4KI2A

Crystallographic analysis of an rna-polymerase sigma-subunit fragment complexed with -10 promoter element ssdna
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
178
structure length
178
Chain Sequence
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*CP*AP*AP*TP*GP*GP*G)-3')
publication title Crystallographic analysis of an RNA polymerase sigma-subunit fragment complexed with -10 promoter element ssDNA: quadruplex formation as a possible tool for engineering crystal contacts in protein-ssDNA complexes.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 65
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ki2A00
2A6HF 4KI2A 3UGOA 4XLPF 2A69F 4OINF 2A68F 3UGPA 4OIOF 3LEVA 1IW7F 4XLNF 3LESA 4Q4ZF 3WODF 1SMYF 1KU2A 2BE5F 4G7ZF 4OIRF 3DXJF 4OIQF 4OIPF 4G7OF 3EQLF 4G7HF 4Q5SF 2CW0F 2A6EF 1ZYRF 4MQ9F
chains in the Genus database with same CATH superfamily
4MVRA 4WGZA 1IZMA 3G4XA 4YL3A 5DVWA 2KGOA 4IAOA 4RDAA 4U5CE 3ZDLA 5B3IA 2EPNA 1GS9A 3ASNC 3HKKA 3KH2A 3T4RA 1T6QA 2X51A 2G3VA 1FR0A 1NFOA 4EBJA 2OJED 2OEVA 2ICWG 4G78A 5JP7A 3WODF 2C03A 5GPGB 1KU2A 2HMQA 4YT4A 3K6BA 1VYKA 2KJGA 2HMZA 3LS1A 2DB4A 4XPYA 3O10A 2R7OA 2L6FA 1ZHTA 4HE8D 4LDQA 4ULVA 3VM6A 3FOOA 1I4YA 1LS1A 2LFDA 3ZWIA 2LQGA 4ULWA 1OCOC 2XLHA 1RCPA 3QW0A 4NY3A 2VCAA 3OEOA 1YAUO 1G4WR 4YWQA 2KW3C 2WVOA 3N2ZB 4YT5A 1VMAA 4XWJA 2J46A 4EIYA 5AC4A 1YYJA 4F4BA 3O6XA 4O6YA 1VLSA 5D91A 1EKYA 5JUAA 4XEVA 2YRFA 1F1MA 2HJMA 2J0WA 3M79A 4NC3A 4NTAA 3LEVA 1CGOA 2CDQA 2PX0A 3DZAA 3MYFA 4C3EA 2IYLD 3U8VA 5L0HA 1K04A 1K05A 1BBHA 2DGJA 4H54A 1ORYA 3N24A 3TOLA 3RKOF 1OW7A 3AQCA 1FAPB 1YZAA 4J7YA 4JE9A 4YL0A 3U2LA 1YVIA 2HFIA 4OD4A 1TWAA 2EINC 3RYLA 2AU5A 2DI3A 3HNKA 5FZTA 2L7AA 3I5QA 4AE4A 2PP4A 1HE9A 2XL6A 3F47A 2Q3TA 3SNHA 3K1IA 1TWHA 4CSAC 1Z63A 2Q9AA 2H7VC 3L34A 3M4CA 1U0BB 2R02A 4MVMA 1FNTc 4G7HF 3HNLA 3V7OA 3ZSUA 4Q5SF 2A6EF 3TOMA 3I5PA 4DOZA 1MNEA 1NSGB 4PJNA 2YLDA 3U8PA 4CDAA 4EBKA 2A0UA 3EGXB 1ZHXA 4U5FE 4KC9A 4Z9IA 1OR3A 2Y3DA 1SR2A 3RIPA 1OKKD 3EJNA 2LCHA 3C18A 4IB4A 5BQIA 4MW3A 1OCZC 3VRCA 2NUTA 2KNHA 1GQAA 1OQCA 2O9XA 1MMAA 1CPRA 1D0XA 1J8MF 2CNWA 2D5RB 2ZXWC 3QVYA 4GEHA 3VAYA 4H4KC 5A6BA 2HSBA 2OEXA 4NTFA 3IPMO 1QSPA 2H8AA 3N0TA 3B9QA 4NQFA 3S90A 2GDCA 4IWBA 2KYHA 4BJ6A 2W45A 2XLDA 4ANJA 2LK4A 1C02A 1BR1A 2NG1A 3R2PA 3SXKA 1T6IA 3X2QC 5KYYB 5JVEA 3U0CA 4O7GA 3BRJA 3DKAA 2R25A 3HJCA 3LLKA 3MLGA 3ZC4A 2CNWD 5DLJA 1H6GA 1RMVA 4IRUA 4XPWA 4N6CA 4BJTA 1T01A 2J7PA 3GANA 3EZIA 4JIOA 4JURI 5CI8A 3SP1A 4K1OA 1M6TA 5CIVA 3X1OA 4YN0B 3JYHA 3K33A 3V5YA 4YK5A 1SZIA 3GEHA 3IQTA 3EGXA 3TK0A 2YL7A 3W2WA 4CSAA 3LUTB 4MVQA 4D4NA 4Q4ZF 2MWQA 2ZPAA 3JTLO 1YLMA 1LE2A 1FFTC 4PACA 1ST6A 1CGNA 2QY9A 1FMVA 4YT2A 2HUJA 1TKNA 4U5GA 1M2OA 3DXJF 2C04A 1K40A 2I15A 5BQHA 3KKBA 2W4MA 4MTOA 4J7TA 1S05A 2AP3A 2QLAA 2L6GA 3FAJA 2QNLA 4AL0A 2DYRC 2WZLA 4K7BA 3PDMP 1JAFA 1TFOB 4ZLDA 1LI5A 2P7VA 2QE9A 4MVZA 3ABMC 5L3QA 1HW2A 4C3BA 1APCA 3SXZA 4U5EE 1OCRC 1YJGA 5A6AA 1QPUA 4E18A 3W8IA 1QLEC 3ZIBA 3L8IA 1E2XA 4PJLA 4CJOA 1M2VB 4YJWA 2LD6A 2B0HA 2EPOA 3Q6NA 2XS8A 3U5SA 2CGEA 3TD7A 4U5HA 2PNOA 4DRJB 3ZTMA 1GGQA 4U5BE 4MNDA 3GEIA 1Z23A 2IXPA 2VC9A 5COGA 5AC5A 5T3WA 3GEEA 5L0FA 3H2VA 2Q4FA 5COFA 1ORJA 2NPUA 4KBLA 5T1DB 2P6VA 3DMDA 3AG4C 2CW0F 3H65A 1NU9C 1NU7D 4XEKA 4MTFA 1V54C 3W4YA 5DQTA 4Z9JA 3GODA 1T5OA 4KNVA 4OINF 3RF3A 1ZHZA 2Y3GA 1PD1A 5IY5C 2FAPB 5JLIA 2R7UA 3LEOA 5EHHA 3CZ6A 4K0DA 2QUPA 2UUIA 3K66A 1MMNA 1JR8A 2NSFA 2NUPB 3B29A 1JMWA 3C8GD 3OWTA 4GQHA 2YZSA 3RQGA 3S27A 1JOGA 3LNRA 3FDQA 3QTHA 5EGYA 1R5ID 3NG1A 2VCCA 1AVOB 4PFPA 1ZU5A 2EPKX 4CBEA 3UR3C 1OW6A 3NKEA 4PFOA 3ZQYA 4C7OB 4RD9A 4AK9A 4FAPB 4BJ5C 4OIQF 4U9DA 2OG2A 3T9OA 1W2WA 4I1MA 5KYUA 3ATPA 3WHNA 2WL8A 3RH3A 4PK4A 4U9EA 3T6BA 4QDLA 3DE8A 5F28E 4BPMA 5KYXA 2VASA 1HMDA 2R05A 1A7EA 3UGOA 3LNMB 4CS9C 5A6JA 4LLEA 4FX5A 4GYTA 1E86A 1LI7A 1LKXA 3S0XA 4OIOF 1N1CA 4XPXA 2BC5A 3IQCA 5DS5A 3NRHA 4QI0A 1O3UA 4HEAJ 3U3FA 3WAQA 5B1BC 1NFNA 4ZLCA 4I3MA 4E17A 2R7RA 3AQBA 2EPLX 5A6KA 4E7ZA 3EG9B 3UMHA 3A11A 3AGTA 5HV9A 1ZHWA 5E2QA 2HV7A 2LSEA 1O87A 2WZFA 1HE1A 3MFNA 5A69A 3FAPB 3SXMA 5JT4A 4Q7CA 4C7OA 2J45A 4MS2A 2A0BA 2P0NA 3DAGA 4XTKA 5BUOA 3QZCA 4MQ9F 3EHNA 1G8XA 4MVOA 1E85A 5KYWB 4R32A 3S9OA 1RKEB 3RVYA 1WGWA 2NSGA 2Y39A 3TJ5A 3V5ZA 5COMA 3I4UA 3B71A 1IW7F 1T9KA 4FWVA 2PFDA 1D0ZA 2Q9BA 4I1OB 4DRIB 1LE4A 4E0HA 4G0HA 1E84A 4U5DE 2JD3A 3US6A 3U3BA 4A4AA 2KQ9A 3GWNA 4N4WA 1QZXA 2IXOA 2ZXRA 4XEFA 3UNGC 3TULA 2AWCA 4JEBA 2HV6A 1KTMA 3EG9A 2HKVA 4WGYA 5E33A 3AG1C 1VB5A 2LP4A 3CEXA 3DM5A 4PJJA 2B0JA 1TR2A 1Q0DA 2DYSC 4CJGA 3A9CA 5K0IA 2XL8A 2EIKC 2J8WA 2Q00A 4UDVA 5A6BD 1L7CA 2IXMA 1YA7O 4KNWA 3SEOA 3JT1A 4AX2A 3NDBB 3AJMA 3FMSA 2FFHA 2A69F 1OXBA 4DVZA 2RSEB 2P61A 3OA1A 2R7QA 3EGDB 1RJ9B 2R7SA 4ER9A 3O39A 1CPQA 1RKEA 2HZ8A 1JRAA 2GFHA 4B6IA 4J32B 1C17M 2L81A 3JRMO 3NKDA 1ZHYA 3NMJA 2J7PD 3HLZA 1U89A 2Y3HA 1HW1A 2R7WA 3FXHA 4JRZA 1VOMA 4LLCA 5B3SC 1C03A 3B0VC 4YL1A 5L0JA 3RQFA 4XQ1A 1VYIA 2Z15A 4ONSA 3ZTZA 1G4US 1FFHA 1V4AA 4AL1A 3W2VA 2YL0A 1U6HA 3PHF2 4P6IC 3Q6MA 2WVNA 3EQLF 3NYJA 2YL3A 4MVUA 2JX0A 2PX3A 2EILC 4DBQA 4QI2A 5KYYA 1WATA 2YVKA 5T3TA 2MYSA 2EIJC 4LERA 3EFOB 2YLIA 4E0IA 1LM3B 1O5HA 1VLTA 2ZD9A 3KMIA 4BJ5A 1LS4A 2E87A 2G3KA 4CIPA 1FTSA 3DAFA 4P9TA 1WOLA 4D4XA 1ORSC 4E7SA 2I8BA 3EGDA 2HS5A 2OQMA 3L0IA 1M57C 2J0XA 4JTAB 2R7VA 4CIHA 2J9VA 1YYXA 1XZQA 1D0YA 1HMOA 3JRTA 4BG0A 4CS9A 5KYNA 4MW8A 2IOQA 3C7JA 4MVSA 1LIHA 3QMKA 3R7CA 2G62A 5DS6A 1T6UA 3DI5A 3W8HA 4O6NA 1LPEA 2TMVP 2XXAB 3AG3C 3ABLC 1WASA 1TQGA 1AUEA 2M64A 3EZHA 4IAQA 3AG2C 2GA0A 3GORA 3DJUB 3ASOC 3DWWA 3NMKA 4M63A 2Y69C 3L8JA 4JKVA 1VTMP 1ZW3A 1MNDA 1ZVZA 3G50A 1WN0A 1A41A 2J9WA 4JC7A 5B1AC 3U2MA 3T6GB 4O79A 2J9UA 4BEJA 3NMIA 3ZG1A 3DJNB 1I4ZA 2ASRA 5JS5A 5HSWA 3J06A 4G7ZF 2YLGA 2EPMX 1JPNA 1H9TA 2UUHA 1SYQA 1M2VA 1ZW2A 3EHMA 2LFFA 2XL4A 3S84A 2KSFA 4HFFB 3LLIA 4JCZA 1I5NA 1S7ZA 1QVXA 1TWGA 2OCCC 2F22A 2XRHA 1A7VA 2XLEA 3MYIA 3LAYA 4X0RA 1MMGA 1ZYRF 3EH2A 3F46A 3IQ5A 2HJ3A 4DBRA 1LVKA 2YHSA 3KYIA 1Y4CA 1ZZPA 1RXQA 3UGPA 3POVA 4LACB 4CS8C 4JCHA 1EQ1A 2RD9A 4DJ9A 2XLVA 1E83A 1WTYA 2XLOA 4NTBA 2A1DD 2W4BA 2WVQA 2LIGA 4AE4B 3SXYA 3UMKA 2NUPA 4J30B 3WG7C 3U9JA 4DXWA 1MQVA 4FESA 1B68A 3ZQVA 3T6JA 2VB6A 2M4EA 2XM0A 4JEAA 3CAXA 1XZPA 2GWWA 1DOVA 5JRAA 1BR4A 1QQ3A 2ETSA 3GM2A 4CS7A 4I44A 3JCUQ 1Z6AA 3CQZA 2CYDA 3DD7A 2YKZA 4JTCB 3VF0A 1Q0KA 2NUTB 4XLPF 1J8YF 1Y6DA 2JPUA 1OXKA 1KNYA 3Q7GA 3HTKC 3DE9A 4EKWA 1CGME 4XLNF 2OU6A 3KYJA 3LESA 2D4UA 2L6HA 1NG1A 1V55C 4LDKA 4W8KA 1TWCA 2H7OA 1SMYF 3K7DA 1HY5A 2IXNA 2BE5F 5L0IA 4IGGA 256BA 1NBBA 3JSZA 2Y3BA 2OOCA 3AOUA 4JW1A 1H7IA 5D92A 1D1AA 1OKKA 2OKUA 1Q0MA 4OIPF 4JVSA 2IBFA 3O55A 4JJGA 3RVZA 1A7DA 1D1CA 2R9RB 4PR9A 5BQGA 3UMIA 1WWPA 1MMDA 3IQ6A 3G4ZA 5EK0A 2PF4E 4EUKB 2W9YA 2A6HF 3M1CB 4KI2A 3JSEO 1A0BA 2XS1A 4L6RA 4P9FA 3RW0A 3E9VA 2YQYA 3GWLA 4O6MA 3U9MA 2V3CC 1VK5A 2R03A 1OR2A 2YL1A 3DM9B 3ECSA 1H9GA 3EH1A 5KYWA 1TFKB 2ZXPA 2X0CA 5L0DA 2L9JA 1YZCA 2PBEA 2EIMC 2XSEA 1YARO 3PCVA 5F5FA 4MTGA 1Z5ZA 5FCLA 5E3AA 4Z9HA 3SYNA 3FVYA 5DS4A 1YDIA 1Z3IX 2BL2A 3HNIA 4DRHB 2XM4A 3BEHA 2V26A 2WB7A 1BDJB 3MBGA 1Q0GA 3QVZA 3FHDA 3GM1A 5AGFA 3ITFA 4G7OF 1UFBA 2Q9CA 5L0GA 5DQZA 1EA8A 1BR2A 2AVKA 5TJ5E 3HNJA 3ZVRA 1BZ4A 1M56C 4LDRA 4RBNA 3LJBA 4PJMA 5CI9A 4NCQA 1PD0A 4CDVA 2HSQA 3LS0A 4IJJA 3RFYA 4EHPA 4EBBA 1YA9A 4YT8A 4JZAA 1PCXA 3K1IC 1RKCA 3M4BA 1RJ9A 1V74B 3IHUA 1DOWA 3EPVA 3QW1A 2QTVA 3S28A 3C8GB 3K1HA 2GAQA 4BJ1A 2VCBA 2OJQA 2VH3A 1L3PA 4HFKB 1G5ZA 2FGYA 3GM3A 3B0UX 4A2NB 1PV3A 3C63A 1GM5A 4CS8A 3PMRA 3JZ0A 2YEVA 3C62A 2Q7RA 3S29A 2R7XA 1NZEA 1QKRA 2WZGA 3B0PA 4EWCA 3FOPA 2XLMA 1ZU4A 2P1AA 4WABA 4IARA 4CX9A 1Z7Qc 2A68F 2KC3A 2XLWA 4BJ6C 4W8PA 1R4TA 1NLXA 1OW8A 2AWYA 2YWAA 3Q7LA 4JTDB 4OD5A 5E3CA 3IEEA 5F5HA 3KL4A 4BEMJ 2CCYA 3L1MA 4N06A 3EFOA 3M15A 3CSKA 5L3VA 3E70C 3NYMA 4N6HA 2R7TA 2J9BA 3JYYA 4DVYP 1AEPA 1SF8A 2MHRA 1EI7A 3V5XA 1Q0FA 4C3DA 5KYUB 3ABKC 4OIRF 1FMWA 1OCCC 2IM8A 2KK1A 4JJFA 5L0CA 3TQOA 5KYXB 2ZXOA 3MX3A 3C8GA 3TJ6A 1XWJA 1D1BA 3H2UA 4CDYA 3RQEA 1JPJA 1UG7A 2H7BA 4WJ0A 5JSLA 3SZRA 3KPHA 3VYWA 3AGUA 3C8ZA 2XXAA 3NYLA
chains in the Genus database with same CATH topology
1IZMA 5DVWA 2KGOA 4IAOA 4RDAA 4U5CE 3ASNC 3KH2A 3T4RA 2X51A 2G3VA 3WODF 2C03A 1KU2A 4YT4A 3K6BA 1VYKA 2KJGA 3LS1A 2R7OA 1ZHTA 4HE8D 1LS1A 4ULWA 1OCOC 4NY3A 3OEOA 4YWQA 2KW3C 2WVOA 3N2ZB 4YT5A 1VMAA 4XWJA 2J46A 4F4BA 3O6XA 4O6YA 5D91A 2J0WA 3LEVA 2CDQA 3DZAA 2PX0A 4C3EA 2IYLD 2DGJA 3N24A 3RKOF 3AQCA 4OD4A 1TWAA 2EINC 3RYLA 3I5QA 4AE4A 2PP4A 3F47A 2Q3TA 3SNHA 4CSAC 1TWHA 1Z63A 2Q9AA 2H7VC 3L34A 4G7HF 3V7OA 3ZSUA 4Q5SF 2A6EF 3I5PA 4DOZA 1MNEA 4PJNA 3EGXB 1ZHXA 4U5FE 4KC9A 2Y3DA 3RIPA 1OKKD 3EJNA 1OCZC 2NUTA 2KNHA 3UNGC 2O9XA 1MMAA 1D0XA 2CNWA 1J8MF 4GEHA 2D5RB 2ZXWC 3VAYA 4H4KC 3N0TA 3B9QA 4IWBA 4BJ6A 2W45A 4ANJA 1BR1A 2NG1A 3X2QC 5KYYB 4O7GA 3HJCA 3LLKA 3MLGA 3ZC4A 2CNWD 5DLJA 4IRUA 4BJTA 3GANA 2J7PA 4JURI 3EZIA 3SP1A 5CI8A 3X1OA 4YN0B 3JYHA 3K33A 1SZIA 3EGXA 3W2WA 4Q4ZF 2MWQA 2ZPAA 1FFTC 1ST6A 2QY9A 4YT2A 1FMVA 1TKNA 4U5GA 1M2OA 3DXJF 2C04A 3KKBA 2W4MA 3FAJA 2DYRC 2WZLA 4K7BA 4ZLDA 2P7VA 5L3QA 3ABMC 4C3BA 4U5EE 1OCRC 3W8IA 1QLEC 3ZIBA 4PJLA 1M2VB 4YJWA 3Q6NA 2CGEA 3TD7A 4U5HA 4U5BE 4MNDA 1Z23A 2IXPA 5T3WA 4KBLA 5T1DB 2P6VA 3DMDA 3H65A 2CW0F 3AG4C 1NU9C 1NU7D 1V54C 5DQTA 3GODA 4KNVA 4OINF 2R7UA 1ZHZA 2Y3GA 1PD1A 5IY5C 5EHHA 3CZ6A 4K0DA 3K66A 1MMNA 2NUPB 4CSAA 3OWTA 3S27A 2YZSA 3LNRA 3FDQA 5EGYA 3NG1A 4PFPA 1ZU5A 4CBEA 3UR3C 3NKEA 4PFOA 4C7OB 4RD9A 4AK9A 4BJ5C 4OIQF 2OG2A 1W2WA 4I1MA 5KYUA 2WL8A 3RH3A 4PK4A 3T6BA 4QDLA 5KYXA 2VASA 3UGOA 4CS9C 4LLEA 4FX5A 4GYTA 1LKXA 3S0XA 4OIOF 1N1CA 5DS5A 3NRHA 4QI0A 4HEAJ 5B1BC 4ZLCA 4I3MA 2R7RA 3AQBA 4E7ZA 3EG9B 3UMHA 1ZHWA 5E2QA 2HV7A 2LSEA 1O87A 2WZFA 4Q7CA 4C7OA 2J45A 3DAGA 4XTKA 5BUOA 3QZCA 4MQ9F 3EHNA 1G8XA 5KYWB 1WGWA 2Y39A 3I4UA 1IW7F 4FWVA 2PFDA 1D0ZA 2Q9BA 4I1OB 4G0HA 4U5DE 2JD3A 2KQ9A 1QZXA 2IXOA 2ZXRA 2HV6A 3EG9A 5E33A 3AG1C 3DM5A 4PJJA 2B0JA 1TR2A 2DYSC 2EIKC 3SEOA 2IXMA 4KNWA 4AX2A 3NDBB 3JT1A 2FFHA 2A69F 4DVZA 3OA1A 2R7QA 3EGDB 1RJ9B 2R7SA 3O39A 2GFHA 4B6IA 4J32B 2L81A 3NKDA 1ZHYA 2J7PD 3HLZA 2R7WA 2Y3HA 4LLCA 1VOMA 5B3SC 3B0VC 1VYIA 2Z15A 1FFHA 3W2VA 3PHF2 4P6IC 3Q6MA 2WVNA 3EQLF 3NYJA 4QI2A 2PX3A 2EILC 4DBQA 5KYYA 5T3TA 2MYSA 2EIJC 4LERA 3EFOB 1O5HA 3KMIA 4BJ5A 2G3KA 2E87A 1FTSA 3DAFA 4E7SA 2I8BA 3EGDA 3L0IA 1M57C 2J0XA 2R7VA 4CIHA 2J9VA 3JRTA 1D0YA 4BG0A 5KYNA 4CS9A 2IOQA 3QMKA 2G62A 5DS6A 3W8HA 4O6NA 2XXAB 3AG3C 3ABLC 3EZHA 3AG2C 3DJUB 3ASOC 4M63A 2Y69C 1MNDA 5B1AC 2J9WA 4O79A 2J9UA 4BEJA 3ZG1A 3DJNB 5HSWA 4G7ZF 1JPNA 1M2VA 3EHMA 2XL4A 4HFFB 3LLIA 1S7ZA 2OCCC 1TWGA 2XRHA 3LAYA 4X0RA 1MMGA 1ZYRF 3EH2A 3F46A 4DBRA 1LVKA 2YHSA 3UGPA 3POVA 4LACB 4CS8C 4JCHA 2A1DD 2W4BA 2WVQA 4AE4B 3UMKA 2NUPA 4J30B 3WG7C 4FESA 3T6JA 2VB6A 2M4EA 1BR4A 4CS7A 4I44A 3JCUQ 1Z6AA 3CQZA 3DD7A 4XLPF 2NUTB 1J8YF 3Q7GA 3HTKC 4XLNF 3LESA 4W8KA 1NG1A 1V55C 1TWCA 2H7OA 1SMYF 3K7DA 2IXNA 2BE5F 3JSZA 2Y3BA 4JW1A 5D92A 1D1AA 1OKKA 4OIPF 4JVSA 4JJGA 1D1CA 3UMIA 1MMDA 2PF4E 2W9YA 2A6HF 3M1CB 4KI2A 3E9VA 4O6MA 2V3CC 1VK5A 3ECSA 3DM9B 3EH1A 5KYWA 2ZXPA 2L9JA 2EIMC 2XSEA 5F5FA 1Z5ZA 5FCLA 5E3AA 3SYNA 3FVYA 5DS4A 1Z3IX 2V26A 2WB7A 3FHDA 3ITFA 4G7OF 2Q9CA 5DQZA 1BR2A 3ZVRA 4RBNA 1M56C 3LJBA 4PJMA 5CI9A 1PD0A 3LS0A 4IJJA 3RFYA 4EBBA 4YT8A 4JZAA 1PCXA 3K1IC 1RJ9A 3EPVA 3S28A 2QTVA 4BJ1A 3K1HA 4HFKB 2VH3A 2FGYA 3B0UX 4A2NB 4CS8A 3PMRA 2YEVA 3S29A 2R7XA 1NZEA 2WZGA 3B0PA 4EWCA 1ZU4A 2A68F 4BJ6C 3Q7LA 4OD5A 5E3CA 5F5HA 3IEEA 3KL4A 4N06A 3EFOA 3CSKA 5L3VA 3E70C 3NYMA 2R7TA 4DVYP 1SF8A 4C3DA 5KYUB 3ABKC 4OIRF 1FMWA 1OCCC 4JJFA 5KYXB 2ZXOA 3MX3A 1D1BA 1JPJA 2H7BA 4WJ0A 3SZRA 3VYWA 2XXAA 3NYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H F;  4KI2 A;  3UGO A;  4XLP F;  2A69 F;  4OIN F;  2A68 F;  3UGP A;  4OIO F;  3LEV A;  1IW7 F;  4XLN F;  3LES A;  4Q4Z F;  3WOD F;  1SMY F;  1KU2 A;  2BE5 F;  4G7Z F;  4OIR F;  3DXJ F;  4OIQ F;  4OIP F;  4G7O F;  3EQL F;  4G7H F;  4Q5S F;  2CW0 F;  2A6E F;  1ZYR F;  4MQ9 F; 
#chains in the Genus database with same CATH topology
 4MVR A;  4WGZ A;  1IZM A;  3G4X A;  4YL3 A;  5DVW A;  2KGO A;  4IAO A;  4RDA A;  4U5C E;  3ZDL A;  5B3I A;  2EPN A;  1GS9 A;  3ASN C;  3HKK A;  3KH2 A;  3T4R A;  1T6Q A;  2X51 A;  2G3V A;  1FR0 A;  1NFO A;  4EBJ A;  2OJE D;  2OEV A;  2ICW G;  4G78 A;  5JP7 A;  3WOD F;  2C03 A;  5GPG B;  1KU2 A;  2HMQ A;  4YT4 A;  3K6B A;  1VYK A;  2KJG A;  2HMZ A;  3LS1 A;  2DB4 A;  4XPY A;  3O10 A;  2R7O A;  2L6F A;  1ZHT A;  4HE8 D;  4LDQ A;  4ULV A;  3VM6 A;  3FOO A;  1I4Y A;  1LS1 A;  2LFD A;  3ZWI A;  2LQG A;  4ULW A;  1OCO C;  2XLH A;  1RCP A;  3QW0 A;  4NY3 A;  2VCA A;  3OEO A;  1YAU O;  1G4W R;  4YWQ A;  2KW3 C;  2WVO A;  3N2Z B;  4YT5 A;  1VMA A;  4XWJ A;  2J46 A;  4EIY A;  5AC4 A;  1YYJ A;  4F4B A;  3O6X A;  4O6Y A;  1VLS A;  5D91 A;  1EKY A;  5JUA A;  4XEV A;  2YRF A;  1F1M A;  2HJM A;  2J0W A;  3M79 A;  4NC3 A;  4NTA A;  3LEV A;  1CGO A;  2CDQ A;  2PX0 A;  3DZA A;  3MYF A;  4C3E A;  2IYL D;  3U8V A;  5L0H A;  1K04 A;  1K05 A;  1BBH A;  2DGJ A;  4H54 A;  1ORY A;  3N24 A;  3TOL A;  3RKO F;  1OW7 A;  3AQC A;  1FAP B;  1YZA A;  4J7Y A;  4JE9 A;  4YL0 A;  3U2L A;  1YVI A;  2HFI A;  4OD4 A;  1TWA A;  2EIN C;  3RYL A;  2AU5 A;  2DI3 A;  3HNK A;  5FZT A;  2L7A A;  3I5Q A;  4AE4 A;  2PP4 A;  1HE9 A;  2XL6 A;  3F47 A;  2Q3T A;  3SNH A;  3K1I A;  1TWH A;  4CSA C;  1Z63 A;  2Q9A A;  2H7V C;  3L34 A;  3M4C A;  1U0B B;  2R02 A;  4MVM A;  1FNT c;  4G7H F;  3HNL A;  3V7O A;  3ZSU A;  4Q5S F;  2A6E F;  3TOM A;  3I5P A;  4DOZ A;  1MNE A;  1NSG B;  4PJN A;  2YLD A;  3U8P A;  4CDA A;  4EBK A;  2A0U A;  3EGX B;  1ZHX A;  4U5F E;  4KC9 A;  4Z9I A;  1OR3 A;  2Y3D A;  1SR2 A;  3RIP A;  1OKK D;  3EJN A;  2LCH A;  3C18 A;  4IB4 A;  5BQI A;  4MW3 A;  1OCZ C;  3VRC A;  2NUT A;  2KNH A;  1GQA A;  1OQC A;  2O9X A;  1MMA A;  1CPR A;  1D0X A;  1J8M F;  2CNW A;  2D5R B;  2ZXW C;  3QVY A;  4GEH A;  3VAY A;  4H4K C;  5A6B A;  2HSB A;  2OEX A;  4NTF A;  3IPM O;  1QSP A;  2H8A A;  3N0T A;  3B9Q A;  4NQF A;  3S90 A;  2GDC A;  4IWB A;  2KYH A;  4BJ6 A;  2W45 A;  2XLD A;  4ANJ A;  2LK4 A;  1C02 A;  1BR1 A;  2NG1 A;  3R2P A;  3SXK A;  1T6I A;  3X2Q C;  5KYY B;  5JVE A;  3U0C A;  4O7G A;  3BRJ A;  3DKA A;  2R25 A;  3HJC A;  3LLK A;  3MLG A;  3ZC4 A;  2CNW D;  5DLJ A;  1H6G A;  1RMV A;  4IRU A;  4XPW A;  4N6C A;  4BJT A;  1T01 A;  2J7P A;  3GAN A;  3EZI A;  4JIO A;  4JUR I;  5CI8 A;  3SP1 A;  4K1O A;  1M6T A;  5CIV A;  3X1O A;  4YN0 B;  3JYH A;  3K33 A;  3V5Y A;  4YK5 A;  1SZI A;  3GEH A;  3IQT A;  3EGX A;  3TK0 A;  2YL7 A;  3W2W A;  4CSA A;  3LUT B;  4MVQ A;  4D4N A;  4Q4Z F;  2MWQ A;  2ZPA A;  3JTL O;  1YLM A;  1LE2 A;  1FFT C;  4PAC A;  1ST6 A;  1CGN A;  2QY9 A;  1FMV A;  4YT2 A;  2HUJ A;  1TKN A;  4U5G A;  1M2O A;  3DXJ F;  2C04 A;  1K40 A;  2I15 A;  5BQH A;  3KKB A;  2W4M A;  4MTO A;  4J7T A;  1S05 A;  2AP3 A;  2QLA A;  2L6G A;  3FAJ A;  2QNL A;  4AL0 A;  2DYR C;  2WZL A;  4K7B A;  3PDM P;  1JAF A;  1TFO B;  4ZLD A;  1LI5 A;  2P7V A;  2QE9 A;  4MVZ A;  3ABM C;  5L3Q A;  1HW2 A;  4C3B A;  1APC A;  3SXZ A;  4U5E E;  1OCR C;  1YJG A;  5A6A A;  1QPU A;  4E18 A;  3W8I A;  1QLE C;  3ZIB A;  3L8I A;  1E2X A;  4PJL A;  4CJO A;  1M2V B;  4YJW A;  2LD6 A;  2B0H A;  2EPO A;  3Q6N A;  2XS8 A;  3U5S A;  2CGE A;  3TD7 A;  4U5H A;  2PNO A;  4DRJ B;  3ZTM A;  1GGQ A;  4U5B E;  4MND A;  3GEI A;  1Z23 A;  2IXP A;  2VC9 A;  5COG A;  5AC5 A;  5T3W A;  3GEE A;  5L0F A;  3H2V A;  2Q4F A;  5COF A;  1ORJ A;  2NPU A;  4KBL A;  5T1D B;  2P6V A;  3DMD A;  3AG4 C;  2CW0 F;  3H65 A;  1NU9 C;  1NU7 D;  4XEK A;  4MTF A;  1V54 C;  3W4Y A;  5DQT A;  4Z9J A;  3GOD A;  1T5O A;  4KNV A;  4OIN F;  3RF3 A;  1ZHZ A;  2Y3G A;  1PD1 A;  5IY5 C;  2FAP B;  5JLI A;  2R7U A;  3LEO A;  5EHH A;  3CZ6 A;  4K0D A;  2QUP A;  2UUI A;  3K66 A;  1MMN A;  1JR8 A;  2NSF A;  2NUP B;  3B29 A;  1JMW A;  3C8G D;  3OWT A;  4GQH A;  2YZS A;  3RQG A;  3S27 A;  1JOG A;  3LNR A;  3FDQ A;  3QTH A;  5EGY A;  1R5I D;  3NG1 A;  2VCC A;  1AVO B;  4PFP A;  1ZU5 A;  2EPK X;  4CBE A;  3UR3 C;  1OW6 A;  3NKE A;  4PFO A;  3ZQY A;  4C7O B;  4RD9 A;  4AK9 A;  4FAP B;  4BJ5 C;  4OIQ F;  4U9D A;  2OG2 A;  3T9O A;  1W2W A;  4I1M A;  5KYU A;  3ATP A;  3WHN A;  2WL8 A;  3RH3 A;  4PK4 A;  4U9E A;  3T6B A;  4QDL A;  3DE8 A;  5F28 E;  4BPM A;  5KYX A;  2VAS A;  1HMD A;  2R05 A;  1A7E A;  3UGO A;  3LNM B;  4CS9 C;  5A6J A;  4LLE A;  4FX5 A;  4GYT A;  1E86 A;  1LI7 A;  1LKX A;  3S0X A;  4OIO F;  1N1C A;  4XPX A;  2BC5 A;  3IQC A;  5DS5 A;  3NRH A;  4QI0 A;  1O3U A;  4HEA J;  3U3F A;  3WAQ A;  5B1B C;  1NFN A;  4ZLC A;  4I3M A;  4E17 A;  2R7R A;  3AQB A;  2EPL X;  5A6K A;  4E7Z A;  3EG9 B;  3UMH A;  3A11 A;  3AGT A;  5HV9 A;  1ZHW A;  5E2Q A;  2HV7 A;  2LSE A;  1O87 A;  2WZF A;  1HE1 A;  3MFN A;  5A69 A;  3FAP B;  3SXM A;  5JT4 A;  4Q7C A;  4C7O A;  2J45 A;  4MS2 A;  2A0B A;  2P0N A;  3DAG A;  4XTK A;  5BUO A;  3QZC A;  4MQ9 F;  3EHN A;  1G8X A;  4MVO A;  1E85 A;  5KYW B;  4R32 A;  3S9O A;  1RKE B;  3RVY A;  1WGW A;  2NSG A;  2Y39 A;  3TJ5 A;  3V5Z A;  5COM A;  3I4U A;  3B71 A;  1IW7 F;  1T9K A;  4FWV A;  2PFD A;  1D0Z A;  2Q9B A;  4I1O B;  4DRI B;  1LE4 A;  4E0H A;  4G0H A;  1E84 A;  4U5D E;  2JD3 A;  3US6 A;  3U3B A;  4A4A A;  2KQ9 A;  3GWN A;  4N4W A;  1QZX A;  2IXO A;  2ZXR A;  4XEF A;  3UNG C;  3TUL A;  2AWC A;  4JEB A;  2HV6 A;  1KTM A;  3EG9 A;  2HKV A;  4WGY A;  5E33 A;  3AG1 C;  1VB5 A;  2LP4 A;  3CEX A;  3DM5 A;  4PJJ A;  2B0J A;  1TR2 A;  1Q0D A;  2DYS C;  4CJG A;  3A9C A;  5K0I A;  2XL8 A;  2EIK C;  2J8W A;  2Q00 A;  4UDV A;  5A6B D;  1L7C A;  2IXM A;  1YA7 O;  4KNW A;  3SEO A;  3JT1 A;  4AX2 A;  3NDB B;  3AJM A;  3FMS A;  2FFH A;  2A69 F;  1OXB A;  4DVZ A;  2RSE B;  2P61 A;  3OA1 A;  2R7Q A;  3EGD B;  1RJ9 B;  2R7S A;  4ER9 A;  3O39 A;  1CPQ A;  1RKE A;  2HZ8 A;  1JRA A;  2GFH A;  4B6I A;  4J32 B;  1C17 M;  2L81 A;  3JRM O;  3NKD A;  1ZHY A;  3NMJ A;  2J7P D;  3HLZ A;  1U89 A;  2Y3H A;  1HW1 A;  2R7W A;  3FXH A;  4JRZ A;  1VOM A;  4LLC A;  5B3S C;  1C03 A;  3B0V C;  4YL1 A;  5L0J A;  3RQF A;  4XQ1 A;  1VYI A;  2Z15 A;  4ONS A;  3ZTZ A;  1G4U S;  1FFH A;  1V4A A;  4AL1 A;  3W2V A;  2YL0 A;  1U6H A;  3PHF 2;  4P6I C;  3Q6M A;  2WVN A;  3EQL F;  3NYJ A;  2YL3 A;  4MVU A;  2JX0 A;  2PX3 A;  2EIL C;  4DBQ A;  4QI2 A;  5KYY A;  1WAT A;  2YVK A;  5T3T A;  2MYS A;  2EIJ C;  4LER A;  3EFO B;  2YLI A;  4E0I A;  1LM3 B;  1O5H A;  1VLT A;  2ZD9 A;  3KMI A;  4BJ5 A;  1LS4 A;  2E87 A;  2G3K A;  4CIP A;  1FTS A;  3DAF A;  4P9T A;  1WOL A;  4D4X A;  1ORS C;  4E7S A;  2I8B A;  3EGD A;  2HS5 A;  2OQM A;  3L0I A;  1M57 C;  2J0X A;  4JTA B;  2R7V A;  4CIH A;  2J9V A;  1YYX A;  1XZQ A;  1D0Y A;  1HMO A;  3JRT A;  4BG0 A;  4CS9 A;  5KYN A;  4MW8 A;  2IOQ A;  3C7J A;  4MVS A;  1LIH A;  3QMK A;  3R7C A;  2G62 A;  5DS6 A;  1T6U A;  3DI5 A;  3W8H A;  4O6N A;  1LPE A;  2TMV P;  2XXA B;  3AG3 C;  3ABL C;  1WAS A;  1TQG A;  1AUE A;  2M64 A;  3EZH A;  4IAQ A;  3AG2 C;  2GA0 A;  3GOR A;  3DJU B;  3ASO C;  3DWW A;  3NMK A;  4M63 A;  2Y69 C;  3L8J A;  4JKV A;  1VTM P;  1ZW3 A;  1MND A;  1ZVZ A;  3G50 A;  1WN0 A;  1A41 A;  2J9W A;  4JC7 A;  5B1A C;  3U2M A;  3T6G B;  4O79 A;  2J9U A;  4BEJ A;  3NMI A;  3ZG1 A;  3DJN B;  1I4Z A;  2ASR A;  5JS5 A;  5HSW A;  3J06 A;  4G7Z F;  2YLG A;  2EPM X;  1JPN A;  1H9T A;  2UUH A;  1SYQ A;  1M2V A;  1ZW2 A;  3EHM A;  2LFF A;  2XL4 A;  3S84 A;  2KSF A;  4HFF B;  3LLI A;  4JCZ A;  1I5N A;  1S7Z A;  1QVX A;  1TWG A;  2OCC C;  2F22 A;  2XRH A;  1A7V A;  2XLE A;  3MYI A;  3LAY A;  4X0R A;  1MMG A;  1ZYR F;  3EH2 A;  3F46 A;  3IQ5 A;  2HJ3 A;  4DBR A;  1LVK A;  2YHS A;  3KYI A;  1Y4C A;  1ZZP A;  1RXQ A;  3UGP A;  3POV A;  4LAC B;  4CS8 C;  4JCH A;  1EQ1 A;  2RD9 A;  4DJ9 A;  2XLV A;  1E83 A;  1WTY A;  2XLO A;  4NTB A;  2A1D D;  2W4B A;  2WVQ A;  2LIG A;  4AE4 B;  3SXY A;  3UMK A;  2NUP A;  4J30 B;  3WG7 C;  3U9J A;  4DXW A;  1MQV A;  4FES A;  1B68 A;  3ZQV A;  3T6J A;  2VB6 A;  2M4E A;  2XM0 A;  4JEA A;  3CAX A;  1XZP A;  2GWW A;  1DOV A;  5JRA A;  1BR4 A;  1QQ3 A;  2ETS A;  3GM2 A;  4CS7 A;  4I44 A;  3JCU Q;  1Z6A A;  3CQZ A;  2CYD A;  3DD7 A;  2YKZ A;  4JTC B;  3VF0 A;  1Q0K A;  2NUT B;  4XLP F;  1J8Y F;  1Y6D A;  2JPU A;  1OXK A;  1KNY A;  3Q7G A;  3HTK C;  3DE9 A;  4EKW A;  1CGM E;  4XLN F;  2OU6 A;  3KYJ A;  3LES A;  2D4U A;  2L6H A;  1NG1 A;  1V55 C;  4LDK A;  4W8K A;  1TWC A;  2H7O A;  1SMY F;  3K7D A;  1HY5 A;  2IXN A;  2BE5 F;  5L0I A;  4IGG A;  256B A;  1NBB A;  3JSZ A;  2Y3B A;  2OOC A;  3AOU A;  4JW1 A;  1H7I A;  5D92 A;  1D1A A;  1OKK A;  2OKU A;  1Q0M A;  4OIP F;  4JVS A;  2IBF A;  3O55 A;  4JJG A;  3RVZ A;  1A7D A;  1D1C A;  2R9R B;  4PR9 A;  5BQG A;  3UMI A;  1WWP A;  1MMD A;  3IQ6 A;  3G4Z A;  5EK0 A;  2PF4 E;  4EUK B;  2W9Y A;  2A6H F;  3M1C B;  4KI2 A;  3JSE O;  1A0B A;  2XS1 A;  4L6R A;  4P9F A;  3RW0 A;  3E9V A;  2YQY A;  3GWL A;  4O6M A;  3U9M A;  2V3C C;  1VK5 A;  2R03 A;  1OR2 A;  2YL1 A;  3DM9 B;  3ECS A;  1H9G A;  3EH1 A;  5KYW A;  1TFK B;  2ZXP A;  2X0C A;  5L0D A;  2L9J A;  1YZC A;  2PBE A;  2EIM C;  2XSE A;  1YAR O;  3PCV A;  5F5F A;  4MTG A;  1Z5Z A;  5FCL A;  5E3A A;  4Z9H A;  3SYN A;  3FVY A;  5DS4 A;  1YDI A;  1Z3I X;  2BL2 A;  3HNI A;  4DRH B;  2XM4 A;  3BEH A;  2V26 A;  2WB7 A;  1BDJ B;  3MBG A;  1Q0G A;  3QVZ A;  3FHD A;  3GM1 A;  5AGF A;  3ITF A;  4G7O F;  1UFB A;  2Q9C A;  5L0G A;  5DQZ A;  1EA8 A;  1BR2 A;  2AVK A;  5TJ5 E;  3HNJ A;  3ZVR A;  1BZ4 A;  1M56 C;  4LDR A;  4RBN A;  3LJB A;  4PJM A;  5CI9 A;  4NCQ A;  1PD0 A;  4CDV A;  2HSQ A;  3LS0 A;  4IJJ A;  3RFY A;  4EHP A;  4EBB A;  1YA9 A;  4YT8 A;  4JZA A;  1PCX A;  3K1I C;  1RKC A;  3M4B A;  1RJ9 A;  1V74 B;  3IHU A;  1DOW A;  3EPV A;  3QW1 A;  2QTV A;  3S28 A;  3C8G B;  3K1H A;  2GAQ A;  4BJ1 A;  2VCB A;  2OJQ A;  2VH3 A;  1L3P A;  4HFK B;  1G5Z A;  2FGY A;  3GM3 A;  3B0U X;  4A2N B;  1PV3 A;  3C63 A;  1GM5 A;  4CS8 A;  3PMR A;  3JZ0 A;  2YEV A;  3C62 A;  2Q7R A;  3S29 A;  2R7X A;  1NZE A;  1QKR A;  2WZG A;  3B0P A;  4EWC A;  3FOP A;  2XLM A;  1ZU4 A;  2P1A A;  4WAB A;  4IAR A;  4CX9 A;  1Z7Q c;  2A68 F;  2KC3 A;  2XLW A;  4BJ6 C;  4W8P A;  1R4T A;  1NLX A;  1OW8 A;  2AWY A;  2YWA A;  3Q7L A;  4JTD B;  4OD5 A;  5E3C A;  3IEE A;  5F5H A;  3KL4 A;  4BEM J;  2CCY A;  3L1M A;  4N06 A;  3EFO A;  3M15 A;  3CSK A;  5L3V A;  3E70 C;  3NYM A;  4N6H A;  2R7T A;  2J9B A;  3JYY A;  4DVY P;  1AEP A;  1SF8 A;  2MHR A;  1EI7 A;  3V5X A;  1Q0F A;  4C3D A;  5KYU B;  3ABK C;  4OIR F;  1FMW A;  1OCC C;  2IM8 A;  2KK1 A;  4JJF A;  5L0C A;  3TQO A;  5KYX B;  2ZXO A;  3MX3 A;  3C8G A;  3TJ6 A;  1XWJ A;  1D1B A;  3H2U A;  4CDY A;  3RQE A;  1JPJ A;  1UG7 A;  2H7B A;  4WJ0 A;  5JSL A;  3SZR A;  3KPH A;  3VYW A;  3AGU A;  3C8Z A;  2XXA A;  3NYL A; 
#chains in the Genus database with same CATH homology
 1IZM A;  5DVW A;  2KGO A;  4IAO A;  4RDA A;  4U5C E;  3ASN C;  3KH2 A;  3T4R A;  2X51 A;  2G3V A;  3WOD F;  2C03 A;  1KU2 A;  4YT4 A;  3K6B A;  1VYK A;  2KJG A;  3LS1 A;  2R7O A;  1ZHT A;  4HE8 D;  1LS1 A;  4ULW A;  1OCO C;  4NY3 A;  3OEO A;  4YWQ A;  2KW3 C;  2WVO A;  3N2Z B;  4YT5 A;  1VMA A;  4XWJ A;  2J46 A;  4F4B A;  3O6X A;  4O6Y A;  5D91 A;  2J0W A;  3LEV A;  2CDQ A;  3DZA A;  2PX0 A;  4C3E A;  2IYL D;  2DGJ A;  3N24 A;  3RKO F;  3AQC A;  4OD4 A;  1TWA A;  2EIN C;  3RYL A;  3I5Q A;  4AE4 A;  2PP4 A;  3F47 A;  2Q3T A;  3SNH A;  4CSA C;  1TWH A;  1Z63 A;  2Q9A A;  2H7V C;  3L34 A;  4G7H F;  3V7O A;  3ZSU A;  4Q5S F;  2A6E F;  3I5P A;  4DOZ A;  1MNE A;  4PJN A;  3EGX B;  1ZHX A;  4U5F E;  4KC9 A;  2Y3D A;  3RIP A;  1OKK D;  3EJN A;  1OCZ C;  2NUT A;  2KNH A;  3UNG C;  2O9X A;  1MMA A;  1D0X A;  2CNW A;  1J8M F;  4GEH A;  2D5R B;  2ZXW C;  3VAY A;  4H4K C;  3N0T A;  3B9Q A;  4IWB A;  4BJ6 A;  2W45 A;  4ANJ A;  1BR1 A;  2NG1 A;  3X2Q C;  5KYY B;  4O7G A;  3HJC A;  3LLK A;  3MLG A;  3ZC4 A;  2CNW D;  5DLJ A;  4IRU A;  4BJT A;  3GAN A;  2J7P A;  4JUR I;  3EZI A;  3SP1 A;  5CI8 A;  3X1O A;  4YN0 B;  3JYH A;  3K33 A;  1SZI A;  3EGX A;  3W2W A;  4Q4Z F;  2MWQ A;  2ZPA A;  1FFT C;  1ST6 A;  2QY9 A;  4YT2 A;  1FMV A;  1TKN A;  4U5G A;  1M2O A;  3DXJ F;  2C04 A;  3KKB A;  2W4M A;  3FAJ A;  2DYR C;  2WZL A;  4K7B A;  4ZLD A;  2P7V A;  5L3Q A;  3ABM C;  4C3B A;  4U5E E;  1OCR C;  3W8I A;  1QLE C;  3ZIB A;  4PJL A;  1M2V B;  4YJW A;  3Q6N A;  2CGE A;  3TD7 A;  4U5H A;  4U5B E;  4MND A;  1Z23 A;  2IXP A;  5T3W A;  4KBL A;  5T1D B;  2P6V A;  3DMD A;  3H65 A;  2CW0 F;  3AG4 C;  1NU9 C;  1NU7 D;  1V54 C;  5DQT A;  3GOD A;  4KNV A;  4OIN F;  2R7U A;  1ZHZ A;  2Y3G A;  1PD1 A;  5IY5 C;  5EHH A;  3CZ6 A;  4K0D A;  3K66 A;  1MMN A;  2NUP B;  4CSA A;  3OWT A;  3S27 A;  2YZS A;  3LNR A;  3FDQ A;  5EGY A;  3NG1 A;  4PFP A;  1ZU5 A;  4CBE A;  3UR3 C;  3NKE A;  4PFO A;  4C7O B;  4RD9 A;  4AK9 A;  4BJ5 C;  4OIQ F;  2OG2 A;  1W2W A;  4I1M A;  5KYU A;  2WL8 A;  3RH3 A;  4PK4 A;  3T6B A;  4QDL A;  5KYX A;  2VAS A;  3UGO A;  4CS9 C;  4LLE A;  4FX5 A;  4GYT A;  1LKX A;  3S0X A;  4OIO F;  1N1C A;  5DS5 A;  3NRH A;  4QI0 A;  4HEA J;  5B1B C;  4ZLC A;  4I3M A;  2R7R A;  3AQB A;  4E7Z A;  3EG9 B;  3UMH A;  1ZHW A;  5E2Q A;  2HV7 A;  2LSE A;  1O87 A;  2WZF A;  4Q7C A;  4C7O A;  2J45 A;  3DAG A;  4XTK A;  5BUO A;  3QZC A;  4MQ9 F;  3EHN A;  1G8X A;  5KYW B;  1WGW A;  2Y39 A;  3I4U A;  1IW7 F;  4FWV A;  2PFD A;  1D0Z A;  2Q9B A;  4I1O B;  4G0H A;  4U5D E;  2JD3 A;  2KQ9 A;  1QZX A;  2IXO A;  2ZXR A;  2HV6 A;  3EG9 A;  5E33 A;  3AG1 C;  3DM5 A;  4PJJ A;  2B0J A;  1TR2 A;  2DYS C;  2EIK C;  3SEO A;  2IXM A;  4KNW A;  4AX2 A;  3NDB B;  3JT1 A;  2FFH A;  2A69 F;  4DVZ A;  3OA1 A;  2R7Q A;  3EGD B;  1RJ9 B;  2R7S A;  3O39 A;  2GFH A;  4B6I A;  4J32 B;  2L81 A;  3NKD A;  1ZHY A;  2J7P D;  3HLZ A;  2R7W A;  2Y3H A;  4LLC A;  1VOM A;  5B3S C;  3B0V C;  1VYI A;  2Z15 A;  1FFH A;  3W2V A;  3PHF 2;  4P6I C;  3Q6M A;  2WVN A;  3EQL F;  3NYJ A;  4QI2 A;  2PX3 A;  2EIL C;  4DBQ A;  5KYY A;  5T3T A;  2MYS A;  2EIJ C;  4LER A;  3EFO B;  1O5H A;  3KMI A;  4BJ5 A;  2G3K A;  2E87 A;  1FTS A;  3DAF A;  4E7S A;  2I8B A;  3EGD A;  3L0I A;  1M57 C;  2J0X A;  2R7V A;  4CIH A;  2J9V A;  3JRT A;  1D0Y A;  4BG0 A;  5KYN A;  4CS9 A;  2IOQ A;  3QMK A;  2G62 A;  5DS6 A;  3W8H A;  4O6N A;  2XXA B;  3AG3 C;  3ABL C;  3EZH A;  3AG2 C;  3DJU B;  3ASO C;  4M63 A;  2Y69 C;  1MND A;  5B1A C;  2J9W A;  4O79 A;  2J9U A;  4BEJ A;  3ZG1 A;  3DJN B;  5HSW A;  4G7Z F;  1JPN A;  1M2V A;  3EHM A;  2XL4 A;  4HFF B;  3LLI A;  1S7Z A;  2OCC C;  1TWG A;  2XRH A;  3LAY A;  4X0R A;  1MMG A;  1ZYR F;  3EH2 A;  3F46 A;  4DBR A;  1LVK A;  2YHS A;  3UGP A;  3POV A;  4LAC B;  4CS8 C;  4JCH A;  2A1D D;  2W4B A;  2WVQ A;  4AE4 B;  3UMK A;  2NUP A;  4J30 B;  3WG7 C;  4FES A;  3T6J A;  2VB6 A;  2M4E A;  1BR4 A;  4CS7 A;  4I44 A;  3JCU Q;  1Z6A A;  3CQZ A;  3DD7 A;  4XLP F;  2NUT B;  1J8Y F;  3Q7G A;  3HTK C;  4XLN F;  3LES A;  4W8K A;  1NG1 A;  1V55 C;  1TWC A;  2H7O A;  1SMY F;  3K7D A;  2IXN A;  2BE5 F;  3JSZ A;  2Y3B A;  4JW1 A;  5D92 A;  1D1A A;  1OKK A;  4OIP F;  4JVS A;  4JJG A;  1D1C A;  3UMI A;  1MMD A;  2PF4 E;  2W9Y A;  2A6H F;  3M1C B;  4KI2 A;  3E9V A;  4O6M A;  2V3C C;  1VK5 A;  3ECS A;  3DM9 B;  3EH1 A;  5KYW A;  2ZXP A;  2L9J A;  2EIM C;  2XSE A;  5F5F A;  1Z5Z A;  5FCL A;  5E3A A;  3SYN A;  3FVY A;  5DS4 A;  1Z3I X;  2V26 A;  2WB7 A;  3FHD A;  3ITF A;  4G7O F;  2Q9C A;  5DQZ A;  1BR2 A;  3ZVR A;  4RBN A;  1M56 C;  3LJB A;  4PJM A;  5CI9 A;  1PD0 A;  3LS0 A;  4IJJ A;  3RFY A;  4EBB A;  4YT8 A;  4JZA A;  1PCX A;  3K1I C;  1RJ9 A;  3EPV A;  3S28 A;  2QTV A;  4BJ1 A;  3K1H A;  4HFK B;  2VH3 A;  2FGY A;  3B0U X;  4A2N B;  4CS8 A;  3PMR A;  2YEV A;  3S29 A;  2R7X A;  1NZE A;  2WZG A;  3B0P A;  4EWC A;  1ZU4 A;  2A68 F;  4BJ6 C;  3Q7L A;  4OD5 A;  5E3C A;  5F5H A;  3IEE A;  3KL4 A;  4N06 A;  3EFO A;  3CSK A;  5L3V A;  3E70 C;  3NYM A;  2R7T A;  4DVY P;  1SF8 A;  4C3D A;  5KYU B;  3ABK C;  4OIR F;  1FMW A;  1OCC C;  4JJF A;  5KYX B;  2ZXO A;  3MX3 A;  1D1B A;  1JPJ A;  2H7B A;  4WJ0 A;  3SZR A;  3VYW A;  2XXA A;  3NYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...