4KI2A

Crystallographic analysis of an rna-polymerase sigma-subunit fragment complexed with -10 promoter element ssdna
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
178
structure length
178
Chain Sequence
b'SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*CP*AP*AP*TP*GP*GP*G)-3')
publication title Crystallographic analysis of an RNA polymerase sigma-subunit fragment complexed with -10 promoter element ssDNA: quadruplex formation as a possible tool for engineering crystal contacts in protein-ssDNA complexes.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 65
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ki2A00
4OIOF 4OIRF 4G7OF 4OINF 2A6EF 3EQLF 2BE5F 1KU2A 3LEVA 3DXJF 4OIPF 1IW7F 2A6HF 2A69F 3LESA 2A68F 3UGPA 1SMYF 2CW0F 4Q4ZF 4G7ZF 4KI2A 4OIQF 4Q5SF 4MQ9F 1ZYRF 4XLPF 3WODF 3UGOA 4G7HF 4XLNF
chains in the Genus database with same CATH superfamily
4OIOF 2H7BA 3Q6MA 4LDRA 4U5FE 4GEHA 2CDQA 2A6EF 3UMHA 1ZVZA 3JRMO 3U9JA 1VK5A 3DM5A 2J7PA 5DVWA 4BJ5A 2KYHA 2QNLA 3JSZA 4PJJA 4H4KC 4QDLA 2VH3A 1LIHA 2XL4A 5EK0A 4OIPF 1D1BA 1NFOA 1FR0A 1Q0GA 1I4YA 3ASOC 4MVSA 1YYJA 2NUTA 2XM4A 3SXYA 2QUPA 3F47A 4J32B 2YL3A 5A6KA 2Y3BA 2Q9CA 4UDVA 2KSFA 4KNWA 4PK4A 3S29A 1VLTA 2XRHA 1YLMA 3FHDA 3LJBA 3U9MA 1Z5ZA 3RKOF 1R5ID 4NQFA 4CS9A 5JT4A 1H7IA 4C7OA 1G5ZA 2WVOA 4MQ9F 3KH2A 4I1MA 3M79A 3WODF 5E33A 1SR2A 5B1BC 4XLNF 5B3SC 1LVKA 3ECSA 3POVA 1XWJA 1YA7O 2Y3DA 2KJGA 1SZIA 1Q0FA 4JTCB 3RQGA 3I5PA 1BR1A 4JEAA 1KU2A 2G3KA 3B9QA 1TWAA 2XLEA 3K1IC 5L3QA 1OKKD 2WVNA 4YL1A 3B0VC 2I8BA 3LEVA 3TD7A 1Q0DA 1LI5A 3X1OA 1V74B 2GA0A 4BG0A 4ER9A 3RQEA 1MMNA 2L7AA 2ZD9A 1EI7A 2Z15A 2EIMC 3RFYA 1JMWA 2VB6A 3ZVRA 1M6TA 3B0UX 1DOVA 4JCHA 3N0TA 2JPUA 5L0GA 3EFOA 1J8YF 3JYHA 3MFNA 1Q0MA 4DRIB 1YARO 1Q0KA 2LD6A 3LS0A 3TJ5A 4O79A 4XEFA 3WAQA 1BR2A 2HS5A 1ZYRF 2LCHA 1NSGB 2CNWA 2J0XA 3FMSA 1PD0A 3GWLA 3EGDA 3LS1A 3VRCA 4QI2A 5B3IA 3DMDA 2YKZA 3S28A 2YLGA 3K1IA 2R9RB 2GAQA 4YWQA 4ONSA 3K1HA 4C3EA 4WGZA 3SP1A 3EG9A 1NU7D 3GM1A 2XSEA 4MVOA 1NG1A 3V5XA 1HMOA 1RJ9A 2ASRA 2PX3A 1I5NA 2IBFA 3NMKA 4I44A 5IY5C 3AJMA 3O10A 4WJ0A 2YWAA 1OCZC 5FCLA 4CJOA 3NG1A 4U5HA 2L6FA 2LIGA 1RKEA 4NTBA 4Z9HA 2A0UA 2EPKX 4IRUA 4PJMA 2KC3A 2AWYA 4FAPB 3OA1A 3W8IA 2QLAA 3A9CA 4W8PA 2J9VA 3M1CB 3C18A 3C62A 3ZC4A 4XEVA 3W2VA 3Q7LA 3GODA 1H9TA 2P1AA 4P6IC 2DB4A 3KKBA 4H54A 2YRFA 1HE9A 2EIJC 4OIRF 1A7DA 2X0CA 3EQLF 2DYRC 2IXPA 1MNEA 2LFFA 3L34A 4YJWA 4L6RA 5F28E 3DM9B 2V3CC 4K1OA 3EHMA 1JOGA 1OXKA 4R32A 1YA9A 4I1OB 1FTSA 1FMVA 4MW3A 4YL0A 5COGA 3DXJF 1YZCA 4XPXA 1J8MF 1T6QA 5EGYA 2H7VC 3B0PA 1XZPA 4PJNA 3T6GB 1AEPA 3S27A 5AC4A 1U0BB 2DGJA 4HE8D 2OOCA 4JVSA 4NC3A 4BEMJ 3W8HA 1SYQA 4MNDA 3KL4A 4CSAC 2HSQA 2XS8A 1LI7A 1MMDA 2R25A 1ZW3A 1VYIA 1RKCA 2MYSA 4JEBA 4U5GA 4ULWA 1V54C 1A7VA 4MVUA 2GDCA 5BUOA 1JR8A 5KYUB 5DS4A 1G8XA 3GANA 4KBLA 2YL1A 1TQGA 3AOUA 1AVOB 3GORA 1IZMA 4IB4A 2HJ3A 5L3VA 4CX9A 2Y3GA 4NY3A 4YL3A 1M2VA 3LNMB 1YYXA 2KNHA 3GEIA 1FFHA 1MMGA 3BRJA 1V55C 3IQ5A 2ZXWC 3DE8A 3FOOA 4IGGA 2EPOA 4JURI 1YZAA 4EBBA 3CZ6A 3FDQA 5L0FA 1PCXA 3ZQYA 1HY5A 2OCCC 3IQ6A 1ST6A 3L8IA 5T3WA 3ZTMA 3SXMA 3Q7GA 5COFA 2XM0A 3G4ZA 2J45A 1MNDA 2YLIA 2Q7RA 4PFOA 5F5HA 4FWVA 4XEKA 1DOWA 2NUPB 1VYKA 1LPEA 2OEXA 1CGME 1RMVA 1PV3A 2R7SA 3IEEA 3ASNC 4JZAA 1QVXA 2KK1A 5L0DA 3PHF2 2EIKC 3NYMA 4JTDB 2X51A 2MWQA 2A1DD 2G3VA 2OJED 3EZIA 3FXHA 1HW1A 3AQBA 3QW0A 2LQGA 2XLWA 4J7TA 5HSWA 2A68F 3SYNA 1SF8A 2W4MA 4KI2A 2JX0A 3G4XA 5HV9A 5JVEA 2D4UA 3G50A 3ZWIA 2XL8A 4KNVA 2R03A 2KW3C 1H9GA 2XLDA 5D91A 4E7ZA 3SXZA 5DS5A 3AG3C 3NYJA 1WASA 3C8GA 3ZTZA 1Z3IX 4AK9A 4CS8C 1VLSA 2O9XA 4RDAA 4ANJA 2R7QA 4CIHA 3S84A 3JTLO 3LEOA 1GQAA 2YEVA 4P9TA 3MYIA 5A6BA 3EZHA 4D4NA 1WOLA 3F46A 4NCQA 1PD1A 3L0IA 4MVQA 4YT5A 4PACA 2OU6A 1U6HA 3JYYA 5E3CA 2EPNA 1YVIA 3X2QC 1YJGA 1OR2A 2HJMA 3RH3A 3T6BA 4O6YA 2A6HF 1G4WR 2L81A 4A2NB 2D5RB 2CW0F 5KYXB 5CI9A 1XZQA 1O5HA 2YVKA 3VM6A 1ORSC 4DBRA 1T5OA 3LNRA 3TULA 1L3PA 2HMQA 3ZIBA 1LM3B 2XLHA 3EHNA 3UMIA 1JRAA 4CS8A 1Y4CA 2KQ9A 5K0IA 1E86A 4DXWA 2H8AA 1Z6AA 3AGTA 1E2XA 5L0JA 5KYUA 2L6GA 4KC9A 2XXAA 2R7XA 2BE5F 1S7ZA 3U3BA 3EPVA 5L0IA 3PCVA 4AE4B 1NZEA 1AUEA 1G4US 2QY9A 1ZHXA 2VCAA 2Y3HA 1JAFA 2BC5A 2A0BA 3OWTA 2WL8A 2R7WA 1T6IA 3RVZA 1FMWA 3KMIA 2CCYA 3C63A 5KYYB 3DAGA 2OQMA 1QPUA 1HE1A 2OKUA 2ZXPA 4I3MA 4ZLCA 2P61A 2AP3A 1OQCA 3ATPA 3ABLC 2J9BA 1UG7A 3ABKC 3DKAA 3GM2A 4OD4A 3HTKC 1RXQA 3NKEA 1EQ1A 3UGOA 3QTHA 1FNTc 3KPHA 1TFOB 1ORYA 3K6BA 2QTVA 2HUJA 2B0HA 2WZGA 3TOLA 2Y39A 4YT4A 1OCRC 3B71A 4MVRA 2C04A 5GPGB 3K33A 3PDMP 4OD5A 4AL1A 4YT2A 1K05A 1LS1A 3I5QA 2J7PD 1RCPA 2DI3A 2J9WA 2Q4FA 2RSEB 1IW7F 2XL6A 3FAPB 4BJ6C 3V7OA 3Q6NA 2NUTB 1CPRA 4FESA 1WGWA 2WZLA 5CI8A 5FZTA 4U5DE 1JPNA 2C03A 4YN0B 3MLGA 2B0JA 2L6HA 4CDYA 2W4BA 3HNIA 4FX5A 1OXBA 3HNJA 3ZDLA 1TKNA 3VAYA 4C7OB 4G0HA 5D92A 4LLCA 4Z9IA 4XWJA 3W4YA 1D1AA 1ORJA 3AG1C 3N2ZB 3NRHA 1Z63A 3LLKA 4C3DA 2LP4A 1VTMP 1ZU5A 4MS2A 4O6NA 4Z9JA 4JJFA 3WG7C 4CJGA 3K66A 1LKXA 3AGUA 3CEXA 1E84A 5T1DB 1OKKA 4BEJA 2JD3A 5A6JA 3QMKA 4J7YA 4BJ6A 2GWWA 3FVYA 3LAYA 5JRAA 3VYWA 2V26A 2R7TA 1WTYA 3HKKA 2EINC 3BEHA 2H7OA 2F22A 3V5YA 2XLOA 1TWGA 2VASA 3ZG1A 2R05A 4LLEA 3RYLA 1MMAA 2IXNA 1GGQA 1T9KA 2M4EA 4O6MA 3US6A 2P0NA 1YAUO 3EFOB 3S90A 4CSAA 3T4RA 3IHUA 2QE9A 3TK0A 4N06A 1C17M 1ZHWA 3UNGC 1N1CA 4W8KA 4N6HA 3S0XA 3EGDB 3EGXB 3U2MA 1F1MA 2CNWD 4DRJB 3CSKA 4A4AA 4LDKA 2IYLD 4O7GA 1M57C 3JRTA 5E3AA 5CIVA 1YDIA 2LSEA 3IQTA 5BQIA 5JLIA 4MTOA 2HMZA 4J30B 1TWHA 4XQ1A 2R7VA 2YL7A 4F4BA 1QLEC 1RJ9B 2UUHA 1WN0A 5L0CA 1VB5A 3EH2A 3LESA 1OW8A 2GFHA 3AG2C 4NTFA 4E0IA 2NSFA 2NSGA 1CGOA 1O3UA 2FGYA 2OEVA 1ZU4A 2OG2A 2WVQA 3AG4C 1K04A 3DI5A 3DJNB 3NMJA 4K0DA 1RKEB 3TOMA 5DQTA 1I4ZA 1FAPB 2P7VA 1APCA 2LFDA 3C8ZA 3QW1A 3S9OA 2R7RA 3UMKA 2J0WA 4JCZA 3RF3A 4HFKB 4XTKA 4HEAJ 4G7HF 5KYWB 2EILC 4JJGA 3IPMO 3GWNA 4CBEA 2Y69C 4IJJA 4D4XA 5BQHA 2EPLX 1OW6A 4OINF 4MTFA 2YL0A 1O87A 1QZXA 1H6GA 3H2UA 4NTAA 4PFPA 3M4CA 4YT8A 2EPMX 5JP7A 3GM3A 4IWBA 3LLIA 4CDVA 4Q7CA 2NG1A 2I15A 2J8WA 1Z7Qc 5T3TA 2IXOA 5KYWA 4Q4ZF 4G7ZF 2PP4A 2L9JA 4U9EA 4E18A 1KTMA 3DE9A 4JKVA 1LE2A 2CYDA 4M63A 4RD9A 5COMA 2AU5A 3DD7A 3VF0A 2BL2A 3SNHA 4RBNA 1K40A 1M56C 2HKVA 4XPWA 4CS7A 1CPQA 3CQZA 3JZ0A 3AQCA 2ICWG 3J06A 2ZXOA 2WB7A 1CGNA 3DZAA 4JRZA 4G7OF 2Q3TA 2HV6A 2PNOA 3U8PA 1BBHA 1ZHZA 3ZQVA 2Q9AA 1T6UA 3QVYA 4MVMA 1Y6DA 2P6VA 4MTGA 2YLDA 4CDAA 4BPMA 4QI0A 3EH1A 1HW2A 4WGYA 3CAXA 1M2VB 256BA 2G62A 3JCUQ 4AL0A 4ZLDA 2YHSA 3M15A 2IOQA 1JPJA 5JSLA 1V4AA 4U5BE 3DJUB 3W2WA 4JC7A 1NLXA 1EA8A 2NPUA 1A7EA 1UFBA 3LUTB 1WATA 1C02A 4CIPA 3KYIA 4B6IA 2HFIA 4EHPA 4BJTA 4N6CA 2J9UA 4U5CE 3RVYA 4Q5SF 3R2PA 2PX0A 2RD9A 4U5EE 1U89A 3E9VA 4LDQA 3FOPA 4HFFB 4G78A 2AWCA 3EGXA 4E17A 2NUPA 3R7CA 3QZCA 1S05A 1TR2A 5JUAA 2KGOA 3H2VA 4MVZA 4EBJA 3L1MA 3A11A 3NKDA 5B1AC 3UR3C 3MBGA 4C3BA 3SZRA 4JIOA 3KYJA 3N24A 3QVZA 5KYNA 4GQHA 5L0HA 1QKRA 3H65A 1NBBA 3B29A 2ZXRA 3FAJA 2MHRA 1FFTC 1MQVA 1TFKB 3JT1A 3ZSUA 4E7SA 3GEEA 1B68A 2VC9A 2PBEA 4LACB 4DVZA 3HNLA 3U0CA 2HV7A 3T6JA 4AX2A 3O55A 5DQZA 4LERA 1W2WA 2ZPAA 3DAFA 3ABMC 5A69A 1E83A 2XLMA 1TWCA 3JSEO 3TQOA 2DYSC 4N4WA 1VOMA 4DBQA 3C8GB 3TJ6A 4DRHB 1QSPA 4DJ9A 1A41A 3C7JA 4EUKB 4EWCA 1EKYA 2PF4E 1D0ZA 3C8GD 1A0BA 4DOZA 5DLJA 5JS5A 2LK4A 3T9OA 3MYFA 4IAOA 1GM5A 1OCCC 3IQCA 1KNYA 5A6AA 5A6BD 2TMVP 2J46A 4EBKA 3M4BA 4BJ1A 4PJLA 4DVYP 3O39A 1BDJB 1BR4A 2FAPB 2WZFA 3HJCA 5E2QA 2XLVA 1GS9A 1ZHYA 2UUIA 3L8JA 3PMRA 1BZ4A 1SMYF 2CGEA 4WABA 3O6XA 4ULVA 1R4TA 5BQGA 4XPYA 3U2LA 5KYXA 3V5ZA 4IARA 3RIPA 3NMIA 2YQYA 2W45A 2IM8A 2VCCA 2VCBA 2W9YA 1OCOC 4K7BA 3HNKA 1D0XA 4GYTA 2YZSA 5DS6A 1D1CA 3OEOA 3HLZA 4JW1A 2E87A 1WWPA 2PFDA 3E70C 1ZW2A 4EIYA 2XXAB 2ETSA 4U9DA 3NYLA 4E0HA 4PR9A 2AVKA 1NFNA 1OW7A 1C03A 3ITFA 4IAQA 4AE4A 4YK5A 3U8VA 3EG9B 4EKWA 1Z23A 2IXMA 1LS4A 3RQFA 4BJ5C 4JTAB 3NDBB 3U3FA 2M64A 2R7OA 1NU9C 2A69F 1T01A 2HZ8A 2R02A 2XS1A 2Q00A 3GEHA 4P9FA 2HSBA 1L7CA 3SEOA 5EHHA 3EJNA 1E85A 3I4UA 3UGPA 3DWWA 1LE4A 3MX3A 4JE9A 4X0RA 3WHNA 5AC5A 1OR3A 1VMAA 1ZHTA 2Q9BA 3U5SA 5KYYA 3RW0A 4OIQF 5TJ5E 1M2OA 2FFHA 2R7UA 4MW8A 5F5FA 5AGFA 4XLPF 1HMDA 1D0YA 1ZZPA 4CS9C 3SXKA 1QQ3A 3K7DA 2OJQA
chains in the Genus database with same CATH topology
4OIOF 2H7BA 4U5FE 4GEHA 2CDQA 2A6EF 3UMHA 1VK5A 3DM5A 2J7PA 5DVWA 4BJ5A 3JSZA 4PJJA 4H4KC 4QDLA 2VH3A 2XL4A 4OIPF 1D1BA 3ASOC 2NUTA 3F47A 4J32B 2Y3BA 2Q9CA 4KNWA 4PK4A 3S29A 2XRHA 3LJBA 3FHDA 1Z5ZA 3RKOF 4CS9A 4C7OA 2WVOA 4MQ9F 3KH2A 4I1MA 3WODF 5E33A 5B1BC 4XLNF 5B3SC 1LVKA 3ECSA 3POVA 2Y3DA 2KJGA 1SZIA 3I5PA 1BR1A 1KU2A 2G3KA 3B9QA 1TWAA 3K1IC 5L3QA 1OKKD 2WVNA 3B0VC 2I8BA 3LEVA 3TD7A 3X1OA 4BG0A 1MMNA 2Z15A 2EIMC 3RFYA 2VB6A 3ZVRA 3B0UX 4JCHA 3N0TA 3EFOA 1J8YF 3JYHA 3LS0A 4O79A 1BR2A 1ZYRF 2CNWA 2J0XA 3LS1A 1PD0A 3EGDA 3DMDA 3S28A 4YWQA 3K1HA 4C3EA 3SP1A 3EG9A 1NU7D 2XSEA 1NG1A 1RJ9A 2PX3A 4I44A 5IY5C 4WJ0A 1OCZC 5FCLA 3NG1A 4U5HA 4IRUA 4PJMA 3OA1A 3W8IA 2J9VA 3M1CB 3ZC4A 3W2VA 3Q7LA 3GODA 4P6IC 3KKBA 5KYWA 4OIRF 2EIJC 3EQLF 2DYRC 2IXPA 1MNEA 3L34A 4YJWA 2V3CC 3DM9B 3EHMA 4I1OB 1FTSA 1FMVA 3DXJF 1J8MF 5EGYA 2H7VC 3B0PA 4PJNA 3S27A 2DGJA 4HE8D 4JVSA 3W8HA 4MNDA 3KL4A 4CSAC 1MMDA 2MYSA 1VYIA 4U5GA 4ULWA 1V54C 5BUOA 5KYUB 5DS4A 1G8XA 3GANA 4KBLA 1IZMA 5L3VA 2Y3GA 4NY3A 1M2VA 2KNHA 1FFHA 1MMGA 1V55C 2ZXWC 4JURI 4EBBA 3CZ6A 3FDQA 1PCXA 2OCCC 5T3WA 1ST6A 3Q7GA 2J45A 1MNDA 4PFOA 5F5HA 4FWVA 2NUPB 1VYKA 2R7SA 3IEEA 3ASNC 4JZAA 3PHF2 2EIKC 3NYMA 2X51A 2MWQA 2A1DD 2G3VA 3EZIA 3AQBA 5HSWA 2A68F 3SYNA 1SF8A 2W4MA 4KI2A 4KNVA 2KW3C 5D91A 4E7ZA 5DS5A 3AG3C 3NYJA 1Z3IX 4AK9A 4CS8C 2O9XA 4ANJA 4RDAA 2R7QA 4CIHA 2YEVA 3EZHA 3F46A 1PD1A 3L0IA 4YT5A 5E3CA 3X2QC 3RH3A 3T6BA 4O6YA 2A6HF 2L81A 4A2NB 2D5RB 2CW0F 5KYXB 5CI9A 1O5HA 4DBRA 3LNRA 3ZIBA 3UMIA 3EHNA 4CS8A 2KQ9A 1Z6AA 5KYUA 4KC9A 2XXAA 2R7XA 2BE5F 1S7ZA 3EPVA 4AE4B 1NZEA 2QY9A 1ZHXA 2Y3HA 3OWTA 2WL8A 2R7WA 1FMWA 3KMIA 5KYYB 3DAGA 2ZXPA 4I3MA 4ZLCA 3ABLC 3ABKC 4OD4A 3HTKC 3NKEA 3UGOA 3K6BA 2QTVA 2WZGA 2Y39A 4YT4A 1OCRC 2C04A 3K33A 4OD5A 4YT2A 1LS1A 3I5QA 2J7PD 2J9WA 1IW7F 4BJ6C 3V7OA 3Q6NA 2NUTB 4FESA 5CI8A 1WGWA 2WZLA 4U5DE 1JPNA 2C03A 4YN0B 3MLGA 2B0JA 2W4BA 4FX5A 1TKNA 3VAYA 4C7OB 4G0HA 5D92A 4LLCA 4XWJA 1D1AA 3AG1C 3N2ZB 3NRHA 1Z63A 3LLKA 4C3DA 1ZU5A 4O6NA 3WG7C 4JJFA 3K66A 1LKXA 5T1DB 1OKKA 4BEJA 2JD3A 3QMKA 4BJ6A 3LAYA 3FVYA 3VYWA 2V26A 2R7TA 2EINC 2H7OA 3ZG1A 1TWGA 2VASA 4LLEA 3RYLA 1MMAA 2IXNA 2M4EA 4O6MA 3EFOB 4CSAA 3T4RA 4N06A 1ZHWA 3UNGC 1N1CA 4W8KA 3S0XA 3EGDB 3EGXB 2CNWD 3CSKA 2IYLD 4O7GA 1M57C 3JRTA 5E3AA 2LSEA 4J30B 1TWHA 4F4BA 1QLEC 1RJ9B 3EH2A 3LESA 2GFHA 3AG2C 3Q6MA 2WVQA 2FGYA 3AG4C 1ZU4A 2OG2A 3DJNB 5DQTA 4K0DA 2P7VA 2R7RA 3UMKA 2J0WA 4HFKB 4XTKA 4HEAJ 4G7HF 5KYWB 2EILC 4JJGA 4CBEA 2R7VA 2Y69C 4IJJA 4OINF 1O87A 1QZXA 4PFPA 4YT8A 4IWBA 3LLIA 4Q7CA 2NG1A 5T3TA 2IXOA 4Q4ZF 4G7ZF 2PP4A 2L9JA 4M63A 4RD9A 3DD7A 3SNHA 4RBNA 1M56C 4CS7A 3CQZA 3AQCA 2ZXOA 2WB7A 3DZAA 4G7OF 2Q3TA 2HV6A 1ZHZA 2Q9AA 2P6VA 4QI0A 3EH1A 1M2VB 2G62A 3JCUQ 4ZLDA 2YHSA 2IOQA 1JPJA 4U5BE 3DJUB 3W2WA 3NDBB 4B6IA 4BJTA 2J9UA 4U5CE 4Q5SF 2PX0A 4U5EE 3E9VA 4HFFB 3EGXA 2NUPA 3QZCA 1TR2A 2KGOA 3NKDA 5B1AC 3UR3C 4C3BA 3SZRA 3N24A 5KYNA 3H65A 3FAJA 2ZXRA 1FFTC 3JT1A 3ZSUA 4E7SA 4LACB 4DVZA 2HV7A 3T6JA 4AX2A 5DQZA 4LERA 1W2WA 2ZPAA 3DAFA 3ABMC 1TWCA 2DYSC 1VOMA 4DBQA 4EWCA 2PF4E 1D0ZA 4DOZA 5DLJA 4IAOA 1OCCC 2J46A 4BJ1A 4DVYP 4PJLA 3O39A 1BR4A 2WZFA 5E2QA 3HJCA 1ZHYA 3PMRA 1SMYF 2CGEA 3O6XA 5KYXA 3RIPA 2W45A 4K7BA 2W9YA 1OCOC 1D0XA 4GYTA 2YZSA 5DS6A 1D1CA 3OEOA 3HLZA 4JW1A 2E87A 2PFDA 3E70C 2XXAB 3NYLA 3ITFA 4AE4A 3EG9B 1Z23A 2IXMA 4BJ5C 2R7OA 1NU9C 2A69F 3SEOA 3UGPA 4QI2A 5EHHA 3EJNA 3I4UA 3MX3A 4X0RA 5KYYA 1VMAA 1ZHTA 2Q9BA 4OIQF 1M2OA 2FFHA 2R7UA 5F5FA 4XLPF 1D0YA 4CS9C 3K7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO F;  4OIR F;  4G7O F;  4OIN F;  2A6E F;  3EQL F;  2BE5 F;  1KU2 A;  3LEV A;  3DXJ F;  4OIP F;  1IW7 F;  2A6H F;  2A69 F;  3LES A;  2A68 F;  3UGP A;  1SMY F;  2CW0 F;  4Q4Z F;  4G7Z F;  4KI2 A;  4OIQ F;  4Q5S F;  4MQ9 F;  1ZYR F;  4XLP F;  3WOD F;  3UGO A;  4G7H F;  4XLN F; 
#chains in the Genus database with same CATH topology
 4OIO F;  2H7B A;  3Q6M A;  4LDR A;  4U5F E;  4GEH A;  2CDQ A;  2A6E F;  3UMH A;  1ZVZ A;  3JRM O;  3U9J A;  1VK5 A;  3DM5 A;  2J7P A;  5DVW A;  4BJ5 A;  2KYH A;  2QNL A;  3JSZ A;  4PJJ A;  4H4K C;  4QDL A;  2VH3 A;  1LIH A;  2XL4 A;  5EK0 A;  4OIP F;  1D1B A;  1NFO A;  1FR0 A;  1Q0G A;  1I4Y A;  3ASO C;  4MVS A;  1YYJ A;  2NUT A;  2XM4 A;  3SXY A;  2QUP A;  3F47 A;  4J32 B;  2YL3 A;  5A6K A;  2Y3B A;  2Q9C A;  4UDV A;  2KSF A;  4KNW A;  4PK4 A;  3S29 A;  1VLT A;  2XRH A;  1YLM A;  3FHD A;  3LJB A;  3U9M A;  1Z5Z A;  3RKO F;  1R5I D;  4NQF A;  4CS9 A;  5JT4 A;  1H7I A;  4C7O A;  1G5Z A;  2WVO A;  4MQ9 F;  3KH2 A;  4I1M A;  3M79 A;  3WOD F;  5E33 A;  1SR2 A;  5B1B C;  4XLN F;  5B3S C;  1LVK A;  3ECS A;  3POV A;  1XWJ A;  1YA7 O;  2Y3D A;  2KJG A;  1SZI A;  1Q0F A;  4JTC B;  3RQG A;  3I5P A;  1BR1 A;  4JEA A;  1KU2 A;  2G3K A;  3B9Q A;  1TWA A;  2XLE A;  3K1I C;  5L3Q A;  1OKK D;  2WVN A;  4YL1 A;  3B0V C;  2I8B A;  3LEV A;  3TD7 A;  1Q0D A;  1LI5 A;  3X1O A;  1V74 B;  2GA0 A;  4BG0 A;  4ER9 A;  3RQE A;  1MMN A;  2L7A A;  2ZD9 A;  1EI7 A;  2Z15 A;  2EIM C;  3RFY A;  1JMW A;  2VB6 A;  3ZVR A;  1M6T A;  3B0U X;  1DOV A;  4JCH A;  3N0T A;  2JPU A;  5L0G A;  3EFO A;  1J8Y F;  3JYH A;  3MFN A;  1Q0M A;  4DRI B;  1YAR O;  1Q0K A;  2LD6 A;  3LS0 A;  3TJ5 A;  4O79 A;  4XEF A;  3WAQ A;  1BR2 A;  2HS5 A;  1ZYR F;  2LCH A;  1NSG B;  2CNW A;  2J0X A;  3FMS A;  1PD0 A;  3GWL A;  3EGD A;  3LS1 A;  3VRC A;  4QI2 A;  5B3I A;  3DMD A;  2YKZ A;  3S28 A;  2YLG A;  3K1I A;  2R9R B;  2GAQ A;  4YWQ A;  4ONS A;  3K1H A;  4C3E A;  4WGZ A;  3SP1 A;  3EG9 A;  1NU7 D;  3GM1 A;  2XSE A;  4MVO A;  1NG1 A;  3V5X A;  1HMO A;  1RJ9 A;  2ASR A;  2PX3 A;  1I5N A;  2IBF A;  3NMK A;  4I44 A;  5IY5 C;  3AJM A;  3O10 A;  4WJ0 A;  2YWA A;  1OCZ C;  5FCL A;  4CJO A;  3NG1 A;  4U5H A;  2L6F A;  2LIG A;  1RKE A;  4NTB A;  4Z9H A;  2A0U A;  2EPK X;  4IRU A;  4PJM A;  2KC3 A;  2AWY A;  4FAP B;  3OA1 A;  3W8I A;  2QLA A;  3A9C A;  4W8P A;  2J9V A;  3M1C B;  3C18 A;  3C62 A;  3ZC4 A;  4XEV A;  3W2V A;  3Q7L A;  3GOD A;  1H9T A;  2P1A A;  4P6I C;  2DB4 A;  3KKB A;  4H54 A;  2YRF A;  1HE9 A;  2EIJ C;  4OIR F;  1A7D A;  2X0C A;  3EQL F;  2DYR C;  2IXP A;  1MNE A;  2LFF A;  3L34 A;  4YJW A;  4L6R A;  5F28 E;  3DM9 B;  2V3C C;  4K1O A;  3EHM A;  1JOG A;  1OXK A;  4R32 A;  1YA9 A;  4I1O B;  1FTS A;  1FMV A;  4MW3 A;  4YL0 A;  5COG A;  3DXJ F;  1YZC A;  4XPX A;  1J8M F;  1T6Q A;  5EGY A;  2H7V C;  3B0P A;  1XZP A;  4PJN A;  3T6G B;  1AEP A;  3S27 A;  5AC4 A;  1U0B B;  2DGJ A;  4HE8 D;  2OOC A;  4JVS A;  4NC3 A;  4BEM J;  3W8H A;  1SYQ A;  4MND A;  3KL4 A;  4CSA C;  2HSQ A;  2XS8 A;  1LI7 A;  1MMD A;  2R25 A;  1ZW3 A;  1VYI A;  1RKC A;  2MYS A;  4JEB A;  4U5G A;  4ULW A;  1V54 C;  1A7V A;  4MVU A;  2GDC A;  5BUO A;  1JR8 A;  5KYU B;  5DS4 A;  1G8X A;  3GAN A;  4KBL A;  2YL1 A;  1TQG A;  3AOU A;  1AVO B;  3GOR A;  1IZM A;  4IB4 A;  2HJ3 A;  5L3V A;  4CX9 A;  2Y3G A;  4NY3 A;  4YL3 A;  1M2V A;  3LNM B;  1YYX A;  2KNH A;  3GEI A;  1FFH A;  1MMG A;  3BRJ A;  1V55 C;  3IQ5 A;  2ZXW C;  3DE8 A;  3FOO A;  4IGG A;  2EPO A;  4JUR I;  1YZA A;  4EBB A;  3CZ6 A;  3FDQ A;  5L0F A;  1PCX A;  3ZQY A;  1HY5 A;  2OCC C;  3IQ6 A;  1ST6 A;  3L8I A;  5T3W A;  3ZTM A;  3SXM A;  3Q7G A;  5COF A;  2XM0 A;  3G4Z A;  2J45 A;  1MND A;  2YLI A;  2Q7R A;  4PFO A;  5F5H A;  4FWV A;  4XEK A;  1DOW A;  2NUP B;  1VYK A;  1LPE A;  2OEX A;  1CGM E;  1RMV A;  1PV3 A;  2R7S A;  3IEE A;  3ASN C;  4JZA A;  1QVX A;  2KK1 A;  5L0D A;  3PHF 2;  2EIK C;  3NYM A;  4JTD B;  2X51 A;  2MWQ A;  2A1D D;  2G3V A;  2OJE D;  3EZI A;  3FXH A;  1HW1 A;  3AQB A;  3QW0 A;  2LQG A;  2XLW A;  4J7T A;  5HSW A;  2A68 F;  3SYN A;  1SF8 A;  2W4M A;  4KI2 A;  2JX0 A;  3G4X A;  5HV9 A;  5JVE A;  2D4U A;  3G50 A;  3ZWI A;  2XL8 A;  4KNV A;  2R03 A;  2KW3 C;  1H9G A;  2XLD A;  5D91 A;  4E7Z A;  3SXZ A;  5DS5 A;  3AG3 C;  3NYJ A;  1WAS A;  3C8G A;  3ZTZ A;  1Z3I X;  4AK9 A;  4CS8 C;  1VLS A;  2O9X A;  4RDA A;  4ANJ A;  2R7Q A;  4CIH A;  3S84 A;  3JTL O;  3LEO A;  1GQA A;  2YEV A;  4P9T A;  3MYI A;  5A6B A;  3EZH A;  4D4N A;  1WOL A;  3F46 A;  4NCQ A;  1PD1 A;  3L0I A;  4MVQ A;  4YT5 A;  4PAC A;  2OU6 A;  1U6H A;  3JYY A;  5E3C A;  2EPN A;  1YVI A;  3X2Q C;  1YJG A;  1OR2 A;  2HJM A;  3RH3 A;  3T6B A;  4O6Y A;  2A6H F;  1G4W R;  2L81 A;  4A2N B;  2D5R B;  2CW0 F;  5KYX B;  5CI9 A;  1XZQ A;  1O5H A;  2YVK A;  3VM6 A;  1ORS C;  4DBR A;  1T5O A;  3LNR A;  3TUL A;  1L3P A;  2HMQ A;  3ZIB A;  1LM3 B;  2XLH A;  3EHN A;  3UMI A;  1JRA A;  4CS8 A;  1Y4C A;  2KQ9 A;  5K0I A;  1E86 A;  4DXW A;  2H8A A;  1Z6A A;  3AGT A;  1E2X A;  5L0J A;  5KYU A;  2L6G A;  4KC9 A;  2XXA A;  2R7X A;  2BE5 F;  1S7Z A;  3U3B A;  3EPV A;  5L0I A;  3PCV A;  4AE4 B;  1NZE A;  1AUE A;  1G4U S;  2QY9 A;  1ZHX A;  2VCA A;  2Y3H A;  1JAF A;  2BC5 A;  2A0B A;  3OWT A;  2WL8 A;  2R7W A;  1T6I A;  3RVZ A;  1FMW A;  3KMI A;  2CCY A;  3C63 A;  5KYY B;  3DAG A;  2OQM A;  1QPU A;  1HE1 A;  2OKU A;  2ZXP A;  4I3M A;  4ZLC A;  2P61 A;  2AP3 A;  1OQC A;  3ATP A;  3ABL C;  2J9B A;  1UG7 A;  3ABK C;  3DKA A;  3GM2 A;  4OD4 A;  3HTK C;  1RXQ A;  3NKE A;  1EQ1 A;  3UGO A;  3QTH A;  1FNT c;  3KPH A;  1TFO B;  1ORY A;  3K6B A;  2QTV A;  2HUJ A;  2B0H A;  2WZG A;  3TOL A;  2Y39 A;  4YT4 A;  1OCR C;  3B71 A;  4MVR A;  2C04 A;  5GPG B;  3K33 A;  3PDM P;  4OD5 A;  4AL1 A;  4YT2 A;  1K05 A;  1LS1 A;  3I5Q A;  2J7P D;  1RCP A;  2DI3 A;  2J9W A;  2Q4F A;  2RSE B;  1IW7 F;  2XL6 A;  3FAP B;  4BJ6 C;  3V7O A;  3Q6N A;  2NUT B;  1CPR A;  4FES A;  1WGW A;  2WZL A;  5CI8 A;  5FZT A;  4U5D E;  1JPN A;  2C03 A;  4YN0 B;  3MLG A;  2B0J A;  2L6H A;  4CDY A;  2W4B A;  3HNI A;  4FX5 A;  1OXB A;  3HNJ A;  3ZDL A;  1TKN A;  3VAY A;  4C7O B;  4G0H A;  5D92 A;  4LLC A;  4Z9I A;  4XWJ A;  3W4Y A;  1D1A A;  1ORJ A;  3AG1 C;  3N2Z B;  3NRH A;  1Z63 A;  3LLK A;  4C3D A;  2LP4 A;  1VTM P;  1ZU5 A;  4MS2 A;  4O6N A;  4Z9J A;  4JJF A;  3WG7 C;  4CJG A;  3K66 A;  1LKX A;  3AGU A;  3CEX A;  1E84 A;  5T1D B;  1OKK A;  4BEJ A;  2JD3 A;  5A6J A;  3QMK A;  4J7Y A;  4BJ6 A;  2GWW A;  3FVY A;  3LAY A;  5JRA A;  3VYW A;  2V26 A;  2R7T A;  1WTY A;  3HKK A;  2EIN C;  3BEH A;  2H7O A;  2F22 A;  3V5Y A;  2XLO A;  1TWG A;  2VAS A;  3ZG1 A;  2R05 A;  4LLE A;  3RYL A;  1MMA A;  2IXN A;  1GGQ A;  1T9K A;  2M4E A;  4O6M A;  3US6 A;  2P0N A;  1YAU O;  3EFO B;  3S90 A;  4CSA A;  3T4R A;  3IHU A;  2QE9 A;  3TK0 A;  4N06 A;  1C17 M;  1ZHW A;  3UNG C;  1N1C A;  4W8K A;  4N6H A;  3S0X A;  3EGD B;  3EGX B;  3U2M A;  1F1M A;  2CNW D;  4DRJ B;  3CSK A;  4A4A A;  4LDK A;  2IYL D;  4O7G A;  1M57 C;  3JRT A;  5E3A A;  5CIV A;  1YDI A;  2LSE A;  3IQT A;  5BQI A;  5JLI A;  4MTO A;  2HMZ A;  4J30 B;  1TWH A;  4XQ1 A;  2R7V A;  2YL7 A;  4F4B A;  1QLE C;  1RJ9 B;  2UUH A;  1WN0 A;  5L0C A;  1VB5 A;  3EH2 A;  3LES A;  1OW8 A;  2GFH A;  3AG2 C;  4NTF A;  4E0I A;  2NSF A;  2NSG A;  1CGO A;  1O3U A;  2FGY A;  2OEV A;  1ZU4 A;  2OG2 A;  2WVQ A;  3AG4 C;  1K04 A;  3DI5 A;  3DJN B;  3NMJ A;  4K0D A;  1RKE B;  3TOM A;  5DQT A;  1I4Z A;  1FAP B;  2P7V A;  1APC A;  2LFD A;  3C8Z A;  3QW1 A;  3S9O A;  2R7R A;  3UMK A;  2J0W A;  4JCZ A;  3RF3 A;  4HFK B;  4XTK A;  4HEA J;  4G7H F;  5KYW B;  2EIL C;  4JJG A;  3IPM O;  3GWN A;  4CBE A;  2Y69 C;  4IJJ A;  4D4X A;  5BQH A;  2EPL X;  1OW6 A;  4OIN F;  4MTF A;  2YL0 A;  1O87 A;  1QZX A;  1H6G A;  3H2U A;  4NTA A;  4PFP A;  3M4C A;  4YT8 A;  2EPM X;  5JP7 A;  3GM3 A;  4IWB A;  3LLI A;  4CDV A;  4Q7C A;  2NG1 A;  2I15 A;  2J8W A;  1Z7Q c;  5T3T A;  2IXO A;  5KYW A;  4Q4Z F;  4G7Z F;  2PP4 A;  2L9J A;  4U9E A;  4E18 A;  1KTM A;  3DE9 A;  4JKV A;  1LE2 A;  2CYD A;  4M63 A;  4RD9 A;  5COM A;  2AU5 A;  3DD7 A;  3VF0 A;  2BL2 A;  3SNH A;  4RBN A;  1K40 A;  1M56 C;  2HKV A;  4XPW A;  4CS7 A;  1CPQ A;  3CQZ A;  3JZ0 A;  3AQC A;  2ICW G;  3J06 A;  2ZXO A;  2WB7 A;  1CGN A;  3DZA A;  4JRZ A;  4G7O F;  2Q3T A;  2HV6 A;  2PNO A;  3U8P A;  1BBH A;  1ZHZ A;  3ZQV A;  2Q9A A;  1T6U A;  3QVY A;  4MVM A;  1Y6D A;  2P6V A;  4MTG A;  2YLD A;  4CDA A;  4BPM A;  4QI0 A;  3EH1 A;  1HW2 A;  4WGY A;  3CAX A;  1M2V B;  256B A;  2G62 A;  3JCU Q;  4AL0 A;  4ZLD A;  2YHS A;  3M15 A;  2IOQ A;  1JPJ A;  5JSL A;  1V4A A;  4U5B E;  3DJU B;  3W2W A;  4JC7 A;  1NLX A;  1EA8 A;  2NPU A;  1A7E A;  1UFB A;  3LUT B;  1WAT A;  1C02 A;  4CIP A;  3KYI A;  4B6I A;  2HFI A;  4EHP A;  4BJT A;  4N6C A;  2J9U A;  4U5C E;  3RVY A;  4Q5S F;  3R2P A;  2PX0 A;  2RD9 A;  4U5E E;  1U89 A;  3E9V A;  4LDQ A;  3FOP A;  4HFF B;  4G78 A;  2AWC A;  3EGX A;  4E17 A;  2NUP A;  3R7C A;  3QZC A;  1S05 A;  1TR2 A;  5JUA A;  2KGO A;  3H2V A;  4MVZ A;  4EBJ A;  3L1M A;  3A11 A;  3NKD A;  5B1A C;  3UR3 C;  3MBG A;  4C3B A;  3SZR A;  4JIO A;  3KYJ A;  3N24 A;  3QVZ A;  5KYN A;  4GQH A;  5L0H A;  1QKR A;  3H65 A;  1NBB A;  3B29 A;  2ZXR A;  3FAJ A;  2MHR A;  1FFT C;  1MQV A;  1TFK B;  3JT1 A;  3ZSU A;  4E7S A;  3GEE A;  1B68 A;  2VC9 A;  2PBE A;  4LAC B;  4DVZ A;  3HNL A;  3U0C A;  2HV7 A;  3T6J A;  4AX2 A;  3O55 A;  5DQZ A;  4LER A;  1W2W A;  2ZPA A;  3DAF A;  3ABM C;  5A69 A;  1E83 A;  2XLM A;  1TWC A;  3JSE O;  3TQO A;  2DYS C;  4N4W A;  1VOM A;  4DBQ A;  3C8G B;  3TJ6 A;  4DRH B;  1QSP A;  4DJ9 A;  1A41 A;  3C7J A;  4EUK B;  4EWC A;  1EKY A;  2PF4 E;  1D0Z A;  3C8G D;  1A0B A;  4DOZ A;  5DLJ A;  5JS5 A;  2LK4 A;  3T9O A;  3MYF A;  4IAO A;  1GM5 A;  1OCC C;  3IQC A;  1KNY A;  5A6A A;  5A6B D;  2TMV P;  2J46 A;  4EBK A;  3M4B A;  4BJ1 A;  4PJL A;  4DVY P;  3O39 A;  1BDJ B;  1BR4 A;  2FAP B;  2WZF A;  3HJC A;  5E2Q A;  2XLV A;  1GS9 A;  1ZHY A;  2UUI A;  3L8J A;  3PMR A;  1BZ4 A;  1SMY F;  2CGE A;  4WAB A;  3O6X A;  4ULV A;  1R4T A;  5BQG A;  4XPY A;  3U2L A;  5KYX A;  3V5Z A;  4IAR A;  3RIP A;  3NMI A;  2YQY A;  2W45 A;  2IM8 A;  2VCC A;  2VCB A;  2W9Y A;  1OCO C;  4K7B A;  3HNK A;  1D0X A;  4GYT A;  2YZS A;  5DS6 A;  1D1C A;  3OEO A;  3HLZ A;  4JW1 A;  2E87 A;  1WWP A;  2PFD A;  3E70 C;  1ZW2 A;  4EIY A;  2XXA B;  2ETS A;  4U9D A;  3NYL A;  4E0H A;  4PR9 A;  2AVK A;  1NFN A;  1OW7 A;  1C03 A;  3ITF A;  4IAQ A;  4AE4 A;  4YK5 A;  3U8V A;  3EG9 B;  4EKW A;  1Z23 A;  2IXM A;  1LS4 A;  3RQF A;  4BJ5 C;  4JTA B;  3NDB B;  3U3F A;  2M64 A;  2R7O A;  1NU9 C;  2A69 F;  1T01 A;  2HZ8 A;  2R02 A;  2XS1 A;  2Q00 A;  3GEH A;  4P9F A;  2HSB A;  1L7C A;  3SEO A;  5EHH A;  3EJN A;  1E85 A;  3I4U A;  3UGP A;  3DWW A;  1LE4 A;  3MX3 A;  4JE9 A;  4X0R A;  3WHN A;  5AC5 A;  1OR3 A;  1VMA A;  1ZHT A;  2Q9B A;  3U5S A;  5KYY A;  3RW0 A;  4OIQ F;  5TJ5 E;  1M2O A;  2FFH A;  2R7U A;  4MW8 A;  5F5F A;  5AGF A;  4XLP F;  1HMD A;  1D0Y A;  1ZZP A;  4CS9 C;  3SXK A;  1QQ3 A;  3K7D A;  2OJQ A; 
#chains in the Genus database with same CATH homology
 4OIO F;  2H7B A;  4U5F E;  4GEH A;  2CDQ A;  2A6E F;  3UMH A;  1VK5 A;  3DM5 A;  2J7P A;  5DVW A;  4BJ5 A;  3JSZ A;  4PJJ A;  4H4K C;  4QDL A;  2VH3 A;  2XL4 A;  4OIP F;  1D1B A;  3ASO C;  2NUT A;  3F47 A;  4J32 B;  2Y3B A;  2Q9C A;  4KNW A;  4PK4 A;  3S29 A;  2XRH A;  3LJB A;  3FHD A;  1Z5Z A;  3RKO F;  4CS9 A;  4C7O A;  2WVO A;  4MQ9 F;  3KH2 A;  4I1M A;  3WOD F;  5E33 A;  5B1B C;  4XLN F;  5B3S C;  1LVK A;  3ECS A;  3POV A;  2Y3D A;  2KJG A;  1SZI A;  3I5P A;  1BR1 A;  1KU2 A;  2G3K A;  3B9Q A;  1TWA A;  3K1I C;  5L3Q A;  1OKK D;  2WVN A;  3B0V C;  2I8B A;  3LEV A;  3TD7 A;  3X1O A;  4BG0 A;  1MMN A;  2Z15 A;  2EIM C;  3RFY A;  2VB6 A;  3ZVR A;  3B0U X;  4JCH A;  3N0T A;  3EFO A;  1J8Y F;  3JYH A;  3LS0 A;  4O79 A;  1BR2 A;  1ZYR F;  2CNW A;  2J0X A;  3LS1 A;  1PD0 A;  3EGD A;  3DMD A;  3S28 A;  4YWQ A;  3K1H A;  4C3E A;  3SP1 A;  3EG9 A;  1NU7 D;  2XSE A;  1NG1 A;  1RJ9 A;  2PX3 A;  4I44 A;  5IY5 C;  4WJ0 A;  1OCZ C;  5FCL A;  3NG1 A;  4U5H A;  4IRU A;  4PJM A;  3OA1 A;  3W8I A;  2J9V A;  3M1C B;  3ZC4 A;  3W2V A;  3Q7L A;  3GOD A;  4P6I C;  3KKB A;  5KYW A;  4OIR F;  2EIJ C;  3EQL F;  2DYR C;  2IXP A;  1MNE A;  3L34 A;  4YJW A;  2V3C C;  3DM9 B;  3EHM A;  4I1O B;  1FTS A;  1FMV A;  3DXJ F;  1J8M F;  5EGY A;  2H7V C;  3B0P A;  4PJN A;  3S27 A;  2DGJ A;  4HE8 D;  4JVS A;  3W8H A;  4MND A;  3KL4 A;  4CSA C;  1MMD A;  2MYS A;  1VYI A;  4U5G A;  4ULW A;  1V54 C;  5BUO A;  5KYU B;  5DS4 A;  1G8X A;  3GAN A;  4KBL A;  1IZM A;  5L3V A;  2Y3G A;  4NY3 A;  1M2V A;  2KNH A;  1FFH A;  1MMG A;  1V55 C;  2ZXW C;  4JUR I;  4EBB A;  3CZ6 A;  3FDQ A;  1PCX A;  2OCC C;  5T3W A;  1ST6 A;  3Q7G A;  2J45 A;  1MND A;  4PFO A;  5F5H A;  4FWV A;  2NUP B;  1VYK A;  2R7S A;  3IEE A;  3ASN C;  4JZA A;  3PHF 2;  2EIK C;  3NYM A;  2X51 A;  2MWQ A;  2A1D D;  2G3V A;  3EZI A;  3AQB A;  5HSW A;  2A68 F;  3SYN A;  1SF8 A;  2W4M A;  4KI2 A;  4KNV A;  2KW3 C;  5D91 A;  4E7Z A;  5DS5 A;  3AG3 C;  3NYJ A;  1Z3I X;  4AK9 A;  4CS8 C;  2O9X A;  4ANJ A;  4RDA A;  2R7Q A;  4CIH A;  2YEV A;  3EZH A;  3F46 A;  1PD1 A;  3L0I A;  4YT5 A;  5E3C A;  3X2Q C;  3RH3 A;  3T6B A;  4O6Y A;  2A6H F;  2L81 A;  4A2N B;  2D5R B;  2CW0 F;  5KYX B;  5CI9 A;  1O5H A;  4DBR A;  3LNR A;  3ZIB A;  3UMI A;  3EHN A;  4CS8 A;  2KQ9 A;  1Z6A A;  5KYU A;  4KC9 A;  2XXA A;  2R7X A;  2BE5 F;  1S7Z A;  3EPV A;  4AE4 B;  1NZE A;  2QY9 A;  1ZHX A;  2Y3H A;  3OWT A;  2WL8 A;  2R7W A;  1FMW A;  3KMI A;  5KYY B;  3DAG A;  2ZXP A;  4I3M A;  4ZLC A;  3ABL C;  3ABK C;  4OD4 A;  3HTK C;  3NKE A;  3UGO A;  3K6B A;  2QTV A;  2WZG A;  2Y39 A;  4YT4 A;  1OCR C;  2C04 A;  3K33 A;  4OD5 A;  4YT2 A;  1LS1 A;  3I5Q A;  2J7P D;  2J9W A;  1IW7 F;  4BJ6 C;  3V7O A;  3Q6N A;  2NUT B;  4FES A;  5CI8 A;  1WGW A;  2WZL A;  4U5D E;  1JPN A;  2C03 A;  4YN0 B;  3MLG A;  2B0J A;  2W4B A;  4FX5 A;  1TKN A;  3VAY A;  4C7O B;  4G0H A;  5D92 A;  4LLC A;  4XWJ A;  1D1A A;  3AG1 C;  3N2Z B;  3NRH A;  1Z63 A;  3LLK A;  4C3D A;  1ZU5 A;  4O6N A;  3WG7 C;  4JJF A;  3K66 A;  1LKX A;  5T1D B;  1OKK A;  4BEJ A;  2JD3 A;  3QMK A;  4BJ6 A;  3LAY A;  3FVY A;  3VYW A;  2V26 A;  2R7T A;  2EIN C;  2H7O A;  3ZG1 A;  1TWG A;  2VAS A;  4LLE A;  3RYL A;  1MMA A;  2IXN A;  2M4E A;  4O6M A;  3EFO B;  4CSA A;  3T4R A;  4N06 A;  1ZHW A;  3UNG C;  1N1C A;  4W8K A;  3S0X A;  3EGD B;  3EGX B;  2CNW D;  3CSK A;  2IYL D;  4O7G A;  1M57 C;  3JRT A;  5E3A A;  2LSE A;  4J30 B;  1TWH A;  4F4B A;  1QLE C;  1RJ9 B;  3EH2 A;  3LES A;  2GFH A;  3AG2 C;  3Q6M A;  2WVQ A;  2FGY A;  3AG4 C;  1ZU4 A;  2OG2 A;  3DJN B;  5DQT A;  4K0D A;  2P7V A;  2R7R A;  3UMK A;  2J0W A;  4HFK B;  4XTK A;  4HEA J;  4G7H F;  5KYW B;  2EIL C;  4JJG A;  4CBE A;  2R7V A;  2Y69 C;  4IJJ A;  4OIN F;  1O87 A;  1QZX A;  4PFP A;  4YT8 A;  4IWB A;  3LLI A;  4Q7C A;  2NG1 A;  5T3T A;  2IXO A;  4Q4Z F;  4G7Z F;  2PP4 A;  2L9J A;  4M63 A;  4RD9 A;  3DD7 A;  3SNH A;  4RBN A;  1M56 C;  4CS7 A;  3CQZ A;  3AQC A;  2ZXO A;  2WB7 A;  3DZA A;  4G7O F;  2Q3T A;  2HV6 A;  1ZHZ A;  2Q9A A;  2P6V A;  4QI0 A;  3EH1 A;  1M2V B;  2G62 A;  3JCU Q;  4ZLD A;  2YHS A;  2IOQ A;  1JPJ A;  4U5B E;  3DJU B;  3W2W A;  3NDB B;  4B6I A;  4BJT A;  2J9U A;  4U5C E;  4Q5S F;  2PX0 A;  4U5E E;  3E9V A;  4HFF B;  3EGX A;  2NUP A;  3QZC A;  1TR2 A;  2KGO A;  3NKD A;  5B1A C;  3UR3 C;  4C3B A;  3SZR A;  3N24 A;  5KYN A;  3H65 A;  3FAJ A;  2ZXR A;  1FFT C;  3JT1 A;  3ZSU A;  4E7S A;  4LAC B;  4DVZ A;  2HV7 A;  3T6J A;  4AX2 A;  5DQZ A;  4LER A;  1W2W A;  2ZPA A;  3DAF A;  3ABM C;  1TWC A;  2DYS C;  1VOM A;  4DBQ A;  4EWC A;  2PF4 E;  1D0Z A;  4DOZ A;  5DLJ A;  4IAO A;  1OCC C;  2J46 A;  4BJ1 A;  4DVY P;  4PJL A;  3O39 A;  1BR4 A;  2WZF A;  5E2Q A;  3HJC A;  1ZHY A;  3PMR A;  1SMY F;  2CGE A;  3O6X A;  5KYX A;  3RIP A;  2W45 A;  4K7B A;  2W9Y A;  1OCO C;  1D0X A;  4GYT A;  2YZS A;  5DS6 A;  1D1C A;  3OEO A;  3HLZ A;  4JW1 A;  2E87 A;  2PFD A;  3E70 C;  2XXA B;  3NYL A;  3ITF A;  4AE4 A;  3EG9 B;  1Z23 A;  2IXM A;  4BJ5 C;  2R7O A;  1NU9 C;  2A69 F;  3SEO A;  3UGP A;  4QI2 A;  5EHH A;  3EJN A;  3I4U A;  3MX3 A;  4X0R A;  5KYY A;  1VMA A;  1ZHT A;  2Q9B A;  4OIQ F;  1M2O A;  2FFH A;  2R7U A;  5F5F A;  4XLP F;  1D0Y A;  4CS9 C;  3K7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...