2W4MA

The crystal structure of human n-acetylneuraminic acid phosphatase, nanp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
b'NLYFQSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLNEURAMINATE-9-PHOSPHATASE
publication title The Crystal Structure of Human N-Acetylneuraminic Acid Phosphatase, Nanp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 96
structure length 250
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w4mA01
1ZD2P 1Y8AA 2I54A 3NUQA 5ALSA 5AKXA 1YS9A 3ZVLA 1U7PA 2GMWA 3U19A 3I28A 3ED5A 3WK8A 2CFTA 5AI5A 1RKUA 1RLTA 3L7YA 1YMQA 4JDPA 4UMDA 5ALPA 2IOFA 3NASA 2W43A 3IJ5A 4G9BA 1Z88A 3W5CA 3KZXA 3ZI4A 5AM1A 4EEKA 5AM4A 2PKEA 3SKYA 5AIBA 4HAIA 2EAUA 2O2XA 2X4DA 3ZTYA 4C4RA 5AW6A 3KD3A 5T41A 5AVTA 1YV9A 3B9BA 2JARA 1TA0A 1JUDA 3D6JA 3ZX5A 5ALQA 4BKMA 4B6JA 2EATA 2CN1A 3I76A 4OHFA 1L7OA 3KOOA 1RRCA 1Z4LA 4ZEXA 4H1WA 1U7OA 3NALA 4CF5A 4J03A 1Z4KA 2IOFK 2YMMA 3ZW7A 1F5SA 3QU9A 1T5TA 3B9RA 1XVIA 2G80A 4HGOA 1Z4PX 4CNQA 1XPJA 3AR2A 2R8YA 1Z4IA 1T5SA 1RPZA 2YN4A 3NANA 2R8ZA 4GIBA 3OCYA 4KX3A 2ZOSA 4C4TA 3RF6A 3QLEA 2AGVA 3M9LA 3UMCA 3AR8A 4YIKA 2HI0A 4HYTA 3U7EB 2ZBEA 4BBJA 2C4NA 5AW5A 3SD7A 5AM3A 4J2TA 5AI4A 3FGOA 3L1UA 3PCTA 4Y2QA 2P69A 2HF7A 1O08A 2MSNA 4YCLA 5AI8A 2HF2A 2G0AA 4EELA 5ALDA 2Q5EA 2HSZA 4Y2TA 3NRJA 5AK5A 1QH9A 4BYGA 3QUQA 5AVXA 1NF2A 2P9JA 4MWOA 3AR7A 4XQ0A 3E81A 4BX3A 2PQ0A 5AKZA 2ZBDA 3QU5A 1RKVA 3A3YA 3EPRA 1S8OA 5AVRA 1ZD5A 3L0BA 1SU4A 2G06A 3K1ZA 4Y2JA 3ZVMA 3L8GA 3EF1A 2P11A 5AKLA 4EZEA 1RQNA 2D2VA 5AVQA 5A3RA 4UW9A 5ALUA 5ALWA 3PGLA 3QYPA 5AK6A 1Q91A 5ALNA 5AW0A 3OCVA 2JAWA 4Y2XA 3QXGA 2Q4TA 5ALGA 3WK5A 2OM6A 2QYHA 1L7PA 2FEAA 3NIWA 3A1DA 3UMBA 4DFDA 2G09A 4UM5A 3IRUA 4UMEA 2NYVA 4HGQA 5ALTA 2YMPA 2R8EA 5AIAA 5AKJA 3OCWA 1TJ5A 3N8GA 2GFHA 1ZRNA 5AKKA 4BX2A 4XOUA 1QQ5A 5AKEA 3L8FA 3L8HA 1Z5UA 4UM7A 4MUMA 3BA6A 2YFYA 5AKHA 2WF6A 3N1UA 4C4SA 2HX1A 1LTQA 1WVIA 4KYTA 1Z4NA 3N07A 3DDHA 1ZOLA 3I6BA 1Z4QA 2YBDA 2I33A 4I9GA 2ZXEA 2OYCA 2ZBGA 5AI9A 5ALHA 2MU1A 1EK2A 2RBKA 3E8MA 4DWOA 2WFAA 3ET5A 4QJBA 4L6CA 1TJ3A 1WPGA 4NAVA 4PNHA 5AW1A 3PDWA 1L8LA 1VJRA 4XE5A 4IFTA 5A3SA 1U02A 2AUTA 1ZS9A 3ESRA 2FPSA 1TE2A 1RDFA 2HEGA 5ALIA 2HDOA 3R9KA 2HO4A 3RFUA 5AW2A 4NFLA 1L7MA 5ALKA 4KX5A 4XPZA 4UAUA 3P96A 5ALFA 4YCNA 1WZCA 3N28A 1RKQA 2RB5A 4BEWA 3W5AA 4UARA 2CFRA 4FFDA 4KNWA 2ZG6A 3ZWKA 3VAYA 1SWVA 5AW9A 2YY6A 3J7TA 5AICA 2BDUA 3WKEA 1U2TA 4ZEWA 4CE6A 3S6JA 3ZX4A 2OA0A 4L6AA 1MH9A 2W4MA 4UU0A 3A1CA 4Y2PA 3L5KA 1YJ5A 2FPUA 5ALXA 1N9KA 4UAVA 5ALMA 4RETA 2WF7A 2G08A 1Z4OA 2W11A 3MMZA 1QYIA 3ZU6A 4RESA 2HHLA 5AM0A 2B82A 3HLTA 3SMVA 2JAOA 3OTQA 1X42A 5AHXA 3MC1A 3WGVA 4AS2A 1CR6A 1NNLA 4G63A 4Y2UA 5AK4A 1J8DA 4EENA 4Y3UA 2AMYA 3ET4A 2EARA 4OD0A 2NO5A 2BDEA 2FDRA 5AVVA 1XP5A 4HGPA 3ZTWA 2YJ6A 2B1QA 3W5DA 2PR7A 3DNPA 4AS3A 3SF0A 1KYTA 3DAOA 1YNSA 3M1YA 3WK6A 2B1RA 2NO4A 3HYCA 4F71A 2R8XA 4UMVA 1N8NA 4DCCA 5A3QA 5JJBA 1QQ7A 2FPRA 2I34A 3L8EA 3QU4A 1EK1A 2YMQA 3CNHA 3N5KA 4Y2VA 5AI0A 4CF3A 2RAVA 5AVWA 2FI1A 3FVVA 5ALZA 3OPXA 1RMYA 3MN1A 3TLMA 1YDFA 1TJ4A 5E0OA 2G1AA 2HOQA 5ALVA 5AKGA 5AESA 4NABA 4NWIA 5AVUA 3QNMA 3AR9A 4QQFA 3U26A 3OCXA 3WK9A 1J97A 1L6RA 4BNDB 2CFSA 4E88A 3FPSA 4YCMA 4L57A 3I1YA 2JAUA 5IS2A 1T9ZA 2WF9A 4HGNA 4FYPA 3MPOA 3QUCA 1O03A 3U7FB 3SLRA 4Y2RA 1Z4JA 3R4CA 3SHQA 5AKIA 2IYEA 2YJ5A 1ZRMA 3AR6A 3QGMA 4CF4A 2C8KA 2YJ3A 4I9FA 3GYGA 1RC8A 1ZD4A 3A1EA 1Z4MA 2I6XA 4KNVA 1Q92A 2GHTA 1SWWA 4UU1A 1ZD3A 1LVHA 3AR4A 3WKBA 2B8EA 3DV9A 3OCZA 3ZWDA 2WM8A 2BY4A 2C9MA 3EF0A 5AKYA 5AK3A 1RLOA 3R09A 1RMTA 2FPWA 4JB3A 3IB6A 2OBBA 4YGYA 1L8OA 3ZVNA 3U7HB 4BNDA 2RARA 4BEVA 2P27A 4F72A 4BX0A 1PW5A 5AW7A 3WKDA 3PGVA 2FUEA 3EWIA 4IG4A 1AQ6A 4YIHA 4AP9A 3WKCA 3NAMA 2VKQA 3FZQA 5ALOA 2O9JA 5AW3A 1CQZA 2ODAA 3AR5A 3OCUA 4O8CA 3FPBA 4OCZA 4ZEVA 3U7GA 2AH5A 1K1EA 5ALYA 2YMLA 1S2OA 3QU2A 5ALJA 5FP0A 3KC2A 2HCFA 4UASA 1QQ6A 3AR3A 5AW4A 5AVYA 4YH1A 4GXTA 3QUTA 4UATA 1WR8A 3L1VA 2FPXA 4NV0A 5AM2A 3SKXA 2WF5A 2I7DA 2B8JA 4OFZA 2I55A 3B8EA 1NRWA 2C88A 3WK4A 2WHEA 1VFPA 5ALRA 3ZUPA 2GHQA 1Z5GA 2G07A 2GO7A 1FEZA 4DW8A 1RMQA 1L7NA 3E84A 3QU7A 5ALLA 3WGUA 2IOHA 2ZBFA 2JGAA 2IA5A 2QLTA 3WK7A 4UMFA 2DQSA 2YJ4A 5AVZA 3BWVA 4HGRA 5IT4A 3KBBA 4Y2SA 3QX7A 3WKAA 4Y2YA 4KN8A 3F9RA 4FE3A 1IWOA 5IT0A 1U2SA 3ESQA 3ONNA 3QUBA 1VJ5A 3KDPA 3L0YA 3U13A 2WF8A 3L0CA 1RQLA 2Q4RA 2C8LA 3UM9A 3FM9A 4EX6A 2FUCA 3CZ4A 1RLMA 5ALEA 5AM5A 2B30A 2B0CA 3UMGA 3E58A 5AVSA 4EX7A 1ZJJA 3W5BA 5AI6A 5AW8A
chains in the Genus database with same CATH superfamily
5EHZA 3M4BA 1U0SY 1QDLB 1ORRA 2D4HA 3NGLA 1ZH6A 4Y6OA 2V7TA 4JP3A 2RK6A 3CYFA 4MGZR 3KVRA 1IYZA 1SCIA 1PR3A 1EA5A 3ZZUA 1QYDA 4W1QA 3W8NA 4OX9Y 1W48A 5AVTA 2FFHA 3EGDA 3ZE9A 4F38A 1PYDA 3VOBA 2WD8A 3F5MA 4NAUA 4ISBA 4NX2A 5DVWA 5L9AA 5KYUA 3FOCA 2I22A 3GHHA 3KXLA 1CTQA 5K0SA 5BVHB 1NXPA 1QHIA 2DH6A 5ELXA 3GLSA 3IQFA 5KKAA 5T64A 4CT4B 4BWGA 3LOQA 4XGIA 3I5AA 5FV4A 1QE0A 2ENWA 4GP9A 4DR1B 2JFBA 3BWMA 1QS0A 3DCNA 4B43A 3WADA 1PN3A 2OVFA 3MZ0A 3ELBA 2PA3A 3HO8A 2G6TA 3PLAE 2CE7A 1ZLYA 1QX4A 4YV7A 3CVVA 2IXGA 5ILGA 4KSYA 2CVPA 1KYIA 3PFCA 2OGSA 1P60A 1ZUIA 1WXGA 2TMDA 1UKZA 4OGGA 3HCRA 4P6IC 2DE0X 2G17A 2NPOA 2ZBRA 2YW9A 3CS3A 1JE0A 4BMXA 2OK7A 2R8EA 5KTPA 2YFHA 5DB4A 2BM8A 3AP3A 3AB7A 4K8OA 4MJ3A 4P98A 3AHHA 3DM5A 3V8NA 1HW2A 1IRXA 4A7PA 1PV4A 3W90A 2ZVPX 2QU8A 4DJTA 2YL3A 3GJSA 2J4CA 2J9ZB 4I9GA 1NLXA 2ZXEA 5BQPA 4GMGA 1YZGA 2VH1A 2OHFA 3MPUA 5BNTA 3OY2A 1GCAA 4DRZA 4QJBA 4CIWA 4G6ZA 4PNHA 1FDIA 2PKRA 3L9WA 1MABA 1TRKA 2BKXA 5JJ5A 1MX3A 2G8NA 4GI2A 1TO1E 4K86A 3H2KA 4FT4A 1QHYA 1WULS 4HR7A 3NV7A 1CFZA 3CH7A 4L08A 1OW8A 4QU0A 1UBNA 3H1FA 3RIXA 1X19A 1R2QA 3NUGA 2NZVG 1Z5PA 4BRWA 4OREX 3RJZA 5KHLB 1OTYA 2B82A 1SR8A 3EMKA 4TX1A 2K7FA 2R05A 3ZZMA 4QYSA 4DYHA 1P0IA 2ID9A 4MPRA 4EF5A 1Y63A 4N0QA 1GNSA 4HGZA 1U31A 1BHSA 1SKYE 5KJCA 1NJ8A 4QRHA 1H8HD 3HCNA 2A8YA 3LNRA 4EBJA 1GP2A 3FF4A 3ZGOA 4IDHA 4POAA 2OOSA 3CLHA 4WBNA 4OHPA 3LKVA 1FW6A 3U48A 4GPAA 4QVKA 3GUHA 3F3YA 3TKAA 1NXVA 1I5EA 4LERA 5EP4A 3PGKA 1I4ZA 3N39C 5CLLA 2GB4A 1N5KA 1MUUA 1YQEA 5JR3A 4HVAA 4DRXB 2QQEA 2WM8A 3D0RA 3JZFA 2X19A 1WBJB 1KKLA 3R09A 3IB6A 3B51X 1R4MB 3OLXA 3BBLA 4BNJA 4BNDA 3KDSE 4MJXA 2GEDA 3ME5A 4AIIA 1FUKA 3CNOA 3UUFA 4E2XA 2J7KA 1T2EA 2NACA 3LGAA 2XGJA 4U6NA 5JXGA 2D8MA 1P2BA 5GVSA 2OZPA 5FNVF 1LQUA 1CGOA 4JYPA 1YARO 4L1KA 3X1MA 3CLVA 1J23A 5AVZA 2CK3A 4KKXB 2GH1A 2WOJA 2IUFA 3MM4A 3EZHA 5H5JA 4R81A 1VCHA 1N1CA 3ABMC 1P2UA 4F2PA 4H3SA 3VDRA 1O94A 1T8TA 1PFWA 3O95A 1E9AA 4PO1A 5M7EA 2JX0A 1ZK3A 2JJQA 1DOHA 2NSGA 1ZDMA 4QU5A 4KE8A 3W6OA 4NPCA 2ID8A 1SQ6A 1TUGA 3N8NA 2A9RA 4BPBA 3HUUA 2VQFB 2G67A 3HU3A 3FCEA 1XTBA 3ETGA 2WD9A 1Y4SA 2XEXA 3KR9A 3PP8A 3A10A 3LWNA 2BFDA 4WESA 1A5AB 3RIHA 1SHKA 4H3KB 5D3MB 1EUCB 3HR7A 1AGPA 3PSAA 2QY6A 5D86A 5JLIA 4AZSA 2ZYGA 2M6LA 3GWNA 3AR8A 4I5IA 4KSCA 2H1RA 2Q07A 3M8KA 5JP7A 5DWVA 3UJ8A 1UK7A 4UEJA 2VEOA 1NI3A 3DBHB 3MB8A 5B53A 1R6BX 3GARA 3BZUA 4Q05A 4BNVA 1SCDA 3L0BA 3BCSA 1FMJA 3ETDA 3OJWA 1B6SA 2GAAA 3V8PA 3QBTA 4LVOA 3B6KA 3WOVA 2JLBA 4C29A 3K0CC 3GIWA 3IRUA 5B64A 4HWSA 4AF8A 4LHYA 4N41A 5DQZA 2HDWA 4ZVRA 1JEDA 3C1OA 3MJDA 1VTMP 4FBGA 3R4VA 3GANA 5KC9A 4ALKA 2BZ1A 1MB9A 1PG2A 1WPGA 5T3TA 2D0OB 4G09A 4XE5A 3UT6A 2AWNA 5BQFA 3R9KA 4P3PA 1GG5A 1V11A 3F5SA 3IFSA 1QAMA 2OCAA 1YBHA 4N76A 1S9DA 3ADBA 2ZFUA 4H16A 2Q0SA 2E5FA 3LA8A 4JLKA 5COAA 3MCVA 3GOQA 4LJAA 4TZ0A 3TAHA 2MR5A 5DM0A 5JPCA 1FFCA 2DKOA 5KVQA 4RACA 1PKXA 4GLBA 2I8AA 2FAXA 2NZYA 1GUFA 1UPXA 2HNBA 4NIMA 3WGVA 3UV3A 4ZYVA 4Q4LA 4MP8A 2VSQA 1LM3B 5C1IA 3T52A 2QR3A 3WQQA 2QT9A 1RRKA 3QWAA 3C5HA 3DNPA 1ODCA 3JYYA 1TAQA 1JR4A 4QASA 8OHMA 2YRWA 4WXYB 3R6TA 3VTZA 4P4UA 5HF5A 1JT9A 1NVAA 2COEA 2OESA 5DYTA 3G89A 1N2SA 3LESA 3GRVA 4K40A 2UVQA 1M2JA 1NMQA 1BVYF 1JLLB 5TQJA 2LZ0A 3U0CA 1FTGA 3GFSA 2YWXA 5IBCA 3WHKA 121PA 1JAYA 4GUDA 4RK4A 2ODBA 3CNBA 4Q7KA 1NR7A 3G2LA 1W1IA 3GF4A 4RVNA 4YAKA 1ZD4A 4OQDA 4FMDB 1PQ4A 5HW0A 4ZAXA 2QVYX 1WXDA 1L4NA 2BR5A 1C80A 3MCAA 4REMA 2C9MA 2R6AA 4ALLA 2YHSA 1CULC 5EJ2A 4CM1A 1BJKA 1E2KA 5HDQA 1HE2A 1RYMA 2OEVA 1I3OA 1MO4A 4RZ2A 1CPRA 5B1HA 3E1SA 3E9NA 2GBCA 2DUMA 3AJEA 1ZZGA 1Q0MA 2ZI6A 1NYQA 4ZJYA 2CUKA 1PFKA 4JEHA 3NH6A 2H5EA 4PTYA 4PZZA 1K6IA 4ENSA 1GRRA 3HDGA 4DLYA 2JCBA 3EQ7A 5EHNA 1NFNA 3WGZA 1COWA 3N86A 4MVXA 3MBGA 1RJ9A 5CFRA 4WJZA 2O0HA 2RD2A 5K3CA 1EP1B 4DUZB 2XE8A 3B0VC 4QXRA 5J5VA 2JPUA 1OH8A 2A84A 1SHLA 1L4GA 2ZJFA 4UMDA 1QGZA 5DEOA 3FXHA 4EEKA 3IIKA 3TFWA 1M75A 5JNWA 5AIBA 4LDAA 5U1PA 3C8UA 1EX1A 2JARA 1TA0A 4JMPA 1ULUA 3E3MA 4YQFA 4DT1B 1Y8RB 2R5WA 4IOJA 5J1TB 4BB5A 3TRDA 3I76A 4BFZA 2DYRC 2V8OA 3EVDA 4J1TA 2VK1A 4WHMA 3BXGA 2JKVA 5JCJA 3PICA 2QM3A 2YIJA 2EG5A 4DV0B 2AN4A 1XQ6A 3BL8A 4BGVA 1PI3A 2VPPA 2NXNA 3JSAA 5JS5A 5HV9A 2JZOA 4E0BA 2NZ8A 1IQUA 1NHWA 5FWAA 1YQWA 2AJCA 2Y99A 4RHYA 1ID8A 4O59O 3ZTMA 1NASA 2QRUA 3TMAA 4MV0A 5I7OA 1JSCA 3MHPA 4DC0A 1KS2A 2GXAA 5K9ZA 4ES6A 2P11A 2G83A 1T0PA 2WWHA 3SQNA 2QR5A 4MVYA 5CCDA 2Y3BA 3ZS9A 1YT5A 3Q3JB 2ZIXA 4CDRA 3DXJF 4ZQEA 4RMNA 3A6GA 4ODIA 1KMHA 4LSWA 1TM3E 3PL1A 4IAOA 2PGAA 4ZTUB 2X42A 4JT4A 4BN0A 1OIXA 1SR2A 3CNLA 3JQDA 4WOJA 1NPTO 1GG9A 3FYCA 2YFYA 3OCJA 2DGDA 1OBFO 1KMCA 1TYDE 5DHQA 5HG0A 1QONA 2H1SA 4FEAA 4H1HA 2YLGA 3QWIA 2YV5A 4UUAA 2RAPA 4DV6B 1OR8A 3IESA 3ANLA 1NUHA 2QL7A 3OM9A 1LLUA 1K06A 5DDIP 1J5XA 2JC3A 2RGGA 5CA1B 1ZG3A 2FP4A 2YFQA 3O74A 3CE9A 1SVNA 4BEMJ 4WZZA 3MJVA 4KOAA 3Q8WA 4HHEA 4DDVA 2HLNA 2UXDB 3KZVA 1KIFA 3GLFA 2UYQA 4YRCA 7ABPA 4J3FA 2VHVA 1SUPA 2AQKA 2QUKA 3L84A 4KJZA 2IEIA 4XYGA 4ZVLA 2B1QA 1G17A 1FCJA 4WEQA 2OHHA 2GZDA 4V0KA 5CVUA 4HBGA 4FGWA 1N8NA 3H2YA 2GPTA 4Q9AA 5DPMA 1XCBA 2RAVA 5AVWA 1H05A 4PBTA 3ZJ4A 3LVRE 1CCWA 3LV8A 2ZWOA 1FP6A 3KV1A 3SHFA 4BKQA 5C8ZA 4DUPA 1M83A 3AO0B 1OXBB 2RHRA 5DNUA 3B78A 3OHMA 2ASEA 4E4TA 4KXQA 2FFQA 1BO6A 4OMFG 3GUYA 4L8GA 3GAMA 3I01M 5FOUA 5BQHA 3JD4A 2VCYA 3T3NA 4JX9A 1M10A 1SBHA 5DTMA 2CVFA 4Z99A 2DERA 3C8GB 4BZXA 1OI3A 4ZCLA 1W1UA 1PJLA 4BNWA 2J3DA 4BZPA 1ZRSA 3C70A 4H0CA 1ZJ4A 4JBIA 2QRPA 1JJ7A 3HB0A 1KXJA 1NMSA 2ZXUA 3UGJA 1AGNA 2XWSA 2IDMA 2P7IA 4BEVA 1DP4A 1AO0A 2PH3A 2DWUA 4PR0A 5AYVA 1KFCB 4JR1A 2KJGA 2VBIA 3AY3A 1FFBA 5KWSA 1QG2A 2HK8A 5KAMA 2YLDA 4AMZA 3D7KA 2HCFA 3ANMA 2FUG1 3ZKWA 2DUJA 1F12A 1II8B 5E1DA 3KKEA 1RMQA 2BFCA 4GWLA 1R5NA 1E3WB 1N7HA 1XDBA 1UKAA 1XTVA 2VJDA 3Q9SA 2C9OA 4ZOLB 1FFHA 2C7QA 5F3RA 5JW6A 3WMWA 1O5OA 4MRVA 1B7GO 4IM7A 1ENOA 1QKJA 5J4YA 1RIIA 3UJPA 1ZJJA 2Z4RA 1Z0DA 2QLAA 1KSJA 2GD2A 4IXDA 3HYLA 4B7ZA 3R9XA 1W4BA 5K0CA 2I66A 1O9GA 2IE0A 2WVGA 4X60A 5JSLA 2XWQA 2AC7A 5FO1A 3PE6A 3ZY2A 1VL6A 5EZ6B 1RRFA 3MTDA 2NSHA 2B6HA 4X1YB 3EZYA 1PGQA 2R7WA 1RHRA 2P30A 3L7MA 4MP3A 5BQ3A 3SIRA 3AP1A 1FYXA 1XGKA 3S2EA 3PENA 2O8BA 3Q2OA 2J07A 1YZ3A 1ZNWA 1XNJA 4R7TA 4U5EE 1LKZA 4RU1A 1NSYA 4FOOA 2PUHA 1YZFA 4DHEA 4US1R 3U7EB 3CZRA 3KZOA 5G3YA 2IHNA 2P69A 4Z4QA 5F5FA 3QWHA 1T8SA 4M1WA 5ALDA 1KK3A 5TMPA 1W75A 3HY3A 1ADFA 4KYUA 4YMVA 2HZ7A 1T8PA 2XCOA 4NEHB 3G5AA 2UUHA 1E5VA 1VYVA 2JH3A 5J47A 1D2AA 1AKNA 4EGFA 5BP7A 5AKLA 4GICA 1HEYA 2JEYA 2O9XA 1TRHA 4EFDA 2C78A 1VFNA 1JXAA 3PGLA 1N7IA 3GGSA 1E85A 4NESA 2FDXA 3O8CA 4EW1A 1N1EA 2AFIE 2CHGA 3VSCA 3HKKA 2YNMA 3DHYA 5AVOA 3OMWA 2R87A 3QJ5A 4EI9A 2O0KA 4LXGA 1Y3DE 2WK1A 4ANFA 1XZEA 4CXMA 2PSSA 2BV3A 2WI8A 1XWIA 5T67A 2OYCA 5DK6A 5IKEA 4IFIA 4DMHA 3KVOA 3DHEA 2JVJA 2W93A 1QRSA 1I7DA 4XM1A 3TLJA 2B9EA 5H3LA 1GXSB 2KB0A 3G17A 1KZ1A 4YUZA 4B3MB 5IKOA 3KYCB 1U2DA 3OMLA 2HDOA 3A36A 4YDHB 4OHRA 1Z18A 5GOTA 2VT7A 2F3SA 3AJ8A 4BC0A 1H3EA 2CFRA 4IQFA 1J7JA 1WSBA 4TRJA 1IEXA 1D0YA 1SWVA 2ZM6B 5JJIA 1M34A 2VR1A 2JLQA 5L95A 1CRLA 4ZAWA 4BRSA 1FDRA 2R11A 3EOAI 4HDKA 3HWWA 2J3EA 2FQ1A 3HP1A 5HRCA 3U44A 4Y3UA 1M0TA 1IB0A 1RTKA 1RRMA 5CDGA 1GTRA 3LUJA 5JD5A 1DDGA 4BEBA 4C0SA 2Y0EA 3D8TA 4N5DA 2BTQB 2WDPA 2O3UA 1Y6RA 4M60A 1V8FA 5ITWA 2WJJA 1X80B 3UGTA 1I8TA 3H97A 3V8QA 1O3YA 4ZT7A 3IQCA 3D7RA 3M4NA 1OTXA 2GXUA 3G1TA 4UUQA 5ENZA 3RYCA 1XAIA 1CQIA 1H4QA 4LRWA 7MDHA 1WASA 3CJRA 4JNKA 3BB4A 3M1AA 1TFKB 2L82A 2IY9A 4CIBA 2HJRA 4E3ZA 3H86A 1QVWA 2OGTA 4F21A 4I1SA 2CYCA 1WXWA 2C2MA 4JYBA 3RS3A 1GGHA 4Q3BA 3P9PA 2YHBA 1QPBA 2GN6A 1D8TA 1P1JA 2IF0A 3MGCA 4G0VA 1XDWA 4B34A 1R7RA 1ZM3A 3NMKA 2XRHA 4HNUA 1F1MA 2D8AA 1UPUA 1BQ4A 5LBIA 1G4AE 4OQXA 3ZGYA 3KXPA 4ZAZA 1HE5A 1MG5A 4FHDA 3W2IA 1XPOA 3THYB 3TLEA 1JWBB 5IAEA 2QP3A 2C88A 5ALRA 5CYPA 2ZATA 3K35A 3ZEAA 3PRHA 2ZZMA 2G63A 2YWEA 2GK3A 1UZAA 3VR1A 5JS2A 1QH8B 3W3AA 2YJ4A 1OXTA 1LW6E 1HLDA 5LKRA 1RLIA 1WDKA 1LB1B 2IS6A 5TRTA 2O8FB 1RWWA 5L7TA 3RKSA 1KYQA 3ZE8A 5E4FA 4MYDA 3MLAA 4KR2A 1O94C 2VUTA 5AI6A 1VIMA 3R3SA 2BEVA 5AKXA 3TQSA 4WMLA 5DJ5A 1BMDA 4ESVA 3OESA 1D4ZA 3LCRA 3ZG1A 1X70A 2JCXA 2JLSA 1OBOA 3KYDA 5A5VA 3VDNB 3ZJVA 1N5DA 4F3RA 4PICA 3B9BA 5AJUA 1FNMA 3ZVKA 1MH1A 3D6AA 1Q57A 4NI5A 5D3QA 2WL8A 1EM8B 2ASVA 2BD0A 4LY9A 1C3XA 1Q7RA 2M32A 2O50A 4BRUA 1M74A 3AIKA 1EFVA 2AXNA 2AF3C 1VK5A 2VP4A 5GM2A 4DR6B 2H9YA 3ND9A 3EJNA 4NY1A 4BCCA 2E9SA 4BNHA 3I4UA 4YALA 4E2WA 2YQYA 1FIUA 4E5MA 4EA8A 4AJIA 2QRMA 1DUSA 5EG5A 3KUXA 1HQDA 4XM2A 1SRRA 1XUOA 1PP4A 3TZKA 3KJXA 1ZN2A 1SXIA 3K6SB 4IO0A 1PR6A 4LV6A 1IHUA 2ZE5A 1ZVVA 2Y1CA 3HGQA 4LNHA 3UK2A 1MAUA 1OOEA 4KPEC 1LNZA 5EWLA 2ECFA 3BPSA 4HTFB 1E1DA 4QXOA 1W9HA 3JARA 1ISRA 3U1BA 4EHHA 5A4IS 1E64A 3P2JA 2OV4A 2W2PA 2UVPB 2DWPA 3H5VA 4B87A 2Q1XA 5EWJA 2EW8A 4YRDA 3DD7A 1GUBA 5LSAA 2H59A 3I12A 4A8JA 4MEJA 3K1HA 1DMSA 3GGGA 2ZXRA 4XD7A 4L2IB 1R16A 3HKEA 5HFAA 3IDAA 3UKOA 5CGQB 3I4CA 2L6GA 4TV8F 1YCFA 2ETVA 2O54A 3AEQB 2GDZA 4RA6A 1BA2A 1NBMD 4EAAA 3R0XA 4GLFA 5D84A 1BWSA 2BKAA 2HXYA 1H5NA 5JAUA 1YDHA 2J5KA 3D4NA 1YJGA 2BDEA 5ICEA 2NO0A 4Q7CA 4XUGB 4NQFA 3BFKA 3FNFA 1MKYA 4DCNA 2VHCA 1KE1A 2H7BA 2H65A 1T4MA 1KR5A 2FUKA 3LBYA 4ZARA 2R8XA 3BULA 3RC9A 4U0KA 2DFNA 3PYXA 5TQ2A 3RHTA 4EGCB 1OYWA 2BI4A 1SUWA 5U4XA 2O06A 1X8LA 4KDCA 1Z62A 3IOYA 1ECJA 1GAXA 3TTSA 3U4MA 1MC1A 4I1YA 5JRDS 1YB7A 4DYVA 4JS0A 4PZ0A 1LWOA 6AT1A 4LMRA 5ITZA 4RZXA 3Q0EA 2DVMA 1KPHA 5T8KA 5FULA 3T1QA 2YWAA 1RLJA 1E1NA 4YNBA 2B4TO 4GMDA 3WLPA 2GNPA 1UBSB 3A1UA 4U3JB 4ESHA 4QUIA 3QW1A 5BQGA 1JG4A 5FBKA 1WDLA 3F5DA 1BBHA 3WKDA 1KMIY 1AQ6A 3QVWA 2ZS7A 3AR5A 4HNHA 2Q9AA 4XOIA 4I9NA 4DJ9A 1YIDA 5J2UF 1TJPB 4FYKA 1Q17A 4CTNA 1NRWA 2XCTB 1J20A 1DQYA 5AGFA 2A0KA 1D1SA 1ZOSA 2P1DA 1HDYA 4KRFA 2GK7A 4CG0A 4XYBA 1IK4A 4BL5A 1CPQA 4XVHA 3RSZA 3W2GA 3E82A 1IPFA 2B4AA 3F2VA 3JSZA 2V7XA 1UIMA 3II6X 3M3DA 4M1YA 1J49A 1Y3CE 5JOQA 3E58A 3DCYA 3TULA 1QHHA 3PWTA 1B14A 3I5QA 1PJQA 2Q8QA 1GUAA 1U5BA 4F1KA 3NRHA 3WA6A 4URXR 3ZD9A 2O8NA 3ZI4A 2H52A 2PMKA 4RQTA 1FE8A 2LDXA 3EVZA 1AUXA 1QHNA 4MWSA 2I4LA 3FB1A 4YBRA 2EFGA 3R5TA 2JHCA 1U7OA 3GBSA 1V1RB 3FZEA 4KAFA 1SXJA 1PZMA 2G76A 4OXKA 3PXXA 3RAEC 1NHGA 4J1TC 3RV4A 2GDJA 4KLNA 3T99A 4FWTA 5LYJB 4J3JA 2B35A 5IF3A 3TJZA 4NZPA 3EPKA 2OC9A 5THKA 2ZB3A 3WTBA 3TB4A 2W2XA 4XIGS 1GPLA 4XEUA 4IWNA 4CKCA 5JAOA 3AR7A 5EQFA 4J0IA 2D2EA 3BQMB 4R2KA 5FIUA 5CB0A 3AKZA 1BWRA 3W6NA 3K33A 4LRSB 4F3KA 2OCPA 1CVRA 3JQ6A 1QBGA 3SXJA 4CL2A 2NWQA 4O4LB 5DFAA 4YMWA 2WSSA 4ILEA 4GPTA 1QRDA 1K4KA 1XZDA 1ZAYA 4M0FA 3HEAA 4F6CA 1E1RA 4MNTA 3ESYA 2P2DA 5DHAA 2BI8A 3IVCA 4K3VA 1QH1B 5FTLA 5K99A 2O7SA 3I52A 1H2BA 3KPWA 2DPHA 2WG0A 4XGNA 2VHXA 2H4FA 4NFLA 4OM7A 2G1JA 4Z3DA 5LOVA 1VJTA 8ATCA 3A31A 1RAFA 1ESMA 1HY5A 3N0XA 1WUKS 2G0TA 3WKEA 1UMKA 3L07A 4EHBA 2H4JA 5NLLA 3THRA 4FNMA 5DBGA 4IIJF 2I9KA 4GS5A 3BMNA 2X0NA 4MTOA 3C3WA 2A0BA 2HT6A 4EF6A 3G49A 3QVVA 4U02A 3M7IA 1EFRA 5AJWA 4HAYA 3MGBA 2B8NA 2HZBA 3UMHA 3D6TB 1E6WA 1KVUA 4IR7A 4J0HA 4MQMA 1P9WA 2YMQA 3CNHA 1PS8A 1JP7A 3NTVA 4QXQA 4UTZA 3WGLA 4JVLA 2PMDA 2VDUE 1YASA 2CV2A 1ESNA 4PO8A 1C3VA 2DBVO 3GJYA 2LIGA 1RADA 4FCWA 5AESA 2XHEA 5DEIA 1TYBE 1ZMTA 3FOAA 1Y7TA 4OA5A 2B5WA 3KOYA 2ECPA 1ELOA 4IOMA 4KIWA 1MRZA 3PSHA 4TRMA 3LUBA 2VKTA 5DLQC 3T9OA 3GVCA 1JFFB 1RYEA 1NDHA 2W45A 2QZPA 4YRIA 4IZIA 3VBEA 2AD5A 5GVRA 2DJIA 4DKXA 4EYOA 4R2WA 1QFJA 3NC0C 4C06A 4CKWA 1OAAA 4RGVA 4A82A 4Y8VA 3D81A 4D45A 5BR1A 4JEUA 2ESRA 1Q0UA 1PJTA 3AJMA 1H2EA 1E3TA 1NVEA 1SUAA 4PQFA 4C4YA 3QW2A 2ZGVA 2ZW9A 4DOZA 2J48A 1T1RA 3CUYA 4XLLA 1KEZA 1N4DA 1UL1X 4IYJA 5DGCA 4XUCA 1YMVA 1E0DA 5E6SB 4MMZB 2H0QA 2EX1A 4YRPA 4KXVA 1E4VA 4FFVA 4M53A 1VP9A 4EX6A 5IC5A 4BV9A 5K6TA 1DAOA 1T24A 4NZYA 3VU3A 4BIIA 4QDOA 3OPVA 1JEEA 3GIDA 5JJKA 3VU0A 1R4NB 4B3TB 4CLRA 1UZMA 2LP4A 4KV9A 5BWNA 1IUKA 5JUWA 3E53A 1Z7EA 2PEYA 3GGDA 4RVDA 1PR0A 2WHQA 3PNSA 3PNOA 2Z8YM 1HBJA 3NKLA 2H2HA 4F12A 4LHSA 3H19A 1OXXK 4CF5A 3GN2A 3KVYA 4DTCA 2APJA 1UJCA 4JIOA 3A4VA 2PZBA 4QQ8A 4P3XA 2VP3A 3QI2A 3IAUA 2ZT6A 1LNSA 4OK3A 3JYLA 1FS5A 4HY3A 4OF4A 1U1GA 1RCFA 3AI7A 4P0TA 4QOFA 4LI3X 4J16A 4QM6A 2Q3LA 1BXGB 4RMJA 5KVCA 1NPDA 2PK3A 3DV2A 3A8TA 4IJ6A 4N5LA 5BRAA 1TTHA 4XWTA 3LQ2A 3AG5A 4Y2JA 4EP1A 1Q1BA 1SBCA 2R6R1 4KFRA 1WD7A 2JFGA 2GBFA 3WAKA 3TDNA 3PNKA 5IJ0A 2PXCA 2RG1A 4WLVA 4F04A 1QYXA 4DUGA 3EH2A 2WRZA 3NJ8A 5H0IA 1NXSA 4TUYB 5JROA 3P94A 4FPXA 1CP2A 3OA0A 4XYLA 1EVYA 2XXJA 1UEXC 1DPGA 421PA 2YNMC 4WRRA 4AO7A 4PBRA 2WJVA 4RQUA 1G5HA 4B6PA 4DZRA 5CXSA 4W5RA 2XMGA 1CJCA 2H1FA 4QGBA 1T3SA 4DSAA 3MJSA 4ZI7F 5TGDA 1YDGA 1U2DC 3AY0A 4OHUA 4ZYLA 1WZCA 1CF4A 3BH0A 4EK9A 1FTQA 2A14A 4DMFA 4UU0A 4UVDA 2A0YA 2BMEA 5LA6F 4OSEA 3PQ2A 2O5VA 4ZOBA 4G0YA 3CN9A 1DBWA 4BO2A 2ZI5A 1VP3A 2ZRQA 2YWDA 3ET4A 3ZHBA 1ZVQA 4HQ0A 3HKCA 4DXWA 2YJ6A 1ENYA 1B73A 3OZCA 2Y69C 4UNPA 4ER3A 3KUCA 4QBIA 4P58A 4BMDA 4F5YA 1MEJA 1S2LA 4TGLA 5DNEA 4HVTA 3AFNA 1NJFA 4WK0B 3IOEA 3P2KA 4EQZA 3H13A 4J91A 5KSOA 3PJEA 1KPGA 2PE5A 1YRQA 4WKBA 2ATIA 1D04A 5PGMA 4YAWA 1V8PA 4TPKA 4UBOA 1FLVA 5I9BA 2YN2A 3GLFE 3LQKA 5I9MA 3Q3VA 5C32A 2VF4X 1Q1NA 4JBYA 3S1AA 2H5LA 3HFGA 2ZI4A 1XKTA 3NDBB 1RWQA 4X44A 3HCPA 4O8ZA 3VV3A 2JFYA 1ZRMA 5LZ8A 4JQZA 3GODA 2IPXA 4UU1A 4Y7DA 3BXEA 4DMLA 2W48A 4PVCA 4R5HA 3I37X 2X7XA 3FAKA 3RSCA 3U56A 4BY9E 3BEOA 3NHJA 1GPDG 3GNQA 4UNRA 2PMBA 4PG6A 4ZC1A 4XLZA 1QNLA 1M9NA 1OLSA 2CUTA 2JHGA 3SYNA 3FMSA 1I80A 4EZIA 1XNGA 3NORA 1A0BA 1OYVA 1T5BA 1ZM2A 2HJMA 3KKZA 5B3JA 5TXGA 2PRIA 3UWMA 2C4KA 2ZAYA 4DLWA 3RW9A 5AOBA 2B7BA 2QVGA 3Q98A 2J3JA 2OTCA 2F9FA 3BT7A 4Y2SA 1QJCA 2R7XA 2D1YA 3ZQJA 1F60A 5BR4A 2ZYWX 3ONNA 3PFIA 5CDFA 1J99A 4A0FA 3FRHA 3M2PA 1GTVA 4B1FA 5FNVB 3KB2A 2HWKA 4JQOA 5E4TA 5TEWA 1TC1A 2HMAA 2XZDA 3N87A 1TKAA 1QP8A 4BE4A 2WZFA 1PZHA 1MVLA 1ECPA 4MKHA 3D7NA 4UUBA 5CAEB 3BDVA 4DJAA 2IS1A 3WK8A 5G0UA 4ZVQA 1FPQA 3CLTC 3CQ9A 2KPOA 3HU2A 3BKWA 3NBAA 3STXA 3T6JA 3ZTYA 4TLBA 4DSUA 4YAUA 5TB5A 3VZPA 1EESA 2ZB7A 1Y6QA 3DXXA 3HMKA 4LDJA 1U89A 4JUFA 3CEMA 3MYYA 4WGZA 3P0EA 1YS4A 3G9UA 7REQA 3CA8A 3E9VA 3JWHA 2G70A 4YMLA 3L02A 2BTEA 2XAAA 2JGDB 1MQAA 1N6OA 4RJTA 1YKSA 4BP1A 4UHJA 4G23A 1T5SA 3I9V6 1KIMA 1SUSA 2IBMA 3VO1A 1Q19A 5L0HA 3SSOA 3IKVA 4J2TA 5TQ0A 1XLTA 3BGSA 1HFKA 3R3WA 3C7DB 2HF2A 2WIBA 2XW6A 1OV4A 4FVTA 2H2FA 5AKZA 3ASYA 1XA3A 1DC6A 1U99A 3V4RA 1CFJA 3MWJA 1LI4A 3T15A 5K0ZA 2HA7A 3FE2A 3DE5X 3KR2A 4KAAA 4PPGA 5IXYA 4LE0A 1NVVQ 3L7LA 3DEZA 1P6UA 2FH5B 2MYTA 1BS9A 4WCVA 5IFLA 5K8IA 2E4ZA 5LPNA 1E7SA 2CZQA 3F90A 4RVOA 4PYIA 3DFMA 1U3GA 3HLYA 1TADA 4DDTA 4YCCA 4ZK6A 4C88A 4LG1A 3RTBA 3EHNA 3NJ4A 2JCSA 3CJTA 4GQBA 1L5LA 5BNWA 1L4BA 1S96A 5EN4A 2GEVA 1OCZC 1KMNA 4ASUA 1WB4A 1CDOA 3AERA 5K0IA 3P27A 5DGHA 1RXCA 4MKXA 5LLTA 3AZPA 2C2ZA 4A8JC 4KMSA 3LD9A 3TXYA 4JVSA 1RS0A 1ZNXA 1MW8X 4XX0A 2SNIE 3I2YX 1K6MA 1N3YA 3OJXA 1I6KA 4YL1A 4LI0A 3EW9A 2G9VA 1WE2A 3ZCUA 1TW3A 2O2JA 2Z3VA 4BG0A 2X0JA 1H8EA 1NSFA 3NTUA 3EGXB 1TM2A 2XUGA 2ON6A 1A4RA 2VUUA 4FQ5A 1UADA 3G4ZA 3EGEA 2BONA 3SFVA 3QNUA 3EXG1 4TZ6A 1M34E 4QFDA 4YPFA 5H59A 1ZH4A 5B1AC 2IIBA 3KQKA 4C4OA 3INNA 4H9GA 3FXAA 3WR5A 1P91A 4XWAA 2GZAA 3OEYA 4C7KA 3DAPA 3IUNA 5E6UB 1A5BB 1FBTA 1IOVA 4S1VA 3VQTA 2PUDA 1P39A 5LNK6 2XLEA 4EUFA 3RLIA 5BUZA 4MRMB 5EXSA 3V8MA 2PUJA 5T8KC 5AO9A 4O1HA 5K01A 5EIBC 4IIEA 2V65A 3B13B 4OX9B 3K09A 3ESXA 1QK3A 2V1UA 1A2BA 5JY1A 1CF2O 3QKUA 3UAOA 5DISB 3WTCA 2M6RA 4YXWD 3LUTB 3FNBA 1G59A 1X3LA 5EC8A 3G2OA 1W52X 3FPBA 3G2PA 4OMDA 2BN4A 4N18A 4ZZ0A 4UASA 4G56A 5AW4A 4CI0B 4HLDA 1TM5E 1I4TD 4DB2A 1FW8A 3NFYA 1EZ4A 1QV9A 2UAGA 2OLEA 1Q0RA 4PYJA 2GCNA 2JGAA 2J9GA 4GZ5A 1I14A 4H1TA 1MU0A 4FYHA 1TYEB 1RZVA 1MQVA 4X6UA 1E7WA 1YA8A 1G5TA 4TL7A 3KRTA 2QTHA 2GK4A 3OPNA 2V74B 2IHUA 3W5VA 3WMXA 1TZCA 2CBZA 1NVTA 5ALEA 1JKMA 2W90A 3AEUB 4RC9A 1ICEA 3GT3A 3K7DA 5E3IA 4Z9YA 1V74B 4NV3A 4IH9A 3WGOA 5J4VA 4OFWA 4RULA 1IJKA 3CXRA 4TTAA 2W98A 1MVNA 2BOVA 1PL7A 3JQQA 5EINA 2CDNA 3LQYA 3IHUA 4WN3A 2AA3A 1W7AA 3F6PA 3NWOA 1Q15A 4KWTA 4QD3A 1QOQB 1RAAA 4X0RA 1MC8A 5M3BA 1T5HX 1EFAA 3DVAB 3E48A 3HBMA 1T29A 5JWRA 3B52X 4HXYA 1SXJC 2HV7A 5KWEA 2MYSA 1V16B 4BQPA 4XKJA 1IN8A 2AEFA 3TX2A 2ZOSA 3FHDA 2LCQA 2RB4A 1LDBA 4F9EA 2IEAA 2ZJ2A 1Z35A 3OIUA 4PCAA 4YJ2F 2N47A 5JQGA 1AKRA 3FYSA 1HNWB 5DM2A 4GYTA 2DSNA 5JNLA 1O6CA 2QORA 4RHCA 1K5GA 3A2NA 2BL4A 2DPXA 3QMWA 3G2KA 3NNSA 3V4LA 3RVJA 1Z39A 4MHTA 2BVNA 3L4SO 3QXGA 2CXPA 4IQ0A 4HRXA 2QI9C 2ZYAA 3DZHA 1SF8A 4XFDA 1VHLA 4FS3A 1L5FA 3O7WA 1RP1A 5AKHA 1SU6A 2XWJI 1LTQA 3GPDG 5K51A 4YDRA 3KPYA 1L8AA 1EVLA 1CQWA 4NBKA 4UTPA 4UUOA 3T9EA 3DW3X 3RVKA 1T6XA 1YA4A 1V7QA 3TM5A 4R0MA 4JB2A 3D4PA 3UHAA 3EPLA 3C8DA 2Q6KA 1QHEA 4GKAA 1J07A 3OIGA 1JOGA 2IYWA 3DL4A 3FG9A 3DFZA 3VR5H 3I45A 2IPMA 2OBMA 2PX2A 4GL2A 1EFTA 1ZSYA 3NZEA 2O5RA 2HXGA 3S7ZA 4G5SA 2PSEA 3NOQA 3OM1A 2K2QB 4W7HA 1QRUA 4XJTA 3KYBA 4L9SA 4RTOA 3PPXA 4LNUA 4YJ3F 3UMYA 4FILA 4JTDB 4ONSA 2C5HA 3NYIA 4CV2A 1BQ3A 1MEOA 3ZIAD 5LN1A 4LECA 2YV3A 2ADMA 4D6XA 2J67A 3RASA 4BXOB 3F6BX 4UUPA 2ZR8A 3GLHB 3TI7A 4BHTA 4IFEA 3WLSA 3L1JA 4HGNA 4R51A 2VH3A 2HBZA 4KI0A 3UJDA 3SXPA 4PS0A 3KYJA 3IBTA 1LSUA 2AFVA 4BMOB 1FNTc 1MJHA 7ADHA 4B6RA 1J56A 5B2ZA 1L5GB 1JHUA 4KNVA 3IBFA 3K9NA 4N6OA 3DW1X 3J06A 4OQQA 2PFSA 4MW3A 4NBNA 2EGUA 4P2GA 1JBEA 1MNAA 2CV1A 4PK4A 2AX4A 3BKXA 4FYYA 2EJVA 5TIIA 2P9GA 2XVXA 4DTIA 4E2YA 2AH5A 4BJ3A 2QUJA 5TT1A 4L8FA 4G5RA 4O5OA 1MNQA 4MRNA 1RKCA 1D9XA 4WK4B 3FVRA 3OBIA 4LXYA 4WX2B 2B7LA 3ZU3A 4RM2A 4W7SA 3E22B 3EG9B 1AXEA 1JDTA 2RGDA 4C7OB 3GOHA 4HK4A 1I5OA 4BMSA 2IU3A 1M1YB 3W79A 2RKBA 2C1EA 1W0JD 2VRCD 2OMKA 4QPCA 4MLPA 2VSXA 4KHZA 4G5QA 1KFEB 4FFMA 1HY3A 3CZ4A 1HDZA 4NRDA 4HDNB 5AM5A 3A3PA 1MT0A 1P0PA 2ZXOA 1JU9A 4B5LA 3DEKA 4CR7A 1EJ6A 1GO2A 1WF3A 5ALSA 2F3UA 4NDNE 4PJLA 1CRZA 4KQCA 2P77A 4J43A 2ADFA 2ZIVB 3L7YA 4RVSA 2M4EA 1G41A 5K0JA 3AQCA 3MERA 3JXEA 1H9CA 1UP7A 3W8EA 3Q41A 1ZMXA 2HW8A 2AWYA 4BKMA 1E0AA 1DRWA 4M7WA 4I1OA 1BHQ1 4DDMA 1W8DA 2QYTA 1LA2A 1QTQA 4FD2A 1XPJA 3ZIUA 2VBFA 4ZGWA 1Z4IA 5KKCA 3CNNA 1WEKA 1HDGO 4B48A 3RF6A 3G4XA 3MJTA 4AJPA 1Z13A 2XDQB 1ZU4A 3PQ6A 2GCOB 3JYNA 2BW0A 1RWOA 3HVUA 1PJ4A 2FSGA 2IP1A 3AK4A 3ZDAA 4J16C 3NOOA 4XPYA 1JR3A 1V5EA 1JIKA 3P0FA 2GM5A 3FWNA 3GFTA 4JC4A 4ZICA 3LX8A 2VO1A 1ZCJA 3MK31 4ZT4A 2DPYA 3WLTA 3U2LA 1SXJE 3KKLA 5I9TA 3PHF2 1M1XB 5AK6A 3LXXA 3NVKI 2HM7A 2R7RA 2C7PA 3WP0A 1L0BA 1IZ9A 5FQOA 4W8KA 4QFBA 3RK1A 1DCTA 3NDIA 3JQBA 4LEIA 5ER6A 4ZANA 4PYNA 2X22A 2JVKA 3V2IA 3WNDA 4R2HA 1XXHB 4OI1A 4CG1A 5DQTA 2CXOA 1MQ8B 2B69A 4WCDA 1VJRA 5LBTA 3O9ZA 4M1OA 5JXIA 4K28A 2PFGA 4UDVA 2YASA 1Y6GA 5K6RA 2A1UA 1A9TA 4BV3A 1GVNB 2AYZA 4F4UA 3KFVA 3NWEA 3EXFA 2OK8A 3TO5A 5INTA 1JQJC 2V3CC 4M76B 3S6JA 3TG8A 2RSLA 3FGZA 1E2DA 2YZNA 1C9NA 1BDHA 2F8LA 4I6GA 4EW3A 4R1QA 4O2AF 4J7AA 5KOHA 2ONZA 2VVTA 4J75A 2CMKA 1JDSA 2Q7RA 4I6EA 2QE6A 3N76A 3US6A 2Q28A 1Y4UA 4CS9A 4AS3A 4Q19A 4X1KB 2J5QA 4IJWA 3B1WA 3SAJA 3IB3A 2XS1A 3L7NA 2VXYA 1QVRA 1ILEA 4GXRA 1VGRA 1DAHA 2XEDA 3DMNA 1VXRA 1YE5A 3AUTA 4NOJA 3BHJA 3WL3A 5EMMA 2YUIA 1HFJA 3BXZA 4QGSA 4LC1A 4RJIA 2HWYA 5DBOA 3Q3IA 3IPLA 3CBGA 2QYOA 1O58A 2QMZA 3UHJA 2VTKA 5K1ZA 5FOWA 1AZWA 1UFQA 3QPVA 1KTVA 1Y9AA 4A03A 2VTBA 2CCGA 3F74A 1OD6A 1WLSA 4GPEA 2QX7A 4LFCB 1OI4A 2XYRA 1VPEA 3FVQA 3GVIA 3A1TA 3PJRA 2QIOA 5KYYA 4C6RA 4EQ6B 3RUPA 5L51A 2JI9A 1Z75A 3K6BA 3F3KA 4UHHA 3FYUA 1CR2A 2ZIUB 1WCXA 4ERXA 1QP7A 2CEKA 2VSNA 3L1VA 1M0WA 2WF5A 1I24A 2I87A 1G4WR 2GO7A 3ZCQA 3TIIA 4Q4JA 2H4YA 5B3JC 4AN1A 1VCIA 1EFHA 5FO0A 3WK7A 3HGMA 1LZKA 5JAQA 2R8BA 4DPLA 3GYBA 2AJBA 3E7XA 4LE2A 3T7KA 4O4HF 1UJMA 2HFJA 4NE2A 2QA5A 3Q7IA 5DP2A 1TK2A 3E9RA 1SB8A 4ZQBA 1EUZA 4R9SA 4N9WA 2VLIA 1QHXA 5FHQA 4ABTA 3DKVA 2OL4A 3PGA1 3C3YA 1LBTA 1SQSA 3N6RA 1GM5A 1YL7A 3PFKA 4O4JA 4X97A 3CRMA 3T3IA 1Y5IA 1P1RA 5EHGA 3L6CA 3CLUC 3IJ5A 4UQOA 3JRNA 4W9MC 4NK4A 2AT1A 4G5FA 5IKXA 1AUOA 1WUHS 2IEYA 4EY5A 1GD1O 2A9VA 1Z0UA 4JJAA 3O3OB 4TYPA 3EVGA 1FLDA 4NCKA 4DEYA 4P38A 4CIVA 3WFJA 4D9FA 4LIPD 2I78A 2GZSA 2QJRA 2IPLA 2B4QA 1GQSA 3AJRA 1XHLA 3G8CA 1N77A 2EYQA 4LTMA 4MKFA 2ZBEA 1R6TA 2A6PA 2DQ4A 3L06A 3OLCX 3IP5A 4BO0A 1P3Y1 4CGYA 3VH4A 5JCZA 4PAMA 1XLTC 1LFDB 1JECA 2V5AA 3VGPA 5AHWA 1II0A 4BNGA 2WLSA 4RKEA 4PG5A 2CDCA 1XZNA 3N0RA 5A4KA 2I1VB 5EIFA 4EB3A 1DEXA 3P19A 1QF9A 1PGOA 3WRVA 1OYYA 1JAFA 4S04A 4O4IA 2PL3A 2C2OA 3RLFA 5DNAA 2IYQA 3KJFA 2R7QA 2H11A 1B0AA 4LKRA 3FBWA 5DYNA 5DNVA 2RCYA 1RM3A 2Z1MA 3TQOA 3QTHA 4H6PA 2VHYA 4IL5A 5IC4A 1YQQA 2ZBGA 2OP0A 3D4LA 5EMNA 1C14A 1Q12A 1JDNA 3OCCA 4B32A 2P2GA 1UAYA 6GPBA 4QJIA 6Q21A 2R4QA 2PWZA 1CLEA 1YO6A 3AOUA 2A3RA 4YP6A 4WA8A 3RYHB 4D81A 3AG2C 3UGPA 2OAP1 2R4TA 1TT5B 4D43A 3QBJA 4GOOD 4OGWA 3R5HA 2C2WA 4AUMA 4C0BA 4JCCA 2HHLA 3VPAA 1TQDA 3KJHA 3RT7A 5IAKA 3D7SA 1NURA 4EHIA 1PYOA 4F3TA 1QU2A 4QFCA 3ZCVA 1QPGA 1OROA 1KJWA 1PBNA 3KHKA 1EXDA 3NKDA 3RV3A 1Q1AA 4MKRA 1UWVA 4HS4A 3A9SA 3V97A 4TV8B 1P1CA 1DOWA 2VT6A 1J39A 4EG1A 1C3EA 3P2IA 3C15C 3FSGA 5EE5B 3U9JA 4YLEA 1SULA 4EVQA 1ISJA 3KPJA 1ZJ5A 1UZNA 4CL3A 3LC1O 5B1SA 2B34A 2YL7A 3DKAA 2R66A 4HZUA 3E03A 3D54D 4HUQB 2OQVA 1GEEA 1Z4JA 2HPZA 4EWCA 2IYEA 1GDTA 4GNRA 4PFPA 2YJTD 4AWAA 3EVEA 5B3SC 2G3YA 2VNSA 3PD1A 2PWAA 1ZJZA 2Z98A 3L1KA 3LG2A 5FQNA 2PX6A 1GTG1 2BKEA 3W7BA 1ZGHA 3LWZA 3K09C 5L0CA 1P8AA 4BIMA 3F1LA 3RU2A 1WATA 1BVHA 3G8YA 4MW2A 3LLMA 4L22A 5EXXA 2DZDA 1OX4B 5JZBA 1VOTA 4Q02A 1IXSB 3CZ9A 5DN6A 1CRPA 2QM7A 5LZ2A 2HMWA 4I5DA 5EJAA 4ZEOA 4D8VA 1ZRHA 4R6XA 3BTUA 4GSYA 2WWRA 3WIBA 2WQ6A 3NC4A 1XNRB 2O3SA 2XD9A 3MBKA 4LJSA 4E7ZA 3D3KA 2D5CA 4HADA 1YXMA 2CVZA 1XYGA 4DKJA 3DTYA 5J2UB 3CRZA 5T4HA 4K6HA 4K9RA 3OIVA 3QIAA 3KMIA 3R1IA 4C7MA 1SHUX 1GV1A 1CWUA 5HE8A 4P5DA 4AZWA 4NLLA 1BMTA 3ZVLA 2UYCA 1RLTA 2BGJA 4U2GA 5E1BA 3ETJA 3NCHA 2ORED 5JC1A 4TKLA 1BJRE 3SKYA 4X3PA 4G5HA 1NQUA 2HJGA 3ZGVA 3UW3A 2MWQA 5ERXA 1I36A 4UPEA 1RTTA 2GLUA 5LD2C 2X77A 5JBNA 2PGOA 5CDFE 4BMYA 4LJLA 5DH9A 3OWHA 3NTLA 4ZHQA 2OGWA 1FU4A 4W6QA 4J1NA 1KETA 3S29A 2QPLA 3MNFA 3S5JA 3EULA 5FH9A 3COYA 1L5RA 2PGJA 2R7SA 1A9SA 2YXNA 4ETIA 4KODA 1V7CA 2WINI 1CF9A 5AI8A 2QRGA 4DY6A 4BNMA 1IPEA 1UDRA 1KEEA 1QCYA 1Y1LA 4C6TA 4WA7A 5CLIA 3M6VA 1NF2A 4ZPXA 2Y9MB 1YJ8A 5JCXA 3WRYA 3QU5A 1NQAO 5FEMA 3NI2A 1CGNA 2ZRGA 2HREA 2C96A 5B12A 4DV5B 2VDQB 4V0MA 2E4YA 1PJAA 4KTVE 2DETA 3F4KA 3K8OE 3I9KA 3B36A 2WJ4A 3TFOA 4LMBA 5ALGA 4B6IA 1UDCA 2R6ZA 4UEOA 1K4YA 2WD7A 2QW0X 2OWDA 1Y3IA 3O84A 4IS2A 1GY8A 1MJ5A 5FUMA 1H3FA 4B0PA 2VP6A 3BL6A 2YHUA 4XX1A 2GYWA 1IWBB 2FEPA 3KJIA 1A7JA 3HPRA 3P2OA 5CK5A 4XXHA 4R2MA 4LDPA 1BAPA 3DJYA 3B7GA 1UFRA 5F9FA 4B6FA 5LXTA 1FLAA 3SS8A 2NUBA 2WYIA 4QI0A 5DO9A 3TSWA 4QOEA 1B76A 4KR9A 3NLLA 3PZRA 3C7AA 2SHKA 3TD2A 1U2TA 1HF3A 2PRKA 1T4CA 3ZH9B 4WT7A 4EB6B 1WPRA 2VDWA 1L7CA 3VKHA 1OX5A 2G36A 3UOWA 4QECA 3QKWA 2PCLA 2DT5A 4BU1A 1YB4A 1M3SA 3SQOA 4JVNA 4OBWA 3GRFA 2NPUA 3LF2A 3H9BA 3IPXA 1NNLA 2ORVA 1M2GA 4D9GA 1G1AA 3MWKA 2JBAA 1T9BA 3CW2A 4IPTA 1AVOB 3AVTA 2YZKA 4MW6A 3TBHA 2HKIA 3MINA 1YHZA 2YINC 1HMYA 1F3LA 1R0LA 2OO3A 4IIJB 3CRQA 4OB7A 2RHTA 4C78A 1C1XA 2GARA 1KWKA 3BRWD 4D57A 3KXDA 4DVGA 4ZCTA 4B3GA 4YCMA 2XL8A 1THGA 4BAZA 5K8VA 4FFBA 1T9ZA 3T7TA 4QBGB 4FYIA 4DJFC 1R8JA 3U3KA 4A8PA 1F14A 2AE2A 1A3CA 3SHOA 2LGJA 3ICWA 4FX2A 3AR6A 1NSGB 2JI8A 2P61A 5I7VA 1YFJA 1SQFA 1EHCA 4WH0A 4WQMA 2QN1A 1A2QA 3LPMA 1IXZA 1VE3A 4QWWA 1KO7A 2YL1A 1EQ2A 4GQHA 1KBOA 1L7DA 5KNDH 4OKNA 4UM9B 5CXUA 1X7XB 4EVIA 2Z56A 5B6PA 2W5UA 1LPNA 3DVLA 3UV6A 2QMYA 2P3LA 3KZMA 3UC5A 2GZRA 4Q93A 2ZIAA 4MGHA 1VHTA 3QEOA 4RDCA 4TVSA 3QUTA 5FUWA 2I55A 4G0HA 3K2EA 1ENZA 1WU8A 3RR2A 1O8CA 1UAAA 4HYEA 2J0SA 5FBVB 1RD4A 4FBLA 3BC1A 4IXNA 4PNZA 2BCJQ 3BJMA 3LKDA 3WB0A 3PQFA 4YWHA 4FR5A 3H3JA 3QXJA 4LMAA 3FOFC 4I4LA 3ROPA 4MRSA 1RWKA 1SCBA 4JEMA 1RI5A 3U61B 1BKYA 2TMGA 1IJBA 4CCSA 2NP6A 4EUKA 3ZK8A 4B71A 2NQ2C 5I7SA 4MGYR 2P2CA 3S40A 3ZLBA 3ZDYB 4A2WA 3FROA 2NX2A 4X95A 1XZFA 3R3VA 3WNQA 3PR1A 1BMQA 4JROA 1T6QA 1MNEA 3BG5A 1OXSC 5L3RA 2Q0QA 4DIUA 1Q7TA 1XQWA 1UBTS 3ADPA 2OQIA 4B45A 3M5WA 3KO8A 4O0LA 3EFOB 3OCYA 3FY4A 4P3KA 1OHHA 5KDOA 4QEZA 2MSNA 4KACA 4MVJG 4UXIA 3ND8A 4W82A 5GQSA 4WBSA 4ZJZA 1V3UA 4JJ4A 4MVZA 5CPBA 4N5HX 4A16A 1CUUA 3IDZA 1G4UR 2CHVA 5GJBA 2REQA 4KQMA 3LFUA 3SXUA 1CX9B 2VPQA 1A71A 1UR5A 1YU6A 4HFJA 3EIOA 3I58A 3E23A 4KUGA 3RUIA 1PFVA 1EP3B 4O02B 5IWAB 3G5TA 2Q7DA 4Y6RA 3JYHA 2JJYA 1ZCFA 1LY1A 1JBKA 4BX2A 3H4MA 3TVYA 5TJ5E 3M4JA 3V6LA 3JQBC 3THOA 1EHYA 1R4AA 4QPDA 3IOCA 1DHRA 1C0KA 1QZXA 1I1HA 1NW8A 3DMFA 1XTJA 3BMQB 3LX4A 3R6GA 3SE7A 3RG8A 4TRRA 1BDJA 4BATA 4WE3A 2PKXA 3Q3HA 2JAPA 5KDLA 2FW1A 4ALMA 1XRSB 3V4ZA 5CLGA 3CEAA 1G7CA 1YTUA 4NE7A 4KGDA 3QYJA 3UYLA 2QBYB 1GCUA 2HCJB 3P26A 2FE1A 2WYVA 1RJGA 5HA5A 4AN4A 1V1MB 1GAWA 3EJWA 2GXQA 1R8SA 1T6YA 3DTVA 4CV1A 1FS6A 3KHUA 1FVOA 2H57A 2OXFA 4MW5A 2YN0A 3LUAA 4RFSB 2VNKA 2QUIA 2GPNA 3OT1A 4ZI7B 5D5HA 2QZSA 1E7QA 4B81A 2G1PA 3UAWA 2LKDA 2OBYA 1US8B 1M8PA 5F9HA 2F67A 1UBLS 4M1QA 4OHVA 4Z86A 4CS9C 5LA6B 2VUIB 4WGFA 2NO9A 2TRSB 1GUDA 3OC6A 2RI0A 3CX8A 4IDPA 1E8DA 2PIAA 1UG7A 3A6FA 1VMEA 2FSIA 3HM2A 5LDHA 4IVQA 2ZSKA 3AF3A 2Z1DA 2RI6A 5KYXA 1UWCA 1QBKC 2IXFA 3H6GA 4EKDA 5CEJA 3O4IA 4NYIQ 3UK1A 2ES4A 4QI2A 3QUCA 1O03A 4HB3A 1G2OA 4GDMA 4TKUA 1MOQA 3BIJA 4MCHA 4GEKA 5JMPA 5H4GA 3IQGX 2R7NA 4C89A 3ZE2B 1LVHA 3PIDA 3S28A 1OXKB 1Z47A 1MIOB 4GD3Q 1FSGA 3QVYA 3QTBA 1NXTA 1RZRD 5JAZA 2FW8A 1J8VA 4F72A 1AJEA 1O6FA 1FYDA 2AG6A 1F6BA 1Y1RA 4J29A 3BJIC 5A3VA 5F1YA 1XEXB 2FJPA 2Q45A 3QJGA 4TTTS 4P34A 4CU2A 5TNXA 5HSWA 5U4QA 3RT1A 3U2QA 3V7UA 2IUYA 3FYUC 4DCJA 1RHQA 4AE4A 3A27A 4TWZA 2VCAA 2D5AA 3WLLA 1GL7A 1QK5A 3LKZA 3VPSA 4MV6A 3WLHA 5HILA 4FJ2A 1MDBA 1DO0A 4MQEA 4QTYA 3SFZA 1VJ5A 5FL7A 4ZVMA 3KDPA 3O03A 1VA5A 4LOJA 1Z29A 2BBOA 1WWPA 5BUSA 2FUCA 4J4HA 4CF6A 1LIHA 4ZZ2A 1Z0FA 2WNIA 2ZWIA 4U2FA 4GPD1 5CNKA 4WJLA 1APBA 2CGEA 3RG2A 1GTSA 2MHCA 4HNAB 3MGAA 1JQEA 1QANA 4QOSA 3GJ0A 2PVPA 1EVJA 4GRIA 3R0VA 5L0DA 5GIPE 3SBDA 1K05A 3RSLA 4JI6B 1NI4B 3M4XA 3RVYA 5HQ3A 2OU6A 5H16A 2G28A 3L4EA 4D9MA 5HOQA 4HN4B 1P1FA 2AI2A 1YS1X 3RIGA 4RTPA 1D1BA 1C7EA 1M5RA 5IDVA 2FMTA 5I8WA 3GMIA 3LUDA 1CQPA 4D8UA 3H87A 1N2HA 2X1MA 2EQBA 2V7VA 2OV8A 2NV6A 4GLLA 2OZLA 4DBZA 4C30A 2O1SA 4LTNA 4RMHA 1T5OA 1FSZA 2EWVA 3GGPA 2RGUA 4HNGA 2P67A 3NHFA 2OMEA 3AILA 1E2EA 3B6ZA 2X0DA 1JRLA 5E2BA 4NZZA 2DFVA 4HQNA 5FPPA 1NF8A 3OQHA 2NTYC 3OBBA 1Z68A 5D6OA 1WMDA 2IXDA 3DKRA 4BO9A 1P4HA 3EUEA 3NV9A 2ZP1A 5G1PA 1XMJA 2OM6A 2Q5QA 1XTZA 4JIMA 4P83A 3DWWA 3T5TA 2YMPA 4F2GA 1A9QA 2I8LA 4INOA 1UT5A 2VF7A 4A6DA 2FCAA 1X7WB 3ER8A 2HSBA 2JK1A 5ED0A 2CNNA 1JR3E 2Y3HA 1NE7A 5T4FA 4J8PA 4KBYA 2EZTA 2R00A 4HEA1 4M8SA 4QU8A 1LPEA 4ARCA 3H5RA 2PLWA 3FVWA 3ZI0A 1QMPA 2FVXA 5BN4A 4XPZA 2GT1A 3MJEA 2PP4A 1F3OA 4TLCA 3HCFA 1IONA 2P41A 4QODA 4Q37A 1X77A 1ZH0A 1HTTA 2GCGA 5KI6A 1MC4A 2YYZA 4V1CA 4OD4A 3DHNA 3ETNA 2WM2A 2VHEA 5FUBA 5AHOA 3WAJA 3W8FA 3CIFA 5FLKA 4Q82A 3JQGB 5CYOA 2B2NA 1CR6A 3QYFA 2XZOA 3A2LA 1M7HA 5FUVA 3DBIA 3H2JA 2HQBA 1D6JA 3K05A 1FFGA 4HDSB 1YNSA 2PZFA 1CUCA 1ZHHA 5B1EA 2FFBA 2ICAA 4D25A 4A36A 3NUZA 4CCYB 3AF1A 3OEHA 1YJCA 2ONKA 2ZJOA 3MN1A 3F8WA 3MLBA 3HXMA 2ZJ7A 1TLTA 1UXIA 2YV2A 4NABA 5CVCA 2EL9A 4UNIA 4FDMA 3H83A 3AQBA 3FPSA 4C0QC 1GPKA 5ECDA 2H85A 3NAQA 2KWIA 4DQ0A 5AKIA 4YP1A 3WBKA 4ZVOA 2FV8A 4BE9A 2ENUA 4EJSA 1R10A 2ZTSA 1W2GA 4JBNA 5K05A 4DLUA 9GPBA 4BB0A 5KYWB 1YCHA 3M6XA 1D09A 2QDKA 2H7XA 5J23A 4G86A 1P0CA 2GILA 4WY8A 4WIAA 1P2DA 3AINA 1MB3A 1ZW6A 3L0OA 1KORA 1SCQA 3L3BA 4A0GA 3L7KA 3DYBA 3TB6A 4JLDA 4UCWA 5BSMA 1HDEA 2QSYA 4JTCB 5K0FA 3L8ZA 4RLQA 2VF2A 1YDEA 3OJ0A 5A6SB 1KC1A 4UVEA 3CRVA 2R1TA 4CRWB 1H2HA 5GJWC 5BVGB 4G0UA 1T9DA 1X1SA 1K2WA 4K0DA 2OFWA 3PDCA 4QAQA 2XMZA 3U3ZA 3ZQVA 2UUAB 4OUKX 2EBUA 4RA9A 4TWJA 2JLRA 1UM9B 1DXHA 3POVA 2NU6A 2FPPA 1OZHA 3UWKA 5GWXA 4MVJD 2PD4A 4MOWA 2C2KA 1KJYA 4M37A 4DDKA 3E5MA 1OZ0A 4MXDA 4CVNA 2ZZNA 1U9ZA 2IBSA 4M54A 3UW1A 1DIGA 1Y3AA 2RD9A 3VC7A 3WL4A 3IPMO 2W0MA 1P2FA 2VF5X 4U39A 3TR5A 1GYPA 5A04A 1N5JA 5CIYA 1FJXA 4R9RA 5K2MA 4HRYA 1EJ2A 1T15A 3HZOA 2J3HA 1V9LA 1X8XA 5FI0B 1ITZA 3GT4A 3BAZA 4ENUA 4PYKA 3O8NA 3ELWA 5AXBA 5FWYB 4CG2A 4BVJA 4UVGA 2LCIA 3RS2A 1DXQA 2F00A 2CXNA 1GQAA 5KNBA 2CCKA 2YYYA 5CNIA 1L8QA 5EHHA 1RKVA 3EPRA 4HAUA 3WGHA 3QA3E 4V0NA 5GMOA 3F9IA 1E9DA 3H1EA 1VMDA 3WRYC 2WHPB 1C3OA 3IEEA 1ECBA 4KHPB 1IU9A 2C5SA 1N2CB 5CHEA 3EEBA 2JLVA 4LYYA 2K4MA 1X0VA 5CTAA 4G81A 2J33A 3AIIA 5F23A 4UMEA 2NYVA 4YJ2B 2NYAA 4MROA 2I65A 4G01B 1OI7A 1HLFA 3S55A 3DH0A 4QTZA 2OPHA 5DNCA 5CEFA 1H1LA 3LPCA 4HRAA 1TF7A 4XB1A 1VG9B 4ZAVA 4AQDA 5T3YA 4JZAA 3LLVA 4B3DA 2AUNA 1DEHA 4MS4A 3W2VA 3TQHA 4JYZA 1T36B 4B3HA 1AG9A 4F9GA 1LLQA 3EVTA 5BPFA 1T5DX 1ONPA 3N8DA 3ITNA 4ZOEA 3NKEA 5AW2A 3BIXA 3R7FA 4B82A 3C3XA 3SGLA 2C9DA 3I5XA 4INJA 5HKKD 2X8JA 1JWAB 5ICMA 1P73A 1BN7A 2FG7C 5LMNB 1VI6A 4CE6A 2XCQA 4N5IX 3MFYA 1EI9A 4Z4FA 3NVAA 4J7UA 2GWWA 3SC6A 3G88A 3IELA 1QYWA 4NYMQ 3OQ1A 1RI2A 3T5CA 1O95A 1HA3A 3ZZ1A 3M3PA 4P3NA 4MW1A 2O2GA 2PH7A 1Z45A 2EZ9A 4MW8A 2JGKA 3DWIA 3O4RA 4DC9A 4Q4DA 3C3CA 1PQPA 4DNQA 3E9DA 4ARUA 2ZE8A 2FP3A 2IZOA 2E6UX 2JAQA 2FXVA 5ESRA 5I9SA 2JFVA 1ZUNB 2R03A 5F5HA 1RMVA 1M33A 1G7TA 3ASVA 3DMGA 4FGLA 2OBNA 4QSHA 4YJ3B 4XVRA 2CJWB 3M2TA 3KQVA 4D4LA 4R8RA 2IYFA 1JAIA 1OUMA 2ZSIA 1KJNA 2YVUA 3CKLA 4HH4A 1I4OA 1WXEA 4ML3A 2YUTA 5FCLA 2HJ9A 4EG7A 4OHCA 2JFUA 3VVCA 1ZD3A 4MWZA 4RY9A 5FEUA 1N25A 2J45A 3UXHA 3KKQA 2DLCX 3CXUA 3OIFA 2R7UA 4C7VA 1UDAA 5FTWA 1E3LA 1L3CA 2LE0A 3CX6A 1KR2A 3WB2A 1NX9A 2KSFA 3N2ZB 1FF9A 1UT6A 1CG6A 1A9YA 2VZLA 2JH8A 3DLHA 4DM4A 1ISGA 1I6LA 2WHEA 5JVDF 3TSOA 3FNQA 5EP3A 1U3VA 4GF5A 4LVNA 5HF9A 2Q8PA 3KQQA 1KZHA 4UBMA 5JXJA 1YLMA 1LC0A 3CZ6A 1KK2A 1KWGA 1TKRA 2B30A 3HL0A 1E9RA 3E9YA 1XD2B 1W85B 1F8YA 3NUQA 2EFDB 1N5IA 3QKIA 4JR0A 3W1EA 1WJGA 1RKUA 3OD1A 2HTFA 3FDIA 2AI1A 1NWHA 4PC7A 1JFVA 1U63A 3ZWOA 3I3SR 1J0BA 2PUWA 2A5LA 4DA6A 2P4SA 4U8GA 1L5KA 1V54C 1UKEA 3I9LA 2VPZA 5HK8A 2W8BB 3Q8XB 4JITA 4I4NA 3D6MA 2HXSA 1I10A 2Q2OA 2NN3C 2GZHA 4HMOA 4CJXA 5MN4A 1ZU5A 4C7JA 5GPGB 3PX2A 4YMSA 4P4LA 2P4UA 5AR1A 1G9XA 4YT2A 2C7RA 4E5NA 2ACWA 5EE0A 1XAJA 2R2GA 3TEMA 1NV9A 2J5XA 3D4IA 3DUWA 2UYYA 3DQQA 1ZZPA 5ARDA 4YJWA 1NUUA 2RH9B 4J7CA 4BASA 1X9IA 1P33A 4BX3A 2ZBDA 2AMFA 1GGMA 2YIMA 2FK7A 3AV3A 2UZ1A 2XUKA 3BYZA 3D6UA 3IVXA 3AUFA 2V3VA 3LY7A 3G59A 4I0WB 2ZSDA 1X6VA 1URPA 1OWNA 1KERA 3ONDA 1Y4DE 4EA6A 5DSTA 3LP5A 3LS0A 4I4TF 1OKKD 1XRRA 2A0XA 5J63A 2QROA 4G0ZA 3VI3B 4EKGA 4DADA 4C3ZA 1ULSA 1XK6A 5EJ7A 1PBTA 4TV9A 4P82A 3B0PA 4WK2B 1NVBA 1WKCA 2D06A 3EUFA 3AFOA 1JBQA 2O19A 1Z07A 2BBWA 4V0ME 3NM5A 2QTVA 4NENA 3RCBA 3AHEA 1VB3A 1BVRA 3G2MA 1A98A 2IOQA 4HDMB 1W47A 3VR2D 2NADA 3L0IB 4M0UA 4MR8B 3RYLA 1V3VA 4INZA 3CSDA 2B83A 3PV0A 4IGKA 1MH9A 2Q7OE 3VBCA 2W4MA 4RFVA 1EKXA 1W87A 2QQ5A 3UR3C 5CDHA 1NVDA 2AQ8A 4Q21A 3SICE 2Y0DA 3OETA 4O2BF 3RF3A 5JE8A 4S1WA 3ZWVA 4A2QA 4X5OA 4IHQA 3QEBZ 2ZAGA 5C3UA 2E4VA 2RHGB 3QVGA 3M6WA 1W4LA 1WCYA 1OLXA 2F4NA 2AOVA 1FFAA 2CHQA 4TXMA 5FBLB 1HQKA 3BF8A 2VJCA 4CQMA 1C8KA 1DG9A 4CLOB 1GL6A 1QVAA 1X1TA 1NOKA 3LTEA 1VJ0A 4AVYA 1EK1A 3GVXA 3SSNA 1G8FA 3V5NA 5F35A 3ROQA 3FDZB 3AVOA 1CP3A 4BC1A 2DPLA 1C4OA 2XLCA 3N05A 4Y30A 2Q4OA 5KTMA 3ETEA 2CFOA 1EWQA 3GUZA 2Q5HA 4XUDA 5DHRA 2GD1O 1N8TA 1IY0A 1W34A 1VGVA 2FW7A 3S90A 4EKNB 3EZGA 4NPAA 1MMFB 4ADSG 1O8BA 1WL8A 2H2IA 1R8YA 2B8EA 4BO4A 2XE6A 3U3MA 1EUQA 3KWLA 1A96A 1ECFA 3UT0A 1W0KA 3UCXA 4NCQA 4DS3A 2SECE 5IWCA 4BN4A 2JW5A 2QIPA 1KDTA 1MGOA 1EM6A 2QN2A 2O2YA 3LK6A 5HVNA 4LF4B 2JB9A 3GEIA 3FJYA 4BO3A 4F4HA 4REOA 3D0QA 4JC8A 5CYGA 2YQ5A 3C62A 3A0UA 1FEZA 2GA8A 2WJYA 4FKBA 3WGUA 1SOAA 2O8CB 5FCDA 3KEFA 2YVQA 4YRRA 1CPYA 2VYNA 1EQ1A 2WUVA 1EUDA 3WKAA 5IKPA 5FADA 3F9RA 3DAFA 5AUQA 1E6MA 3ABLC 2XCIA 3QBDA 4W1PA 3SR3A 4DDUA 2CLMB 4IO1A 5CBPB 2OAEA 1FQOA 2CT8A 4PN7A 5CI9A 1N4AA 1LLCA 4DWJA 4MGIR 1AUPA 2XKAA 1W35A 4GI7A 1XCLA 3MCTA 4WXPA 1EIZA 2O3TA 5JZVA 4X20A 1UP4A 1QV7A 3LL7A 3DBRA 3SNKA 4IHKA 2JJ1A 4GBMA 3KZXA 1T3LA 2DKNA 1K3UB 4IEIA 3E6AA 4PFSA 4P9TA 5ITSA 3O91A 4QRDA 4PLHA 5FRDA 2F1IA 3X2QC 2QXUA 2J08A 4LF6B 1SK9A 3OZXA 2AS0A 2D2XA 1Z12A 1RKEB 2UZ0A 1DXOA 5HQJA 4JI4B 3M81A 1T13A 2H4XA 1IUOA 3RTGA 3IDQA 3H8JA 1DDOA 3IQWA 4I7EA 2OV2A 3U4QB 3PXGA 1GU0A 4PXAA 5AM3A 3KJQA 5HTOA 2X0FA 2FWRA 3OQJA 2B94A 3VOTA 4QGFA 2HSZA 3BE4A 4DRHB 1FDSA 4DNPA 1WMEA 2UYOA 3OOEA 1XDSA 5H1YA 1Z2OX 3E1GA 3T3MB 4JXKA 5KOIA 4E7SA 1M2VB 1XT6A 4ZQCB 5KYGA 4WACA 2GF9A 4KO2S 1OGYA 1YE3A 1S2MA 4LPSA 2JL1A 3MRTA 2BRUA 5AKJA 5EEGA 3UK7A 4R84A 4XOUA 4ETNA 3KVVA 5IDQA 3JTEA 1ZOOA 1BCSA 3BWXA 1HZZA 1G8KA 4HQFA 1HYQA 4X7RA 5IABA 3AG3C 4LHXA 4DE5A 1UKVY 2AUMA 2WFAA 1XZGA 2A0WA 4ACAA 1KAQA 2OXCA 1YQDA 5JSKA 1NUSA 4ULWA 4UFOA 4YAGA 1DVRA 2R00C 2Q1WA 5BYAA 2P4HX 3CZMA 3OECA 5AUPB 3KOMA 4B4KA 3Q2IA 2FPKA 3IMGA 4MVOA 1LSJA 3DKKA 2FSSA 4EY4A 3V9PA 4QT0A 4YUYA 4YRGA 4P0QB 1Y1QA 3SJZA 1L7AA 1V8OA 3I6YA 1E2LA 1GZUA 4M9QA 3HLTA 1VA4A 4JA0A 5MDHA 3LCMA 2YZSA 4U7JA 3TLGA 1CC1S 1D5WA 1IHDA 1KXZA 3PCRB 1O1YA 5JD3A 2CXQA 4YT5A 2DLNA 5C53B 1XTQA 2P9TA 1M56C 2CF5A 4PO3X 1EFPA 5HZKA 3K53A 1T26A 3U0BA 1XTIA 1FTNA 1PE0A 2AX3A 2I80A 3IAAA 3JALB 3QU4A 4MCJA 5DCWA 4DJ5X 2R1VB 4N3NA 5DASA 3IT0A 1XQXA 3TLKA 4ZVPA 4RLSA 4FD3A 2PGXA 2OPBA 3L8JA 4G25A 4OQMA 4RPJA 5CFQA 1SCNE 1R0RE 1OLUB 1E1QD 3MPOA 1U4OA 5C1OA 1WO8A 4HVCA 4HAZA 2NU8B 3WQRA 5F12A 3KE9A 4YACA 1E2HA 1TWCA 3IUBA 3ZV6A 4EJSC 1QH0A 4X93A 2I0FA 3H8SA 4BMNA 4G4IA 5SZIA 1UWKA 4IX9A 3ECCA 3VR3D 1YZCA 1MMAA 1YZKA 4CKEA 2O8EB 3BK1A 3JD2A 5JWHA 4RLFA 3IAM1 5IM5A 4B8ZA 4D0RA 1YZNA 2J3QA 2FOXA 4UATA 2UVDA 3O47A 4HEJA 4QQRA 1DIHA 5JH7F 4WFJA 4Q9JA 3VUFA 3THXA 3LZDA 4ACBA 2AKAB 1U7UA 4K2AA 4WNAA 4PR9A 3N7UA 1Q16A 4D4MA 1IE3A 4Y2YA 3WMGA 2AZXA 1CY4A 2NU9A 4IDOA 1KS9A 2AN3A 4F56A 2P7VA 3UMIA 2QNIA 1T3ZA 1F2DA 5A69A 1Z37A 2Q1UA 3AFHA 3EE6A 2PHZA 1TI7A 2VK2A 3W5BA 2XMDA 2F1RA 4G2TA 2J30A 3R3XA 1J8FA 3FKQA 4FP9A 1Q7GA 4L4XA 1W88A 3ED5A 3BWYA 5EAIA 4BFYA 4RKQA 1U2PA 2A69F 1L5HA 2WP0A 1AK9A 3PEVA 2A1TR 4RE6A 3I2IA 4RIGA 4N65A 1NNUA 3ANXA 3F4BA 2X4LA 2AOUA 4L28A 1PV1A 1VKHA 1QP0A 2NO6A 5K3FB 3K7EA 3IKLA 4Q3LA 3BX1A 3BL5A 1PZFA 4CQNA 1ZKMA 2BMDA 2P9BA 3JQ7A 1CRWG 1E6UA 5FPTA 3B9RA 4ZO9A 3S2YA 4B7UA 4KBFA 5KMGB 4FDTA 4R16A 4Z0HO 5KVSA 3CLKA 3ATPA 2XIJA 1NU9C 3O4FA 1B42A 2G4LA 5DX0A 3TSCA 1KTMA 1Z82A 2PEZA 1F7UA 5ADUS 1G5PA 1JH9A 3MT0A 4MEAA 4XGQA 4KO4S 1N2IA 2XSZA 2XUDA 4ARVA 5L4SA 1AY0A 3K0AA 5EIOA 3TTVA 1GCIA 4LYDA 3VSDA 2YVAA 4Q7MB 3UMBA 4LUCA 4JP1A 2A5DA 3BN3A 2FPMA 1VIVA 5FFMA 3S0JA 2O2ZA 4EY8A 1Z3CA 3RGWS 3VHLB 4E5YA 5CFNA 2HY7A 4D4JA 3GZNA 2XYHA 4ZGBA 1H1TA 4AJ1A 1RWXA 1JKJA 3LUHA 2CFCA 3UMRA 4ETWA 2IYNA 1GG8A 4PSUA 3GJ6A 4N0PA 2G88A 3GWLA 2XZLA 3BCRA 1XZ8A 3KJEA 3BXHA 2NVUB 4P3YA 1W59A 4B85A 3HB9A 4OXNA 1FP1D 1VLTA 3DV0B 2EPNA 1KDYA 3A4TA 4CMBA 2HIHA 4NQRA 3TS1A 1DARA 2QX4A 2N3ZA 1MIHA 1O95C 4MHOA 3KSUA 1ADCA 3LH5A 1DELA 2PR7A 2F17A 2DXIA 5IARA 2NUAA 2PWBA 2PX5A 2IXTA 5DHPA 3ITFA 3FNGA 4M0PA 4XAQA 1E77A 3DKPA 4DLPA 4CM8B 1CYDA 5FOTA 4BTEA 2A9FA 3LBHA 5LP6A 4X85A 3JASB 2XS8A 3GFQA 4EVRA 4QQFA 4G0NA 4RO0A 4RY0A 2W0SA 1ONSA 1FRFS 4J4BA 4Z9AA 2YOFA 4PSCA 1O4WA 4GPZA 3TLYA 1KJ9A 4O33A 3SF8A 1RQRA 2NUTB 4HLNA 3QMKA 4H4KC 1E3QA 2V9CA 3QA9A 4X45A 1U3UA 4RZQA 1LFAA 3I39X 1H42A 1QVZA 3KKMA 5I7WA 4NATA 2D4UA 4Q3OA 4HFNA 1MAHA 1AS3A 4BLVA 2QX9A 1E1CA 3COVA 3ZK9A 4GRAA 1SXHA 4OINF 5HDBB 3D5EA 3GROA 1WOYA 1DEOA 3THSA 4YAEA 3CLRD 1Q21A 2A0FA 2C84A 1BH6A 1TD9A 4DCMA 4KPUB 2DYSC 3H7AA 5FPYA 2IKQA 2BMVA 3WAQA 5T4EA 4G36A 5FPKA 3AOGA 4M1KA 2FOIA 4JQSA 1PEAA 2MYNA 2HUNA 3N74A 5TMEA 3RIYA 1Y5LA 1Z5GA 4EHAA 2PLNA 4V0RA 3C3PA 5ENDA 3RH0A 2OENG 1H9BA 2F90A 3FWZA 3QXXA 1YTLA 2C2GA 3SJ7A 1OCRC 5C8XA 1CY2A 1GKLA 2D13A 4IILA 3O8BA 1IHXA 4IDFA 2A1IA 3LVFO 4MPTA 3U16A 4X6XA 1TNDA 4XR4A 2EDCA 2B92A 4E6EA 1YBFA 3B3GA 3NRCA 1JLMA 4HH3C 2EIJC 1KI6A 3EEIA 1DIRA 2LD6A 2K6GA 2KM1A 2PNJA 5JSHA 4R1OA 4E5PA 1YV9A 5A4MS 2XNSA 2XAUA 1E6KA 3CUEF 3F4LA 3F8TA 4RS4A 1DE0A 2WLTA 1NM5A 3OZSA 3ZLTA 1U8XX 1V8DA 2C9ZA 3RKRA 3SEFA 2A1TS 5TSDA 3W7AA 1Y4AE 4UFNA 2RGBA 4P84A 2L6HA 2PU7A 5I5EA 4R4JA 3UH1A 1QC5B 2VATA 1OXUA 2O7RA 4K9PA 4RKFA 4DNFA 1L4YA 2C5BA 3S2FA 2XPCA 1QF6A 1L2TA 1SZDA 2FSPA 1NW7A