2L7AA

Solution structure of the talin vbs2b domain
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
131
Chain Sequence
GIDPFTAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Talin-1
publication title RIAM and vinculin binding to talin are mutually exclusive and regulate adhesion assembly and turnover.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2l7aA00
2GDCA 2L7AA 4W8PA 4EHPA 1DOVA 5L0FA 1SYQA 1H6GA 4DJ9A 1RKEA 5FZTA 4P9TA 5L0DA 5L0GA 1QKRA 3VF0A 2GWWA 3TJ5A 1XWJA 4ONSA 1DOWA 2IBFA 5L0IA 2HSQA 3T6GB 4E18A 3S90A 1ZVZA 1YDIA 1ZW2A 4K1OA 3TJ6A 1RKEB 2LQGA 1RKCA 3H2VA 1U89A 1L7CA 2X0CA 3ZDLA 1T01A 1U6HA 1ZW3A 3H2UA 3MYIA 1TR2A 4E17A 5L0JA 4PR9A 5L0CA 2B0HA 3RF3A 4IGGA 1ST6A 5L0HA
chains in the Genus database with same CATH superfamily
2P61A 4LLCA 4MVRA 1VYIA 2KYHA 5AGFA 3ZQVA 1T6QA 3RYLA 1LE2A 2H8AA 5CI9A 1AUEA 1Z5ZA 1LM3B 3AOUA 4CS8A 5A6BD 2BC5A 4JCZA 2I15A 4AE4B 5KYYB 4YJWA 2RSEB 4ULVA 3RQEA 1DOWA 2YL0A 1J8MF 5DS4A 4C7OA 1I4ZA 1YDIA 2IXMA 4B6IA 5JT4A 4NCQA 1U89A 3C63A 3S27A 3E70C 3KYJA 3M4CA 2Q7RA 3T6JA 1BR4A 1KU2A 2QTVA 3EFOB 4U5EE 1FFTC 2J45A 4IAQA 4WGYA 3S29A 5EHHA 1K05A 2EPOA 2Q9AA 5IY5C 4JCHA 3N24A 1E84A 1Z6AA 1BR1A 2P0NA 2ETSA 2C04A 3RF3A 1LS1A 4A2NB 4LDKA 1TFKB 2W9YA 2NSFA 3FHDA 3NKEA 1TKNA 2WZLA 4J7TA 3G4XA 5CI8A 1H6GA 3PMRA 3O10A 5L0FA 1V74B 1LIHA 2VH3A 2A0BA 3FMSA 1QLEC 3ABKC 5JP7A 2L6FA 2WZFA 3MYFA 2HSQA 3JSEO 3TD7A 4E18A 1H7IA 2TMVP 1FMVA 4DBQA 3SZRA 3TK0A 3FOPA 4O6NA 3AG2C 4C3EA 4CBEA 1G8XA 1EQ1A 3H2VA 1ZHWA 3Q7LA 1HE1A 5KYUB 3GEHA 2L6GA 1SMYF 2MWQA 3MX3A 3DWWA 4IB4A 4YL0A 1C03A 2G3KA 4HE8D 1EKYA 2IM8A 1YVIA 3FDQA 1OCCC 3LLIA 4OINF 1OKKD 2R7OA 3EGDB 4U5CE 2XL6A 4IRUA 1EA8A 2R9RB 1MQVA 3LS1A 1V55C 2R7RA 1T6UA 4CJGA 3W2WA 5BQHA 3RVZA 1HMOA 2EILC 2VASA 2WB7A 4N06A 3RFYA 2OU6A 3B9QA 4G7HF 1CGME 2OJQA 2XM0A 1JPJA 3AG3C 4MW8A 3T6GB 2LSEA 1OXBA 2HJ3A 2L9JA 2YEVA 3EG9A 3K1IA 4QDLA 5E3AA 4LERA 1M6TA 5E3CA 2HMZA 2AWYA 4YT2A 2AVKA 4OD4A 3FOOA 4JEAA 1LI5A 1MNEA 2YL1A 2G62A 4FX5A 3JCUQ 3K1IC 2HFIA 5JLIA 5L0HA 3FXHA 4MTFA 2L7AA 1M57C 4YT5A 2XS1A 3WHNA 5T3TA 3VM6A 4DVZA 4FAPB 5A6BA 3B0UX 1WOLA 3LNMB 1QKRA 4CIHA 3O6XA 1BBHA 2CW0F 3K7DA 3GM3A 1H9GA 4XEKA 3U5SA 1Q0FA 1M2VA 2AWCA 3DE8A 1O87A 2J9UA 4NTAA 2R02A 5CIVA 2VCCA 4K1OA 1Q0KA 1M56C 2A68F 2HV6A 3C8GA 2LCHA 3LESA 2YVKA 3L8IA 5F5FA 3TOMA 5KYWA 2BL2A 2RD9A 3T6BA 1Y4CA 3U3BA 4RBNA 2X51A 1FR0A 1D1AA 4QI0A 1J8YF 4J30B 4AL1A 3W4YA 3L8JA 2J8WA 4BJ5A 1WWPA 1OCZC 5DLJA 5DS6A 2O9XA 1GM5A 2XRHA 4XPWA 2Y69C 5T3WA 3UMHA 2NUTB 3U2MA 2A0UA 1BR2A 2YL3A 3LUTB 2Y3DA 4CDVA 2DYRC 1RJ9B 2EPKX 2YRFA 4JC7A 1OCOC 3DMDA 1VMAA 4O6MA 1O3UA 2A6HF 1A0BA 1XWJA 4K7BA 5DS5A 2LD6A 3PCVA 1NZEA 1ORJA 2Y3HA 1OW8A 3B71A 3GODA 3ITFA 4N4WA 4Q7CA 4NTBA 3V5ZA 3ZIBA 2YHSA 3NMIA 3U9MA 2F22A 1CGOA 2QNLA 2VCAA 1ZW3A 4X0RA 3RIPA 3H2UA 4GYTA 3DXJF 1E86A 3FAPB 1CGNA 2EIJC 2WVNA 3C62A 2OG2A 2XLOA 4DRHB 4AX2A 1WATA 1K40A 4JEBA 2IXOA 4C7OB 1GS9A 1A41A 1OKKA 2CDQA 1ZHZA 5COGA 5COMA 4HFKB 1NFNA 1ZYRF 1YZCA 3S28A 3UNGC 2GDCA 3DZAA 2Q00A 3KYIA 3DJNB 4RD9A 1V54C 1W2WA 4YL3A 4HFFB 5JSLA 2DGJA 4U9EA 4Q5SF 3ASOC 4G78A 2ZXOA 1WTYA 4OIRF 3NYMA 2Z15A 3UR3C 2IOQA 3EGXA 4BJTA 5AC5A 3QW1A 1BZ4A 2Y3BA 1KTMA 2PX3A 5F5HA 3NRHA 2JD3A 2LQGA 1RKCA 3B0VC 1MNDA 3LJBA 1TWHA 2XSEA 2Y39A 3ZDLA 1T01A 1U6HA 3NYJA 3C8GD 3GM2A 4CS8C 3CEXA 1QVXA 1NFOA 3DKAA 4E17A 5A6AA 2UUIA 4Q4ZF 3PDMP 1OQCA 4G7ZF 4CX9A 4YL1A 2B0HA 4EKWA 3M15A 2KW3C 1D1BA 4KBLA 5COFA 4DXWA 1FFHA 2EPNA 3NKDA 4KI2A 1IW7F 1JMWA 1YYJA 3OWTA 3K6BA 2XLWA 4BPMA 4ER9A 4XEVA 2CYDA 3RQGA 2MYSA 3QVZA 2D5RB 4I1MA 2HSBA 4P9TA 5EGYA 1FTSA 4LLEA 1VLTA 1D0XA 5E2QA 5KYXB 3K33A 2H7OA 2E87A 3MLGA 3R2PA 3JYHA 4K0DA 3LEVA 2PX0A 5BQIA 4G7OF 3TJ6A 2ZD9A 1G4US 4Z9IA 1K04A 3AQBA 4N6CA 2J9WA 4JIOA 4JRZA 5DQTA 4BEMJ 1YLMA 2HMQA 5EK0A 1XZPA 1Y6DA 2Y3GA 3I4UA 4JJFA 3M4BA 4M63A 3B29A 2JX0A 1JR8A 4JZAA 5KYYA 2AU5A 3HJCA 1T6IA 3I5PA 4JTAB 1HW1A 1S05A 4BG0A 1NBBA 2A6EF 1SF8A 2L81A 4NTFA 1TWCA 1YJGA 4XPYA 1C17M 3V7OA 4DRIB 4CDYA 1ORSC 1DOVA 3R7CA 4BEJA 2R7UA 4BJ6A 2V26A 4CS9A 4PJJA 3HTKC 3EFOA 5A6JA 3GANA 2ZPAA 2ZXPA 3MFNA 2VB6A 4JTCB 4ONSA 2ZXWC 2NUPB 3NYLA 3RKOF 3OA1A 5FCLA 2IYLD 4ANJA 3NG1A 1EI7A 2H7VC 4P9FA 4CS9C 3LNRA 3MYIA 3KPHA 2XLMA 3JYYA 3U0CA 3EZIA 4PACA 2PFDA 1M2VB 4WJ0A 3UMKA 4F4BA 4YWQA 4O79A 3AG1C 4Z9JA 1G4WR 3IQTA 1WN0A 2HKVA 4CDAA 5L0CA 1WASA 1E83A 4EUKB 3HLZA 1HY5A 4JW1A 2R7WA 2OKUA 4GEHA 5KYWB 1ST6A 4OIOF 1B68A 3W8HA 4DRJB 4EBJA 3W8IA 2MHRA 2D4UA 4YN0B 3VRCA 4CJOA 1JOGA 4JE9A 2UUHA 5KYUA 3T4RA 3O55A 5JS5A 2ICWG 2KJGA 3GEIA 4MS2A 1VLSA 4O6YA 5B3SC 3IPMO 3KL4A 3JTLO 4YT4A 2PNOA 1MMDA 3ZVRA 2VCBA 5JUAA 3SXYA 2HZ8A 3GORA 1AEPA 1Z7Qc 4AL0A 4PR9A 1TQGA 2OEXA 3O39A 3U2LA 3LLKA 5A6KA 2HUJA 2KNHA 5JRAA 4LDRA 3QW0A 4E7ZA 5JVEA 3AGTA 3CZ6A 2P1AA 4CS7A 1O5HA 1RKEA 3DM9B 4ZLCA 4KC9A 2FAPB 4MVZA 4U5GA 2IXPA 4MVSA 3TULA 3VF0A 1BDJB 3L34A 2AP3A 3S9OA 2I8BA 4BJ5C 3K66A 2XLHA 1JAFA 1RXQA 1ZVZA 3JSZA 2QE9A 3L1MA 1TWGA 2XLVA 3BEHA 4NC3A 4EBBA 1GQAA 4XQ1A 3X1OA 4U5FE 3A9CA 2R7VA 2LFDA 3ECSA 1YAUO 1OW7A 3N2ZB 3C18A 4XLPF 3M1CB 2EINC 4Z9HA 4CIPA 5HV9A 2WZGA 3SXMA 3ZG1A 2C03A 4CSAA 1A7VA 2Q9CA 4PK4A 3UMIA 4EBKA 3AG4C 1QSPA 1JRAA 4UDVA 3UGOA 4RDAA 2CCYA 3U9JA 1NU7D 1TWAA 1I4YA 3ABLC 1NG1A 3U3FA 4ZLDA 2DI3A 5BQGA 1R5ID 4EHPA 1Q0MA 1ZHTA 4KNVA 1FNTc 1VTMP 3TQOA 4CSAC 4D4XA 3ABMC 2PF4E 5DVWA 3GWLA 1JPNA 2LK4A 3LEOA 2XXAA 4IAOA 1NSGB 4JVSA 3POVA 3E9VA 2M4EA 2OEVA 4IWBA 1F1MA 4U5HA 5BUOA 1UFBA 4KNWA 5TJ5E 3WAQA 4MVQA 1L7CA 1OW6A 1NU9C 2NUTA 1PD1A 3RH3A 2YZSA 4E0HA 1FAPB 1XZQA 1TR2A 4LDQA 5T1DB 4O7GA 4DVYP 3SYNA 2YWAA 1S7ZA 1Z23A 3DAGA 3HNLA 4PJMA 2V3CC 1N1CA 3CAXA 4J32B 4YK5A 1V4AA 2ZXRA 3S84A 3WG7C 4EIYA 2W4MA 3KKBA 3V5XA 2CNWA 5HSWA 4G0HA 3U8PA 1RCPA 4NQFA 3WODF 4L6RA 3EHNA 3HNJA 4JJGA 4W8PA 1T5OA 3MBGA 2J46A 1HW2A 3T9OA 1TFOB 5L0GA 2W45A 3GM1A 3C7JA 4E7SA 3U8VA 2ASRA 1PD0A 3DM5A 4PJLA 3AGUA 2J0WA 3ZTZA 3AJMA 1A7DA 5D91A 3EH1A 4XPXA 2QLAA 3JRTA 1AVOB 3TOLA 1D0YA 2J9BA 2OQMA 1H9TA 3K1HA 3Q6MA 2DYSC 5A69A 2PP4A 1E85A 1G5ZA 3DAFA 1OXKA 1E2XA 1CPQA 2B0JA 2YL7A 3EG9B 3Q6NA 4R32A 4AE4A 3SNHA 4H54A 4GQHA 4DOZA 1Q0GA 4PFPA 3EPVA 5DQZA 2FFHA 3DJUB 2HJMA 1YA9A 4DBRA 2A69F 4OIQF 3H65A 1LE4A 3F46A 3X2QC 1ZHXA 3ZQYA 4YT8A 4MVOA 5L0DA 3HNIA 3LS0A 3OEOA 2GWWA 3TJ5A 1ZHYA 1U0BB 1Z63A 2IBFA 1LKXA 1VYKA 1YARO 2VC9A 4J7YA 4XWJA 2KC3A 1WGWA 4E0IA 5L3VA 3BRJA 2A1DD 1QZXA 1OR3A 2J7PA 2NSGA 4MW3A 4XTKA 1PCXA 4MNDA 5B3IA 4BJ6C 1YYXA 4BJ1A 3EZHA 3SXZA 2FGYA 3NMKA 1QQ3A 5KYNA 2R7SA 5AC4A 3N0TA 2J0XA 4JURI 3M79A 2EIMC 2WVOA 3AQCA 5KYXA 4IARA 3C8GB 1A7EA 1HMDA 1LI7A 1YZAA 2Q3TA 5K0IA 3SP1A 2LIGA 2Q4FA 2R7XA 1C02A 3JT1A 2WVQA 2CNWD 4PJNA 3QZCA 4DJ9A 5FZTA 1NLXA 2YLGA 4C3DA 3KH2A 4OIPF 3G4ZA 2J9VA 1Q0DA 1UG7A 2Q9BA 4W8KA 2EPMX 2R7QA 4JKVA 1GGQA 1APCA 3ATPA 4JTDB 2G3VA 5D92A 4A4AA 2KGOA 4U5DE 4C3BA 1PV3A 4H4KC 1HE9A 1RKEB 1M2OA 2X0CA 3IEEA 1D0ZA 3EGDA 2PBEA 3ZSUA 3HKKA 3S0XA 3UGPA 3J06A 3EJNA 3L0IA 3QMKA 3CQZA 2OJED 3I5QA 2M64A 4U5BE 3ASNC 4I44A 3V5YA 3G50A 3QTHA 2KSFA 1KNYA 2NUPA 1MMAA 2P6VA 2LFFA 1OR2A 3SXKA 1OCRC 3CSKA 1SYQA 4XLNF 4NY3A 3IQCA 1LPEA 2XL8A 1YA7O 4WGZA 3EHMA 1RMVA 2XLEA 1ZZPA 2LP4A 3A11A 2XL4A 1FMWA 3B0PA 3Q7GA 3VAYA 5L0IA 2R05A 2P7VA 5F28E 3IQ5A 4ULWA 2YKZA 3JRMO 3RQFA 1ZW2A 3DD7A 4D4NA 4EWCA 4OD5A 2R7TA 3RW0A 2XLDA 2NPUA 3GEEA 3NMJA 256BA 2CGEA 2KK1A 2YQYA 4QI2A 1D1CA 3DE9A 3EGXB 4I1OB 3KMIA 2GAQA 2J7PD 2NG1A 2XS8A 3DI5A 2HV7A 4MQ9F 5B1AC 2XXAB 2XM4A 3FAJA 4MVMA 3F47A 1LS4A 2EIKC 3HNKA 3ZWIA 1Z3IX 1VB5A 1ZU5A 2R03A 1QPUA 4IGGA 1T9KA 2KQ9A 1ORYA 1VOMA 2L6HA 4PFOA 3C8ZA 1MMNA 2GA0A 4FESA 1R4TA 2EPLX 4MTOA 3GWNA 2DB4A 4LACB 4MVUA 5B1BC 3FVYA 4AK9A 1L3PA 1SR2A 4U9DA 2GFHA 3QVYA 5GPGB 1LVKA 3US6A 1VK5A 4FWVA 1ZU4A 3S90A 4XEFA 2YLIA 1SZIA 2YLDA 3NDBB 3LAYA 2H7BA 2WL8A 2OCCC 2IXNA 2BE5F 3VYWA 1IZMA 4HEAJ 4MTGA 1I5NA 2OOCA 2QUPA 3ZTMA 3EH2A 2QY9A 4I3MA 3SEOA 4WABA 5L3QA 3EQLF 1MMGA 5E33A 5L0JA 2R25A 3IHUA 3W2VA 4P6IC 3ZC4A 2W4BA 3JZ0A 1RJ9A 4N6HA 3RVYA 3IQ6A 2HS5A 3PHF2 2JPUA 4IJJA 1CPRA
chains in the Genus database with same CATH topology
2GDCA 2L7AA 4W8PA 4EHPA 1DOVA 5L0FA 1SYQA 1H6GA 4DJ9A 1RKEA 5FZTA 4P9TA 5L0DA 5L0GA 1QKRA 3VF0A 2GWWA 3TJ5A 1XWJA 4ONSA 1DOWA 2IBFA 5L0IA 2HSQA 3T6GB 4E18A 3S90A 1ZVZA 1YDIA 1ZW2A 4K1OA 3TJ6A 1RKEB 2LQGA 1RKCA 3H2VA 1U89A 1L7CA 2X0CA 3ZDLA 1T01A 1U6HA 1ZW3A 3H2UA 3MYIA 1TR2A 4E17A 5L0JA 4PR9A 5L0CA 2B0HA 3RF3A 4IGGA 1ST6A 5L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDC A;  2L7A A;  4W8P A;  4EHP A;  1DOV A;  5L0F A;  1SYQ A;  1H6G A;  4DJ9 A;  1RKE A;  5FZT A;  4P9T A;  5L0D A;  5L0G A;  1QKR A;  3VF0 A;  2GWW A;  3TJ5 A;  1XWJ A;  4ONS A;  1DOW A;  2IBF A;  5L0I A;  2HSQ A;  3T6G B;  4E18 A;  3S90 A;  1ZVZ A;  1YDI A;  1ZW2 A;  4K1O A;  3TJ6 A;  1RKE B;  2LQG A;  1RKC A;  3H2V A;  1U89 A;  1L7C A;  2X0C A;  3ZDL A;  1T01 A;  1U6H A;  1ZW3 A;  3H2U A;  3MYI A;  1TR2 A;  4E17 A;  5L0J A;  4PR9 A;  5L0C A;  2B0H A;  3RF3 A;  4IGG A;  1ST6 A;  5L0H A; 
#chains in the Genus database with same CATH topology
 2P61 A;  4LLC A;  4MVR A;  1VYI A;  2KYH A;  5AGF A;  3ZQV A;  1T6Q A;  3RYL A;  1LE2 A;  2H8A A;  5CI9 A;  1AUE A;  1Z5Z A;  1LM3 B;  3AOU A;  4CS8 A;  5A6B D;  2BC5 A;  4JCZ A;  2I15 A;  4AE4 B;  5KYY B;  4YJW A;  2RSE B;  4ULV A;  3RQE A;  1DOW A;  2YL0 A;  1J8M F;  5DS4 A;  4C7O A;  1I4Z A;  1YDI A;  2IXM A;  4B6I A;  5JT4 A;  4NCQ A;  1U89 A;  3C63 A;  3S27 A;  3E70 C;  3KYJ A;  3M4C A;  2Q7R A;  3T6J A;  1BR4 A;  1KU2 A;  2QTV A;  3EFO B;  4U5E E;  1FFT C;  2J45 A;  4IAQ A;  4WGY A;  3S29 A;  5EHH A;  1K05 A;  2EPO A;  2Q9A A;  5IY5 C;  4JCH A;  3N24 A;  1E84 A;  1Z6A A;  1BR1 A;  2P0N A;  2ETS A;  2C04 A;  3RF3 A;  1LS1 A;  4A2N B;  4LDK A;  1TFK B;  2W9Y A;  2NSF A;  3FHD A;  3NKE A;  1TKN A;  2WZL A;  4J7T A;  3G4X A;  5CI8 A;  1H6G A;  3PMR A;  3O10 A;  5L0F A;  1V74 B;  1LIH A;  2VH3 A;  2A0B A;  3FMS A;  1QLE C;  3ABK C;  5JP7 A;  2L6F A;  2WZF A;  3MYF A;  2HSQ A;  3JSE O;  3TD7 A;  4E18 A;  1H7I A;  2TMV P;  1FMV A;  4DBQ A;  3SZR A;  3TK0 A;  3FOP A;  4O6N A;  3AG2 C;  4C3E A;  4CBE A;  1G8X A;  1EQ1 A;  3H2V A;  1ZHW A;  3Q7L A;  1HE1 A;  5KYU B;  3GEH A;  2L6G A;  1SMY F;  2MWQ A;  3MX3 A;  3DWW A;  4IB4 A;  4YL0 A;  1C03 A;  2G3K A;  4HE8 D;  1EKY A;  2IM8 A;  1YVI A;  3FDQ A;  1OCC C;  3LLI A;  4OIN F;  1OKK D;  2R7O A;  3EGD B;  4U5C E;  2XL6 A;  4IRU A;  1EA8 A;  2R9R B;  1MQV A;  3LS1 A;  1V55 C;  2R7R A;  1T6U A;  4CJG A;  3W2W A;  5BQH A;  3RVZ A;  1HMO A;  2EIL C;  2VAS A;  2WB7 A;  4N06 A;  3RFY A;  2OU6 A;  3B9Q A;  4G7H F;  1CGM E;  2OJQ A;  2XM0 A;  1JPJ A;  3AG3 C;  4MW8 A;  3T6G B;  2LSE A;  1OXB A;  2HJ3 A;  2L9J A;  2YEV A;  3EG9 A;  3K1I A;  4QDL A;  5E3A A;  4LER A;  1M6T A;  5E3C A;  2HMZ A;  2AWY A;  4YT2 A;  2AVK A;  4OD4 A;  3FOO A;  4JEA A;  1LI5 A;  1MNE A;  2YL1 A;  2G62 A;  4FX5 A;  3JCU Q;  3K1I C;  2HFI A;  5JLI A;  5L0H A;  3FXH A;  4MTF A;  2L7A A;  1M57 C;  4YT5 A;  2XS1 A;  3WHN A;  5T3T A;  3VM6 A;  4DVZ A;  4FAP B;  5A6B A;  3B0U X;  1WOL A;  3LNM B;  1QKR A;  4CIH A;  3O6X A;  1BBH A;  2CW0 F;  3K7D A;  3GM3 A;  1H9G A;  4XEK A;  3U5S A;  1Q0F A;  1M2V A;  2AWC A;  3DE8 A;  1O87 A;  2J9U A;  4NTA A;  2R02 A;  5CIV A;  2VCC A;  4K1O A;  1Q0K A;  1M56 C;  2A68 F;  2HV6 A;  3C8G A;  2LCH A;  3LES A;  2YVK A;  3L8I A;  5F5F A;  3TOM A;  5KYW A;  2BL2 A;  2RD9 A;  3T6B A;  1Y4C A;  3U3B A;  4RBN A;  2X51 A;  1FR0 A;  1D1A A;  4QI0 A;  1J8Y F;  4J30 B;  4AL1 A;  3W4Y A;  3L8J A;  2J8W A;  4BJ5 A;  1WWP A;  1OCZ C;  5DLJ A;  5DS6 A;  2O9X A;  1GM5 A;  2XRH A;  4XPW A;  2Y69 C;  5T3W A;  3UMH A;  2NUT B;  3U2M A;  2A0U A;  1BR2 A;  2YL3 A;  3LUT B;  2Y3D A;  4CDV A;  2DYR C;  1RJ9 B;  2EPK X;  2YRF A;  4JC7 A;  1OCO C;  3DMD A;  1VMA A;  4O6M A;  1O3U A;  2A6H F;  1A0B A;  1XWJ A;  4K7B A;  5DS5 A;  2LD6 A;  3PCV A;  1NZE A;  1ORJ A;  2Y3H A;  1OW8 A;  3B71 A;  3GOD A;  3ITF A;  4N4W A;  4Q7C A;  4NTB A;  3V5Z A;  3ZIB A;  2YHS A;  3NMI A;  3U9M A;  2F22 A;  1CGO A;  2QNL A;  2VCA A;  1ZW3 A;  4X0R A;  3RIP A;  3H2U A;  4GYT A;  3DXJ F;  1E86 A;  3FAP B;  1CGN A;  2EIJ C;  2WVN A;  3C62 A;  2OG2 A;  2XLO A;  4DRH B;  4AX2 A;  1WAT A;  1K40 A;  4JEB A;  2IXO A;  4C7O B;  1GS9 A;  1A41 A;  1OKK A;  2CDQ A;  1ZHZ A;  5COG A;  5COM A;  4HFK B;  1NFN A;  1ZYR F;  1YZC A;  3S28 A;  3UNG C;  2GDC A;  3DZA A;  2Q00 A;  3KYI A;  3DJN B;  4RD9 A;  1V54 C;  1W2W A;  4YL3 A;  4HFF B;  5JSL A;  2DGJ A;  4U9E A;  4Q5S F;  3ASO C;  4G78 A;  2ZXO A;  1WTY A;  4OIR F;  3NYM A;  2Z15 A;  3UR3 C;  2IOQ A;  3EGX A;  4BJT A;  5AC5 A;  3QW1 A;  1BZ4 A;  2Y3B A;  1KTM A;  2PX3 A;  5F5H A;  3NRH A;  2JD3 A;  2LQG A;  1RKC A;  3B0V C;  1MND A;  3LJB A;  1TWH A;  2XSE A;  2Y39 A;  3ZDL A;  1T01 A;  1U6H A;  3NYJ A;  3C8G D;  3GM2 A;  4CS8 C;  3CEX A;  1QVX A;  1NFO A;  3DKA A;  4E17 A;  5A6A A;  2UUI A;  4Q4Z F;  3PDM P;  1OQC A;  4G7Z F;  4CX9 A;  4YL1 A;  2B0H A;  4EKW A;  3M15 A;  2KW3 C;  1D1B A;  4KBL A;  5COF A;  4DXW A;  1FFH A;  2EPN A;  3NKD A;  4KI2 A;  1IW7 F;  1JMW A;  1YYJ A;  3OWT A;  3K6B A;  2XLW A;  4BPM A;  4ER9 A;  4XEV A;  2CYD A;  3RQG A;  2MYS A;  3QVZ A;  2D5R B;  4I1M A;  2HSB A;  4P9T A;  5EGY A;  1FTS A;  4LLE A;  1VLT A;  1D0X A;  5E2Q A;  5KYX B;  3K33 A;  2H7O A;  2E87 A;  3MLG A;  3R2P A;  3JYH A;  4K0D A;  3LEV A;  2PX0 A;  5BQI A;  4G7O F;  3TJ6 A;  2ZD9 A;  1G4U S;  4Z9I A;  1K04 A;  3AQB A;  4N6C A;  2J9W A;  4JIO A;  4JRZ A;  5DQT A;  4BEM J;  1YLM A;  2HMQ A;  5EK0 A;  1XZP A;  1Y6D A;  2Y3G A;  3I4U A;  4JJF A;  3M4B A;  4M63 A;  3B29 A;  2JX0 A;  1JR8 A;  4JZA A;  5KYY A;  2AU5 A;  3HJC A;  1T6I A;  3I5P A;  4JTA B;  1HW1 A;  1S05 A;  4BG0 A;  1NBB A;  2A6E F;  1SF8 A;  2L81 A;  4NTF A;  1TWC A;  1YJG A;  4XPY A;  1C17 M;  3V7O A;  4DRI B;  4CDY A;  1ORS C;  1DOV A;  3R7C A;  4BEJ A;  2R7U A;  4BJ6 A;  2V26 A;  4CS9 A;  4PJJ A;  3HTK C;  3EFO A;  5A6J A;  3GAN A;  2ZPA A;  2ZXP A;  3MFN A;  2VB6 A;  4JTC B;  4ONS A;  2ZXW C;  2NUP B;  3NYL A;  3RKO F;  3OA1 A;  5FCL A;  2IYL D;  4ANJ A;  3NG1 A;  1EI7 A;  2H7V C;  4P9F A;  4CS9 C;  3LNR A;  3MYI A;  3KPH A;  2XLM A;  3JYY A;  3U0C A;  3EZI A;  4PAC A;  2PFD A;  1M2V B;  4WJ0 A;  3UMK A;  4F4B A;  4YWQ A;  4O79 A;  3AG1 C;  4Z9J A;  1G4W R;  3IQT A;  1WN0 A;  2HKV A;  4CDA A;  5L0C A;  1WAS A;  1E83 A;  4EUK B;  3HLZ A;  1HY5 A;  4JW1 A;  2R7W A;  2OKU A;  4GEH A;  5KYW B;  1ST6 A;  4OIO F;  1B68 A;  3W8H A;  4DRJ B;  4EBJ A;  3W8I A;  2MHR A;  2D4U A;  4YN0 B;  3VRC A;  4CJO A;  1JOG A;  4JE9 A;  2UUH A;  5KYU A;  3T4R A;  3O55 A;  5JS5 A;  2ICW G;  2KJG A;  3GEI A;  4MS2 A;  1VLS A;  4O6Y A;  5B3S C;  3IPM O;  3KL4 A;  3JTL O;  4YT4 A;  2PNO A;  1MMD A;  3ZVR A;  2VCB A;  5JUA A;  3SXY A;  2HZ8 A;  3GOR A;  1AEP A;  1Z7Q c;  4AL0 A;  4PR9 A;  1TQG A;  2OEX A;  3O39 A;  3U2L A;  3LLK A;  5A6K A;  2HUJ A;  2KNH A;  5JRA A;  4LDR A;  3QW0 A;  4E7Z A;  5JVE A;  3AGT A;  3CZ6 A;  2P1A A;  4CS7 A;  1O5H A;  1RKE A;  3DM9 B;  4ZLC A;  4KC9 A;  2FAP B;  4MVZ A;  4U5G A;  2IXP A;  4MVS A;  3TUL A;  3VF0 A;  1BDJ B;  3L34 A;  2AP3 A;  3S9O A;  2I8B A;  4BJ5 C;  3K66 A;  2XLH A;  1JAF A;  1RXQ A;  1ZVZ A;  3JSZ A;  2QE9 A;  3L1M A;  1TWG A;  2XLV A;  3BEH A;  4NC3 A;  4EBB A;  1GQA A;  4XQ1 A;  3X1O A;  4U5F E;  3A9C A;  2R7V A;  2LFD A;  3ECS A;  1YAU O;  1OW7 A;  3N2Z B;  3C18 A;  4XLP F;  3M1C B;  2EIN C;  4Z9H A;  4CIP A;  5HV9 A;  2WZG A;  3SXM A;  3ZG1 A;  2C03 A;  4CSA A;  1A7V A;  2Q9C A;  4PK4 A;  3UMI A;  4EBK A;  3AG4 C;  1QSP A;  1JRA A;  4UDV A;  3UGO A;  4RDA A;  2CCY A;  3U9J A;  1NU7 D;  1TWA A;  1I4Y A;  3ABL C;  1NG1 A;  3U3F A;  4ZLD A;  2DI3 A;  5BQG A;  1R5I D;  4EHP A;  1Q0M A;  1ZHT A;  4KNV A;  1FNT c;  1VTM P;  3TQO A;  4CSA C;  4D4X A;  3ABM C;  2PF4 E;  5DVW A;  3GWL A;  1JPN A;  2LK4 A;  3LEO A;  2XXA A;  4IAO A;  1NSG B;  4JVS A;  3POV A;  3E9V A;  2M4E A;  2OEV A;  4IWB A;  1F1M A;  4U5H A;  5BUO A;  1UFB A;  4KNW A;  5TJ5 E;  3WAQ A;  4MVQ A;  1L7C A;  1OW6 A;  1NU9 C;  2NUT A;  1PD1 A;  3RH3 A;  2YZS A;  4E0H A;  1FAP B;  1XZQ A;  1TR2 A;  4LDQ A;  5T1D B;  4O7G A;  4DVY P;  3SYN A;  2YWA A;  1S7Z A;  1Z23 A;  3DAG A;  3HNL A;  4PJM A;  2V3C C;  1N1C A;  3CAX A;  4J32 B;  4YK5 A;  1V4A A;  2ZXR A;  3S84 A;  3WG7 C;  4EIY A;  2W4M A;  3KKB A;  3V5X A;  2CNW A;  5HSW A;  4G0H A;  3U8P A;  1RCP A;  4NQF A;  3WOD F;  4L6R A;  3EHN A;  3HNJ A;  4JJG A;  4W8P A;  1T5O A;  3MBG A;  2J46 A;  1HW2 A;  3T9O A;  1TFO B;  5L0G A;  2W45 A;  3GM1 A;  3C7J A;  4E7S A;  3U8V A;  2ASR A;  1PD0 A;  3DM5 A;  4PJL A;  3AGU A;  2J0W A;  3ZTZ A;  3AJM A;  1A7D A;  5D91 A;  3EH1 A;  4XPX A;  2QLA A;  3JRT A;  1AVO B;  3TOL A;  1D0Y A;  2J9B A;  2OQM A;  1H9T A;  3K1H A;  3Q6M A;  2DYS C;  5A69 A;  2PP4 A;  1E85 A;  1G5Z A;  3DAF A;  1OXK A;  1E2X A;  1CPQ A;  2B0J A;  2YL7 A;  3EG9 B;  3Q6N A;  4R32 A;  4AE4 A;  3SNH A;  4H54 A;  4GQH A;  4DOZ A;  1Q0G A;  4PFP A;  3EPV A;  5DQZ A;  2FFH A;  3DJU B;  2HJM A;  1YA9 A;  4DBR A;  2A69 F;  4OIQ F;  3H65 A;  1LE4 A;  3F46 A;  3X2Q C;  1ZHX A;  3ZQY A;  4YT8 A;  4MVO A;  5L0D A;  3HNI A;  3LS0 A;  3OEO A;  2GWW A;  3TJ5 A;  1ZHY A;  1U0B B;  1Z63 A;  2IBF A;  1LKX A;  1VYK A;  1YAR O;  2VC9 A;  4J7Y A;  4XWJ A;  2KC3 A;  1WGW A;  4E0I A;  5L3V A;  3BRJ A;  2A1D D;  1QZX A;  1OR3 A;  2J7P A;  2NSG A;  4MW3 A;  4XTK A;  1PCX A;  4MND A;  5B3I A;  4BJ6 C;  1YYX A;  4BJ1 A;  3EZH A;  3SXZ A;  2FGY A;  3NMK A;  1QQ3 A;  5KYN A;  2R7S A;  5AC4 A;  3N0T A;  2J0X A;  4JUR I;  3M79 A;  2EIM C;  2WVO A;  3AQC A;  5KYX A;  4IAR A;  3C8G B;  1A7E A;  1HMD A;  1LI7 A;  1YZA A;  2Q3T A;  5K0I A;  3SP1 A;  2LIG A;  2Q4F A;  2R7X A;  1C02 A;  3JT1 A;  2WVQ A;  2CNW D;  4PJN A;  3QZC A;  4DJ9 A;  5FZT A;  1NLX A;  2YLG A;  4C3D A;  3KH2 A;  4OIP F;  3G4Z A;  2J9V A;  1Q0D A;  1UG7 A;  2Q9B A;  4W8K A;  2EPM X;  2R7Q A;  4JKV A;  1GGQ A;  1APC A;  3ATP A;  4JTD B;  2G3V A;  5D92 A;  4A4A A;  2KGO A;  4U5D E;  4C3B A;  1PV3 A;  4H4K C;  1HE9 A;  1RKE B;  1M2O A;  2X0C A;  3IEE A;  1D0Z A;  3EGD A;  2PBE A;  3ZSU A;  3HKK A;  3S0X A;  3UGP A;  3J06 A;  3EJN A;  3L0I A;  3QMK A;  3CQZ A;  2OJE D;  3I5Q A;  2M64 A;  4U5B E;  3ASN C;  4I44 A;  3V5Y A;  3G50 A;  3QTH A;  2KSF A;  1KNY A;  2NUP A;  1MMA A;  2P6V A;  2LFF A;  1OR2 A;  3SXK A;  1OCR C;  3CSK A;  1SYQ A;  4XLN F;  4NY3 A;  3IQC A;  1LPE A;  2XL8 A;  1YA7 O;  4WGZ A;  3EHM A;  1RMV A;  2XLE A;  1ZZP A;  2LP4 A;  3A11 A;  2XL4 A;  1FMW A;  3B0P A;  3Q7G A;  3VAY A;  5L0I A;  2R05 A;  2P7V A;  5F28 E;  3IQ5 A;  4ULW A;  2YKZ A;  3JRM O;  3RQF A;  1ZW2 A;  3DD7 A;  4D4N A;  4EWC A;  4OD5 A;  2R7T A;  3RW0 A;  2XLD A;  2NPU A;  3GEE A;  3NMJ A;  256B A;  2CGE A;  2KK1 A;  2YQY A;  4QI2 A;  1D1C A;  3DE9 A;  3EGX B;  4I1O B;  3KMI A;  2GAQ A;  2J7P D;  2NG1 A;  2XS8 A;  3DI5 A;  2HV7 A;  4MQ9 F;  5B1A C;  2XXA B;  2XM4 A;  3FAJ A;  4MVM A;  3F47 A;  1LS4 A;  2EIK C;  3HNK A;  3ZWI A;  1Z3I X;  1VB5 A;  1ZU5 A;  2R03 A;  1QPU A;  4IGG A;  1T9K A;  2KQ9 A;  1ORY A;  1VOM A;  2L6H A;  4PFO A;  3C8Z A;  1MMN A;  2GA0 A;  4FES A;  1R4T A;  2EPL X;  4MTO A;  3GWN A;  2DB4 A;  4LAC B;  4MVU A;  5B1B C;  3FVY A;  4AK9 A;  1L3P A;  1SR2 A;  4U9D A;  2GFH A;  3QVY A;  5GPG B;  1LVK A;  3US6 A;  1VK5 A;  4FWV A;  1ZU4 A;  3S90 A;  4XEF A;  2YLI A;  1SZI A;  2YLD A;  3NDB B;  3LAY A;  2H7B A;  2WL8 A;  2OCC C;  2IXN A;  2BE5 F;  3VYW A;  1IZM A;  4HEA J;  4MTG A;  1I5N A;  2OOC A;  2QUP A;  3ZTM A;  3EH2 A;  2QY9 A;  4I3M A;  3SEO A;  4WAB A;  5L3Q A;  3EQL F;  1MMG A;  5E33 A;  5L0J A;  2R25 A;  3IHU A;  3W2V A;  4P6I C;  3ZC4 A;  2W4B A;  3JZ0 A;  1RJ9 A;  4N6H A;  3RVY A;  3IQ6 A;  2HS5 A;  3PHF 2;  2JPU A;  4IJJ A;  1CPR A; 
#chains in the Genus database with same CATH homology
 2GDC A;  2L7A A;  4W8P A;  4EHP A;  1DOV A;  5L0F A;  1SYQ A;  1H6G A;  4DJ9 A;  1RKE A;  5FZT A;  4P9T A;  5L0D A;  5L0G A;  1QKR A;  3VF0 A;  2GWW A;  3TJ5 A;  1XWJ A;  4ONS A;  1DOW A;  2IBF A;  5L0I A;  2HSQ A;  3T6G B;  4E18 A;  3S90 A;  1ZVZ A;  1YDI A;  1ZW2 A;  4K1O A;  3TJ6 A;  1RKE B;  2LQG A;  1RKC A;  3H2V A;  1U89 A;  1L7C A;  2X0C A;  3ZDL A;  1T01 A;  1U6H A;  1ZW3 A;  3H2U A;  3MYI A;  1TR2 A;  4E17 A;  5L0J A;  4PR9 A;  5L0C A;  2B0H A;  3RF3 A;  4IGG A;  1ST6 A;  5L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...