4KI2A

Crystallographic analysis of an rna-polymerase sigma-subunit fragment complexed with -10 promoter element ssdna
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
178
structure length
178
Chain Sequence
SDPVRQYLHEIGQVPLLTLEEEIDLARKVEEGMEAIKKLSEATGLDQELIREVVRAKILGTARIQKIPGLKEKPDPKTVEEVDGKLKSLPKELKRYLHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAVEKFEYKRRFKFSTYATWWIRQAINRAIADQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*GP*TP*AP*CP*AP*AP*TP*GP*GP*G)-3')
publication title Crystallographic analysis of an RNA polymerase sigma-subunit fragment complexed with -10 promoter element ssDNA: quadruplex formation as a possible tool for engineering crystal contacts in protein-ssDNA complexes.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 65
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2
A PF04542 Sigma70_r2 Sigma-70 region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1810 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ki2A00
3WODF 4XLNF 3LESA 1ZYRF 1SMYF 4Q4ZF 1KU2A 4OIRF 4OIPF 4MQ9F 2CW0F 4G7ZF 3EQLF 2A6HF 4G7OF 4XLPF 2A69F 2A68F 3DXJF 4OIOF 2BE5F 4Q5SF 4OINF 3UGOA 2A6EF 1IW7F 4KI2A 4OIQF 3UGPA 4G7HF 3LEVA
chains in the Genus database with same CATH superfamily
1Q0FA 2OG2A 1I5NA 2C03A 3TOMA 4XLNF 3LJBA 1GS9A 2R7UA 4N4WA 2QNLA 3EPVA 3FVYA 2NG1A 3M1CB 2OOCA 3QMKA 4JEBA 1V55C 4P6IC 1D0YA 2H7OA 4XQ1A 5COMA 5KYYA 4PFPA 1RJ9A 2CW0F 2OEXA 3AOUA 1ORJA 3NYMA 5K0IA 2CCYA 3NMKA 4KNVA 3S9OA 1OXKA 2HMZA 1E86A 1YYJA 1M2VB 3JTLO 2UUHA 4CDYA 1FAPB 2BE5F 1NFNA 3K1HA 2D4UA 4HFKB 1QKRA 4U5FE 5B3SC 2G3KA 3IEEA 4W8KA 3KL4A 3WHNA 2IOQA 2ZXPA 4YJWA 4EBKA 1BR2A 1Z7Qc 5L0IA 3LLIA 1AVOB 1NU7D 3EHMA 3LEVA 2CNWA 1Z5ZA 2J9WA 3W2VA 3K66A 4JC7A 1FFHA 1HE9A 4Z9IA 3ZIBA 1CGME 3MYIA 1SMYF 1JAFA 1I4ZA 3RW0A 1FTSA 4Q4ZF 1OKKD 3QZCA 1MNEA 4LDQA 4OIPF 3DI5A 4NC3A 4WABA 1LI5A 2XLOA 3DWWA 4CIPA 1A0BA 1KNYA 1YDIA 2R7QA 5JS5A 3S84A 1HMDA 1K04A 2J7PA 1HY5A 1V4AA 3GORA 2PX0A 2B0HA 2HV7A 3EH1A 3VYWA 3GWNA 1D1CA 3DXJF 4EWCA 5JT4A 3FOPA 3G50A 4NY3A 4EBBA 4BJ5A 2VCBA 1OCCC 2DGJA 2G62A 3MFNA 4Z9JA 4CBEA 2Y3DA 4IJJA 2NUTB 2ZXOA 1RKEA 3JYHA 3LAYA 1UG7A 3HLZA 4G7HF 2XXAA 1Z63A 4BG0A 3BEHA 4BJ6C 5JUAA 4N6HA 2AP3A 2L7AA 3NKDA 1SZIA 2GFHA 2EPLX 2NSFA 4MNDA 1H9GA 2EIJC 3QTHA 4YL0A 3C8GA 1WATA 2R25A 4PJNA 4LDRA 5JLIA 3RVZA 4U5EE 1F1MA 3ABKC 2WZLA 4B6IA 4C7OB 3FHDA 3SXZA 2OJQA 2KK1A 1A41A 2IXPA 4LACB 4YT5A 4JVSA 2H8AA 5JRAA 1D1BA 4AE4B 1VLSA 3NKEA 1LIHA 3K7DA 4N6CA 5COFA 4H54A 1YZCA 2M64A 1BBHA 1WGWA 2Q00A 3RKOF 3U8VA 4ANJA 5IY5C 3K33A 4C3EA 2A6EF 1ORSC 2F22A 2OJED 2WL8A 4IB4A 1OW8A 2V3CC 4DVZA 3JRTA 1G5ZA 1GQAA 1WWPA 1EQ1A 3AGUA 3IQ5A 3S28A 2HMQA 2O9XA 3NMJA 4U5GA 3WODF 3PDMP 2R7SA 5L0GA 1TFKB 5EGYA 1YYXA 2E87A 4OD4A 1ZYRF 1WOLA 1D0ZA 4EBJA 2LCHA 2TMVP 5F5FA 3S0XA 2XS1A 1HE1A 3RFYA 3K6BA 2P6VA 3EG9B 1NG1A 1ST6A 4I1OB 1H9TA 4ONSA 4JW1A 3W2WA 3AG3C 3H65A 3U9JA 2EPKX 5L0HA 4P9TA 1NZEA 1OKKA 1W2WA 3ECSA 4J7TA 1EI7A 2YWAA 3C62A 4WGYA 3EGDB 1Z3IX 1HMOA 3ITFA 2NUPA 4XPWA 3C8ZA 4OIOF 2WZFA 3EZIA 5EHHA 2IBFA 1ZHXA 3AG2C 3RQFA 1PV3A 4J7YA 1OW7A 3I5QA 3SZRA 5B3IA 4OIQF 3KH2A 3J06A 3OEOA 3B29A 3NG1A 3LNMB 3U3FA 3L0IA 4U5BE 5T3WA 3ZVRA 2A0BA 2X51A 3HJCA 4QI0A 3ZWIA 4FAPB 1XZPA 1OR3A 2QUPA 3HNKA 3JYYA 4U5HA 3QVZA 3M4CA 2J7PD 2XSEA 3WG7C 1RKCA 2YLDA 2YL0A 2VC9A 3C7JA 1AUEA 2XLVA 5TJ5E 3UMIA 5F5HA 1RXQA 3DKAA 4DBQA 1WASA 5L0CA 3FAJA 3JCUQ 3EJNA 4FX5A 3OWTA 5HSWA 4G7ZF 1S05A 5BQGA 3E9VA 3ZQYA 4G7OF 1N1CA 2PFDA 5DS4A 1LS1A 4ULWA 1QPUA 1T9KA 3U8PA 4PJLA 4JCHA 3SXKA 1T5OA 2H7VC 2XS8A 3F46A 4D4NA 3F47A 1NFOA 2YVKA 2WVOA 1M2VA 4BJ5C 5L3QA 3JSZA 2VCAA 3RQGA 2XL6A 4UDVA 4I1MA 4AL0A 2DYSC 2HSQA 4DXWA 1U6HA 1FR0A 1BR1A 1MQVA 1NLXA 4K7BA 1T6UA 5GPGB 1C03A 2IYLD 3FOOA 1I4YA 4MVMA 2I8BA 3V7OA 3EFOB 3FAPB 5D91A 5DS6A 2L6GA 3KPHA 3AGTA 3GEHA 2HUJA 1MNDA 4KC9A 3BRJA 4PFOA 3UMHA 3V5ZA 5JVEA 2Q9CA 3GODA 5DQTA 4JCZA 2J0WA 1SR2A 3KMIA 3N0TA 3Q6MA 3O6XA 2R02A 3FMSA 4DVYP 2JD3A 4MVQA 4JTDB 5L3VA 2XM0A 3GM1A 1APCA 1SF8A 4MVOA 3GEIA 1R5ID 2Q7RA 2CDQA 3T6JA 3MYFA 1Y4CA 2L6HA 2V26A 4I3MA 4NQFA 3LNRA 4CS9A 2NUTA 2Y39A 2YZSA 3NDBB 4IARA 1Q0DA 2LK4A 2KNHA 1H6GA 1LPEA 4NTAA 2KW3C 2L81A 3S27A 3W8HA 3L8IA 1PD0A 2Q9BA 4MTFA 4OD5A 4I44A 3ZQVA 3G4XA 3X1OA 4JEAA 3DJNB 3EZHA 1QLEC 1JRAA 1XZQA 4CS8A 1MMNA 2IM8A 2J46A 2MYSA 4C7OA 4J30B 1VK5A 2NPUA 4U9DA 3EH2A 4A2NB 4AE4A 3C63A 3US6A 1O87A 1FMWA 5A6JA 1OW6A 3L1MA 2QY9A 2YLIA 4KNWA 3LLKA 2OCCC 2EIKC 1JMWA 2D5RB 1J8MF 4L6RA 2Q3TA 3TOLA 3B0VC 3IQCA 4C3DA 1D0XA 2EPNA 3DZAA 3RVYA 3UNGC 4JKVA 2R9RB 4XEFA 1CPRA 4Z9HA 3B9QA 4HFFB 5BUOA 1CPQA 4E17A 1EKYA 1YZAA 3GM2A 4DRHB 4JURI 2VASA 4CSAA 4ULVA 3EG9A 4YL1A 4W8PA 1K40A 2DYRC 3SP1A 4JJFA 4CDAA 4EHPA 1TWCA 2UUIA 4U9EA 2R7WA 3S29A 1L7CA 1Z6AA 2A0UA 2J9VA 3EGDA 4PJJA 3VAYA 2GA0A 3UGOA 3O55A 2JPUA 2EIMC 3KYIA 4JRZA 3AQCA 5A6BA 1GM5A 1RMVA 2QLAA 1QQ3A 3UGPA 3DE9A 2IXNA 1B68A 3ZC4A 4F4BA 2R7RA 4G78A 3SYNA 1MMAA 2P1AA 3Q6NA 3V5YA 1O3UA 5CIVA 3H2UA 3RH3A 4YT2A 1ZZPA 3DAGA 3HNLA 4OIRF 2Q9AA 3MX3A 1E83A 4BEJA 1OR2A 3PCVA 5B1AC 4E7ZA 2ETSA 2ZXRA 3QVYA 4N06A 2PNOA 2EPMX 3R2PA 4MTGA 4ER9A 4JJGA 5COGA 2WVNA 4H4KC 2XLDA 4P9FA 5JSLA 2VB6A 3A9CA 3U5SA 2A69F 1H7IA 2X0CA 3I5PA 2P7VA 4BEMJ 3SXYA 1ZU5A 3SNHA 1OQCA 2YL7A 3T9OA 3MBGA 2AWYA 1G8XA 2EPOA 2MHRA 2YLGA 4YT8A 2R7TA 2J0XA 2IXOA 3JRMO 3Q7LA 3EGXB 4CS9C 1VMAA 4O6YA 2KSFA 2KGOA 3LESA 4BJ1A 5DVWA 3IHUA 1KU2A 1K05A 1JR8A 1R4TA 1UFBA 5CI8A 4D4XA 3EFOA 3L8JA 4CS7A 2XL4A 3IQTA 3NRHA 3VM6A 2AVKA 2RD9A 2B0JA 4WGZA 3IPMO 4CS8C 2GAQA 2YEVA 2A6HF 1U89A 4JTAB 5E3CA 5T3TA 2WVQA 4A4AA 1M57C 5KYUB 3ZTMA 3K1IA 4E7SA 3DJUB 2LSEA 1HW1A 4NCQA 2YL3A 5E33A 3T6GB 2HKVA 5BQHA 2VCCA 3ABLC 5A69A 2KC3A 1A7DA 2PF4E 1QZXA 3ZSUA 4KI2A 2WZGA 2KYHA 1YLMA 5HV9A 2HSBA 1Q0KA 1TFOB 2XM4A 3DE8A 3DM9B 4YN0B 1ZHYA 3TULA 2QE9A 1Q0MA 4FWVA 3NYJA 3W4YA 2A1DD 3HTKC 4C3BA 2YKZA 5AC4A 2HS5A 2WB7A 4DRJB 3LS1A 3QW1A 4CSAC 1QVXA 1Z23A 4MS2A 4O6NA 3EQLF 4NTBA 3EHNA 4R32A 4CX9A 5KYXB 2H7BA 1T6IA 5T1DB 4HEAJ 1KTMA 1RCPA 4G0HA 1MMDA 4GQHA 5A6BD 1WTYA 3ATPA 3ZTZA 1E85A 2BL2A 2EILC 1YAUO 2ZPAA 3T4RA 3LEOA 1ORYA 4MVSA 1NSGB 2OKUA 1M56C 2ICWG 1VTMP 1TWHA 1IW7F 5CI9A 4XEKA 5BQIA 1E2XA 1VB5A 2HZ8A 3KKBA 4XWJA 2BC5A 2JX0A 4AX2A 3JZ0A 3M15A 1YVIA 1LS4A 3SXMA 2R03A 1TWGA 1ZHWA 1CGOA 1Y6DA 3GEEA 1L3PA 2NSGA 1J8YF 1TWAA 2J9UA 4DOZA 4PK4A 1ZHZA 2MWQA 2P0NA 2R05A 2YL1A 4E18A 2ZXWC 4CJOA 2XLHA 4JTCB 1PD1A 4DJ9A 5EK0A 4K1OA 5DQZA 1V74B 2LD6A 4XLPF 2DI3A 1T01A 3GM3A 3POVA 4ZLDA 2L9JA 3DM5A 3I4UA 4YK5A 3ZDLA 4EUKB 2Y3HA 4LLEA 5KYWB 3B71A 3ABMC 1QSPA 1TR2A 3FXHA 3U9MA 2Y69C 4PR9A 1HW2A 4E0IA 3S90A 1AEPA 2CGEA 4XPXA 1LE2A 5FCLA 2P61A 1OCZC 4O79A 3R7CA 2R7OA 3AG1C 1M6TA 256BA 2QTVA 4KBLA 5KYYB 1SYQA 3GANA 2XL8A 5F28E 1OXBA 1ZW3A 3LUTB 1A7EA 4BJTA 1EA8A 1RJ9B 4IAOA 3TJ6A 2YHSA 4LERA 4RDAA 3AJMA 3M4BA 2KJGA 2Y3BA 4LDKA 1NU9C 4MQ9F 4MVZA 4O6MA 4WJ0A 1LVKA 4DBRA 3CEXA 3HNJA 3A11A 4CIHA 3B0UX 3U2MA 2Y3GA 3H2VA 3N2ZB 3C18A 3LS0A 3OA1A 2LQGA 1YARO 3MLGA 1ZVZA 3K1IC 3CQZA 3JT1A 1MMGA 3DMDA 3QW0A 1FFTC 2XLWA 4NTFA 4XEVA 3UMKA 1JPJA 3HKKA 4OINF 2XLEA 4MTOA 1VOMA 2XLMA 1BZ4A 2XRHA 3CSKA 4IRUA 2J8WA 4GYTA 3FDQA 3PHF2 3O10A 4GEHA 3L34A 2R7VA 1O5HA 4K0DA 2J45A 3T6BA 3TQOA 4EIYA 4E0HA 3EGXA 1LE4A 2FAPB 3Q7GA 5B1BC 4FESA 4JE9A 5DLJA 1OCRC 2LFDA 3JSEO 2G3VA 4ZLCA 3UR3C 1FMVA 3GWLA 2KQ9A 2FGYA 4PJMA 4XTKA 1OCOC 3VRCA 1YA7O 2CYDA 1LM3B 2J9BA 2RSEB 1BDJB 3IQ6A 2LP4A 3O39A 5KYNA 4IGGA 4QI2A 3X2QC 1LI7A 3TK0A 2AU5A 3WAQA 4U5DE 1ZU4A 5KYUA 1FNTc 2GDCA 2M4EA 4HE8D 4LLCA 1RKEB 1WN0A 4YWQA 4XPYA 1CGNA 2XXAB 3DAFA 3AG4C 3PMRA 5E2QA 1TKNA 5D92A 4EKWA 2DB4A 3C8GB 4YL3A 5FZTA 2I15A 5E3AA 4AK9A 3E70C 1C02A 1VLTA 4O7GA 3U3BA 4MW8A 1IZMA 2VH3A 1XWJA 1YA9A 3VF0A 2GWWA 4RD9A 1TQGA 1VYIA 1U0BB 1Q0GA 2C04A 3ASOC 2LFFA 1ZW2A 2W4BA 3TD7A 1V54C 5L0DA 2Q4FA 3B0PA 4MVUA 2W4MA 4U5CE 4MVRA 5KYXA 2A68F 3TJ5A 5A6KA 3SEOA 2CNWD 2HJ3A 4X0RA 2OQMA 4MW3A 3U0CA 1G4US 2W9YA 2PP4A 2ZD9A 4JZAA 4PACA 4AL1A 1VYKA 5A6AA 4IWBA 3RQEA 4QDLA 4CDVA 1C17M 1G4WR 2FFHA 3KYJA 1JPNA 1D1AA 2YRFA 2Z15A 4BJ6A 2EINC 1E84A 1YJGA 1BR4A 2YQYA 3ASNC 2HJMA 5L0JA 2PX3A 2PBEA 3DD7A 4JIOA 5AGFA 3V5XA 3W8IA 1PCXA 2W45A 5L0FA 3NMIA 4RBNA 3ZG1A 2HFIA 4CJGA 3HNIA 1GGQA 2OU6A 3M79A 3RYLA 4DRIB 3CAXA 1NBBA 2NUPB 1LKXA 4J32B 2OEVA 1ZHTA 2HV6A 1M2OA 3G4ZA 3U2LA 3RIPA 1A7VA 1S7ZA 1DOVA 4IAQA 2L6FA 5JP7A 4BPMA 4Q5SF 4M63A 2ASRA 2AWCA 1DOWA 2LIGA 3N24A 3CZ6A 4YT4A 2R7XA 4Q7CA 5KYWA 3NYLA 3AQBA 1T6QA 3C8GD 5DS5A 3RF3A 1JOGA 2IXMA 5AC5A
chains in the Genus database with same CATH topology
2OG2A 2C03A 4XLNF 3LJBA 2R7UA 3FVYA 3EPVA 2NG1A 3M1CB 3QMKA 1V55C 4P6IC 1D0YA 2H7OA 5KYYA 4PFPA 1RJ9A 2CW0F 3NYMA 4KNVA 1M2VB 2BE5F 3K1HA 4HFKB 4U5FE 5B3SC 2G3KA 3IEEA 4W8KA 3KL4A 2IOQA 2ZXPA 4YJWA 1BR2A 3LLIA 1NU7D 3EHMA 3LEVA 2CNWA 1Z5ZA 2J9WA 3W2VA 3K66A 1FFHA 1SMYF 4Q4ZF 1FTSA 1OKKD 3QZCA 1MNEA 4OIPF 2R7QA 2J7PA 2PX0A 2HV7A 3EH1A 3VYWA 1D1CA 3DXJF 4EWCA 4EBBA 4NY3A 4BJ5A 1OCCC 2DGJA 2G62A 4CBEA 2Y3DA 4IJJA 2NUTB 2ZXOA 3JYHA 3LAYA 3HLZA 4G7HF 2XXAA 1Z63A 4BG0A 4BJ6C 3NKDA 1SZIA 2GFHA 4MNDA 2EIJC 4PJNA 4U5EE 3ABKC 4B6IA 2WZLA 4C7OB 3FHDA 2IXPA 4LACB 4YT5A 4JVSA 1D1BA 4AE4B 3NKEA 3K7DA 1WGWA 4ANJA 3RKOF 5IY5C 3K33A 4C3EA 2A6EF 2V3CC 2WL8A 4DVZA 3JRTA 3S28A 2O9XA 4U5GA 3WODF 2R7SA 5EGYA 2E87A 4OD4A 1ZYRF 1D0ZA 5F5FA 3S0XA 3RFYA 3K6BA 2P6VA 3EG9B 1NG1A 1ST6A 4I1OB 4JW1A 3W2WA 3AG3C 3H65A 1NZEA 1OKKA 1W2WA 3ECSA 3EGDB 1Z3IX 3ITFA 2NUPA 4OIOF 2WZFA 3EZIA 5EHHA 1ZHXA 3AG2C 3I5QA 3SZRA 4OIQF 3KH2A 3OEOA 3NG1A 3L0IA 4U5BE 5T3WA 3ZVRA 2X51A 3HJCA 4QI0A 4U5HA 2J7PD 2XSEA 3WG7C 3ZIBA 4DBQA 3UMIA 5F5HA 3FAJA 3JCUQ 3EJNA 4FX5A 3OWTA 5HSWA 4G7ZF 3E9VA 4G7OF 1N1CA 2PFDA 5DS4A 1LS1A 4ULWA 4PJLA 4JCHA 2H7VC 3F46A 3F47A 2WVOA 1M2VA 4BJ5C 5L3QA 3JSZA 2DYSC 1BR1A 4K7BA 2IYLD 3V7OA 5DS6A 2I8BA 3EFOB 5D91A 1MNDA 4KC9A 4PFOA 3UMHA 2Q9CA 3GODA 5DQTA 2J0WA 3KMIA 3N0TA 3Q6MA 3O6XA 4DVYP 2JD3A 5L3VA 1SF8A 2CDQA 3T6JA 4I3MA 2V26A 3LNRA 4CS9A 2NUTA 2Y39A 2YZSA 3NDBB 2KNHA 3S27A 2KW3C 2L81A 3W8HA 1PD0A 2Q9BA 4OD5A 4I44A 3X1OA 3DJNB 3EZHA 1QLEC 4CS8A 1MMNA 2J46A 4C7OA 2MYSA 4J30B 1VK5A 3EH2A 4A2NB 4AE4A 1O87A 1FMWA 2QY9A 4KNWA 3LLKA 2OCCC 2EIKC 2D5RB 1J8MF 2Q3TA 3B0VC 4C3DA 1D0XA 3DZAA 3UNGC 3B9QA 4HFFB 5BUOA 4JURI 2VASA 4CSAA 3EG9A 2DYRC 3SP1A 4JJFA 1TWCA 2R7WA 3S29A 3EGDA 1Z6AA 2J9VA 4PJJA 3VAYA 3UGOA 2EIMC 3AQCA 3UGPA 2IXNA 3ZC4A 4F4BA 2R7RA 3SYNA 1MMAA 3Q6NA 4YT2A 3RH3A 3DAGA 4OIRF 2Q9AA 3MX3A 4BEJA 4E7ZA 5B1AC 2ZXRA 4N06A 4JJGA 2WVNA 4H4KC 2VB6A 2A69F 3I5PA 2P7VA 1ZU5A 3SNHA 1G8XA 4YT8A 2R7TA 2J0XA 2IXOA 3Q7LA 3EGXB 4CS9C 1VMAA 4O6YA 2KGOA 3LESA 4BJ1A 5DVWA 1KU2A 5CI8A 3EFOA 4CS7A 2XL4A 3NRHA 2B0JA 4CS8C 2YEVA 2A6HF 5E3CA 5KYUB 5T3TA 2WVQA 1M57C 4E7SA 3DJUB 2LSEA 5E33A 3ABLC 2PF4E 1QZXA 3ZSUA 4KI2A 2WZGA 3DM9B 4YN0B 1ZHYA 4FWVA 3NYJA 4C3BA 2A1DD 3HTKC 2WB7A 3LS1A 4CSAC 1Z23A 4O6NA 3EQLF 5KYXB 3EHNA 2H7BA 5T1DB 4HEAJ 4G0HA 1MMDA 2EILC 2ZPAA 3T4RA 1M56C 1TWHA 1IW7F 5CI9A 3KKBA 4XWJA 4AX2A 1TWGA 1ZHWA 1J8YF 1TWAA 2J9UA 4DOZA 4PK4A 1ZHZA 2MWQA 2ZXWC 1PD1A 5DQZA 4XLPF 3POVA 4ZLDA 2L9JA 3DM5A 3I4UA 2Y3HA 4LLEA 5KYWB 3ABMC 1TR2A 2Y69C 2CGEA 5FCLA 1OCZC 4O79A 2R7OA 3AG1C 2QTVA 4KBLA 5KYYB 3GANA 4BJTA 1RJ9B 4IAOA 2YHSA 4LERA 4RDAA 4O6MA 2KJGA 2Y3BA 4DBRA 1NU9C 4MQ9F 4WJ0A 1LVKA 4CIHA 3B0UX 2Y3GA 3N2ZB 3OA1A 3LS0A 3MLGA 3K1IC 3CQZA 3JT1A 1MMGA 3DMDA 1FFTC 3UMKA 1JPJA 4OINF 1VOMA 4IRUA 2XRHA 3CSKA 4GYTA 3FDQA 3PHF2 4GEHA 3L34A 2R7VA 1O5HA 4K0DA 2J45A 3T6BA 3EGXA 3Q7GA 5B1BC 4FESA 5DLJA 1OCRC 4ZLCA 2G3VA 3UR3C 1FMVA 2KQ9A 2FGYA 4PJMA 4XTKA 1OCOC 3O39A 5KYNA 4QI2A 3X2QC 4U5DE 1ZU4A 5KYUA 2M4EA 4HE8D 4LLCA 4YWQA 2XXAB 3DAFA 3AG4C 3PMRA 5E2QA 1TKNA 5D92A 5E3AA 3E70C 4O7GA 1IZMA 2VH3A 4RD9A 1VYIA 2C04A 3ASOC 2W4BA 3TD7A 1V54C 3B0PA 2W4MA 4U5CE 5KYXA 2A68F 3SEOA 2CNWD 4X0RA 2W9YA 2PP4A 4JZAA 1VYKA 4IWBA 4QDLA 2FFHA 1JPNA 1D1AA 2Z15A 4BJ6A 2EINC 1BR4A 3ASNC 2PX3A 3DD7A 3W8IA 1PCXA 2W45A 4RBNA 3ZG1A 3RYLA 2NUPB 1LKXA 4J32B 1ZHTA 2HV6A 1M2OA 3RIPA 1S7ZA 4Q5SF 4M63A 3N24A 2R7XA 3CZ6A 4YT4A 4Q7CA 5KYWA 3NYLA 3AQBA 4AK9A 5DS5A 4I1MA 2IXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WOD F;  4XLN F;  3LES A;  1ZYR F;  1SMY F;  4Q4Z F;  1KU2 A;  4OIR F;  4OIP F;  4MQ9 F;  2CW0 F;  4G7Z F;  3EQL F;  2A6H F;  4G7O F;  4XLP F;  2A69 F;  2A68 F;  3DXJ F;  4OIO F;  2BE5 F;  4Q5S F;  4OIN F;  3UGO A;  2A6E F;  1IW7 F;  4KI2 A;  4OIQ F;  3UGP A;  4G7H F;  3LEV A; 
#chains in the Genus database with same CATH topology
 1Q0F A;  2OG2 A;  1I5N A;  2C03 A;  3TOM A;  4XLN F;  3LJB A;  1GS9 A;  2R7U A;  4N4W A;  2QNL A;  3EPV A;  3FVY A;  2NG1 A;  3M1C B;  2OOC A;  3QMK A;  4JEB A;  1V55 C;  4P6I C;  1D0Y A;  2H7O A;  4XQ1 A;  5COM A;  5KYY A;  4PFP A;  1RJ9 A;  2CW0 F;  2OEX A;  3AOU A;  1ORJ A;  3NYM A;  5K0I A;  2CCY A;  3NMK A;  4KNV A;  3S9O A;  1OXK A;  2HMZ A;  1E86 A;  1YYJ A;  1M2V B;  3JTL O;  2UUH A;  4CDY A;  1FAP B;  2BE5 F;  1NFN A;  3K1H A;  2D4U A;  4HFK B;  1QKR A;  4U5F E;  5B3S C;  2G3K A;  3IEE A;  4W8K A;  3KL4 A;  3WHN A;  2IOQ A;  2ZXP A;  4YJW A;  4EBK A;  1BR2 A;  1Z7Q c;  5L0I A;  3LLI A;  1AVO B;  1NU7 D;  3EHM A;  3LEV A;  2CNW A;  1Z5Z A;  2J9W A;  3W2V A;  3K66 A;  4JC7 A;  1FFH A;  1HE9 A;  4Z9I A;  3ZIB A;  1CGM E;  3MYI A;  1SMY F;  1JAF A;  1I4Z A;  3RW0 A;  1FTS A;  4Q4Z F;  1OKK D;  3QZC A;  1MNE A;  4LDQ A;  4OIP F;  3DI5 A;  4NC3 A;  4WAB A;  1LI5 A;  2XLO A;  3DWW A;  4CIP A;  1A0B A;  1KNY A;  1YDI A;  2R7Q A;  5JS5 A;  3S84 A;  1HMD A;  1K04 A;  2J7P A;  1HY5 A;  1V4A A;  3GOR A;  2PX0 A;  2B0H A;  2HV7 A;  3EH1 A;  3VYW A;  3GWN A;  1D1C A;  3DXJ F;  4EWC A;  5JT4 A;  3FOP A;  3G50 A;  4NY3 A;  4EBB A;  4BJ5 A;  2VCB A;  1OCC C;  2DGJ A;  2G62 A;  3MFN A;  4Z9J A;  4CBE A;  2Y3D A;  4IJJ A;  2NUT B;  2ZXO A;  1RKE A;  3JYH A;  3LAY A;  1UG7 A;  3HLZ A;  4G7H F;  2XXA A;  1Z63 A;  4BG0 A;  3BEH A;  4BJ6 C;  5JUA A;  4N6H A;  2AP3 A;  2L7A A;  3NKD A;  1SZI A;  2GFH A;  2EPL X;  2NSF A;  4MND A;  1H9G A;  2EIJ C;  3QTH A;  4YL0 A;  3C8G A;  1WAT A;  2R25 A;  4PJN A;  4LDR A;  5JLI A;  3RVZ A;  4U5E E;  1F1M A;  3ABK C;  2WZL A;  4B6I A;  4C7O B;  3FHD A;  3SXZ A;  2OJQ A;  2KK1 A;  1A41 A;  2IXP A;  4LAC B;  4YT5 A;  4JVS A;  2H8A A;  5JRA A;  1D1B A;  4AE4 B;  1VLS A;  3NKE A;  1LIH A;  3K7D A;  4N6C A;  5COF A;  4H54 A;  1YZC A;  2M64 A;  1BBH A;  1WGW A;  2Q00 A;  3RKO F;  3U8V A;  4ANJ A;  5IY5 C;  3K33 A;  4C3E A;  2A6E F;  1ORS C;  2F22 A;  2OJE D;  2WL8 A;  4IB4 A;  1OW8 A;  2V3C C;  4DVZ A;  3JRT A;  1G5Z A;  1GQA A;  1WWP A;  1EQ1 A;  3AGU A;  3IQ5 A;  3S28 A;  2HMQ A;  2O9X A;  3NMJ A;  4U5G A;  3WOD F;  3PDM P;  2R7S A;  5L0G A;  1TFK B;  5EGY A;  1YYX A;  2E87 A;  4OD4 A;  1ZYR F;  1WOL A;  1D0Z A;  4EBJ A;  2LCH A;  2TMV P;  5F5F A;  3S0X A;  2XS1 A;  1HE1 A;  3RFY A;  3K6B A;  2P6V A;  3EG9 B;  1NG1 A;  1ST6 A;  4I1O B;  1H9T A;  4ONS A;  4JW1 A;  3W2W A;  3AG3 C;  3H65 A;  3U9J A;  2EPK X;  5L0H A;  4P9T A;  1NZE A;  1OKK A;  1W2W A;  3ECS A;  4J7T A;  1EI7 A;  2YWA A;  3C62 A;  4WGY A;  3EGD B;  1Z3I X;  1HMO A;  3ITF A;  2NUP A;  4XPW A;  3C8Z A;  4OIO F;  2WZF A;  3EZI A;  5EHH A;  2IBF A;  1ZHX A;  3AG2 C;  3RQF A;  1PV3 A;  4J7Y A;  1OW7 A;  3I5Q A;  3SZR A;  5B3I A;  4OIQ F;  3KH2 A;  3J06 A;  3OEO A;  3B29 A;  3NG1 A;  3LNM B;  3U3F A;  3L0I A;  4U5B E;  5T3W A;  3ZVR A;  2A0B A;  2X51 A;  3HJC A;  4QI0 A;  3ZWI A;  4FAP B;  1XZP A;  1OR3 A;  2QUP A;  3HNK A;  3JYY A;  4U5H A;  3QVZ A;  3M4C A;  2J7P D;  2XSE A;  3WG7 C;  1RKC A;  2YLD A;  2YL0 A;  2VC9 A;  3C7J A;  1AUE A;  2XLV A;  5TJ5 E;  3UMI A;  5F5H A;  1RXQ A;  3DKA A;  4DBQ A;  1WAS A;  5L0C A;  3FAJ A;  3JCU Q;  3EJN A;  4FX5 A;  3OWT A;  5HSW A;  4G7Z F;  1S05 A;  5BQG A;  3E9V A;  3ZQY A;  4G7O F;  1N1C A;  2PFD A;  5DS4 A;  1LS1 A;  4ULW A;  1QPU A;  1T9K A;  3U8P A;  4PJL A;  4JCH A;  3SXK A;  1T5O A;  2H7V C;  2XS8 A;  3F46 A;  4D4N A;  3F47 A;  1NFO A;  2YVK A;  2WVO A;  1M2V A;  4BJ5 C;  5L3Q A;  3JSZ A;  2VCA A;  3RQG A;  2XL6 A;  4UDV A;  4I1M A;  4AL0 A;  2DYS C;  2HSQ A;  4DXW A;  1U6H A;  1FR0 A;  1BR1 A;  1MQV A;  1NLX A;  4K7B A;  1T6U A;  5GPG B;  1C03 A;  2IYL D;  3FOO A;  1I4Y A;  4MVM A;  2I8B A;  3V7O A;  3EFO B;  3FAP B;  5D91 A;  5DS6 A;  2L6G A;  3KPH A;  3AGT A;  3GEH A;  2HUJ A;  1MND A;  4KC9 A;  3BRJ A;  4PFO A;  3UMH A;  3V5Z A;  5JVE A;  2Q9C A;  3GOD A;  5DQT A;  4JCZ A;  2J0W A;  1SR2 A;  3KMI A;  3N0T A;  3Q6M A;  3O6X A;  2R02 A;  3FMS A;  4DVY P;  2JD3 A;  4MVQ A;  4JTD B;  5L3V A;  2XM0 A;  3GM1 A;  1APC A;  1SF8 A;  4MVO A;  3GEI A;  1R5I D;  2Q7R A;  2CDQ A;  3T6J A;  3MYF A;  1Y4C A;  2L6H A;  2V26 A;  4I3M A;  4NQF A;  3LNR A;  4CS9 A;  2NUT A;  2Y39 A;  2YZS A;  3NDB B;  4IAR A;  1Q0D A;  2LK4 A;  2KNH A;  1H6G A;  1LPE A;  4NTA A;  2KW3 C;  2L81 A;  3S27 A;  3W8H A;  3L8I A;  1PD0 A;  2Q9B A;  4MTF A;  4OD5 A;  4I44 A;  3ZQV A;  3G4X A;  3X1O A;  4JEA A;  3DJN B;  3EZH A;  1QLE C;  1JRA A;  1XZQ A;  4CS8 A;  1MMN A;  2IM8 A;  2J46 A;  2MYS A;  4C7O A;  4J30 B;  1VK5 A;  2NPU A;  4U9D A;  3EH2 A;  4A2N B;  4AE4 A;  3C63 A;  3US6 A;  1O87 A;  1FMW A;  5A6J A;  1OW6 A;  3L1M A;  2QY9 A;  2YLI A;  4KNW A;  3LLK A;  2OCC C;  2EIK C;  1JMW A;  2D5R B;  1J8M F;  4L6R A;  2Q3T A;  3TOL A;  3B0V C;  3IQC A;  4C3D A;  1D0X A;  2EPN A;  3DZA A;  3RVY A;  3UNG C;  4JKV A;  2R9R B;  4XEF A;  1CPR A;  4Z9H A;  3B9Q A;  4HFF B;  5BUO A;  1CPQ A;  4E17 A;  1EKY A;  1YZA A;  3GM2 A;  4DRH B;  4JUR I;  2VAS A;  4CSA A;  4ULV A;  3EG9 A;  4YL1 A;  4W8P A;  1K40 A;  2DYR C;  3SP1 A;  4JJF A;  4CDA A;  4EHP A;  1TWC A;  2UUI A;  4U9E A;  2R7W A;  3S29 A;  1L7C A;  1Z6A A;  2A0U A;  2J9V A;  3EGD A;  4PJJ A;  3VAY A;  2GA0 A;  3UGO A;  3O55 A;  2JPU A;  2EIM C;  3KYI A;  4JRZ A;  3AQC A;  5A6B A;  1GM5 A;  1RMV A;  2QLA A;  1QQ3 A;  3UGP A;  3DE9 A;  2IXN A;  1B68 A;  3ZC4 A;  4F4B A;  2R7R A;  4G78 A;  3SYN A;  1MMA A;  2P1A A;  3Q6N A;  3V5Y A;  1O3U A;  5CIV A;  3H2U A;  3RH3 A;  4YT2 A;  1ZZP A;  3DAG A;  3HNL A;  4OIR F;  2Q9A A;  3MX3 A;  1E83 A;  4BEJ A;  1OR2 A;  3PCV A;  5B1A C;  4E7Z A;  2ETS A;  2ZXR A;  3QVY A;  4N06 A;  2PNO A;  2EPM X;  3R2P A;  4MTG A;  4ER9 A;  4JJG A;  5COG A;  2WVN A;  4H4K C;  2XLD A;  4P9F A;  5JSL A;  2VB6 A;  3A9C A;  3U5S A;  2A69 F;  1H7I A;  2X0C A;  3I5P A;  2P7V A;  4BEM J;  3SXY A;  1ZU5 A;  3SNH A;  1OQC A;  2YL7 A;  3T9O A;  3MBG A;  2AWY A;  1G8X A;  2EPO A;  2MHR A;  2YLG A;  4YT8 A;  2R7T A;  2J0X A;  2IXO A;  3JRM O;  3Q7L A;  3EGX B;  4CS9 C;  1VMA A;  4O6Y A;  2KSF A;  2KGO A;  3LES A;  4BJ1 A;  5DVW A;  3IHU A;  1KU2 A;  1K05 A;  1JR8 A;  1R4T A;  1UFB A;  5CI8 A;  4D4X A;  3EFO A;  3L8J A;  4CS7 A;  2XL4 A;  3IQT A;  3NRH A;  3VM6 A;  2AVK A;  2RD9 A;  2B0J A;  4WGZ A;  3IPM O;  4CS8 C;  2GAQ A;  2YEV A;  2A6H F;  1U89 A;  4JTA B;  5E3C A;  5T3T A;  2WVQ A;  4A4A A;  1M57 C;  5KYU B;  3ZTM A;  3K1I A;  4E7S A;  3DJU B;  2LSE A;  1HW1 A;  4NCQ A;  2YL3 A;  5E33 A;  3T6G B;  2HKV A;  5BQH A;  2VCC A;  3ABL C;  5A69 A;  2KC3 A;  1A7D A;  2PF4 E;  1QZX A;  3ZSU A;  4KI2 A;  2WZG A;  2KYH A;  1YLM A;  5HV9 A;  2HSB A;  1Q0K A;  1TFO B;  2XM4 A;  3DE8 A;  3DM9 B;  4YN0 B;  1ZHY A;  3TUL A;  2QE9 A;  1Q0M A;  4FWV A;  3NYJ A;  3W4Y A;  2A1D D;  3HTK C;  4C3B A;  2YKZ A;  5AC4 A;  2HS5 A;  2WB7 A;  4DRJ B;  3LS1 A;  3QW1 A;  4CSA C;  1QVX A;  1Z23 A;  4MS2 A;  4O6N A;  3EQL F;  4NTB A;  3EHN A;  4R32 A;  4CX9 A;  5KYX B;  2H7B A;  1T6I A;  5T1D B;  4HEA J;  1KTM A;  1RCP A;  4G0H A;  1MMD A;  4GQH A;  5A6B D;  1WTY A;  3ATP A;  3ZTZ A;  1E85 A;  2BL2 A;  2EIL C;  1YAU O;  2ZPA A;  3T4R A;  3LEO A;  1ORY A;  4MVS A;  1NSG B;  2OKU A;  1M56 C;  2ICW G;  1VTM P;  1TWH A;  1IW7 F;  5CI9 A;  4XEK A;  5BQI A;  1E2X A;  1VB5 A;  2HZ8 A;  3KKB A;  4XWJ A;  2BC5 A;  2JX0 A;  4AX2 A;  3JZ0 A;  3M15 A;  1YVI A;  1LS4 A;  3SXM A;  2R03 A;  1TWG A;  1ZHW A;  1CGO A;  1Y6D A;  3GEE A;  1L3P A;  2NSG A;  1J8Y F;  1TWA A;  2J9U A;  4DOZ A;  4PK4 A;  1ZHZ A;  2MWQ A;  2P0N A;  2R05 A;  2YL1 A;  4E18 A;  2ZXW C;  4CJO A;  2XLH A;  4JTC B;  1PD1 A;  4DJ9 A;  5EK0 A;  4K1O A;  5DQZ A;  1V74 B;  2LD6 A;  4XLP F;  2DI3 A;  1T01 A;  3GM3 A;  3POV A;  4ZLD A;  2L9J A;  3DM5 A;  3I4U A;  4YK5 A;  3ZDL A;  4EUK B;  2Y3H A;  4LLE A;  5KYW B;  3B71 A;  3ABM C;  1QSP A;  1TR2 A;  3FXH A;  3U9M A;  2Y69 C;  4PR9 A;  1HW2 A;  4E0I A;  3S90 A;  1AEP A;  2CGE A;  4XPX A;  1LE2 A;  5FCL A;  2P61 A;  1OCZ C;  4O79 A;  3R7C A;  2R7O A;  3AG1 C;  1M6T A;  256B A;  2QTV A;  4KBL A;  5KYY B;  1SYQ A;  3GAN A;  2XL8 A;  5F28 E;  1OXB A;  1ZW3 A;  3LUT B;  1A7E A;  4BJT A;  1EA8 A;  1RJ9 B;  4IAO A;  3TJ6 A;  2YHS A;  4LER A;  4RDA A;  3AJM A;  3M4B A;  2KJG A;  2Y3B A;  4LDK A;  1NU9 C;  4MQ9 F;  4MVZ A;  4O6M A;  4WJ0 A;  1LVK A;  4DBR A;  3CEX A;  3HNJ A;  3A11 A;  4CIH A;  3B0U X;  3U2M A;  2Y3G A;  3H2V A;  3N2Z B;  3C18 A;  3LS0 A;  3OA1 A;  2LQG A;  1YAR O;  3MLG A;  1ZVZ A;  3K1I C;  3CQZ A;  3JT1 A;  1MMG A;  3DMD A;  3QW0 A;  1FFT C;  2XLW A;  4NTF A;  4XEV A;  3UMK A;  1JPJ A;  3HKK A;  4OIN F;  2XLE A;  4MTO A;  1VOM A;  2XLM A;  1BZ4 A;  2XRH A;  3CSK A;  4IRU A;  2J8W A;  4GYT A;  3FDQ A;  3PHF 2;  3O10 A;  4GEH A;  3L34 A;  2R7V A;  1O5H A;  4K0D A;  2J45 A;  3T6B A;  3TQO A;  4EIY A;  4E0H A;  3EGX A;  1LE4 A;  2FAP B;  3Q7G A;  5B1B C;  4FES A;  4JE9 A;  5DLJ A;  1OCR C;  2LFD A;  3JSE O;  2G3V A;  4ZLC A;  3UR3 C;  1FMV A;  3GWL A;  2KQ9 A;  2FGY A;  4PJM A;  4XTK A;  1OCO C;  3VRC A;  1YA7 O;  2CYD A;  1LM3 B;  2J9B A;  2RSE B;  1BDJ B;  3IQ6 A;  2LP4 A;  3O39 A;  5KYN A;  4IGG A;  4QI2 A;  3X2Q C;  1LI7 A;  3TK0 A;  2AU5 A;  3WAQ A;  4U5D E;  1ZU4 A;  5KYU A;  1FNT c;  2GDC A;  2M4E A;  4HE8 D;  4LLC A;  1RKE B;  1WN0 A;  4YWQ A;  4XPY A;  1CGN A;  2XXA B;  3DAF A;  3AG4 C;  3PMR A;  5E2Q A;  1TKN A;  5D92 A;  4EKW A;  2DB4 A;  3C8G B;  4YL3 A;  5FZT A;  2I15 A;  5E3A A;  4AK9 A;  3E70 C;  1C02 A;  1VLT A;  4O7G A;  3U3B A;  4MW8 A;  1IZM A;  2VH3 A;  1XWJ A;  1YA9 A;  3VF0 A;  2GWW A;  4RD9 A;  1TQG A;  1VYI A;  1U0B B;  1Q0G A;  2C04 A;  3ASO C;  2LFF A;  1ZW2 A;  2W4B A;  3TD7 A;  1V54 C;  5L0D A;  2Q4F A;  3B0P A;  4MVU A;  2W4M A;  4U5C E;  4MVR A;  5KYX A;  2A68 F;  3TJ5 A;  5A6K A;  3SEO A;  2CNW D;  2HJ3 A;  4X0R A;  2OQM A;  4MW3 A;  3U0C A;  1G4U S;  2W9Y A;  2PP4 A;  2ZD9 A;  4JZA A;  4PAC A;  4AL1 A;  1VYK A;  5A6A A;  4IWB A;  3RQE A;  4QDL A;  4CDV A;  1C17 M;  1G4W R;  2FFH A;  3KYJ A;  1JPN A;  1D1A A;  2YRF A;  2Z15 A;  4BJ6 A;  2EIN C;  1E84 A;  1YJG A;  1BR4 A;  2YQY A;  3ASN C;  2HJM A;  5L0J A;  2PX3 A;  2PBE A;  3DD7 A;  4JIO A;  5AGF A;  3V5X A;  3W8I A;  1PCX A;  2W45 A;  5L0F A;  3NMI A;  4RBN A;  3ZG1 A;  2HFI A;  4CJG A;  3HNI A;  1GGQ A;  2OU6 A;  3M79 A;  3RYL A;  4DRI B;  3CAX A;  1NBB A;  2NUP B;  1LKX A;  4J32 B;  2OEV A;  1ZHT A;  2HV6 A;  1M2O A;  3G4Z A;  3U2L A;  3RIP A;  1A7V A;  1S7Z A;  1DOV A;  4IAQ A;  2L6F A;  5JP7 A;  4BPM A;  4Q5S F;  4M63 A;  2ASR A;  2AWC A;  1DOW A;  2LIG A;  3N24 A;  3CZ6 A;  4YT4 A;  2R7X A;  4Q7C A;  5KYW A;  3NYL A;  3AQB A;  1T6Q A;  3C8G D;  5DS5 A;  3RF3 A;  1JOG A;  2IXM A;  5AC5 A; 
#chains in the Genus database with same CATH homology
 2OG2 A;  2C03 A;  4XLN F;  3LJB A;  2R7U A;  3FVY A;  3EPV A;  2NG1 A;  3M1C B;  3QMK A;  1V55 C;  4P6I C;  1D0Y A;  2H7O A;  5KYY A;  4PFP A;  1RJ9 A;  2CW0 F;  3NYM A;  4KNV A;  1M2V B;  2BE5 F;  3K1H A;  4HFK B;  4U5F E;  5B3S C;  2G3K A;  3IEE A;  4W8K A;  3KL4 A;  2IOQ A;  2ZXP A;  4YJW A;  1BR2 A;  3LLI A;  1NU7 D;  3EHM A;  3LEV A;  2CNW A;  1Z5Z A;  2J9W A;  3W2V A;  3K66 A;  1FFH A;  1SMY F;  4Q4Z F;  1FTS A;  1OKK D;  3QZC A;  1MNE A;  4OIP F;  2R7Q A;  2J7P A;  2PX0 A;  2HV7 A;  3EH1 A;  3VYW A;  1D1C A;  3DXJ F;  4EWC A;  4EBB A;  4NY3 A;  4BJ5 A;  1OCC C;  2DGJ A;  2G62 A;  4CBE A;  2Y3D A;  4IJJ A;  2NUT B;  2ZXO A;  3JYH A;  3LAY A;  3HLZ A;  4G7H F;  2XXA A;  1Z63 A;  4BG0 A;  4BJ6 C;  3NKD A;  1SZI A;  2GFH A;  4MND A;  2EIJ C;  4PJN A;  4U5E E;  3ABK C;  4B6I A;  2WZL A;  4C7O B;  3FHD A;  2IXP A;  4LAC B;  4YT5 A;  4JVS A;  1D1B A;  4AE4 B;  3NKE A;  3K7D A;  1WGW A;  4ANJ A;  3RKO F;  5IY5 C;  3K33 A;  4C3E A;  2A6E F;  2V3C C;  2WL8 A;  4DVZ A;  3JRT A;  3S28 A;  2O9X A;  4U5G A;  3WOD F;  2R7S A;  5EGY A;  2E87 A;  4OD4 A;  1ZYR F;  1D0Z A;  5F5F A;  3S0X A;  3RFY A;  3K6B A;  2P6V A;  3EG9 B;  1NG1 A;  1ST6 A;  4I1O B;  4JW1 A;  3W2W A;  3AG3 C;  3H65 A;  1NZE A;  1OKK A;  1W2W A;  3ECS A;  3EGD B;  1Z3I X;  3ITF A;  2NUP A;  4OIO F;  2WZF A;  3EZI A;  5EHH A;  1ZHX A;  3AG2 C;  3I5Q A;  3SZR A;  4OIQ F;  3KH2 A;  3OEO A;  3NG1 A;  3L0I A;  4U5B E;  5T3W A;  3ZVR A;  2X51 A;  3HJC A;  4QI0 A;  4U5H A;  2J7P D;  2XSE A;  3WG7 C;  3ZIB A;  4DBQ A;  3UMI A;  5F5H A;  3FAJ A;  3JCU Q;  3EJN A;  4FX5 A;  3OWT A;  5HSW A;  4G7Z F;  3E9V A;  4G7O F;  1N1C A;  2PFD A;  5DS4 A;  1LS1 A;  4ULW A;  4PJL A;  4JCH A;  2H7V C;  3F46 A;  3F47 A;  2WVO A;  1M2V A;  4BJ5 C;  5L3Q A;  3JSZ A;  2DYS C;  1BR1 A;  4K7B A;  2IYL D;  3V7O A;  5DS6 A;  2I8B A;  3EFO B;  5D91 A;  1MND A;  4KC9 A;  4PFO A;  3UMH A;  2Q9C A;  3GOD A;  5DQT A;  2J0W A;  3KMI A;  3N0T A;  3Q6M A;  3O6X A;  4DVY P;  2JD3 A;  5L3V A;  1SF8 A;  2CDQ A;  3T6J A;  4I3M A;  2V26 A;  3LNR A;  4CS9 A;  2NUT A;  2Y39 A;  2YZS A;  3NDB B;  2KNH A;  3S27 A;  2KW3 C;  2L81 A;  3W8H A;  1PD0 A;  2Q9B A;  4OD5 A;  4I44 A;  3X1O A;  3DJN B;  3EZH A;  1QLE C;  4CS8 A;  1MMN A;  2J46 A;  4C7O A;  2MYS A;  4J30 B;  1VK5 A;  3EH2 A;  4A2N B;  4AE4 A;  1O87 A;  1FMW A;  2QY9 A;  4KNW A;  3LLK A;  2OCC C;  2EIK C;  2D5R B;  1J8M F;  2Q3T A;  3B0V C;  4C3D A;  1D0X A;  3DZA A;  3UNG C;  3B9Q A;  4HFF B;  5BUO A;  4JUR I;  2VAS A;  4CSA A;  3EG9 A;  2DYR C;  3SP1 A;  4JJF A;  1TWC A;  2R7W A;  3S29 A;  3EGD A;  1Z6A A;  2J9V A;  4PJJ A;  3VAY A;  3UGO A;  2EIM C;  3AQC A;  3UGP A;  2IXN A;  3ZC4 A;  4F4B A;  2R7R A;  3SYN A;  1MMA A;  3Q6N A;  4YT2 A;  3RH3 A;  3DAG A;  4OIR F;  2Q9A A;  3MX3 A;  4BEJ A;  4E7Z A;  5B1A C;  2ZXR A;  4N06 A;  4JJG A;  2WVN A;  4H4K C;  2VB6 A;  2A69 F;  3I5P A;  2P7V A;  1ZU5 A;  3SNH A;  1G8X A;  4YT8 A;  2R7T A;  2J0X A;  2IXO A;  3Q7L A;  3EGX B;  4CS9 C;  1VMA A;  4O6Y A;  2KGO A;  3LES A;  4BJ1 A;  5DVW A;  1KU2 A;  5CI8 A;  3EFO A;  4CS7 A;  2XL4 A;  3NRH A;  2B0J A;  4CS8 C;  2YEV A;  2A6H F;  5E3C A;  5KYU B;  5T3T A;  2WVQ A;  1M57 C;  4E7S A;  3DJU B;  2LSE A;  5E33 A;  3ABL C;  2PF4 E;  1QZX A;  3ZSU A;  4KI2 A;  2WZG A;  3DM9 B;  4YN0 B;  1ZHY A;  4FWV A;  3NYJ A;  4C3B A;  2A1D D;  3HTK C;  2WB7 A;  3LS1 A;  4CSA C;  1Z23 A;  4O6N A;  3EQL F;  5KYX B;  3EHN A;  2H7B A;  5T1D B;  4HEA J;  4G0H A;  1MMD A;  2EIL C;  2ZPA A;  3T4R A;  1M56 C;  1TWH A;  1IW7 F;  5CI9 A;  3KKB A;  4XWJ A;  4AX2 A;  1TWG A;  1ZHW A;  1J8Y F;  1TWA A;  2J9U A;  4DOZ A;  4PK4 A;  1ZHZ A;  2MWQ A;  2ZXW C;  1PD1 A;  5DQZ A;  4XLP F;  3POV A;  4ZLD A;  2L9J A;  3DM5 A;  3I4U A;  2Y3H A;  4LLE A;  5KYW B;  3ABM C;  1TR2 A;  2Y69 C;  2CGE A;  5FCL A;  1OCZ C;  4O79 A;  2R7O A;  3AG1 C;  2QTV A;  4KBL A;  5KYY B;  3GAN A;  4BJT A;  1RJ9 B;  4IAO A;  2YHS A;  4LER A;  4RDA A;  4O6M A;  2KJG A;  2Y3B A;  4DBR A;  1NU9 C;  4MQ9 F;  4WJ0 A;  1LVK A;  4CIH A;  3B0U X;  2Y3G A;  3N2Z B;  3OA1 A;  3LS0 A;  3MLG A;  3K1I C;  3CQZ A;  3JT1 A;  1MMG A;  3DMD A;  1FFT C;  3UMK A;  1JPJ A;  4OIN F;  1VOM A;  4IRU A;  2XRH A;  3CSK A;  4GYT A;  3FDQ A;  3PHF 2;  4GEH A;  3L34 A;  2R7V A;  1O5H A;  4K0D A;  2J45 A;  3T6B A;  3EGX A;  3Q7G A;  5B1B C;  4FES A;  5DLJ A;  1OCR C;  4ZLC A;  2G3V A;  3UR3 C;  1FMV A;  2KQ9 A;  2FGY A;  4PJM A;  4XTK A;  1OCO C;  3O39 A;  5KYN A;  4QI2 A;  3X2Q C;  4U5D E;  1ZU4 A;  5KYU A;  2M4E A;  4HE8 D;  4LLC A;  4YWQ A;  2XXA B;  3DAF A;  3AG4 C;  3PMR A;  5E2Q A;  1TKN A;  5D92 A;  5E3A A;  3E70 C;  4O7G A;  1IZM A;  2VH3 A;  4RD9 A;  1VYI A;  2C04 A;  3ASO C;  2W4B A;  3TD7 A;  1V54 C;  3B0P A;  2W4M A;  4U5C E;  5KYX A;  2A68 F;  3SEO A;  2CNW D;  4X0R A;  2W9Y A;  2PP4 A;  4JZA A;  1VYK A;  4IWB A;  4QDL A;  2FFH A;  1JPN A;  1D1A A;  2Z15 A;  4BJ6 A;  2EIN C;  1BR4 A;  3ASN C;  2PX3 A;  3DD7 A;  3W8I A;  1PCX A;  2W45 A;  4RBN A;  3ZG1 A;  3RYL A;  2NUP B;  1LKX A;  4J32 B;  1ZHT A;  2HV6 A;  1M2O A;  3RIP A;  1S7Z A;  4Q5S F;  4M63 A;  3N24 A;  2R7X A;  3CZ6 A;  4YT4 A;  4Q7C A;  5KYW A;  3NYL A;  3AQB A;  4AK9 A;  5DS5 A;  4I1M A;  2IXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...