2W4MA

The crystal structure of human n-acetylneuraminic acid phosphatase, nanp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
NLYFQSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-ACYLNEURAMINATE-9-PHOSPHATASE
publication title The Crystal Structure of Human N-Acetylneuraminic Acid Phosphatase, Nanp
rcsb
source organism Homo sapiens
total genus 96
structure length 250
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w4mA01
4EX7A 2AGVA 3B9RA 3M9LA 3OCZA 5ALGA 4I9GA 4EENA 3MMZA 4HGOA 2VKQA 3L7YA 4OFZA 1TE2A 2C8KA 2R8XA 3A1CA 5ALIA 4G9BA 2HSZA 2NO4A 3L1UA 3AR4A 2G0AA 4YCLA 3BWVA 5ALXA 5AESA 1YDFA 3AR8A 5AW7A 4FE3A 2ZBGA 1S8OA 1U2SA 4L6AA 5AKGA 4NAVA 2GMWA 2G1AA 3A1DA 3U13A 3WK9A 3ZVLA 1IWOA 4BKMA 1N8NA 3NALA 4UMVA 4AS3A 4UASA 2MU1A 2YN4A 1EK1A 3AR9A 3B9BA 2B82A 3L8GA 1WR8A 1Z4IA 5AM3A 1RKQA 5ALWA 2D2VA 3RF6A 4NV0A 3WKEA 4BEVA 4QQFA 4KNWA 1Q92A 4J03A 4KN8A 3WGUA 1WPGA 5AKLA 4J2TA 5AVZA 3MN1A 3ZWDA 3W5DA 1QH9A 2O2XA 5AKKA 3OCUA 4UMDA 1T5TA 2GHQA 3K1ZA 5ALLA 5AW9A 3A1EA 3L8FA 2HF7A 2RB5A 5A3QA 4C4SA 3FPBA 2YJ4A 3NANA 2C4NA 1Z4NA 1RKUA 3VAYA 5ALUA 5AW8A 3U7GA 5AVVA 4JDPA 3U26A 2WF5A 1Z4MA 2WF8A 4L6CA 3EWIA 2YFYA 3ED5A 2B1QA 3FVVA 4DCCA 5AIAA 3WK8A 3SKYA 2FEAA 4PNHA 2WHEA 1RQLA 5AK5A 1RQNA 2FUEA 1T9ZA 5AVQA 3ZW7A 5AI8A 4NFLA 3E8MA 5AW1A 4EZEA 5AK4A 4O8CA 1QQ6A 5ALVA 4HGRA 4IFTA 3R4CA 4QJBA 3PGLA 2G06A 1LVHA 4DWOA 4BNDA 1TJ5A 3AR7A 1RC8A 1ZD5A 5AKXA 5E0OA 3S6JA 4EEKA 4Y2UA 1YS9A 2FPXA 1Z88A 5AI0A 3QU4A 4MUMA 3U7FB 2GHTA 2B1RA 2HEGA 2Q4RA 2ZBEA 2JAWA 5AIBA 1U7OA 2EATA 3I1YA 2ZG6A 5A3RA 3P96A 3QUQA 1Z4JA 3IJ5A 2RARA 5ALSA 4HAIA 1CR6A 4YIHA 4H1WA 2R8ZA 4GXTA 2PQ0A 3ONNA 1ZD4A 5ALNA 5ALYA 2YMMA 4UM5A 4YGYA 3ZI4A 4RETA 3NASA 3MPOA 3SD7A 4Y3UA 2HF2A 4NABA 2AUTA 5JJBA 3IRUA 3KC2A 4Y2PA 4ZEWA 2GO7A 3ZX5A 2YMLA 3HLTA 3NUQA 2B30A 4YH1A 5AKIA 1L7NA 2ODAA 5AI4A 4EELA 4FYPA 2ZOSA 3PCTA 4Y2QA 3UMBA 1U7PA 5ALMA 2HX1A 3ZTWA 2P9JA 4OCZA 2NYVA 5AKZA 2FPSA 2I34A 1RLTA 1PW5A 5AW3A 5AKYA 3WGVA 2YBDA 1L8OA 2IOFK 4UU0A 2FPRA 4CNQA 1VJ5A 4NWIA 5AW6A 4L57A 1RMTA 4YCMA 3OCWA 2G80A 3OCVA 3AR6A 1Y8AA 1ZD3A 2YMPA 1RLOA 2I33A 4XQ0A 4CF4A 1U02A 4IG4A 4B6JA 3N28A 2PKEA 4KNVA 2R8EA 2X4DA 2O9JA 4CF5A 2BDEA 5AW0A 3DDHA 3QU5A 2FUCA 1Z5UA 4F72A 3SLRA 4YCNA 3ZVMA 1S2OA 5AKEA 4UAVA 3W5BA 3W5AA 2ZXEA 3E58A 3FZQA 3QUCA 4HGPA 2OA0A 3CNHA 3UMGA 3ZU6A 1VFPA 3U7HB 5AI9A 1N9KA 3I6BA 3OCXA 4BX0A 5AVTA 4AS2A 2JARA 3M1YA 4Y2TA 2IOHA 5AM2A 1TJ3A 2YY6A 3QYPA 5AW4A 1L7OA 4OD0A 3FM9A 3PGVA 1RKVA 2FDRA 3WK4A 4KX5A 3WKDA 4MWOA 1RRCA 4ZEXA 3F9RA 3A3YA 3N5KA 4ZEVA 5AVXA 2YMQA 3KD3A 3N1UA 4Y2RA 3L5KA 2B8EA 3QUBA 3QXGA 4GIBA 4BX2A 2Q5EA 5A3SA 2YJ3A 2WF9A 1NNLA 1L6RA 2W4MA 2QYHA 3MC1A 2HDOA 1ZS9A 2RAVA 4C4TA 4KYTA 3L0BA 2C8LA 3B8EA 3QU7A 2WF7A 3BA6A 5ALOA 3IB6A 1L7PA 1RDFA 3CZ4A 3ZX4A 1RMQA 1YNSA 5ALFA 2CFRA 3EF1A 2C88A 5ALHA 1XPJA 2I55A 3FPSA 1K1EA 5AW5A 2BY4A 1KYTA 3KOOA 1WVIA 1ZJJA 5AVSA 2OYCA 4JB3A 2YJ6A 3QX7A 4KX3A 4UARA 1Z4OA 1O08A 2HHLA 3WKAA 2WFAA 2JAOA 3AR5A 2I6XA 1T5SA 4UM7A 4Y2VA 2P11A 5ALPA 4OHFA 5AM1A 3TLMA 3SKXA 4F71A 3U19A 1Z4PX 3WKBA 5ALZA 3NRJA 3WK5A 2AMYA 4DFDA 2EAUA 1TA0A 5AI6A 5IT0A 3L8EA 1QQ5A 3U7EB 1X42A 1SU4A 2PR7A 1Z5GA 2Q4TA 2G07A 4Y2YA 3DNPA 3R9KA 2JAUA 4UU1A 2QLTA 2WF6A 4HGNA 2RBKA 4HGQA 4XOUA 4YIKA 4Y2XA 3L1VA 5IT4A 1J8DA 3PDWA 4E88A 1RLMA 4BYGA 1TJ4A 1L8LA 2G08A 2OBBA 5ALDA 2CFSA 1MH9A 3AR2A 2B0CA 1WZCA 1YV9A 3L0CA 4BBJA 3W5CA 2YJ5A 1YJ5A 3ZWKA 5ALTA 2I54A 4XE5A 1EK2A 4Y2JA 4XPZA 2W43A 5ALEA 2HCFA 3UM9A 1SWWA 1JUDA 2I7DA 5AM4A 2HO4A 2FI1A 5AM0A 5T41A 1Z4LA 1Q91A 5AVUA 1RPZA 5AHXA 3N07A 3QGMA 3WKCA 4UAUA 2FPUA 4AP9A 4UW9A 4G63A 3RFUA 4UATA 2W11A 1ZOLA 2ZBFA 4BEWA 3ET5A 1Z4KA 3ZUPA 5AK3A 2FPWA 3SHQA 3AR3A 3QNMA 3OCYA 4RESA 4UMEA 4FFDA 1ZRNA 1J97A 3ZVNA 3SF0A 5AICA 4UMFA 3I28A 2MSNA 1NF2A 3ET4A 3KBBA 1L7MA 1FEZA 3OPXA 1QYIA 2GFHA 2P69A 3I76A 3L0YA 4C4RA 1NRWA 4I9FA 4Y2SA 1O03A 3OTQA 5ALKA 5ALQA 3R09A 5AKJA 3J7TA 3WK7A 1LTQA 3KDPA 5AK6A 1ZRMA 3L8HA 5AKHA 5AVWA 2HI0A 2WM8A 3EF0A 4CE6A 1QQ7A 3KZXA 1ZD2P 3FGOA 4HYTA 3UMCA 3WK6A 2ZBDA 2G09A 1F5SA 2HOQA 2DQSA 2EARA 3E84A 2BDUA 3QUTA 3DV9A 1Z4QA 1RMYA 3EPRA 2IA5A 4DW8A 3DAOA 2CFTA 2P27A 3GYGA 3SMVA 4CF3A 5AI5A 5AVYA 5AM5A 5AW2A 1XP5A 3ESQA 3NIWA 3QU9A 4BX3A 2CN1A 5IS2A 5FP0A 1U2TA 3N8GA 2C9MA 1AQ6A 2IYEA 3ZTYA 3E81A 5AVRA 4EX6A 1CQZA 3QU2A 2OM6A 2NO5A 3ESRA 2B8JA 3NAMA 1SWVA 5ALJA 1VJRA 5ALRA 2JGAA 3D6JA 2R8YA 1XVIA 3QLEA 3HYCA 1YMQA 4BNDB 2IOFA 2AH5A
chains in the Genus database with same CATH superfamily
3TAHA 4AYXA 5I7SA 5KBYA 2GA9A 4GYKA 3KWJA 5JAMA 2WAOA 2XE6A 4DR3B 2QM0A 5CVUA 2IBSA 1D0YA 3V8EA 1II9A 1V26A 3H1BA 2VI5A 1EBFA 2BKXA 3EXG2 4RY8A 3MUNA 4P0TA 1HOTA 1OTYA 1AUXA 2Y1CA 3UMIA 1G5PA 1P1HA 5H4HA 4YACA 2XIQA 4QUIA 4ARSA 1GPMA 1XXLA 3WICA 1G8JA 4MA0A 4DMMA 2EZUA 1D6SA 1QF6A 3ZTZA 2GT1A 4HKTA 4TSFD 3C6KA 3CA8A 3L7JA 5IM4A 1P2DA 3WK8A 3ILXA 1M1XB 1W36C 3QWIA 4LWQA 1C9YA 3ZQKA 4V2UA 4L4ZA 4CXMA 1M6YA 2VDUE 3BG5A 2JD2A 3EUEA 1TTQB 1KPGA 4FWVA 3GEIA 1OXVA 5FUQA 3NYLA 1RC8A 3HEAA 4MWSA 4GI1A 3C3MA 2IHZA 3J81A 3N2IA 3IKMB 2BZ1A 2G1JA 1VLMA 2IYSA 2DQYA 4JVLA 1CE8B 3NTLA 1NFOA 1QCZA 3ND7A 2HREA 3B3GA 2AXNA 2IIPA 2SBTA 4DQLA 3BSFA 3IBGA 4Y2QA 3QLUA 2YOFA 5C3MA 3AVOA 3IP6A 1UPBA 2AWYA 4IOJA 2WHYA 2Z30A 4XEHA 4HQ6A 2WUEA 1JMYA 3BDAA 3EH2A 3C63A 3GI1A 1SXJD 2JGLA 4BJ6C 1LS4A 4AKTA 2XOKA 3TUIC 4XQ0A 5GM1A 2X4DA 1NQXA 5D3KA 3ZN2A 1K75A 4IHJB 2V9PA 5I7FA 4OQDA 3CUVA 3VFDA 3WL8A 3KEMA 1K89A 4EHJA 3TSAA 3F5QA 5DW3A 1UXJA 5IT9A 2FNAA 5LQUA 1P2UA 4AF8A 4UNNA 2GM5A 2LIVA 4J4TA 3RANA 1E3QA 3CJQA 3R40A 2F90A 2ECPA 2Z2JA 2VQEB 2GETA 4R6XA 3D7NA 5ALHA 2A1TS 1XMXA 7YASA 3EQ2A 1GLGA 4OIOF 2X1VA 5ANRB 2AN4A 3TTTA 1TZ2A 3AJ8A 5I7VA 4KX3A 1PX2A 2ESRA 2GCGA 3DHEA 4PZCA 5DTEA 4FCTA 1PTKA 3HHEA 3RAPR 3S9OA 3V7YA 1V1MA 2BFEB 3LPNA 3IAUA 5REQA 3V4ZA 4HVAA 3DAYA 5AO9A 2HK6A 4DDKA 2ARKA 2PZKA 4ADSG 5KB3A 1PV2A 3X1ZA 3LQ4A 2E82A 1U28A 3G5UA 4AJNA 1R5OA 3ANLA 2I87A 3I5QA 5FCLA 3IELA 4MHSA 3S27A 3MWKA 1TTPB 4JLPA 5K0JA 3U1BA 2X42A 3V2UA 3OH8A 2EIJC 1G19A 4LGVA 4KXQA 1LPMA 4JSYA 3C6BA 2CK3D 3PMRA 2ZJ2A 1SC6A 4X6UA 1RJ9B 1FDSA 2GFHA 1R66A 1YUNA 1N5RA 4F4FA 5BMVA 1ZW6A 3QXCA 4P4UA 3SQDA 2ECOA 4F1WA 3UYKA 3ZGVA 5JBQA 1T5HX 2WILA 3TSWA 1BGWA 3NHYA 2J3QA 4BV8A 4CKWB 2HQRA 4BZXA 2V96A 2C7RA 3FHCB 3DVLA 3N8GA 1TFOB 1JBKA 2VNAA 2FSIA 2DGDA 3PYLA 4FJ2A 5FDFA 4AG5A 1DGQA 1Y5MA 1E79A 1YZCA 2ZJ8A 1GL9B 1WULS 1AN0A 3M9LA 3NAZA 2J3IA 1EP1B 3I42A 4IQFA 4KW7A 3EMVA 5DWDA 1H4TA 1OFGA 2WD7A 4OQZA 3I32A 1EK1A 2QMEA 5GGYA 2L42A 1ULHA 3UWPA 1ZGHA 3GRYA 3PQ5A 1K8QA 3M4YA 4M63A 1E0DA 2QIPA 4FGSA 1H05A 2Z9DA 1WCXA 1RAHA 3SXUB 4G89A 3IMFA 3TJRA 3H2GA 3PXDA 1R74A 3SKYA 2Z95A 3EVDA 3H5AA 2ZR8A 3V34A 4J7UA 2TECE 3CVYA 3REGA 4YXWD 2DKOA 4RCVA 4UVGA 1PS8A 2XA9A 1OFUA 3EXAA 1JU9A 4OEHA 2WIDA 1NJGA 3RSGA 4EIWA 1K7SN 4C5AA 1EINA 3RRZA 4CJGA 5FBQB 2EJUA 3IULA 3KLMX 3AG6A 2R03A 3AF0A 4LFBB 1YR2A 2ETVA 3HO8A 4WDQA 1L4NA 3PQEA 3KQLA 2XVXA 2YMMA 4BNNA 1IW7F 2AJTA 1KKLA 4WERA 4DC9A 3DE3X 2BFPA 4IIVA 2F8SA 2CL5A 5KQRA 3R8FA 5E8RA 2WIKA 3LFTA 2JGFA 4Q4CA 2AR0A 1SGWA 1LRKA 2IK8A 3W2WA 1QCCA 3QJYA 4Q1FA 2BSXA 3JYNA 3JQFC 4GZLA 3N6RA 3WGVA 3LQ1A 5EWJB 1OXMA 1B93A 1NBOA 3BFJA 5JMOA 5KREA 3NYWA 4UHDA 2I03A 3RYTC 1KZYC 3WYBA 3IUPA 1B6SA 4B47A 4Y6RA 1MKYA 3ABMC 1YQXA 2G82A 2D5AA 5HUJA 1F4VA 4L4XA 1WW8A 1ZOOA 3KBOA 1LBTA 5F52A 4Y7CA 1P3Y1 3VDMA 2ZCJA 1QUFA 3FYUB 5FR2A 2VBFA 1U4OA 1OHHD 3C3BA 4ZEVA 2WZBA 1QGAA 2Q4BA 1HQKA 4BO1A 3P9IA 3C97A 1U1FA 2AKYA 4X20A 5GJBA 3RV4A 3H11B 1M9NA 2VXCA 1XO1A 3SSOA 5A6BD 2XBUA 3O38A 1C4WA 3R3WA 4LY6A 5EHQA 5DNCA 1PJQA 1H4VB 4UARA 4JVMA 2W70A 3H9BA 1T5SA 3TL2A 2OV8A 1G4UR 5D87A 4E4YA 5FTKA 4XWWA 2CHGA 1PQ4A 1NSFA 1KXJA 5I7AA 3JQCA 1YHZA 1OZAA 4FMBB 3K9GA 3NTQA 1K98A 5C34B 2WU8A 2KWIA 5BSWA 1JVNA 2TMYA 1SBYA 4PZUA 2IVFA 4EFNA 3BFPA 4XGNA 5M04A 3DL2A 2O7VA 1SCKA 5JISA 4OO3A 3CF0A 3AKZA 5IN5A 5HVNA 4BVGA 3JZDA 4KFTA 1V16A 1M1YA 1PJ4A 1DO2A 3NHWA 5EERA 4QDUA 2HDWA 4OREX 2DWUA 5T3TA 3EXEB 3TFQA 2HL6A 5G0SA 3OT1A 5CEJA 2A5DA 4R8LA 1NRWA 1BROA 3RT7A 2OZLB 2FSVC 4CIBA 2X15A 3J7TA 2Y0BA 3V8NA 2BP7B 4K0DA 2W6OA 2WTEA 4PSKA 1XU9A 4BEBA 2IS4A 4BLQA 3GP8A 2H4FA 4LI3X 4MYHA 1J23A 1Z4QA 4DS3A 1OAKA 1OCZC 3BJMA 2IBFA 2A0YA 2DOKA 3UB3A 3NIWA 3DE6X 4RELA 2FETA 3U2QA 1E6UA 4U00A 4IHKA 4EQ6B 4PXSA 4N7MA 1P29A 1W94A 3II6X 3IMGA 3MCZA 2PYIA 1OE0A 3DWEX 2H18A 1E99A 3M1LA 1HXHA 5CYPA 3H75A 3Q6MA 2I6GA 3BGWA 1HRKA 1OWLA 4WGGA 1T2DA 1B4DA 1S8OA 3G2KA 1DI0A 2BTEA 2R8OA 4BJ1A 2NADA 1QR6A 2FQWA 1S02A 4ZVVA 2A2ZA 1CETA 4UBKA 3NTVA 5BN4B 3IAEA 3B20A 4KRFA 2WD9A 1CJMA 4ZVQA 2VDLB 5CNJA 2D6FA 3C16C 4BAUA 4ZOAA 3MJ4A 2Z4SA 3IEPA 4A0SA 2OORA 1T9HA 2ZGVA 3FPEA 1U9YA 3KJNA 4GWLA 5JHHB 1I2ZA 3A1VA 3X1WA 4Q15A 4MV7A 2C4KA 3CSKA 5LDHA 3IFSA 1Z0IA 4MUMA 4NXNB 4OXXA 4E5DA 4QODA 3IAM1 2J0UB 5FOUA 3DWIA 3MJVA 3K09C 4RETA 5EFZA 1HDOA 3A6KA 4RHUA 3ROQA 2X77A 2ZYWX 5CIYA 4ND8A 2Q3CA 4PWYA 1U2ZA 3INGA 5EWJA 3TTVA 1JHXA 4FR5A 3D3KA 1U7PA 5KCMA 5EFOA 4YV0A 2Z09A 2X2PA 2QW8A 2FPSA 2FW0A 4IICA 1RADA 3OCCA 3B5JA 3P7MA 3WGIA 2J32A 4RC9A 4QDLA 1Y1LA 2ATCA 4TKMA 2YWEA 4XEKA 1OVMA 4AM8A 3DMGA 1T5OA 3AR6A 1OI4A 2B4TO 4B6JA 3AOEC 1BKDR 2OBLA 1FXUA 1E0KA 3AFMA 5JTTA 2AEMA 2I2AA 2V6IA 4PHHA 3W4KA 4P4GA 1KSHA 2D3TA 2E49A 1OXUA 5F7OA 3LT5A 3DVRX 4Q7KA 1EFRA 4KX5A 621PA 3B9PA 4W9RA 3V8PA 2AHOA 2AMVA 1QIKA 1T15A 4MVJA 3TLKA 3H65A 3E7PA 3LX5A 4IFIA 3M6FA 1TVMA 1TK2A 5EJ7A 3E9NA 4KBYA 5BSVA 2KB0A 2ZUSA 2IYUA 4KPYA 3O92A 1BQ3A 3O0DA 1OYWA 3MJEA 1OI3A 3DE8A 2WFAA 1N2EA 1CZHA 1C14A 2BFDB 2AI3A 3IOYA 1W4ZA 3C7CB 4RD4A 4DB4A 2A92A 1XHFA 1NHWA 2GCOB 3EXG1 2G3VA 1W4BA 1J0XO 2ONYA 1Z8DA 4QU5A 2KX7A 4XGRA 4P4NA 2QL6A 1SG6A 3ZBQA 1KY2A 4M76B 1H8HD 5DE3A 2A1UB 4TKVA 2JCSA 2IUTA 2PT9A 2WIAA 1S3SA 1G291 4RCYA 3VC3A 4KITB 3RAGA 4YBRA 1GG2A 1BFKA 3L4JA 2BCEA 3TVTA 3Q3VA 2Y76A 3WFJA 1KTVA 3JQAD 4FYHA 2MSLA 1Z0FA 1Y3FE 5AJVB 4YMWA 3E3MA 4D4KA 3ZU3A 4B2IA 2PLWA 5D3MA 1ZNQO 5JFOA 4TV9F 1L4UA 1QB8A 3IRVA 3R9XB 3CZCA 4PBSA 5LMZA 3E8XA 4ETMA 2Q2OA 4EQ6A 2V6JA 1GA6A 4A2CA 1QQ7A 1QNFA 3UJ7A 3HJHA 4IDFA 1E0SA 1GSOA 5DK4A 2VDQB 1VTKA 3A9TA 3IQEA 3V5XA 1R8JA 5KVAA 4D81A 3OJXA 3CIOA 1CV2A 5ERXA 4DV2B 3CH5A 1RHJA 4R9SA 4XYEA 4Q4AB 2PMFA 3ZV4A 2IH5A 3L7KA 3Q3JB 3ZDAA 1HDGO 3OQ1A 4NMLA 4NC9A 5JW6A 2J9YB 5IDWA 4KIFA 2XMSA 1U6IA 1R9GA 1YF3A 1D04A 2TSYB 1RKBA 1UMBA 1LDYA 5AT1A 3KJEA 3PK0A 5DYYA 3LKZA 4HAWA 4WOKA 2BGMA 4CX9A 4FDVA 3WWZA 3FMVA 4KXUA 3CEPB 1M1YE 5G2OA 2C0CA 4NNPA 3SC2A 4CMIA 2VL7A 5FNVF 3I9JA 3L1MA 4ETNA 4BZWA 3HLZA 2BF4A 3FVVA 1PR9A 2E87A 2B35A 5AVQA 3ZW7A 5AI8A 3FPJA 2FQ1A 2O4UX 1F0YA 2QSYA 4JI0B 3F96A 4CG2A 1NI5A 3X2SA 1U1DA 3ZDEA 1GNRA 2QU7A 3JWJA 1MIHA 4ZALA 5A02A 4C0LA 3IODA 2QZ4A 4F8JA 8GPBA 2Y92A 4KGVA 4AY2A 1WHTB 2PX0A 2W6MA 3H7IA 3JWPA 2R8ZA 2GX6A 1PR6A 2JIOA 5COMA 1R6TA 2ZE7A 3HDQA 1KDTA 3GNTA 5FRDA 1KNQA 3IA7A 2VA9A 2B30A 1DAIA 3NWPA 4I14A 3WLSA 2GS9A 3RRMA 5IU6A 3JRTA 1ZW2A 5BNIA 4L22A 4URWR 3Q5DA 4WXMA 2JGIA 2Q7OE 3ERCA 1CX9B 1A4UA 2BAGA 3QELB 1LGYA 4JEAA 5AW6A 2YC4C 1L8QA 4DSAA 1E0JA 3OCVA 1Y8AA 2RGEA 1PGPA 5JNRA 1DC8A 4P32A 4KPGA 4W99A 1CHNA 4QHTA 1GYRA 2C2BA 3DCIA 4KODA 4OGKA 1SM4A 1T9KA 1OQAA 1OBHA 3A0RB 3DSRA 1WAMA 2ZB7A 3L02A 1MXFA 2RSLA 2R86A 4E1BA 3HC7A 3AWDA 1OMOA 2PBFA 4RWZA 1TYEB 3DCNA 4H31A 1M8PA 3QIVA 2QZ9A 3CVJA 3MOGA 1IQRA 1IHOA 3FPLA 3A4LA 4AE4B 4QGFA 3NHKA 4W8KA 4X97A 3GR6A 1VMEA 4QSHA 2Y6VA 2XE7A 3PJFA 1B26A 2Q8NA 4ZOLA 1E18A 1T2AA 1RTTA 2CB9A 4DT1A 1JB9A 3U17A 1DTWA 1COWA 1U5CA 2K87A 4MB2A 4OXKA 4C4PA 1CJBA 1PR2A 2DBRA 4YEDA 3A2KA 4Y98A 2CYAA 1LDBA 4RXMA 3CKYA 3AR5A 4R6WA 2ZXUA 2H5EA 2AOTA 3GBVA 1X42A 5KPJA 2AYZA 4RMNA 2H6EA 2M64A 1I4YA 1TLLA 1VL1A 2XA2A 2YYYA 2ISCA 4CQMD 5DLYA 1RCFA 4CR7A 3G2IA 1TZBA 1NC1A 2IX3A 1AQIA 1J7JA 4D9EA 1X1DA 3IIMA 4I81A 3EG9B 2ZVPX 2VAXA 1A9ZA 3QTLA 2P0NA 2J6HA 5DM4A 4PINA 3FXAA 5F3WB 4C6TB 1XDUA 2H1VA 3IEIA 4KBFA 3TCNA 3ER6A 2ACKA 5JH7A 1SZJG 3ZD9A 4QVIA 3VYTB 1A27A 3W1EA 4B3MB 3AC0A 4G7HF 2E85A 2DB4A 3NEYA 2EGGA 1ZAYA 4CM4A 1MBZA 5EPEA 4DNFA 1DBWA 3TTWA 1M2FA 3K0KA 3O94A 2YW9A 3SY8A 4KMSA 3BGDA 3G50A 1NVAA 1B00A 4MJ3A 2AC7A 5AK6A 4DOMA 5FUBA 2F1JA 3S8EA 3GYBA 3E84A 4I1VA 4E5VA 1M7BA 5E4FA 2XLBA 4ZFNA 5CBPB 5DMHA 3X3HA 3MUEA 3V32A 1U0JA 5IS2A 1YKFA 3CUTA 4EB8A 3R7BA 4W7HA 5HQ3A 3G59A 3PV0A 3VRCA 5BN1A 1OTXA 4Q3CA 5CTAA 1JE0A 1VHQA 3CUUA 3RNLA 1J1UA 1N6PA 1WXEA 4JIMA 4TWBA 4FSXA 3BIOA 2GXUA 4V0SA 4NCBA 2QA5A 4QQRA 1GQ2A 3U56A 2Y39A 1FDWA 4K9LA 2Y71A 3LWDA 2OCGA 4PO1A 3ZXSA 4QNMA 3CNNA 2JAXA 4Q37A 3FTCA 4S1NA 1VI2A 3MGAA 2B82A 5AJYA 4A8HA 1G8XA 4IEFB 1C1DA 3PX7A 2XDAA 4ZCRA 1JR8A 4PIVA 4U9HS 2WOJA 2W2KB 1DQNA 3DZCA 2XMBA 3ZDFA 1XTTA 3OESA 3U60B 2PSJA 2NUTB 2PYZA 4KXYA 4IIJB 3NBFA 1WHTA 1EXNA 4XEFA 1MF7A 4WIAA 4W5OA 4MS4A 3VO8A 3TBKA 3VR4H 4ZVTA 2VHYA 5JUWA 2RH9B 4HAUA 3RVNA 3YASA 2DC1A 1Q2XA 5DHRA 4IIHA 1YL5A 3A26A 3HN6A 5SV2A 4DBZA 1T3LA 1U8ZA 3GK3A 3KLBA 4JA0A 3I1IA 5B4UA 4B46A 2J3EA 1R18A 4J1NA 4LJLA 2C9YA 1OAAA 5L9AA 4LDPA 2VF5X 5LQKA 3GEGA 2P2SA 4GP7A 3WAGA 3B1YA 3TIGA 1QJCA 4L78A 5IW8A 2JEOA 5G3YA 3GZ4A 1DCFA 4WXRA 4HN2A 4PRZA 4I55F 3GIDA 3TEJA 4XVRA 1WO8A 3NPAA 2OGZA 4JIOA 4GDMA 5DBGA 1B8VA 3VVLA 2H52A 5IKPA 3THSA 1WN0A 4DIKA 2WU0A 3DV0A 3B0UX 3LHIA 2CJPA 5IVKA 2NPFA 1QLEC 3AI2A 4HNTA 4O8ZA 3QVVA 3KZVA 4IH1A 1MV5A 4PZZA 2BGTA 3PUVA 5BP7A 3CH4B 5COFA 3LOPA 2PY6A 1Q0SA 4TGLA 3RBXA 1D8AA 3K0HA 4WBSA 2NACA 4S1PA 1C4XA 4HDNB 2RHLA 4NPHA 1QHXA 2IU4A 2WF9A 2JD0A 3QX3A 3LUHA 3A6JA 4CIHA 1K4MA 1R6VA 1PNVA 4OD5A 4IJWA 3WHIA 1ZJ4A 3MWDB 4X44A 3JRWA 3GT7A 1KYTA 2GR9A 3KVNA 4LPKA 5IJXA 3URKA 3EG9A 1YZ3A 2ATVA 3H1TA 2L7AA 2QYOA 1V5EA 3GCGA 4A2WA 1E61A 2HCTA 2L81A 2RKWA 2LCQA 3TOVA 3ROTA 5FBRB 5CU7A 5FI0B 4GVLA 4UNQA 1U8EA 4IKPA 1Y0BA 3PVCA 1H2FA 3LHKA 3RS2A 1CW2B 4G41A 5CCXA 2BLLA 5CT5A 4AN0A 1U99A 1P9RA 3D6HA 1UBEA 5T4BA 3L7LA 5JRZA 3Q8KA 4RGQA 2IY7A 4HTAA 3ZDBA 3NHAA 3K6SB 1PL0A 3LGSA 5F77A 1QPUA 1E2MA 3GZJA 1HLGA 3HN2A 1EVQA 1TCVA 4O4LB 4YHBA 1YK0A 2XI4A 3HSYA 1U5BA 1JFFA 4JEIA 2GPBA 1TEVA 3VI4B 5IMSA 4WKCA 3LPLA 2AQ8A 5C5CA 2POCA 5CK4A 4YRIA 5C8VA 3SF0A 1JHZA 4P4SB 3ETHA 4D9GA 5HDBB 2IW1A 3VMMA 4C29A 5BRNA 1WOMA 4C4RA 1ZONA 1HL7A 4C0KA 4MIOA 1VJTA 5C7IO 1KSJA 3HB9A 1TMGE 4U0JA 4XPWA 2IJGX 5D2CA 1SHKA 1J2UA 1ZVZA 2EYQA 2HQSA 3UWKA 3TLBA 2CL6X 1FMFA 2YHAA 4BMOB 4YDQA 5K01A 1NVKA 2P0EA 4MZDA 4LSGA 2J3LA 4PLVA 4ZICA 1R8QA 4BQOA 5C51B 5B6JA 3LVRE 3Q3CA 5K45A 5CFQA 2RIPA 4MCJA 4CEIB 5ALIA 5K0BA 1JAZA 1OR3A 5CA1A 2ZXFA 2PUCA 4K40A 4D6YA 4O1HA 4GBMA 1GA1A 5LDDC 3EY9A 1IK6A 4J49A 4UMVA 3MBOA 4P34A 3OY7A 3FPFA 4QRHA 4YQZA 2DTEA 4OSPA 4LZLA 1FPMA 3QPUA 4V02A 4RLQA 1ECBA 1TUEA 3ELBA 5DCLA 4ZI7A 3EXFB 4F5EA 5CH3A 2G63A 1KOGA 5ITWA 2OD9A 1XU4A 1RXYA 2OCYC 3PDIB 4PYIA 1H2BA 1FOEB 3CUKA 5B4VA 4DLPA 5EZYF 3LUTB 2OP1A 2OUKA 1LVHA 1HSZA 4MLPA 1OXXK 2L19A 4HYEA 3S6JA 4OKNA 3OOWA 1B0ZA 4PHGA 1Q1QA 2ERCA 5IYZF 1J4AA 1K2WA 5A9SB 1B43A 3BH7A 3PFNA 2QVBA 4A92A 5FL7D 3B3JA 5MN5A 2O8EA 1XQWA 3MTGA 2YJZA 2FMTA 4Q7JB 1O95C 3G13A 5JRAA 1U9IA 4RLFA 2C2ZA 3SEQA 4YRRA 5M5BA 1RCPA 4NY3A 3F67A 1TZJA 2XECA 1HEUA 5H16A 4BC0A 4ER6A 2GSDA 3OZSA 4G37A 3S1AB 1U7XA 5GADl 2FW1A 3TEMA 5CLHA 2BYTA 3HLYA 1E6LA 3CKKA 2GKGA 3UG6A 4DIEA 3OCWA 1XQYA 1QIEA 2A84A 1EX1A 4IS2A 1GL6A 4UBNA 1WA5A 3S2IA 1GM5A 1POWA 5KX5F 3CGGA 2X5OA 3H8JA 1A7EA 1MOZA 1ENPA 1NASA 1R27A 1NNEA 1Q57A 1CJTC 2INGX 1RPTA 4Z9BA 4D9KA 1I4WA 3KKBA 1VPDA 5KS2A 2YIVX 3WK4A 3LV8A 3MWDA 2Q62A 2HWYA 2G67A 4QXMA 3N5KA 4AJ9A 4LKOA 3JQ8A 3PPWA 5K0CA 1RRKA 4K9MA 3GT0A 3IV9A 1EJ2A 3B3QA 2H1FA 3K1AB 4N4AA 4G1FA 1A2BA 1Q7RA 5FOWA 2H7YA 4X61A 4DZRA 1I0LA 1Z0AA 1UMCB 4PQFA 5DM70 4DQUA 2IRWA 2FKNA 4H27A 4I50F 3GAAA 3WO0A 5FI1B 3K0CA 2CUNA 3EQLF 4KQIA 5M2QA 4WE3A 2DJIA 3S3TA 3KWFA 4WUTA 4NRDA 3NEAA 4O2LA 3Q0IA 5E6SB 3AVUA 4ARAA 4X54A 4PSUA 2R68A 1K7XB 1AGNA 3IUNA 1ESNA 1ZK0A 1TMOA 4ESHA 4XLZA 4CKEA 1B8NA 4FFWA 2QPLA 4WXPA 4M88A 3H2SA 4G1MB 1L5HB 4PACA 3KR1A 3HTXA 4YV7A 5I4KA 4BNLA 4RA9A 2PKRA 1W34A 4ZT4A 4O0LA 1A50B 2Q8QA 3O2JA 1T43A 1NLXA 4WKBA 5AVUA 3REFA 2RHTA 4GYWA 3CCCA 4W7IA 2PVPA 4JNKA 3P9KA 3PP8A 2ZREA 4U7DA 3W79A 3HFGA 5AWFC 4LQCA 2QJWA 3A27A 1WNFA 3V42A 4F4DA 5TQVA 3KL4A 3INRA 4EGJA 3US6A 1SUIA 2QPAA 2HIHA 1O03A 4EG3A 3D5TA 2ZPAA 3U1VA 1GWNA 1E3IA 1CPRA 1I2DA 3NBMA 3HGQA 4FC6A 1SZPA 3MS7A 4YWJA 5JXIA 2D5IA 4FNMA 4D97A 3FZYA 4XARA 1LSOA 3N0RA 5K8LA 4RF2A 1GPDG 1RFLA 4P35A 3ZQVA 2VS1A 3E4CA 3EMKA 1QTQA 2ZRLA 1GZ5A 4KFUA 1QM5A 3GUZA 4P5EA 2F9MA 2R1VA 3DZDA 3JU3A 4AG3A 1G64A 2PKXA 4HVTA 3QYJA 1MG5A 1KOJA 2ENWA 2O0KA 4FFPA 3L8MA 4KG7A 4OG2A 2OFPA 4MWEA 3RQSA 2LDXA 1MCZA 1GPUA 3TJ6A 1SVKA 5CXQA 3JRMO 1WW3A 1WPGA 3AU9A 1KK0A 5T7BA 1V25A 2P5YA 1PQWA 5SY9A 4EITA 3HMKA 4GMGA 4RV9A 3ED1A 3GJRA 1FFSA 3T0GA 4HDAA 1ECPA 5CH5A 4L6CA 3UC5A 4A4DA 2YFYA 5BN5A 3W78A 2QD4A 2BBSA 4HYYA 3K4QA 4DF3A 3I1FA 2PR2A 3SMQA 2OKCA 4L08A 4D1YA 3ICQB 2OD7A 4XJSA 3EOBI 3ST7A 3A6ZA 3O4VA 4GPIB 3HCCA 2WAXA 1VBFA 5IZCC 4JSTA 2BJVA 1J2TA 4HDCA 2ZPUA 5TGDA 4U2GA 4KB5A 2GLTA 3BORA 3GFBA 5FFNA 2VH3A 2XDYA 3RU7A 4RKQA 2VDOB 1QIJA 4YIHA 2E1PA 4LMPA 3RTAA 4MUFA 4HOYA 3NU1A 2Z2XA 4MUNA 4CEHA 2B36A 1KI3A 5FEUA 4I5IA 3CU5A 4YC7A 2V7QA 1LKXA 4RV4A 3BIJA 1IM8A 2CZGA 1FDVA 4LNHA 3MB5A 3KXKA 2JLAA 1UK8A 1OREA 2ZXRA 4YJ2F 1U8YA 2FMHA 2HSGA 4ESEA 2JLWA 1IAQA 2OCDA 5F7JA 3WQHA 2B9EA 4B33A 1BDIA 2PGJA 1V1MB 4MWTA 3FYTA 2PANA 1YKGA 8LDHA 2BR3A 5REQB 2CLMB 4ZV7A 4KFSA 1FSGA 3CNOA 4RH0A 3PF8A 3PFBA 3QUCA 1XEXA 2GPWA 3M2PA 5AVTA 2V03A 2DHDA 2EWMA 2OB2A 1BU5A 1UIMA 1LXCA 1Y9DA 5CYFA 2WMOB 1JXOA 4FB5A 3ZU2A 1DG9A 1PGJA 4HB2A 3UJAA 1AURA 2QNIA 1O6GA 5HJ5A 1KDRA 2OCCC 3PTLA 4KYTA 3L0BA 4RVFA 2R6ZA 2PU5A 5WRFA 1QLWA 1CZOA 1QRSA 5SZKB 3VDNB 2ZM5A 1XT6A 3TECE 2P4SA 5AOVA 1YA8A 1P73A 3HBLA 2JHAA 4FM9A 1HG1A 1L5HA 5BMVB 1PYDA 5EQTA 4DQKA 3EK2A 4GZ3A 3GFVA 4UU1A 1IM2A 2B61A 4LF7B 1TM2A 2IUUA 1OH5A 4X62B 1H9GA 2E4WA 1O5TA 5JEDA 2PFKA 1RWBA 3KG2A 3U3DA 4H7KA 5D3ZA 4ZYTA 3R7FA 2BL2A 3OLVA 1AKRA 4BU0A 3FPCA 5B5SA 3BRJA 1O4WA 2H4XA 2P6NA 1Z16A 4Z4EA 4ITVA 4PSVA 4OHYA 2V3WA 1J0BA 5EY5B 2YVQA 3I23A 2R8RA 3GRCA 3JWEA 4KFRA 4N3GA 4K6HA 5H81A 2E55A 1TQ8A 1FF9A 5HK9A 1JZSA 3ROKA 4HRVA 1OW7A 1R64A 5B12A 1AK1A 2P9HA 1L5FA 1YZNA 4JEBA 5JSQA 1VKJA 3HL0A 4NMMA 3OQHA 2O06A 2WD7B 3T9CA 3FSEA 1QYIA 1GTSA 3TL3A 4NX2A 3H5NA 1JDPA 4H6WA 4JUCA 4H7JA 1QU2A 1VLZA 3KYDA 4V1CA 4D26A 3V8RA 4A8JA 4MYDA 1Q0PA 2P2GA 2J8ZA 1RLJA 1Y1PA 1GZ4A 2QQGA 3NM4A 1Q1GA 3T9EA 3IAAA 2OM6A 2C9DA 4KRGA 4Z5XA 3B7WA 3LE8A 2Q4OA 3I53A 5CAEA 1NU8A 2WJPA 3G6KA 3G7SA 4MKHA 2YY7A 5HHTA 4EDHA 4EHFA 3LNCA 4RWEA 1G5FA 4BC1A 1Q7GA 3K0EA 5GPGB 1HQDA 1L7AA 4DMFA 5DFAA 3B9BA 3LP5A 3PHF2 1DQSA 2FWBA 5H3LA 3BXPA 4BQEA 1ZD8A 3NEPX 2I67A 5JC1A 3RC3A 1YOVA 3OLWA 3WL4A 3QBEA 1AGPA 1Z0KA 2HK7A 2EFEB 2L6HA 3A4YA 2BVNA 2PKYX 2EX0A 4EFDA 2RHDA 4HGYA 1WX1A 2J9WA 1N6IA 4BNZA 2H2HA 1BA2A 3IDSA 5BQFA 4MW9A 1Z6XA 2H16A 4M21A 1ISIA 1KYWA 5AW1A 2YV2A 5A0FA 4V0KA 5HRAA 4MVJM 1YYXA 1SBQA 1N36B 5LXTF 5M29A 3HTKC 4PPFA 5E0OA 4W8OA 1F7UA 4C05A 3L7BA 3L77A 3BS4A 2XCIA 5DGHA 5DLJA 4R2LA 2QW1A 4PIMA 4ZMSA 4I9NA 3MELA 1E7YA 5T4HA 1JP7A 4G4IA 2F4NA 5CVVA 4U02A 4XEVA 3V00A 1XCGB 3RWMB 1ADJA 5IAEA 4X20B 4PLHA 2JJ1A 1W44A 4R1PA 1DBVO 1KYXA 1FDUA 5CJJA 5AKZA 4YRNA 4KO3S 2JLXA 1XDZA 2NV6A 4B7UA 1YS2X 1VJ5A 3PE3A 1RYZA 4CIXA 4RZQA 1H0HA 4EG5A 4Z4CA 1YQ9A 1NMXA 3OZUA 3WA7A 4AY3A 4LOJA 4AUMA 4IH4A 5KQSA 3NIGB 4CDVA 4L5YA 1M2GA 1P61B 1P18A 2FX5A 4ANJA 1XEFA 2IP2A 4ZDJA 2H8AA 2DECA 5F98A 2CVOA 2FGYA 2XQFA 1IB0A 4KLRA 3GMTA 2MSKA 3KZOA 2JLSA 2HTEA 4JITA 4GOXA 4L8WB 2DZDA 4DRHB 2POQX 3E9ZA 3DBHA 4GEHA 3GJYA 3NH6A 1V16B 1ZZPA 1M1YB 1CQJA 5LA6B 4CF7A 4GF5A 2BLNA 4JRZA 4XQCA 4P7JA 3F3SA 1RDFA 1VLQA 2V3CC 2EFCB 1NW9B 3L6CA 3OT1B 2XLWA 1VI6A 2Q0QA 3ZLBA 2ZRFA 3FVRA 4MUXA 2C9BA 3AP2A 3C24A 4NFYA 1GD1O 1SU4A 3IPCA 4JLOA 1YCHA 1GUYA 4WASA 2ZS9A 1D2NA 3OI7A 5K6RA 4ENWA 2QZSA 1GTVA 3NVAA 1I1NA 4BVBA 4Z49A 4NPAA 2ZRPA 5B30A 4AMBA 2GDZA 2YZSA 1SXHA 3C87A 2HWXA 2XLCA 2OCLA 2C9ZA 1UZNA 2I6UA 1TM3E 3VM6A 4BVEA 2YFHA 1UWLA 4FYMA 3RIPA 1M2HA 4JH0A 2OEVA 3K96A 5DLEA 2XJ9A 8OHMA 5JLJA 2Y3BA 2NQ2C 4BO9A 3A6GA 1VPLA 2VJAA 3PCVA 5FB3A 1EEXB 1ODJA 3DHWC 4NU0A 1A2QA 4H60A 1WXGA 2B1GA 1Z6YA 3S2SA 2HI0A 1KZHA 2OXEA 2XZPA 2PWPA 2VZEA 5D8DA 1CD5A 2CLKB 2IZOA 5JHGB 5KAMA 5IG2A 1XHLA 5DVWA 4XD7A 5FKJA 1LBHA 4XR4A 3HZOA 3DA8A 5FP0A 1HNNA 2NTVA 3KIPA 2QTTA 1XFDA 3NONA 1SUDA 2ZJYA 1W93A 3GJ6A 4M60A 2WSBA 4N54A 2ZSKA 3Q3HA 1LFDB 3IHLA 1E2NA 4UTVA 4Q7CA 1R6XA 3EZFA 3GUCA 3T34A 1HFJA 4RV5A 2QLLA 2CWWA 4KR0A 1K5GA 4DGQA 1UK9A 2H7VC 4ND8B 4I46A 2ZB3A 3TR0A 5FWNA 4L5IA 4LZAA 2IZZA 5JBIA 3AF6A 4KNWA 2L6GA 2RHMA 2C3YA 4J2TA 2GXQA 2QRNA 1ZGBA 2G5GX 1E2LA 1IZZA 1MAVA 1QZUA 1OIWA 3U7GA 4GKVA 1C3JA 3NRHA 3AXSA 1Y1SA 2WVOA 2GLXA 3H2VA 3N6XA 1PZXA 5K4GA 2ZKLA 4CU5A 4CEJA 2H00A 4QIHA 4PNEA 3M89A 3PSHA 3NP7A 4MP6A 2HZ8A 1FR0A 2WAYA 2PSFA 2YWCA 2NSDA 3MD9A 4G5HA 4DCPA 1CR6A 1DPFA 4MB0A 4Y6LA 3PKZA 2VAWA 1FYEA 2ONZA 2OGTA 2BM9A 3BE6A 4GKKB 1ESEA 3DPIA 5T1DB 1BRTA 2ZVDA 3Q3IA 3EIWA 4M0DA 4K1XA 2A9KA 4N4WA 3H8WA 5BY2A 1V3VA 4FCWA 3V4OA 4YJGA 3VC7A 3O8BA 3SZMA 4WBNA 3LUFA 1KYIA 3K94A 5F1YA 2FN4A 5LU9A 1PP4A 3HO1A 5IZ4A 1SAYA 4AO8A 3MOSA 2XKBA 1VJGA 3Q8XB 5FI5A 1SHZA 4BMNA 3JWHA 3FOEC 2J08A 1AV6A 2YXEA 5LA6A 1A76A 4LZOA 3K2EA 3EEQA 4TKVB 3V48A 3HU3A 1PNTA 2WJIA 5KNLA 1GFZA 2EBUA 4P3XA 1UADA 5KSYA 2R96A 4NEHB 1RHQA 3K8YA 2YKZA 2D7DA 1KK3A 5DH9A 4XVUA 1YARO 4WTOA 4ZU1X 4L75A 2WYOA 3KHKA 1PJTA 2NAFA 2XODA 2C8LA 2IQ5A 1SNYA 4RTSA 3A6PC 3BD8A 4QOHA 5D3MB 1DG3A 5DYGA 3N0XA 4W4TA 5CVTA 3STWA 3H1PA 3IIIA 4HF7A 4I08A 4EQZA 2OZEA 4TS9A 1YRHA 4M0LA 2ORED 4XIYA 4Y2YA 3PTAA 4PJLA 3R9KA 2JG3A 2QMUA 3DFIA 3FMFA 5KVCA 4E13A 4G0PA 4LV8B 2ZZKA 4RMIA 4YAKA 3ZGZA 1OX5A 3EVAA 2RHCA 5HGXA 5JUAA 2WL8A 4G9EA 3NBUA 3ZH2A 4B8ZA 1KJYA 3P2IA 4OBEA 2PKCA 1N1EA 3FUUA 1Y3IA 1TTHA 1WY5A 4WXYB 3OZTA 2GD2A 3C5CA 2G1UA 2OHHA 3OG9A 4BVKA 4ISBA 1BCRA 1EGQA 4IUBS 5GP1A 2QD5A 3V1LA 2JFNA 3I34X 5EP4A 2HJMA 4QXAA 4FESA 1IULA 3N3BC 1QGDA 2YL2A 2EYUA 1UMBB 2GF9A 4NXMB 1JR2A 2Y4NA 3CLRD 3FI9A 2CFOA 4GQAA 4GICA 3U62A 2NXNA 4X90A 1GAXA 3ZR4B 2IYXA 4YV1A 5K5EA 1N6NA 4MQ9F 3SC2B 4CMIB 2A3NA 2R6CA 3RS0A 2BDUA 1ZJWA 3R5HA 1EB9A 4E17A 3IVGA 3SQLA 3C41J 3TULA 3DZGA 3TE7A 4F11A 4NNOA 2BI7A 3N6VA 2W2NA 4W82A 4DSUA 4RIHA 3IKVA 4JXXA 3STUA 1WXDA 4PPNA 2WB7A 2GN0A 1ZNWA 1R6DA 1YRBA 5ALGA 4BAZA 2R62A 1X7YA 3FTQA 2QSUA 1IC6A 1O57A 2CUTA 3U4HA 3PU6A 4G86A 5LL6P 2OD2A 3S40A 3SKVA 1E2UA 3WK9A 2YZNA 5DT9A 3GRRA 1Z5WA 2I4MA 4PR0A 4PEVA 1HI9A 1ST6A 1EFPA 5H0IA 4TX1A 1G1MA 1PUIA 1EQ2A 3UMKA 2LCIA 4KEAA 3R5TA 4FQ8A 1SD5A 1EFTA 2GBGA 5JZSA 3RJ9A 5A2QA 5EJ5A 2HF7A 3RC9A 4AP5A 3G4XA 2E4XA 4FLFA 5AW8A 1RPJA 4FMCF 2R6FA 4JYPA 5AHWA 1CDZA 2E5FA 1E69A 3RRNA 5AK5A 1OF1A 1TU4A 3UOWA 5C1PA 2RGUA 2Y3IA 4PFKA 1J20A 2FY8A 4U5FE 1XAHA 3JCZA 1Y33E 3KPUA 4M87A 3EG5A 2EQBA 3ZJYA 1UKCA 1PE0A 2OKGA 3JZAA 2R7TA 3GEBA 4K2HA 4LPSA 4AJHA 4YN0B 3IERA 1ISPA 2WOOA 2PSEA 4X6XA 3EVZA 3GEPA 1U9CA 3K35A 3PR3A 2A9OA 4JJZA 2YEVA 4WSOA 1SUWA 4ZOLB 4J0HA 1GV1A 2WJ3A 4DT1B 2IXTA 1YE5A 4BNVA 3H16A 4MV5A 4MWCA 3OO1A 1DTWB 4JLWA 1Z9BA 1UBHS 3BREA 1U6KA 3LRPA 1X3SA 4YRBA 1I0ZA 4R1QA 4EEXA 4QSMA 4D7AA 1HGXA 1L8OA 2QTWB 2X0NA 5GPBA 3GP3A 2AOTB 3TPCA 4PGHA 1AVOB 1HW1A 4L02A 3DV2A 4G2TA 5EL0A 2YC2C 3H3XA 4MRRA 1NJSA 3K71B 4S2UA 4UD2A 3ZS8A 2PMEA 4YV2A 1GCGA 5AW0A 2RCNA 4F72A 3B0PA 1Y4AE 5C1BA 4PCVA 5ESXA 2GD1O 3WAKA 2QUIA 4KREA 2RSEB 2I7XA 3I04A 1ZJ5A 1MPTA 1H0RA 2AHRA 5JH7B 2B4AA 2BBOA 1YVEI 1KIAA 4ROTA 4O5OA 1PFWA 5E33A 4AU1A 3GJQA 4BQPA 2FR8A 3WWOA 1G7SA 1RMVA 5B2ZA 2J0QA 4CM4B 5E1BA 3BRCA 5BQIA 4ZT3A 4K05A 5FBLB 3QJ5A 1C9NA 2CXXA 3I5MA 1UEXC 1V4VA 3WKBA 1LA2A 3PXBA 5BWMA 1G5HA 4EM6A 3HP7A 3ETCA 3ZIBA 3PHLA 1ZZGA 5JS6A 2C58A 2GSWA 3WJ2A 3ICOA 1L5RA 4MW0A 1H0SA 1VA4A 1GAWA 1OFIA 1KY3A 4CGZA 1TJ4A 4Q1DA 3IP9A 4E14A 1KA9H 1H8EA 4MRNA 3L0SA 4B6SA 3STHA 5HQ3B 2PD6A 1RNLA 3U5SA 4PQRA 3MX3A 2FQXA 4O4JA 2JLZA 5LP6F 3AXTA 1GRRA 2JA1A 1EM6A 4FINA 5KC9A 2CXOA 1CEQA 1WB5A 5BNFA 3O4GA 1NVEA 1NXOA 2AJ8A 3SI7A 1N77A 2P9QA 5C32A 3DXYA 5C8XA 1D0ZA 4RVHA 1BA3A 3IOEA 5BW5A 4U8HA 3KXLA 3SJAA 2QY9A 4Q4HA 5C8YA 3ZD8A 1JI3A 1Q0KA 1FEZA 3E70C 2P4EA 2XNSA 5K3CA 3H3FA 2H11A 3RVBA 5JYEA 4O6VA 1C1DB 2EXXA 3WDSA 5IJ9A 3Q15C 5D01A 3HXQA 1J06A 3HYLA 5JCJA 2HZBA 2B9VA 5CVCA 4GBGA 3K70C 1PFYA 5DYNA 4K9SA 2MIIA 4DW8A 3DDWA 5AW2A 2JKZA 4KDRA 3D81A 1WMAA 2C9CA 2DFVA 2OVFA 4MS4B 5DIFA 2IPAB 3MVEA 1BC5A 5HE8A 1UUFA 3UMHA 1KHHA 1UBLS 3C3PA 2YHBA 5FA8A 1V7PC 4B4OA 2JIZA 3C4JA 3SIRA 1N2XA 4ZO4A 1U0BB 1JFVA 4WFQA 1NLMA 3LCUA 4Z7JA 1CIVA 1F8YA 1IWOA 1P1FA 3H86A 4KMOA 4X85A 4XWAA 1RXQA 3RADC 3KSMA 5AUOB 2DFPA 3VNUA 6PFKA 2C92A 3DQZA 5TSDA 3DWWA 4YK5A 1ZWKA 1KHTA 2NSJA 1MC1A 4LVUA 1DARA 1UFKA 4OBXA 1KI1A 2YLGA 1LX6A 5A71A 3RSHA 1FS4A 2P4HX 3FCYA 3LLMA 3LX8A 1T6XA 3E82A 4JXZA 2QRUA 3KT0A 3QIAA 2XUDA 1FNTc 3DV0B 2WWYA 4D8YA 1DWQA 1X9HA 1D0VA 3B1KA 1DX9A 2IV3A 4Z7NB 1E4YA 3BXXA 4IGEA 2R7KA 3O73A 1PZFA 3AHHA 1G2IA 3U81A 2HMUA 1PJ2A 3TR5A 2JGKA 4GP9A 3F9IA 3HZRA 3SFVA 4P08A 1NZFA 2AV6A 3LWZA 3KTOA 2AEFA 1L4KA 5EINA 4M0EA 1XA4A 2JJMA 2HMWA 5CDHA 3GCWA 3OZFA 2DTDA 3I83A 1P1KA 2CXUA 3A8TA 1NT2A 3KEFA 4E3WA 5EKDA 3K6BA 4ZYZA 2P67A 1VCMA 3GLUA 5LZ7A 1UCFA 2HV7A 1FLNA 2YWFA 4KIWA 3VR2A 3AZPA 2IF0A 4MQUA 5I4BA 4ER7A 5HM8A 2WBLC 1Z68A 1ZKMA 2JLVA 3I09A 5EMNA 4RQBA 1B0AA 4ESVA 1MMGA 1TF2A 3W5VA 3R2JA 5JPCA 1MT0A 4DV7B 2VEOA 1CC1S 5L95A 4EDFA 1ZJ6A 1LLDA 1RQ2A 1HMDA 4C3DA 2WV7A 1UWCA 2PXAA 3ZXIA 3VR6D 4XTKA 4D3YA 2GARA 2XVAA 1FMTA 3KQKA 1VC2A 1T8YA 4QUEA 4MVJE 2IXDA 4O2AA 5LQSA 1ZY2A 3HA3A 1U5BB 1DWPA 1JFFB 4WVLA 3U6KA 3MWJA 1LBSA 2I55A 2JF0A 1UM9A 4EYEA 3TQTA 1ZIPA 2V9CA 3VJMA 1DKLA 2E4ZA 3IP8A 4MI1A 2DUNA 2ZXWC 4HR7A 5K3EA 2WM2A 2ZSBA 3WK5A 1IN6A 4QBKA 1ZH2A 3CVXA 1YWGO 2PR7A 3H1FA 4J0IA 3K1TA 3CN7A 1EDDA 4ALLA 2XZDA 3V1NA 1N5IA 3QENA 5CP8A 1S01A 3QFHA 3PQDA 3AIMA 5BV1A 1YJ5A 2R7VA 4B7ZA 4ENQA 4P2GA 1XV5A 2I7DA 2Y77A 1NW4A 3WRXC 4L3WA 5A4FS 4DKXA 5CA1B 3GF4A 3CF4G 3D0KA 4MLCA 3ZQUA 4UOEA 2HV8A 2C0PA 2EBWA 3TRJA 5FPYA 3I8SA 2EIMC 2HLPA 3LUCA 3POVA 3OAAA 3TO5A 2WLTA 2PGAA 2OCPA 5EOVA 1NXVA 4L15A 2ZJ7A 1U2EA 5DNEA 3L46A 2VBIA 3P2JA 4IKEA 4E33A 4Q3KA 3ENQA 3H5VA 2YZ2A 3ZHTA 4ZI7B 1KMQA 4PAQA 1WZEA 3EPRA 1ZJYA 3O91A 1H7IA 3TG2A 1BXZA 3VDQA 2VYND 1E9DA 4A0HA 2O50A 4U5HA 1UM8A 5IXSA 2BD0A 3VJKA 2H2WA 2GA8A 2WINI 1RHMA 1EUZA 2WR8A 2AN3A 1R8SA 4EO9A 3I0ZA 1PI3A 2V8OA 2CXQA 3AQBA 2ODNA 2C3OA 4EPTA 1R4ZA 3M3PA 4HWOA 1QHEA 1XMIA 5J2UA 1M75A 1U2SA 4FDUA 2C31A 3A1DA 3S2GA 1IZMA 3WLJA 4YYZA 4KIUA 4U6SA 10MHA 2O8EB 4F6RA 5ESRA 1YE8A 3KELA 2CBZA 4KGDA 3FMOB 4X7RA 4TL7A 1GL3A 3IA2A 1GCIA 2I78A 4TQ9A 3MN1A 1GP2A 2NPUA 1WMEA 1IBMB 2IWHA 4DQVA 1PGOA 3K05A 4QDJA 3I01A 5CT6A 2UYCA 3LYUA 3G9UA 1F12A 3IT0A 1X2EA 5THKA 5J4LA 3GOHA 1GKYA 1AUOA 4PO8A 1T6BY 3T7JA 1TPZA 2YIMA 1KR2A 9LDTA 1ZD5A 3R9WA 2VDJA 4B8YA 4MEJA 2FR1A 1D07A 4C5BA 2P1AA 5F5NA 2ZP1A 5TQ2A 3S2EA 3UGTA 5E0KB 4XWOA 2QOEA 4I3HA 2V4MA 1NBMD 4U6QA 3JQ8B 3NHMA 4DM7A 1ZPDA 4S0ZA 3R4VA 2CLSA 3UAZA 2ZYRA 4GWKA 2C5GA 2HHJA 1GNTA 2VCEA 5GOTA 1E3MA 2XEDA 3ETJA 1J8QA 3M6WA 5KTTA 1J8FA 4LRWA 3V4LA 2G7MC 3F4KA 3ZHVA 4EIYA 4UQLA 4QOFA 3I0NA 4KXMA 2KC3A 4KTTE 2A4MA 1KZ7B 4ZCPA 1A97A 2Q1YA 3NMUF 2OHFA 3M15A 4B0OA 4CKEB 4GEKA 3QPBA 2Y3DA 1W85B 2XWSA 2IS2A 1GXSA 4D3DA 4Q3BA 4EW1A 6ABPA 5DHFA 1X1BA 1CUHA 4RA9B 3BXOA 3BA1A 2YY6A 2QZZA 1A4IA 1EGVB 1JNYA 2Q6LA 3WS7A 4FS8A 2DUWA 1HEYA 2VH1A 3A3YA 3PE4A 2QNBA 1VCNA 5E3IA 1EFHA 3DZ8A 2W6QA 1GQAA 3T4XA 1NNLA 4B3BA 1YS4A 4JBNA 3PPIA 1UQTA 5EJIA 2YYAA 4EPYA 4KI0A 4BVAA 2D8AA 5TR9A 5L3ZA 1DWUA 2FKAA 2BM0A 3GPBA 1X14A 4JYCA 3CPJB 2JI7A 4B3DA 2RI6A 3G2NA 1OX4A 2I6XA 3SLGA 4KVAA 4Q4ZF 1BE6A 3AFHA 5HA5A 4KQ1A 3KSZO 5CVJA 3MBKA 256BA 3SVZA 2Y1DA 4NV1A 4C0WA 3ZWAA 3LL7A 4BECA 3P9ZA 4Q12A 2VTBA 4PBRA 3QFFA 2GLUA 5HZKA 3ZY3A 1Y48E 3IEEA 3FG9A 2HRZA 5B7QA 1SULA 1Z56C 4LE2A 3HV2A 5AM4A 1H9TA 5HCIA 5SY4A 4N6HA 1RP1A 2UUBB 3T5PA 1W581 2M1ZA 1ZOLA 2R1VB 1NWCA 5TVGA 4X3OA 1EQAA 4BJHB 1T6UA 3R6TA 4IO1A 3CTMA 5J2TA 4RD1A 4BPRA 4Q02A 2GJSA 2PX4A 3QTBA 4CMEA 4WJZA 3ZVNA 5B1BC 4GPBA 5DASA 3KTFA 3ILVA 4I5DA 2WTUA 2VSYA 5IWCA 5HJ2A 1X39A 1WZNA 3U7IA 2FPKA 5D3QA 1STOA 4CBVA 1U2DC 3GA7A 5HJEA 3SE7A 1ZD2P 3B6JA 1W0JD 2W9XA 4R16A 4DNXA 3TLYA 3JZIA 2XWJI 1VDZA 5BN5B 3JZFA 2WICA 4UFNA 3PKIA 1PR4A 2DETA 2PF4E 1VMDA 5CLFA 4M53A 4F93B 3K9HA 5BV2P 1AG9A 2Z4TA 4OQNA 5DNDA 4LLCA 5FUYA 1ZHWA 1TO2E 1GNQA 2BKVA 4CF5A 4RM2A 2JLYA 3LU1A 4D4JA 4QG3A 2QRLA 1ZN7A 3W5JA 3ESAA 1KC3A 4ESOA 3I72A 3H2YA 5HRUA 4CEHB 4IUCS 3DXZA 4HNUA 3F2VA 3R20A 3G2QA 3RW0A 1PVOA 2ZYHA 1Z5ZA 4A6DA 1W9HA 2EJCA 1SK8A 4MI3A 5C31A 4DMKA 1XMOB 4MA5A 3KZMA 3TINA 2D3WA 2ZYDA 4H7IA 1W0KD 4MMYB 3CEAA 4QRDA 5AJHA 3H1GA 1QYRA 5A3QA 1PJ3A 1E7MA 4LE1A 1YKSA 1ZI9A 2G83A 4GM1A 3EC7A 2WF8A 2B34A 2HADA 2XADA 1RVV1 5EJ6A 3E53A 3DDZX 1E5VA 2CNKA 1NQAO 2QEQA 4ZJYA 1CP3A 1TKAA 1XEXB 4HLNA 4YUVA 5DB4A 1BDBA 4DEVA 3WLLA 3EN0A 5ILQA 1A04A 1SUEA 2QQEA 3ORHA 2W6JA 1UOQA 4PHTA 4Q47A 4ER0A 4BFTA 5FUWA 1P77A 3N59A 5CB4A 3FHDA 4O4HA 1XKLA 5AUNB 2OXTA 4FMDB 5H1YA 4PW0A 4FI3F 3E9RA 4PYOA 3NCTA 1PHRA 4JI1B 5KMGB 2NWQA 1QONA 3N0VA 3PI6A 2PTGA 4L9AA 4NTFA 3SDSA 3ZTWA 3KVYA 2H9YA 1K8YB 2O2SA 1XTPA 2PG3A 1DDOA 2P7IA 5LNK6 1RBZA 2VNJA 5AKYA 1W85A 4AG6A 4BLWA 1G17A 3RVSA 3IBYA 1YQUA 4K8RB 1D2RA 5KKAA 2G80A 2GCIA 1H6DA 2H2IA 1NTRA 2O6LA 1FTGA 4R7GA 5GMOA 1U0RA 1UKZA 4F38A 5ITSA 1HZZC 3SLRA 3HNKA 3LC2O 4J9VA 3O9VA 4U9EA 2W6ZA 1TADA 1O77A 5FJIA 3LAWA 3X1YA 4I6GA 5EMJA 2VDMB 5CM2Z 2QVCA 2RHOA 4N0PA 1GR1A 1Y6DA 5L40A 1Q1EA 2HN9A 1VPVA 1H5UA 1ZDMA 1XP8A 4EF5A 5EA2A 1NP3A 1QHGA 3LG2A 3LYHA 4BP1A 1CTQA 3S1SA 1R9JA 5HILA 1SQ6A 3TZHA 2EPKX 2R4TA 3N8DA 5DRTA 5D5HA 1Q0MA 3HZZA 4QHYA 1JJFA 3F5SA 1H5NA 4I7EA 4JZYA 3QWAA 4HHEA 4WCFA 1C0KA 3KYDB 2A7QA 4LJAA 2ZRQA 4V1CB 5IAGA 4A8JB 5IJ0A 2NUAA 4KK4A 3COSA 4HPJB 1MP0A 1EUQA 2WZDA 4RPKA 3BEDA 2XLOA 3B0VC 3FTNA 1UH5A 1VE3A 3SHVA 1EKXA 5EVCA 1GV0A 2WHRA 1V6CA 1JRAA 2W43A 3BWMA 1O5IA 1YVIA 3ZHYA 1GAQA 3DNFA 1DCKA 1M72A 5CAEB 3TSOA 4B2YA 3IPAA 5JDIC 1TGVA 4M7WA 3U3XA 1E5XA 2IPLA 2VPWA 2MYTA 5DS5A 4FYKA 1YGYA 1XTVA 1CBUA 1XTUA 3MW8A 1IN1A 4X6YA 3R24A 4H0FA 4AROA 2OR3A 4R1NA 4IDBA 4QC2A 2JD1A 3OC0A 3SFZA 2AEJA 2B20A 1T1EA 1YOVB 1Z7GA 4HLUA 4L5JA 1N5DA 3RUCA 1KGSA 2FRDC 4E32A 4JT8A 5FJJA 3C0KA 2A30A 4BGIA 2EPOA 2JBAA 3KAKA 3SOPA 1DB3A 1MNDA 1XL1A 3P5SA 5IVIA 2ZR0A 2ZUBA 2PUTA 1C0EA 2NLOA 3TW4A 2HJWA 3N05A 2NU8A 2DB3A 1TI7A 3PXGA 1H1LA 3EGVA 4XWTA 4G8BA 3ZIAD 1SZCA 4MXDA 3JTLO 2XCTB 4UZSA 2I29A 4Q1VA 1UOPA 2W6IA 3Q6IA 1PAUA 3A6HA 1QE5A 5DIZA 4ONSA 3C1AA 1ECGA 1U63A 4WFJA 4LHWA 5E6RA 3VR1A 2Q1WA 3F6SA 1WMBA 5ES4B 1QTRA 1JHRA 2XHZA 2NYRA 1SCAA 4MVJP 3ND5A 1Q16A 5AH0A 4V03A 3ML1A 5GJCA 3RJMA 4N8EA 3QYAA 5AOBA 4ZARA 4L5CA 4BMXA 5EKTA 2YFKA 3I58A 5COAA 1L3IA 3KB2A 3T0FA 2VA8A 4PGGA 1GPLA 1K68A 4W5HA 3JVIA 3WQSB 4E08A 4QTXA 1QOZA 1YCGA 2G40A 2FZKA 1M6NA 4WJLA 2JEYA 4NS1A 2X7HA 4PHCA 2O57A 1TCUA 4IJQA 4YAFA 3ZG6A 1OW6A 3ETNA 2J07A 4DJDC 1NRIA 1YZHA 4UCFA 1AVTA 5BQOA 5KMGA 2ASVA 1JFTA 4LYDA 1BOOA 3BQMB 2OKUA 3HL4A 5DKFA 4S1TA 4H1WA 1JYEA 1UAAA 4LHXA 5ALNA 4F85A 4YJFA 5IJWA 3DBHB 2DULA 2Y0PA 2C4MA 1CQJB 5DP2A 3ONEA 2F55A 4TT3A 3D02A 2EBHX 3FIUA 1F06A 3UR3C 5LYYA 1ST3A 1SVIA 4JBHA 3L4BC 1IMJA 1ZW1A 3LBAA 4QU9A 2DE0X 4GRDA 1RYNA 1ZGGA 1ZD3A 4UDVA 2QVGA 3N28A 2IGTA 4V24A 4Z4QA 4MR9A 4OU5A 3U80A 2IXAA 4HCJA 5FORA 4HGPA 4GLFA 2JARA 3KJHA 3D4LA 3OURA 1U90A 4L9WA 1UZLA 4WX2B 3VSDA 3A1FA 5BVGA 3G8CA 2JZOA 2R1TA 3WNCA 2W4MA 4XFDA 3B1FA 4Z9IA 3E6AA 5ALFA 3S2YA 3UHFA 3DEHA 1YZGA 2EQAA 2ISSD 5DTRA 4G7OF 2J6BA 3LI2A 1G0NA 2XYRA 4IWBA 1AZWA 4J75A 3SKXA 2P40A 2PUWA 3BHMA 4NZZA 2LKDA 4WT7A 5IKXA 1YFKA 2JLUA 2B3DA 4UULA 1CRWG 1B1AA 4M9QA 2CBGA 3C1UA 5IFKA 3PCRB 4JT9A 1I3CA 2W2TA 2P2LA 3Q8LA 3UOGA 3N7AA 1PU2A 3N2ZB 3UPTA 4WH0A 5I8WA 1N33B 3ZDDA 4AQDA 3EULA 5B3LA 3WQBA 4WLEA 4AQ7A 4PAOA 5HV9A 5MN4A 2XM4A 1XDSA 4II3A 3D6VA 1LQUA 3PUIA 3I6IA 1WXFA 5FI3A 4M54A 2R25A 3H42B 3EDYA 3T3HA 3O3CA 4PV7A 5JMTA 4YRKA 3KQTA 4WNIA 3NAQA 2D0PB 2AG5A 3PITA 2XUGA 4PAMA 3NOOA 4P7BA 4ASUA 1BEEA 2HSBA 1Y8ZA 4RIEA 1PKEA 3SJBA 1WE2A 3WLFA 2BPOA 3R09A 3OF3A 1A98A 2NN3C 4E18A 1GO2A 3PT9A 3T6KA 1CR0A 4HRYA 1K08A 4ENPA 2FSFA 2IH4A 4YT8A 4AJKA 3ZJUA 1U8XX 4DCVA 2EC5A 2ORIA 1LE4A 1R0BA 4M1QA 3ZLJA 3MERA 4GGOA 4IGIA 3K30A 2KS6A 4CEJB 1E84A 1HDZA 4CM6A 3U5TA 3C6QA 2EV9A 4I1SA 2VPZA 2J6IA 4XM1A 4MEAA 1HNXB 1LD3A 1B2RA 4H16A 9MHTA 1YJ8A 3G17A 1CVRA 3R1IA 4TTJA 1BFDA 5LKAA 1CJVC 3M79A 4C7BA 5B7GA 2X9QA 4XD2A 3R5FA 5EJ4A 5I48A 2NU9A 1RAFA 1VB5A 1LS6A 2IW3A 5T4FA 1LWNA 2G6TA 2OAQ1 2FH5B 1DBRA 4G8CA 1CIPA 1L4FA 2BH2A 3DTVD 4C08A 2I15A 2ZSEA 1RJGA 4XH9B 1E8DA 4LQ4A 4WOJA 4PTZA 5I9NA 1YBHA 4OYYA 4QJ4A 4YJGB 3TQHA 3AEYA 3AHFA 4WBNB 4GKBA 4RPIA 4NPCA 5J9FA 3U26A 4CIPA 2XGOA 3WNQA 3DBLA 5IHPA 1NT4A 4FGJA 4RAOA 1NULA 2NP7A 3SYNA 3I04M 1I24A 4DY4A 1X1SA 3ZWBA 5E38A 1GTRA 1AXEA 3OE7D 4C1NA 2IZ7A 3LRTA 2Y99A 1TJ5A 3JWGA 2B92A 3QK7A 4DQ0A 3L7NA 3CZQA 1Z88A 3I39X 3FUWA 4RJTA 1TT7A 5A5EA 1TU3A 4HZGA 4M8LA 4RD0A 4Y2PA 4QOEA 3ETDA 2R7WA 4JKIA 3UGPA 2C5EA 4B8WA 2WFLB 4B3HA 3PC7A 3VNBA 2P61A 1C9DB 2HU8A 4DA9A 4RA6B 1C8VB 3UGOA 2BGKA 4A0RA 4UTPA 5ULLA 1XWFA 3PNVA 4L57A 4BYMA 1QSGA 4GZ5A 1T24A 3FOFC 2FF5A 1WSAA 2PHZA 4YL0A 1LW6E 5F1KA 1Z5UA 2EKZA 3PVSA 2GN9A 1U7TA 4S24A 2HMTA 1UG7A 5FPHA 3UMGA 3LT2A 5ADWA 4HJXA 3GNLA 1JIUA 2X9GA 4RTNA 2PZFA 1J2RA 3E1KA 2QRHA 3ZTTA 4GOOD 4YP9A 4F8EA 4TS4A 3NM6B 3D3EA 4HLDA 2ZSAA 5FPQA 2JPDA 2XQKA 3S44A 3PNMA 1G9TA 3BRWA 4KO2S 4H3SA 1BCRB 3I2IA 3LK7A 3OJFA 1P39A 4OHVA 3B8EA 1OASA 3Q7GA 5K3DA 1C8BA 4EARA 3DKKA 3ACCA 4B2LA 3Q41A 1EGHA 4OUDA 4X7PA 5L4SA 5JR3A 1O5HA 1SK9A 1EE9A 4URYR 3C18A 1ZIXA 4B9AA 1IONA 3S5JA 1OXSC 3PDWA 2O8FA 5LOVF 1A96A 4Q00A 3GJ0A 4O1MA 4L3OA 1LY1A 4UDOA 1AN9A 3ENZA 4RVSA 1LTKA 1T9GS 2I2BA 1I6WA 2GAFA 1FMLA 1T0JB 3I5AA 4MVJH 3ZWKA 3MGBA 3BCSA 2P8SA 3CIFA 4KQXA 3O8DA 2AF4C 2PEZA 2PQ2A 5AJZA 1MABA 3IESA 3JR7A 1X7YB 2Q3EA 2ZBFA 3Q2KA 2WRZA 2O7RA 1RM5A 1LKZA 1U2RA 1SKMA 5BURA 1E3JA 4U2BA 4IXMA 2RGAA 1A41A 4X0RA 4ZT2A 4S1VA 4ZO8A 3UK7A 1AHIA 1EFPB 3HVJA 4QJIA 2V55B 1FFTC 5HQTA 3EC2A 4OBBA 1QDUA 4EVRA 4LCJA 1PT5A 5JJ5A 2GBIA 1P7ZA 2FEKA 3P5BA 2ZD9A 2HU5A 5BVHA 2QI9F 1C3EA 1VLTA 3FJ1A 2ZUFA 1NSTA 4EH1A 5JASA 3RIGA 3TFOA 1XTZA 1I51A 3B5EA 4H3VA 4YQYA 4DBVO 2XGJA 4BB6A 3IHUA 4LYHA 4YFVA 4KMMA 1RWMA 1CDDA 5TT0A 3LEVA 3D3QA 3MUOA 3I92A 4ZIRA 5ALRA 4DV6B 1KI8A 2VKQA 1RP7A 1UAYA 3PX2A 4I19A 3AR4A 1KNYA 5DM2A 4QFBA 5JNSA 2ZBGA 1CHDA 4MIEA 4Q6WA 3JXEA 2ZUUA 1W35A 2VASA 2WT4A 2G3YA 2YLDA 1YDHA 1OIXA 1R0SA 2O8VA 3GRKA 4RVCA 5A04A 1KP2A 1O0CA 4KDEA 1Q92A 3CW8X 3QG1A 5AKLA 2CL7X 2P41A 3UMVA 4AULA 3RH0A 2BELA 2ZPTX 4EYQA 2EIKC 1QRAA 5DPMA 1C80A 1PT7A 3IP5A 1VYIA 3U8VA 4XWGA 5EJ9A 3ZCUA 3H0KA 3PNPA 3L49A 4HGRA 2Q3LA 3EMDA 3DR5A 5AKXA 4EMSA 2EILC 2RGGA 3EA4A 5DI3A 1NZEA 4K8OA 4MVYA 2WFLA 4W6QA 5EHNA 2YNMD 3LPDA 4PG6A 4YT2A 3L84A 4OJYA 5L3SA 4RA6A 4ZQCB 4FN4A 1OW3B 5FX2A 1NDQA 4K7BA 2J87A 1F0PA 3O2QB 3KC2A 1KQNA 1V47A 3FOOA 4PJMA 3Q5GA 3QXXA 1KE2A 1XQXA 1L0BA 3VYRB 3USES 1YVUA 4HMQA 2ZJFA 3A25A 5LYJF 1AQNA 4IZ6A 4Z8YA 5E3CA 2Y1GA 1U1CA 3K4HA 4ANFA 4ZJUA 4TKLA 3GLVA 5K6AC 1GLNA 1A0BA 3QVSA 1Z38A 5LM3A 2ZYIA 5B7NA 1YVPA 2GXAA 1WMDA 2QJRA 1KFJB 1J56A 2WPDA 4UXIA 3ZCTA 1DVRA 3ZVMA 4ZKEA 4PLFA 2WVGA 3H1AA 3KSUA 3TJZA 2AJBA 2F3PA 4CSAA 4D98A 1JMVA 3ZCRA 5AM2A 2C5HA 4O4JB 3CLHA 3ZZUA 5FHRA 4P5DA 2Q1XA 3HCDA 1BR4A 3ZGNA 4K9PA 3L5KA 1IVNA 3QUBA 3BERA 2QUPA 2Q5EA 1D5CA 3WGTA 4D43A 1EI9A 3IR6A 3EF1A 1Z6AA 4Q4HB 5C8YB 3COJA 1TQGA 3TQOA 3OEEA 4YT4A 4YJ3F 2NPOA 4A03A 2GDCA 4BGUA 4RH1A 4HEQA 1S4QA 3QVZA 3UUWA 3DJFA 4UEJA 5IJ9B 3KUCA 1TF5A 2VRBA 1EWRA 1DT5A 3CO5A 3DPUA 1HYGA 4KVFA 3T1YB 3BF8A 5JDCC 5JJLA 3VBEA 2OE2A 2VJDA 3Q98A 2OPHA 1G98A 2HUJA 4HDKA 1TJYA 4OB6A 3E3OA 5CLJA 2G4LA 2JFYA 1SBTA 1ZMTA 2MSWA 4PVDA 5E6UA 3GCZA 3GH3A 4J0JA 2WNSA 4L0QA 3ZQ6A 1FP4A 1UJNA 3X44A 3DMNA 4HBGA 3IMKA 3PEEA 2XNKA 2W11A 1AC5A 1NUQA 4HXFB 1ILWA 1CY2A 4TV8A 1TWCA 4D44A 9ATCA 3M81A 4JI4B 5H3HA 2R48A 3HI4A 1PJCA 5HZMA 2J3KA 2WDPA 1XRRA 1XZHA 2DVMA 2ZYSA 3I01M 3ZYCA 1U3WA 5LC1A 4B75A 3LS0A 3KJZA 4ER3A 2X3UA 5ISMA 2NZUG 2HRCA 4QBHA 1Z6ZA 4LF8B 1NW8A 3O9MA 1NFQA 5ICGA 3EARA 1G42A 1U8TA 1GILA 4RKYA 4ZYYA 1SOMA 2BM8A 4UBJA 4HX9A 4URFA 2J0VA 5AXDA 3LQRA 4DYDA 3V5ZA 2A58A 2P9EA 2W2PA 2AH5A 2BFBA 1XTBA 1I4ZA 4ITRC 4UD6A 3IKTA 4R1SA 2YRWA 4KJZA 1GNVA 2X19A 5DHTA 3UMMA 4AX2A 5JQGA 3KSRA 3WTBA 2HH9A 5C81A 3H4VA 2GWWA 4BBPA 4DE5A 5A4AA 4KQFA 2O2DA 2GUGA 4FGUA 2FSGA 4NICA 2ZRBA 2HGZA 3A11A 2C4NA 4HJRA 2JVJA 3ZYZA 2W58A 4QBFA 1NJ8A 5T57A 3K32A 4PNHA 1L5VA 3D8HA 4DLLA 3FCOA 4EJSC 5MFZA 3UBMA 4OHMA 2H4WA 5KJ6A 3LXRA 2XUZA 5TDHA 4QJBA 4J7TA 3P9SA 3D4BA 4MVUA 2OBFA 5JFTA 3H2IA 4YB8A 3P8ZA 2B1RA 2JW5A 1GTL1 3MAGA 3EOZA 3C8GA 1X13A 2LGJA 2NV0A 3KKKA 4TMTA 3EEIA 5IBCA 5K2MA 4GPAA 3JQBA 3OJ0A 4M6WA 4US0R 4O2AB 3R9IA 1YQWA 1SR8A 3HCOA 2DTXA 1E6EA 4LZJA 2P9JA 1O94C 3WWPA 1VL8A 1RWWA 1UM9B 4JW1A 4AURA 4XPIA 1R5ID 1Y8CA 4Z2YA 3NH9A 1EJBA 4PLPA 4ULWA 2V45A 1DT3A 2O2HA 1HT1E 4JELA 4QXPA 2NVBA 4MO9A 4E3ZA 2JIDA 1NR7A 2Z04A 4WACA 1G8PA 1GUFA 3B7GA 1B16A 3H6GA 2CHUA 4CR8A 4Q5SF 4HVCA 3M83A 3GWZA 3ADDA 5FLKA 4D5EA 5AW4A 4TM7A 4R1TA 4YLGA 4GQBA 1LJ8A 2IYWA 5L0JA 4U7FA 4GBJA 3ZE9A 2X9VA 5CLGA 3GMIA 7MHTA 1RT9A 2XY4A 3RHTA 1BH6A 4HATA 1RMQA 1XU7A 4JLBA 1ORJA 1E4OA 1ACLA 5AW5A 1OPRA 1KZ1A 1OX6A 3RS4A 3B29A 4WGFA 1JXMA 1ADFA 2G88A 1YIOA 4ZAZA 2UUAB 2VP6A 4PQGA 5DTIA 1E1RA 3DNPA 3E7WA 4EL0A 4DBRA 1FFHA 5D86A 1OCOC 3Q87B 3W5HA 1I4OA 2HC9A 2QE9A 2XZLA 3W5CA 4F3TA 4Z1OA 3GHHA 3WB9A 2NZWA 4RY2A 1YI8A 4GOKA 1DX4A 4JP5A 2BMFA 2ACWA 2WYVA 4YASA 1TT5A 4V2IA 1CP2A 2CLOB 2B8NA 3H9UA 4Y1FA 1Z4KA 3ECCA 5J2UB 2PO7A 5KYUA 4BEJA 1AZSC 4HWGA 2Q6IA 2COUA 5EE1A 5THQA 2WSSD 4F6RB 3F97A 3WV4A 1CDOA 5DNVA 3F6BX 2ZRIA 3ATPA 4UEOA 2WZLA 1I10A 2XUQA 4FQ5A 1Z0ZA 3ENNA 1DCTA 3WK7A 4TMXA 4INPA 2PWBA 4CI0B 3KZXA 3C8DA 1R0ZA 5EQJB 3KPYA 2ZJ4A 1Z17A 3Q4GA 3DAOA 3TZCA 1HF3A 3RARA 2P65A 3P9NA 3AI3A 3NGXA 3B52X 3VR4D 1ZHXA 4BRWA 3CFYA 3BH0A 4DBQA 3INYA 1USIA 1DL5A 4OJKA 2HIAA 3QOWA 3OO0A 5LQAA 1M74A 2O8DB 3W2VA 3OCZA 5HF8A 2HSZA 4ZEOA 5TQ2B 1V7QA 2BEUA 2WYIA 5IP5A 3FLMA 4L6AA 5AKGA 1DRJA 1J90A 1N3LA 3PUXA 1I30A 2VKTA 1JKIA 3TIFA 4I4TA 1MIOA 3GEHA 1B41A 4RIIA 2GFQA 3NETA 1OZHA 5CIQA 5A5VA 4TMYA 2XRZA 3FMIA 2QXYA 3H84A 1NBWB 3ZI7A 2A0XA 3ORFA 4F4BA 1ZNYA 1RYDA 1JHAA 1UC9A 2P3QA 1K06A 3OLXA 1UFOA 1X86B 2JAPA 1L7QA 3VNAA 1YC2A 3RYHA 1PGQA 4OM7A 3T5CA 3R2PA 4FE4A 4H9GA 5CDGA 2O5VA 1N92A 2CNBA 2GHIA 1KJJA 4CTNA 1GXSB 5CXSA 1T8TA 2NVUA 1E63A 3S81A 5B2EA 4KZKA 2Q5IA 5AI0A 4NIMA 5FWYA 3NV9A 3TLGA 4DBLC 4IRUA 2JIQA 4UEWA 3DM5A 4W7SA 4ZAYA 4MTLA 3HLTA 2PBEA 1N2SA 1TEHA 3SFTA 1QHIA 1GRCA 2AXQA 3RVOA 2Q6KA 4CM7A 1RSZA 5EIXA 1CF9A 3U37A 2Q07A 1MPXA 3SC4A 2PRIA 1TMYA 2WKWA 1OX4B 3WIOA 4RQAA 1DAMA 3LXMA 2FK8A 2OILA 1XPOA 3EQ9A 4TLCA 4US1R 3COPA 3LSYA 3V2GA 2CNNA 3D8NA 2QLJA 4DDUA 3RK1A 2ZR7A 1LK0A 4A27A 1Y1TA 5DSXA 2P91A 1GA4A 2VTBB 3JRXA 3DG9A 2J0EA 3ZU6A 1N9KA 1VIYA 4RTRA 5EAIA 1G20A 4YL1A 4PZPA 2C83A 7ABPA 2D7JA 4PXAA 3BL6A 2D4HA 4OH1A 2FFJA 1BXGB 5CH8A 3LBNA 2PQ6A 1U3CA 1CSEE 4G0XA 2X6RA 4RL6A 2C5LA 3QOXA 5SYNA 4X1IB 5FWXA 5HFAA 2B25A 1LIHA 5FCDA 4QYWA 2WPNA 3C6YA 1L5QA 4IOLA 5J2TB 3F0TA 2XQVA 1JDSA 3B9QA 5COQA 1BDMA 3T5GA 2QPOA 1UZMA 4JB3A 4TOIA 4EJ2A 3OTOB 3BB3A 4RHYA 3JTEA 3ZCSA 2D1FA 2D59A 3RJTA 3WBJA 1QIMA 1TJNA 1JHOA 1F0KA 2CNOA 4PYJA 2ICWG 221PA 4Y2XA 1J8DA 4DCGA 2XAAA 4E7PA 1LLUA 3H2UA 2R9VA 2W9YA 1ZFNA 2H5LA 5G1NA 5BNZA 1T0IA 1Z45A 3DXFA 4Y9DA 1IG3A 3T9FA 3L5OA 1IOLA 1YB6A 3DD1A 4PYNA 4GL4A 1EA7A 1G2QA 2W2LD 1F8FA 2ZT5A 3H13A 2X41A 3TLZA 1PEKE 4LMRA 1J0AA 3TCXB 3AO0B 3AFNA 1FSSA 2R5FA 4YRMA 2QS9A 1TYCA 2FR0A 2XZTA 4FLMA 3AZOA 4OKIA 1T0PA 3U09A 4EP1A 1TFKB 4J4BA 4WW0A 4OIQF 4ZU3A 1KDPA 2QP4A 4TQAA 5LQDA 4PG5A 1ECJA 4QRIA 1O7JA 2O8DA 1IZ7A 3PFFA 3M70A 4LHVA 1GUDA 2DBVO 4PPQA 1RYYA 2G6BA 3OX1A 5EK0A 4TVBA 3OFJA 4L7VA 5BRAA 4MZXA 1GSHA 3I64A 1G8SA 5TJHA 1GU1A 3H0EA 5DNWA 3JD4A 1K66A 4JX9A 3O8CA 3W3AA 3X43A 3W2IA 3VRHA 3WGHA 2UKDA 2R11A 4J16C 1N0WA 4M49A 5F2KA 5K0NA 4ZPJA 2P78A 1C1YA 3WBKA 3PWKA 4HWPA 3C6XA 4AS1A 2IUEA 1OFTA 5CB4B 4X0EA 4O4HB 2AK2A 2Z2ZA 3G7NA 3DEYX 4J2HA 2PCJA 1ZBQA 5ARBA 1A3CA 3V5NA 4O2BA 1K63A 5JSZA 3ZWYA 2FRVA 3CURA 4EUKA 4M9UA 4LX8A 4NDAA 4JD5A 3ORQA 1IOVA 5D85A 5KNDA 2R6JA 2XUIA 3F7MA 3ESDA 4U9DA 1NXPA 1CZLA 1D6JA 3BICA 5B3JA 4D92A 2H65A 1J0EA 1YL6A 2J9FA 3UJ9A 2DLNA 1SUPA 2PRYA 4AKIA 2QRPA 5G02A 3SXKA 4QE3A 1C41A 3C1OA 2JAWA 4LNUB 1OZFA 1BAPA 4GX2A 3ES9A 3KCNA 2PDAA 4KIJA 2AG8A 4ONE