains in the Genus database with same CATH topology
 4U5B E;  2J0X A;  3AGU A;  3ZG1 A;  1AUE A;  1VYI A;  3U8V A;  2QUP A;  3CAX A;  3EQL F;  3T9O A;  1TR2 A;  3S90 A;  1H9T A;  4W8P A;  2V3C C;  1W2W A;  3K1I A;  3X2Q C;  2HS5 A;  3B0U X;  3U0C A;  1M56 C;  4C7O A;  3IQ5 A;  4ULW A;  3VRC A;  1E86 A;  2HFI A;  3B71 A;  4JE9 A;  3RQG A;  5F5F A;  5CI8 A;  4WGZ A;  3NMK A;  2J9B A;  3JRM O;  4YJW A;  4DRJ B;  2J9V A;  1RJ9 A;  2WVQ A;  4P6I C;  2YEV A;  2YZS A;  2YRF A;  4E17 A;  1D1C A;  3KH2 A;  3L34 A;  3AQC A;  2MHR A;  5A6B D;  3JSE O;  2LFF A;  3UNG C;  2X51 A;  1T6U A;  3EGX A;  4YT5 A;  2XSE A;  2P7V A;  2HV6 A;  3VYW A;  2A6E F;  2M4E A;  1LS1 A;  2CCY A;  5TJ5 E;  2H7V C;  3WG7 C;  2CGE A;  3S84 A;  3NDB B;  1U0B B;  1B68 A;  4O7G A;  4BPM A;  2PF4 E;  1D1B A;  1CGM E;  3DKA A;  3ASO C;  1Y6D A;  1D1A A;  1LE4 A;  4CS9 A;  4Q7C A;  4MTO A;  2OU6 A;  1J8Y F;  1T9K A;  2KNH A;  1FFT C;  3T6J A;  1OW8 A;  3SXY A;  3V5Z A;  4E18 A;  3SEO A;  2GWW A;  4IGG A;  1APC A;  3I5Q A;  2MWQ A;  2WL8 A;  3CZ6 A;  4Z9I A;  2PX3 A;  2JX0 A;  2YL0 A;  3SYN A;  3GOD A;  2IXM A;  1WOL A;  5L0I A;  4GEH A;  1ORY A;  4XWJ A;  3T6G B;  3EFO A;  3S28 A;  1ZW2 A;  2NUP A;  5JS5 A;  3W8H A;  3KYJ A;  2YL1 A;  4NCQ A;  3RQE A;  3AQB A;  4HFF B;  4C3D A;  1SR2 A;  1ORS C;  4K7B A;  2J0W A;  3U3F A;  1JR8 A;  2J45 A;  1OCZ C;  1RKC A;  3C8Z A;  4IAR A;  3QW0 A;  4A4A A;  1CGN A;  4EWC A;  4IRU A;  1CPQ A;  2BL2 A;  3KKB A;  4CBE A;  2HSQ A;  4A2N B;  5KYY B;  2FGY A;  3T6B A;  3ZVR A;  3U3B A;  3L1M A;  3ZIB A;  3FMS A;  1EA8 A;  1MND A;  2EIN C;  4YN0 B;  2XRH A;  3WHN A;  1E2X A;  4LLE A;  5L3V A;  2G3V A;  2PP4 A;  4XTK A;  1A0B A;  1BBH A;  2Z15 A;  2G3K A;  4JIO A;  1NU7 D;  3C8G B;  4RBN A;  2XL6 A;  3JZ0 A;  1CPR A;  2HJM A;  4QI0 A;  5BQH A;  3E9V A;  1L7C A;  1OKK A;  3CQZ A;  4ZLD A;  5A6A A;  3C7J A;  2AVK A;  4KC9 A;  4O6Y A;  4PR9 A;  2DYS C;  2XL4 A;  3ZC4 A;  2KQ9 A;  1HW2 A;  3RFY A;  2ZXR A;  4DXW A;  3AOU A;  4PJN A;  1LI5 A;  1Q0G A;  2VC9 A;  2LIG A;  5KYN A;  1YA7 O;  3N24 A;  3FVY A;  3GEH A;  1H9G A;  3EHN A;  3DZA A;  4CJG A;  4X0R A;  4DVY P;  5T1D B;  3DE9 A;  4U5H A;  2NG1 A;  1H7I A;  3A11 A;  5CIV A;  4R32 A;  4H54 A;  1VB5 A;  2ETS A;  4GYT A;  4O6M A;  1BR1 A;  3IQ6 A;  2AWC A;  4AL0 A;  4BEM J;  3AJM A;  4CDV A;  4PJL A;  4D4X A;  3GM1 A;  1YYJ A;  4LAC B;  2YQY A;  4PJJ A;  4U5C E;  4U5D E;  5COM A;  4YL3 A;  4XEF A;  4YWQ A;  3PHF 2;  4OD5 A;  3EH1 A;  1A7D A;  3HTK C;  1I4Z A;  3AGT A;  4LER A;  4K1O A;  3U9M A;  2V26 A;  5COF A;  3JYY A;  1LIH A;  3KPH A;  2B0H A;  2R7U A;  2CW0 F;  1HW1 A;  2H7B A;  5DS6 A;  2A1D D;  1OCO C;  1G4W R;  2O9X A;  3IPM O;  4C3E A;  1WAT A;  3GOR A;  4CJO A;  4DBQ A;  2R7X A;  1SMY F;  5KYY A;  2PNO A;  1EQ1 A;  1DOV A;  3TUL A;  1FAP B;  3U2L A;  1TWA A;  2ZXW C;  3ABL C;  3FAJ A;  1Q0K A;  1QZX A;  1ZZP A;  3EHM A;  2RD9 A;  2L7A A;  3PDM P;  4OIP F;  3HNK A;  3LAY A;  4XPW A;  1DOW A;  5IY5 C;  3J06 A;  3C8G A;  3O39 A;  1XWJ A;  2I15 A;  3QMK A;  3X1O A;  4B6I A;  3F46 A;  1EKY A;  4CS8 C;  3PCV A;  4CIH A;  1TFO B;  4U5E E;  5KYX B;  3V7O A;  2JD3 A;  1SF8 A;  2PX0 A;  3K66 A;  4MVU A;  3DWW A;  3EGD A;  4J32 B;  4HE8 D;  4AK9 A;  1M2V B;  1FTS A;  1BR2 A;  2XXA B;  4IJJ A;  3SZR A;  3AG4 C;  1XZP A;  1J8M F;  3TK0 A;  3O6X A;  4YL0 A;  4IAO A;  1MQV A;  1V4A A;  3K6B A;  2Q7R A;  1YYX A;  2W9Y A;  5L0H A;  3L8I A;  5L0J A;  1S7Z A;  3LNM B;  1OKK D;  2GA0 A;  1RKE B;  4U5F E;  1XZQ A;  3BEH A;  2CDQ A;  1LE2 A;  2WVO A;  2ZPA A;  3GWL A;  3US6 A;  5DQZ A;  4CIP A;  3QW1 A;  2R03 A;  2YLD A;  3LLI A;  5DQT A;  2TMV P;  4I1O B;  3NYM A;  3QZC A;  4DRH B;  2WZG A;  1V54 C;  2NSF A;  2Q00 A;  3Q7G A;  4ZLC A;  2ZD9 A;  1G5Z A;  1U6H A;  1EI7 A;  1MMA A;  5L0D A;  1LM3 B;  4BJ1 A;  1A41 A;  1JPJ A;  4H4K C;  1VOM A;  4WJ0 A;  4G7O F;  2AWY A;  2J46 A;  4XEV A;  3SXK A;  1QKR A;  2AU5 A;  5BQI A;  1Q0D A;  5F5H A;  5KYU B;  3LLK A;  5HV9 A;  4OIN F;  3EJN A;  3POV A;  1GGQ A;  2Y39 A;  4D4N A;  2XL8 A;  4KNW A;  4EIY A;  4PAC A;  5T3W A;  2KK1 A;  3K1I C;  3TQO A;  1MMN A;  2HV7 A;  1F1M A;  4P9F A;  3MFN A;  3TD7 A;  4MND A;  2A68 F;  4CDY A;  3RVY A;  2EPL X;  3GM2 A;  2Y3G A;  5F28 E;  5A6K A;  2IOQ A;  3Q7L A;  2EIK C;  4LLC A;  5BQG A;  3HNJ A;  5E3C A;  3W2W A;  3ZTM A;  3W2V A;  2CYD A;  3EG9 B;  3TOM A;  3EZI A;  4DJ9 A;  3UMK A;  3RVZ A;  2R02 A;  2Q9A A;  1PCX A;  1TWC A;  3DD7 A;  3WOD F;  2MYS A;  3CEX A;  3RYL A;  3K1H A;  2R7O A;  3QTH A;  5JP7 A;  1JAF A;  2JPU A;  1OCC C;  5DVW A;  1G4U S;  1PV3 A;  4KI2 A;  4I44 A;  1KNY A;  2W4M A;  1JOG A;  4CX9 A;  3LES A;  4OD4 A;  1D0Z A;  4NC3 A;  2ZXO A;  1Y4C A;  3E70 C;  2QY9 A;  3OA1 A;  3B0V C;  2L6H A;  2XLV A;  4ONS A;  2F22 A;  2HMZ A;  4AX2 A;  2XXA A;  1QVX A;  4FES A;  1C02 A;  4N06 A;  5E33 A;  1TFK B;  3QVZ A;  1JMW A;  2P0N A;  3MLG A;  2D5R B;  3FAP B;  2OJE D;  3VF0 A;  4CS9 C;  1NG1 A;  2EPK X;  1MMD A;  4J7Y A;  2R25 A;  2EIM C;  3ZQY A;  4BJ6 A;  4JEB A;  3FDQ A;  1RKE A;  4MW8 A;  4XEK A;  3GEE A;  1UG7 A;  2KGO A;  2VB6 A;  3ABM C;  2G62 A;  4N4W A;  1HE9 A;  3U2M A;  4M63 A;  1ST6 A;  1Z7Q c;  2DI3 A;  1FFH A;  1NSG B;  2XS1 A;  3FOO A;  4J30 B;  2WVN A;  3HKK A;  5DS4 A;  1T6I A;  3PMR A;  2OEV A;  2VH3 A;  4EHP A;  1NZE A;  3MBG A;  1AEP A;  2E87 A;  2OG2 A;  2ZXP A;  2OKU A;  1C17 M;  1LS4 A;  1OXK A;  3C63 A;  1GS9 A;  3JSZ A;  4JTD B;  5COG A;  4CSA C;  1H6G A;  2J9U A;  2QLA A;  4OIR F;  3RIP A;  4JRZ A;  4G7H F;  2ASR A;  1ZHT A;  1T6Q A;  3JTL O;  3O10 A;  3NRH A;  3I4U A;  4AL1 A;  2NUT B;  3ZSU A;  2KC3 A;  3ZDL A;  1SYQ A;  2WZL A;  2AP3 A;  4GQH A;  4EBJ A;  5CI9 A;  5D91 A;  5JUA A;  4DBR A;  3NG1 A;  1M6T A;  4O6N A;  2XM0 A;  3UMH A;  4MW3 A;  1D0Y A;  3LUT B;  2HMQ A;  2EIJ C;  5A6B A;  1NU9 C;  1WN0 A;  1LKX A;  4G78 A;  3S0X A;  1A7V A;  1YJG A;  1A7E A;  3ABK C;  3EG9 A;  3G4Z A;  4JCH A;  4EKW A;  1Q0F A;  3R2P A;  1JRA A;  3NKD A;  1TWG A;  3FOP A;  4C7O B;  3L0I A;  3EZH A;  3SP1 A;  5AC4 A;  4NTA A;  4Q5S F;  1HMO A;  1E84 A;  4LDK A;  4E7Z A;  3KL4 A;  5B3I A;  4Q4Z F;  1FR0 A;  2YVK A;  3FHD A;  2DB4 A;  1RXQ A;  4MQ9 F;  4JVS A;  2GDC A;  2KYH A;  2LK4 A;  2R05 A;  3JCU Q;  1YAU O;  4JKV A;  1Z6A A;  2W4B A;  2VCB A;  2C03 A;  4HFK B;  3DAG A;  3K33 A;  3NMJ A;  1VYK A;  3HJC A;  4QDL A;  3U9J A;  2OOC A;  1WWP A;  2A0B A;  2J7P A;  3AG1 C;  1NFN A;  1IW7 F;  2LSE A;  2C04 A;  1S05 A;  5EGY A;  2XLM A;  4NTB A;  4KNV A;  3Q6N A;  1GQA A;  3EH2 A;  4BJT A;  4JC7 A;  2PBE A;  1NBB A;  3B0P A;  1TQG A;  4FWV A;  5JT4 A;  1OR2 A;  1Q0M A;  2BE5 F;  5JVE A;  4E7S A;  1PD1 A;  1Z23 A;  3RQF A;  3IEE A;  3SNH A;  1IZM A;  2OCC C;  1UFB A;  3T4R A;  2BC5 A;  4F4B A;  4E0I A;  3N0T A;  3UGO A;  2A6H F;  1FNT c;  3NMI A;  3SXM A;  2A0U A;  2R7R A;  1BR4 A;  4MS2 A;  1U89 A;  1VLS A;  4EBK A;  1I5N A;  3ECS A;  2Q3T A;  2FFH A;  3B9Q A;  3GAN A;  1BDJ B;  3JT1 A;  2Y3H A;  4MVS A;  4U9E A;  3DE8 A;  1WGW A;  2ICW G;  3ASN C;  4YT8 A;  5BUO A;  3UGP A;  3M1C B;  1SZI A;  1O3U A;  1PD0 A;  2XM4 A;  2DYR C;  3EFO B;  5AGF A;  1Z3I X;  3LS0 A;  2NUT A;  2NUP B;  4EBB A;  1QSP A;  4BG0 A;  4DVZ A;  3G50 A;  3F47 A;  4BJ5 C;  5FCL A;  3ZTZ A;  1ZU4 A;  2LFD A;  3JYH A;  1K40 A;  4XPY A;  4U9D A;  5GPG B;  4IWB A;  2EPM X;  1K04 A;  2QE9 A;  1OXB A;  1YVI A;  2Q9B A;  1CGO A;  2IXP A;  4MVM A;  2HSB A;  4JCZ A;  3UR3 C;  2D4U A;  4CS7 A;  3CSK A;  2OEX A;  1QLE C;  1BZ4 A;  1VMA A;  4P9T A;  2KJG A;  3V5X A;  4J7T A;  2RSE B;  1KTM A;  2YWA A;  3AG3 C;  4ULV A;  3UMI A;  3HLZ A;  4OIO F;  1YAR O;  2DGJ A;  3A9C A;  1O87 A;  3VM6 A;  4AE4 B;  3I5P A;  1AVO B;  1MMG A;  1OCR C;  4ER9 A;  3MX3 A;  256B A;  2R9R B;  3S9O A;  2OQM A;  1YDI A;  4O79 A;  2M64 A;  2OJQ A;  3IQC A;  3DAF A;  4PJM A;  5L0F A;  3GM3 A;  2IXN A;  3BRJ A;  1K05 A;  1FMW A;  4JUR I;  3KMI A;  2L6G A;  2VAS A;  4XQ1 A;  5A6J A;  4XLP F;  2CNW A;  1D0X A;  1OW7 A;  1WTY A;  2I8B A;  3DJN B;  1R4T A;  2Y3B A;  2XS8 A;  5FZT A;  3WAQ A;  5AC5 A;  5A69 A;  2EPO A;  2Q9C A;  3L8J A;  2GAQ A;  5L3Q A;  3JRT A;  4LDR A;  5KYW B;  1OQC A;  4JZA A;  2HJ3 A;  4XLN F;  1O5H A;  5KYX A;  4E0H A;  2R7V A;  1M2O A;  4JJG A;  1I4Y A;  2LCH A;  4Z9H A;  4C3B A;  4OIQ F;  3NYL A;  4G0H A;  3Q6M A;  2KSF A;  1Z5Z A;  2QNL A;  3TJ5 A;  1M2V A;  3TOL A;  3ZQV A;  2J7P D;  4PK4 A;  3W8I A;  4BEJ A;  5JRA A;  1G8X A;  4MVR A;  3C8G D;  1ORJ A;  2HZ8 A;  3M4C A;  1ZHX A;  3W4Y A;  3G4X A;  4N6C A;  3B29 A;  3ZWI A;  2QTV A;  1LPE A;  4CSA A;  2R7W A;  2H8A A;  4MVO A;  2EIL C;  1VK5 A;  4NTF A;  3SXZ A;  2IXO A;  5DS5 A;  1GM5 A;  1ZHW A;  3HNI A;  3IHU A;  1N1C A;  2YLG A;  5EHH A;  1ZU5 A;  2L9J A;  4UDV A;  4EUK B;  3M4B A;  1YA9 A;  5E3A A;  3M15 A;  1HE1 A;  1LI7 A;  2A69 F;  2GFH A;  2YLI A;  4U5G A;  5KYU A;  2HUJ A;  4FAP B;  4MVZ A;  2KW3 C;  4MTG A;  2H7O A;  2FAP B;  2Q4F A;  4WAB A;  3RKO F;  2VCA A;  3LS1 A;  1YZC A;  4RDA A;  2HKV A;  4AE4 A;  1HMD A;  3OEO A;  2B0J A;  3DI5 A;  1RMV A;  1YLM A;  4PFP A;  3H65 A;  3EGD B;  4MTF A;  2W45 A;  3S29 A;  3MYF A;  5DLJ A;  3V5Y A;  4CDA A;  1ZVZ A;  3TJ6 A;  4BJ6 C;  1FMV A;  4I1M A;  3LEO A;  3KYI A;  1WAS A;  2PFD A;  4W8K A;  4N6H A;  4YL1 A;  5T3T A;  1KU2 A;  1Z63 A;  2R7T A;  2J8W A;  4KBL A;  2UUH A;  1T5O A;  1TKN A;  2VCC A;  2WB7 A;  2Y69 C;  1TWH A;  4L6R A;  5KYW A;  4DOZ A;  1VTM P;  3ITF A;  4IAQ A;  2L6F A;  2X0C A;  1LVK A;  2LD6 A;  4YT4 A;  2IYL D;  3EPV A;  1ZYR F;  1V55 C;  3MYI A;  1RJ9 B;  3DM5 A;  3HNL A;  2P6V A;  5HSW A;  5K0I A;  3N2Z B;  3NKE A;  2YKZ A;  3S27 A;  5L0G A;  1M57 C;  1RCP A;  2WZF A;  2CNW D;  3RF3 A;  4CS8 A;  2YHS A;  1YZA A;  3EGX B;  3FXH A;  2R7Q A;  2YL7 A;  3M79 A;  4Z9J A;  2IM8 A;  1ZW3 A;  1HY5 A;  5E2Q A;  1OW6 A;  4I3M A;  1L3P A;  5JLI A;  4DRI B;  3ATP A;  3U5S A;  5B3S C;  1E83 A;  1ZHZ A;  3IQT A;  3AG2 C;  1NLX A;  1VLT A;  2J9W A;  3LJB A;  3U8P A;  4QI2 A;  2XLD A;  4JTA B;  3RW0 A;  2UUI A;  3OWT A;  4JJF A;  4IB4 A;  2NSG A;  3H2V A;  4NQF A;  1QPU A;  1ZHY A;  4FX5 A;  4JW1 A;  1T01 A;  2XLH A;  3K7D A;  4NY3 A;  5B1A C;  3RH3 A;  2XLW A;  2XLO A;  2EPN A;  4PFO A;  4ANJ A;  2P61 A;  4JTC B;  2R7S A;  2NPU A;  2P1A A;  3GWN A;  1C03 A;  1QQ3 A;  4MVQ A;  4G7Z F;  1V74 B;  3C62 A;  4WGY A;  4RD9 A;  1R5I D;  3H2U A;  3LEV A;  4LDQ A;  2YL3 A;  5EK0 A;  3R7C A;  4BJ5 A;  1NFO A;  4K0D A;  3VAY A;  3QVY A;  4JEA A;  3NYJ A;  4YK5 A;  2LQG A;  2LP4 A;  3C18 A;  3GEI A;  3DJU B;  3O55 A;  3DXJ F;  1E85 A;  1MNE A;  5L0C A;  4XPX A;  5JSL A;  1OR3 A;  2Y3D A;  5B1B C;  1JPN A;  2IBF A;  3LNR A;  2XLE A;  5D92 A;  3DM9 B;  4HEA J;  2L81 A;  4YT2 A;  3DMD A; 
#chains in the Genus database with same CATH homology
 1TR2 A;  3H2V A;  1QKR A;  3S90 A;  2HSQ A;  4W8P A;  1H6G A;  1T01 A;  4P9T A;  4ONS A;  1U89 A;  2X0C A;  3TJ5 A;  3MYI A;  2GDC A;  5L0H A;  1DOV A;  5L0J A;  4E18 A;  3H2U A;  3VF0 A;  2GWW A;  4IGG A;  3ZDL A;  1SYQ A;  1RKE B;  2B0H A;  5L0G A;  3RF3 A;  2L7A A;  4E17 A;  5L0I A;  2LQG A;  1L7C A;  1YDI A;  1DOW A;  1RKE A;  5L0F A;  1XWJ A;  3T6G B;  4PR9 A;  1ZW3 A;  5L0C A;  1ZW2 A;  4DJ9 A;  1ST6 A;  5FZT A;  1ZVZ A;  3TJ6 A;  2IBF A;  1U6H A;  4K1O A;  5L0D A;  4EHP A;  1RKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...