4KI2A

Crystallographic analysis of an rna-polymerase sigma-subunit fragment complexed with -10 promoter element ssdna
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
178
structure length
178
Chain Sequence
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*GP*TP*AP*CP*AP*AP*TP*GP*GP*G)-3')
publication title Crystallographic analysis of an RNA polymerase sigma-subunit fragment complexed with -10 promoter element ssDNA: quadruplex formation as a possible tool for engineering crystal contacts in protein-ssDNA complexes.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 65
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ki2A00
4G7HF 4OIOF 4KI2A 3UGPA 1KU2A 4Q4ZF 4XLPF 4OINF 4XLNF 4Q5SF 2BE5F 1IW7F 4MQ9F 2A68F 4OIPF 2A6HF 4OIRF 3EQLF 2A6EF 3LEVA 2CW0F 4OIQF 3LESA 1ZYRF 3WODF 4G7ZF 4G7OF 3UGOA 1SMYF 2A69F 3DXJF
chains in the Genus database with same CATH superfamily
3AG4C 1OR2A 4N4WA 3ZC4A 1U0BB 5E3CA 2VH3A 3W8IA 2CYDA 2R7XA 2OU6A 3U9MA 1F1MA 1G5ZA 4MTFA 3S27A 3GM1A 1Y6DA 1AVOB 3ZQYA 4JTCB 3NKDA 2LCHA 1Z7Qc 2PF4E 4QI2A 4JCZA 1WN0A 2Q9BA 4OIPF 2XLEA 3MYFA 5K0IA 1RCPA 3IEEA 4XEVA 1ZHZA 3N2ZB 4EKWA 2HSBA 2H7VC 3AJMA 1QVXA 2H8AA 4NCQA 2R03A 4YL1A 1D0ZA 4U9EA 2R05A 3I5QA 3UMHA 2NSGA 3SXKA 5AC4A 4CS9C 1E85A 4PR9A 2DYRC 3EGDA 1MMAA 3VYWA 1ZU4A 3DI5A 2B0JA 2A69F 2IM8A 2HMZA 3C8GD 4O7GA 2NUTB 3MLGA 1NG1A 2XLMA 3K33A 1NU9C 4J30B 3UGPA 3QVZA 2XL8A 3LAYA 4XLPF 2G3VA 2M64A 2IXMA 3DM5A 3G50A 2CNWA 3K1HA 4NQFA 1TWHA 2J46A 2H7OA 2KNHA 2LD6A 2PNOA 1ZW3A 2WVNA 3DE8A 1LE2A 4HE8D 3UMKA 1HW2A 4BPMA 2YKZA 1CGME 5KYWB 1SYQA 1A7VA 2F22A 2Y39A 3EQLF 3GM3A 3DJNB 3LEVA 1LI7A 3PMRA 4KNWA 3TD7A 4CIPA 1RKCA 2CGEA 4OIQF 1CPRA 4AK9A 3EZIA 3MFNA 5A6BA 4CX9A 4KBLA 1FMWA 1FFHA 2R9RB 1Q0DA 2CDQA 5FZTA 4CIHA 3AG1C 5L0JA 4IGGA 4AE4B 5KYYB 4IJJA 5JVEA 1I5NA 2L81A 3DJUB 3RW0A 2XLDA 3L1MA 2BL2A 3H65A 5F5FA 1NBBA 5E2QA 3A11A 3B0UX 3M1CB 1JPJA 1EKYA 4ER9A 5B1BC 2YL3A 3M4BA 4NY3A 2GDCA 2HJMA 1Z23A 2LQGA 2VASA 2HJ3A 1YA9A 4I44A 1S7ZA 3E70C 3B71A 1O3UA 1G4WR 5B3SC 5L0GA 3DKAA 3S0XA 3EJNA 2IXPA 2A6HF 3GORA 3JCUQ 3KL4A 5IY5C 2R7QA 2YLGA 3UR3C 1NLXA 4CS8A 1LPEA 1D1CA 2LIGA 3SXYA 1V74B 2FGYA 2YQYA 2VCBA 4MVRA 5HSWA 3K6BA 2ETSA 1TWAA 1QZXA 3RYLA 2LP4A 1HY5A 4CS9A 4I1OB 4XPWA 1MMDA 1YJGA 2XM0A 3FDQA 2Z15A 3ZDLA 2AWCA 5A69A 1EI7A 2EIMC 4GEHA 4LLEA 1H6GA 1PD0A 1GQAA 2VCCA 4N6HA 2X0CA 4OIOF 1L7CA 3OEOA 3U2MA 4P9FA 3ZTMA 3S84A 1T6UA 3B0PA 3EPVA 3FXHA 2W45A 1OCOC 4RDAA 4X0RA 3U8VA 1UG7A 2AU5A 3CZ6A 3EGXB 3ZQVA 3C8GB 1NU7D 1QPUA 5CI8A 4O6NA 5JT4A 2KQ9A 5DS5A 4AX2A 1GGQA 2YWAA 3EG9A 2XSEA 4MTOA 1V55C 4GQHA 1JR8A 4P6IC 5BQGA 3S28A 3T9OA 4MTGA 2NUPA 5JRAA 1A7EA 4JRZA 4K1OA 5T1DB 2HZ8A 3DD7A 4WJ0A 3V5XA 2AVKA 2B0HA 3HKKA 3NYLA 2HSQA 4G7HF 2CNWD 1CGNA 1OXBA 2W4MA 1Q0MA 3M79A 2D4UA 1H7IA 1GS9A 2HUJA 1YYXA 3X2QC 2HV7A 3ZVRA 1Q0GA 2OEVA 4BJTA 3X1OA 5JLIA 4D4XA 2DGJA 3OA1A 3IQTA 4HFFB 1YZAA 3DAFA 3K7DA 1TFKB 1WTYA 4BJ6A 2WVOA 4B6IA 1CGOA 3M15A 1D1BA 3GEEA 1ORSC 3AG3C 1N1CA 3DZAA 2EPKX 1PCXA 1LVKA 4JURI 4MW8A 4DJ9A 1C02A 4DXWA 2P6VA 2FAPB 3CQZA 4JCHA 4JIOA 3ZTZA 1T01A 4E0IA 3JTLO 2G3KA 1U89A 4H54A 4MVSA 2LFFA 4DOZA 2YVKA 3O39A 4YN0B 3PHF2 3ABLC 3VM6A 3EFOB 2OKUA 4LDQA 3AG2C 4BEMJ 2DB4A 4W8KA 3ABKC 1WGWA 1M6TA 2ZXPA 1ZW2A 2QY9A 2GAQA 1PV3A 1M2VB 2LK4A 2XXAA 2HMQA 1IW7F 3R2PA 1YARO 4MS2A 4CS8C 1I4YA 4KC9A 3I4UA 1HMDA 4JEBA 1WATA 2CW0F 4U5DE 1Q0KA 5GPGB 4IAOA 5B1AC 2R7SA 3GEHA 3MX3A 1E84A 1ZYRF 2Q9CA 2VCAA 3WODF 4IWBA 2J9BA 1Z5ZA 5DQZA 2KC3A 1OKKA 1L3PA 1SMYF 2DI3A 4O6MA 3EGDB 4W8PA 3RQEA 4ULWA 2P0NA 1W2WA 1SR2A 2MHRA 3VF0A 1Q0FA 4WGZA 4KI2A 4E17A 1DOWA 1RKEB 5EK0A 1YLMA 4U5CE 1JAFA 3G4XA 2RD9A 3FOOA 2P7VA 1BBHA 3QTHA 3HLZA 2KSFA 3AGTA 3RQFA 4DVYP 4E7SA 4IRUA 5EGYA 3LS0A 2IBFA 3C63A 3VRCA 2MWQA 5JP7A 5E3AA 1EQ1A 4J7TA 4YT2A 3PCVA 3US6A 5KYXA 1VK5A 1G8XA 1VMAA 2XS8A 3N24A 3R7CA 1A7DA 1MMNA 4O6YA 3ABMC 5L0CA 3C18A 1O5HA 1YA7O 3EHNA 2ICWG 3KYIA 4HFKB 4MVZA 3VAYA 2H7BA 1TFOB 2P61A 4U5BE 2IXOA 5BQHA 4RD9A 1VYKA 5E33A 2Q3TA 3Q7LA 4ONSA 3U3FA 4DBRA 1YAUO 2PP4A 2X51A 3G4ZA 3SYNA 1MNDA 1VYIA 4Z9JA 4JVSA 2JD3A 1OXKA 2WZLA 3ITFA 3NMKA 3U2LA 4LLCA 1VTMP 1TKNA 1H9TA 1S05A 1J8YF 5KYWA 1LE4A 3CAXA 4RBNA 1AEPA 1OCRC 4LDRA 1RJ9B 2R7WA 2RSEB 2QE9A 3QW0A 1ZZPA 5KYUA 2Y3BA 3LJBA 4CDVA 2J9VA 4BJ6C 3TJ5A 4BJ5A 2V3CC 1QSPA 2R25A 1VB5A 4ZLCA 5BQIA 2GFHA 4IARA 1C03A 1D0XA 3GWNA 4PACA 4DRJB 3U0CA 1XZQA 4C7OA 3T6GB 1QQ3A 3EH2A 2R02A 4JJFA 4L6RA 4AE4A 4C3BA 3T6JA 5A6AA 3MYIA 1OQCA 2CCYA 4O79A 5A6KA 2WZFA 5DLJA 1T6IA 3SNHA 3QMKA 1FTSA 2IOQA 3LNMB 1D1AA 2R7UA 1OW7A 4G0HA 2NPUA 3KKBA 3NYMA 4LACB 4XEKA 3T6BA 1SF8A 2FFHA 4OINF 4A2NB 4Q5SF 4XEFA 4Z9HA 3U5SA 1VLTA 1Z6AA 2Y3GA 5TJ5E 3NKEA 1M56C 4MQ9F 1RXQA 4LDKA 1TWGA 2IXNA 1BR2A 3QVYA 3LEOA 1FMVA 3ASNC 3O55A 4IB4A 4NTBA 3MBGA 5JSLA 3W2VA 3IHUA 4CDYA 4FAPB 3DWWA 2ZPAA 4XQ1A 3NG1A 4OD4A 2PBEA 2D5RB 2YL0A 4A4AA 4JTAB 3UGOA 1LI5A 3AQCA 4NC3A 3V5ZA 2KGOA 2NG1A 1J8MF 5EHHA 5AC5A 1Y4CA 3NDBB 2QNLA 1HW1A 5L0HA 3LUTB 1NZEA 3C8GA 2Q00A 3RH3A 4EHPA 2VC9A 1E2XA 3UMIA 4E7ZA 4Q4ZF 4YJWA 3NRHA 1YVIA 4PJNA 2M4EA 3OWTA 1LS1A 1VLSA 3TQOA 3TJ6A 1Z3IX 4OIRF 3ATPA 3U3BA 5A6BD 4JTDB 2J8WA 3IQ5A 5A6JA 4I1MA 2JPUA 1JOGA 4KNVA 3JYYA 5DS6A 2TMVP 2J9UA 2PX0A 4U5GA 1NFOA 5L0DA 5COGA 3RVYA 3V5YA 4YWQA 4XWJA 4EIYA 2ZXOA 1MQVA 1Z63A 4CSAC 1EA8A 1ZHTA 2YL7A 5JUAA 5T3TA 3ZSUA 3POVA 1NFNA 3AQBA 3KPHA 2GWWA 3S29A 4E18A 3K1IA 1T5OA 3L34A 3Q6MA 2C04A 3RFYA 5L0FA 2QLAA 1ZVZA 4BJ1A 4YT5A 1T9KA 2R7VA 2J9WA 2L6HA 1QLEC 2LSEA 2OCCC 2HV6A 1PD1A 2KYHA 2PX3A 5FCLA 2J7PA 3QZCA 5L0IA 1KTMA 2YL1A 3WG7C 3IPMO 1OW6A 1ZHWA 3F47A 4BJ5C 4PFOA 1AUEA 3JT1A 3CSKA 4U5HA 1ST6A 1MNEA 4XPYA 2C03A 4CDAA 5F5HA 1LM3B 2WZGA 3Q6NA 4J32B 5CIVA 3JZ0A 1TWCA 5DQTA 1MMGA 2W4BA 2E87A 1WWPA 3EFOA 3AOUA 3A9CA 4JKVA 2WB7A 2MYSA 1K40A 3E9VA 1YDIA 5COFA 1DOVA 2I15A 1M2VA 3JRTA 4LERA 1VOMA 1B68A 3N0TA 2EIKC 1CPQA 2YLIA 5HV9A 3L0IA 4YT8A 3WHNA 3UNGC 3W2WA 4XLNF 1M57C 2Q4FA 3ZIBA 1LKXA 2IYLD 2J0WA 2XRHA 4HEAJ 4ZLDA 2Y69C 3DAGA 3JYHA 2R7OA 3WAQA 2EIJC 2XLWA 1HMOA 2ZXRA 3FMSA 1H9GA 3FAJA 3FOPA 2XM4A 4U9DA 3U8PA 4K7BA 1QKRA 4MVOA 5KYXB 4EBBA 2NUTA 1A41A 4G7OF 4CBEA 2OOCA 2O9XA 1RKEA 5F28E 1R5ID 1M2OA 3LNRA 3RKOF 3KH2A 1ORJA 3S9OA 3ZWIA 2VB6A 3LS1A 3NMJA 4CSAA 2AWYA 1FNTc 4U5EE 3JRMO 4JJGA 3QW1A 3V7OA 2AP3A 5KYNA 1V4AA 4DRIB 2HKVA 4FESA 5D91A 5L3VA 3HNLA 2R7RA 1BR1A 2WL8A 4FX5A 4GYTA 3SXMA 3C8ZA 4E0HA 3M4CA 2WVQA 2HS5A 4PJLA 2A0UA 4JEAA 1E86A 3EH1A 4MW3A 3BEHA 3HJCA 3SP1A 1RMVA 2EPMX 3L8JA 2J0XA 1E83A 1HE9A 1LS4A 1OW8A 1OCZC 2OEXA 4EUKB 3ZG1A 5KYUB 1WOLA 3TULA 3FVYA 1GM5A 4G7ZF 4IAQA 1O87A 2UUHA 2L6GA 3B9QA 4N6CA 3TOLA 4P9TA 5KYYA 4C7OB 2YZSA 1OR3A 2EPLX 1HE1A 4H4KC 3SXZA 1JMWA 1OCCC 4MNDA 3GANA 1I4ZA 4I3MA 5AGFA 4ANJA 2A0BA 1LIHA 1RJ9A 2NSFA 2OQMA 3JSZA 3K1IC 4WABA 2J7PD 2EINC 4DVZA 1BR4A 5L3QA 3FHDA 4M63A 1FFTC 2YHSA 4EWCA 4PFPA 3EZHA 3C62A 2GA0A 3NYJA 3RIPA 3IQ6A 3LLIA 4YT4A 1C17M 1K05A 1XWJA 1ZHYA 2YLDA 3TOMA 2EILC 4EBKA 3GWLA 3LLKA 3SZRA 2BC5A 2UUIA 1YYJA 1A0BA 2A6EF 3AGUA 1UFBA 3HTKC 1XZPA 5JS5A 1ZHXA 4C3DA 1OKKD 3DM9B 3PDMP 4JE9A 1D0YA 3EG9B 3LESA 4MVQA 1WASA 5COMA 5DVWA 3W4YA 4QDLA 3JSEO 2NUPB 2KJGA 3RF3A 3HNJA 4JC7A 4PK4A 1IZMA 3ECSA 2OG2A 1ORYA 4J7YA 5D92A 3F46A 1JPNA 3GEIA 3I5PA 4MVMA 4QI0A 1BZ4A 1JRAA 2Q7RA 2XLVA 3EGXA 4FWVA 4PJMA 1ZU5A 4MVUA 2J45A 4NTFA 1TR2A 1BDJB 4ULVA 4DRHB 4G78A 2OJQA 3NMIA 2R7TA 2EPNA 2L7AA 2YEVA 2I8BA 2XLOA 2OJED 2XL6A 2BE5F 3L8IA 1TQGA 2XL4A 3W8HA 2ZD9A 2A68F 2P1AA 3DE9A 3H2VA 3HNKA 4CJGA 2QTVA 4F4BA 4BEJA 4UDVA 4CS7A 2L6FA 4K0DA 3EHMA 1SZIA 2V26A 3K66A 4R32A 3B0VC 2Y3HA 3O6XA 4JW1A 4YL3A 2YRFA 2A1DD 4Z9IA 1NSGB 2QUPA 4AL0A 3S90A 3RQGA 4CJOA 2ASRA 3J06A 3DMDA 1G4US 3IQCA 2XLHA 3BRJA 1YZCA 3U9JA 2KK1A 2G62A 4EBJA 3DXJF 4BG0A 5CI9A 3KMIA 3TK0A 2L9JA 1KU2A 2XS1A 3C7JA 4D4NA 2KW3C 4JZAA 1V54C 1K04A 1FR0A 4XPXA 3HNIA 4N06A 3H2UA 4OD5A 1KNYA 3CEXA 4Q7CA 3Q7GA 2ZXWC 3ASOC 2HFIA 2Y3DA 2LFDA 1FAPB 3SEOA 5DS4A 5BUOA 4NTAA 3GODA 1R4TA 2PFDA 4YL0A 2JX0A 2W9YA 4DBQA 1APCA 4YK5A 2XXAB 5B3IA 2EPOA 3T4RA 4XTKA 5T3WA 256BA 1U6HA 4C3EA 3KYJA 4WGYA 3O10A 1T6QA 2DYSC 4PJJA 2Q9AA 3FAPB 4AL1A 3RVZA 3GM2A 4U5FE 3B29A
chains in the Genus database with same CATH topology
3AG4C 3ZC4A 5E3CA 2VH3A 3W8IA 2R7XA 3S27A 3NKDA 2PF4E 4QI2A 2Q9BA 4OIPF 3IEEA 1ZHZA 3N2ZB 2H7VC 3X1OA 1D0ZA 3UMHA 3I5QA 4CS9C 2DYRC 3EGDA 1MMAA 3VYWA 1ZU4A 2B0JA 2A69F 4O7GA 2NUTB 3MLGA 1NG1A 3K33A 1NU9C 4J30B 3UGPA 3LAYA 4XLPF 2G3VA 2IXMA 3DM5A 2CNWA 3K1HA 1TWHA 2J46A 2H7OA 2KNHA 3UMKA 2WVNA 4EWCA 4HE8D 5KYWB 2Y39A 3EQLF 3PMRA 4KNWA 3LEVA 3DJNB 3TD7A 2CGEA 4OIQF 4AK9A 3EZIA 4KBLA 1FMWA 1FFHA 4CIHA 2CDQA 3AG1C 4AE4B 5KYYB 4IJJA 3DJUB 2L81A 3H65A 5F5FA 5E2QA 3B0UX 3M1CB 1JPJA 5B1BC 4NY3A 1Z23A 2VASA 4I44A 1S7ZA 3E70C 5B3SC 3S0XA 3EJNA 2IXPA 2A6HF 3JCUQ 3KL4A 5IY5C 2R7QA 3UR3C 4CS8A 1D1CA 2FGYA 5HSWA 3K6BA 1TWAA 1QZXA 3RYLA 4CS9A 4I1OB 3FDQA 1MMDA 2Z15A 2EIMC 4GEHA 4LLEA 1PD0A 4OIOF 3OEOA 3B0PA 3EPVA 4RDAA 2W45A 1OCOC 4X0RA 3CZ6A 3EGXB 1NU7D 5CI8A 4O6NA 2KQ9A 5DS5A 4AX2A 3EG9A 4P6IC 2XSEA 1V55C 3S28A 2NUPA 5T1DB 3DD7A 4WJ0A 3NYLA 4G7HF 2CNWD 2W4MA 3X2QC 2HV7A 3ZVRA 4BJTA 2DGJA 3OA1A 4HFFB 3DAFA 3K7DA 4BJ6A 2WVOA 4B6IA 1D1BA 3AG3C 1N1CA 3DZAA 1PCXA 1LVKA 4JURI 2P6VA 3CQZA 4JCHA 2G3KA 4DOZA 3O39A 4YN0B 3PHF2 3ABLC 3EFOB 3AG2C 4W8KA 3ABKC 1WGWA 2ZXPA 2QY9A 1M2VB 2XXAA 1IW7F 4CS8C 4KC9A 3I4UA 4U5DE 2CW0F 5B1AC 4IAOA 2R7SA 3MX3A 1ZYRF 2Q9CA 3WODF 4IWBA 1Z5ZA 5DQZA 1OKKA 1SMYF 4O6MA 3EGDB 4ULWA 1W2WA 4KI2A 4U5CE 2P7VA 3HLZA 4E7SA 4DVYP 4IRUA 5EGYA 3LS0A 2MWQA 5E3AA 4YT2A 5KYXA 1VK5A 3N24A 1G8XA 1VMAA 1MMNA 4O6YA 3ABMC 1O5HA 3EHNA 4HFKB 3VAYA 2H7BA 4U5BE 2IXOA 4RD9A 1VYKA 5E33A 2Q3TA 3Q7LA 4DBRA 2X51A 2PP4A 3SYNA 1MNDA 1VYIA 4JVSA 2JD3A 3ITFA 2WZLA 2R7TA 4LLCA 1TKNA 1J8YF 5KYWA 4RBNA 1OCRC 1RJ9B 2R7WA 5KYUA 2Y3BA 3LJBA 2J9VA 4BJ6C 4BJ5A 2V3CC 4ZLCA 2GFHA 1D0XA 4C7OA 4AE4A 3EH2A 4JJFA 4C3BA 3T6JA 4O79A 2WZFA 5DLJA 3SNHA 3QMKA 1FTSA 2IOQA 1D1AA 2R7UA 4G0HA 3KKBA 3NYMA 4LACB 3T6BA 1SF8A 2FFHA 4OINF 4A2NB 4Q5SF 1Z6AA 2Y3GA 3NKEA 1M56C 4MQ9F 1TWGA 2IXNA 1BR2A 1FMVA 3ASNC 3W2VA 2ZPAA 3NG1A 4OD4A 2D5RB 3UGOA 3AQCA 2KGOA 2NG1A 1J8MF 5EHHA 3NDBB 1NZEA 3RH3A 4E7ZA 3UMIA 4Q4ZF 4YJWA 3NRHA 4PJNA 2M4EA 3OWTA 1LS1A 1Z3IX 4OIRF 4I1MA 4KNVA 5DS6A 2J9UA 2PX0A 4U5GA 4YWQA 4XWJA 2ZXOA 1Z63A 4CSAC 1ZHTA 5T3TA 3ZSUA 3POVA 3AQBA 3S29A 3Q6MA 3L34A 2C04A 3RFYA 4BJ1A 4YT5A 2R7VA 2J9WA 1QLEC 2LSEA 2OCCC 2HV6A 1PD1A 2PX3A 5FCLA 2J7PA 3QZCA 3WG7C 1ZHWA 3F47A 4BJ5C 4PFOA 3JT1A 3CSKA 4U5HA 1ST6A 1MNEA 2C03A 5F5HA 2WZGA 3Q6NA 4J32B 1TWCA 5DQTA 1MMGA 2W4BA 2E87A 3EFOA 2WB7A 2MYSA 3E9VA 1M2VA 3JRTA 4LERA 1VOMA 3N0TA 2EIKC 3L0IA 4YT8A 3UNGC 3W2WA 4XLNF 1M57C 3ZIBA 1LKXA 2IYLD 2J0WA 2XRHA 4HEAJ 4ZLDA 2Y69C 3DAGA 3JYHA 2R7OA 2EIJC 2ZXRA 3FAJA 4K7BA 5KYXB 4EBBA 2NUTA 4G7OF 4CBEA 2O9XA 1M2OA 3LNRA 3RKOF 3KH2A 2VB6A 3LS1A 4CSAA 4U5EE 4JJGA 3V7OA 5KYNA 5L3VA 4FESA 5D91A 2R7RA 1BR1A 2WL8A 4FX5A 4GYTA 2WVQA 4PJLA 3EH1A 3HJCA 3SP1A 2J0XA 1OCZC 5KYUB 3ZG1A 3FVYA 4G7ZF 1O87A 3B9QA 5KYYA 4C7OB 2YZSA 4H4KC 1OCCC 4MNDA 3GANA 4ANJA 4I3MA 1RJ9A 3JSZA 3K1IC 2J7PD 2EINC 4DVZA 1BR4A 5L3QA 3FHDA 4M63A 1FFTC 2YHSA 4PFPA 3EZHA 3NYJA 3RIPA 3LLIA 4YT4A 1ZHYA 2EILC 3LLKA 3SZRA 2A6EF 3HTKC 1ZHXA 4C3DA 1OKKD 3DM9B 5DVWA 1D0YA 3EG9B 3LESA 4QDLA 2NUPB 2KJGA 4PK4A 1IZMA 3ECSA 2OG2A 5D92A 3F46A 1JPNA 3I5PA 4QI0A 3EGXA 4FWVA 4PJMA 1ZU5A 2J45A 1TR2A 2YEVA 2I8BA 3W8HA 2BE5F 2XL4A 2A68F 4F4BA 2QTVA 4BEJA 4CS7A 4K0DA 3EHMA 1SZIA 3K66A 2V26A 3B0VC 2Y3HA 3O6XA 4JW1A 2A1DD 3DMDA 2G62A 3DXJF 4BG0A 5CI9A 3KMIA 2L9JA 1KU2A 2KW3C 4JZAA 1V54C 4N06A 4OD5A 4Q7CA 3Q7GA 2ZXWC 3ASOC 2Y3DA 5DS4A 3SEOA 5BUOA 3GODA 2XXAB 2PFDA 4DBQA 2W9YA 3T4RA 4XTKA 5T3WA 4C3EA 2DYSC 4PJJA 2Q9AA 4U5FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H F;  4OIO F;  4KI2 A;  3UGP A;  1KU2 A;  4Q4Z F;  4XLP F;  4OIN F;  4XLN F;  4Q5S F;  2BE5 F;  1IW7 F;  4MQ9 F;  2A68 F;  4OIP F;  2A6H F;  4OIR F;  3EQL F;  2A6E F;  3LEV A;  2CW0 F;  4OIQ F;  3LES A;  1ZYR F;  3WOD F;  4G7Z F;  4G7O F;  3UGO A;  1SMY F;  2A69 F;  3DXJ F; 
#chains in the Genus database with same CATH topology
 3AG4 C;  1OR2 A;  4N4W A;  3ZC4 A;  1U0B B;  5E3C A;  2VH3 A;  3W8I A;  2CYD A;  2R7X A;  2OU6 A;  3U9M A;  1F1M A;  1G5Z A;  4MTF A;  3S27 A;  3GM1 A;  1Y6D A;  1AVO B;  3ZQY A;  4JTC B;  3NKD A;  2LCH A;  1Z7Q c;  2PF4 E;  4QI2 A;  4JCZ A;  1WN0 A;  2Q9B A;  4OIP F;  2XLE A;  3MYF A;  5K0I A;  1RCP A;  3IEE A;  4XEV A;  1ZHZ A;  3N2Z B;  4EKW A;  2HSB A;  2H7V C;  3AJM A;  1QVX A;  2H8A A;  4NCQ A;  2R03 A;  4YL1 A;  1D0Z A;  4U9E A;  2R05 A;  3I5Q A;  3UMH A;  2NSG A;  3SXK A;  5AC4 A;  4CS9 C;  1E85 A;  4PR9 A;  2DYR C;  3EGD A;  1MMA A;  3VYW A;  1ZU4 A;  3DI5 A;  2B0J A;  2A69 F;  2IM8 A;  2HMZ A;  3C8G D;  4O7G A;  2NUT B;  3MLG A;  1NG1 A;  2XLM A;  3K33 A;  1NU9 C;  4J30 B;  3UGP A;  3QVZ A;  2XL8 A;  3LAY A;  4XLP F;  2G3V A;  2M64 A;  2IXM A;  3DM5 A;  3G50 A;  2CNW A;  3K1H A;  4NQF A;  1TWH A;  2J46 A;  2H7O A;  2KNH A;  2LD6 A;  2PNO A;  1ZW3 A;  2WVN A;  3DE8 A;  1LE2 A;  4HE8 D;  3UMK A;  1HW2 A;  4BPM A;  2YKZ A;  1CGM E;  5KYW B;  1SYQ A;  1A7V A;  2F22 A;  2Y39 A;  3EQL F;  3GM3 A;  3DJN B;  3LEV A;  1LI7 A;  3PMR A;  4KNW A;  3TD7 A;  4CIP A;  1RKC A;  2CGE A;  4OIQ F;  1CPR A;  4AK9 A;  3EZI A;  3MFN A;  5A6B A;  4CX9 A;  4KBL A;  1FMW A;  1FFH A;  2R9R B;  1Q0D A;  2CDQ A;  5FZT A;  4CIH A;  3AG1 C;  5L0J A;  4IGG A;  4AE4 B;  5KYY B;  4IJJ A;  5JVE A;  1I5N A;  2L81 A;  3DJU B;  3RW0 A;  2XLD A;  3L1M A;  2BL2 A;  3H65 A;  5F5F A;  1NBB A;  5E2Q A;  3A11 A;  3B0U X;  3M1C B;  1JPJ A;  1EKY A;  4ER9 A;  5B1B C;  2YL3 A;  3M4B A;  4NY3 A;  2GDC A;  2HJM A;  1Z23 A;  2LQG A;  2VAS A;  2HJ3 A;  1YA9 A;  4I44 A;  1S7Z A;  3E70 C;  3B71 A;  1O3U A;  1G4W R;  5B3S C;  5L0G A;  3DKA A;  3S0X A;  3EJN A;  2IXP A;  2A6H F;  3GOR A;  3JCU Q;  3KL4 A;  5IY5 C;  2R7Q A;  2YLG A;  3UR3 C;  1NLX A;  4CS8 A;  1LPE A;  1D1C A;  2LIG A;  3SXY A;  1V74 B;  2FGY A;  2YQY A;  2VCB A;  4MVR A;  5HSW A;  3K6B A;  2ETS A;  1TWA A;  1QZX A;  3RYL A;  2LP4 A;  1HY5 A;  4CS9 A;  4I1O B;  4XPW A;  1MMD A;  1YJG A;  2XM0 A;  3FDQ A;  2Z15 A;  3ZDL A;  2AWC A;  5A69 A;  1EI7 A;  2EIM C;  4GEH A;  4LLE A;  1H6G A;  1PD0 A;  1GQA A;  2VCC A;  4N6H A;  2X0C A;  4OIO F;  1L7C A;  3OEO A;  3U2M A;  4P9F A;  3ZTM A;  3S84 A;  1T6U A;  3B0P A;  3EPV A;  3FXH A;  2W45 A;  1OCO C;  4RDA A;  4X0R A;  3U8V A;  1UG7 A;  2AU5 A;  3CZ6 A;  3EGX B;  3ZQV A;  3C8G B;  1NU7 D;  1QPU A;  5CI8 A;  4O6N A;  5JT4 A;  2KQ9 A;  5DS5 A;  4AX2 A;  1GGQ A;  2YWA A;  3EG9 A;  2XSE A;  4MTO A;  1V55 C;  4GQH A;  1JR8 A;  4P6I C;  5BQG A;  3S28 A;  3T9O A;  4MTG A;  2NUP A;  5JRA A;  1A7E A;  4JRZ A;  4K1O A;  5T1D B;  2HZ8 A;  3DD7 A;  4WJ0 A;  3V5X A;  2AVK A;  2B0H A;  3HKK A;  3NYL A;  2HSQ A;  4G7H F;  2CNW D;  1CGN A;  1OXB A;  2W4M A;  1Q0M A;  3M79 A;  2D4U A;  1H7I A;  1GS9 A;  2HUJ A;  1YYX A;  3X2Q C;  2HV7 A;  3ZVR A;  1Q0G A;  2OEV A;  4BJT A;  3X1O A;  5JLI A;  4D4X A;  2DGJ A;  3OA1 A;  3IQT A;  4HFF B;  1YZA A;  3DAF A;  3K7D A;  1TFK B;  1WTY A;  4BJ6 A;  2WVO A;  4B6I A;  1CGO A;  3M15 A;  1D1B A;  3GEE A;  1ORS C;  3AG3 C;  1N1C A;  3DZA A;  2EPK X;  1PCX A;  1LVK A;  4JUR I;  4MW8 A;  4DJ9 A;  1C02 A;  4DXW A;  2P6V A;  2FAP B;  3CQZ A;  4JCH A;  4JIO A;  3ZTZ A;  1T01 A;  4E0I A;  3JTL O;  2G3K A;  1U89 A;  4H54 A;  4MVS A;  2LFF A;  4DOZ A;  2YVK A;  3O39 A;  4YN0 B;  3PHF 2;  3ABL C;  3VM6 A;  3EFO B;  2OKU A;  4LDQ A;  3AG2 C;  4BEM J;  2DB4 A;  4W8K A;  3ABK C;  1WGW A;  1M6T A;  2ZXP A;  1ZW2 A;  2QY9 A;  2GAQ A;  1PV3 A;  1M2V B;  2LK4 A;  2XXA A;  2HMQ A;  1IW7 F;  3R2P A;  1YAR O;  4MS2 A;  4CS8 C;  1I4Y A;  4KC9 A;  3I4U A;  1HMD A;  4JEB A;  1WAT A;  2CW0 F;  4U5D E;  1Q0K A;  5GPG B;  4IAO A;  5B1A C;  2R7S A;  3GEH A;  3MX3 A;  1E84 A;  1ZYR F;  2Q9C A;  2VCA A;  3WOD F;  4IWB A;  2J9B A;  1Z5Z A;  5DQZ A;  2KC3 A;  1OKK A;  1L3P A;  1SMY F;  2DI3 A;  4O6M A;  3EGD B;  4W8P A;  3RQE A;  4ULW A;  2P0N A;  1W2W A;  1SR2 A;  2MHR A;  3VF0 A;  1Q0F A;  4WGZ A;  4KI2 A;  4E17 A;  1DOW A;  1RKE B;  5EK0 A;  1YLM A;  4U5C E;  1JAF A;  3G4X A;  2RD9 A;  3FOO A;  2P7V A;  1BBH A;  3QTH A;  3HLZ A;  2KSF A;  3AGT A;  3RQF A;  4DVY P;  4E7S A;  4IRU A;  5EGY A;  3LS0 A;  2IBF A;  3C63 A;  3VRC A;  2MWQ A;  5JP7 A;  5E3A A;  1EQ1 A;  4J7T A;  4YT2 A;  3PCV A;  3US6 A;  5KYX A;  1VK5 A;  1G8X A;  1VMA A;  2XS8 A;  3N24 A;  3R7C A;  1A7D A;  1MMN A;  4O6Y A;  3ABM C;  5L0C A;  3C18 A;  1O5H A;  1YA7 O;  3EHN A;  2ICW G;  3KYI A;  4HFK B;  4MVZ A;  3VAY A;  2H7B A;  1TFO B;  2P61 A;  4U5B E;  2IXO A;  5BQH A;  4RD9 A;  1VYK A;  5E33 A;  2Q3T A;  3Q7L A;  4ONS A;  3U3F A;  4DBR A;  1YAU O;  2PP4 A;  2X51 A;  3G4Z A;  3SYN A;  1MND A;  1VYI A;  4Z9J A;  4JVS A;  2JD3 A;  1OXK A;  2WZL A;  3ITF A;  3NMK A;  3U2L A;  4LLC A;  1VTM P;  1TKN A;  1H9T A;  1S05 A;  1J8Y F;  5KYW A;  1LE4 A;  3CAX A;  4RBN A;  1AEP A;  1OCR C;  4LDR A;  1RJ9 B;  2R7W A;  2RSE B;  2QE9 A;  3QW0 A;  1ZZP A;  5KYU A;  2Y3B A;  3LJB A;  4CDV A;  2J9V A;  4BJ6 C;  3TJ5 A;  4BJ5 A;  2V3C C;  1QSP A;  2R25 A;  1VB5 A;  4ZLC A;  5BQI A;  2GFH A;  4IAR A;  1C03 A;  1D0X A;  3GWN A;  4PAC A;  4DRJ B;  3U0C A;  1XZQ A;  4C7O A;  3T6G B;  1QQ3 A;  3EH2 A;  2R02 A;  4JJF A;  4L6R A;  4AE4 A;  4C3B A;  3T6J A;  5A6A A;  3MYI A;  1OQC A;  2CCY A;  4O79 A;  5A6K A;  2WZF A;  5DLJ A;  1T6I A;  3SNH A;  3QMK A;  1FTS A;  2IOQ A;  3LNM B;  1D1A A;  2R7U A;  1OW7 A;  4G0H A;  2NPU A;  3KKB A;  3NYM A;  4LAC B;  4XEK A;  3T6B A;  1SF8 A;  2FFH A;  4OIN F;  4A2N B;  4Q5S F;  4XEF A;  4Z9H A;  3U5S A;  1VLT A;  1Z6A A;  2Y3G A;  5TJ5 E;  3NKE A;  1M56 C;  4MQ9 F;  1RXQ A;  4LDK A;  1TWG A;  2IXN A;  1BR2 A;  3QVY A;  3LEO A;  1FMV A;  3ASN C;  3O55 A;  4IB4 A;  4NTB A;  3MBG A;  5JSL A;  3W2V A;  3IHU A;  4CDY A;  4FAP B;  3DWW A;  2ZPA A;  4XQ1 A;  3NG1 A;  4OD4 A;  2PBE A;  2D5R B;  2YL0 A;  4A4A A;  4JTA B;  3UGO A;  1LI5 A;  3AQC A;  4NC3 A;  3V5Z A;  2KGO A;  2NG1 A;  1J8M F;  5EHH A;  5AC5 A;  1Y4C A;  3NDB B;  2QNL A;  1HW1 A;  5L0H A;  3LUT B;  1NZE A;  3C8G A;  2Q00 A;  3RH3 A;  4EHP A;  2VC9 A;  1E2X A;  3UMI A;  4E7Z A;  4Q4Z F;  4YJW A;  3NRH A;  1YVI A;  4PJN A;  2M4E A;  3OWT A;  1LS1 A;  1VLS A;  3TQO A;  3TJ6 A;  1Z3I X;  4OIR F;  3ATP A;  3U3B A;  5A6B D;  4JTD B;  2J8W A;  3IQ5 A;  5A6J A;  4I1M A;  2JPU A;  1JOG A;  4KNV A;  3JYY A;  5DS6 A;  2TMV P;  2J9U A;  2PX0 A;  4U5G A;  1NFO A;  5L0D A;  5COG A;  3RVY A;  3V5Y A;  4YWQ A;  4XWJ A;  4EIY A;  2ZXO A;  1MQV A;  1Z63 A;  4CSA C;  1EA8 A;  1ZHT A;  2YL7 A;  5JUA A;  5T3T A;  3ZSU A;  3POV A;  1NFN A;  3AQB A;  3KPH A;  2GWW A;  3S29 A;  4E18 A;  3K1I A;  1T5O A;  3L34 A;  3Q6M A;  2C04 A;  3RFY A;  5L0F A;  2QLA A;  1ZVZ A;  4BJ1 A;  4YT5 A;  1T9K A;  2R7V A;  2J9W A;  2L6H A;  1QLE C;  2LSE A;  2OCC C;  2HV6 A;  1PD1 A;  2KYH A;  2PX3 A;  5FCL A;  2J7P A;  3QZC A;  5L0I A;  1KTM A;  2YL1 A;  3WG7 C;  3IPM O;  1OW6 A;  1ZHW A;  3F47 A;  4BJ5 C;  4PFO A;  1AUE A;  3JT1 A;  3CSK A;  4U5H A;  1ST6 A;  1MNE A;  4XPY A;  2C03 A;  4CDA A;  5F5H A;  1LM3 B;  2WZG A;  3Q6N A;  4J32 B;  5CIV A;  3JZ0 A;  1TWC A;  5DQT A;  1MMG A;  2W4B A;  2E87 A;  1WWP A;  3EFO A;  3AOU A;  3A9C A;  4JKV A;  2WB7 A;  2MYS A;  1K40 A;  3E9V A;  1YDI A;  5COF A;  1DOV A;  2I15 A;  1M2V A;  3JRT A;  4LER A;  1VOM A;  1B68 A;  3N0T A;  2EIK C;  1CPQ A;  2YLI A;  5HV9 A;  3L0I A;  4YT8 A;  3WHN A;  3UNG C;  3W2W A;  4XLN F;  1M57 C;  2Q4F A;  3ZIB A;  1LKX A;  2IYL D;  2J0W A;  2XRH A;  4HEA J;  4ZLD A;  2Y69 C;  3DAG A;  3JYH A;  2R7O A;  3WAQ A;  2EIJ C;  2XLW A;  1HMO A;  2ZXR A;  3FMS A;  1H9G A;  3FAJ A;  3FOP A;  2XM4 A;  4U9D A;  3U8P A;  4K7B A;  1QKR A;  4MVO A;  5KYX B;  4EBB A;  2NUT A;  1A41 A;  4G7O F;  4CBE A;  2OOC A;  2O9X A;  1RKE A;  5F28 E;  1R5I D;  1M2O A;  3LNR A;  3RKO F;  3KH2 A;  1ORJ A;  3S9O A;  3ZWI A;  2VB6 A;  3LS1 A;  3NMJ A;  4CSA A;  2AWY A;  1FNT c;  4U5E E;  3JRM O;  4JJG A;  3QW1 A;  3V7O A;  2AP3 A;  5KYN A;  1V4A A;  4DRI B;  2HKV A;  4FES A;  5D91 A;  5L3V A;  3HNL A;  2R7R A;  1BR1 A;  2WL8 A;  4FX5 A;  4GYT A;  3SXM A;  3C8Z A;  4E0H A;  3M4C A;  2WVQ A;  2HS5 A;  4PJL A;  2A0U A;  4JEA A;  1E86 A;  3EH1 A;  4MW3 A;  3BEH A;  3HJC A;  3SP1 A;  1RMV A;  2EPM X;  3L8J A;  2J0X A;  1E83 A;  1HE9 A;  1LS4 A;  1OW8 A;  1OCZ C;  2OEX A;  4EUK B;  3ZG1 A;  5KYU B;  1WOL A;  3TUL A;  3FVY A;  1GM5 A;  4G7Z F;  4IAQ A;  1O87 A;  2UUH A;  2L6G A;  3B9Q A;  4N6C A;  3TOL A;  4P9T A;  5KYY A;  4C7O B;  2YZS A;  1OR3 A;  2EPL X;  1HE1 A;  4H4K C;  3SXZ A;  1JMW A;  1OCC C;  4MND A;  3GAN A;  1I4Z A;  4I3M A;  5AGF A;  4ANJ A;  2A0B A;  1LIH A;  1RJ9 A;  2NSF A;  2OQM A;  3JSZ A;  3K1I C;  4WAB A;  2J7P D;  2EIN C;  4DVZ A;  1BR4 A;  5L3Q A;  3FHD A;  4M63 A;  1FFT C;  2YHS A;  4EWC A;  4PFP A;  3EZH A;  3C62 A;  2GA0 A;  3NYJ A;  3RIP A;  3IQ6 A;  3LLI A;  4YT4 A;  1C17 M;  1K05 A;  1XWJ A;  1ZHY A;  2YLD A;  3TOM A;  2EIL C;  4EBK A;  3GWL A;  3LLK A;  3SZR A;  2BC5 A;  2UUI A;  1YYJ A;  1A0B A;  2A6E F;  3AGU A;  1UFB A;  3HTK C;  1XZP A;  5JS5 A;  1ZHX A;  4C3D A;  1OKK D;  3DM9 B;  3PDM P;  4JE9 A;  1D0Y A;  3EG9 B;  3LES A;  4MVQ A;  1WAS A;  5COM A;  5DVW A;  3W4Y A;  4QDL A;  3JSE O;  2NUP B;  2KJG A;  3RF3 A;  3HNJ A;  4JC7 A;  4PK4 A;  1IZM A;  3ECS A;  2OG2 A;  1ORY A;  4J7Y A;  5D92 A;  3F46 A;  1JPN A;  3GEI A;  3I5P A;  4MVM A;  4QI0 A;  1BZ4 A;  1JRA A;  2Q7R A;  2XLV A;  3EGX A;  4FWV A;  4PJM A;  1ZU5 A;  4MVU A;  2J45 A;  4NTF A;  1TR2 A;  1BDJ B;  4ULV A;  4DRH B;  4G78 A;  2OJQ A;  3NMI A;  2R7T A;  2EPN A;  2L7A A;  2YEV A;  2I8B A;  2XLO A;  2OJE D;  2XL6 A;  2BE5 F;  3L8I A;  1TQG A;  2XL4 A;  3W8H A;  2ZD9 A;  2A68 F;  2P1A A;  3DE9 A;  3H2V A;  3HNK A;  4CJG A;  2QTV A;  4F4B A;  4BEJ A;  4UDV A;  4CS7 A;  2L6F A;  4K0D A;  3EHM A;  1SZI A;  2V26 A;  3K66 A;  4R32 A;  3B0V C;  2Y3H A;  3O6X A;  4JW1 A;  4YL3 A;  2YRF A;  2A1D D;  4Z9I A;  1NSG B;  2QUP A;  4AL0 A;  3S90 A;  3RQG A;  4CJO A;  2ASR A;  3J06 A;  3DMD A;  1G4U S;  3IQC A;  2XLH A;  3BRJ A;  1YZC A;  3U9J A;  2KK1 A;  2G62 A;  4EBJ A;  3DXJ F;  4BG0 A;  5CI9 A;  3KMI A;  3TK0 A;  2L9J A;  1KU2 A;  2XS1 A;  3C7J A;  4D4N A;  2KW3 C;  4JZA A;  1V54 C;  1K04 A;  1FR0 A;  4XPX A;  3HNI A;  4N06 A;  3H2U A;  4OD5 A;  1KNY A;  3CEX A;  4Q7C A;  3Q7G A;  2ZXW C;  3ASO C;  2HFI A;  2Y3D A;  2LFD A;  1FAP B;  3SEO A;  5DS4 A;  5BUO A;  4NTA A;  3GOD A;  1R4T A;  2PFD A;  4YL0 A;  2JX0 A;  2W9Y A;  4DBQ A;  1APC A;  4YK5 A;  2XXA B;  5B3I A;  2EPO A;  3T4R A;  4XTK A;  5T3W A;  256B A;  1U6H A;  4C3E A;  3KYJ A;  4WGY A;  3O10 A;  1T6Q A;  2DYS C;  4PJJ A;  2Q9A A;  3FAP B;  4AL1 A;  3RVZ A;  3GM2 A;  4U5F E;  3B29 A; 
#chains in the Genus database with same CATH homology
 3AG4 C;  3ZC4 A;  5E3C A;  2VH3 A;  3W8I A;  2R7X A;  3S27 A;  3NKD A;  2PF4 E;  4QI2 A;  2Q9B A;  4OIP F;  3IEE A;  1ZHZ A;  3N2Z B;  2H7V C;  3X1O A;  1D0Z A;  3UMH A;  3I5Q A;  4CS9 C;  2DYR C;  3EGD A;  1MMA A;  3VYW A;  1ZU4 A;  2B0J A;  2A69 F;  4O7G A;  2NUT B;  3MLG A;  1NG1 A;  3K33 A;  1NU9 C;  4J30 B;  3UGP A;  3LAY A;  4XLP F;  2G3V A;  2IXM A;  3DM5 A;  2CNW A;  3K1H A;  1TWH A;  2J46 A;  2H7O A;  2KNH A;  3UMK A;  2WVN A;  4EWC A;  4HE8 D;  5KYW B;  2Y39 A;  3EQL F;  3PMR A;  4KNW A;  3LEV A;  3DJN B;  3TD7 A;  2CGE A;  4OIQ F;  4AK9 A;  3EZI A;  4KBL A;  1FMW A;  1FFH A;  4CIH A;  2CDQ A;  3AG1 C;  4AE4 B;  5KYY B;  4IJJ A;  3DJU B;  2L81 A;  3H65 A;  5F5F A;  5E2Q A;  3B0U X;  3M1C B;  1JPJ A;  5B1B C;  4NY3 A;  1Z23 A;  2VAS A;  4I44 A;  1S7Z A;  3E70 C;  5B3S C;  3S0X A;  3EJN A;  2IXP A;  2A6H F;  3JCU Q;  3KL4 A;  5IY5 C;  2R7Q A;  3UR3 C;  4CS8 A;  1D1C A;  2FGY A;  5HSW A;  3K6B A;  1TWA A;  1QZX A;  3RYL A;  4CS9 A;  4I1O B;  3FDQ A;  1MMD A;  2Z15 A;  2EIM C;  4GEH A;  4LLE A;  1PD0 A;  4OIO F;  3OEO A;  3B0P A;  3EPV A;  4RDA A;  2W45 A;  1OCO C;  4X0R A;  3CZ6 A;  3EGX B;  1NU7 D;  5CI8 A;  4O6N A;  2KQ9 A;  5DS5 A;  4AX2 A;  3EG9 A;  4P6I C;  2XSE A;  1V55 C;  3S28 A;  2NUP A;  5T1D B;  3DD7 A;  4WJ0 A;  3NYL A;  4G7H F;  2CNW D;  2W4M A;  3X2Q C;  2HV7 A;  3ZVR A;  4BJT A;  2DGJ A;  3OA1 A;  4HFF B;  3DAF A;  3K7D A;  4BJ6 A;  2WVO A;  4B6I A;  1D1B A;  3AG3 C;  1N1C A;  3DZA A;  1PCX A;  1LVK A;  4JUR I;  2P6V A;  3CQZ A;  4JCH A;  2G3K A;  4DOZ A;  3O39 A;  4YN0 B;  3PHF 2;  3ABL C;  3EFO B;  3AG2 C;  4W8K A;  3ABK C;  1WGW A;  2ZXP A;  2QY9 A;  1M2V B;  2XXA A;  1IW7 F;  4CS8 C;  4KC9 A;  3I4U A;  4U5D E;  2CW0 F;  5B1A C;  4IAO A;  2R7S A;  3MX3 A;  1ZYR F;  2Q9C A;  3WOD F;  4IWB A;  1Z5Z A;  5DQZ A;  1OKK A;  1SMY F;  4O6M A;  3EGD B;  4ULW A;  1W2W A;  4KI2 A;  4U5C E;  2P7V A;  3HLZ A;  4E7S A;  4DVY P;  4IRU A;  5EGY A;  3LS0 A;  2MWQ A;  5E3A A;  4YT2 A;  5KYX A;  1VK5 A;  3N24 A;  1G8X A;  1VMA A;  1MMN A;  4O6Y A;  3ABM C;  1O5H A;  3EHN A;  4HFK B;  3VAY A;  2H7B A;  4U5B E;  2IXO A;  4RD9 A;  1VYK A;  5E33 A;  2Q3T A;  3Q7L A;  4DBR A;  2X51 A;  2PP4 A;  3SYN A;  1MND A;  1VYI A;  4JVS A;  2JD3 A;  3ITF A;  2WZL A;  2R7T A;  4LLC A;  1TKN A;  1J8Y F;  5KYW A;  4RBN A;  1OCR C;  1RJ9 B;  2R7W A;  5KYU A;  2Y3B A;  3LJB A;  2J9V A;  4BJ6 C;  4BJ5 A;  2V3C C;  4ZLC A;  2GFH A;  1D0X A;  4C7O A;  4AE4 A;  3EH2 A;  4JJF A;  4C3B A;  3T6J A;  4O79 A;  2WZF A;  5DLJ A;  3SNH A;  3QMK A;  1FTS A;  2IOQ A;  1D1A A;  2R7U A;  4G0H A;  3KKB A;  3NYM A;  4LAC B;  3T6B A;  1SF8 A;  2FFH A;  4OIN F;  4A2N B;  4Q5S F;  1Z6A A;  2Y3G A;  3NKE A;  1M56 C;  4MQ9 F;  1TWG A;  2IXN A;  1BR2 A;  1FMV A;  3ASN C;  3W2V A;  2ZPA A;  3NG1 A;  4OD4 A;  2D5R B;  3UGO A;  3AQC A;  2KGO A;  2NG1 A;  1J8M F;  5EHH A;  3NDB B;  1NZE A;  3RH3 A;  4E7Z A;  3UMI A;  4Q4Z F;  4YJW A;  3NRH A;  4PJN A;  2M4E A;  3OWT A;  1LS1 A;  1Z3I X;  4OIR F;  4I1M A;  4KNV A;  5DS6 A;  2J9U A;  2PX0 A;  4U5G A;  4YWQ A;  4XWJ A;  2ZXO A;  1Z63 A;  4CSA C;  1ZHT A;  5T3T A;  3ZSU A;  3POV A;  3AQB A;  3S29 A;  3Q6M A;  3L34 A;  2C04 A;  3RFY A;  4BJ1 A;  4YT5 A;  2R7V A;  2J9W A;  1QLE C;  2LSE A;  2OCC C;  2HV6 A;  1PD1 A;  2PX3 A;  5FCL A;  2J7P A;  3QZC A;  3WG7 C;  1ZHW A;  3F47 A;  4BJ5 C;  4PFO A;  3JT1 A;  3CSK A;  4U5H A;  1ST6 A;  1MNE A;  2C03 A;  5F5H A;  2WZG A;  3Q6N A;  4J32 B;  1TWC A;  5DQT A;  1MMG A;  2W4B A;  2E87 A;  3EFO A;  2WB7 A;  2MYS A;  3E9V A;  1M2V A;  3JRT A;  4LER A;  1VOM A;  3N0T A;  2EIK C;  3L0I A;  4YT8 A;  3UNG C;  3W2W A;  4XLN F;  1M57 C;  3ZIB A;  1LKX A;  2IYL D;  2J0W A;  2XRH A;  4HEA J;  4ZLD A;  2Y69 C;  3DAG A;  3JYH A;  2R7O A;  2EIJ C;  2ZXR A;  3FAJ A;  4K7B A;  5KYX B;  4EBB A;  2NUT A;  4G7O F;  4CBE A;  2O9X A;  1M2O A;  3LNR A;  3RKO F;  3KH2 A;  2VB6 A;  3LS1 A;  4CSA A;  4U5E E;  4JJG A;  3V7O A;  5KYN A;  5L3V A;  4FES A;  5D91 A;  2R7R A;  1BR1 A;  2WL8 A;  4FX5 A;  4GYT A;  2WVQ A;  4PJL A;  3EH1 A;  3HJC A;  3SP1 A;  2J0X A;  1OCZ C;  5KYU B;  3ZG1 A;  3FVY A;  4G7Z F;  1O87 A;  3B9Q A;  5KYY A;  4C7O B;  2YZS A;  4H4K C;  1OCC C;  4MND A;  3GAN A;  4ANJ A;  4I3M A;  1RJ9 A;  3JSZ A;  3K1I C;  2J7P D;  2EIN C;  4DVZ A;  1BR4 A;  5L3Q A;  3FHD A;  4M63 A;  1FFT C;  2YHS A;  4PFP A;  3EZH A;  3NYJ A;  3RIP A;  3LLI A;  4YT4 A;  1ZHY A;  2EIL C;  3LLK A;  3SZR A;  2A6E F;  3HTK C;  1ZHX A;  4C3D A;  1OKK D;  3DM9 B;  5DVW A;  1D0Y A;  3EG9 B;  3LES A;  4QDL A;  2NUP B;  2KJG A;  4PK4 A;  1IZM A;  3ECS A;  2OG2 A;  5D92 A;  3F46 A;  1JPN A;  3I5P A;  4QI0 A;  3EGX A;  4FWV A;  4PJM A;  1ZU5 A;  2J45 A;  1TR2 A;  2YEV A;  2I8B A;  3W8H A;  2BE5 F;  2XL4 A;  2A68 F;  4F4B A;  2QTV A;  4BEJ A;  4CS7 A;  4K0D A;  3EHM A;  1SZI A;  3K66 A;  2V26 A;  3B0V C;  2Y3H A;  3O6X A;  4JW1 A;  2A1D D;  3DMD A;  2G62 A;  3DXJ F;  4BG0 A;  5CI9 A;  3KMI A;  2L9J A;  1KU2 A;  2KW3 C;  4JZA A;  1V54 C;  4N06 A;  4OD5 A;  4Q7C A;  3Q7G A;  2ZXW C;  3ASO C;  2Y3D A;  5DS4 A;  3SEO A;  5BUO A;  3GOD A;  2XXA B;  2PFD A;  4DBQ A;  2W9Y A;  3T4R A;  4XTK A;  5T3W A;  4C3E A;  2DYS C;  4PJJ A;  2Q9A A;  4U5F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...