4J30B

Structure of the effector - immunity system tae4 / tai4 from salmonella typhimurium, selenomethionine variant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
101
structure length
101
Chain Sequence
QEALTTQYSQSELLKNWALSHCLALVYKDDVVKNDARATASAYLEYGKQSVEIYHEIDEIAKKYSGLKYNGSISSDFNTMKCIDFIHDRELNELIKRRVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Structural Insights into the Effector - Immunity System Tae4/Tai4 from Salmonella typhimurium.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Toxin/inhibitor
total genus 34
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16695 Tai4 Type VI secretion system (T6SS), amidase immunity protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4j30B00
4HFFB 4AX2A 4J30B 3ZIBA 4HFKB 4J32B 4JURI 4B6IA
chains in the Genus database with same CATH superfamily
2BE5F 3QTHA 2Q3TA 5L0JA 2J9BA 4BPMA 4ONSA 1IW7F 1LIHA 1YDIA 1YYJA 3R7CA 4XEKA 1CPRA 1QVXA 2VASA 4JVSA 4U5DE 1ZHXA 1Z3IX 4CDAA 1TKNA 1CPQA 3ZQVA 3PCVA 4U5CE 2H7VC 4AK9A 3JSZA 4MW8A 3N2ZB 4FX5A 2HSBA 4JTCB 3GM3A 1FAPB 5COGA 3V5XA 1C02A 3DD7A 2Y39A 1YYXA 2R03A 3MYIA 4FESA 4NY3A 5BQHA 4CSAA 3UMHA 5CI8A 3ECSA 2OCCC 2A1DD 3ZVRA 4EUKB 4KNVA 1C03A 3OWTA 2W45A 2IM8A 3L0IA 3R2PA 3JZ0A 4MVQA 1NG1A 4GYTA 2MHRA 2OU6A 2VB6A 2YLGA 1E83A 1TWCA 1V54C 3Q6NA 4WGYA 4XPXA 5BUOA 3I5QA 3EGXA 1W2WA 4GEHA 2P61A 3Q7LA 4CJOA 2X0CA 2A68F 3CAXA 1ORYA 1SYQA 3HNJA 1RJ9B 4QDLA 5KYXB 2XXAB 2R02A 3FHDA 2NSGA 2XS1A 2GDCA 2KJGA 1BR4A 2WB7A 1M56C 4L6RA 4AE4B 4CDYA 4EBJA 1RCPA 3OA1A 4KI2A 3CZ6A 1JMWA 5L0GA 3AGUA 2WZGA 4FWVA 2PX3A 3F47A 5L0FA 3QW0A 3ASOC 2EILC 3HNKA 5A69A 4KBLA 4DVYP 3ZTMA 1HY5A 1OCCC 4Z9HA 4JKVA 4Z9JA 1F1MA 2ZD9A 1CGME 3ZWIA 1M57C 3VYWA 4OINF 2VCCA 3B0VC 3RYLA 1TFOB 1FNTc 3ABMC 4JEBA 2ZXOA 3X1OA 4MS2A 1ORJA 1PCXA 2PP4A 4JCZA 1XZQA 4ER9A 2AWYA 2IBFA 3J06A 2ZXPA 2HJMA 1R5ID 3V7OA 2J0XA 1CGNA 1GQAA 2H8AA 2A6HF 2B0JA 2P7VA 2L6GA 1QSPA 1T5OA 1FFTC 3O10A 1PD1A 1SMYF 4MTFA 4MW3A 5AC5A 1HMDA 3B0PA 3H65A 3DJUB 2CDQA 1LI7A 2L7AA 3QVYA 4PJMA 4U5GA 1YZCA 1ZW3A 3SXMA 5JS5A 1D0ZA 1GS9A 1RJ9A 5KYUA 1NFNA 4XLNF 5KYXA 4N6CA 2XXAA 1OKKA 1JR8A 3NMJA 4BJTA 4AE4A 2Z15A 4U5EE 1MNEA 3EHNA 1IZMA 3FOOA 2EPLX 1OR3A 4U9EA 5A6JA 1Z7Qc 4J7YA 2XM4A 3RQGA 2AP3A 3B29A 4YL0A 1ZHYA 3DI5A 2YHSA 2YRFA 3L34A 4MQ9F 4RDAA 3DE8A 3DZAA 4PACA 3RFYA 3TJ5A 1Y4CA 2VCBA 3T6BA 2R7XA 1XWJA 4J30B 2LQGA 2YQYA 3C8GB 1T6UA 2DYSC 4DBRA 1H9TA 1RKEB 4PJLA 4IWBA 2JPUA 2KW3C 3NRHA 1PD0A 2OG2A 4NCQA 3RKOF 4ANJA 1H6GA 2LD6A 1G8XA 1OCZC 2NUTB 2M4EA 4CS8C 4PJJA 1MMDA 4CIPA 1J8MF 3DM9B 3T6GB 2LSEA 3NKEA 3GEEA 4PFPA 5E3AA 3EHMA 2YL0A 3AOUA 4LLEA 2IOQA 5D92A 2NG1A 3B0UX 1VOMA 3W8HA 5A6AA 1XZPA 3UR3C 2XM0A 4G0HA 2Q00A 1LKXA 1ZU4A 3ASNC 4LDRA 3T9OA 2OQMA 3UNGC 3FDQA 2R7OA 1Z5ZA 3AG1C 1Z63A 1K40A 1TWHA 3EGDB 3E9VA 3KMIA 4RBNA 3HNLA 3JSEO 3ZSUA 1FTSA 3WAQA 4D4NA 4E17A 1OR2A 4NQFA 4I1MA 5F28E 4KNWA 4CSAC 1V4AA 2HKVA 3O6XA 2VH3A 2NUPA 5E3CA 3NYLA 3EH2A 1OCOC 1Q0GA 1H7IA 2HFIA 4OD5A 4PK4A 4XPWA 1R4TA 4I1OB 4DOZA 4C3BA 2OEXA 5B3IA 2QUPA 3IQ5A 1G4US 2C03A 4YL3A 2IXNA 3PMRA 1LM3B 3K1IA 3ZIBA 5COFA 3U3BA 3M79A 3ABKC 5DS4A 3ZDLA 3A11A 3SNHA 1O87A 1JPJA 3FAJA 4U5BE 2NUTA 4ZLDA 2P0NA 3AGTA 2JD3A 4M63A 1YA9A 4X0RA 3W4YA 2CCYA 4K7BA 2DI3A 3KYIA 4QI0A 1U6HA 4YT5A 1CGOA 1D1AA 3L1MA 3WODF 2XLHA 4A4AA 4DVZA 5B3SC 3U8PA 4EHPA 1Q0KA 4XTKA 4MVUA 4E0HA 3SYNA 4NTAA 1Z23A 2QE9A 2CW0F 2EINC 3DAFA 3G50A 3MFNA 2VCAA 2EIKC 1JOGA 2J7PD 2NSFA 2OJED 2PFDA 1NU7D 4G7HF 4U9DA 3EGDA 1ZW2A 4C3EA 3PDMP 1QZXA 1O3UA 3EPVA 1K05A 3NG1A 1M6TA 3DM5A 2EPOA 3QMKA 1JRAA 1C17M 2GFHA 3ATPA 3GORA 1HE1A 3O39A 4H54A 2GAQA 3CQZA 4JIOA 4PR9A 1JPNA 4JTDB 5BQGA 3T4RA 3NYJA 2XL6A 4O6YA 3W2VA 3W8IA 3FOPA 3FMSA 3UMIA 3F46A 2NPUA 2WL8A 3AJMA 3MLGA 2E87A 3EG9B 4MVOA 3RH3A 3U8VA 4Z9IA 2Y3BA 5EGYA 3QVZA 3G4ZA 3LUTB 2ASRA 2Y3DA 1A7EA 3M15A 2W4BA 3RVYA 5JVEA 1M2VB 4LACB 4IB4A 1JAFA 4HEAJ 2EPKX 4XQ1A 1DOWA 2X51A 4WABA 4YT4A 4N6HA 2A0BA 2LK4A 1NBBA 5FCLA 1G4WR 2A69F 3LS0A 3Q7GA 4BEJA 4DXWA 5DVWA 1A0BA 1LVKA 3LLIA 1ST6A 2XLMA 2QTVA 4W8KA 4K0DA 2HV6A 3NYMA 4JJFA 1HMOA 2R9RB 3GWNA 3I4UA 5HV9A 3FAPB 1RMVA 1WOLA 1LPEA 3WG7C 3HTKC 3FXHA 3LLKA 3ZTZA 5JP7A 3U9JA 3ZQYA 1L3PA 2EIMC 4P9TA 4PFOA 3DAGA 4WJ0A 4CDVA 3FVYA 1OKKD 1V55C 1VYKA 3KKBA 4YJWA 2V26A 3C18A 1AUEA 4IJJA 2R7RA 2LP4A 4XLPF 4AL1A 2Q9CA 5L0IA 3S84A 1UFBA 1WWPA 3EG9A 3B9QA 1L7CA 2PBEA 1U0BB 2A6EF 4AX2A 2KGOA 1BBHA 1EI7A 3GM2A 3JRMO 2OEVA 3LAYA 1K04A 2WVOA 4K1OA 5KYWB 3AG3C 2XLDA 1HE9A 2YL7A 4LDQA 1D0YA 1TQGA 2EIJC 3US6A 4DRIB 3ITFA 2XL4A 2BL2A 2HSQA 3LEVA 1SR2A 3C8ZA 3M4BA 4BJ6A 2Y3HA 5KYNA 2C04A 2TMVP 2V3CC 3N24A 3JTLO 1MMAA 3NMKA 3DXJF 4MVSA 4MVMA 1MQVA 2HMZA 2IXPA 4H4KC 3MYFA 2R7UA 2R7WA 1G5ZA 4XEVA 3RIPA 4CBEA 2J46A 3RVZA 1ZYRF 1B68A 3TULA 2KQ9A 4HFKB 4EBKA 1VLSA 1KTMA 4MTGA 3H2VA 4OD4A 2FAPB 2KNHA 2R05A 2EPMX 3V5ZA 5D91A 3RW0A 4OIQF 4IAOA 2J9VA 2YZSA 4DRHB 5F5HA 3K33A 5JRAA 2RSEB 3K1IC 2I15A 3C7JA 3HLZA 4C7OB 2MYSA 3POVA 1ORSC 1YJGA 1ZHTA 3IQCA 3DWWA 2QNLA 1QPUA 3B71A 3SZRA 2YLIA 3K1HA 2J8WA 1NLXA 2ZPAA 4NTBA 1LI5A 5KYWA 1VK5A 2H7BA 2GA0A 1LE4A 3RF3A 5JUAA 4JZAA 2P1AA 4UDVA 3KPHA 3LNMB 3A9CA 5JSLA 5L3VA 3TOMA 1DOVA 2OKUA 256BA 4MVZA 1ZHWA 1A41A 2GWWA 2ICWG 1OXKA 2F22A 4DJ9A 4YK5A 2M64A 3K66A 2HZ8A 2R25A 1MMNA 1S7ZA 3E70C 1WTYA 2PX0A 2XLEA 3S28A 3X2QC 1OXBA 1S05A 3V5YA 2UUHA 3VF0A 5A6BA 4NTFA 1OQCA 3IQTA 3EJNA 3SP1A 3C63A 1MNDA 3C8GA 1GGQA 3EH1A 4O6NA 3S29A 1VYIA 1RKEA 1NFOA 2W4MA 4R32A 4G7OF 3S9OA 5B1AC 1SF8A 1A7VA 4G7ZF 3AQCA 3GWLA 2WVNA 3ZC4A 4W8PA 4CS9A 1V74B 4PJNA 1M2OA 3GEHA 5DQTA 1BR2A 5L0DA 1FMWA 4LDKA 2L9JA 2YLDA 1O5HA 3JYYA 4U5FE 2XRHA 4RD9A 4YWQA 2MWQA 5L0CA 4JCHA 1WN0A 2ZXWC 4NC3A 2KYHA 1VTMP 3EFOB 5L3QA 1T6IA 4HE8D 1D1CA 5T3WA 3EGXB 2YEVA 4CX9A 4MVRA 1YZAA 3CSKA 1OCRC 2YL3A 3DE9A 3LS1A 5DS5A 3GM1A 4FAPB 1HW2A 5B1BC 1SZIA 4OIRF 5AGFA 1LE2A 3UGOA 3QW1A 2L6HA 4LERA 2ZXRA 3HJCA 2DB4A 4IAQA 1TWAA 2IYLD 4G78A 2W9YA 2FGYA 2YVKA 3ZG1A 2JX0A 4OIPF 4DRJB 3GANA 1Q0DA 2CNWA 1QKRA 3M4CA 3AQBA 2OJQA 2R7VA 3NKDA 3QZCA 3UGPA 2A0UA 2AU5A 2G3KA 3IEEA 3SEOA 4BJ5A 4DBQA 2CYDA 3S90A 2HV7A 2L81A 3VM6A 3W2WA 5FZTA 3LNRA 1HW1A 1RXQA 1T9KA 2I8BA 2J9WA 4XWJA 5KYYB 1APCA 4IARA 3EZIA 4E7SA 3JT1A 2WZFA 3K6BA 1Q0FA 2UUIA 4BG0A 2FFHA 2LFDA 3DMDA 5IY5C 1EKYA 3U2MA 1NZEA 4CJGA 1I5NA 1QLEC 3IHUA 4P9FA 1MMGA 1WGWA 4YN0B 1H9GA 1T01A 3H2UA 3T6JA 4BJ6C 1U89A 4Q7CA 3EFOA 4JTAB 5COMA 4D4XA 4Q5SF 4N4WA 3TK0A 1ZZPA 2J7PA 2D4UA 2J9UA 1KU2A 4O79A 4IGGA 4YT8A 3RQEA 1E86A 2L6FA 3M1CB 1Z6AA 1RKCA 3G4XA 4XPYA 2D5RB 1NSGB 2EPNA 1YA7O 3KL4A 3U9MA 1E2XA 4I3MA 4KC9A 3RQFA 2ETSA 1VLTA 2XSEA 3ABLC 1FR0A 2Q9BA 4EIYA 3OEOA 3JCUQ 2O9XA 5E2QA 3U3FA 4F4BA 2IXMA 2KK1A 1M2VA 4JW1A 2IXOA 4JURI 4LLCA 5DS6A 1OW6A 1TWGA 3K7DA 3LEOA 1ZU5A 3TQOA 2WVQA 3WHNA 2RD9A 3EZHA 5BQIA 5HSWA 1D0XA 4IRUA 3GEIA 1N1CA 5KYYA 1ZHZA 3I5PA 2Y69C 3NMIA 4GQHA 1PV3A 2Q7RA 4O6MA 3SXZA 1LS4A 2LIGA 2CGEA 3KYJA 4O7GA 4HFFB 3UMKA 1BDJB 2PF4E 4A2NB 3JRTA 3S0XA 5A6KA 3BEHA 2XLWA 2BC5A 4JC7A 1YVIA 1Y6DA 5T1DB 4AL0A 4ZLCA 4QI2A 2QLAA 2HS5A 1YARO 2HJ3A 3EQLF 1T6QA 2XLOA 4WGZA 3BRJA 1FMVA 4Q4ZF 4E7ZA 1ZVZA 4YT2A 2KC3A 2DGJA 3KH2A 3DJNB 3L8JA 5F5FA 1D1BA 4BEMJ 5DLJA 1VMAA 1TR2A 2LCHA 1AVOB 3TOLA 3U5SA 4ULWA 5TJ5E 1EQ1A 3L8IA 1WATA 4OIOF 2YWAA 2B0HA 2NUPB 4JE9A 5EK0A 4JEAA 1QQ3A 4CS9C 5GPGB 5A6BD 1OW7A 2G62A 1TFKB 2H7OA 5CI9A 3C62A 3C8GD 4EKWA 4XEFA 4JJGA 3HKKA 5K0IA 4U5HA 2DYRC 1UG7A 1Q0MA 2QY9A 1A7DA 4E18A 3CEXA 2G3VA 2HMQA 2P6VA 1I4YA 1LS1A 3MX3A 2HUJA 2J45A 2PNOA 3PHF2 3HNIA 3AG4C 4J7TA 3VRCA 4EWCA 2XS8A 4MNDA 2OOCA 5DQZA 4MTOA 1YLMA 3IQ6A 2VC9A 4B6IA 2Q9AA 1NU9C 3IPMO 2R7TA 1VB5A 2XLVA 3SXKA 4E0IA 5AC4A 4I44A 4C3DA 4YL1A 1YAUO 1E84A 3N0TA 3LESA 3S27A 5CIVA 3JYHA 3U0CA 1KNYA 3GODA 3DKAA 2YL1A 3U2LA 4N06A 4EBBA 1GM5A 1BZ4A 2YKZA 3TD7A 4CS7A 1FFHA 1E85A 1EA8A 2XL8A 2AWCA 2J0WA 1J8YF 3O55A 4C7OA 5E33A 4P6IC 4BJ5C 5KYUB 2Y3GA 1BR1A 1OW8A 4ULVA 3SXYA 4BJ1A 5T3TA 3AG2C 2R7SA 3MBGA 2AVKA 4J32B 3VAYA 3NDBB 2Q4FA 1WASA 5JLIA 2LFFA 4JRZA 1I4ZA 4CIHA 2CNWD 2R7QA 3LJBA 4CS8A 5JT4A 3TJ6A 2WZLA 1AEPA 5L0HA 2KSFA 3Q6MA 5EHHA
chains in the Genus database with same CATH topology
2BE5F 2Q3TA 1IW7F 2VASA 4JVSA 4U5DE 1ZHXA 1Z3IX 1TKNA 4U5CE 2H7VC 4AK9A 3JSZA 3N2ZB 4FX5A 3DD7A 2Y39A 4FESA 4NY3A 4CSAA 3UMHA 5CI8A 3ECSA 2OCCC 2A1DD 3ZVRA 4KNVA 3OWTA 2W45A 3L0IA 1NG1A 4GYTA 2VB6A 1TWCA 1V54C 3Q6NA 5BUOA 3I5QA 3EGXA 1W2WA 4GEHA 3Q7LA 2A68F 1RJ9B 4QDLA 5KYXB 2XXAB 3FHDA 2KJGA 1BR4A 2WB7A 1M56C 4AE4B 4KI2A 3OA1A 3CZ6A 2WZGA 4FWVA 2PX3A 3F47A 3ASOC 2EILC 4KBLA 4DVYP 1OCCC 1M57C 3VYWA 4OINF 3B0VC 3RYLA 3ABMC 3X1OA 2ZXOA 1PCXA 2PP4A 2ZXPA 3V7OA 2J0XA 2P7VA 2A6HF 2B0JA 4Q4ZF 1FFTC 1PD1A 1SMYF 3B0PA 3H65A 3DJUB 2CDQA 4PJMA 4U5GA 1D0ZA 1RJ9A 4XLNF 5KYXA 2XXAA 1OKKA 4BJTA 4AE4A 2Z15A 4U5EE 1MNEA 3EHNA 1IZMA 1ZHYA 2YHSA 3L34A 4MQ9F 4RDAA 3DZAA 3RFYA 3T6BA 2R7XA 4J30B 4DBRA 2DYSC 4PJLA 4IWBA 2KW3C 3NRHA 1PD0A 2OG2A 3RKOF 4ANJA 2NUTB 1G8XA 1OCZC 2M4EA 4CS8C 4PJJA 1MMDA 1J8MF 3DM9B 3NKEA 2LSEA 4PFPA 5E3AA 3EHMA 4LLEA 2IOQA 5D92A 2NG1A 3B0UX 1VOMA 3W8HA 3UR3C 4G0HA 3ASNC 1LKXA 1ZU4A 3UNGC 3FDQA 2R7OA 1Z5ZA 3AG1C 3EGDB 1TWHA 3E9VA 3KMIA 4RBNA 3ZSUA 1FTSA 4I1MA 4KNWA 4CSAC 3O6XA 2VH3A 2NUPA 5E3CA 3NYLA 3EH2A 1OCOC 4PK4A 4OD5A 4I1OB 4DOZA 4C3BA 2C03A 2IXNA 3PMRA 3ZIBA 5DS4A 3ABKC 3SNHA 1O87A 1JPJA 3FAJA 4U5BE 2NUTA 2JD3A 4M63A 4X0RA 4K7BA 4QI0A 4YT5A 1D1AA 3WODF 4DVZA 5B3SC 4XTKA 3SYNA 1Z23A 3DAFA 2CW0F 2EINC 2EIKC 2J7PD 2PFDA 1NU7D 4G7HF 3EGDA 4C3EA 1QZXA 4LACB 3EPVA 3NG1A 3DM5A 3QMKA 2GFHA 3O39A 5KYUA 4C3DA 3CQZA 4ZLDA 1JPNA 3T4RA 3W2VA 3W8IA 3NYJA 4O6YA 3UMIA 3F46A 3MLGA 2WL8A 3RH3A 2E87A 3EG9B 5EGYA 2Y3BA 2Y3DA 2W4BA 1M2VB 4HEAJ 2X51A 4YT4A 5FCLA 2A69F 3LS0A 3Q7GA 4BEJA 5DVWA 1LVKA 3LLIA 1ST6A 2QTVA 4W8KA 4K0DA 2HV6A 3NYMA 4JJFA 3I4UA 3WG7C 3HTKC 3LLKA 2EIMC 4WJ0A 4PFOA 3DAGA 3FVYA 1OKKD 1V55C 1VYKA 3KKBA 4YJWA 2V26A 4IJJA 2R7RA 4XLPF 2Q9CA 3EG9A 3B9QA 2A6EF 4AX2A 2KGOA 3LAYA 2WVOA 5KYWB 3AG3C 1D0YA 2EIJC 3ITFA 2XL4A 3LEVA 4BJ6A 2V3CC 2Y3HA 5KYNA 2C04A 3N24A 1MMAA 3DXJF 2IXPA 4H4KC 2R7UA 2R7WA 3RIPA 4CBEA 2J46A 1ZYRF 2KQ9A 4HFKB 4OD4A 2KNHA 5D91A 4OIQF 4IAOA 2J9VA 2YZSA 5F5HA 3K33A 3K1IC 3HLZA 4C7OB 2MYSA 3POVA 1ZHTA 3SZRA 3K1HA 2ZPAA 5KYWA 1VK5A 2H7BA 4JZAA 5L3VA 1ZHWA 3K66A 4EBBA 1MMNA 1S7ZA 3E70C 2PX0A 3X2QC 3S28A 3EJNA 3SP1A 1MNDA 4O6NA 3EH1A 3S29A 1VYIA 2W4MA 4G7OF 5B1AC 1SF8A 4G7ZF 3AQCA 2WVNA 3ZC4A 4CS9A 4PJNA 1M2OA 5DQTA 1BR2A 1FMWA 2L9JA 1O5HA 4U5FE 2XRHA 4RD9A 4YWQA 2MWQA 4JCHA 2ZXWC 3EFOB 5L3QA 4HE8D 1D1CA 5T3WA 3EGXB 2YEVA 3CSKA 3LS1A 1OCRC 5DS5A 5B1BC 1SZIA 4OIRF 3UGOA 4LERA 2ZXRA 3HJCA 1TWAA 2IYLD 2W9YA 2FGYA 3ZG1A 4OIPF 3GANA 2CNWA 3AQBA 2R7VA 3NKDA 3QZCA 3UGPA 2G3KA 3IEEA 3SEOA 4BJ5A 4DBQA 2HV7A 2L81A 3W2WA 3LNRA 1Z63A 4XWJA 2I8BA 2J9WA 5KYYB 4E7SA 3EZIA 3JT1A 2WZFA 3K6BA 4BG0A 2FFHA 3DMDA 5IY5C 1NZEA 1QLEC 1MMGA 1WGWA 4YN0B 3T6JA 4BJ6C 4Q7CA 3EFOA 4Q5SF 2J7PA 2J9UA 1KU2A 4O79A 4YT8A 3M1CB 1Z6AA 2D5RB 3KL4A 4KC9A 4I3MA 2XSEA 3ABLC 2Q9BA 3OEOA 3JCUQ 2O9XA 5E2QA 4F4BA 2IXMA 1M2VA 4JW1A 2IXOA 4JURI 4LLCA 5DS6A 1TWGA 3K7DA 1ZU5A 2WVQA 5HSWA 3EZHA 1D0XA 4IRUA 1N1CA 5KYYA 1ZHZA 3I5PA 2Y69C 4O6MA 2CGEA 4O7GA 4HFFB 3UMKA 4A2NB 2PF4E 3JRTA 3S0XA 5T1DB 4ZLCA 4QI2A 3EQLF 1FMVA 4E7ZA 4YT2A 2DGJA 3KH2A 3DJNB 5F5FA 1D1BA 5DLJA 1VMAA 1TR2A 4ULWA 4OIOF 2NUPB 4CS9C 2G62A 2H7OA 5CI9A 4JJGA 4U5HA 2DYRC 2QY9A 3MX3A 2G3VA 2P6VA 1LS1A 2J45A 3PHF2 3AG4C 4EWCA 4MNDA 5DQZA 4B6IA 2Q9AA 1NU9C 2R7TA 4I44A 3N0TA 3LESA 3S27A 3JYHA 3GODA 4N06A 3TD7A 4CS7A 1FFHA 2J0WA 1J8YF 4C7OA 5E33A 4P6IC 4BJ5C 5KYUB 2Y3GA 1BR1A 2R7SA 4BJ1A 5T3TA 3AG2C 4J32B 3VAYA 3NDBB 4CIHA 2CNWD 3LJBA 2R7QA 4CS8A 2WZLA 3Q6MA 5EHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFF B;  4AX2 A;  4J30 B;  3ZIB A;  4HFK B;  4J32 B;  4JUR I;  4B6I A; 
#chains in the Genus database with same CATH topology
 2BE5 F;  3QTH A;  2Q3T A;  5L0J A;  2J9B A;  4BPM A;  4ONS A;  1IW7 F;  1LIH A;  1YDI A;  1YYJ A;  3R7C A;  4XEK A;  1CPR A;  1QVX A;  2VAS A;  4JVS A;  4U5D E;  1ZHX A;  1Z3I X;  4CDA A;  1TKN A;  1CPQ A;  3ZQV A;  3PCV A;  4U5C E;  2H7V C;  4AK9 A;  3JSZ A;  4MW8 A;  3N2Z B;  4FX5 A;  2HSB A;  4JTC B;  3GM3 A;  1FAP B;  5COG A;  3V5X A;  1C02 A;  3DD7 A;  2Y39 A;  1YYX A;  2R03 A;  3MYI A;  4FES A;  4NY3 A;  5BQH A;  4CSA A;  3UMH A;  5CI8 A;  3ECS A;  2OCC C;  2A1D D;  3ZVR A;  4EUK B;  4KNV A;  1C03 A;  3OWT A;  2W45 A;  2IM8 A;  3L0I A;  3R2P A;  3JZ0 A;  4MVQ A;  1NG1 A;  4GYT A;  2MHR A;  2OU6 A;  2VB6 A;  2YLG A;  1E83 A;  1TWC A;  1V54 C;  3Q6N A;  4WGY A;  4XPX A;  5BUO A;  3I5Q A;  3EGX A;  1W2W A;  4GEH A;  2P61 A;  3Q7L A;  4CJO A;  2X0C A;  2A68 F;  3CAX A;  1ORY A;  1SYQ A;  3HNJ A;  1RJ9 B;  4QDL A;  5KYX B;  2XXA B;  2R02 A;  3FHD A;  2NSG A;  2XS1 A;  2GDC A;  2KJG A;  1BR4 A;  2WB7 A;  1M56 C;  4L6R A;  4AE4 B;  4CDY A;  4EBJ A;  1RCP A;  3OA1 A;  4KI2 A;  3CZ6 A;  1JMW A;  5L0G A;  3AGU A;  2WZG A;  4FWV A;  2PX3 A;  3F47 A;  5L0F A;  3QW0 A;  3ASO C;  2EIL C;  3HNK A;  5A69 A;  4KBL A;  4DVY P;  3ZTM A;  1HY5 A;  1OCC C;  4Z9H A;  4JKV A;  4Z9J A;  1F1M A;  2ZD9 A;  1CGM E;  3ZWI A;  1M57 C;  3VYW A;  4OIN F;  2VCC A;  3B0V C;  3RYL A;  1TFO B;  1FNT c;  3ABM C;  4JEB A;  2ZXO A;  3X1O A;  4MS2 A;  1ORJ A;  1PCX A;  2PP4 A;  4JCZ A;  1XZQ A;  4ER9 A;  2AWY A;  2IBF A;  3J06 A;  2ZXP A;  2HJM A;  1R5I D;  3V7O A;  2J0X A;  1CGN A;  1GQA A;  2H8A A;  2A6H F;  2B0J A;  2P7V A;  2L6G A;  1QSP A;  1T5O A;  1FFT C;  3O10 A;  1PD1 A;  1SMY F;  4MTF A;  4MW3 A;  5AC5 A;  1HMD A;  3B0P A;  3H65 A;  3DJU B;  2CDQ A;  1LI7 A;  2L7A A;  3QVY A;  4PJM A;  4U5G A;  1YZC A;  1ZW3 A;  3SXM A;  5JS5 A;  1D0Z A;  1GS9 A;  1RJ9 A;  5KYU A;  1NFN A;  4XLN F;  5KYX A;  4N6C A;  2XXA A;  1OKK A;  1JR8 A;  3NMJ A;  4BJT A;  4AE4 A;  2Z15 A;  4U5E E;  1MNE A;  3EHN A;  1IZM A;  3FOO A;  2EPL X;  1OR3 A;  4U9E A;  5A6J A;  1Z7Q c;  4J7Y A;  2XM4 A;  3RQG A;  2AP3 A;  3B29 A;  4YL0 A;  1ZHY A;  3DI5 A;  2YHS A;  2YRF A;  3L34 A;  4MQ9 F;  4RDA A;  3DE8 A;  3DZA A;  4PAC A;  3RFY A;  3TJ5 A;  1Y4C A;  2VCB A;  3T6B A;  2R7X A;  1XWJ A;  4J30 B;  2LQG A;  2YQY A;  3C8G B;  1T6U A;  2DYS C;  4DBR A;  1H9T A;  1RKE B;  4PJL A;  4IWB A;  2JPU A;  2KW3 C;  3NRH A;  1PD0 A;  2OG2 A;  4NCQ A;  3RKO F;  4ANJ A;  1H6G A;  2LD6 A;  1G8X A;  1OCZ C;  2NUT B;  2M4E A;  4CS8 C;  4PJJ A;  1MMD A;  4CIP A;  1J8M F;  3DM9 B;  3T6G B;  2LSE A;  3NKE A;  3GEE A;  4PFP A;  5E3A A;  3EHM A;  2YL0 A;  3AOU A;  4LLE A;  2IOQ A;  5D92 A;  2NG1 A;  3B0U X;  1VOM A;  3W8H A;  5A6A A;  1XZP A;  3UR3 C;  2XM0 A;  4G0H A;  2Q00 A;  1LKX A;  1ZU4 A;  3ASN C;  4LDR A;  3T9O A;  2OQM A;  3UNG C;  3FDQ A;  2R7O A;  1Z5Z A;  3AG1 C;  1Z63 A;  1K40 A;  1TWH A;  3EGD B;  3E9V A;  3KMI A;  4RBN A;  3HNL A;  3JSE O;  3ZSU A;  1FTS A;  3WAQ A;  4D4N A;  4E17 A;  1OR2 A;  4NQF A;  4I1M A;  5F28 E;  4KNW A;  4CSA C;  1V4A A;  2HKV A;  3O6X A;  2VH3 A;  2NUP A;  5E3C A;  3NYL A;  3EH2 A;  1OCO C;  1Q0G A;  1H7I A;  2HFI A;  4OD5 A;  4PK4 A;  4XPW A;  1R4T A;  4I1O B;  4DOZ A;  4C3B A;  2OEX A;  5B3I A;  2QUP A;  3IQ5 A;  1G4U S;  2C03 A;  4YL3 A;  2IXN A;  3PMR A;  1LM3 B;  3K1I A;  3ZIB A;  5COF A;  3U3B A;  3M79 A;  3ABK C;  5DS4 A;  3ZDL A;  3A11 A;  3SNH A;  1O87 A;  1JPJ A;  3FAJ A;  4U5B E;  2NUT A;  4ZLD A;  2P0N A;  3AGT A;  2JD3 A;  4M63 A;  1YA9 A;  4X0R A;  3W4Y A;  2CCY A;  4K7B A;  2DI3 A;  3KYI A;  4QI0 A;  1U6H A;  4YT5 A;  1CGO A;  1D1A A;  3L1M A;  3WOD F;  2XLH A;  4A4A A;  4DVZ A;  5B3S C;  3U8P A;  4EHP A;  1Q0K A;  4XTK A;  4MVU A;  4E0H A;  3SYN A;  4NTA A;  1Z23 A;  2QE9 A;  2CW0 F;  2EIN C;  3DAF A;  3G50 A;  3MFN A;  2VCA A;  2EIK C;  1JOG A;  2J7P D;  2NSF A;  2OJE D;  2PFD A;  1NU7 D;  4G7H F;  4U9D A;  3EGD A;  1ZW2 A;  4C3E A;  3PDM P;  1QZX A;  1O3U A;  3EPV A;  1K05 A;  3NG1 A;  1M6T A;  3DM5 A;  2EPO A;  3QMK A;  1JRA A;  1C17 M;  2GFH A;  3ATP A;  3GOR A;  1HE1 A;  3O39 A;  4H54 A;  2GAQ A;  3CQZ A;  4JIO A;  4PR9 A;  1JPN A;  4JTD B;  5BQG A;  3T4R A;  3NYJ A;  2XL6 A;  4O6Y A;  3W2V A;  3W8I A;  3FOP A;  3FMS A;  3UMI A;  3F46 A;  2NPU A;  2WL8 A;  3AJM A;  3MLG A;  2E87 A;  3EG9 B;  4MVO A;  3RH3 A;  3U8V A;  4Z9I A;  2Y3B A;  5EGY A;  3QVZ A;  3G4Z A;  3LUT B;  2ASR A;  2Y3D A;  1A7E A;  3M15 A;  2W4B A;  3RVY A;  5JVE A;  1M2V B;  4LAC B;  4IB4 A;  1JAF A;  4HEA J;  2EPK X;  4XQ1 A;  1DOW A;  2X51 A;  4WAB A;  4YT4 A;  4N6H A;  2A0B A;  2LK4 A;  1NBB A;  5FCL A;  1G4W R;  2A69 F;  3LS0 A;  3Q7G A;  4BEJ A;  4DXW A;  5DVW A;  1A0B A;  1LVK A;  3LLI A;  1ST6 A;  2XLM A;  2QTV A;  4W8K A;  4K0D A;  2HV6 A;  3NYM A;  4JJF A;  1HMO A;  2R9R B;  3GWN A;  3I4U A;  5HV9 A;  3FAP B;  1RMV A;  1WOL A;  1LPE A;  3WG7 C;  3HTK C;  3FXH A;  3LLK A;  3ZTZ A;  5JP7 A;  3U9J A;  3ZQY A;  1L3P A;  2EIM C;  4P9T A;  4PFO A;  3DAG A;  4WJ0 A;  4CDV A;  3FVY A;  1OKK D;  1V55 C;  1VYK A;  3KKB A;  4YJW A;  2V26 A;  3C18 A;  1AUE A;  4IJJ A;  2R7R A;  2LP4 A;  4XLP F;  4AL1 A;  2Q9C A;  5L0I A;  3S84 A;  1UFB A;  1WWP A;  3EG9 A;  3B9Q A;  1L7C A;  2PBE A;  1U0B B;  2A6E F;  4AX2 A;  2KGO A;  1BBH A;  1EI7 A;  3GM2 A;  3JRM O;  2OEV A;  3LAY A;  1K04 A;  2WVO A;  4K1O A;  5KYW B;  3AG3 C;  2XLD A;  1HE9 A;  2YL7 A;  4LDQ A;  1D0Y A;  1TQG A;  2EIJ C;  3US6 A;  4DRI B;  3ITF A;  2XL4 A;  2BL2 A;  2HSQ A;  3LEV A;  1SR2 A;  3C8Z A;  3M4B A;  4BJ6 A;  2Y3H A;  5KYN A;  2C04 A;  2TMV P;  2V3C C;  3N24 A;  3JTL O;  1MMA A;  3NMK A;  3DXJ F;  4MVS A;  4MVM A;  1MQV A;  2HMZ A;  2IXP A;  4H4K C;  3MYF A;  2R7U A;  2R7W A;  1G5Z A;  4XEV A;  3RIP A;  4CBE A;  2J46 A;  3RVZ A;  1ZYR F;  1B68 A;  3TUL A;  2KQ9 A;  4HFK B;  4EBK A;  1VLS A;  1KTM A;  4MTG A;  3H2V A;  4OD4 A;  2FAP B;  2KNH A;  2R05 A;  2EPM X;  3V5Z A;  5D91 A;  3RW0 A;  4OIQ F;  4IAO A;  2J9V A;  2YZS A;  4DRH B;  5F5H A;  3K33 A;  5JRA A;  2RSE B;  3K1I C;  2I15 A;  3C7J A;  3HLZ A;  4C7O B;  2MYS A;  3POV A;  1ORS C;  1YJG A;  1ZHT A;  3IQC A;  3DWW A;  2QNL A;  1QPU A;  3B71 A;  3SZR A;  2YLI A;  3K1H A;  2J8W A;  1NLX A;  2ZPA A;  4NTB A;  1LI5 A;  5KYW A;  1VK5 A;  2H7B A;  2GA0 A;  1LE4 A;  3RF3 A;  5JUA A;  4JZA A;  2P1A A;  4UDV A;  3KPH A;  3LNM B;  3A9C A;  5JSL A;  5L3V A;  3TOM A;  1DOV A;  2OKU A;  256B A;  4MVZ A;  1ZHW A;  1A41 A;  2GWW A;  2ICW G;  1OXK A;  2F22 A;  4DJ9 A;  4YK5 A;  2M64 A;  3K66 A;  2HZ8 A;  2R25 A;  1MMN A;  1S7Z A;  3E70 C;  1WTY A;  2PX0 A;  2XLE A;  3S28 A;  3X2Q C;  1OXB A;  1S05 A;  3V5Y A;  2UUH A;  3VF0 A;  5A6B A;  4NTF A;  1OQC A;  3IQT A;  3EJN A;  3SP1 A;  3C63 A;  1MND A;  3C8G A;  1GGQ A;  3EH1 A;  4O6N A;  3S29 A;  1VYI A;  1RKE A;  1NFO A;  2W4M A;  4R32 A;  4G7O F;  3S9O A;  5B1A C;  1SF8 A;  1A7V A;  4G7Z F;  3AQC A;  3GWL A;  2WVN A;  3ZC4 A;  4W8P A;  4CS9 A;  1V74 B;  4PJN A;  1M2O A;  3GEH A;  5DQT A;  1BR2 A;  5L0D A;  1FMW A;  4LDK A;  2L9J A;  2YLD A;  1O5H A;  3JYY A;  4U5F E;  2XRH A;  4RD9 A;  4YWQ A;  2MWQ A;  5L0C A;  4JCH A;  1WN0 A;  2ZXW C;  4NC3 A;  2KYH A;  1VTM P;  3EFO B;  5L3Q A;  1T6I A;  4HE8 D;  1D1C A;  5T3W A;  3EGX B;  2YEV A;  4CX9 A;  4MVR A;  1YZA A;  3CSK A;  1OCR C;  2YL3 A;  3DE9 A;  3LS1 A;  5DS5 A;  3GM1 A;  4FAP B;  1HW2 A;  5B1B C;  1SZI A;  4OIR F;  5AGF A;  1LE2 A;  3UGO A;  3QW1 A;  2L6H A;  4LER A;  2ZXR A;  3HJC A;  2DB4 A;  4IAQ A;  1TWA A;  2IYL D;  4G78 A;  2W9Y A;  2FGY A;  2YVK A;  3ZG1 A;  2JX0 A;  4OIP F;  4DRJ B;  3GAN A;  1Q0D A;  2CNW A;  1QKR A;  3M4C A;  3AQB A;  2OJQ A;  2R7V A;  3NKD A;  3QZC A;  3UGP A;  2A0U A;  2AU5 A;  2G3K A;  3IEE A;  3SEO A;  4BJ5 A;  4DBQ A;  2CYD A;  3S90 A;  2HV7 A;  2L81 A;  3VM6 A;  3W2W A;  5FZT A;  3LNR A;  1HW1 A;  1RXQ A;  1T9K A;  2I8B A;  2J9W A;  4XWJ A;  5KYY B;  1APC A;  4IAR A;  3EZI A;  4E7S A;  3JT1 A;  2WZF A;  3K6B A;  1Q0F A;  2UUI A;  4BG0 A;  2FFH A;  2LFD A;  3DMD A;  5IY5 C;  1EKY A;  3U2M A;  1NZE A;  4CJG A;  1I5N A;  1QLE C;  3IHU A;  4P9F A;  1MMG A;  1WGW A;  4YN0 B;  1H9G A;  1T01 A;  3H2U A;  3T6J A;  4BJ6 C;  1U89 A;  4Q7C A;  3EFO A;  4JTA B;  5COM A;  4D4X A;  4Q5S F;  4N4W A;  3TK0 A;  1ZZP A;  2J7P A;  2D4U A;  2J9U A;  1KU2 A;  4O79 A;  4IGG A;  4YT8 A;  3RQE A;  1E86 A;  2L6F A;  3M1C B;  1Z6A A;  1RKC A;  3G4X A;  4XPY A;  2D5R B;  1NSG B;  2EPN A;  1YA7 O;  3KL4 A;  3U9M A;  1E2X A;  4I3M A;  4KC9 A;  3RQF A;  2ETS A;  1VLT A;  2XSE A;  3ABL C;  1FR0 A;  2Q9B A;  4EIY A;  3OEO A;  3JCU Q;  2O9X A;  5E2Q A;  3U3F A;  4F4B A;  2IXM A;  2KK1 A;  1M2V A;  4JW1 A;  2IXO A;  4JUR I;  4LLC A;  5DS6 A;  1OW6 A;  1TWG A;  3K7D A;  3LEO A;  1ZU5 A;  3TQO A;  2WVQ A;  3WHN A;  2RD9 A;  3EZH A;  5BQI A;  5HSW A;  1D0X A;  4IRU A;  3GEI A;  1N1C A;  5KYY A;  1ZHZ A;  3I5P A;  2Y69 C;  3NMI A;  4GQH A;  1PV3 A;  2Q7R A;  4O6M A;  3SXZ A;  1LS4 A;  2LIG A;  2CGE A;  3KYJ A;  4O7G A;  4HFF B;  3UMK A;  1BDJ B;  2PF4 E;  4A2N B;  3JRT A;  3S0X A;  5A6K A;  3BEH A;  2XLW A;  2BC5 A;  4JC7 A;  1YVI A;  1Y6D A;  5T1D B;  4AL0 A;  4ZLC A;  4QI2 A;  2QLA A;  2HS5 A;  1YAR O;  2HJ3 A;  3EQL F;  1T6Q A;  2XLO A;  4WGZ A;  3BRJ A;  1FMV A;  4Q4Z F;  4E7Z A;  1ZVZ A;  4YT2 A;  2KC3 A;  2DGJ A;  3KH2 A;  3DJN B;  3L8J A;  5F5F A;  1D1B A;  4BEM J;  5DLJ A;  1VMA A;  1TR2 A;  2LCH A;  1AVO B;  3TOL A;  3U5S A;  4ULW A;  5TJ5 E;  1EQ1 A;  3L8I A;  1WAT A;  4OIO F;  2YWA A;  2B0H A;  2NUP B;  4JE9 A;  5EK0 A;  4JEA A;  1QQ3 A;  4CS9 C;  5GPG B;  5A6B D;  1OW7 A;  2G62 A;  1TFK B;  2H7O A;  5CI9 A;  3C62 A;  3C8G D;  4EKW A;  4XEF A;  4JJG A;  3HKK A;  5K0I A;  4U5H A;  2DYR C;  1UG7 A;  1Q0M A;  2QY9 A;  1A7D A;  4E18 A;  3CEX A;  2G3V A;  2HMQ A;  2P6V A;  1I4Y A;  1LS1 A;  3MX3 A;  2HUJ A;  2J45 A;  2PNO A;  3PHF 2;  3HNI A;  3AG4 C;  4J7T A;  3VRC A;  4EWC A;  2XS8 A;  4MND A;  2OOC A;  5DQZ A;  4MTO A;  1YLM A;  3IQ6 A;  2VC9 A;  4B6I A;  2Q9A A;  1NU9 C;  3IPM O;  2R7T A;  1VB5 A;  2XLV A;  3SXK A;  4E0I A;  5AC4 A;  4I44 A;  4C3D A;  4YL1 A;  1YAU O;  1E84 A;  3N0T A;  3LES A;  3S27 A;  5CIV A;  3JYH A;  3U0C A;  1KNY A;  3GOD A;  3DKA A;  2YL1 A;  3U2L A;  4N06 A;  4EBB A;  1GM5 A;  1BZ4 A;  2YKZ A;  3TD7 A;  4CS7 A;  1FFH A;  1E85 A;  1EA8 A;  2XL8 A;  2AWC A;  2J0W A;  1J8Y F;  3O55 A;  4C7O A;  5E33 A;  4P6I C;  4BJ5 C;  5KYU B;  2Y3G A;  1BR1 A;  1OW8 A;  4ULV A;  3SXY A;  4BJ1 A;  5T3T A;  3AG2 C;  2R7S A;  3MBG A;  2AVK A;  4J32 B;  3VAY A;  3NDB B;  2Q4F A;  1WAS A;  5JLI A;  2LFF A;  4JRZ A;  1I4Z A;  4CIH A;  2CNW D;  2R7Q A;  3LJB A;  4CS8 A;  5JT4 A;  3TJ6 A;  2WZL A;  1AEP A;  5L0H A;  2KSF A;  3Q6M A;  5EHH A; 
#chains in the Genus database with same CATH homology
 2BE5 F;  2Q3T A;  1IW7 F;  2VAS A;  4JVS A;  4U5D E;  1ZHX A;  1Z3I X;  1TKN A;  4U5C E;  2H7V C;  4AK9 A;  3JSZ A;  3N2Z B;  4FX5 A;  3DD7 A;  2Y39 A;  4FES A;  4NY3 A;  4CSA A;  3UMH A;  5CI8 A;  3ECS A;  2OCC C;  2A1D D;  3ZVR A;  4KNV A;  3OWT A;  2W45 A;  3L0I A;  1NG1 A;  4GYT A;  2VB6 A;  1TWC A;  1V54 C;  3Q6N A;  5BUO A;  3I5Q A;  3EGX A;  1W2W A;  4GEH A;  3Q7L A;  2A68 F;  1RJ9 B;  4QDL A;  5KYX B;  2XXA B;  3FHD A;  2KJG A;  1BR4 A;  2WB7 A;  1M56 C;  4AE4 B;  4KI2 A;  3OA1 A;  3CZ6 A;  2WZG A;  4FWV A;  2PX3 A;  3F47 A;  3ASO C;  2EIL C;  4KBL A;  4DVY P;  1OCC C;  1M57 C;  3VYW A;  4OIN F;  3B0V C;  3RYL A;  3ABM C;  3X1O A;  2ZXO A;  1PCX A;  2PP4 A;  2ZXP A;  3V7O A;  2J0X A;  2P7V A;  2A6H F;  2B0J A;  4Q4Z F;  1FFT C;  1PD1 A;  1SMY F;  3B0P A;  3H65 A;  3DJU B;  2CDQ A;  4PJM A;  4U5G A;  1D0Z A;  1RJ9 A;  4XLN F;  5KYX A;  2XXA A;  1OKK A;  4BJT A;  4AE4 A;  2Z15 A;  4U5E E;  1MNE A;  3EHN A;  1IZM A;  1ZHY A;  2YHS A;  3L34 A;  4MQ9 F;  4RDA A;  3DZA A;  3RFY A;  3T6B A;  2R7X A;  4J30 B;  4DBR A;  2DYS C;  4PJL A;  4IWB A;  2KW3 C;  3NRH A;  1PD0 A;  2OG2 A;  3RKO F;  4ANJ A;  2NUT B;  1G8X A;  1OCZ C;  2M4E A;  4CS8 C;  4PJJ A;  1MMD A;  1J8M F;  3DM9 B;  3NKE A;  2LSE A;  4PFP A;  5E3A A;  3EHM A;  4LLE A;  2IOQ A;  5D92 A;  2NG1 A;  3B0U X;  1VOM A;  3W8H A;  3UR3 C;  4G0H A;  3ASN C;  1LKX A;  1ZU4 A;  3UNG C;  3FDQ A;  2R7O A;  1Z5Z A;  3AG1 C;  3EGD B;  1TWH A;  3E9V A;  3KMI A;  4RBN A;  3ZSU A;  1FTS A;  4I1M A;  4KNW A;  4CSA C;  3O6X A;  2VH3 A;  2NUP A;  5E3C A;  3NYL A;  3EH2 A;  1OCO C;  4PK4 A;  4OD5 A;  4I1O B;  4DOZ A;  4C3B A;  2C03 A;  2IXN A;  3PMR A;  3ZIB A;  5DS4 A;  3ABK C;  3SNH A;  1O87 A;  1JPJ A;  3FAJ A;  4U5B E;  2NUT A;  2JD3 A;  4M63 A;  4X0R A;  4K7B A;  4QI0 A;  4YT5 A;  1D1A A;  3WOD F;  4DVZ A;  5B3S C;  4XTK A;  3SYN A;  1Z23 A;  3DAF A;  2CW0 F;  2EIN C;  2EIK C;  2J7P D;  2PFD A;  1NU7 D;  4G7H F;  3EGD A;  4C3E A;  1QZX A;  4LAC B;  3EPV A;  3NG1 A;  3DM5 A;  3QMK A;  2GFH A;  3O39 A;  5KYU A;  4C3D A;  3CQZ A;  4ZLD A;  1JPN A;  3T4R A;  3W2V A;  3W8I A;  3NYJ A;  4O6Y A;  3UMI A;  3F46 A;  3MLG A;  2WL8 A;  3RH3 A;  2E87 A;  3EG9 B;  5EGY A;  2Y3B A;  2Y3D A;  2W4B A;  1M2V B;  4HEA J;  2X51 A;  4YT4 A;  5FCL A;  2A69 F;  3LS0 A;  3Q7G A;  4BEJ A;  5DVW A;  1LVK A;  3LLI A;  1ST6 A;  2QTV A;  4W8K A;  4K0D A;  2HV6 A;  3NYM A;  4JJF A;  3I4U A;  3WG7 C;  3HTK C;  3LLK A;  2EIM C;  4WJ0 A;  4PFO A;  3DAG A;  3FVY A;  1OKK D;  1V55 C;  1VYK A;  3KKB A;  4YJW A;  2V26 A;  4IJJ A;  2R7R A;  4XLP F;  2Q9C A;  3EG9 A;  3B9Q A;  2A6E F;  4AX2 A;  2KGO A;  3LAY A;  2WVO A;  5KYW B;  3AG3 C;  1D0Y A;  2EIJ C;  3ITF A;  2XL4 A;  3LEV A;  4BJ6 A;  2V3C C;  2Y3H A;  5KYN A;  2C04 A;  3N24 A;  1MMA A;  3DXJ F;  2IXP A;  4H4K C;  2R7U A;  2R7W A;  3RIP A;  4CBE A;  2J46 A;  1ZYR F;  2KQ9 A;  4HFK B;  4OD4 A;  2KNH A;  5D91 A;  4OIQ F;  4IAO A;  2J9V A;  2YZS A;  5F5H A;  3K33 A;  3K1I C;  3HLZ A;  4C7O B;  2MYS A;  3POV A;  1ZHT A;  3SZR A;  3K1H A;  2ZPA A;  5KYW A;  1VK5 A;  2H7B A;  4JZA A;  5L3V A;  1ZHW A;  3K66 A;  4EBB A;  1MMN A;  1S7Z A;  3E70 C;  2PX0 A;  3X2Q C;  3S28 A;  3EJN A;  3SP1 A;  1MND A;  4O6N A;  3EH1 A;  3S29 A;  1VYI A;  2W4M A;  4G7O F;  5B1A C;  1SF8 A;  4G7Z F;  3AQC A;  2WVN A;  3ZC4 A;  4CS9 A;  4PJN A;  1M2O A;  5DQT A;  1BR2 A;  1FMW A;  2L9J A;  1O5H A;  4U5F E;  2XRH A;  4RD9 A;  4YWQ A;  2MWQ A;  4JCH A;  2ZXW C;  3EFO B;  5L3Q A;  4HE8 D;  1D1C A;  5T3W A;  3EGX B;  2YEV A;  3CSK A;  3LS1 A;  1OCR C;  5DS5 A;  5B1B C;  1SZI A;  4OIR F;  3UGO A;  4LER A;  2ZXR A;  3HJC A;  1TWA A;  2IYL D;  2W9Y A;  2FGY A;  3ZG1 A;  4OIP F;  3GAN A;  2CNW A;  3AQB A;  2R7V A;  3NKD A;  3QZC A;  3UGP A;  2G3K A;  3IEE A;  3SEO A;  4BJ5 A;  4DBQ A;  2HV7 A;  2L81 A;  3W2W A;  3LNR A;  1Z63 A;  4XWJ A;  2I8B A;  2J9W A;  5KYY B;  4E7S A;  3EZI A;  3JT1 A;  2WZF A;  3K6B A;  4BG0 A;  2FFH A;  3DMD A;  5IY5 C;  1NZE A;  1QLE C;  1MMG A;  1WGW A;  4YN0 B;  3T6J A;  4BJ6 C;  4Q7C A;  3EFO A;  4Q5S F;  2J7P A;  2J9U A;  1KU2 A;  4O79 A;  4YT8 A;  3M1C B;  1Z6A A;  2D5R B;  3KL4 A;  4KC9 A;  4I3M A;  2XSE A;  3ABL C;  2Q9B A;  3OEO A;  3JCU Q;  2O9X A;  5E2Q A;  4F4B A;  2IXM A;  1M2V A;  4JW1 A;  2IXO A;  4JUR I;  4LLC A;  5DS6 A;  1TWG A;  3K7D A;  1ZU5 A;  2WVQ A;  5HSW A;  3EZH A;  1D0X A;  4IRU A;  1N1C A;  5KYY A;  1ZHZ A;  3I5P A;  2Y69 C;  4O6M A;  2CGE A;  4O7G A;  4HFF B;  3UMK A;  4A2N B;  2PF4 E;  3JRT A;  3S0X A;  5T1D B;  4ZLC A;  4QI2 A;  3EQL F;  1FMV A;  4E7Z A;  4YT2 A;  2DGJ A;  3KH2 A;  3DJN B;  5F5F A;  1D1B A;  5DLJ A;  1VMA A;  1TR2 A;  4ULW A;  4OIO F;  2NUP B;  4CS9 C;  2G62 A;  2H7O A;  5CI9 A;  4JJG A;  4U5H A;  2DYR C;  2QY9 A;  3MX3 A;  2G3V A;  2P6V A;  1LS1 A;  2J45 A;  3PHF 2;  3AG4 C;  4EWC A;  4MND A;  5DQZ A;  4B6I A;  2Q9A A;  1NU9 C;  2R7T A;  4I44 A;  3N0T A;  3LES A;  3S27 A;  3JYH A;  3GOD A;  4N06 A;  3TD7 A;  4CS7 A;  1FFH A;  2J0W A;  1J8Y F;  4C7O A;  5E33 A;  4P6I C;  4BJ5 C;  5KYU B;  2Y3G A;  1BR1 A;  2R7S A;  4BJ1 A;  5T3T A;  3AG2 C;  4J32 B;  3VAY A;  3NDB B;  4CIH A;  2CNW D;  3LJB A;  2R7Q A;  4CS8 A;  2WZL A;  3Q6M A;  5EHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...