4J30B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium, selenomethionine variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j30B00
4B6IA 4AX2A 4HFKB 4HFFB 4J32B 4J30B 4JURI 3ZIBA
chains in the Genus database with same CATH superfamily
2FAPB 3C63A 3W2VA 3K66A 3ZQVA 1BBHA 2EIMC 1R4TA 3GM3A 3KL4A 3RIPA 3F46A 5A6BD 1Q0KA 3EGXA 2EPKX 4MTOA 5KYYB 1TWCA 1VTMP 1D0ZA 1WTYA 2YLIA 2YVKA 4ZLCA 1MNEA 2H7OA 3NYMA 3O55A 4WGZA 4XEVA 256BA 3L1MA 1E83A 4B6IA 1OKKD 4E7SA 4G7HF 1B68A 2FFHA 1Q0DA 2Y3HA 3LAYA 4NTFA 4LDKA 2KGOA 5DQZA 4BJ6C 5A6BA 2YL0A 3EH2A 1LPEA 3QTHA 4U5FE 1Z7Qc 3NKEA 3VRCA 1G8XA 1RCPA 1SF8A 3SP1A 4DRJB 1RJ9A 3SXMA 4Q5SF 1UG7A 1OKKA 1FMWA 3K7DA 2HMZA 1NSGB 3TD7A 4N06A 3TOMA 1T5OA 2L6GA 3E9VA 4LERA 3SXYA 4AK9A 2YHSA 2XRHA 1RKEB 2CGEA 2YEVA 3M1CB 4W8KA 2YLDA 3X1OA 1YYJA 3NRHA 5A6AA 4IAOA 2GWWA 3TOLA 2R7SA 2F22A 3C8GD 3SYNA 4K0DA 4FX5A 4L6RA 4E17A 2HV6A 3AG2C 4IB4A 4NTAA 1CPQA 2J9BA 2YL3A 4XPWA 1NU9C 3IQCA 4FWVA 2DYSC 3GEEA 4YWQA 2IYLD 4U5DE 5IY5C 3U8PA 1EA8A 3RQGA 1VYIA 2PP4A 3ZC4A 2ZXWC 1DOWA 1Z23A 2PX0A 2YRFA 1VB5A 2Q9CA 3C8GA 4JJGA 2XL4A 3GWNA 4KC9A 3AQBA 3S9OA 1ZW2A 4C3EA 4CDAA 2LD6A 4PFOA 5B3IA 3DJNB 4WGYA 1D0XA 3EPVA 4OINF 1YVIA 1C17M 3DM5A 4Z9HA 3L8IA 1ORYA 3AGTA 4BJ5A 5DS6A 1BR4A 2NG1A 4HFFB 1Q0FA 3FAPB 3EJNA 4OD4A 2XL8A 3AQCA 1LI5A 3CQZA 2B0HA 4MNDA 1HMDA 2XM4A 3BRJA 1I4YA 3EGDB 4D4NA 4O79A 4P6IC 3K1HA 3JSEO 3S27A 2WVQA 3RH3A 5JT4A 4UDVA 2BC5A 2Y3DA 4J30B 2R03A 3MLGA 4NY3A 3V5XA 4CSAA 2D5RB 4EBBA 5L0IA 1PV3A 2MWQA 3CZ6A 4JEAA 4J7YA 2PX3A 3H2VA 4MW3A 4K1OA 3T6BA 4PK4A 2EILC 5F28E 2AWCA 5GPGB 5L3QA 2WB7A 1A7DA 5JUAA 1YAUO 1TQGA 3HNJA 2X51A 4FESA 1LS4A 4XPXA 3L0IA 2HV7A 2QNLA 5DS4A 4YK5A 5DLJA 4ZLDA 3NG1A 4HFKB 2J9VA 3LESA 2C04A 4NC3A 4U9DA 3G50A 1PD0A 3JTLO 1VMAA 1PD1A 1OW6A 1T6IA 3DKAA 1S05A 1GQAA 3IPMO 1VK5A 2A69F 3S28A 1U89A 1JAFA 3WHNA 1G5ZA 3DD7A 3QVYA 4DVZA 4GQHA 1U0BB 1WATA 4JIOA 2IOQA 2QE9A 2HJMA 2AU5A 3ZTZA 2YZSA 1YDIA 1OR2A 4CDVA 3V7OA 4I3MA 3VYWA 5KYXB 3G4ZA 3QMKA 4NQFA 1JPNA 3TULA 1A41A 5KYUB 2E87A 1NZEA 1OXKA 1FR0A 2Q9BA 4QI2A 1C03A 2XLHA 2P61A 1FFTC 3E70C 1YZAA 1K40A 4ULWA 2XLDA 5L0DA 3EFOB 3B9QA 2KC3A 1BDJB 1SMYF 2J9WA 2ZXRA 3DM9B 3FOPA 4JJFA 1OR3A 3R2PA 4P9TA 1TR2A 2QUPA 2JD3A 4JC7A 2EIJC 2GFHA 2CW0F 1ZVZA 2YL7A 1H7IA 3JSZA 4U5BE 3EH1A 4MVUA 4PJJA 3BEHA 2V3CC 3MYIA 5COMA 2XM0A 3U2LA 1CGNA 4JRZA 4XWJA 5L0JA 1WOLA 4OIPF 2LCHA 1XWJA 2B0JA 2NUTB 1RKCA 4O7GA 5EK0A 1SYQA 2IXNA 3DZAA 3EZIA 3NKDA 4PJNA 1LM3B 1NFOA 2OKUA 2P6VA 3VM6A 2Y69C 3FOOA 4OIQF 2R7VA 3AJMA 4OD5A 4LACB 2OG2A 3QW1A 2Q9AA 4CIPA 3ZIBA 2XXAA 3JRTA 2P0NA 2XSEA 3JT1A 4YT2A 3K1IC 3RVYA 4JE9A 3B0UX 2XS1A 5KYYA 5E3AA 4XLNF 3RYLA 3ECSA 3RVZA 1UFBA 5T3WA 1IZMA 1EQ1A 1OCRC 2JX0A 2W4BA 2XL6A 4I1OB 4O6YA 1YJGA 1TFKB 3W8IA 5JLIA 3VAYA 1FNTc 2IBFA 1FMVA 2P1AA 2UUIA 1IW7F 2VCBA 3M79A 4DXWA 3Q6MA 4JZAA 2DB4A 2LQGA 3H2UA 1ZU5A 2H7BA 2PFDA 1XZPA 3GM1A 1QQ3A 3KMIA 4OIRF 1OCCC 2J46A 4MTGA 2EPMX 4ANJA 5K0IA 3S29A 2DYRC 1W2WA 1WGWA 2OEXA 2CDQA 1O5HA 1Y6DA 2WVNA 3DJUB 2OCCC 1NLXA 4GYTA 4KNWA 1NBBA 4X0RA 2NUPB 3O39A 1EKYA 4MVZA 2J9UA 1QVXA 2MHRA 1RKEA 3CSKA 4I1MA 5T3TA 5EHHA 3SXZA 4PFPA 1VLTA 4NTBA 1XZQA 1GS9A 5A6JA 2KJGA 2AWYA 2XS8A 1NG1A 1YARO 3Q7GA 3QZCA 5CIVA 1A7EA 1V74B 4BJ6A 3C7JA 5BQHA 3I4UA 1GM5A 3A9CA 1R5ID 3HJCA 3C18A 4CS8C 1E85A 4O6NA 3J06A 1WN0A 3SXKA 2AVKA 4CS7A 3UNGC 5AC5A 4CIHA 2VCAA 1WASA 2XLWA 5E2QA 5JVEA 4XLPF 2RD9A 3FDQA 1FAPB 3L8JA 4U5CE 5L0HA 3HKKA 4Q7CA 2Q7RA 5DVWA 4XEFA 3N2ZB 3EGXB 4E7ZA 4G7ZF 2YQYA 4GEHA 4U9EA 4MTFA 4CS8A 2M4EA 2A6HF 4MQ9F 4R32A 3RQEA 1N1CA 4EKWA 4YT4A 2Y3GA 2ASRA 3M4BA 4AL0A 1ZHZA 2PBEA 2C03A 4EUKB 4DJ9A 3ABLC 4DOZA 4DBQA 3EGDA 3R7CA 3AG4C 3EZHA 3NDBB 2LP4A 1ST6A 3DI5A 3LJBA 3JCUQ 5D92A 4C3DA 1HW1A 1TWHA 3UGPA 4JTAB 2R7QA 4N4WA 4W8PA 1HW2A 4G0HA 5HV9A 2J0XA 2VASA 2KNHA 3JRMO 4WJ0A 1J8YF 3ZVRA 5KYWA 2LK4A 1HE1A 3KKBA 2R7WA 3WAQA 2DGJA 3QW0A 3LLIA 2GAQA 4G78A 2A68F 3EHNA 2ZXOA 3CAXA 1CGOA 4IARA 1V54C 4KBLA 3RFYA 2IXOA 5L0FA 5B1BC 3MFNA 2R25A 1K05A 2ETSA 3VF0A 1M2VB 2AP3A 1BR1A 2BE5F 2Z15A 3ABMC 3ITFA 2YLGA 4AE4A 2EPLX 3C8GB 4MVSA 4F4BA 3KYIA 3IQ6A 3N0TA 5JS5A 1VLSA 3LLKA 1ZW3A 2J45A 1QSPA 3POVA 3FMSA 2OEVA 3MBGA 5FZTA 5KYXA 1VYKA 1C02A 1LE4A 1LKXA 3T9OA 1GGQA 3FAJA 3I5QA 5KYUA 1OW7A 1T9KA 3ASOC 5CI8A 4DBRA 3UGOA 3WODF 1RXQA 1KNYA 5FCLA 2HFIA 1YYXA 3LNRA 3EFOA 3IEEA 2Q4FA 1ORJA 1HMOA 1KU2A 1JOGA 3DWWA 3IHUA 1LIHA 4Q4ZF 1T6UA 2R02A 5JSLA 2FGYA 2QY9A 5E33A 4QDLA 3OEOA 2EINC 2OJQA 2YKZA 3LUTB 4YN0B 2WL8A 4KNVA 1L7CA 1VOMA 1E84A 3AGUA 1MNDA 1MMGA 4JW1A 1ZHWA 4AX2A 4C7OA 3FXHA 3HNKA 1G4WR 5L0GA 3EQLF 3HNIA 4N6HA 3V5YA 4E0HA 2HSBA 3F47A 3PCVA 5EGYA 2L81A 4LLEA 3KH2A 3NMKA 4J32B 4DRHB 2HJ3A 1H9GA 4XTKA 1T01A 3ZQYA 4JCZA 3SEOA 2G3KA 4DVYP 5DQTA 3NMJA 1Z3IX 3AG1C 4MW8A 2J7PA 3LS0A 1FFHA 1EI7A 1OQCA 1Y4CA 4EWCA 4JVSA 4H4KC 3H65A 1Z63A 2RSEB 5JRAA 3C62A 1YZCA 2ZXPA 4YL0A 2HS5A 5COGA 3DE8A 2LFDA 1JMWA 2G3VA 3GEIA 1D1AA 1WWPA 4CDYA 3LEOA 2H8AA 3US6A 1CPRA 4ER9A 5B3SC 4JCHA 1QKRA 1ZZPA 3ZDLA 4AL1A 2CCYA 3U3FA 2TMVP 3K1IA 4IJJA 4DRIB 3TJ5A 3PMRA 4RDAA 1MMAA 1BR2A 2L9JA 2NUPA 5COFA 4ONSA 3X2QC 3AOUA 2L7AA 3B0PA 3NYJA 2A0BA 3UMKA 3EG9B 4IRUA 1M57C 1ZU4A 2KYHA 2NSFA 3C8ZA 1U6HA 2W45A 1ORSC 3CEXA 4XPYA 4YJWA 2YWAA 2X0CA 4BJ5C 5KYNA 2QLAA 4HEAJ 4EHPA 1F1MA 3ATPA 4JTCB 3W4YA 1YA9A 2R05A 3T4RA 1HE9A 3TQOA 4RBNA 5A69A 3GEHA 1O3UA 4LLCA 2LSEA 2IXPA 5AC4A 2XXAB 3LS1A 2VC9A 4IAQA 3IQ5A 3ZSUA 4E18A 1SZIA 1OCZC 4CBEA 5A6KA 3GANA 3A11A 2OOCA 2GA0A 4U5GA 4CJOA 3PDMP 1HY5A 1ZYRF 2XLMA 2ICWG 2KQ9A 1ZHYA 3EHMA 4NCQA 3RQFA 1O87A 3W8HA 2EIKC 2XLOA 1D0YA 2I15A 3GORA 3T6JA 4YT8A 3RW0A 3U8VA 4C7OB 3U2MA 2QTVA 4XQ1A 1BZ4A 4JEBA 4OIOF 5HSWA 4JTDB 1L3PA 3OA1A 2HUJA 3QVZA 4CS9C 4CX9A 1NU7D 3Q7LA 4EBKA 4U5HA 2GDCA 4MVRA 2R7TA 4G7OF 3S90A 3NMIA 1OW8A 4MS2A 4RD9A 2L6HA 1NFNA 1TFOB 2ZPAA 3G4XA 3TK0A 1M2OA 2H7VC 4I44A 4XEKA 3HTKC 2JPUA 3U5SA 5BQIA 3S0XA 1TWAA 3IQTA 2VCCA 2OQMA 4CS9A 3PHF2 2M64A 3W2WA 3U0CA 1H9TA 2BL2A 1Z5ZA 5BUOA 1LI7A 1RJ9B 2HZ8A 1Q0GA 2D4UA 1LS1A 5CI9A 3U9JA 1M6TA 1QZXA 2KW3C 1AVOB 1LVKA 4FAPB 3HLZA 2WZLA 4PJLA 2LFFA 2VH3A 2R7RA 1QLEC 3DAFA 3O6XA 3U9MA 1OCOC 1MMNA 5DS5A 1M2VA 4A2NB 1MQVA 3FVYA 1DOVA 3GM2A 5TJ5E 3UR3C 3M15A 5JP7A 2HKVA 4BJTA 1E2XA 3FHDA 4BEMJ 1JR8A 4U5EE 1TKNA 4H54A 3RF3A 5L3VA 2R7OA 4KI2A 1I5NA 1AEPA 5BQGA 4D4XA 3KYJA 2LIGA 1M56C 2P7VA 4HE8D 3B0VC 3SNHA 3DE9A 2V26A 4YL3A 4ULVA 2I8BA 2OJED 2Y39A 4CSAC 4MVQA 1AUEA 3M4CA 4QI0A 5B1AC 4LDRA 2A0UA 3JYHA 2W9YA 5T1DB 3U3BA 5F5FA 1KTMA 4LDQA 2R7UA 3UMIA 1Z6AA 2IM8A 1J8MF 5AGFA 1Q0MA 1V4AA 4JKVA 4A4AA 4PJMA 4WABA 2WZFA 4IGGA 1JPJA 3S84A 1SR2A 2PF4E 3ZTMA 4C3BA 4PR9A 1S7ZA 2EPOA 2WVOA 2Y3BA 3GWLA 3Q6NA 5KYWB 3MYFA 3LNMB 3HNLA 3NYLA 1YA7O 3B71A 4MVMA 3K33A 1APCA 2MYSA 4EIYA 2O9XA 2IXMA 4BEJA 4YT5A 1D1BA 4E0IA 2A6EF 4EBJA 3L34A 3DAGA 2YL1A 2KK1A 2Q3TA 3AG3C 2KSFA 1A7VA 3ABKC 3UMHA 2NUTA 1CGME 2UUHA 3KPHA 4K7BA 3ZWIA 2A1DD 4AE4B 2WZGA 2J7PD 4YL1A 2DI3A 2Q00A 2HSQA 4BJ1A 1QPUA 4M63A 2OU6A 2XLEA 4Z9IA 1FTSA 1G4US 4BPMA 2J0WA 1MMDA 3O10A 1JRAA 4MVOA 3SZRA 3TJ6A 4P9FA 2ZD9A 1T6QA 3GODA 1RMVA 4IWBA 3OWTA 3V5ZA 2R7XA 1LE2A 1ZHXA 2G62A 1I4ZA 4PACA 5L0CA 4O6MA 3JYYA 3DMDA 3DXJF 2CNWD 4Z9JA 3EG9A 1D1CA 4JURI 1TWGA 4J7TA 1ZHTA 2R9RB 5F5HA 1OXBA 4BG0A 4CJGA 2NSGA 3LEVA 3B29A 3JZ0A 4N6CA 2CNWA 2J8WA 3I5PA 2HMQA 1V55C 1H6GA 2NPUA 2L6FA 1A0BA 3K6BA 2PNOA 5D91A 1K04A 2VB6A 5E3CA 3ZG1A 1E86A 3ASNC 3RKOF 2CYDA 3T6GB 1YLMA 1PCXA 3WG7C 2EPNA 3N24A 3MX3A 2W4MA 2XLVA
chains in the Genus database with same CATH topology
3W2VA 3K66A 2EIMC 3KL4A 3RIPA 3F46A 3EGXA 5KYYB 1TWCA 1D0ZA 4ZLCA 1MNEA 2H7OA 3NYMA 4G7HF 4B6IA 1OKKD 4E7SA 2FFHA 2Y3HA 3LAYA 4BJ6C 2KGOA 5DQZA 3EH2A 4U5FE 3NKEA 1G8XA 1SF8A 3SP1A 1RJ9A 4Q5SF 3K7DA 1OKKA 1FMWA 3TD7A 4N06A 3E9VA 4LERA 4AK9A 3B0VC 2YHSA 2XRHA 2CGEA 2YEVA 3M1CB 4W8KA 3X1OA 3NRHA 4IAOA 2R7SA 3SYNA 4K0DA 4FX5A 2HV6A 3AG2C 1NU9C 4FWVA 2DYSC 4YWQA 2IYLD 4U5DE 5IY5C 1VYIA 2PP4A 3ZC4A 2ZXWC 4BJ5C 1Z23A 2PX0A 2Q9CA 4JJGA 4KC9A 4C3EA 2XL4A 3AQBA 4PFOA 3DJNB 4OINF 1D0XA 3EPVA 3DM5A 4BJ5A 5DS6A 1BR4A 2NG1A 4HFFB 4OD4A 3EJNA 3AQCA 3CQZA 4MNDA 3EGDB 4O79A 4P6IC 3K1HA 3S27A 2WVQA 3RH3A 2Y3DA 4J30B 4NY3A 3MLGA 4CSAA 2D5RB 4EBBA 2MWQA 3CZ6A 3T6BA 2PX3A 4PK4A 2EILC 5L3QA 2WB7A 2X51A 4FESA 3L0IA 2HV7A 5DS4A 4ZLDA 5DLJA 3NG1A 4HFKB 2J9VA 3LESA 2C04A 1PD0A 1VMAA 1PD1A 3S28A 1VK5A 2A69F 3DD7A 4DVZA 2IOQA 5KYXB 2YZSA 3V7OA 4I3MA 3VYWA 3QMKA 1JPNA 5KYUB 2E87A 1NZEA 2Q9BA 4QI2A 3E70C 1FFTC 4ULWA 3EFOB 3B9QA 1SMYF 3DM9B 2J9WA 2ZXRA 4JJFA 1TR2A 2JD3A 2EIJC 2GFHA 2CW0F 3JSZA 4U5BE 3EH1A 4PJJA 2V3CC 4XWJA 4OIPF 4C7OB 2NUTB 2B0JA 4O7GA 2IXNA 3DZAA 3EZIA 3NKDA 4PJNA 2P6VA 4OIQF 2R7VA 2Y69C 4OD5A 4LACB 2OG2A 2Q9AA 2XXAA 3ZIBA 3JRTA 2XSEA 3JT1A 4YT2A 3K1IC 5KYYA 5E3AA 4XLNF 3RYLA 3ECSA 5T3WA 1IZMA 1OCRC 2W4BA 4I1OB 4O6YA 3W8IA 3VAYA 1FMVA 1IW7F 3Q6MA 4JZAA 1ZU5A 2H7BA 2PFDA 3KMIA 4OIRF 1OCCC 2J46A 4ANJA 3S29A 2DYRC 2WVNA 1W2WA 1WGWA 2CDQA 1O5HA 4KNWA 3DJUB 2OCCC 4GYTA 4X0RA 2NUPB 3O39A 2J9UA 3CSKA 4I1MA 5T3TA 5EHHA 4PFPA 2KJGA 3Q7GA 1NG1A 3QZCA 4BJ6A 3I4UA 3HJCA 4CS8C 4O6NA 4CS7A 3UNGC 4XLPF 4CIHA 3FDQA 5E2QA 4U5CE 4Q7CA 5DVWA 3N2ZB 3EGXB 4E7ZA 4G7ZF 4CS8A 4GEHA 2M4EA 2A6HF 4MQ9F 1N1CA 4YT4A 2Y3GA 1ZHZA 2C03A 3ABLC 4DBQA 3EGDA 3AG4C 3EZHA 3NDBB 3LJBA 1ST6A 4C3DA 3JCUQ 5D92A 1TWHA 3UGPA 2R7QA 4G0HA 2J0XA 2VASA 2KNHA 4WJ0A 3ZVRA 1J8YF 5KYWA 3KKBA 2R7WA 2DGJA 3LLIA 2A68F 3EHNA 2ZXOA 1V54C 4KBLA 3RFYA 2IXOA 5B1BC 2Z15A 1M2VB 3ITFA 3ABMC 1BR1A 2BE5F 4AE4A 4F4BA 3N0TA 3LLKA 2J45A 3POVA 5KYXA 1VYKA 1LKXA 3FAJA 3I5QA 5KYUA 5CI8A 3ASOC 4DBRA 3UGOA 3WODF 5FCLA 3LNRA 3EFOA 3IEEA 1KU2A 4Q4ZF 2FGYA 2QY9A 5E33A 4QDLA 3OEOA 2EINC 4YN0B 2WL8A 4KNVA 1VOMA 1MNDA 1MMGA 4JW1A 1ZHWA 4AX2A 4C7OA 3EQLF 3F47A 5EGYA 2L81A 4LLEA 3KH2A 4J32B 4XTKA 3SEOA 4DVYP 2G3KA 5DQTA 1Z3IX 3AG1C 2J7PA 3LS0A 1FFHA 4EWCA 4JVSA 4H4KC 3H65A 1Z63A 2ZXPA 2G3VA 1D1AA 5B3SC 4JCHA 4IJJA 3PMRA 4RDAA 1MMAA 1BR2A 2L9JA 2NUPA 3X2QC 3B0PA 3NYJA 3UMKA 3EG9B 4IRUA 1M57C 1ZU4A 3B0UX 4YJWA 2W45A 5KYNA 4HEAJ 3T4RA 4RBNA 4LLCA 2LSEA 2IXPA 2XXAB 3LS1A 3ZSUA 1SZIA 1OCZC 4CBEA 3GANA 4U5GA 1ZYRF 2KQ9A 1ZHYA 3EHMA 3W8HA 1O87A 2EIKC 1D0YA 3T6JA 4YT8A 2QTVA 4OIOF 5HSWA 3OA1A 4CS9C 1NU7D 3Q7LA 4U5HA 2R7TA 4G7OF 4KI2A 4DOZA 4RD9A 2ZPAA 3S0XA 1M2OA 2H7VC 4I44A 3HTKC 1TWAA 4CS9A 3PHF2 3W2WA 1Z5ZA 5BUOA 1RJ9B 1LS1A 5CI9A 1QZXA 2KW3C 1LVKA 3HLZA 2WZLA 4PJLA 2VH3A 2R7RA 1QLEC 3DAFA 3O6XA 1OCOC 1MMNA 5DS5A 1M2VA 4A2NB 3FVYA 3UR3C 4BJTA 3FHDA 4U5EE 1TKNA 5L3VA 2R7OA 1M56C 2P7VA 4HE8D 3SNHA 2V26A 2I8BA 2Y39A 4CSAC 4QI0A 5B1AC 5T1DB 3JYHA 5F5FA 2W9YA 2R7UA 3UMIA 1Z6AA 1J8MF 4PJMA 2WZFA 1JPJA 2PF4E 4C3BA 1S7ZA 2WVOA 2Y3BA 3Q6NA 5KYWB 3NYLA 3K33A 2MYSA 2O9XA 2IXMA 4BEJA 4YT5A 1D1BA 2A6EF 3L34A 3DAGA 2Q3TA 3AG3C 3ABKC 3UMHA 2NUTA 4K7BA 2A1DD 4AE4B 2WZGA 2J7PD 4BJ1A 4M63A 1FTSA 2J0WA 1MMDA 3SZRA 3GODA 4IWBA 3OWTA 2R7XA 1ZHXA 2G62A 4O6MA 3DMDA 3DXJF 2CNWD 3EG9A 1D1CA 4JURI 1TWGA 5F5HA 1ZHTA 4BG0A 3LEVA 2CNWA 3I5PA 1V55C 3K6BA 5D91A 2VB6A 5E3CA 3ZG1A 3ASNC 3RKOF 3WG7C 1PCXA 3N24A 3MX3A 2W4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B6I A;  4AX2 A;  4HFK B;  4HFF B;  4J32 B;  4J30 B;  4JUR I;  3ZIB A; 
#chains in the Genus database with same CATH topology
 2FAP B;  3C63 A;  3W2V A;  3K66 A;  3ZQV A;  1BBH A;  2EIM C;  1R4T A;  3GM3 A;  3KL4 A;  3RIP A;  3F46 A;  5A6B D;  1Q0K A;  3EGX A;  2EPK X;  4MTO A;  5KYY B;  1TWC A;  1VTM P;  1D0Z A;  1WTY A;  2YLI A;  2YVK A;  4ZLC A;  1MNE A;  2H7O A;  3NYM A;  3O55 A;  4WGZ A;  4XEV A;  256B A;  3L1M A;  1E83 A;  4B6I A;  1OKK D;  4E7S A;  4G7H F;  1B68 A;  2FFH A;  1Q0D A;  2Y3H A;  3LAY A;  4NTF A;  4LDK A;  2KGO A;  5DQZ A;  4BJ6 C;  5A6B A;  2YL0 A;  3EH2 A;  1LPE A;  3QTH A;  4U5F E;  1Z7Q c;  3NKE A;  3VRC A;  1G8X A;  1RCP A;  1SF8 A;  3SP1 A;  4DRJ B;  1RJ9 A;  3SXM A;  4Q5S F;  1UG7 A;  1OKK A;  1FMW A;  3K7D A;  2HMZ A;  1NSG B;  3TD7 A;  4N06 A;  3TOM A;  1T5O A;  2L6G A;  3E9V A;  4LER A;  3SXY A;  4AK9 A;  2YHS A;  2XRH A;  1RKE B;  2CGE A;  2YEV A;  3M1C B;  4W8K A;  2YLD A;  3X1O A;  1YYJ A;  3NRH A;  5A6A A;  4IAO A;  2GWW A;  3TOL A;  2R7S A;  2F22 A;  3C8G D;  3SYN A;  4K0D A;  4FX5 A;  4L6R A;  4E17 A;  2HV6 A;  3AG2 C;  4IB4 A;  4NTA A;  1CPQ A;  2J9B A;  2YL3 A;  4XPW A;  1NU9 C;  3IQC A;  4FWV A;  2DYS C;  3GEE A;  4YWQ A;  2IYL D;  4U5D E;  5IY5 C;  3U8P A;  1EA8 A;  3RQG A;  1VYI A;  2PP4 A;  3ZC4 A;  2ZXW C;  1DOW A;  1Z23 A;  2PX0 A;  2YRF A;  1VB5 A;  2Q9C A;  3C8G A;  4JJG A;  2XL4 A;  3GWN A;  4KC9 A;  3AQB A;  3S9O A;  1ZW2 A;  4C3E A;  4CDA A;  2LD6 A;  4PFO A;  5B3I A;  3DJN B;  4WGY A;  1D0X A;  3EPV A;  4OIN F;  1YVI A;  1C17 M;  3DM5 A;  4Z9H A;  3L8I A;  1ORY A;  3AGT A;  4BJ5 A;  5DS6 A;  1BR4 A;  2NG1 A;  4HFF B;  1Q0F A;  3FAP B;  3EJN A;  4OD4 A;  2XL8 A;  3AQC A;  1LI5 A;  3CQZ A;  2B0H A;  4MND A;  1HMD A;  2XM4 A;  3BRJ A;  1I4Y A;  3EGD B;  4D4N A;  4O79 A;  4P6I C;  3K1H A;  3JSE O;  3S27 A;  2WVQ A;  3RH3 A;  5JT4 A;  4UDV A;  2BC5 A;  2Y3D A;  4J30 B;  2R03 A;  3MLG A;  4NY3 A;  3V5X A;  4CSA A;  2D5R B;  4EBB A;  5L0I A;  1PV3 A;  2MWQ A;  3CZ6 A;  4JEA A;  4J7Y A;  2PX3 A;  3H2V A;  4MW3 A;  4K1O A;  3T6B A;  4PK4 A;  2EIL C;  5F28 E;  2AWC A;  5GPG B;  5L3Q A;  2WB7 A;  1A7D A;  5JUA A;  1YAU O;  1TQG A;  3HNJ A;  2X51 A;  4FES A;  1LS4 A;  4XPX A;  3L0I A;  2HV7 A;  2QNL A;  5DS4 A;  4YK5 A;  5DLJ A;  4ZLD A;  3NG1 A;  4HFK B;  2J9V A;  3LES A;  2C04 A;  4NC3 A;  4U9D A;  3G50 A;  1PD0 A;  3JTL O;  1VMA A;  1PD1 A;  1OW6 A;  1T6I A;  3DKA A;  1S05 A;  1GQA A;  3IPM O;  1VK5 A;  2A69 F;  3S28 A;  1U89 A;  1JAF A;  3WHN A;  1G5Z A;  3DD7 A;  3QVY A;  4DVZ A;  4GQH A;  1U0B B;  1WAT A;  4JIO A;  2IOQ A;  2QE9 A;  2HJM A;  2AU5 A;  3ZTZ A;  2YZS A;  1YDI A;  1OR2 A;  4CDV A;  3V7O A;  4I3M A;  3VYW A;  5KYX B;  3G4Z A;  3QMK A;  4NQF A;  1JPN A;  3TUL A;  1A41 A;  5KYU B;  2E87 A;  1NZE A;  1OXK A;  1FR0 A;  2Q9B A;  4QI2 A;  1C03 A;  2XLH A;  2P61 A;  1FFT C;  3E70 C;  1YZA A;  1K40 A;  4ULW A;  2XLD A;  5L0D A;  3EFO B;  3B9Q A;  2KC3 A;  1BDJ B;  1SMY F;  2J9W A;  2ZXR A;  3DM9 B;  3FOP A;  4JJF A;  1OR3 A;  3R2P A;  4P9T A;  1TR2 A;  2QUP A;  2JD3 A;  4JC7 A;  2EIJ C;  2GFH A;  2CW0 F;  1ZVZ A;  2YL7 A;  1H7I A;  3JSZ A;  4U5B E;  3EH1 A;  4MVU A;  4PJJ A;  3BEH A;  2V3C C;  3MYI A;  5COM A;  2XM0 A;  3U2L A;  1CGN A;  4JRZ A;  4XWJ A;  5L0J A;  1WOL A;  4OIP F;  2LCH A;  1XWJ A;  2B0J A;  2NUT B;  1RKC A;  4O7G A;  5EK0 A;  1SYQ A;  2IXN A;  3DZA A;  3EZI A;  3NKD A;  4PJN A;  1LM3 B;  1NFO A;  2OKU A;  2P6V A;  3VM6 A;  2Y69 C;  3FOO A;  4OIQ F;  2R7V A;  3AJM A;  4OD5 A;  4LAC B;  2OG2 A;  3QW1 A;  2Q9A A;  4CIP A;  3ZIB A;  2XXA A;  3JRT A;  2P0N A;  2XSE A;  3JT1 A;  4YT2 A;  3K1I C;  3RVY A;  4JE9 A;  3B0U X;  2XS1 A;  5KYY A;  5E3A A;  4XLN F;  3RYL A;  3ECS A;  3RVZ A;  1UFB A;  5T3W A;  1IZM A;  1EQ1 A;  1OCR C;  2JX0 A;  2W4B A;  2XL6 A;  4I1O B;  4O6Y A;  1YJG A;  1TFK B;  3W8I A;  5JLI A;  3VAY A;  1FNT c;  2IBF A;  1FMV A;  2P1A A;  2UUI A;  1IW7 F;  2VCB A;  3M79 A;  4DXW A;  3Q6M A;  4JZA A;  2DB4 A;  2LQG A;  3H2U A;  1ZU5 A;  2H7B A;  2PFD A;  1XZP A;  3GM1 A;  1QQ3 A;  3KMI A;  4OIR F;  1OCC C;  2J46 A;  4MTG A;  2EPM X;  4ANJ A;  5K0I A;  3S29 A;  2DYR C;  1W2W A;  1WGW A;  2OEX A;  2CDQ A;  1O5H A;  1Y6D A;  2WVN A;  3DJU B;  2OCC C;  1NLX A;  4GYT A;  4KNW A;  1NBB A;  4X0R A;  2NUP B;  3O39 A;  1EKY A;  4MVZ A;  2J9U A;  1QVX A;  2MHR A;  1RKE A;  3CSK A;  4I1M A;  5T3T A;  5EHH A;  3SXZ A;  4PFP A;  1VLT A;  4NTB A;  1XZQ A;  1GS9 A;  5A6J A;  2KJG A;  2AWY A;  2XS8 A;  1NG1 A;  1YAR O;  3Q7G A;  3QZC A;  5CIV A;  1A7E A;  1V74 B;  4BJ6 A;  3C7J A;  5BQH A;  3I4U A;  1GM5 A;  3A9C A;  1R5I D;  3HJC A;  3C18 A;  4CS8 C;  1E85 A;  4O6N A;  3J06 A;  1WN0 A;  3SXK A;  2AVK A;  4CS7 A;  3UNG C;  5AC5 A;  4CIH A;  2VCA A;  1WAS A;  2XLW A;  5E2Q A;  5JVE A;  4XLP F;  2RD9 A;  3FDQ A;  1FAP B;  3L8J A;  4U5C E;  5L0H A;  3HKK A;  4Q7C A;  2Q7R A;  5DVW A;  4XEF A;  3N2Z B;  3EGX B;  4E7Z A;  4G7Z F;  2YQY A;  4GEH A;  4U9E A;  4MTF A;  4CS8 A;  2M4E A;  2A6H F;  4MQ9 F;  4R32 A;  3RQE A;  1N1C A;  4EKW A;  4YT4 A;  2Y3G A;  2ASR A;  3M4B A;  4AL0 A;  1ZHZ A;  2PBE A;  2C03 A;  4EUK B;  4DJ9 A;  3ABL C;  4DOZ A;  4DBQ A;  3EGD A;  3R7C A;  3AG4 C;  3EZH A;  3NDB B;  2LP4 A;  1ST6 A;  3DI5 A;  3LJB A;  3JCU Q;  5D92 A;  4C3D A;  1HW1 A;  1TWH A;  3UGP A;  4JTA B;  2R7Q A;  4N4W A;  4W8P A;  1HW2 A;  4G0H A;  5HV9 A;  2J0X A;  2VAS A;  2KNH A;  3JRM O;  4WJ0 A;  1J8Y F;  3ZVR A;  5KYW A;  2LK4 A;  1HE1 A;  3KKB A;  2R7W A;  3WAQ A;  2DGJ A;  3QW0 A;  3LLI A;  2GAQ A;  4G78 A;  2A68 F;  3EHN A;  2ZXO A;  3CAX A;  1CGO A;  4IAR A;  1V54 C;  4KBL A;  3RFY A;  2IXO A;  5L0F A;  5B1B C;  3MFN A;  2R25 A;  1K05 A;  2ETS A;  3VF0 A;  1M2V B;  2AP3 A;  1BR1 A;  2BE5 F;  2Z15 A;  3ABM C;  3ITF A;  2YLG A;  4AE4 A;  2EPL X;  3C8G B;  4MVS A;  4F4B A;  3KYI A;  3IQ6 A;  3N0T A;  5JS5 A;  1VLS A;  3LLK A;  1ZW3 A;  2J45 A;  1QSP A;  3POV A;  3FMS A;  2OEV A;  3MBG A;  5FZT A;  5KYX A;  1VYK A;  1C02 A;  1LE4 A;  1LKX A;  3T9O A;  1GGQ A;  3FAJ A;  3I5Q A;  5KYU A;  1OW7 A;  1T9K A;  3ASO C;  5CI8 A;  4DBR A;  3UGO A;  3WOD F;  1RXQ A;  1KNY A;  5FCL A;  2HFI A;  1YYX A;  3LNR A;  3EFO A;  3IEE A;  2Q4F A;  1ORJ A;  1HMO A;  1KU2 A;  1JOG A;  3DWW A;  3IHU A;  1LIH A;  4Q4Z F;  1T6U A;  2R02 A;  5JSL A;  2FGY A;  2QY9 A;  5E33 A;  4QDL A;  3OEO A;  2EIN C;  2OJQ A;  2YKZ A;  3LUT B;  4YN0 B;  2WL8 A;  4KNV A;  1L7C A;  1VOM A;  1E84 A;  3AGU A;  1MND A;  1MMG A;  4JW1 A;  1ZHW A;  4AX2 A;  4C7O A;  3FXH A;  3HNK A;  1G4W R;  5L0G A;  3EQL F;  3HNI A;  4N6H A;  3V5Y A;  4E0H A;  2HSB A;  3F47 A;  3PCV A;  5EGY A;  2L81 A;  4LLE A;  3KH2 A;  3NMK A;  4J32 B;  4DRH B;  2HJ3 A;  1H9G A;  4XTK A;  1T01 A;  3ZQY A;  4JCZ A;  3SEO A;  2G3K A;  4DVY P;  5DQT A;  3NMJ A;  1Z3I X;  3AG1 C;  4MW8 A;  2J7P A;  3LS0 A;  1FFH A;  1EI7 A;  1OQC A;  1Y4C A;  4EWC A;  4JVS A;  4H4K C;  3H65 A;  1Z63 A;  2RSE B;  5JRA A;  3C62 A;  1YZC A;  2ZXP A;  4YL0 A;  2HS5 A;  5COG A;  3DE8 A;  2LFD A;  1JMW A;  2G3V A;  3GEI A;  1D1A A;  1WWP A;  4CDY A;  3LEO A;  2H8A A;  3US6 A;  1CPR A;  4ER9 A;  5B3S C;  4JCH A;  1QKR A;  1ZZP A;  3ZDL A;  4AL1 A;  2CCY A;  3U3F A;  2TMV P;  3K1I A;  4IJJ A;  4DRI B;  3TJ5 A;  3PMR A;  4RDA A;  1MMA A;  1BR2 A;  2L9J A;  2NUP A;  5COF A;  4ONS A;  3X2Q C;  3AOU A;  2L7A A;  3B0P A;  3NYJ A;  2A0B A;  3UMK A;  3EG9 B;  4IRU A;  1M57 C;  1ZU4 A;  2KYH A;  2NSF A;  3C8Z A;  1U6H A;  2W45 A;  1ORS C;  3CEX A;  4XPY A;  4YJW A;  2YWA A;  2X0C A;  4BJ5 C;  5KYN A;  2QLA A;  4HEA J;  4EHP A;  1F1M A;  3ATP A;  4JTC B;  3W4Y A;  1YA9 A;  2R05 A;  3T4R A;  1HE9 A;  3TQO A;  4RBN A;  5A69 A;  3GEH A;  1O3U A;  4LLC A;  2LSE A;  2IXP A;  5AC4 A;  2XXA B;  3LS1 A;  2VC9 A;  4IAQ A;  3IQ5 A;  3ZSU A;  4E18 A;  1SZI A;  1OCZ C;  4CBE A;  5A6K A;  3GAN A;  3A11 A;  2OOC A;  2GA0 A;  4U5G A;  4CJO A;  3PDM P;  1HY5 A;  1ZYR F;  2XLM A;  2ICW G;  2KQ9 A;  1ZHY A;  3EHM A;  4NCQ A;  3RQF A;  1O87 A;  3W8H A;  2EIK C;  2XLO A;  1D0Y A;  2I15 A;  3GOR A;  3T6J A;  4YT8 A;  3RW0 A;  3U8V A;  4C7O B;  3U2M A;  2QTV A;  4XQ1 A;  1BZ4 A;  4JEB A;  4OIO F;  5HSW A;  4JTD B;  1L3P A;  3OA1 A;  2HUJ A;  3QVZ A;  4CS9 C;  4CX9 A;  1NU7 D;  3Q7L A;  4EBK A;  4U5H A;  2GDC A;  4MVR A;  2R7T A;  4G7O F;  3S90 A;  3NMI A;  1OW8 A;  4MS2 A;  4RD9 A;  2L6H A;  1NFN A;  1TFO B;  2ZPA A;  3G4X A;  3TK0 A;  1M2O A;  2H7V C;  4I44 A;  4XEK A;  3HTK C;  2JPU A;  3U5S A;  5BQI A;  3S0X A;  1TWA A;  3IQT A;  2VCC A;  2OQM A;  4CS9 A;  3PHF 2;  2M64 A;  3W2W A;  3U0C A;  1H9T A;  2BL2 A;  1Z5Z A;  5BUO A;  1LI7 A;  1RJ9 B;  2HZ8 A;  1Q0G A;  2D4U A;  1LS1 A;  5CI9 A;  3U9J A;  1M6T A;  1QZX A;  2KW3 C;  1AVO B;  1LVK A;  4FAP B;  3HLZ A;  2WZL A;  4PJL A;  2LFF A;  2VH3 A;  2R7R A;  1QLE C;  3DAF A;  3O6X A;  3U9M A;  1OCO C;  1MMN A;  5DS5 A;  1M2V A;  4A2N B;  1MQV A;  3FVY A;  1DOV A;  3GM2 A;  5TJ5 E;  3UR3 C;  3M15 A;  5JP7 A;  2HKV A;  4BJT A;  1E2X A;  3FHD A;  4BEM J;  1JR8 A;  4U5E E;  1TKN A;  4H54 A;  3RF3 A;  5L3V A;  2R7O A;  4KI2 A;  1I5N A;  1AEP A;  5BQG A;  4D4X A;  3KYJ A;  2LIG A;  1M56 C;  2P7V A;  4HE8 D;  3B0V C;  3SNH A;  3DE9 A;  2V26 A;  4YL3 A;  4ULV A;  2I8B A;  2OJE D;  2Y39 A;  4CSA C;  4MVQ A;  1AUE A;  3M4C A;  4QI0 A;  5B1A C;  4LDR A;  2A0U A;  3JYH A;  2W9Y A;  5T1D B;  3U3B A;  5F5F A;  1KTM A;  4LDQ A;  2R7U A;  3UMI A;  1Z6A A;  2IM8 A;  1J8M F;  5AGF A;  1Q0M A;  1V4A A;  4JKV A;  4A4A A;  4PJM A;  4WAB A;  2WZF A;  4IGG A;  1JPJ A;  3S84 A;  1SR2 A;  2PF4 E;  3ZTM A;  4C3B A;  4PR9 A;  1S7Z A;  2EPO A;  2WVO A;  2Y3B A;  3GWL A;  3Q6N A;  5KYW B;  3MYF A;  3LNM B;  3HNL A;  3NYL A;  1YA7 O;  3B71 A;  4MVM A;  3K33 A;  1APC A;  2MYS A;  4EIY A;  2O9X A;  2IXM A;  4BEJ A;  4YT5 A;  1D1B A;  4E0I A;  2A6E F;  4EBJ A;  3L34 A;  3DAG A;  2YL1 A;  2KK1 A;  2Q3T A;  3AG3 C;  2KSF A;  1A7V A;  3ABK C;  3UMH A;  2NUT A;  1CGM E;  2UUH A;  3KPH A;  4K7B A;  3ZWI A;  2A1D D;  4AE4 B;  2WZG A;  2J7P D;  4YL1 A;  2DI3 A;  2Q00 A;  2HSQ A;  4BJ1 A;  1QPU A;  4M63 A;  2OU6 A;  2XLE A;  4Z9I A;  1FTS A;  1G4U S;  4BPM A;  2J0W A;  1MMD A;  3O10 A;  1JRA A;  4MVO A;  3SZR A;  3TJ6 A;  4P9F A;  2ZD9 A;  1T6Q A;  3GOD A;  1RMV A;  4IWB A;  3OWT A;  3V5Z A;  2R7X A;  1LE2 A;  1ZHX A;  2G62 A;  1I4Z A;  4PAC A;  5L0C A;  4O6M A;  3JYY A;  3DMD A;  3DXJ F;  2CNW D;  4Z9J A;  3EG9 A;  1D1C A;  4JUR I;  1TWG A;  4J7T A;  1ZHT A;  2R9R B;  5F5H A;  1OXB A;  4BG0 A;  4CJG A;  2NSG A;  3LEV A;  3B29 A;  3JZ0 A;  4N6C A;  2CNW A;  2J8W A;  3I5P A;  2HMQ A;  1V55 C;  1H6G A;  2NPU A;  2L6F A;  1A0B A;  3K6B A;  2PNO A;  5D91 A;  1K04 A;  2VB6 A;  5E3C A;  3ZG1 A;  1E86 A;  3ASN C;  3RKO F;  2CYD A;  3T6G B;  1YLM A;  1PCX A;  3WG7 C;  2EPN A;  3N24 A;  3MX3 A;  2W4M A;  2XLV A; 
#chains in the Genus database with same CATH homology
 3W2V A;  3K66 A;  2EIM C;  3KL4 A;  3RIP A;  3F46 A;  3EGX A;  5KYY B;  1TWC A;  1D0Z A;  4ZLC A;  1MNE A;  2H7O A;  3NYM A;  4G7H F;  4B6I A;  1OKK D;  4E7S A;  2FFH A;  2Y3H A;  3LAY A;  4BJ6 C;  2KGO A;  5DQZ A;  3EH2 A;  4U5F E;  3NKE A;  1G8X A;  1SF8 A;  3SP1 A;  1RJ9 A;  4Q5S F;  3K7D A;  1OKK A;  1FMW A;  3TD7 A;  4N06 A;  3E9V A;  4LER A;  4AK9 A;  3B0V C;  2YHS A;  2XRH A;  2CGE A;  2YEV A;  3M1C B;  4W8K A;  3X1O A;  3NRH A;  4IAO A;  2R7S A;  3SYN A;  4K0D A;  4FX5 A;  2HV6 A;  3AG2 C;  1NU9 C;  4FWV A;  2DYS C;  4YWQ A;  2IYL D;  4U5D E;  5IY5 C;  1VYI A;  2PP4 A;  3ZC4 A;  2ZXW C;  4BJ5 C;  1Z23 A;  2PX0 A;  2Q9C A;  4JJG A;  4KC9 A;  4C3E A;  2XL4 A;  3AQB A;  4PFO A;  3DJN B;  4OIN F;  1D0X A;  3EPV A;  3DM5 A;  4BJ5 A;  5DS6 A;  1BR4 A;  2NG1 A;  4HFF B;  4OD4 A;  3EJN A;  3AQC A;  3CQZ A;  4MND A;  3EGD B;  4O79 A;  4P6I C;  3K1H A;  3S27 A;  2WVQ A;  3RH3 A;  2Y3D A;  4J30 B;  4NY3 A;  3MLG A;  4CSA A;  2D5R B;  4EBB A;  2MWQ A;  3CZ6 A;  3T6B A;  2PX3 A;  4PK4 A;  2EIL C;  5L3Q A;  2WB7 A;  2X51 A;  4FES A;  3L0I A;  2HV7 A;  5DS4 A;  4ZLD A;  5DLJ A;  3NG1 A;  4HFK B;  2J9V A;  3LES A;  2C04 A;  1PD0 A;  1VMA A;  1PD1 A;  3S28 A;  1VK5 A;  2A69 F;  3DD7 A;  4DVZ A;  2IOQ A;  5KYX B;  2YZS A;  3V7O A;  4I3M A;  3VYW A;  3QMK A;  1JPN A;  5KYU B;  2E87 A;  1NZE A;  2Q9B A;  4QI2 A;  3E70 C;  1FFT C;  4ULW A;  3EFO B;  3B9Q A;  1SMY F;  3DM9 B;  2J9W A;  2ZXR A;  4JJF A;  1TR2 A;  2JD3 A;  2EIJ C;  2GFH A;  2CW0 F;  3JSZ A;  4U5B E;  3EH1 A;  4PJJ A;  2V3C C;  4XWJ A;  4OIP F;  4C7O B;  2NUT B;  2B0J A;  4O7G A;  2IXN A;  3DZA A;  3EZI A;  3NKD A;  4PJN A;  2P6V A;  4OIQ F;  2R7V A;  2Y69 C;  4OD5 A;  4LAC B;  2OG2 A;  2Q9A A;  2XXA A;  3ZIB A;  3JRT A;  2XSE A;  3JT1 A;  4YT2 A;  3K1I C;  5KYY A;  5E3A A;  4XLN F;  3RYL A;  3ECS A;  5T3W A;  1IZM A;  1OCR C;  2W4B A;  4I1O B;  4O6Y A;  3W8I A;  3VAY A;  1FMV A;  1IW7 F;  3Q6M A;  4JZA A;  1ZU5 A;  2H7B A;  2PFD A;  3KMI A;  4OIR F;  1OCC C;  2J46 A;  4ANJ A;  3S29 A;  2DYR C;  2WVN A;  1W2W A;  1WGW A;  2CDQ A;  1O5H A;  4KNW A;  3DJU B;  2OCC C;  4GYT A;  4X0R A;  2NUP B;  3O39 A;  2J9U A;  3CSK A;  4I1M A;  5T3T A;  5EHH A;  4PFP A;  2KJG A;  3Q7G A;  1NG1 A;  3QZC A;  4BJ6 A;  3I4U A;  3HJC A;  4CS8 C;  4O6N A;  4CS7 A;  3UNG C;  4XLP F;  4CIH A;  3FDQ A;  5E2Q A;  4U5C E;  4Q7C A;  5DVW A;  3N2Z B;  3EGX B;  4E7Z A;  4G7Z F;  4CS8 A;  4GEH A;  2M4E A;  2A6H F;  4MQ9 F;  1N1C A;  4YT4 A;  2Y3G A;  1ZHZ A;  2C03 A;  3ABL C;  4DBQ A;  3EGD A;  3AG4 C;  3EZH A;  3NDB B;  3LJB A;  1ST6 A;  4C3D A;  3JCU Q;  5D92 A;  1TWH A;  3UGP A;  2R7Q A;  4G0H A;  2J0X A;  2VAS A;  2KNH A;  4WJ0 A;  3ZVR A;  1J8Y F;  5KYW A;  3KKB A;  2R7W A;  2DGJ A;  3LLI A;  2A68 F;  3EHN A;  2ZXO A;  1V54 C;  4KBL A;  3RFY A;  2IXO A;  5B1B C;  2Z15 A;  1M2V B;  3ITF A;  3ABM C;  1BR1 A;  2BE5 F;  4AE4 A;  4F4B A;  3N0T A;  3LLK A;  2J45 A;  3POV A;  5KYX A;  1VYK A;  1LKX A;  3FAJ A;  3I5Q A;  5KYU A;  5CI8 A;  3ASO C;  4DBR A;  3UGO A;  3WOD F;  5FCL A;  3LNR A;  3EFO A;  3IEE A;  1KU2 A;  4Q4Z F;  2FGY A;  2QY9 A;  5E33 A;  4QDL A;  3OEO A;  2EIN C;  4YN0 B;  2WL8 A;  4KNV A;  1VOM A;  1MND A;  1MMG A;  4JW1 A;  1ZHW A;  4AX2 A;  4C7O A;  3EQL F;  3F47 A;  5EGY A;  2L81 A;  4LLE A;  3KH2 A;  4J32 B;  4XTK A;  3SEO A;  4DVY P;  2G3K A;  5DQT A;  1Z3I X;  3AG1 C;  2J7P A;  3LS0 A;  1FFH A;  4EWC A;  4JVS A;  4H4K C;  3H65 A;  1Z63 A;  2ZXP A;  2G3V A;  1D1A A;  5B3S C;  4JCH A;  4IJJ A;  3PMR A;  4RDA A;  1MMA A;  1BR2 A;  2L9J A;  2NUP A;  3X2Q C;  3B0P A;  3NYJ A;  3UMK A;  3EG9 B;  4IRU A;  1M57 C;  1ZU4 A;  3B0U X;  4YJW A;  2W45 A;  5KYN A;  4HEA J;  3T4R A;  4RBN A;  4LLC A;  2LSE A;  2IXP A;  2XXA B;  3LS1 A;  3ZSU A;  1SZI A;  1OCZ C;  4CBE A;  3GAN A;  4U5G A;  1ZYR F;  2KQ9 A;  1ZHY A;  3EHM A;  3W8H A;  1O87 A;  2EIK C;  1D0Y A;  3T6J A;  4YT8 A;  2QTV A;  4OIO F;  5HSW A;  3OA1 A;  4CS9 C;  1NU7 D;  3Q7L A;  4U5H A;  2R7T A;  4G7O F;  4KI2 A;  4DOZ A;  4RD9 A;  2ZPA A;  3S0X A;  1M2O A;  2H7V C;  4I44 A;  3HTK C;  1TWA A;  4CS9 A;  3PHF 2;  3W2W A;  1Z5Z A;  5BUO A;  1RJ9 B;  1LS1 A;  5CI9 A;  1QZX A;  2KW3 C;  1LVK A;  3HLZ A;  2WZL A;  4PJL A;  2VH3 A;  2R7R A;  1QLE C;  3DAF A;  3O6X A;  1OCO C;  1MMN A;  5DS5 A;  1M2V A;  4A2N B;  3FVY A;  3UR3 C;  4BJT A;  3FHD A;  4U5E E;  1TKN A;  5L3V A;  2R7O A;  1M56 C;  2P7V A;  4HE8 D;  3SNH A;  2V26 A;  2I8B A;  2Y39 A;  4CSA C;  4QI0 A;  5B1A C;  5T1D B;  3JYH A;  5F5F A;  2W9Y A;  2R7U A;  3UMI A;  1Z6A A;  1J8M F;  4PJM A;  2WZF A;  1JPJ A;  2PF4 E;  4C3B A;  1S7Z A;  2WVO A;  2Y3B A;  3Q6N A;  5KYW B;  3NYL A;  3K33 A;  2MYS A;  2O9X A;  2IXM A;  4BEJ A;  4YT5 A;  1D1B A;  2A6E F;  3L34 A;  3DAG A;  2Q3T A;  3AG3 C;  3ABK C;  3UMH A;  2NUT A;  4K7B A;  2A1D D;  4AE4 B;  2WZG A;  2J7P D;  4BJ1 A;  4M63 A;  1FTS A;  2J0W A;  1MMD A;  3SZR A;  3GOD A;  4IWB A;  3OWT A;  2R7X A;  1ZHX A;  2G62 A;  4O6M A;  3DMD A;  3DXJ F;  2CNW D;  3EG9 A;  1D1C A;  4JUR I;  1TWG A;  5F5H A;  1ZHT A;  4BG0 A;  3LEV A;  2CNW A;  3I5P A;  1V55 C;  3K6B A;  5D91 A;  2VB6 A;  5E3C A;  3ZG1 A;  3ASN C;  3RKO F;  3WG7 C;  1PCX A;  3N24 A;  3MX3 A;  2W4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...