4J30B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium, selenomethionine variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/inhibitor
molecule keywords Putative cytoplasmic protein
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j30B00
4HFKB 4AX2A 4J32B 4JURI 3ZIBA 4HFFB 4B6IA 4J30B
chains in the Genus database with same CATH superfamily
1OKKA 1OXBA 1NFNA 3F46A 3JRTA 3Q6NA 2RD9A 3ABLC 1DOVA 2LK4A 3UMHA 1I4YA 3AG3C 5L0CA 3GWNA 3AQBA 4MVUA 3DM9B 1J8MF 3SEOA 1M6TA 1NU9C 1R5ID 3EFOA 5GPGB 4AX2A 1A7VA 5EGYA 4CSAC 2QUPA 3NMKA 1LIHA 1K04A 1GM5A 4R32A 3ZQVA 2KJGA 3FAJA 3B0UX 1RMVA 3SXYA 3W4YA 4EHPA 3CZ6A 1LS1A 1VMAA 2XM4A 3LJBA 2Z15A 3V5ZA 3ZG1A 1HMDA 5D91A 2GDCA 2HMZA 2KQ9A 1S7ZA 2QTVA 4PJMA 3GEEA 4IAOA 1F1MA 3RQFA 2R9RB 1JPJA 3U9JA 4XEKA 2ETSA 2Y39A 2LP4A 5E33A 1U89A 2KGOA 3C7JA 5DS5A 3EJNA 1VK5A 2Y3BA 2CNWD 3EQLF 2PNOA 3C63A 3VM6A 3GODA 4AE4B 1MMAA 2XL4A 5BQHA 5B1BC 3RF3A 3C8GD 3OWTA 4MVZA 3TOMA 5BQIA 1RKEB 1BR1A 4IGGA 2P1AA 2XLOA 2W4MA 4IWBA 3GM3A 1AEPA 1HE1A 1C02A 4NY3A 2I15A 2A1DD 4MVSA 2XL8A 3ZDLA 4WGZA 4AE4A 3A11A 1OXKA 3SXKA 4JJFA 5L0HA 1W2WA 2D5RB 1ZHWA 2MWQA 1ZHXA 4I1MA 5E2QA 1RKEA 3JCUQ 1NFOA 2IBFA 4HFKB 5DQTA 5DS4A 2HV7A 1A7DA 5JS5A 1FR0A 4WGYA 3NMIA 2GWWA 1GQAA 2J0XA 3C62A 2VC9A 3G4ZA 4U5HA 2YZSA 4DOZA 1E83A 3PHF2 1C17M 1B68A 3EGDB 3ZVRA 1LPEA 4EIYA 1TQGA 1T6UA 3S90A 4QI2A 2JD3A 5DVWA 1MMDA 4MTOA 4H54A 2WL8A 2CYDA 2H7OA 4U9DA 3T9OA 3V5YA 3U2LA 4CJOA 2PX0A 4EWCA 2DGJA 1WWPA 2P7VA 4YJWA 2W45A 3DZAA 3T6BA 3U8PA 5KYNA 1T9KA 2IXMA 3EGDA 3S27A 1CGOA 5TJ5E 1Q0FA 4MS2A 4CDAA 3ECSA 2EILC 3G50A 3NYJA 4J7TA 4BEJA 1Q0GA 1IZMA 3LS1A 4BJ6C 3AJMA 4MTGA 5JSLA 1LVKA 3Q7GA 3HNKA 3FVYA 1FFHA 1QSPA 2EPMX 3AOUA 4I1OB 2XL6A 4J32B 4BPMA 3GORA 3LLIA 4P6IC 3WAQA 4YT4A 2AP3A 2AWYA 2D4UA 2EINC 2YL0A 3C8ZA 3LUTB 4EBJA 1C03A 3EZHA 1YJGA 1GS9A 4X0RA 1TFOB 3JRMO 3JSZA 2WB7A 2R7QA 1TKNA 1PV3A 2R25A 2R7SA 4O79A 4PJJA 4YT8A 1T5OA 2Q9AA 5AGFA 5A6BA 1NG1A 2M4EA 2XXAB 4Z9JA 4CSAA 2BE5F 1Q0DA 4HE8D 1YYXA 4CS7A 1ZVZA 2YLDA 2LSEA 5E3AA 2H7BA 2L9JA 2LD6A 4CJGA 1LS4A 1XZQA 3KPHA 4K7BA 4HFFB 4QDLA 5HSWA 1J8YF 2XLHA 2J9VA 2EIMC 1LE4A 1TWHA 1CPRA 2J46A 2NSGA 1E85A 3FXHA 4IARA 2J8WA 1E2XA 1G4WR 4U5GA 4IJJA 1U6HA 5KYWB 3US6A 3TOLA 2KK1A 3MX3A 4YT2A 2CGEA 1K40A 3DKAA 2A6EF 4C3BA 2A68F 2GAQA 5JRAA 4OIPF 2UUIA 1H6GA 2YKZA 1V4AA 2EIKC 4E0IA 4KNWA 3UR3C 2YVKA 2OG2A 3ZTZA 1HE9A 3KYJA 3TJ5A 3FDQA 2R02A 5KYWA 2WVOA 4MW8A 2KSFA 3E9VA 3DI5A 4JC7A 3LLKA 2Q3TA 4DRHB 3GM2A 1QLEC 3ZSUA 2J7PD 3FMSA 2LCHA 5L0JA 1NSGB 2VH3A 5COFA 1Y4CA 3ASOC 2RSEB 3U8VA 3TULA 2DI3A 3B29A 1ZHTA 3DJUB 4HEAJ 5AC5A 2B0HA 4BJ1A 4CX9A 2R7RA 3IQ5A 3E70C 3ASNC 3L8JA 4AL1A 4GEHA 4LDKA 3N24A 3JYYA 3CAXA 2GFHA 2XSEA 3QVYA 4O7GA 2VASA 1YZAA 1ZHYA 2UUHA 4LERA 1OCCC 1L3PA 1XWJA 2DB4A 3LEVA 3MLGA 3M4BA 3VF0A 3W2VA 2A69F 2EIJC 2IXOA 3PMRA 3TK0A 1D0YA 1YA9A 2XS1A 1TWCA 2G3VA 3CQZA 3GANA 3QMKA 1LM3B 3GEIA 4Q5SF 3L34A 3G4XA 4JKVA 4MVRA 2YRFA 4E7SA 3NDBB 2G3KA 3NMJA 4BJ6A 3SYNA 3QTHA 3S9OA 2C03A 2HJ3A 1IW7F 2L6GA 1MNEA 4ULWA 4DBRA 1VB5A 3S84A 2EPLX 1BBHA 2ASRA 1FTSA 3M4CA 1YVIA 1TFKB 1Z6AA 2XRHA 1VYKA 1D1AA 1JR8A 3ZTMA 5COGA 2HSBA 4NCQA 4JTAB 3JTLO 4O6NA 3M15A 2QY9A 3U3FA 4U5DE 1V54C 1G4US 1FMWA 2CW0F 4MVOA 3ZIBA 1N1CA 3QW1A 4N4WA 2HUJA 1SZIA 3PCVA 2Y3GA 4O6YA 1XZPA 2WZGA 3BEHA 4N06A 2MYSA 2XLEA 1VOMA 4BJ5A 2NUPB 4O6MA 5L0IA 4E0HA 3DAGA 2OEVA 2I8BA 3HNLA 3HLZA 3IEEA 1UG7A 4NTAA 3NRHA 2Q9BA 1A41A 3V5XA 4XPXA 1V55C 3RYLA 4UDVA 5FCLA 2YL3A 3EHNA 1JPNA 1T01A 2ZD9A 4JEAA 3JZ0A 3GEHA 2G62A 1VLSA 2JX0A 3RFYA 2NUPA 3H65A 2XS8A 1SR2A 4DJ9A 2Y3DA 3B0PA 3RKOF 4E7ZA 1EA8A 2J0WA 2YL7A 4U5BE 3MYFA 4FAPB 5K0IA 2V3CC 5KYUB 3O10A 3C8GB 2ZXOA 3K1IC 4N6CA 2HZ8A 1TWAA 2PFDA 4PACA 3FOOA 3JYHA 3RVZA 1CPQA 2CNWA 3CEXA 3S0XA 3LEOA 2J9WA 2XLMA 4N6HA 2P6VA 1ZYRF 4J7YA 1OCZC 5T3TA 2IXNA 5KYUA 2OKUA 2WZFA 4CDVA 3W8IA 3FAPB 4CS8C 2HSQA 1APCA 3V7OA 4AL0A 1FMVA 1RJ9B 4DBQA 3L1MA 2QE9A 4CIHA 5A6BD 2ZXPA 1TWGA 3M79A 4ONSA 1ZZPA 3M1CB 2F22A 4JCHA 4RDAA 1H7IA 3ABKC 3Q7LA 3IHUA 4YL1A 2OOCA 4MNDA 2XLWA 1RJ9A 2R7OA 4XLPF 1KU2A 5CI8A 2FFHA 2XLVA 3ATPA 4CBEA 1MMNA 4WABA 2KNHA 2TMVP 1YAUO 2IXPA 2Q4FA 3LNMB 3U9MA 3KMIA 4E17A 1HMOA 3LS0A 5DQZA 3EH1A 1ORSC 3DM5A 5DLJA 5F5FA 4BG0A 1EKYA 2J9UA 4MQ9F 5IY5C 4H4KC 1HW1A 2P0NA 4FESA 5A6AA 2XXAA 1T6QA 2W9YA 4W8PA 3RH3A 4B6IA 4DVYP 1EQ1A 4XQ1A 1OW6A 4DVZA 4D4NA 2YHSA 2KC3A 4U5FE 4KC9A 4D4XA 2IM8A 4ZLCA 1ST6A 4Q4ZF 2VB6A 3U2MA 5B3SC 4EKWA 3ZWIA 3WODF 4PFOA 3VYWA 1OR3A 4DXWA 1ZHZA 3AGUA 4ZLDA 1VLTA 4NQFA 1R4TA 1OR2A 2J45A 2PF4E 2PBEA 3BRJA 3FOPA 1YZCA 3IQTA 3KH2A 4MVQA 3TQOA 4F4BA 1U0BB 2FGYA 2ZPAA 1OKKD 1YLMA 3N2ZB 3AG2C 3K6BA 4M63A 1I4ZA 4EBBA 1Z5ZA 2OEXA 3B71A 1HY5A 4OIRF 4PJLA 5EK0A 2R7XA 3RIPA 2R7WA 4J30B 5B3IA 1WN0A 2Q7RA 1ZU5A 4U5EE 5CI9A 3RVYA 5EHHA 1A7EA 3QW0A 5BQGA 3HJCA 1EI7A 2HJMA 1DOWA 2Q00A 1D0XA 1LE2A 2QLAA 1H9GA 3JT1A 4JTDB 1CGNA 2WZLA 3SP1A 5KYYB 4JVSA 4L6RA 3U3BA 4BJTA 3L8IA 3EH2A 5AC4A 2A0UA 3EHMA 2OQMA 3SXMA 2GA0A 5JLIA 4YN0B 3KL4A 3AG4C 1YYJA 3EG9B 4CDYA 1KTMA 3GM1A 2E87A 3B0VC 3KYIA 2Q9CA 4A4AA 1D1CA 3SZRA 2J7PA 1ZW2A 4XWJA 3K33A 3OEOA 5L0DA 4P9TA 2R7UA 4XEVA 3EG9A 3I5PA 3WG7C 4BEMJ 1FFTC 4LDRA 1O87A 1O5HA 2YL1A 3UGOA 1YDIA 4OD4A 1PD0A 1WATA 3DD7A 3N0TA 2L7AA 3O6XA 1LI5A 4CS9C 5L3QA 2VCCA 4C7OB 2AU5A 1QVXA 2YQYA 2IOQA 3JSEO 1YA7O 1MNDA 2NPUA 3AGTA 2P61A 1NBBA 4YWQA 2Y3HA 1LKXA 4IAQA 4DRJB 4AK9A 4Q7CA 3H2VA 4Z9IA 1OCRC 1CGME 4DRIB 1D1BA 4P9FA 3UMIA 3DE8A 1M2VB 4JCZA 3SXZA 4EBKA 4C7OA 2AWCA 1S05A 3TD7A 1HW2A 3W2WA 1Q0MA 3U5SA 4LLEA 256BA 4KNVA 5T1DB 4PR9A 1OQCA 1ZW3A 2H7VC 2L6HA 1RXQA 3CSKA 3ZQYA 3RQEA 4G7OF 4IB4A 4JEBA 1M2VA 4JIOA 4EUKB 3HNIA 3HKKA 4K0DA 1QKRA 4IRUA 2VCAA 2X0CA 5L0GA 4XEFA 4NC3A 1BR4A 3NYMA 3Q6MA 4YT5A 4W8KA 1UFBA 4G78A 4JZAA 1NU7D 3IQCA 4XTKA 1ORYA 2QNLA 3MFNA 5A69A 4OIQF 3LNRA 4U9EA 1SYQA 1PCXA 2KW3C 3K7DA 5A6JA 1E84A 4KI2A 2IYLD 1PD1A 3DJNB 3MBGA 1FNTc 1Y6DA 1WOLA 3I5QA 3C8GA 4JRZA 2O9XA 2NUTB 2JPUA 2W4BA 2YLGA 3DMDA 3C18A 1WGWA 2YWAA 3NKDA 3X2QC 1GGQA 1NZEA 3LAYA 4ANJA 3UGPA 3ZC4A 4E18A 3FHDA 3R2PA 2WVQA 3EGXB 2FAPB 2WVNA 1Z3IX 4NTFA 4FX5A 2J9BA 3X1OA 1JAFA 5L0FA 2B0JA 1QQ3A 2NUTA 2LQGA 4RD9A 3HTKC 3T4RA 2PP4A 2HFIA 1KNYA 2YEVA 3UNGC 2LIGA 5F28E 5A6KA 5HV9A 2HKVA 5DS6A 4XPYA 1MQVA 1RKCA 4GQHA 4JJGA 4JURI 1JMWA 4PK4A 3T6JA 2AVKA 1VTMP 3EGXA 4I44A 1MMGA 4G0HA 4PJNA 3S29A 1AUEA 1OW8A 4MW3A 4ULVA 2R7TA 1JRAA 2PX3A 4MVMA 2CDQA 2EPKX 3IPMO 4I3MA 3S28A 2R7VA 2LFDA 5KYYA 2R03A 3GWLA 1YARO 2HS5A 3LESA 4GYTA 4LACB 4U5CE 1BDJB 1M57C 5BUOA 3QVZA 3F47A 3RQGA 1D0ZA 3T6GB 1V74B 1RCPA 3K1HA 2ZXWC 4XPWA 3DE9A 4JTCB 4JW1A 3TJ6A 1M56C 4Z9HA 3AG1C 2L81A 5CIVA 2HMQA 4G7HF 5F5HA 4G7ZF 3K66A 2DYSC 2C04A 1FAPB 2X51A 3DWWA 3QZCA 5JUAA 1G8XA 4YL0A 4PFPA 2M64A 2NG1A 4KBLA 4QI0A 5B1AC 4BJ5C 1SF8A 5L3VA 5D92A 1BZ4A 2EPNA 1Q0KA 2ICWG 2XM0A 3NG1A 3OA1A 2A0BA 4RBNA 5T3WA 1JOGA 1K05A 1LI7A 1OW7A 2EPOA 2OJQA 2BL2A 4LLCA 3RW0A 4C3DA 4CS9A 2VCBA 4MTFA 3POVA 3SNHA 1I5NA 1T6IA 2OCCC 4ER9A 4JE9A 3U0CA 1VYIA 3O39A 4K1OA 4C3EA 3NKEA 3O55A 4CIPA 5E3CA 3EPVA 1H9TA 3HNJA 3H2UA 1ORJA 2NSFA 1QPUA 3R7CA 4A2NB 3ITFA 4XLNF 3B9QA 3ABMC 4LDQA 2MHRA 2V26A 1WASA 4NTBA 2OU6A 1BR2A 4YL3A 1SMYF 1ZU4A 4YK5A 2DYRC 5COMA 3VRCA 1NLXA 2A6HF 1E86A 1OCOC 2XLDA 2YLIA 5JP7A 3VAYA 1L7CA 3J06A 1G5ZA 5JVEA 2HV6A 3L0IA 4FWVA 3DXJF 1AVOB 1Z7Qc 2CCYA 1Z63A 5KYXB 2H8AA 1Z23A 2LFFA 3K1IA 3KKBA 2BC5A 5FZTA 3NYLA 3UMKA 3W8HA 1QZXA 2ZXRA 1TR2A 3MYIA 3I4UA 1M2OA 2OJED 3WHNA 3A9CA 1A0BA 4WJ0A 3DAFA 1WTYA 4CS8A 4OINF 2R05A 4OIOF 3IQ6A 3EFOB 5JT4A 5KYXA 2L6FA 2KYHA 3AQCA 3EZIA 1O3UA 3PDMP 4OD5A 2Y69C
chains in the Genus database with same CATH topology
1OKKA 3UMHA 3F46A 3JRTA 3Q6NA 3ABLC 3AG3C 3AQBA 3SEOA 3DM9B 1J8MF 3EFOA 1NU9C 4AX2A 5EGYA 4CSAC 2KJGA 3FAJA 3B0UX 3CZ6A 1LS1A 1VMAA 3LJBA 3ZG1A 2Z15A 5D91A 2KQ9A 1S7ZA 2QTVA 4PJMA 4IAOA 1JPJA 2Y39A 5E33A 2KGOA 5DS5A 3EJNA 1VK5A 2Y3BA 2CNWD 3EQLF 3GODA 4AE4B 1MMAA 2XL4A 5B1BC 3OWTA 1BR1A 2W4MA 4IWBA 4NY3A 2A1DD 4AE4A 4JJFA 1W2WA 2D5RB 1ZHWA 2MWQA 1ZHXA 4I1MA 5E2QA 3JCUQ 4HFKB 5DQTA 5DS4A 2HV7A 4U5HA 2J0XA 4DOZA 2YZSA 3PHF2 3ZVRA 3EGDB 4QI2A 2JD3A 5DVWA 1MMDA 2WL8A 2H7OA 2PX0A 4EWCA 2DGJA 2P7VA 4YJWA 2W45A 3DZAA 3T6BA 5KYNA 2IXMA 3EGDA 3S27A 3ECSA 2EILC 3NYJA 4BEJA 1IZMA 3LS1A 4BJ6C 1LVKA 3Q7GA 3FVYA 1FFHA 4I1OB 4J32B 4YT4A 3LLIA 4P6IC 2EINC 3EZHA 4X0RA 3JSZA 2WB7A 2R7QA 1TKNA 2R7SA 4O79A 4PJJA 4YT8A 2Q9AA 1NG1A 2M4EA 2XXAB 4CSAA 2BE5F 4HE8D 4CS7A 2LSEA 5E3AA 2H7BA 2L9JA 4QDLA 4K7BA 5HSWA 4HFFB 1J8YF 2J9VA 2EIMC 2J46A 1TWHA 4U5GA 5KYWB 4IJJA 4YT2A 3MX3A 2CGEA 4C3BA 2A6EF 4OIPF 2A68F 2EIKC 4KNWA 3UR3C 2OG2A 3FDQA 5KYWA 2WVOA 3E9VA 3LLKA 2Q3TA 1QLEC 3ZSUA 2J7PD 2VH3A 3ASOC 1ZHTA 3DJUB 4HEAJ 4BJ1A 2R7RA 3E70C 3ASNC 4GEHA 3N24A 2GFHA 2XSEA 4O7GA 2VASA 1ZHYA 4LERA 1OCCC 3LEVA 3MLGA 3W2VA 2A69F 2EIJC 2IXOA 3PMRA 1D0YA 3CQZA 1TWCA 2G3VA 3GANA 3QMKA 4Q5SF 3L34A 4E7SA 3NDBB 2G3KA 4BJ6A 3SYNA 2C03A 1IW7F 4ULWA 1MNEA 4DBRA 1FTSA 1Z6AA 2XRHA 1VYKA 1D1AA 4O6NA 2QY9A 4U5DE 1V54C 1FMWA 2CW0F 3ZIBA 1N1CA 1SZIA 2Y3GA 4O6YA 2WZGA 4N06A 2MYSA 1VOMA 4BJ5A 2NUPB 4O6MA 3DAGA 2I8BA 3HLZA 3IEEA 3NRHA 2Q9BA 1V55C 3RYLA 5FCLA 3EHNA 1JPNA 2G62A 3RFYA 2NUPA 3H65A 2Y3DA 3B0PA 3RKOF 4E7ZA 2J0WA 4U5BE 2V3CC 5KYUB 2ZXOA 3K1IC 1TWAA 2PFDA 3JYHA 2CNWA 3S0XA 2J9WA 2P6VA 1ZYRF 1OCZC 5T3TA 2IXNA 5KYUA 2WZFA 4CS8C 3W8IA 3V7OA 1FMVA 1RJ9B 4DBQA 4CIHA 2ZXPA 1TWGA 3M1CB 4JCHA 4RDAA 3ABKC 3Q7LA 4MNDA 1RJ9A 2R7OA 4XLPF 1KU2A 5CI8A 2FFHA 4CBEA 1MMNA 2KNHA 2IXPA 3KMIA 3LS0A 5DQZA 3EH1A 3DM5A 5DLJA 5F5FA 4BG0A 2J9UA 4MQ9F 5IY5C 4H4KC 4FESA 2XXAA 2W9YA 3RH3A 4B6IA 4DVYP 4DVZA 2YHSA 4U5FE 4KC9A 4Q4ZF 4ZLCA 1ST6A 2VB6A 5B3SC 3WODF 4PFOA 3VYWA 1ZHZA 4ZLDA 2J45A 2PF4E 3KH2A 4F4BA 2FGYA 2ZPAA 1OKKD 3N2ZB 3AG2C 3K6BA 4M63A 4EBBA 1Z5ZA 4OIRF 4PJLA 2R7XA 3RIPA 2R7WA 4J30B 1ZU5A 4U5EE 5CI9A 5EHHA 3HJCA 1D0XA 3JT1A 2WZLA 3SP1A 5KYYB 4JVSA 4BJTA 3EH2A 3EHMA 4YN0B 3KL4A 3AG4C 3EG9B 2E87A 3B0VC 2Q9CA 1D1CA 3SZRA 2J7PA 4XWJA 3K33A 3OEOA 2R7UA 3EG9A 3I5PA 3WG7C 1FFTC 1O87A 1O5HA 3UGOA 4OD4A 1PD0A 3DD7A 3N0TA 3O6XA 5L3QA 4CS9C 4C7OB 2IOQA 1MNDA 4YWQA 2Y3HA 1LKXA 4AK9A 4Q7CA 1OCRC 1D1BA 3UMIA 1M2VB 4C7OA 3TD7A 3W2WA 4LLEA 4KNVA 5T1DB 2H7VC 3CSKA 4G7OF 1M2VA 4K0DA 4IRUA 4YT5A 1BR4A 3NYMA 3Q6MA 4W8KA 4XTKA 4JZAA 1NU7D 4OIQF 3LNRA 1PCXA 2KW3C 3K7DA 4KI2A 2IYLD 1PD1A 3DJNB 3I5QA 2O9XA 2NUTB 3DMDA 2W4BA 3NKDA 3X2QC 1WGWA 3LAYA 1NZEA 4ANJA 3UGPA 3ZC4A 3FHDA 2WVQA 3EGXB 2WVNA 1Z3IX 4FX5A 3X1OA 2B0JA 2NUTA 4RD9A 3HTKC 3T4RA 2PP4A 2YEVA 3UNGC 5DS6A 3T6JA 4JURI 4JJGA 4PK4A 3EGXA 4I44A 1MMGA 4G0HA 4PJNA 3S29A 2R7TA 2PX3A 2CDQA 4I3MA 3S28A 2R7VA 5KYYA 4U5CE 3LESA 4GYTA 4LACB 1M57C 5BUOA 3F47A 1D0ZA 3K1HA 2ZXWC 4JW1A 1M56C 3AG1C 2L81A 4G7HF 5F5HA 4G7ZF 3K66A 2DYSC 2C04A 2X51A 3QZCA 1G8XA 4PFPA 4QI0A 2NG1A 4KBLA 5B1AC 4BJ5C 5L3VA 1SF8A 5D92A 3NG1A 4RBNA 3OA1A 5T3WA 4CS9A 4LLCA 4C3DA 3POVA 3SNHA 2OCCC 1VYIA 3O39A 4C3EA 3NKEA 5E3CA 3EPVA 4A2NB 3ITFA 4XLNF 3B9QA 3ABMC 2V26A 1BR2A 1SMYF 1ZU4A 2DYRC 2A6HF 1OCOC 3VAYA 2HV6A 3L0IA 4FWVA 3DXJF 1Z63A 5KYXB 1Z23A 3KKBA 3W8HA 3UMKA 3NYLA 1QZXA 2ZXRA 1TR2A 3I4UA 1M2OA 4WJ0A 3DAFA 4CS8A 4OINF 4OIOF 3EFOB 5KYXA 3AQCA 3EZIA 4OD5A 2Y69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFK B;  4AX2 A;  4J32 B;  4JUR I;  3ZIB A;  4HFF B;  4B6I A;  4J30 B; 
#chains in the Genus database with same CATH topology
 1OKK A;  1OXB A;  1NFN A;  3F46 A;  3JRT A;  3Q6N A;  2RD9 A;  3ABL C;  1DOV A;  2LK4 A;  3UMH A;  1I4Y A;  3AG3 C;  5L0C A;  3GWN A;  3AQB A;  4MVU A;  3DM9 B;  1J8M F;  3SEO A;  1M6T A;  1NU9 C;  1R5I D;  3EFO A;  5GPG B;  4AX2 A;  1A7V A;  5EGY A;  4CSA C;  2QUP A;  3NMK A;  1LIH A;  1K04 A;  1GM5 A;  4R32 A;  3ZQV A;  2KJG A;  3FAJ A;  3B0U X;  1RMV A;  3SXY A;  3W4Y A;  4EHP A;  3CZ6 A;  1LS1 A;  1VMA A;  2XM4 A;  3LJB A;  2Z15 A;  3V5Z A;  3ZG1 A;  1HMD A;  5D91 A;  2GDC A;  2HMZ A;  2KQ9 A;  1S7Z A;  2QTV A;  4PJM A;  3GEE A;  4IAO A;  1F1M A;  3RQF A;  2R9R B;  1JPJ A;  3U9J A;  4XEK A;  2ETS A;  2Y39 A;  2LP4 A;  5E33 A;  1U89 A;  2KGO A;  3C7J A;  5DS5 A;  3EJN A;  1VK5 A;  2Y3B A;  2CNW D;  3EQL F;  2PNO A;  3C63 A;  3VM6 A;  3GOD A;  4AE4 B;  1MMA A;  2XL4 A;  5BQH A;  5B1B C;  3RF3 A;  3C8G D;  3OWT A;  4MVZ A;  3TOM A;  5BQI A;  1RKE B;  1BR1 A;  4IGG A;  2P1A A;  2XLO A;  2W4M A;  4IWB A;  3GM3 A;  1AEP A;  1HE1 A;  1C02 A;  4NY3 A;  2I15 A;  2A1D D;  4MVS A;  2XL8 A;  3ZDL A;  4WGZ A;  4AE4 A;  3A11 A;  1OXK A;  3SXK A;  4JJF A;  5L0H A;  1W2W A;  2D5R B;  1ZHW A;  2MWQ A;  1ZHX A;  4I1M A;  5E2Q A;  1RKE A;  3JCU Q;  1NFO A;  2IBF A;  4HFK B;  5DQT A;  5DS4 A;  2HV7 A;  1A7D A;  5JS5 A;  1FR0 A;  4WGY A;  3NMI A;  2GWW A;  1GQA A;  2J0X A;  3C62 A;  2VC9 A;  3G4Z A;  4U5H A;  2YZS A;  4DOZ A;  1E83 A;  3PHF 2;  1C17 M;  1B68 A;  3EGD B;  3ZVR A;  1LPE A;  4EIY A;  1TQG A;  1T6U A;  3S90 A;  4QI2 A;  2JD3 A;  5DVW A;  1MMD A;  4MTO A;  4H54 A;  2WL8 A;  2CYD A;  2H7O A;  4U9D A;  3T9O A;  3V5Y A;  3U2L A;  4CJO A;  2PX0 A;  4EWC A;  2DGJ A;  1WWP A;  2P7V A;  4YJW A;  2W45 A;  3DZA A;  3T6B A;  3U8P A;  5KYN A;  1T9K A;  2IXM A;  3EGD A;  3S27 A;  1CGO A;  5TJ5 E;  1Q0F A;  4MS2 A;  4CDA A;  3ECS A;  2EIL C;  3G50 A;  3NYJ A;  4J7T A;  4BEJ A;  1Q0G A;  1IZM A;  3LS1 A;  4BJ6 C;  3AJM A;  4MTG A;  5JSL A;  1LVK A;  3Q7G A;  3HNK A;  3FVY A;  1FFH A;  1QSP A;  2EPM X;  3AOU A;  4I1O B;  2XL6 A;  4J32 B;  4BPM A;  3GOR A;  3LLI A;  4P6I C;  3WAQ A;  4YT4 A;  2AP3 A;  2AWY A;  2D4U A;  2EIN C;  2YL0 A;  3C8Z A;  3LUT B;  4EBJ A;  1C03 A;  3EZH A;  1YJG A;  1GS9 A;  4X0R A;  1TFO B;  3JRM O;  3JSZ A;  2WB7 A;  2R7Q A;  1TKN A;  1PV3 A;  2R25 A;  2R7S A;  4O79 A;  4PJJ A;  4YT8 A;  1T5O A;  2Q9A A;  5AGF A;  5A6B A;  1NG1 A;  2M4E A;  2XXA B;  4Z9J A;  4CSA A;  2BE5 F;  1Q0D A;  4HE8 D;  1YYX A;  4CS7 A;  1ZVZ A;  2YLD A;  2LSE A;  5E3A A;  2H7B A;  2L9J A;  2LD6 A;  4CJG A;  1LS4 A;  1XZQ A;  3KPH A;  4K7B A;  4HFF B;  4QDL A;  5HSW A;  1J8Y F;  2XLH A;  2J9V A;  2EIM C;  1LE4 A;  1TWH A;  1CPR A;  2J46 A;  2NSG A;  1E85 A;  3FXH A;  4IAR A;  2J8W A;  1E2X A;  1G4W R;  4U5G A;  4IJJ A;  1U6H A;  5KYW B;  3US6 A;  3TOL A;  2KK1 A;  3MX3 A;  4YT2 A;  2CGE A;  1K40 A;  3DKA A;  2A6E F;  4C3B A;  2A68 F;  2GAQ A;  5JRA A;  4OIP F;  2UUI A;  1H6G A;  2YKZ A;  1V4A A;  2EIK C;  4E0I A;  4KNW A;  3UR3 C;  2YVK A;  2OG2 A;  3ZTZ A;  1HE9 A;  3KYJ A;  3TJ5 A;  3FDQ A;  2R02 A;  5KYW A;  2WVO A;  4MW8 A;  2KSF A;  3E9V A;  3DI5 A;  4JC7 A;  3LLK A;  2Q3T A;  4DRH B;  3GM2 A;  1QLE C;  3ZSU A;  2J7P D;  3FMS A;  2LCH A;  5L0J A;  1NSG B;  2VH3 A;  5COF A;  1Y4C A;  3ASO C;  2RSE B;  3U8V A;  3TUL A;  2DI3 A;  3B29 A;  1ZHT A;  3DJU B;  4HEA J;  5AC5 A;  2B0H A;  4BJ1 A;  4CX9 A;  2R7R A;  3IQ5 A;  3E70 C;  3ASN C;  3L8J A;  4AL1 A;  4GEH A;  4LDK A;  3N24 A;  3JYY A;  3CAX A;  2GFH A;  2XSE A;  3QVY A;  4O7G A;  2VAS A;  1YZA A;  1ZHY A;  2UUH A;  4LER A;  1OCC C;  1L3P A;  1XWJ A;  2DB4 A;  3LEV A;  3MLG A;  3M4B A;  3VF0 A;  3W2V A;  2A69 F;  2EIJ C;  2IXO A;  3PMR A;  3TK0 A;  1D0Y A;  1YA9 A;  2XS1 A;  1TWC A;  2G3V A;  3CQZ A;  3GAN A;  3QMK A;  1LM3 B;  3GEI A;  4Q5S F;  3L34 A;  3G4X A;  4JKV A;  4MVR A;  2YRF A;  4E7S A;  3NDB B;  2G3K A;  3NMJ A;  4BJ6 A;  3SYN A;  3QTH A;  3S9O A;  2C03 A;  2HJ3 A;  1IW7 F;  2L6G A;  1MNE A;  4ULW A;  4DBR A;  1VB5 A;  3S84 A;  2EPL X;  1BBH A;  2ASR A;  1FTS A;  3M4C A;  1YVI A;  1TFK B;  1Z6A A;  2XRH A;  1VYK A;  1D1A A;  1JR8 A;  3ZTM A;  5COG A;  2HSB A;  4NCQ A;  4JTA B;  3JTL O;  4O6N A;  3M15 A;  2QY9 A;  3U3F A;  4U5D E;  1V54 C;  1G4U S;  1FMW A;  2CW0 F;  4MVO A;  3ZIB A;  1N1C A;  3QW1 A;  4N4W A;  2HUJ A;  1SZI A;  3PCV A;  2Y3G A;  4O6Y A;  1XZP A;  2WZG A;  3BEH A;  4N06 A;  2MYS A;  2XLE A;  1VOM A;  4BJ5 A;  2NUP B;  4O6M A;  5L0I A;  4E0H A;  3DAG A;  2OEV A;  2I8B A;  3HNL A;  3HLZ A;  3IEE A;  1UG7 A;  4NTA A;  3NRH A;  2Q9B A;  1A41 A;  3V5X A;  4XPX A;  1V55 C;  3RYL A;  4UDV A;  5FCL A;  2YL3 A;  3EHN A;  1JPN A;  1T01 A;  2ZD9 A;  4JEA A;  3JZ0 A;  3GEH A;  2G62 A;  1VLS A;  2JX0 A;  3RFY A;  2NUP A;  3H65 A;  2XS8 A;  1SR2 A;  4DJ9 A;  2Y3D A;  3B0P A;  3RKO F;  4E7Z A;  1EA8 A;  2J0W A;  2YL7 A;  4U5B E;  3MYF A;  4FAP B;  5K0I A;  2V3C C;  5KYU B;  3O10 A;  3C8G B;  2ZXO A;  3K1I C;  4N6C A;  2HZ8 A;  1TWA A;  2PFD A;  4PAC A;  3FOO A;  3JYH A;  3RVZ A;  1CPQ A;  2CNW A;  3CEX A;  3S0X A;  3LEO A;  2J9W A;  2XLM A;  4N6H A;  2P6V A;  1ZYR F;  4J7Y A;  1OCZ C;  5T3T A;  2IXN A;  5KYU A;  2OKU A;  2WZF A;  4CDV A;  3W8I A;  3FAP B;  4CS8 C;  2HSQ A;  1APC A;  3V7O A;  4AL0 A;  1FMV A;  1RJ9 B;  4DBQ A;  3L1M A;  2QE9 A;  4CIH A;  5A6B D;  2ZXP A;  1TWG A;  3M79 A;  4ONS A;  1ZZP A;  3M1C B;  2F22 A;  4JCH A;  4RDA A;  1H7I A;  3ABK C;  3Q7L A;  3IHU A;  4YL1 A;  2OOC A;  4MND A;  2XLW A;  1RJ9 A;  2R7O A;  4XLP F;  1KU2 A;  5CI8 A;  2FFH A;  2XLV A;  3ATP A;  4CBE A;  1MMN A;  4WAB A;  2KNH A;  2TMV P;  1YAU O;  2IXP A;  2Q4F A;  3LNM B;  3U9M A;  3KMI A;  4E17 A;  1HMO A;  3LS0 A;  5DQZ A;  3EH1 A;  1ORS C;  3DM5 A;  5DLJ A;  5F5F A;  4BG0 A;  1EKY A;  2J9U A;  4MQ9 F;  5IY5 C;  4H4K C;  1HW1 A;  2P0N A;  4FES A;  5A6A A;  2XXA A;  1T6Q A;  2W9Y A;  4W8P A;  3RH3 A;  4B6I A;  4DVY P;  1EQ1 A;  4XQ1 A;  1OW6 A;  4DVZ A;  4D4N A;  2YHS A;  2KC3 A;  4U5F E;  4KC9 A;  4D4X A;  2IM8 A;  4ZLC A;  1ST6 A;  4Q4Z F;  2VB6 A;  3U2M A;  5B3S C;  4EKW A;  3ZWI A;  3WOD F;  4PFO A;  3VYW A;  1OR3 A;  4DXW A;  1ZHZ A;  3AGU A;  4ZLD A;  1VLT A;  4NQF A;  1R4T A;  1OR2 A;  2J45 A;  2PF4 E;  2PBE A;  3BRJ A;  3FOP A;  1YZC A;  3IQT A;  3KH2 A;  4MVQ A;  3TQO A;  4F4B A;  1U0B B;  2FGY A;  2ZPA A;  1OKK D;  1YLM A;  3N2Z B;  3AG2 C;  3K6B A;  4M63 A;  1I4Z A;  4EBB A;  1Z5Z A;  2OEX A;  3B71 A;  1HY5 A;  4OIR F;  4PJL A;  5EK0 A;  2R7X A;  3RIP A;  2R7W A;  4J30 B;  5B3I A;  1WN0 A;  2Q7R A;  1ZU5 A;  4U5E E;  5CI9 A;  3RVY A;  5EHH A;  1A7E A;  3QW0 A;  5BQG A;  3HJC A;  1EI7 A;  2HJM A;  1DOW A;  2Q00 A;  1D0X A;  1LE2 A;  2QLA A;  1H9G A;  3JT1 A;  4JTD B;  1CGN A;  2WZL A;  3SP1 A;  5KYY B;  4JVS A;  4L6R A;  3U3B A;  4BJT A;  3L8I A;  3EH2 A;  5AC4 A;  2A0U A;  3EHM A;  2OQM A;  3SXM A;  2GA0 A;  5JLI A;  4YN0 B;  3KL4 A;  3AG4 C;  1YYJ A;  3EG9 B;  4CDY A;  1KTM A;  3GM1 A;  2E87 A;  3B0V C;  3KYI A;  2Q9C A;  4A4A A;  1D1C A;  3SZR A;  2J7P A;  1ZW2 A;  4XWJ A;  3K33 A;  3OEO A;  5L0D A;  4P9T A;  2R7U A;  4XEV A;  3EG9 A;  3I5P A;  3WG7 C;  4BEM J;  1FFT C;  4LDR A;  1O87 A;  1O5H A;  2YL1 A;  3UGO A;  1YDI A;  4OD4 A;  1PD0 A;  1WAT A;  3DD7 A;  3N0T A;  2L7A A;  3O6X A;  1LI5 A;  4CS9 C;  5L3Q A;  2VCC A;  4C7O B;  2AU5 A;  1QVX A;  2YQY A;  2IOQ A;  3JSE O;  1YA7 O;  1MND A;  2NPU A;  3AGT A;  2P61 A;  1NBB A;  4YWQ A;  2Y3H A;  1LKX A;  4IAQ A;  4DRJ B;  4AK9 A;  4Q7C A;  3H2V A;  4Z9I A;  1OCR C;  1CGM E;  4DRI B;  1D1B A;  4P9F A;  3UMI A;  3DE8 A;  1M2V B;  4JCZ A;  3SXZ A;  4EBK A;  4C7O A;  2AWC A;  1S05 A;  3TD7 A;  1HW2 A;  3W2W A;  1Q0M A;  3U5S A;  4LLE A;  256B A;  4KNV A;  5T1D B;  4PR9 A;  1OQC A;  1ZW3 A;  2H7V C;  2L6H A;  1RXQ A;  3CSK A;  3ZQY A;  3RQE A;  4G7O F;  4IB4 A;  4JEB A;  1M2V A;  4JIO A;  4EUK B;  3HNI A;  3HKK A;  4K0D A;  1QKR A;  4IRU A;  2VCA A;  2X0C A;  5L0G A;  4XEF A;  4NC3 A;  1BR4 A;  3NYM A;  3Q6M A;  4YT5 A;  4W8K A;  1UFB A;  4G78 A;  4JZA A;  1NU7 D;  3IQC A;  4XTK A;  1ORY A;  2QNL A;  3MFN A;  5A69 A;  4OIQ F;  3LNR A;  4U9E A;  1SYQ A;  1PCX A;  2KW3 C;  3K7D A;  5A6J A;  1E84 A;  4KI2 A;  2IYL D;  1PD1 A;  3DJN B;  3MBG A;  1FNT c;  1Y6D A;  1WOL A;  3I5Q A;  3C8G A;  4JRZ A;  2O9X A;  2NUT B;  2JPU A;  2W4B A;  2YLG A;  3DMD A;  3C18 A;  1WGW A;  2YWA A;  3NKD A;  3X2Q C;  1GGQ A;  1NZE A;  3LAY A;  4ANJ A;  3UGP A;  3ZC4 A;  4E18 A;  3FHD A;  3R2P A;  2WVQ A;  3EGX B;  2FAP B;  2WVN A;  1Z3I X;  4NTF A;  4FX5 A;  2J9B A;  3X1O A;  1JAF A;  5L0F A;  2B0J A;  1QQ3 A;  2NUT A;  2LQG A;  4RD9 A;  3HTK C;  3T4R A;  2PP4 A;  2HFI A;  1KNY A;  2YEV A;  3UNG C;  2LIG A;  5F28 E;  5A6K A;  5HV9 A;  2HKV A;  5DS6 A;  4XPY A;  1MQV A;  1RKC A;  4GQH A;  4JJG A;  4JUR I;  1JMW A;  4PK4 A;  3T6J A;  2AVK A;  1VTM P;  3EGX A;  4I44 A;  1MMG A;  4G0H A;  4PJN A;  3S29 A;  1AUE A;  1OW8 A;  4MW3 A;  4ULV A;  2R7T A;  1JRA A;  2PX3 A;  4MVM A;  2CDQ A;  2EPK X;  3IPM O;  4I3M A;  3S28 A;  2R7V A;  2LFD A;  5KYY A;  2R03 A;  3GWL A;  1YAR O;  2HS5 A;  3LES A;  4GYT A;  4LAC B;  4U5C E;  1BDJ B;  1M57 C;  5BUO A;  3QVZ A;  3F47 A;  3RQG A;  1D0Z A;  3T6G B;  1V74 B;  1RCP A;  3K1H A;  2ZXW C;  4XPW A;  3DE9 A;  4JTC B;  4JW1 A;  3TJ6 A;  1M56 C;  4Z9H A;  3AG1 C;  2L81 A;  5CIV A;  2HMQ A;  4G7H F;  5F5H A;  4G7Z F;  3K66 A;  2DYS C;  2C04 A;  1FAP B;  2X51 A;  3DWW A;  3QZC A;  5JUA A;  1G8X A;  4YL0 A;  4PFP A;  2M64 A;  2NG1 A;  4KBL A;  4QI0 A;  5B1A C;  4BJ5 C;  1SF8 A;  5L3V A;  5D92 A;  1BZ4 A;  2EPN A;  1Q0K A;  2ICW G;  2XM0 A;  3NG1 A;  3OA1 A;  2A0B A;  4RBN A;  5T3W A;  1JOG A;  1K05 A;  1LI7 A;  1OW7 A;  2EPO A;  2OJQ A;  2BL2 A;  4LLC A;  3RW0 A;  4C3D A;  4CS9 A;  2VCB A;  4MTF A;  3POV A;  3SNH A;  1I5N A;  1T6I A;  2OCC C;  4ER9 A;  4JE9 A;  3U0C A;  1VYI A;  3O39 A;  4K1O A;  4C3E A;  3NKE A;  3O55 A;  4CIP A;  5E3C A;  3EPV A;  1H9T A;  3HNJ A;  3H2U A;  1ORJ A;  2NSF A;  1QPU A;  3R7C A;  4A2N B;  3ITF A;  4XLN F;  3B9Q A;  3ABM C;  4LDQ A;  2MHR A;  2V26 A;  1WAS A;  4NTB A;  2OU6 A;  1BR2 A;  4YL3 A;  1SMY F;  1ZU4 A;  4YK5 A;  2DYR C;  5COM A;  3VRC A;  1NLX A;  2A6H F;  1E86 A;  1OCO C;  2XLD A;  2YLI A;  5JP7 A;  3VAY A;  1L7C A;  3J06 A;  1G5Z A;  5JVE A;  2HV6 A;  3L0I A;  4FWV A;  3DXJ F;  1AVO B;  1Z7Q c;  2CCY A;  1Z63 A;  5KYX B;  2H8A A;  1Z23 A;  2LFF A;  3K1I A;  3KKB A;  2BC5 A;  5FZT A;  3NYL A;  3UMK A;  3W8H A;  1QZX A;  2ZXR A;  1TR2 A;  3MYI A;  3I4U A;  1M2O A;  2OJE D;  3WHN A;  3A9C A;  1A0B A;  4WJ0 A;  3DAF A;  1WTY A;  4CS8 A;  4OIN F;  2R05 A;  4OIO F;  3IQ6 A;  3EFO B;  5JT4 A;  5KYX A;  2L6F A;  2KYH A;  3AQC A;  3EZI A;  1O3U A;  3PDM P;  4OD5 A;  2Y69 C; 
#chains in the Genus database with same CATH homology
 1OKK A;  3UMH A;  3F46 A;  3JRT A;  3Q6N A;  3ABL C;  3AG3 C;  3AQB A;  3SEO A;  3DM9 B;  1J8M F;  3EFO A;  1NU9 C;  4AX2 A;  5EGY A;  4CSA C;  2KJG A;  3FAJ A;  3B0U X;  3CZ6 A;  1LS1 A;  1VMA A;  3LJB A;  3ZG1 A;  2Z15 A;  5D91 A;  2KQ9 A;  1S7Z A;  2QTV A;  4PJM A;  4IAO A;  1JPJ A;  2Y39 A;  5E33 A;  2KGO A;  5DS5 A;  3EJN A;  1VK5 A;  2Y3B A;  2CNW D;  3EQL F;  3GOD A;  4AE4 B;  1MMA A;  2XL4 A;  5B1B C;  3OWT A;  1BR1 A;  2W4M A;  4IWB A;  4NY3 A;  2A1D D;  4AE4 A;  4JJF A;  1W2W A;  2D5R B;  1ZHW A;  2MWQ A;  1ZHX A;  4I1M A;  5E2Q A;  3JCU Q;  4HFK B;  5DQT A;  5DS4 A;  2HV7 A;  4U5H A;  2J0X A;  4DOZ A;  2YZS A;  3PHF 2;  3ZVR A;  3EGD B;  4QI2 A;  2JD3 A;  5DVW A;  1MMD A;  2WL8 A;  2H7O A;  2PX0 A;  4EWC A;  2DGJ A;  2P7V A;  4YJW A;  2W45 A;  3DZA A;  3T6B A;  5KYN A;  2IXM A;  3EGD A;  3S27 A;  3ECS A;  2EIL C;  3NYJ A;  4BEJ A;  1IZM A;  3LS1 A;  4BJ6 C;  1LVK A;  3Q7G A;  3FVY A;  1FFH A;  4I1O B;  4J32 B;  4YT4 A;  3LLI A;  4P6I C;  2EIN C;  3EZH A;  4X0R A;  3JSZ A;  2WB7 A;  2R7Q A;  1TKN A;  2R7S A;  4O79 A;  4PJJ A;  4YT8 A;  2Q9A A;  1NG1 A;  2M4E A;  2XXA B;  4CSA A;  2BE5 F;  4HE8 D;  4CS7 A;  2LSE A;  5E3A A;  2H7B A;  2L9J A;  4QDL A;  4K7B A;  5HSW A;  4HFF B;  1J8Y F;  2J9V A;  2EIM C;  2J46 A;  1TWH A;  4U5G A;  5KYW B;  4IJJ A;  4YT2 A;  3MX3 A;  2CGE A;  4C3B A;  2A6E F;  4OIP F;  2A68 F;  2EIK C;  4KNW A;  3UR3 C;  2OG2 A;  3FDQ A;  5KYW A;  2WVO A;  3E9V A;  3LLK A;  2Q3T A;  1QLE C;  3ZSU A;  2J7P D;  2VH3 A;  3ASO C;  1ZHT A;  3DJU B;  4HEA J;  4BJ1 A;  2R7R A;  3E70 C;  3ASN C;  4GEH A;  3N24 A;  2GFH A;  2XSE A;  4O7G A;  2VAS A;  1ZHY A;  4LER A;  1OCC C;  3LEV A;  3MLG A;  3W2V A;  2A69 F;  2EIJ C;  2IXO A;  3PMR A;  1D0Y A;  3CQZ A;  1TWC A;  2G3V A;  3GAN A;  3QMK A;  4Q5S F;  3L34 A;  4E7S A;  3NDB B;  2G3K A;  4BJ6 A;  3SYN A;  2C03 A;  1IW7 F;  4ULW A;  1MNE A;  4DBR A;  1FTS A;  1Z6A A;  2XRH A;  1VYK A;  1D1A A;  4O6N A;  2QY9 A;  4U5D E;  1V54 C;  1FMW A;  2CW0 F;  3ZIB A;  1N1C A;  1SZI A;  2Y3G A;  4O6Y A;  2WZG A;  4N06 A;  2MYS A;  1VOM A;  4BJ5 A;  2NUP B;  4O6M A;  3DAG A;  2I8B A;  3HLZ A;  3IEE A;  3NRH A;  2Q9B A;  1V55 C;  3RYL A;  5FCL A;  3EHN A;  1JPN A;  2G62 A;  3RFY A;  2NUP A;  3H65 A;  2Y3D A;  3B0P A;  3RKO F;  4E7Z A;  2J0W A;  4U5B E;  2V3C C;  5KYU B;  2ZXO A;  3K1I C;  1TWA A;  2PFD A;  3JYH A;  2CNW A;  3S0X A;  2J9W A;  2P6V A;  1ZYR F;  1OCZ C;  5T3T A;  2IXN A;  5KYU A;  2WZF A;  4CS8 C;  3W8I A;  3V7O A;  1FMV A;  1RJ9 B;  4DBQ A;  4CIH A;  2ZXP A;  1TWG A;  3M1C B;  4JCH A;  4RDA A;  3ABK C;  3Q7L A;  4MND A;  1RJ9 A;  2R7O A;  4XLP F;  1KU2 A;  5CI8 A;  2FFH A;  4CBE A;  1MMN A;  2KNH A;  2IXP A;  3KMI A;  3LS0 A;  5DQZ A;  3EH1 A;  3DM5 A;  5DLJ A;  5F5F A;  4BG0 A;  2J9U A;  4MQ9 F;  5IY5 C;  4H4K C;  4FES A;  2XXA A;  2W9Y A;  3RH3 A;  4B6I A;  4DVY P;  4DVZ A;  2YHS A;  4U5F E;  4KC9 A;  4Q4Z F;  4ZLC A;  1ST6 A;  2VB6 A;  5B3S C;  3WOD F;  4PFO A;  3VYW A;  1ZHZ A;  4ZLD A;  2J45 A;  2PF4 E;  3KH2 A;  4F4B A;  2FGY A;  2ZPA A;  1OKK D;  3N2Z B;  3AG2 C;  3K6B A;  4M63 A;  4EBB A;  1Z5Z A;  4OIR F;  4PJL A;  2R7X A;  3RIP A;  2R7W A;  4J30 B;  1ZU5 A;  4U5E E;  5CI9 A;  5EHH A;  3HJC A;  1D0X A;  3JT1 A;  2WZL A;  3SP1 A;  5KYY B;  4JVS A;  4BJT A;  3EH2 A;  3EHM A;  4YN0 B;  3KL4 A;  3AG4 C;  3EG9 B;  2E87 A;  3B0V C;  2Q9C A;  1D1C A;  3SZR A;  2J7P A;  4XWJ A;  3K33 A;  3OEO A;  2R7U A;  3EG9 A;  3I5P A;  3WG7 C;  1FFT C;  1O87 A;  1O5H A;  3UGO A;  4OD4 A;  1PD0 A;  3DD7 A;  3N0T A;  3O6X A;  5L3Q A;  4CS9 C;  4C7O B;  2IOQ A;  1MND A;  4YWQ A;  2Y3H A;  1LKX A;  4AK9 A;  4Q7C A;  1OCR C;  1D1B A;  3UMI A;  1M2V B;  4C7O A;  3TD7 A;  3W2W A;  4LLE A;  4KNV A;  5T1D B;  2H7V C;  3CSK A;  4G7O F;  1M2V A;  4K0D A;  4IRU A;  4YT5 A;  1BR4 A;  3NYM A;  3Q6M A;  4W8K A;  4XTK A;  4JZA A;  1NU7 D;  4OIQ F;  3LNR A;  1PCX A;  2KW3 C;  3K7D A;  4KI2 A;  2IYL D;  1PD1 A;  3DJN B;  3I5Q A;  2O9X A;  2NUT B;  3DMD A;  2W4B A;  3NKD A;  3X2Q C;  1WGW A;  3LAY A;  1NZE A;  4ANJ A;  3UGP A;  3ZC4 A;  3FHD A;  2WVQ A;  3EGX B;  2WVN A;  1Z3I X;  4FX5 A;  3X1O A;  2B0J A;  2NUT A;  4RD9 A;  3HTK C;  3T4R A;  2PP4 A;  2YEV A;  3UNG C;  5DS6 A;  3T6J A;  4JUR I;  4JJG A;  4PK4 A;  3EGX A;  4I44 A;  1MMG A;  4G0H A;  4PJN A;  3S29 A;  2R7T A;  2PX3 A;  2CDQ A;  4I3M A;  3S28 A;  2R7V A;  5KYY A;  4U5C E;  3LES A;  4GYT A;  4LAC B;  1M57 C;  5BUO A;  3F47 A;  1D0Z A;  3K1H A;  2ZXW C;  4JW1 A;  1M56 C;  3AG1 C;  2L81 A;  4G7H F;  5F5H A;  4G7Z F;  3K66 A;  2DYS C;  2C04 A;  2X51 A;  3QZC A;  1G8X A;  4PFP A;  4QI0 A;  2NG1 A;  4KBL A;  5B1A C;  4BJ5 C;  5L3V A;  1SF8 A;  5D92 A;  3NG1 A;  4RBN A;  3OA1 A;  5T3W A;  4CS9 A;  4LLC A;  4C3D A;  3POV A;  3SNH A;  2OCC C;  1VYI A;  3O39 A;  4C3E A;  3NKE A;  5E3C A;  3EPV A;  4A2N B;  3ITF A;  4XLN F;  3B9Q A;  3ABM C;  2V26 A;  1BR2 A;  1SMY F;  1ZU4 A;  2DYR C;  2A6H F;  1OCO C;  3VAY A;  2HV6 A;  3L0I A;  4FWV A;  3DXJ F;  1Z63 A;  5KYX B;  1Z23 A;  3KKB A;  3W8H A;  3UMK A;  3NYL A;  1QZX A;  2ZXR A;  1TR2 A;  3I4U A;  1M2O A;  4WJ0 A;  3DAF A;  4CS8 A;  4OIN F;  4OIO F;  3EFO B;  5KYX A;  3AQC A;  3EZI A;  4OD5 A;  2Y69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...