4J30B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium, selenomethionine variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
molecule keywords Putative cytoplasmic protein
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j30B00
4AX2A 4B6IA 4HFKB 4J30B 3ZIBA 4JURI 4HFFB 4J32B
chains in the Genus database with same CATH superfamily
1H9TA 4CS7A 4QI2A 1DOWA 2X51A 1VTMP 4U5EE 2E87A 4G78A 1OXBA 3ZTMA 4CJGA 3AQBA 2W4BA 2V3CC 2QTVA 3TQOA 3V5ZA 3SXKA 4NTFA 4AK9A 1ZHTA 3U9MA 5L0HA 1JAFA 2NUPA 3ZQYA 3B0UX 4JVSA 4CBEA 1ZHWA 1EI7A 2H7VC 3ASNC 4U9DA 2VCAA 5T1DB 1HW1A 4LLEA 2G3VA 5KYYA 3IHUA 3ZC4A 4A2NB 3C8GA 1YVIA 2R03A 1OCCC 2IBFA 2C04A 2PF4E 3EH2A 1Q0DA 3U3FA 4YK5A 2VCCA 3S28A 2EPKX 2HMZA 2NG1A 4IGGA 5B3SC 5BQHA 2J9UA 1M2VB 1YAUO 2A69F 3M15A 3SXYA 4AL0A 2HV7A 1G4US 2XL8A 2M4EA 1JRAA 1OR3A 4R32A 3U3BA 3X1OA 3PHF2 1MNDA 5EHHA 1E2XA 1OKKD 4EBJA 3F46A 3W8HA 3CQZA 5L0GA 3G4ZA 3QVYA 1NSGB 3DI5A 4DXWA 2HS5A 2UUIA 1GGQA 4XQ1A 2NSGA 1VK5A 3X2QC 3OWTA 3ABKC 3ZDLA 3W4YA 1FMWA 3AG3C 3SEOA 1A41A 2VASA 3JSZA 2GDCA 2EIMC 1HMDA 1LI5A 2NPUA 1BR1A 3B71A 3FOPA 4RBNA 3M79A 3TJ6A 4QDLA 1L7CA 4G7ZF 2HJMA 2XM0A 2W45A 1CPRA 3DKAA 2EPOA 1SMYF 2L6HA 2P7VA 5L0IA 3HNJA 1LKXA 3LEOA 4MTOA 3UMKA 2R7VA 4F4BA 2R9RB 2EILC 1K05A 4IAQA 1M57C 4PK4A 3HJCA 2J46A 4JCHA 4AX2A 2DGJA 3Q6MA 4XLPF 2A68F 4GQHA 4DOZA 5JRAA 4QI0A 1JOGA 1C17M 1SR2A 4OD4A 3LJBA 3NDBB 2WVQA 4DVZA 1VLTA 2TMVP 2Q00A 1LE2A 3RVZA 1RMVA 1YA9A 1T6QA 3K7DA 1Z3IX 2YWAA 5K0IA 3S9OA 2Y3HA 1Y6DA 2L7AA 3A9CA 3DE8A 2ZXRA 4I1MA 1Q0GA 3RQEA 4EWCA 4FAPB 3QVZA 4BJ6A 4E7SA 1NFNA 1ZZPA 3U9JA 3EG9B 2EPNA 3ITFA 3UMHA 2OOCA 1TWGA 1EKYA 2R02A 4YJWA 1J8YF 4I3MA 4JTDB 2PNOA 2PFDA 4JJFA 3L0IA 4U5DE 3ZTZA 4JTAB 4L6RA 3A11A 2B0HA 2Q4FA 4WABA 4PACA 4EIYA 5T3WA 2J9WA 3RW0A 5BUOA 1HW2A 1YLMA 3EGXA 4IAOA 4ZLCA 5EGYA 4CDAA 5KYWA 2WB7A 4GYTA 3T6JA 1GS9A 4CDYA 1Z63A 1I4YA 1NU7D 2P6VA 3JYYA 1D1BA 1VYKA 1KTMA 3RQGA 4HFKB 3LLKA 1QKRA 1ZHYA 2WZFA 4Q4ZF 1OR2A 2HZ8A 2XLMA 3LUTB 5A6AA 2YLGA 1BR4A 2D4UA 4LDRA 1VB5A 3O6XA 4MS2A 1ZHZA 5E2QA 2KGOA 4BEJA 2RSEB 1D0XA 4JZAA 3NKEA 3Q7LA 2ZPAA 1M56C 1NLXA 1KU2A 2VCBA 2CNWD 2W9YA 5KYWB 1ZYRF 3W2WA 4CS9C 3ATPA 5DVWA 1EA8A 4K1OA 3NG1A 4IWBA 4M63A 2CGEA 3TOLA 2R7RA 3IQTA 1YA7O 1I5NA 4KC9A 1T01A 3C63A 2Q9AA 2GAQA 2XLEA 3PMRA 5KYUA 1PV3A 3M4CA 4BJTA 3O39A 4JTCB 4MVOA 2IXMA 1RXQA 4XPWA 4A4AA 2Q3TA 3S27A 3LAYA 4YL1A 1GQAA 2KW3C 3C62A 2J9VA 2KK1A 3QW1A 5E33A 1A7EA 1WGWA 2QNLA 4DRHB 2FFHA 1ORSC 2CW0F 2P61A 3SXMA 1OQCA 1AVOB 2KNHA 2LFDA 4J32B 3WAQA 5JS5A 2R25A 1ORYA 2H8AA 3L1MA 4MVMA 3VM6A 4EKWA 1Z5ZA 3JZ0A 4DVYP 4CIHA 3MYIA 4BJ5C 3S90A 1D1AA 2KC3A 5L3VA 1QLEC 1H9GA 3I5PA 3C8GD 3S84A 3PDMP 2RD9A 2R7SA 4U9EA 1MMDA 3RF3A 3AOUA 5B1AC 5L0DA 5L3QA 1NZEA 4G7OF 1AUEA 5AC5A 4AL1A 2CDQA 3EGDA 4O79A 2IXOA 4MVQA 1G4WR 2OJED 4K0DA 1N1CA 1OW6A 1IW7F 1PD1A 4UDVA 1QSPA 2J8WA 2JD3A 3V5YA 4Q7CA 2O9XA 2XLWA 3WHNA 2ETSA 1F1MA 2HUJA 4FWVA 4KBLA 4LERA 3TK0A 2XL6A 2LIGA 5A6BD 2PP4A 1S7ZA 4PFOA 3RYLA 5L0CA 4MTGA 3TULA 1OXKA 2Q7RA 4YT2A 2Z15A 2YL0A 4WJ0A 4E18A 2R7XA 3Q7GA 3FHDA 3LLIA 5EK0A 1K40A 4JEAA 2YQYA 1I4ZA 2KSFA 3DM5A 3ZWIA 2G3KA 1C03A 4RDAA 1V54C 3GANA 2QY9A 2EPLX 1J8MF 1LS1A 1Z23A 2WZGA 3BRJA 3CSKA 4U5BE 4G0HA 4ANJA 4DBRA 4DJ9A 3POVA 3DD7A 2XSEA 1OCOC 1Y4CA 2EIJC 4CS8C 3W2VA 2OG2A 2J7PD 3K1HA 3GODA 4XLNF 2XS1A 2QLAA 3UNGC 5D91A 1ST6A 2GFHA 1SZIA 2NUPB 3K1IA 1WN0A 2BC5A 4EBBA 4GEHA 5IY5C 2EIKC 2ZXWC 3LNRA 1SF8A 4ZLDA 3ABLC 2C03A 3GWLA 5A69A 1WATA 4MNDA 3CAXA 3F47A 2OKUA 3N2ZB 5GPGB 4ULWA 4XEVA 4CIPA 2PX0A 1VMAA 2BL2A 4O6NA 3QTHA 2HSBA 2Y3BA 1PCXA 3DXJF 3GORA 4DBQA 3TOMA 1TWAA 1LI7A 1CGOA 5JUAA 2R7UA 2ZD9A 3JRMO 2F22A 3RQFA 3IQCA 4LACB 1NG1A 1LVKA 2AP3A 3US6A 4MVZA 2LD6A 4J7TA 3GWNA 4IRUA 1LPEA 3NYMA 2HFIA 2IXNA 3HLZA 5E3AA 1TWCA 2A1DD 4B6IA 3G4XA 3G50A 3L8IA 3Q6NA 4OIOF 1Q0FA 2OJQA 4LDQA 1BZ4A 1BBHA 2AU5A 4HFFB 4BJ6C 5HSWA 1ZU5A 2VB6A 2KJGA 2NUTB 2I15A 2YHSA 4BPMA 2JX0A 1ORJA 3AQCA 3PCVA 1SYQA 2HJ3A 3MYFA 5F28E 1NU9C 2KQ9A 1Z6AA 3NMKA 3VF0A 1RKEB 1FR0A 4EUKB 5DQZA 1V4AA 2FGYA 3I4UA 4YN0B 1WWPA 2G62A 5BQIA 2L6GA 1MMAA 2DYRC 3EH1A 5DQTA 3E70C 2OEXA 2GWWA 2MYSA 4OD5A 4K7BA 5COFA 4YT4A 1JPJA 2A0UA 3WG7C 4BJ5A 1DOVA 3UR3C 3H2UA 3KKBA 3KYIA 4I44A 4JC7A 3RH3A 3U8PA 1H7IA 1LE4A 2WVNA 4HE8D 5CI8A 4YWQA 3HNIA 4ER9A 3DM9B 3VRCA 4JIOA 4PR9A 4PJNA 2W4MA 4J30B 3EFOA 3LEVA 2EPMX 4CJOA 4NTBA 4X0RA 2WZLA 3LS0A 4MW8A 3JRTA 1FMVA 3EHNA 2Y39A 2LCHA 4KNWA 3ZG1A 3UGPA 3HNLA 5FCLA 2B0JA 3ZIBA 1Q0KA 4FX5A 4NQFA 1A7VA 4OINF 3DMDA 3W8IA 4C3DA 3GEEA 3LNMB 4PJLA 3VAYA 3EHMA 3L34A 2ASRA 3JSEO 1TFOB 3CEXA 2IM8A 2R7QA 3QZCA 5JP7A 4C3EA 3IQ5A 3C8ZA 1LM3B 2P0NA 3KH2A 1MQVA 4JKVA 1OCRC 2HSQA 2L81A 3NMIA 2J0XA 5DS5A 4I1OB 3EGDB 5B3IA 1CGME 2QE9A 4BJ1A 1TFKB 4Z9JA 3NYLA 2X0CA 2JPUA 2QUPA 3V7OA 2YKZA 3LS1A 2AWCA 2XL4A 2Y3DA 4JURI 2WL8A 3EZHA 4U5CE 3SYNA 2BE5F 3DAFA 4W8PA 1HE9A 2OCCC 2Q9CA 1VOMA 1K04A 1YYJA 1U6HA 2OU6A 4XEKA 3RFYA 1APCA 3TD7A 5TJ5E 3DJNB 3JTLO 4IB4A 1FFTC 4NTAA 3AG2C 3OA1A 4JE9A 2A0BA 1OCZC 4XPXA 4BG0A 3KMIA 4E7ZA 1O5HA 5BQGA 1MMGA 1H6GA 3KL4A 4OIPF 4NCQA 1FTSA 2ICWG 1G5ZA 2J7PA 2YEVA 4CS8A 4O7GA 4E17A 5L0JA 4OIQF 1ZVZA 2WVOA 3DAGA 3JCUQ 4PJJA 2UUHA 2L9JA 3NMJA 4U5HA 3U2MA 4AE4A 4KNVA 2A6EF 3EPVA 4NY3A 4Q5SF 3M1CB 4C7OB 2HKVA 1E86A 1HMOA 4MTFA 4KI2A 4MQ9F 2LSEA 2Y3GA 4LLCA 4PFPA 5KYUB 3IEEA 1U0BB 2D5RB 2HMQA 4Z9HA 1T6UA 4JJGA 2DB4A 5CI9A 5JVEA 2ZXPA 2LK4A 2A6HF 4MW3A 5A6BA 2AVKA 3B9QA 5AC4A 2GA0A 3MX3A 3WODF 2V26A 3HKKA 4XPYA 2YL3A 1Z7Qc 2LFFA 2CCYA 3AGTA 1L3PA 3EQLF 1OKKA 5F5FA 3U8VA 2IOQA 4O6YA 3SXZA 4PJMA 2MWQA 3R2PA 3DE9A 1VYIA 3B0VC 1HE1A 2J45A 3NYJA 3TJ5A 4NC3A 2YVKA 4Z9IA 1E83A 2R7OA 3EGXB 5DS4A 1XZQA 2ZXOA 3T6BA 1ZW2A 1XWJA 3SNHA 1FAPB 1JPNA 2OEVA 3K6BA 4N06A 3FXHA 4MVSA 1E85A 3GM2A 2VH3A 2Y69C 1CGNA 4J7YA 1RCPA 3GEHA 3EG9A 3V5XA 4EBKA 4C7OA 4D4XA 1NBBA 3MFNA 1A7DA 1NFOA 3E9VA 4AE4B 3ZSUA 1T9KA 2I8BA 3C7JA 3GEIA 4JCZA 1HY5A 1QVXA 4H54A 1TQGA 2R05A 4N6HA 3HTKC 2XRHA 4CSAC 3OEOA 3ASOC 4JEBA 3L8JA 3M4BA 4P6IC 4XWJA 2IYLD 3HNKA 1B68A 2HV6A 2XLHA 1R5ID 4WGZA 3FMSA 3S29A 4C3BA 1KNYA 2XM4A 1UG7A 1S05A 4JRZA 4HEAJ 1PD0A 2MHRA 3N0TA 3FOOA 5FZTA 4DRJB 3ECSA 1CPQA 1YZAA 2FAPB 1C02A 4P9FA 3EJNA 3U5SA 1M2OA 3FDQA 4N6CA 4EHPA 5A6KA 5E3CA 1G8XA 1OW8A 1EQ1A 4N4WA 5CIVA 3S0XA 3K1IC 1FFHA 3JYHA 2R7TA 5F5HA 5D92A 2YLDA 1TR2A 3AGUA 1JR8A 2J9BA 4O6MA 3NRHA 3KPHA 4E0IA 1GM5A 5A6JA 3H2VA 3UMIA 3O55A 1BR2A 3B0PA 4XTKA 3KYJA 2M64A 3FAPB 3GM3A 5B1BC 3ZQVA 1O3UA 3K33A 3CZ6A 1D0YA 5AGFA 3DZAA 3GM1A 5KYNA 3J06A 3U0CA 3I5QA 5L0FA 1OW7A 3SP1A 3UGOA 3C18A 1M2VA 1LS4A 2LP4A 2YL7A 4BEMJ 4U5FE 4LDKA 1JMWA 2YRFA 2Q9BA 1ZU4A 2YL1A 3EFOB 3NKDA 3SZRA 3MLGA 2CNWA 3T4RA 1E84A 1W2WA 1FNTc 1Q0MA 3IPMO 2OQMA 1YARO 3C8GB 4RD9A 2YZSA 1WTYA 4W8KA 5KYYB 1A0BA 3ABMC 1XZPA 3T6GB 4CDVA 1T6IA 3AG4C 3N24A 3FVYA 5COGA 256BA 1YDIA 2NSFA 3H65A 4P9TA 5JT4A 2DYSC 3VYWA 1UFBA 2L6FA 4MVUA 5JLIA 2AWYA 5HV9A 3K66A 3RIPA 1TWHA 2DI3A 1RKEA 1ZW3A 1LIHA 2H7OA 2J0WA 2XS8A 3QW0A 1V55C 4MVRA 4YL0A 5DLJA 5T3TA 4CS9A 1M6TA 5COMA 2EINC 2XLDA 4G7HF 3LESA 1D1CA 1WASA 1RJ9A 3EZIA 3AJMA 3RVYA 1TKNA 1YYXA 2PX3A 2PBEA 3FAJA 2XLOA 1D0ZA 1RKCA 2NUTA 4D4NA 4E0HA 5KYXA 1WOLA 4JW1A 1QQ3A 2XXAA 4FESA 4IJJA 1BDJB 1MNEA 1V74B 3DWWA 1YJGA 4OIRF 4H4KC 3U2LA 1AEPA 4YT5A 4XEFA 4YT8A 2LQGA 3MBGA 2VC9A 2KYHA 3QMKA 4ONSA 4WGYA 1ZHXA 1YZCA 4ULVA 2R7WA 1IZMA 3ZVRA 1QPUA 1VLSA 3R7CA 2H7BA 3BEHA 1U89A 4CSAA 1QZXA 1MMNA 5JSLA 3DJUB 3RKOF 2CYDA 4CX9A 2IXPA 4IARA 3JT1A 2XXAB 2YLIA 3O10A 3T9OA 3AG1C 4DRIB 1T5OA 4YL3A 1O87A 5KYXB 3IQ6A 1R4TA 5DS6A 2XLVA 3B29A 4U5GA 1RJ9B 2P1AA
chains in the Genus database with same CATH topology
4CS7A 4QI2A 2X51A 4U5EE 2E87A 3AQBA 2W4BA 2V3CC 2QTVA 4AK9A 1ZHTA 2NUPA 3B0UX 4JVSA 4CBEA 1ZHWA 2H7VC 3ASNC 5T1DB 4LLEA 2G3VA 5KYYA 4A2NB 3ZC4A 1OCCC 2C04A 2PF4E 3EH2A 3S28A 2NG1A 5B3SC 2J9UA 1M2VB 2A69F 2HV7A 2M4EA 3PHF2 3X1OA 1MNDA 5EHHA 1OKKD 3F46A 3W8HA 3CQZA 1VK5A 3X2QC 3OWTA 3ABKC 1FMWA 3AG3C 3SEOA 2VASA 3JSZA 2EIMC 4RBNA 1BR1A 4QDLA 2W45A 1SMYF 2P7VA 1LKXA 3UMKA 2R7VA 4F4BA 2EILC 4PK4A 1M57C 3HJCA 2J46A 4JCHA 4AX2A 2DGJA 3Q6MA 4XLPF 2A68F 4DOZA 4QI0A 4OD4A 3LJBA 3NDBB 2WVQA 4DVZA 3K7DA 1Z3IX 4G7ZF 2Y3HA 4I1MA 2ZXRA 4EWCA 4E7SA 3EG9B 3ITFA 3UMHA 1TWGA 4YJWA 4BJ6A 1J8YF 4I3MA 2PFDA 4JJFA 3L0IA 4U5DE 5T3WA 2J9WA 5BUOA 4ZLCA 3EGXA 4IAOA 5EGYA 5KYWA 2WB7A 4GYTA 3T6JA 1Z63A 1NU7D 2P6VA 1D1BA 1VYKA 4HFKB 3LLKA 1ZHYA 2WZFA 4Q4ZF 1BR4A 3O6XA 4BEJA 1ZHZA 5E2QA 2KGOA 1D0XA 4JZAA 3NKEA 3Q7LA 2ZPAA 1M56C 1KU2A 2W9YA 2CNWD 5KYWB 1ZYRF 3W2WA 4CS9C 5DVWA 3NG1A 4IWBA 4M63A 2CGEA 2R7RA 4KC9A 2Q9AA 3PMRA 5KYUA 4BJTA 3O39A 2IXMA 2Q3TA 3S27A 3LAYA 2KW3C 2J9VA 5E33A 1WGWA 2FFHA 2CW0F 2KNHA 4J32B 1Z5ZA 4DVYP 4CIHA 4BJ5C 1D1AA 5L3VA 1QLEC 3I5PA 2R7SA 1MMDA 5B1AC 5L3QA 1NZEA 4G7OF 2CDQA 3EGDA 4O79A 2IXOA 4K0DA 1N1CA 1IW7F 1PD1A 2JD3A 4Q7CA 2O9XA 4FWVA 4KBLA 4LERA 2PP4A 1S7ZA 4PFOA 3RYLA 4YT2A 2Z15A 4WJ0A 2R7XA 3Q7GA 3FHDA 3LLIA 3DM5A 2G3KA 4RDAA 1V54C 3GANA 2QY9A 1J8MF 1LS1A 1Z23A 2WZGA 3CSKA 4U5BE 4G0HA 4ANJA 4DBRA 3POVA 3DD7A 2XSEA 1OCOC 2EIJC 4CS8C 3W2VA 2OG2A 2J7PD 3K1HA 3GODA 4XLNF 3UNGC 5D91A 1ST6A 2GFHA 1SZIA 2NUPB 5IY5C 4EBBA 4GEHA 2EIKC 2ZXWC 3LNRA 1SF8A 4ZLDA 3ABLC 2C03A 4MNDA 3F47A 3N2ZB 4ULWA 2PX0A 1VMAA 4O6NA 4DBQA 2Y3BA 1PCXA 3DXJF 1TWAA 2R7UA 4LACB 1NG1A 1LVKA 4IRUA 3NYMA 2IXNA 3HLZA 5E3AA 1TWCA 2A1DD 4B6IA 3Q6NA 4OIOF 4HFFB 4BJ6C 5HSWA 1ZU5A 2VB6A 2KJGA 2NUTB 2YHSA 3AQCA 1NU9C 2KQ9A 1Z6AA 5DQZA 2FGYA 3I4UA 4YN0B 2G62A 3EH1A 1MMAA 2DYRC 5DQTA 3E70C 2MYSA 4OD5A 4YT4A 4K7BA 1JPJA 3WG7C 4BJ5A 3UR3C 3KKBA 3RH3A 4I44A 2WVNA 4HE8D 5CI8A 4YWQA 3DM9B 4PJNA 2W4MA 4J30B 3EFOA 3LEVA 4X0RA 2WZLA 3LS0A 3ZG1A 3JRTA 1FMVA 3EHNA 2Y39A 4KNWA 3UGPA 5FCLA 2B0JA 3ZIBA 4FX5A 4OINF 3DMDA 3W8IA 4C3DA 4PJLA 3VAYA 3EHMA 3L34A 2R7QA 3QZCA 4C3EA 3KH2A 1OCRC 2L81A 2J0XA 5DS5A 4I1OB 3EGDB 4BJ1A 3NYLA 3V7OA 3LS1A 4JURI 2XL4A 2Y3DA 2WL8A 3EZHA 4U5CE 3SYNA 2BE5F 3DAFA 2OCCC 2Q9CA 1VOMA 3RFYA 3TD7A 3DJNB 1FFTC 3AG2C 3OA1A 4BG0A 1OCZC 3KMIA 4E7ZA 1O5HA 1MMGA 3KL4A 4OIPF 1FTSA 2J7PA 2YEVA 4CS8A 4OIQF 4O7GA 2WVOA 3DAGA 3JCUQ 4PJJA 4U5HA 2L9JA 4AE4A 4KNVA 2A6EF 3EPVA 4NY3A 4Q5SF 3M1CB 4C7OB 4KI2A 4MQ9F 2LSEA 2Y3GA 4LLCA 4PFPA 5KYUB 3IEEA 2D5RB 4JJGA 5CI9A 2ZXPA 2A6HF 3B9QA 3MX3A 3WODF 2V26A 3EQLF 1OKKA 5F5FA 2IOQA 4O6YA 4PJMA 2MWQA 3B0VC 1VYIA 2J45A 3NYJA 2R7OA 3EGXB 5DS4A 2ZXOA 3T6BA 3SNHA 1JPNA 3K6BA 4N06A 2VH3A 2Y69C 3EG9A 4C7OA 3E9VA 4AE4B 3ZSUA 2I8BA 3HTKC 2XRHA 4CSAC 3OEOA 3ASOC 4P6IC 4XWJA 2IYLD 2HV6A 3S29A 4C3BA 4HEAJ 1PD0A 3N0TA 3ECSA 3EJNA 1M2OA 3FDQA 5E3CA 1G8XA 3S0XA 3K1IC 1FFHA 3JYHA 2R7TA 5F5HA 5D92A 1TR2A 4O6MA 3NRHA 3UMIA 1BR2A 3B0PA 4XTKA 5B1BC 3K33A 3CZ6A 1D0YA 3DZAA 5KYNA 3I5QA 3UGOA 3SP1A 1M2VA 4U5FE 3NKDA 2Q9BA 1ZU4A 3EFOB 3SZRA 3MLGA 2CNWA 3T4RA 1W2WA 4RD9A 2YZSA 4W8KA 5KYYB 3ABMC 3AG4C 3N24A 3FVYA 3H65A 2DYSC 3VYWA 3K66A 3RIPA 1TWHA 2H7OA 2J0WA 4CS9A 1V55C 5DLJA 5T3TA 2EINC 4G7HF 3LESA 1D1CA 1RJ9A 3EZIA 1TKNA 2PX3A 3FAJA 1D0ZA 2NUTA 5KYXA 4JW1A 2XXAA 4FESA 4IJJA 1MNEA 4OIRF 4H4KC 4YT5A 4YT8A 3QMKA 1ZHXA 2R7WA 1IZMA 3ZVRA 2H7BA 4CSAA 1QZXA 1MMNA 3DJUB 3RKOF 2IXPA 3JT1A 2XXAB 3AG1C 5KYXB 1O87A 5DS6A 4U5GA 1RJ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AX2 A;  4B6I A;  4HFK B;  4J30 B;  3ZIB A;  4JUR I;  4HFF B;  4J32 B; 
#chains in the Genus database with same CATH topology
 1H9T A;  4CS7 A;  4QI2 A;  1DOW A;  2X51 A;  1VTM P;  4U5E E;  2E87 A;  4G78 A;  1OXB A;  3ZTM A;  4CJG A;  3AQB A;  2W4B A;  2V3C C;  2QTV A;  3TQO A;  3V5Z A;  3SXK A;  4NTF A;  4AK9 A;  1ZHT A;  3U9M A;  5L0H A;  1JAF A;  2NUP A;  3ZQY A;  3B0U X;  4JVS A;  4CBE A;  1ZHW A;  1EI7 A;  2H7V C;  3ASN C;  4U9D A;  2VCA A;  5T1D B;  1HW1 A;  4LLE A;  2G3V A;  5KYY A;  3IHU A;  3ZC4 A;  4A2N B;  3C8G A;  1YVI A;  2R03 A;  1OCC C;  2IBF A;  2C04 A;  2PF4 E;  3EH2 A;  1Q0D A;  3U3F A;  4YK5 A;  2VCC A;  3S28 A;  2EPK X;  2HMZ A;  2NG1 A;  4IGG A;  5B3S C;  5BQH A;  2J9U A;  1M2V B;  1YAU O;  2A69 F;  3M15 A;  3SXY A;  4AL0 A;  2HV7 A;  1G4U S;  2XL8 A;  2M4E A;  1JRA A;  1OR3 A;  4R32 A;  3U3B A;  3X1O A;  3PHF 2;  1MND A;  5EHH A;  1E2X A;  1OKK D;  4EBJ A;  3F46 A;  3W8H A;  3CQZ A;  5L0G A;  3G4Z A;  3QVY A;  1NSG B;  3DI5 A;  4DXW A;  2HS5 A;  2UUI A;  1GGQ A;  4XQ1 A;  2NSG A;  1VK5 A;  3X2Q C;  3OWT A;  3ABK C;  3ZDL A;  3W4Y A;  1FMW A;  3AG3 C;  3SEO A;  1A41 A;  2VAS A;  3JSZ A;  2GDC A;  2EIM C;  1HMD A;  1LI5 A;  2NPU A;  1BR1 A;  3B71 A;  3FOP A;  4RBN A;  3M79 A;  3TJ6 A;  4QDL A;  1L7C A;  4G7Z F;  2HJM A;  2XM0 A;  2W45 A;  1CPR A;  3DKA A;  2EPO A;  1SMY F;  2L6H A;  2P7V A;  5L0I A;  3HNJ A;  1LKX A;  3LEO A;  4MTO A;  3UMK A;  2R7V A;  4F4B A;  2R9R B;  2EIL C;  1K05 A;  4IAQ A;  1M57 C;  4PK4 A;  3HJC A;  2J46 A;  4JCH A;  4AX2 A;  2DGJ A;  3Q6M A;  4XLP F;  2A68 F;  4GQH A;  4DOZ A;  5JRA A;  4QI0 A;  1JOG A;  1C17 M;  1SR2 A;  4OD4 A;  3LJB A;  3NDB B;  2WVQ A;  4DVZ A;  1VLT A;  2TMV P;  2Q00 A;  1LE2 A;  3RVZ A;  1RMV A;  1YA9 A;  1T6Q A;  3K7D A;  1Z3I X;  2YWA A;  5K0I A;  3S9O A;  2Y3H A;  1Y6D A;  2L7A A;  3A9C A;  3DE8 A;  2ZXR A;  4I1M A;  1Q0G A;  3RQE A;  4EWC A;  4FAP B;  3QVZ A;  4BJ6 A;  4E7S A;  1NFN A;  1ZZP A;  3U9J A;  3EG9 B;  2EPN A;  3ITF A;  3UMH A;  2OOC A;  1TWG A;  1EKY A;  2R02 A;  4YJW A;  1J8Y F;  4I3M A;  4JTD B;  2PNO A;  2PFD A;  4JJF A;  3L0I A;  4U5D E;  3ZTZ A;  4JTA B;  4L6R A;  3A11 A;  2B0H A;  2Q4F A;  4WAB A;  4PAC A;  4EIY A;  5T3W A;  2J9W A;  3RW0 A;  5BUO A;  1HW2 A;  1YLM A;  3EGX A;  4IAO A;  4ZLC A;  5EGY A;  4CDA A;  5KYW A;  2WB7 A;  4GYT A;  3T6J A;  1GS9 A;  4CDY A;  1Z63 A;  1I4Y A;  1NU7 D;  2P6V A;  3JYY A;  1D1B A;  1VYK A;  1KTM A;  3RQG A;  4HFK B;  3LLK A;  1QKR A;  1ZHY A;  2WZF A;  4Q4Z F;  1OR2 A;  2HZ8 A;  2XLM A;  3LUT B;  5A6A A;  2YLG A;  1BR4 A;  2D4U A;  4LDR A;  1VB5 A;  3O6X A;  4MS2 A;  1ZHZ A;  5E2Q A;  2KGO A;  4BEJ A;  2RSE B;  1D0X A;  4JZA A;  3NKE A;  3Q7L A;  2ZPA A;  1M56 C;  1NLX A;  1KU2 A;  2VCB A;  2CNW D;  2W9Y A;  5KYW B;  1ZYR F;  3W2W A;  4CS9 C;  3ATP A;  5DVW A;  1EA8 A;  4K1O A;  3NG1 A;  4IWB A;  4M63 A;  2CGE A;  3TOL A;  2R7R A;  3IQT A;  1YA7 O;  1I5N A;  4KC9 A;  1T01 A;  3C63 A;  2Q9A A;  2GAQ A;  2XLE A;  3PMR A;  5KYU A;  1PV3 A;  3M4C A;  4BJT A;  3O39 A;  4JTC B;  4MVO A;  2IXM A;  1RXQ A;  4XPW A;  4A4A A;  2Q3T A;  3S27 A;  3LAY A;  4YL1 A;  1GQA A;  2KW3 C;  3C62 A;  2J9V A;  2KK1 A;  3QW1 A;  5E33 A;  1A7E A;  1WGW A;  2QNL A;  4DRH B;  2FFH A;  1ORS C;  2CW0 F;  2P61 A;  3SXM A;  1OQC A;  1AVO B;  2KNH A;  2LFD A;  4J32 B;  3WAQ A;  5JS5 A;  2R25 A;  1ORY A;  2H8A A;  3L1M A;  4MVM A;  3VM6 A;  4EKW A;  1Z5Z A;  3JZ0 A;  4DVY P;  4CIH A;  3MYI A;  4BJ5 C;  3S90 A;  1D1A A;  2KC3 A;  5L3V A;  1QLE C;  1H9G A;  3I5P A;  3C8G D;  3S84 A;  3PDM P;  2RD9 A;  2R7S A;  4U9E A;  1MMD A;  3RF3 A;  3AOU A;  5B1A C;  5L0D A;  5L3Q A;  1NZE A;  4G7O F;  1AUE A;  5AC5 A;  4AL1 A;  2CDQ A;  3EGD A;  4O79 A;  2IXO A;  4MVQ A;  1G4W R;  2OJE D;  4K0D A;  1N1C A;  1OW6 A;  1IW7 F;  1PD1 A;  4UDV A;  1QSP A;  2J8W A;  2JD3 A;  3V5Y A;  4Q7C A;  2O9X A;  2XLW A;  3WHN A;  2ETS A;  1F1M A;  2HUJ A;  4FWV A;  4KBL A;  4LER A;  3TK0 A;  2XL6 A;  2LIG A;  5A6B D;  2PP4 A;  1S7Z A;  4PFO A;  3RYL A;  5L0C A;  4MTG A;  3TUL A;  1OXK A;  2Q7R A;  4YT2 A;  2Z15 A;  2YL0 A;  4WJ0 A;  4E18 A;  2R7X A;  3Q7G A;  3FHD A;  3LLI A;  5EK0 A;  1K40 A;  4JEA A;  2YQY A;  1I4Z A;  2KSF A;  3DM5 A;  3ZWI A;  2G3K A;  1C03 A;  4RDA A;  1V54 C;  3GAN A;  2QY9 A;  2EPL X;  1J8M F;  1LS1 A;  1Z23 A;  2WZG A;  3BRJ A;  3CSK A;  4U5B E;  4G0H A;  4ANJ A;  4DBR A;  4DJ9 A;  3POV A;  3DD7 A;  2XSE A;  1OCO C;  1Y4C A;  2EIJ C;  4CS8 C;  3W2V A;  2OG2 A;  2J7P D;  3K1H A;  3GOD A;  4XLN F;  2XS1 A;  2QLA A;  3UNG C;  5D91 A;  1ST6 A;  2GFH A;  1SZI A;  2NUP B;  3K1I A;  1WN0 A;  2BC5 A;  4EBB A;  4GEH A;  5IY5 C;  2EIK C;  2ZXW C;  3LNR A;  1SF8 A;  4ZLD A;  3ABL C;  2C03 A;  3GWL A;  5A69 A;  1WAT A;  4MND A;  3CAX A;  3F47 A;  2OKU A;  3N2Z B;  5GPG B;  4ULW A;  4XEV A;  4CIP A;  2PX0 A;  1VMA A;  2BL2 A;  4O6N A;  3QTH A;  2HSB A;  2Y3B A;  1PCX A;  3DXJ F;  3GOR A;  4DBQ A;  3TOM A;  1TWA A;  1LI7 A;  1CGO A;  5JUA A;  2R7U A;  2ZD9 A;  3JRM O;  2F22 A;  3RQF A;  3IQC A;  4LAC B;  1NG1 A;  1LVK A;  2AP3 A;  3US6 A;  4MVZ A;  2LD6 A;  4J7T A;  3GWN A;  4IRU A;  1LPE A;  3NYM A;  2HFI A;  2IXN A;  3HLZ A;  5E3A A;  1TWC A;  2A1D D;  4B6I A;  3G4X A;  3G50 A;  3L8I A;  3Q6N A;  4OIO F;  1Q0F A;  2OJQ A;  4LDQ A;  1BZ4 A;  1BBH A;  2AU5 A;  4HFF B;  4BJ6 C;  5HSW A;  1ZU5 A;  2VB6 A;  2KJG A;  2NUT B;  2I15 A;  2YHS A;  4BPM A;  2JX0 A;  1ORJ A;  3AQC A;  3PCV A;  1SYQ A;  2HJ3 A;  3MYF A;  5F28 E;  1NU9 C;  2KQ9 A;  1Z6A A;  3NMK A;  3VF0 A;  1RKE B;  1FR0 A;  4EUK B;  5DQZ A;  1V4A A;  2FGY A;  3I4U A;  4YN0 B;  1WWP A;  2G62 A;  5BQI A;  2L6G A;  1MMA A;  2DYR C;  3EH1 A;  5DQT A;  3E70 C;  2OEX A;  2GWW A;  2MYS A;  4OD5 A;  4K7B A;  5COF A;  4YT4 A;  1JPJ A;  2A0U A;  3WG7 C;  4BJ5 A;  1DOV A;  3UR3 C;  3H2U A;  3KKB A;  3KYI A;  4I44 A;  4JC7 A;  3RH3 A;  3U8P A;  1H7I A;  1LE4 A;  2WVN A;  4HE8 D;  5CI8 A;  4YWQ A;  3HNI A;  4ER9 A;  3DM9 B;  3VRC A;  4JIO A;  4PR9 A;  4PJN A;  2W4M A;  4J30 B;  3EFO A;  3LEV A;  2EPM X;  4CJO A;  4NTB A;  4X0R A;  2WZL A;  3LS0 A;  4MW8 A;  3JRT A;  1FMV A;  3EHN A;  2Y39 A;  2LCH A;  4KNW A;  3ZG1 A;  3UGP A;  3HNL A;  5FCL A;  2B0J A;  3ZIB A;  1Q0K A;  4FX5 A;  4NQF A;  1A7V A;  4OIN F;  3DMD A;  3W8I A;  4C3D A;  3GEE A;  3LNM B;  4PJL A;  3VAY A;  3EHM A;  3L34 A;  2ASR A;  3JSE O;  1TFO B;  3CEX A;  2IM8 A;  2R7Q A;  3QZC A;  5JP7 A;  4C3E A;  3IQ5 A;  3C8Z A;  1LM3 B;  2P0N A;  3KH2 A;  1MQV A;  4JKV A;  1OCR C;  2HSQ A;  2L81 A;  3NMI A;  2J0X A;  5DS5 A;  4I1O B;  3EGD B;  5B3I A;  1CGM E;  2QE9 A;  4BJ1 A;  1TFK B;  4Z9J A;  3NYL A;  2X0C A;  2JPU A;  2QUP A;  3V7O A;  2YKZ A;  3LS1 A;  2AWC A;  2XL4 A;  2Y3D A;  4JUR I;  2WL8 A;  3EZH A;  4U5C E;  3SYN A;  2BE5 F;  3DAF A;  4W8P A;  1HE9 A;  2OCC C;  2Q9C A;  1VOM A;  1K04 A;  1YYJ A;  1U6H A;  2OU6 A;  4XEK A;  3RFY A;  1APC A;  3TD7 A;  5TJ5 E;  3DJN B;  3JTL O;  4IB4 A;  1FFT C;  4NTA A;  3AG2 C;  3OA1 A;  4JE9 A;  2A0B A;  1OCZ C;  4XPX A;  4BG0 A;  3KMI A;  4E7Z A;  1O5H A;  5BQG A;  1MMG A;  1H6G A;  3KL4 A;  4OIP F;  4NCQ A;  1FTS A;  2ICW G;  1G5Z A;  2J7P A;  2YEV A;  4CS8 A;  4O7G A;  4E17 A;  5L0J A;  4OIQ F;  1ZVZ A;  2WVO A;  3DAG A;  3JCU Q;  4PJJ A;  2UUH A;  2L9J A;  3NMJ A;  4U5H A;  3U2M A;  4AE4 A;  4KNV A;  2A6E F;  3EPV A;  4NY3 A;  4Q5S F;  3M1C B;  4C7O B;  2HKV A;  1E86 A;  1HMO A;  4MTF A;  4KI2 A;  4MQ9 F;  2LSE A;  2Y3G A;  4LLC A;  4PFP A;  5KYU B;  3IEE A;  1U0B B;  2D5R B;  2HMQ A;  4Z9H A;  1T6U A;  4JJG A;  2DB4 A;  5CI9 A;  5JVE A;  2ZXP A;  2LK4 A;  2A6H F;  4MW3 A;  5A6B A;  2AVK A;  3B9Q A;  5AC4 A;  2GA0 A;  3MX3 A;  3WOD F;  2V26 A;  3HKK A;  4XPY A;  2YL3 A;  1Z7Q c;  2LFF A;  2CCY A;  3AGT A;  1L3P A;  3EQL F;  1OKK A;  5F5F A;  3U8V A;  2IOQ A;  4O6Y A;  3SXZ A;  4PJM A;  2MWQ A;  3R2P A;  3DE9 A;  1VYI A;  3B0V C;  1HE1 A;  2J45 A;  3NYJ A;  3TJ5 A;  4NC3 A;  2YVK A;  4Z9I A;  1E83 A;  2R7O A;  3EGX B;  5DS4 A;  1XZQ A;  2ZXO A;  3T6B A;  1ZW2 A;  1XWJ A;  3SNH A;  1FAP B;  1JPN A;  2OEV A;  3K6B A;  4N06 A;  3FXH A;  4MVS A;  1E85 A;  3GM2 A;  2VH3 A;  2Y69 C;  1CGN A;  4J7Y A;  1RCP A;  3GEH A;  3EG9 A;  3V5X A;  4EBK A;  4C7O A;  4D4X A;  1NBB A;  3MFN A;  1A7D A;  1NFO A;  3E9V A;  4AE4 B;  3ZSU A;  1T9K A;  2I8B A;  3C7J A;  3GEI A;  4JCZ A;  1HY5 A;  1QVX A;  4H54 A;  1TQG A;  2R05 A;  4N6H A;  3HTK C;  2XRH A;  4CSA C;  3OEO A;  3ASO C;  4JEB A;  3L8J A;  3M4B A;  4P6I C;  4XWJ A;  2IYL D;  3HNK A;  1B68 A;  2HV6 A;  2XLH A;  1R5I D;  4WGZ A;  3FMS A;  3S29 A;  4C3B A;  1KNY A;  2XM4 A;  1UG7 A;  1S05 A;  4JRZ A;  4HEA J;  1PD0 A;  2MHR A;  3N0T A;  3FOO A;  5FZT A;  4DRJ B;  3ECS A;  1CPQ A;  1YZA A;  2FAP B;  1C02 A;  4P9F A;  3EJN A;  3U5S A;  1M2O A;  3FDQ A;  4N6C A;  4EHP A;  5A6K A;  5E3C A;  1G8X A;  1OW8 A;  1EQ1 A;  4N4W A;  5CIV A;  3S0X A;  3K1I C;  1FFH A;  3JYH A;  2R7T A;  5F5H A;  5D92 A;  2YLD A;  1TR2 A;  3AGU A;  1JR8 A;  2J9B A;  4O6M A;  3NRH A;  3KPH A;  4E0I A;  1GM5 A;  5A6J A;  3H2V A;  3UMI A;  3O55 A;  1BR2 A;  3B0P A;  4XTK A;  3KYJ A;  2M64 A;  3FAP B;  3GM3 A;  5B1B C;  3ZQV A;  1O3U A;  3K33 A;  3CZ6 A;  1D0Y A;  5AGF A;  3DZA A;  3GM1 A;  5KYN A;  3J06 A;  3U0C A;  3I5Q A;  5L0F A;  1OW7 A;  3SP1 A;  3UGO A;  3C18 A;  1M2V A;  1LS4 A;  2LP4 A;  2YL7 A;  4BEM J;  4U5F E;  4LDK A;  1JMW A;  2YRF A;  2Q9B A;  1ZU4 A;  2YL1 A;  3EFO B;  3NKD A;  3SZR A;  3MLG A;  2CNW A;  3T4R A;  1E84 A;  1W2W A;  1FNT c;  1Q0M A;  3IPM O;  2OQM A;  1YAR O;  3C8G B;  4RD9 A;  2YZS A;  1WTY A;  4W8K A;  5KYY B;  1A0B A;  3ABM C;  1XZP A;  3T6G B;  4CDV A;  1T6I A;  3AG4 C;  3N24 A;  3FVY A;  5COG A;  256B A;  1YDI A;  2NSF A;  3H65 A;  4P9T A;  5JT4 A;  2DYS C;  3VYW A;  1UFB A;  2L6F A;  4MVU A;  5JLI A;  2AWY A;  5HV9 A;  3K66 A;  3RIP A;  1TWH A;  2DI3 A;  1RKE A;  1ZW3 A;  1LIH A;  2H7O A;  2J0W A;  2XS8 A;  3QW0 A;  1V55 C;  4MVR A;  4YL0 A;  5DLJ A;  5T3T A;  4CS9 A;  1M6T A;  5COM A;  2EIN C;  2XLD A;  4G7H F;  3LES A;  1D1C A;  1WAS A;  1RJ9 A;  3EZI A;  3AJM A;  3RVY A;  1TKN A;  1YYX A;  2PX3 A;  2PBE A;  3FAJ A;  2XLO A;  1D0Z A;  1RKC A;  2NUT A;  4D4N A;  4E0H A;  5KYX A;  1WOL A;  4JW1 A;  1QQ3 A;  2XXA A;  4FES A;  4IJJ A;  1BDJ B;  1MNE A;  1V74 B;  3DWW A;  1YJG A;  4OIR F;  4H4K C;  3U2L A;  1AEP A;  4YT5 A;  4XEF A;  4YT8 A;  2LQG A;  3MBG A;  2VC9 A;  2KYH A;  3QMK A;  4ONS A;  4WGY A;  1ZHX A;  1YZC A;  4ULV A;  2R7W A;  1IZM A;  3ZVR A;  1QPU A;  1VLS A;  3R7C A;  2H7B A;  3BEH A;  1U89 A;  4CSA A;  1QZX A;  1MMN A;  5JSL A;  3DJU B;  3RKO F;  2CYD A;  4CX9 A;  2IXP A;  4IAR A;  3JT1 A;  2XXA B;  2YLI A;  3O10 A;  3T9O A;  3AG1 C;  4DRI B;  1T5O A;  4YL3 A;  1O87 A;  5KYX B;  3IQ6 A;  1R4T A;  5DS6 A;  2XLV A;  3B29 A;  4U5G A;  1RJ9 B;  2P1A A; 
#chains in the Genus database with same CATH homology
 4CS7 A;  4QI2 A;  2X51 A;  4U5E E;  2E87 A;  3AQB A;  2W4B A;  2V3C C;  2QTV A;  4AK9 A;  1ZHT A;  2NUP A;  3B0U X;  4JVS A;  4CBE A;  1ZHW A;  2H7V C;  3ASN C;  5T1D B;  4LLE A;  2G3V A;  5KYY A;  4A2N B;  3ZC4 A;  1OCC C;  2C04 A;  2PF4 E;  3EH2 A;  3S28 A;  2NG1 A;  5B3S C;  2J9U A;  1M2V B;  2A69 F;  2HV7 A;  2M4E A;  3PHF 2;  3X1O A;  1MND A;  5EHH A;  1OKK D;  3F46 A;  3W8H A;  3CQZ A;  1VK5 A;  3X2Q C;  3OWT A;  3ABK C;  1FMW A;  3AG3 C;  3SEO A;  2VAS A;  3JSZ A;  2EIM C;  4RBN A;  1BR1 A;  4QDL A;  2W45 A;  1SMY F;  2P7V A;  1LKX A;  3UMK A;  2R7V A;  4F4B A;  2EIL C;  4PK4 A;  1M57 C;  3HJC A;  2J46 A;  4JCH A;  4AX2 A;  2DGJ A;  3Q6M A;  4XLP F;  2A68 F;  4DOZ A;  4QI0 A;  4OD4 A;  3LJB A;  3NDB B;  2WVQ A;  4DVZ A;  3K7D A;  1Z3I X;  4G7Z F;  2Y3H A;  4I1M A;  2ZXR A;  4EWC A;  4E7S A;  3EG9 B;  3ITF A;  3UMH A;  1TWG A;  4YJW A;  4BJ6 A;  1J8Y F;  4I3M A;  2PFD A;  4JJF A;  3L0I A;  4U5D E;  5T3W A;  2J9W A;  5BUO A;  4ZLC A;  3EGX A;  4IAO A;  5EGY A;  5KYW A;  2WB7 A;  4GYT A;  3T6J A;  1Z63 A;  1NU7 D;  2P6V A;  1D1B A;  1VYK A;  4HFK B;  3LLK A;  1ZHY A;  2WZF A;  4Q4Z F;  1BR4 A;  3O6X A;  4BEJ A;  1ZHZ A;  5E2Q A;  2KGO A;  1D0X A;  4JZA A;  3NKE A;  3Q7L A;  2ZPA A;  1M56 C;  1KU2 A;  2W9Y A;  2CNW D;  5KYW B;  1ZYR F;  3W2W A;  4CS9 C;  5DVW A;  3NG1 A;  4IWB A;  4M63 A;  2CGE A;  2R7R A;  4KC9 A;  2Q9A A;  3PMR A;  5KYU A;  4BJT A;  3O39 A;  2IXM A;  2Q3T A;  3S27 A;  3LAY A;  2KW3 C;  2J9V A;  5E33 A;  1WGW A;  2FFH A;  2CW0 F;  2KNH A;  4J32 B;  1Z5Z A;  4DVY P;  4CIH A;  4BJ5 C;  1D1A A;  5L3V A;  1QLE C;  3I5P A;  2R7S A;  1MMD A;  5B1A C;  5L3Q A;  1NZE A;  4G7O F;  2CDQ A;  3EGD A;  4O79 A;  2IXO A;  4K0D A;  1N1C A;  1IW7 F;  1PD1 A;  2JD3 A;  4Q7C A;  2O9X A;  4FWV A;  4KBL A;  4LER A;  2PP4 A;  1S7Z A;  4PFO A;  3RYL A;  4YT2 A;  2Z15 A;  4WJ0 A;  2R7X A;  3Q7G A;  3FHD A;  3LLI A;  3DM5 A;  2G3K A;  4RDA A;  1V54 C;  3GAN A;  2QY9 A;  1J8M F;  1LS1 A;  1Z23 A;  2WZG A;  3CSK A;  4U5B E;  4G0H A;  4ANJ A;  4DBR A;  3POV A;  3DD7 A;  2XSE A;  1OCO C;  2EIJ C;  4CS8 C;  3W2V A;  2OG2 A;  2J7P D;  3K1H A;  3GOD A;  4XLN F;  3UNG C;  5D91 A;  1ST6 A;  2GFH A;  1SZI A;  2NUP B;  5IY5 C;  4EBB A;  4GEH A;  2EIK C;  2ZXW C;  3LNR A;  1SF8 A;  4ZLD A;  3ABL C;  2C03 A;  4MND A;  3F47 A;  3N2Z B;  4ULW A;  2PX0 A;  1VMA A;  4O6N A;  4DBQ A;  2Y3B A;  1PCX A;  3DXJ F;  1TWA A;  2R7U A;  4LAC B;  1NG1 A;  1LVK A;  4IRU A;  3NYM A;  2IXN A;  3HLZ A;  5E3A A;  1TWC A;  2A1D D;  4B6I A;  3Q6N A;  4OIO F;  4HFF B;  4BJ6 C;  5HSW A;  1ZU5 A;  2VB6 A;  2KJG A;  2NUT B;  2YHS A;  3AQC A;  1NU9 C;  2KQ9 A;  1Z6A A;  5DQZ A;  2FGY A;  3I4U A;  4YN0 B;  2G62 A;  3EH1 A;  1MMA A;  2DYR C;  5DQT A;  3E70 C;  2MYS A;  4OD5 A;  4YT4 A;  4K7B A;  1JPJ A;  3WG7 C;  4BJ5 A;  3UR3 C;  3KKB A;  3RH3 A;  4I44 A;  2WVN A;  4HE8 D;  5CI8 A;  4YWQ A;  3DM9 B;  4PJN A;  2W4M A;  4J30 B;  3EFO A;  3LEV A;  4X0R A;  2WZL A;  3LS0 A;  3ZG1 A;  3JRT A;  1FMV A;  3EHN A;  2Y39 A;  4KNW A;  3UGP A;  5FCL A;  2B0J A;  3ZIB A;  4FX5 A;  4OIN F;  3DMD A;  3W8I A;  4C3D A;  4PJL A;  3VAY A;  3EHM A;  3L34 A;  2R7Q A;  3QZC A;  4C3E A;  3KH2 A;  1OCR C;  2L81 A;  2J0X A;  5DS5 A;  4I1O B;  3EGD B;  4BJ1 A;  3NYL A;  3V7O A;  3LS1 A;  4JUR I;  2XL4 A;  2Y3D A;  2WL8 A;  3EZH A;  4U5C E;  3SYN A;  2BE5 F;  3DAF A;  2OCC C;  2Q9C A;  1VOM A;  3RFY A;  3TD7 A;  3DJN B;  1FFT C;  3AG2 C;  3OA1 A;  4BG0 A;  1OCZ C;  3KMI A;  4E7Z A;  1O5H A;  1MMG A;  3KL4 A;  4OIP F;  1FTS A;  2J7P A;  2YEV A;  4CS8 A;  4OIQ F;  4O7G A;  2WVO A;  3DAG A;  3JCU Q;  4PJJ A;  4U5H A;  2L9J A;  4AE4 A;  4KNV A;  2A6E F;  3EPV A;  4NY3 A;  4Q5S F;  3M1C B;  4C7O B;  4KI2 A;  4MQ9 F;  2LSE A;  2Y3G A;  4LLC A;  4PFP A;  5KYU B;  3IEE A;  2D5R B;  4JJG A;  5CI9 A;  2ZXP A;  2A6H F;  3B9Q A;  3MX3 A;  3WOD F;  2V26 A;  3EQL F;  1OKK A;  5F5F A;  2IOQ A;  4O6Y A;  4PJM A;  2MWQ A;  3B0V C;  1VYI A;  2J45 A;  3NYJ A;  2R7O A;  3EGX B;  5DS4 A;  2ZXO A;  3T6B A;  3SNH A;  1JPN A;  3K6B A;  4N06 A;  2VH3 A;  2Y69 C;  3EG9 A;  4C7O A;  3E9V A;  4AE4 B;  3ZSU A;  2I8B A;  3HTK C;  2XRH A;  4CSA C;  3OEO A;  3ASO C;  4P6I C;  4XWJ A;  2IYL D;  2HV6 A;  3S29 A;  4C3B A;  4HEA J;  1PD0 A;  3N0T A;  3ECS A;  3EJN A;  1M2O A;  3FDQ A;  5E3C A;  1G8X A;  3S0X A;  3K1I C;  1FFH A;  3JYH A;  2R7T A;  5F5H A;  5D92 A;  1TR2 A;  4O6M A;  3NRH A;  3UMI A;  1BR2 A;  3B0P A;  4XTK A;  5B1B C;  3K33 A;  3CZ6 A;  1D0Y A;  3DZA A;  5KYN A;  3I5Q A;  3UGO A;  3SP1 A;  1M2V A;  4U5F E;  3NKD A;  2Q9B A;  1ZU4 A;  3EFO B;  3SZR A;  3MLG A;  2CNW A;  3T4R A;  1W2W A;  4RD9 A;  2YZS A;  4W8K A;  5KYY B;  3ABM C;  3AG4 C;  3N24 A;  3FVY A;  3H65 A;  2DYS C;  3VYW A;  3K66 A;  3RIP A;  1TWH A;  2H7O A;  2J0W A;  4CS9 A;  1V55 C;  5DLJ A;  5T3T A;  2EIN C;  4G7H F;  3LES A;  1D1C A;  1RJ9 A;  3EZI A;  1TKN A;  2PX3 A;  3FAJ A;  1D0Z A;  2NUT A;  5KYX A;  4JW1 A;  2XXA A;  4FES A;  4IJJ A;  1MNE A;  4OIR F;  4H4K C;  4YT5 A;  4YT8 A;  3QMK A;  1ZHX A;  2R7W A;  1IZM A;  3ZVR A;  2H7B A;  4CSA A;  1QZX A;  1MMN A;  3DJU B;  3RKO F;  2IXP A;  3JT1 A;  2XXA B;  3AG1 C;  5KYX B;  1O87 A;  5DS6 A;  4U5G A;  1RJ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...