4J30B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium, selenomethionine variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
molecule keywords Putative cytoplasmic protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j30B00
4JURI 4HFFB 4B6IA 3ZIBA 4AX2A 4J32B 4HFKB 4J30B
chains in the Genus database with same CATH superfamily
3RIPA 4N06A 4BJ5C 1JPNA 2EINC 2Q9CA 2Y3HA 4GYTA 2KYHA 2LIGA 1C17M 1LVKA 1OW6A 2LCHA 3GORA 1TWGA 2NUPA 3DD7A 3H65A 4KNVA 4U5HA 3U3FA 3LLIA 4CIHA 4N4WA 4PK4A 5B1AC 1B68A 1IZMA 3UMIA 4XPYA 1ZVZA 5E2QA 2R7XA 3S84A 1S7ZA 1LS1A 1BR1A 4G7ZF 2QUPA 4KI2A 3IQCA 4JVSA 3DE8A 4LERA 4U5GA 1Y6DA 4DJ9A 2QNLA 4JC7A 2OKUA 1JAFA 1GGQA 1RJ9B 3IQTA 1A7EA 3F47A 4O7GA 1YVIA 4QI0A 3ATPA 2XLOA 2YHSA 4EBKA 4YT8A 1VOMA 3S0XA 3MLGA 1D1CA 5JLIA 3JSEO 3NKEA 5COMA 4CSAA 3ZG1A 3DM5A 3O39A 1ORYA 4CJOA 1V54C 3HNLA 1VB5A 3WAQA 2LK4A 2Q9BA 3JZ0A 5A69A 3UNGC 4GEHA 1FFHA 1S05A 3EZIA 4Q4ZF 1Q0MA 3EJNA 4H4KC 3C8GB 5KYUB 1HW1A 2F22A 2NUTB 1OCCC 1ST6A 4LLEA 4NY3A 4PJMA 1O5HA 3CAXA 5DQZA 4CDYA 2P7VA 4A4AA 3N24A 2A6EF 3HKKA 3QW1A 4JW1A 4EWCA 1MNDA 2EPKX 1IW7F 2KGOA 1G4WR 2WVOA 4L6RA 3RVZA 3EG9A 2C03A 3JSZA 2XS1A 5DS4A 1C03A 3CEXA 4BJ6C 2PF4E 4EHPA 2HMQA 5GPGB 1JPJA 3U9JA 4E18A 5JRAA 1TWCA 1R5ID 2IXNA 3VAYA 3NG1A 3SXZA 4M63A 3RQFA 2Y69C 2R7TA 2YKZA 4KC9A 4YJWA 2QE9A 4DOZA 4XPWA 3EGDB 4I3MA 5E33A 2YRFA 3U3BA 2QLAA 4EBJA 5KYWA 2ASRA 3H2VA 4JURI 4BEMJ 2OEXA 3CSKA 3J06A 1OQCA 4J30B 2KSFA 5K0IA 4OIQF 2R02A 3W8IA 2HSBA 3EHMA 1Y4CA 3GWNA 3L0IA 2CNWA 3ASNC 1AEPA 3K7DA 3C62A 3SXYA 4MVUA 3TQOA 2CDQA 3U0CA 4JZAA 1WATA 4WGZA 1LS4A 3RW0A 2YEVA 2X51A 5AC5A 2Y3BA 3Q6NA 5A6BD 2YL1A 2I8BA 3WODF 1H7IA 3NYLA 1D1BA 4YN0B 2XXAB 1VLTA 3Q7LA 3NRHA 1O87A 2UUIA 5B3SC 3IHUA 5TJ5E 3E9VA 3L8JA 2HMZA 1UFBA 2CGEA 2ZXWC 3SZRA 2VCBA 1MNEA 4AL0A 2PFDA 1GS9A 1OW8A 5EHHA 1D1AA 4BPMA 1MMNA 3QZCA 2QY9A 1XZPA 3ZQYA 4EUKB 4MS2A 3UGPA 1CGNA 4U5DE 3M1CB 5AGFA 3EH1A 4NTAA 4KNWA 3MBGA 3V5YA 3NMJA 4PJNA 1ORSC 1OXKA 1M6TA 3VRCA 3UGOA 4A2NB 2H7OA 2NSFA 1BBHA 4MTOA 2EIMC 3A11A 3EFOA 1NFNA 4I1OB 2LP4A 1BR4A 2XM0A 2YL0A 2IM8A 2DYSC 4ZLDA 1E2XA 4XEKA 1G8XA 3VYWA 2GFHA 3TULA 5E3AA 1M2OA 2XRHA 4J7TA 5L0CA 2M4EA 5CI9A 1SYQA 3LS1A 4O6YA 1BZ4A 3L1MA 4DXWA 2OCCC 3OWTA 1YZAA 5F5FA 2YLDA 1WWPA 2MYSA 3JRTA 4C3BA 1JMWA 1RCPA 2PX0A 2IYLD 2WZGA 3FOOA 2R05A 1M2VB 2PBEA 1FNTc 2E87A 2EIKC 1KTMA 3RQEA 1CPRA 1F1MA 1SF8A 1V55C 1N1CA 5BQGA 5KYYB 1I5NA 4DRJB 5T3WA 3F46A 1YAUO 1MMGA 4DBRA 2NPUA 2WZFA 1MQVA 3KYIA 2VASA 4HEAJ 4XEFA 1TR2A 2A6HF 3VF0A 1YA9A 1ZW3A 2A69F 1T5OA 1RKEB 2YZSA 4WABA 5T3TA 3R7CA 3FMSA 3W4YA 1U89A 3UR3C 4FWVA 2M64A 1WGWA 2DI3A 2H7VC 2WL8A 1XWJA 3LEOA 4EBBA 2XLHA 1OW7A 3AGTA 1BR2A 2C04A 2J0XA 5CIVA 3POVA 4FX5A 2P6VA 2VCCA 4CIPA 4OD5A 1YLMA 2R7UA 3Q7GA 5T1DB 2W4MA 4N6HA 2XLDA 3T6BA 4MTGA 2R7QA 4F4BA 1OR2A 2BE5F 2VC9A 1E83A 4MNDA 5DQTA 2HZ8A 3ZDLA 5JVEA 2Z15A 4JRZA 2B0HA 3EGXB 2R7SA 2G3KA 3QW0A 4IWBA 1L7CA 3LEVA 5JP7A 5B3IA 1RJ9A 3OEOA 4NQFA 4CS9C 1O3UA 1NSGB 1YYJA 1M57C 2XLMA 1KU2A 4E7SA 1DOVA 1EA8A 1T6QA 3HLZA 2RSEB 1PD0A 4LDRA 4NC3A 4YL3A 1OKKA 2OU6A 3HJCA 3IPMO 4YK5A 3ZTMA 4R32A 3U8VA 1G5ZA 1YDIA 3K1IC 5FCLA 5L0DA 1K04A 2QTVA 3B71A 4W8KA 1Q0GA 1ZHTA 2KJGA 2HFIA 1JRAA 3GEIA 1DOWA 2AVKA 4JTAB 4ULWA 4AK9A 3V7OA 4AX2A 4LACB 5D92A 4XQ1A 5EK0A 3VM6A 4IJJA 1LIHA 2JX0A 4DVYP 4G7OF 4B6IA 1I4ZA 2FAPB 1GQAA 2L9JA 4OIRF 1NG1A 2G62A 2EPMX 4JCHA 4H54A 2R9RB 1H9TA 2X0CA 4WGYA 3QVYA 2VB6A 2HSQA 2LSEA 1ZHYA 2I15A 2KNHA 3MYFA 4U5CE 3RH3A 2DGJA 1QLEC 4IRUA 3RVYA 3B0PA 3AGUA 4K7BA 1VYIA 4FAPB 4E17A 2HJMA 2D4UA 1MMAA 4Z9JA 1ZU4A 1ZHXA 4CS7A 1NU9C 1QKRA 2A0BA 1OCOC 2R03A 2L81A 4MVZA 4P9TA 3FDQA 4OD4A 1A41A 3O10A 1M56C 1Q0KA 4QDLA 3HTKC 3S29A 1HE9A 3KYJA 3B0UX 1T6IA 2KW3C 3LS0A 2YL7A 4U5EE 2JD3A 1YA7O 4G78A 4CS9A 2JPUA 1GM5A 1EKYA 1Z63A 3AG4C 3CQZA 5IY5C 2IOQA 1D0ZA 1UG7A 1TQGA 4JTCB 3SXMA 1OCRC 3US6A 4PJJA 4YWQA 1EQ1A 2YVKA 2XL8A 3W2VA 1A7DA 3N0TA 5L0GA 3GEEA 3AQBA 4O79A 5F5HA 1HE1A 4E7ZA 1CPQA 1E85A 3KL4A 1Z7Qc 2XXAA 2Q9AA 2NUTA 5B1BC 1FR0A 1YJGA 3WHNA 3DWWA 4HE8D 4IAOA 4YL1A 5L3QA 2HUJA 5A6AA 5KYNA 4DRHB 4IGGA 3SNHA 2NUPB 4K1OA 3G50A 3ABLC 1OCZC 1V4AA 2H7BA 2XL4A 4RBNA 1K05A 4PJLA 4NTFA 4IARA 3QVZA 3RKOF 4AE4A 5JT4A 2J7PA 3TD7A 3ZSUA 3KPHA 1TKNA 1WOLA 3NMIA 1NLXA 3AG2C 4KBLA 1ZU5A 2AWCA 3JCUQ 1YARO 4XWJA 4I44A 3EH2A 4HFFB 2R7RA 2ZPAA 3AG3C 3SP1A 3LLKA 3M15A 3EZHA 4O6NA 4X0RA 2AWYA 3DI5A 4RD9A 1ZYRF 2HS5A 3O6XA 3L34A 2ZXPA 4RDAA 4PACA 3TJ6A 3I4UA 2A1DD 2FGYA 3K66A 2J45A 2Q00A 3UMKA 5AC4A 3JYYA 3ZTZA 3DJNB 3SEOA 3W2WA 3GM3A 4U5FE 2O9XA 1QPUA 1V74B 1VYKA 1RMVA 4C3EA 1ZZPA 2GAQA 1L3PA 1SMYF 3U2MA 2NG1A 3AOUA 2G3VA 1T9KA 3OA1A 4MW3A 3RFYA 4D4XA 1QVXA 2J9BA 1SZIA 2DYRC 2IXPA 2LD6A 1J8MF 3M79A 4AE4B 5L0JA 2EPOA 2EPNA 2P1AA 4ONSA 4U9DA 2R7OA 4Z9IA 1LE2A 3SYNA 2WVNA 3FOPA 1WN0A 3C7JA 3EHNA 3TJ5A 3HNIA 3NDBB 4BG0A 1OXBA 1RKCA 2XLWA 4CS8C 2KQ9A 3ABKC 1E84A 1CGOA 3G4ZA 1PV3A 3ZWIA 2OJED 1QZXA 4PFPA 3DJUB 3FXHA 4YT5A 3S27A 3TOMA 4GQHA 3V5XA 4EKWA 3C8ZA 3AQCA 3T6JA 1VTMP 2MWQA 5HV9A 4PFOA 4OIPF 2LQGA 5DS6A 2CNWD 2J7PD 2RD9A 1WASA 2EPLX 4O6MA 1J8YF 1PD1A 3GANA 3LUTB 2GDCA 4NCQA 2B0JA 4P9FA 2Y3GA 5L3VA 2J9VA 1SR2A 2AU5A 3TK0A 3AG1C 4PR9A 3I5PA 4LDKA 3S9OA 5BQHA 2XLVA 4WJ0A 1CGME 2UUHA 2LFFA 2CW0F 3C63A 4Z9HA 1TWHA 3UMHA 4CBEA 1Z23A 4E0IA 4LLCA 3LNMB 1TFKB 2CCYA 3G4XA 2Q7RA 2LFDA 4BJ1A 4D4NA 2HV6A 2GWWA 4XLNF 1ZW2A 2YWAA 2XSEA 3WG7C 1LE4A 5F28E 3T9OA 3MYIA 1VLSA 3EPVA 4UDVA 1LI5A 1XZQA 3K6BA 5JSLA 1FAPB 3KKBA 2OOCA 1JR8A 3LAYA 2IXOA 3MFNA 5L0FA 5EGYA 5KYXA 2PP4A 3U2LA 1PCXA 3IQ6A 1HMDA 1HW2A 5DLJA 2PX3A 2YQYA 3NMKA 3T6GB 4ER9A 2VH3A 5KYYA 2Q4FA 2W9YA 3DAGA 3JTLO 1AVOB 4JE9A 5L0IA 3V5ZA 3X1OA 3AJMA 2EIJC 2HV7A 3U9MA 3PMRA 3NYJA 3ZQVA 4DRIB 5KYWB 3FVYA 3JRMO 3N2ZB 1VMAA 2ICWG 2ZXOA 1C02A 3MX3A 4IB4A 5FZTA 2KC3A 3RYLA 3B0VC 2R7WA 4EIYA 5COGA 4Q5SF 1FFTC 1H9GA 2J0WA 3FAPB 1ZHZA 3LESA 4JIOA 1I4YA 3GEHA 5DVWA 2A68F 2L6GA 2J8WA 3DXJF 3HNJA 4U9EA 4CJGA 4CX9A 2Q3TA 3C8GD 1FMWA 3KH2A 4G7HF 4W8PA 3DE9A 4U5BE 2TMVP 4XTKA 1OR3A 1E86A 3PDMP 1ZHWA 4JCZA 4K0DA 1MMDA 3KMIA 2DB4A 2YLGA 3GM1A 4J7YA 4CSAC 2W4BA 4JTDB 1QQ3A 3PCVA 3GWLA 3RF3A 5BUOA 5A6KA 4MTFA 1T6UA 1A0BA 4C3DA 3X2QC 2J9WA 1FTSA 1T01A 3C18A 2XS8A 3EG9B 3K33A 1LPEA 4MW8A 1D0YA 3ECSA 3O55A 4DBQA 4YT4A 2VCAA 3EFOB 4YL0A 4BEJA 2L6HA 3ASOC 3EQLF 4FESA 256BA 1KNYA 2WVQA 3DAFA 3E70C 4OINF 1NBBA 2IBFA 2D5RB 3BEHA 3DKAA 1BDJB 3FAJA 3W8HA 3IEEA 2GA0A 2ZD9A 4MVRA 4CS8A 2V26A 5JUAA 3ZVRA 5KYXB 1YZCA 1R4TA 4LDQA 5DS5A 2L7AA 4JJFA 4JKVA 1Q0DA 5A6JA 3HNKA 4CDAA 4XPXA 2CYDA 2OEVA 4AL1A 4J32B 2A0UA 3M4CA 3U5SA 2OG2A 4BJ5A 5JS5A 3I5QA 3DMDA 1HY5A 1Z6AA 1LM3B 1Z3IX 2MHRA 1Z5ZA 4IAQA 1U0BB 2KK1A 3PHF2 4OIOF 4JEBA 1EI7A 2Y3DA 3QMKA 4MVSA 4ZLCA 3DZAA 3S90A 2Y39A 3C8GA 3GM2A 3ITFA 3QTHA 5KYUA 1OKKD 3SXKA 3R2PA 4I1MA 3NYMA 2EILC 2P61A 4MVQA 2IXMA 2ZXRA 3U8PA 3JT1A 3ZC4A 1Q0FA 2V3CC 3S28A 2J46A 3TOLA 5E3CA 4HFKB 3ABMC 1RXQA 3RQGA 1VK5A 2FFHA 2NSGA 4CDVA 5COFA 3T4RA 1ORJA 3ZIBA 2OJQA 1M2VA 2HKVA 3FHDA 4N6CA 2R25A 4JJGA 1JOGA 1G4US 5D91A 1K40A 5A6BA 5HSWA 4MVMA 1U6HA 2ETSA 3IQ5A 4C7OB 3A9CA 3EGDA 4ULVA 1LKXA 3BRJA 2BL2A 4G0HA 3CZ6A 2WZLA 2PNOA 2HJ3A 2H8AA 4BJ6A 2OQMA 4JEAA 2YLIA 1RKEA 1LI7A 2XM4A 3DM9B 4MQ9F 3NKDA 4NTBA 5L0HA 1WTYA 1TFOB 4C7OA 3B9QA 1D0XA 2BC5A 2P0NA 4MVOA 1A7VA 2AP3A 2R7VA 4E0HA 5CI8A 3L8IA 1APCA 5BQIA 1HMOA 2WB7A 3GODA 3JYHA 4DVZA 3K1IA 4ANJA 3B29A 2XL6A 1H6GA 1NZEA 3H2UA 3LNRA 4P6IC 1AUEA 1NFOA 4XLPF 2W45A 1FMVA 3LJBA 4Q7CA 1W2WA 2XLEA 3K1HA 3M4BA 4BJTA 4YT2A 1NU7D 1YYXA 3Q6MA 2L6FA 1TWAA 4QI2A 4XEVA 3EGXA 1QSPA 2J9UA 2YL3A
chains in the Genus database with same CATH topology
3RIPA 4N06A 4BJ5C 1JPNA 2EINC 2Q9CA 2Y3HA 4GYTA 4KI2A 1LVKA 1TWGA 2NUPA 3DD7A 3H65A 4KNVA 4U5HA 3LLIA 4CIHA 4PK4A 5B1AC 3UMIA 1IZMA 5E2QA 2R7XA 1S7ZA 1LS1A 1BR1A 4G7ZF 4JVSA 4U5GA 4LERA 1RJ9B 3F47A 4O7GA 4QI0A 2YHSA 4YT8A 1VOMA 3S0XA 3MLGA 1D1CA 3NKEA 4CSAA 3ZG1A 3DM5A 3O39A 1V54C 2Q9BA 3UNGC 4GEHA 1FFHA 3EZIA 4Q4ZF 4H4KC 3EJNA 5KYUB 2NUTB 4NY3A 4LLEA 1OCCC 1ST6A 4PJMA 1O5HA 5DQZA 2P7VA 3N24A 2A6EF 5KYXB 4JW1A 4EWCA 1MNDA 2KGOA 1IW7F 2WVOA 3EG9A 2C03A 3JSZA 5DS4A 4BJ6C 2PF4E 1JPJA 1TWCA 2IXNA 3VAYA 3NG1A 4M63A 2Y69C 2R7TA 4KC9A 4YJWA 4DOZA 3EGDB 4I3MA 5E33A 5KYWA 4JURI 3CSKA 4J30B 4OIQF 3W8IA 3EHMA 3L0IA 2CNWA 3ASNC 3K7DA 2CDQA 4JZAA 2YEVA 2X51A 2Y3BA 3Q6NA 2I8BA 3WODF 3NYLA 1D1BA 4YN0B 2XXAB 3Q7LA 3NRHA 1O87A 5B3SC 3E9VA 2CGEA 2ZXWC 3SZRA 1MNEA 2PFDA 5EHHA 1D1AA 1MMNA 3QZCA 2QY9A 3UGPA 4U5DE 3M1CB 3EH1A 4KNWA 4PJNA 3UGOA 4A2NB 2H7OA 2EIMC 3EFOA 4I1OB 1BR4A 2DYSC 4ZLDA 1G8XA 3VYWA 2GFHA 5E3AA 1M2OA 2XRHA 2M4EA 5CI9A 3LS1A 4O6YA 2OCCC 3OWTA 5F5FA 2MYSA 3JRTA 4C3BA 2PX0A 2IYLD 2WZGA 1M2VB 2E87A 2EIKC 1SF8A 1V55C 1N1CA 5KYYB 5T3WA 3F46A 1MMGA 4DBRA 2WZFA 4HEAJ 2VASA 1TR2A 2A6HF 2A69F 2YZSA 5T3TA 3UR3C 4FWVA 1WGWA 2H7VC 4EBBA 2WL8A 1BR2A 2C04A 2J0XA 3POVA 4FX5A 2P6VA 4OD5A 2R7UA 3Q7GA 5T1DB 2W4MA 3T6BA 2R7QA 4F4BA 2BE5F 4MNDA 5DQTA 2Z15A 2R7SA 3EGXB 2G3KA 4IWBA 3LEVA 1RJ9A 3OEOA 4CS9C 1M57C 1KU2A 4E7SA 3HLZA 1PD0A 1OKKA 3HJCA 5FCLA 3K1IC 2QTVA 4W8KA 1ZHTA 2KJGA 4ULWA 4AK9A 3V7OA 4AX2A 4LACB 5D92A 4IJJA 4G7OF 4B6IA 2L9JA 4OIRF 1NG1A 2G62A 4JCHA 2VB6A 4U5CE 2LSEA 1ZHYA 2KNHA 3RH3A 4DVYP 2DGJA 1QLEC 4IRUA 3B0PA 4K7BA 1VYIA 1MMAA 1ZU4A 1ZHXA 4CS7A 1NU9C 1OCOC 2L81A 3FDQA 4OD4A 1M56C 4QDLA 3HTKC 3S29A 3B0UX 2KW3C 3LS0A 4U5EE 2JD3A 4CS9A 1Z63A 3AG4C 3CQZA 5IY5C 2IOQA 1D0ZA 1OCRC 4YWQA 4PJJA 3W2VA 3N0TA 3AQBA 4O79A 5F5HA 4E7ZA 3KL4A 2XXAA 2Q9AA 2NUTA 5B1BC 4HE8D 4IAOA 5L3QA 5KYNA 3SNHA 2NUPB 3ABLC 1OCZC 4RBNA 2H7BA 2XL4A 3RKOF 4PJLA 4AE4A 2J7PA 3TD7A 3ZSUA 1TKNA 3AG2C 4KBLA 1ZU5A 3JCUQ 4XWJA 4I44A 3EH2A 4HFFB 2R7RA 2ZPAA 3AG3C 3SP1A 3LLKA 3EZHA 4O6NA 4X0RA 4RD9A 1ZYRF 3O6XA 3L34A 2ZXPA 4RDAA 3I4UA 2A1DD 2FGYA 3K66A 2J45A 3UMKA 3DJNB 3SEOA 3W2WA 4U5FE 2O9XA 1VYKA 4C3EA 1SMYF 2NG1A 2G3VA 3RFYA 3OA1A 2DYRC 1SZIA 2IXPA 1J8MF 4AE4B 2R7OA 3SYNA 2WVNA 3NDBB 3EHNA 4BG0A 4CS8C 2KQ9A 3ABKC 1QZXA 4PFPA 3DJUB 4YT5A 3S27A 3AQCA 3T6JA 4OIPF 2MWQA 4PFOA 5DS6A 2CNWD 2J7PD 4O6MA 1J8YF 1PD1A 3GANA 2B0JA 5L3VA 2Y3GA 2J9VA 3AG1C 3I5PA 4WJ0A 3UMHA 2CW0F 4CBEA 1TWHA 1Z23A 4LLCA 4BJ1A 2HV6A 4XLNF 2XSEA 3WG7C 3EPVA 3K6BA 3KKBA 3LAYA 2IXOA 5EGYA 5KYXA 2PP4A 1PCXA 5DLJA 2PX3A 5KYYA 2VH3A 3DAGA 2W9YA 4DVZA 3X1OA 2EIJC 2HV7A 3PMRA 3NYJA 5KYWB 3FVYA 3N2ZB 1VMAA 2ZXOA 3MX3A 3RYLA 3B0VC 2R7WA 4Q5SF 1FFTC 2J0WA 1ZHZA 3LESA 5DVWA 2A68F 3DXJF 2Q3TA 1FMWA 3KH2A 4G7HF 4U5BE 4XTKA 1ZHWA 4K0DA 1MMDA 3KMIA 4CSAC 2W4BA 5BUOA 4C3DA 3X2QC 2J9WA 1FTSA 3EG9B 3K33A 1D0YA 3ECSA 4DBQA 4YT4A 3EFOB 4BEJA 3ASOC 3EQLF 4FESA 2WVQA 3E70C 3DAFA 4OINF 3W8HA 2D5RB 3FAJA 3IEEA 4CS8A 2V26A 3ZVRA 5DS5A 4JJFA 4J32B 2OG2A 4BJ5A 3I5QA 3DMDA 1Z6AA 1Z3IX 1Z5ZA 3PHF2 4OIOF 2Y3DA 3QMKA 4ZLCA 3DZAA 2Y39A 5KYUA 3ITFA 1OKKD 4I1MA 3NYMA 2EILC 3ZC4A 2IXMA 2ZXRA 3JT1A 2V3CC 3S28A 2J46A 5E3CA 4HFKB 3ABMC 1VK5A 2FFHA 3T4RA 3ZIBA 1M2VA 3FHDA 4JJGA 5D91A 5HSWA 4C7OB 3EGDA 1LKXA 4G0HA 3CZ6A 2WZLA 4BJ6A 4MQ9F 3DM9B 3NKDA 4C7OA 3B9QA 1D0XA 2R7VA 5CI8A 3GODA 2WB7A 3JYHA 4ANJA 1NZEA 3LNRA 4P6IC 4XLPF 2W45A 1FMVA 3LJBA 4Q7CA 1W2WA 3K1HA 4BJTA 4YT2A 1NU7D 3Q6MA 1TWAA 4QI2A 3EGXA 2J9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JUR I;  4HFF B;  4B6I A;  3ZIB A;  4AX2 A;  4J32 B;  4HFK B;  4J30 B; 
#chains in the Genus database with same CATH topology
 3RIP A;  4N06 A;  4BJ5 C;  1JPN A;  2EIN C;  2Q9C A;  2Y3H A;  4GYT A;  2KYH A;  2LIG A;  1C17 M;  1LVK A;  1OW6 A;  2LCH A;  3GOR A;  1TWG A;  2NUP A;  3DD7 A;  3H65 A;  4KNV A;  4U5H A;  3U3F A;  3LLI A;  4CIH A;  4N4W A;  4PK4 A;  5B1A C;  1B68 A;  1IZM A;  3UMI A;  4XPY A;  1ZVZ A;  5E2Q A;  2R7X A;  3S84 A;  1S7Z A;  1LS1 A;  1BR1 A;  4G7Z F;  2QUP A;  4KI2 A;  3IQC A;  4JVS A;  3DE8 A;  4LER A;  4U5G A;  1Y6D A;  4DJ9 A;  2QNL A;  4JC7 A;  2OKU A;  1JAF A;  1GGQ A;  1RJ9 B;  3IQT A;  1A7E A;  3F47 A;  4O7G A;  1YVI A;  4QI0 A;  3ATP A;  2XLO A;  2YHS A;  4EBK A;  4YT8 A;  1VOM A;  3S0X A;  3MLG A;  1D1C A;  5JLI A;  3JSE O;  3NKE A;  5COM A;  4CSA A;  3ZG1 A;  3DM5 A;  3O39 A;  1ORY A;  4CJO A;  1V54 C;  3HNL A;  1VB5 A;  3WAQ A;  2LK4 A;  2Q9B A;  3JZ0 A;  5A69 A;  3UNG C;  4GEH A;  1FFH A;  1S05 A;  3EZI A;  4Q4Z F;  1Q0M A;  3EJN A;  4H4K C;  3C8G B;  5KYU B;  1HW1 A;  2F22 A;  2NUT B;  1OCC C;  1ST6 A;  4LLE A;  4NY3 A;  4PJM A;  1O5H A;  3CAX A;  5DQZ A;  4CDY A;  2P7V A;  4A4A A;  3N24 A;  2A6E F;  3HKK A;  3QW1 A;  4JW1 A;  4EWC A;  1MND A;  2EPK X;  1IW7 F;  2KGO A;  1G4W R;  2WVO A;  4L6R A;  3RVZ A;  3EG9 A;  2C03 A;  3JSZ A;  2XS1 A;  5DS4 A;  1C03 A;  3CEX A;  4BJ6 C;  2PF4 E;  4EHP A;  2HMQ A;  5GPG B;  1JPJ A;  3U9J A;  4E18 A;  5JRA A;  1TWC A;  1R5I D;  2IXN A;  3VAY A;  3NG1 A;  3SXZ A;  4M63 A;  3RQF A;  2Y69 C;  2R7T A;  2YKZ A;  4KC9 A;  4YJW A;  2QE9 A;  4DOZ A;  4XPW A;  3EGD B;  4I3M A;  5E33 A;  2YRF A;  3U3B A;  2QLA A;  4EBJ A;  5KYW A;  2ASR A;  3H2V A;  4JUR I;  4BEM J;  2OEX A;  3CSK A;  3J06 A;  1OQC A;  4J30 B;  2KSF A;  5K0I A;  4OIQ F;  2R02 A;  3W8I A;  2HSB A;  3EHM A;  1Y4C A;  3GWN A;  3L0I A;  2CNW A;  3ASN C;  1AEP A;  3K7D A;  3C62 A;  3SXY A;  4MVU A;  3TQO A;  2CDQ A;  3U0C A;  4JZA A;  1WAT A;  4WGZ A;  1LS4 A;  3RW0 A;  2YEV A;  2X51 A;  5AC5 A;  2Y3B A;  3Q6N A;  5A6B D;  2YL1 A;  2I8B A;  3WOD F;  1H7I A;  3NYL A;  1D1B A;  4YN0 B;  2XXA B;  1VLT A;  3Q7L A;  3NRH A;  1O87 A;  2UUI A;  5B3S C;  3IHU A;  5TJ5 E;  3E9V A;  3L8J A;  2HMZ A;  1UFB A;  2CGE A;  2ZXW C;  3SZR A;  2VCB A;  1MNE A;  4AL0 A;  2PFD A;  1GS9 A;  1OW8 A;  5EHH A;  1D1A A;  4BPM A;  1MMN A;  3QZC A;  2QY9 A;  1XZP A;  3ZQY A;  4EUK B;  4MS2 A;  3UGP A;  1CGN A;  4U5D E;  3M1C B;  5AGF A;  3EH1 A;  4NTA A;  4KNW A;  3MBG A;  3V5Y A;  3NMJ A;  4PJN A;  1ORS C;  1OXK A;  1M6T A;  3VRC A;  3UGO A;  4A2N B;  2H7O A;  2NSF A;  1BBH A;  4MTO A;  2EIM C;  3A11 A;  3EFO A;  1NFN A;  4I1O B;  2LP4 A;  1BR4 A;  2XM0 A;  2YL0 A;  2IM8 A;  2DYS C;  4ZLD A;  1E2X A;  4XEK A;  1G8X A;  3VYW A;  2GFH A;  3TUL A;  5E3A A;  1M2O A;  2XRH A;  4J7T A;  5L0C A;  2M4E A;  5CI9 A;  1SYQ A;  3LS1 A;  4O6Y A;  1BZ4 A;  3L1M A;  4DXW A;  2OCC C;  3OWT A;  1YZA A;  5F5F A;  2YLD A;  1WWP A;  2MYS A;  3JRT A;  4C3B A;  1JMW A;  1RCP A;  2PX0 A;  2IYL D;  2WZG A;  3FOO A;  2R05 A;  1M2V B;  2PBE A;  1FNT c;  2E87 A;  2EIK C;  1KTM A;  3RQE A;  1CPR A;  1F1M A;  1SF8 A;  1V55 C;  1N1C A;  5BQG A;  5KYY B;  1I5N A;  4DRJ B;  5T3W A;  3F46 A;  1YAU O;  1MMG A;  4DBR A;  2NPU A;  2WZF A;  1MQV A;  3KYI A;  2VAS A;  4HEA J;  4XEF A;  1TR2 A;  2A6H F;  3VF0 A;  1YA9 A;  1ZW3 A;  2A69 F;  1T5O A;  1RKE B;  2YZS A;  4WAB A;  5T3T A;  3R7C A;  3FMS A;  3W4Y A;  1U89 A;  3UR3 C;  4FWV A;  2M64 A;  1WGW A;  2DI3 A;  2H7V C;  2WL8 A;  1XWJ A;  3LEO A;  4EBB A;  2XLH A;  1OW7 A;  3AGT A;  1BR2 A;  2C04 A;  2J0X A;  5CIV A;  3POV A;  4FX5 A;  2P6V A;  2VCC A;  4CIP A;  4OD5 A;  1YLM A;  2R7U A;  3Q7G A;  5T1D B;  2W4M A;  4N6H A;  2XLD A;  3T6B A;  4MTG A;  2R7Q A;  4F4B A;  1OR2 A;  2BE5 F;  2VC9 A;  1E83 A;  4MND A;  5DQT A;  2HZ8 A;  3ZDL A;  5JVE A;  2Z15 A;  4JRZ A;  2B0H A;  3EGX B;  2R7S A;  2G3K A;  3QW0 A;  4IWB A;  1L7C A;  3LEV A;  5JP7 A;  5B3I A;  1RJ9 A;  3OEO A;  4NQF A;  4CS9 C;  1O3U A;  1NSG B;  1YYJ A;  1M57 C;  2XLM A;  1KU2 A;  4E7S A;  1DOV A;  1EA8 A;  1T6Q A;  3HLZ A;  2RSE B;  1PD0 A;  4LDR A;  4NC3 A;  4YL3 A;  1OKK A;  2OU6 A;  3HJC A;  3IPM O;  4YK5 A;  3ZTM A;  4R32 A;  3U8V A;  1G5Z A;  1YDI A;  3K1I C;  5FCL A;  5L0D A;  1K04 A;  2QTV A;  3B71 A;  4W8K A;  1Q0G A;  1ZHT A;  2KJG A;  2HFI A;  1JRA A;  3GEI A;  1DOW A;  2AVK A;  4JTA B;  4ULW A;  4AK9 A;  3V7O A;  4AX2 A;  4LAC B;  5D92 A;  4XQ1 A;  5EK0 A;  3VM6 A;  4IJJ A;  1LIH A;  2JX0 A;  4DVY P;  4G7O F;  4B6I A;  1I4Z A;  2FAP B;  1GQA A;  2L9J A;  4OIR F;  1NG1 A;  2G62 A;  2EPM X;  4JCH A;  4H54 A;  2R9R B;  1H9T A;  2X0C A;  4WGY A;  3QVY A;  2VB6 A;  2HSQ A;  2LSE A;  1ZHY A;  2I15 A;  2KNH A;  3MYF A;  4U5C E;  3RH3 A;  2DGJ A;  1QLE C;  4IRU A;  3RVY A;  3B0P A;  3AGU A;  4K7B A;  1VYI A;  4FAP B;  4E17 A;  2HJM A;  2D4U A;  1MMA A;  4Z9J A;  1ZU4 A;  1ZHX A;  4CS7 A;  1NU9 C;  1QKR A;  2A0B A;  1OCO C;  2R03 A;  2L81 A;  4MVZ A;  4P9T A;  3FDQ A;  4OD4 A;  1A41 A;  3O10 A;  1M56 C;  1Q0K A;  4QDL A;  3HTK C;  3S29 A;  1HE9 A;  3KYJ A;  3B0U X;  1T6I A;  2KW3 C;  3LS0 A;  2YL7 A;  4U5E E;  2JD3 A;  1YA7 O;  4G78 A;  4CS9 A;  2JPU A;  1GM5 A;  1EKY A;  1Z63 A;  3AG4 C;  3CQZ A;  5IY5 C;  2IOQ A;  1D0Z A;  1UG7 A;  1TQG A;  4JTC B;  3SXM A;  1OCR C;  3US6 A;  4PJJ A;  4YWQ A;  1EQ1 A;  2YVK A;  2XL8 A;  3W2V A;  1A7D A;  3N0T A;  5L0G A;  3GEE A;  3AQB A;  4O79 A;  5F5H A;  1HE1 A;  4E7Z A;  1CPQ A;  1E85 A;  3KL4 A;  1Z7Q c;  2XXA A;  2Q9A A;  2NUT A;  5B1B C;  1FR0 A;  1YJG A;  3WHN A;  3DWW A;  4HE8 D;  4IAO A;  4YL1 A;  5L3Q A;  2HUJ A;  5A6A A;  5KYN A;  4DRH B;  4IGG A;  3SNH A;  2NUP B;  4K1O A;  3G50 A;  3ABL C;  1OCZ C;  1V4A A;  2H7B A;  2XL4 A;  4RBN A;  1K05 A;  4PJL A;  4NTF A;  4IAR A;  3QVZ A;  3RKO F;  4AE4 A;  5JT4 A;  2J7P A;  3TD7 A;  3ZSU A;  3KPH A;  1TKN A;  1WOL A;  3NMI A;  1NLX A;  3AG2 C;  4KBL A;  1ZU5 A;  2AWC A;  3JCU Q;  1YAR O;  4XWJ A;  4I44 A;  3EH2 A;  4HFF B;  2R7R A;  2ZPA A;  3AG3 C;  3SP1 A;  3LLK A;  3M15 A;  3EZH A;  4O6N A;  4X0R A;  2AWY A;  3DI5 A;  4RD9 A;  1ZYR F;  2HS5 A;  3O6X A;  3L34 A;  2ZXP A;  4RDA A;  4PAC A;  3TJ6 A;  3I4U A;  2A1D D;  2FGY A;  3K66 A;  2J45 A;  2Q00 A;  3UMK A;  5AC4 A;  3JYY A;  3ZTZ A;  3DJN B;  3SEO A;  3W2W A;  3GM3 A;  4U5F E;  2O9X A;  1QPU A;  1V74 B;  1VYK A;  1RMV A;  4C3E A;  1ZZP A;  2GAQ A;  1L3P A;  1SMY F;  3U2M A;  2NG1 A;  3AOU A;  2G3V A;  1T9K A;  3OA1 A;  4MW3 A;  3RFY A;  4D4X A;  1QVX A;  2J9B A;  1SZI A;  2DYR C;  2IXP A;  2LD6 A;  1J8M F;  3M79 A;  4AE4 B;  5L0J A;  2EPO A;  2EPN A;  2P1A A;  4ONS A;  4U9D A;  2R7O A;  4Z9I A;  1LE2 A;  3SYN A;  2WVN A;  3FOP A;  1WN0 A;  3C7J A;  3EHN A;  3TJ5 A;  3HNI A;  3NDB B;  4BG0 A;  1OXB A;  1RKC A;  2XLW A;  4CS8 C;  2KQ9 A;  3ABK C;  1E84 A;  1CGO A;  3G4Z A;  1PV3 A;  3ZWI A;  2OJE D;  1QZX A;  4PFP A;  3DJU B;  3FXH A;  4YT5 A;  3S27 A;  3TOM A;  4GQH A;  3V5X A;  4EKW A;  3C8Z A;  3AQC A;  3T6J A;  1VTM P;  2MWQ A;  5HV9 A;  4PFO A;  4OIP F;  2LQG A;  5DS6 A;  2CNW D;  2J7P D;  2RD9 A;  1WAS A;  2EPL X;  4O6M A;  1J8Y F;  1PD1 A;  3GAN A;  3LUT B;  2GDC A;  4NCQ A;  2B0J A;  4P9F A;  2Y3G A;  5L3V A;  2J9V A;  1SR2 A;  2AU5 A;  3TK0 A;  3AG1 C;  4PR9 A;  3I5P A;  4LDK A;  3S9O A;  5BQH A;  2XLV A;  4WJ0 A;  1CGM E;  2UUH A;  2LFF A;  2CW0 F;  3C63 A;  4Z9H A;  1TWH A;  3UMH A;  4CBE A;  1Z23 A;  4E0I A;  4LLC A;  3LNM B;  1TFK B;  2CCY A;  3G4X A;  2Q7R A;  2LFD A;  4BJ1 A;  4D4N A;  2HV6 A;  2GWW A;  4XLN F;  1ZW2 A;  2YWA A;  2XSE A;  3WG7 C;  1LE4 A;  5F28 E;  3T9O A;  3MYI A;  1VLS A;  3EPV A;  4UDV A;  1LI5 A;  1XZQ A;  3K6B A;  5JSL A;  1FAP B;  3KKB A;  2OOC A;  1JR8 A;  3LAY A;  2IXO A;  3MFN A;  5L0F A;  5EGY A;  5KYX A;  2PP4 A;  3U2L A;  1PCX A;  3IQ6 A;  1HMD A;  1HW2 A;  5DLJ A;  2PX3 A;  2YQY A;  3NMK A;  3T6G B;  4ER9 A;  2VH3 A;  5KYY A;  2Q4F A;  2W9Y A;  3DAG A;  3JTL O;  1AVO B;  4JE9 A;  5L0I A;  3V5Z A;  3X1O A;  3AJM A;  2EIJ C;  2HV7 A;  3U9M A;  3PMR A;  3NYJ A;  3ZQV A;  4DRI B;  5KYW B;  3FVY A;  3JRM O;  3N2Z B;  1VMA A;  2ICW G;  2ZXO A;  1C02 A;  3MX3 A;  4IB4 A;  5FZT A;  2KC3 A;  3RYL A;  3B0V C;  2R7W A;  4EIY A;  5COG A;  4Q5S F;  1FFT C;  1H9G A;  2J0W A;  3FAP B;  1ZHZ A;  3LES A;  4JIO A;  1I4Y A;  3GEH A;  5DVW A;  2A68 F;  2L6G A;  2J8W A;  3DXJ F;  3HNJ A;  4U9E A;  4CJG A;  4CX9 A;  2Q3T A;  3C8G D;  1FMW A;  3KH2 A;  4G7H F;  4W8P A;  3DE9 A;  4U5B E;  2TMV P;  4XTK A;  1OR3 A;  1E86 A;  3PDM P;  1ZHW A;  4JCZ A;  4K0D A;  1MMD A;  3KMI A;  2DB4 A;  2YLG A;  3GM1 A;  4J7Y A;  4CSA C;  2W4B A;  4JTD B;  1QQ3 A;  3PCV A;  3GWL A;  3RF3 A;  5BUO A;  5A6K A;  4MTF A;  1T6U A;  1A0B A;  4C3D A;  3X2Q C;  2J9W A;  1FTS A;  1T01 A;  3C18 A;  2XS8 A;  3EG9 B;  3K33 A;  1LPE A;  4MW8 A;  1D0Y A;  3ECS A;  3O55 A;  4DBQ A;  4YT4 A;  2VCA A;  3EFO B;  4YL0 A;  4BEJ A;  2L6H A;  3ASO C;  3EQL F;  4FES A;  256B A;  1KNY A;  2WVQ A;  3DAF A;  3E70 C;  4OIN F;  1NBB A;  2IBF A;  2D5R B;  3BEH A;  3DKA A;  1BDJ B;  3FAJ A;  3W8H A;  3IEE A;  2GA0 A;  2ZD9 A;  4MVR A;  4CS8 A;  2V26 A;  5JUA A;  3ZVR A;  5KYX B;  1YZC A;  1R4T A;  4LDQ A;  5DS5 A;  2L7A A;  4JJF A;  4JKV A;  1Q0D A;  5A6J A;  3HNK A;  4CDA A;  4XPX A;  2CYD A;  2OEV A;  4AL1 A;  4J32 B;  2A0U A;  3M4C A;  3U5S A;  2OG2 A;  4BJ5 A;  5JS5 A;  3I5Q A;  3DMD A;  1HY5 A;  1Z6A A;  1LM3 B;  1Z3I X;  2MHR A;  1Z5Z A;  4IAQ A;  1U0B B;  2KK1 A;  3PHF 2;  4OIO F;  4JEB A;  1EI7 A;  2Y3D A;  3QMK A;  4MVS A;  4ZLC A;  3DZA A;  3S90 A;  2Y39 A;  3C8G A;  3GM2 A;  3ITF A;  3QTH A;  5KYU A;  1OKK D;  3SXK A;  3R2P A;  4I1M A;  3NYM A;  2EIL C;  2P61 A;  4MVQ A;  2IXM A;  2ZXR A;  3U8P A;  3JT1 A;  3ZC4 A;  1Q0F A;  2V3C C;  3S28 A;  2J46 A;  3TOL A;  5E3C A;  4HFK B;  3ABM C;  1RXQ A;  3RQG A;  1VK5 A;  2FFH A;  2NSG A;  4CDV A;  5COF A;  3T4R A;  1ORJ A;  3ZIB A;  2OJQ A;  1M2V A;  2HKV A;  3FHD A;  4N6C A;  2R25 A;  4JJG A;  1JOG A;  1G4U S;  5D91 A;  1K40 A;  5A6B A;  5HSW A;  4MVM A;  1U6H A;  2ETS A;  3IQ5 A;  4C7O B;  3A9C A;  3EGD A;  4ULV A;  1LKX A;  3BRJ A;  2BL2 A;  4G0H A;  3CZ6 A;  2WZL A;  2PNO A;  2HJ3 A;  2H8A A;  4BJ6 A;  2OQM A;  4JEA A;  2YLI A;  1RKE A;  1LI7 A;  2XM4 A;  3DM9 B;  4MQ9 F;  3NKD A;  4NTB A;  5L0H A;  1WTY A;  1TFO B;  4C7O A;  3B9Q A;  1D0X A;  2BC5 A;  2P0N A;  4MVO A;  1A7V A;  2AP3 A;  2R7V A;  4E0H A;  5CI8 A;  3L8I A;  1APC A;  5BQI A;  1HMO A;  2WB7 A;  3GOD A;  3JYH A;  4DVZ A;  3K1I A;  4ANJ A;  3B29 A;  2XL6 A;  1H6G A;  1NZE A;  3H2U A;  3LNR A;  4P6I C;  1AUE A;  1NFO A;  4XLP F;  2W45 A;  1FMV A;  3LJB A;  4Q7C A;  1W2W A;  2XLE A;  3K1H A;  3M4B A;  4BJT A;  4YT2 A;  1NU7 D;  1YYX A;  3Q6M A;  2L6F A;  1TWA A;  4QI2 A;  4XEV A;  3EGX A;  1QSP A;  2J9U A;  2YL3 A; 
#chains in the Genus database with same CATH homology
 3RIP A;  4N06 A;  4BJ5 C;  1JPN A;  2EIN C;  2Q9C A;  2Y3H A;  4GYT A;  4KI2 A;  1LVK A;  1TWG A;  2NUP A;  3DD7 A;  3H65 A;  4KNV A;  4U5H A;  3LLI A;  4CIH A;  4PK4 A;  5B1A C;  3UMI A;  1IZM A;  5E2Q A;  2R7X A;  1S7Z A;  1LS1 A;  1BR1 A;  4G7Z F;  4JVS A;  4U5G A;  4LER A;  1RJ9 B;  3F47 A;  4O7G A;  4QI0 A;  2YHS A;  4YT8 A;  1VOM A;  3S0X A;  3MLG A;  1D1C A;  3NKE A;  4CSA A;  3ZG1 A;  3DM5 A;  3O39 A;  1V54 C;  2Q9B A;  3UNG C;  4GEH A;  1FFH A;  3EZI A;  4Q4Z F;  4H4K C;  3EJN A;  5KYU B;  2NUT B;  4NY3 A;  4LLE A;  1OCC C;  1ST6 A;  4PJM A;  1O5H A;  5DQZ A;  2P7V A;  3N24 A;  2A6E F;  5KYX B;  4JW1 A;  4EWC A;  1MND A;  2KGO A;  1IW7 F;  2WVO A;  3EG9 A;  2C03 A;  3JSZ A;  5DS4 A;  4BJ6 C;  2PF4 E;  1JPJ A;  1TWC A;  2IXN A;  3VAY A;  3NG1 A;  4M63 A;  2Y69 C;  2R7T A;  4KC9 A;  4YJW A;  4DOZ A;  3EGD B;  4I3M A;  5E33 A;  5KYW A;  4JUR I;  3CSK A;  4J30 B;  4OIQ F;  3W8I A;  3EHM A;  3L0I A;  2CNW A;  3ASN C;  3K7D A;  2CDQ A;  4JZA A;  2YEV A;  2X51 A;  2Y3B A;  3Q6N A;  2I8B A;  3WOD F;  3NYL A;  1D1B A;  4YN0 B;  2XXA B;  3Q7L A;  3NRH A;  1O87 A;  5B3S C;  3E9V A;  2CGE A;  2ZXW C;  3SZR A;  1MNE A;  2PFD A;  5EHH A;  1D1A A;  1MMN A;  3QZC A;  2QY9 A;  3UGP A;  4U5D E;  3M1C B;  3EH1 A;  4KNW A;  4PJN A;  3UGO A;  4A2N B;  2H7O A;  2EIM C;  3EFO A;  4I1O B;  1BR4 A;  2DYS C;  4ZLD A;  1G8X A;  3VYW A;  2GFH A;  5E3A A;  1M2O A;  2XRH A;  2M4E A;  5CI9 A;  3LS1 A;  4O6Y A;  2OCC C;  3OWT A;  5F5F A;  2MYS A;  3JRT A;  4C3B A;  2PX0 A;  2IYL D;  2WZG A;  1M2V B;  2E87 A;  2EIK C;  1SF8 A;  1V55 C;  1N1C A;  5KYY B;  5T3W A;  3F46 A;  1MMG A;  4DBR A;  2WZF A;  4HEA J;  2VAS A;  1TR2 A;  2A6H F;  2A69 F;  2YZS A;  5T3T A;  3UR3 C;  4FWV A;  1WGW A;  2H7V C;  4EBB A;  2WL8 A;  1BR2 A;  2C04 A;  2J0X A;  3POV A;  4FX5 A;  2P6V A;  4OD5 A;  2R7U A;  3Q7G A;  5T1D B;  2W4M A;  3T6B A;  2R7Q A;  4F4B A;  2BE5 F;  4MND A;  5DQT A;  2Z15 A;  2R7S A;  3EGX B;  2G3K A;  4IWB A;  3LEV A;  1RJ9 A;  3OEO A;  4CS9 C;  1M57 C;  1KU2 A;  4E7S A;  3HLZ A;  1PD0 A;  1OKK A;  3HJC A;  5FCL A;  3K1I C;  2QTV A;  4W8K A;  1ZHT A;  2KJG A;  4ULW A;  4AK9 A;  3V7O A;  4AX2 A;  4LAC B;  5D92 A;  4IJJ A;  4G7O F;  4B6I A;  2L9J A;  4OIR F;  1NG1 A;  2G62 A;  4JCH A;  2VB6 A;  4U5C E;  2LSE A;  1ZHY A;  2KNH A;  3RH3 A;  4DVY P;  2DGJ A;  1QLE C;  4IRU A;  3B0P A;  4K7B A;  1VYI A;  1MMA A;  1ZU4 A;  1ZHX A;  4CS7 A;  1NU9 C;  1OCO C;  2L81 A;  3FDQ A;  4OD4 A;  1M56 C;  4QDL A;  3HTK C;  3S29 A;  3B0U X;  2KW3 C;  3LS0 A;  4U5E E;  2JD3 A;  4CS9 A;  1Z63 A;  3AG4 C;  3CQZ A;  5IY5 C;  2IOQ A;  1D0Z A;  1OCR C;  4YWQ A;  4PJJ A;  3W2V A;  3N0T A;  3AQB A;  4O79 A;  5F5H A;  4E7Z A;  3KL4 A;  2XXA A;  2Q9A A;  2NUT A;  5B1B C;  4HE8 D;  4IAO A;  5L3Q A;  5KYN A;  3SNH A;  2NUP B;  3ABL C;  1OCZ C;  4RBN A;  2H7B A;  2XL4 A;  3RKO F;  4PJL A;  4AE4 A;  2J7P A;  3TD7 A;  3ZSU A;  1TKN A;  3AG2 C;  4KBL A;  1ZU5 A;  3JCU Q;  4XWJ A;  4I44 A;  3EH2 A;  4HFF B;  2R7R A;  2ZPA A;  3AG3 C;  3SP1 A;  3LLK A;  3EZH A;  4O6N A;  4X0R A;  4RD9 A;  1ZYR F;  3O6X A;  3L34 A;  2ZXP A;  4RDA A;  3I4U A;  2A1D D;  2FGY A;  3K66 A;  2J45 A;  3UMK A;  3DJN B;  3SEO A;  3W2W A;  4U5F E;  2O9X A;  1VYK A;  4C3E A;  1SMY F;  2NG1 A;  2G3V A;  3RFY A;  3OA1 A;  2DYR C;  1SZI A;  2IXP A;  1J8M F;  4AE4 B;  2R7O A;  3SYN A;  2WVN A;  3NDB B;  3EHN A;  4BG0 A;  4CS8 C;  2KQ9 A;  3ABK C;  1QZX A;  4PFP A;  3DJU B;  4YT5 A;  3S27 A;  3AQC A;  3T6J A;  4OIP F;  2MWQ A;  4PFO A;  5DS6 A;  2CNW D;  2J7P D;  4O6M A;  1J8Y F;  1PD1 A;  3GAN A;  2B0J A;  5L3V A;  2Y3G A;  2J9V A;  3AG1 C;  3I5P A;  4WJ0 A;  3UMH A;  2CW0 F;  4CBE A;  1TWH A;  1Z23 A;  4LLC A;  4BJ1 A;  2HV6 A;  4XLN F;  2XSE A;  3WG7 C;  3EPV A;  3K6B A;  3KKB A;  3LAY A;  2IXO A;  5EGY A;  5KYX A;  2PP4 A;  1PCX A;  5DLJ A;  2PX3 A;  5KYY A;  2VH3 A;  3DAG A;  2W9Y A;  4DVZ A;  3X1O A;  2EIJ C;  2HV7 A;  3PMR A;  3NYJ A;  5KYW B;  3FVY A;  3N2Z B;  1VMA A;  2ZXO A;  3MX3 A;  3RYL A;  3B0V C;  2R7W A;  4Q5S F;  1FFT C;  2J0W A;  1ZHZ A;  3LES A;  5DVW A;  2A68 F;  3DXJ F;  2Q3T A;  1FMW A;  3KH2 A;  4G7H F;  4U5B E;  4XTK A;  1ZHW A;  4K0D A;  1MMD A;  3KMI A;  4CSA C;  2W4B A;  5BUO A;  4C3D A;  3X2Q C;  2J9W A;  1FTS A;  3EG9 B;  3K33 A;  1D0Y A;  3ECS A;  4DBQ A;  4YT4 A;  3EFO B;  4BEJ A;  3ASO C;  3EQL F;  4FES A;  2WVQ A;  3E70 C;  3DAF A;  4OIN F;  3W8H A;  2D5R B;  3FAJ A;  3IEE A;  4CS8 A;  2V26 A;  3ZVR A;  5DS5 A;  4JJF A;  4J32 B;  2OG2 A;  4BJ5 A;  3I5Q A;  3DMD A;  1Z6A A;  1Z3I X;  1Z5Z A;  3PHF 2;  4OIO F;  2Y3D A;  3QMK A;  4ZLC A;  3DZA A;  2Y39 A;  5KYU A;  3ITF A;  1OKK D;  4I1M A;  3NYM A;  2EIL C;  3ZC4 A;  2IXM A;  2ZXR A;  3JT1 A;  2V3C C;  3S28 A;  2J46 A;  5E3C A;  4HFK B;  3ABM C;  1VK5 A;  2FFH A;  3T4R A;  3ZIB A;  1M2V A;  3FHD A;  4JJG A;  5D91 A;  5HSW A;  4C7O B;  3EGD A;  1LKX A;  4G0H A;  3CZ6 A;  2WZL A;  4BJ6 A;  4MQ9 F;  3DM9 B;  3NKD A;  4C7O A;  3B9Q A;  1D0X A;  2R7V A;  5CI8 A;  3GOD A;  2WB7 A;  3JYH A;  4ANJ A;  1NZE A;  3LNR A;  4P6I C;  4XLP F;  2W45 A;  1FMV A;  3LJB A;  4Q7C A;  1W2W A;  3K1H A;  4BJT A;  4YT2 A;  1NU7 D;  3Q6M A;  1TWA A;  4QI2 A;  3EGX A;  2J9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...