2W4MA

The crystal structure of human n-acetylneuraminic acid phosphatase, nanp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
NLYFQSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLNEURAMINATE-9-PHOSPHATASE
publication title The Crystal Structure of Human N-Acetylneuraminic Acid Phosphatase, Nanp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 96
structure length 250
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w4mA01
2HX1A 3ZVLA 1WR8A 1CR6A 3QX7A 5AVRA 4KNWA 5ALQA 4XQ0A 2R8XA 4L6CA 3L8HA 3U26A 5AW7A 2GHQA 5AICA 1S8OA 3QLEA 5ALKA 3OCVA 2G09A 4DFDA 1TA0A 4HAIA 1T5SA 3R9KA 3B9RA 1O03A 2YMMA 4JB3A 4KYTA 2ZG6A 4YIHA 1RRCA 5ALVA 2P11A 3U13A 2WHEA 2IYEA 5AVVA 1RQLA 4BYGA 3FGOA 3WK6A 3L1UA 3N1UA 2IA5A 4CF5A 3D6JA 2FUCA 5AI9A 5AKYA 3K1ZA 3EWIA 1Q92A 5AK4A 3QU4A 3IB6A 2GMWA 2Q4TA 3U19A 4KNVA 5AM4A 1QH9A 1WZCA 2HF7A 3N8GA 4FYPA 2AMYA 4E88A 1YJ5A 4FE3A 1VFPA 1LVHA 3E84A 5ALDA 3WK5A 2CN1A 2JAWA 1XVIA 2R8EA 1JUDA 5JJBA 1N8NA 5AKGA 5AI0A 1QQ7A 1YMQA 1Z5UA 3PDWA 4QJBA 4MWOA 5ALYA 1Z5GA 2RBKA 4EZEA 2G08A 5ALZA 2B30A 3ET5A 2ZBFA 3OCUA 3L5KA 5ALGA 3OCYA 4UATA 3QUTA 3QU7A 4NWIA 2JGAA 3FPSA 5ALXA 4IFTA 3PCTA 4UAUA 4CE6A 2RB5A 3AR9A 3SF0A 1LTQA 2W4MA 4DWOA 2G1AA 4BNDB 3NALA 3VAYA 2EAUA 5A3SA 2YFYA 1O08A 4H1WA 4XE5A 4UASA 5AKXA 5FP0A 1YV9A 1RKVA 4L57A 3EF1A 3EF0A 1RLMA 4ZEXA 3KD3A 3HLTA 1L7MA 4Y2TA 3CNHA 3KBBA 3I1YA 2FDRA 3UMBA 2AGVA 1X42A 1J97A 3P96A 3RFUA 5AESA 3IJ5A 3PGVA 4C4RA 5AKJA 2PKEA 4BBJA 5AM5A 1ZRMA 3B8EA 1VJ5A 5AKZA 3QU2A 4I9FA 3N5KA 2JAUA 2YJ6A 3W5BA 5ALNA 2HSZA 2O2XA 5AK3A 5AW3A 4EX7A 2HOQA 1RMYA 5ALJA 2YJ5A 4UMFA 4CF4A 3KZXA 3AR3A 3M9LA 3MMZA 2NYVA 3R09A 5E0OA 1L6RA 1NNLA 4Y2QA 4O8CA 2HI0A 2FUEA 2OA0A 3FVVA 3L1VA 3QUQA 1Z4LA 1CQZA 1Z4NA 1L7NA 4KX5A 3W5CA 2GHTA 3AR7A 4UMVA 3ZU6A 1U7OA 5AM0A 1L8OA 3WK7A 2NO4A 3OCXA 2IOFK 1J8DA 3ZTYA 2JAOA 2YY6A 3QUCA 2I55A 5AW8A 4GXTA 1L8LA 2WF6A 5A3RA 5AVXA 1N9KA 2R8ZA 3U7GA 2B1RA 1RC8A 2FPWA 1VJRA 3L7YA 2WFAA 3S6JA 2C4NA 5AI6A 3W5AA 2ODAA 3KOOA 2G0AA 2HHLA 2I34A 1RLTA 1Z4QA 1U02A 3W5DA 3OCWA 2G07A 2HCFA 1YDFA 5AW4A 4UARA 2ZBDA 2JARA 3ZI4A 5AW0A 3DV9A 3I28A 3UMGA 3BA6A 3WKBA 2WF5A 3QUBA 2R8YA 1TJ5A 3ET4A 5AKIA 2HDOA 1RDFA 2YJ3A 5ALPA 3OCZA 3AR4A 2FPXA 5ALTA 5AVSA 3OPXA 4BX2A 5IS2A 4XOUA 4FFDA 4HGRA 5AI4A 1QQ5A 2YBDA 3I6BA 3ZX5A 3CZ4A 2RARA 4HYTA 3WK9A 5IT4A 2FI1A 3OTQA 4J03A 3KC2A 5AW5A 3FPBA 2C88A 5AKHA 3RF6A 1T9ZA 1QYIA 3MN1A 4KX3A 4AS2A 3ZVMA 1ZD3A 1EK2A 1L7OA 1Z4MA 3DDHA 2D2VA 4OFZA 1ZD4A 1Z4IA 1S2OA 1Z4KA 4UMDA 3ESQA 1U2TA 2W43A 1ZD2P 4BX0A 3L0CA 3FZQA 5AVZA 4Y2SA 3E8MA 1AQ6A 2O9JA 5AM3A 1L7PA 3MC1A 1ZJJA 5AKLA 5ALUA 1Y8AA 2FEAA 2IOFA 4EENA 4Y2JA 4OCZA 2G06A 3ZUPA 5AK5A 1RLOA 4YCMA 4UM7A 4YCNA 3QU5A 5IT0A 1MH9A 4UMEA 5A3QA 1XP5A 4EELA 3SKYA 2MSNA 4UAVA 5AM2A 2BDUA 2YJ4A 3N28A 5AIAA 4G9BA 4C4SA 4RESA 2BY4A 3SHQA 1FEZA 4CNQA 1KYTA 2B1QA 4Y2YA 2ZOSA 4OHFA 5AHXA 4HGPA 1ZS9A 3QXGA 4UU0A 2BDEA 3NAMA 3EPRA 4BEWA 3R4CA 2ZBGA 3MPOA 5ALIA 1XPJA 1RKUA 5AW6A 1Z4JA 4I9GA 3SD7A 1IWOA 1ZRNA 3AR8A 2B0CA 3WKDA 3HYCA 3QYPA 4F71A 1YS9A 1Z88A 4YH1A 3A1CA 1WVIA 1Q91A 4YIKA 3E81A 2ZXEA 5AKKA 1ZOLA 4ZEVA 4B6JA 5AVQA 1QQ6A 2X4DA 2C8KA 1ZD5A 4AS3A 1TE2A 2MU1A 2W11A 5AVTA 1RMTA 3ZVNA 3I76A 4G63A 5AI5A 3A1DA 4HGOA 4ZEWA 3ZTWA 3AR2A 5AIBA 1Z4PX 1U2SA 2I54A 4DCCA 4IG4A 4XPZA 4OD0A 5AVUA 2EATA 2QLTA 5ALLA 1RQNA 2WF8A 2G80A 1YNSA 3ZWKA 3QGMA 4Y2VA 2WM8A 3WGVA 2YMPA 1PW5A 2YMQA 2I7DA 2C8LA 4HGQA 3WGUA 3QNMA 5ALOA 4NAVA 2IOHA 2OBBA 3UMCA 3ZWDA 3SLRA 3TLMA 4BX3A 2P69A 4GIBA 1F5SA 3L8GA 4YCLA 2NO5A 4QQFA 2CFTA 4NABA 5ALRA 5AW9A 4MUMA 3WK8A 3WKAA 3M1YA 3NIWA 3NRJA 3IRUA 4BEVA 2B8JA 5AK6A 2P9JA 1NF2A 3AR5A 1U7PA 3GYGA 2RAVA 3L0YA 5AVWA 3U7FB 1SWWA 1RMQA 5ALMA 1RKQA 2CFRA 2YN4A 2VKQA 3A1EA 2CFSA 3A3YA 3WKEA 4UM5A 2GO7A 3L0BA 1NRWA 2Q4RA 3NANA 2EARA 3ED5A 3QU9A 3SMVA 4NV0A 4RETA 3UM9A 1Z4OA 3DAOA 4HGNA 2FPSA 2I33A 3U7HB 3WK4A 4YGYA 4JDPA 4BNDA 5AKEA 4J2TA 5ALHA 2OM6A 3NASA 2C9MA 3J7TA 3DNPA 3AR6A 3BWVA 2HEGA 3ZX4A 3ONNA 2FPUA 4EEKA 2Q5EA 3ZW7A 2GFHA 4PNHA 1T5TA 4Y2PA 2ZBEA 4Y2UA 2YMLA 1SU4A 2FPRA 4AP9A 3F9RA 2B8EA 1RPZA 4EX6A 5AM1A 4BKMA 4L6AA 4Y2XA 3N07A 4Y3UA 5ALWA 2OYCA 1TJ4A 3U7EB 2P27A 2WF7A 4Y2RA 5ALSA 3L8EA 1WPGA 4CF3A 4NFLA 2AUTA 5AW2A 3L8FA 5AW1A 3SKXA 2HF2A 3PGLA 2PR7A 4DW8A 3NUQA 2I6XA 5AI8A 4UW9A 3B9BA 3FM9A 5T41A 4C4TA 2HO4A 1K1EA 4KN8A 1EK1A 1SWVA 2AH5A 5ALFA 2PQ0A 3KDPA 1TJ3A 4F72A 2B82A 2WF9A 3ESRA 2QYHA 5AVYA 3WKCA 3E58A 4UU1A 5ALEA 2DQSA
chains in the Genus database with same CATH superfamily
2PWPA 3U5ZB 3FPAA 1GO2A 2VAVA 4V0ME 4NEHB 1E9FA 2H8GA 1NYTA 1O0SA 2I87A 2ZAGA 4MITA 4EBBA 2BGKA 5CURA 4NBKA 1KHHA 4RV5A 4L3VA 3AEUB 1KMQA 2BGLA 2W2MA 5EC8A 3QMMA 3U13A 4ENVA 2HU7A 3V2IA 4K2HA 3P5BA 1KTIA 1Y7IA 5AKYA 4J0JA 1ZK2A 1UPAA 3HVKA 2Z95A 4HAWA 4OMDA 3U19A 3QI7A 5DEOA 2ZRNA 3PYXA 1JQLB 4QGAA 3HKDA 4N0EA 3ZGYA 3JYHA 1MJGM 2H0AA 4KWIA 3HR4A 2N1MA 1E7SA 3LP5A 2QTCA 4IRUB 5CDSA 4WGGA 5DYYA 4B40A 3KX2A 4DOZA 4Q9AA 5J1TB 3HA7A 3R3JA 5J2TA 1X7HA 1HDZA 4K81B 1AUPA 2AOWA 1C2YA 4YI3A 3VZSA 5LIPA 2BBTA 3T35A 4CIVA 1JGTA 4R1QA 4BQRA 1SCIA 1TECE 3K0AB 4ZYVA 4FKMA 1P91A 2DUWA 3UKOA 3WLLA 4QPNA 2WIDA 3AOEC 3TOVA 2OZLA 1RVV1 2AZ4A 5G0UA 3N5CA 2NO9A 2XLMA 2NZWA 3RSHA 4EMSA 2G9RA 2WVOA 5K6AA 3K20A 3PHF2 1I2BA 3LQRA 3OTIA 1ZH0A 5FTKA 1RLTA 2H92A 1EIWA 1HTBA 4UARA 2JARA 2FJ0A 4OJMX 3S0JA 2ZYDA 4RV9A 1M1NB 1ZN8A 1ZYUA 2QMOA 2AE2A 3THRA 3O4GA 3A1TA 2YXBA 4BX9A 3IJPA 2ZROA 2PZEA 5IWAB 2QIPA 2GA0A 3PHIA 2QN8A 3L6DA 3LKVA 1YZTA 3L8CA 2C5BA 3U44B 4NEGA 4V2UA 5AW5A 2H2HA 4ER6A 2ZRPA 2CSXA 4LXYA 4KTTE 4L28A 3WB1A 1DDOA 1ZSVA 1IYZA 2W58A 3R0QA 5JNRA 1LEHA 5HJ2A 5IT0A 1JKXA 1E8NA 4NRDA 2XIJA 5KYTA 1RJWA 4GMXA 3EZ9A 2H9AA 1WW8A 4U7GA 1G6OA 5ILQA 1YCFA 4C3BA 5ELLA 3R0JA 3C8ZA 4YWQA 1XV5A 5KTMA 4MVRA 2Z08A 3EXG2 4FZVA 5FXMA 4B0OA 4MMZB 3C70A 1L4GA 4DR5B 3DJNB 4Q4AA 3ZWAA 3NU1A 3FNRA 2G7ZA 1U5AA 4H77A 2O9XA 1X87A 3VRHA 5BY2A 4FMCB 1TT5B 5JUAA 2J8WA 1K7FB 2IYRA 2PX5A 1VIMA 4X64B 1FY2A 1GZSA 5I4KA 3SYNA 3EN0A 3WLRA 3V8VA 2ZIAA 4EUHA 2ZJYA 2R85A 1KEPA 3RYFA 4RHFA 5AVWA 2X7XA 2I4IA 5EHZA 5JQGF 1JT2A 2FDCA 2BE7A 3LQYA 3DM9B 4U4AA 2GPBA 4Q7QA 3MUEA 3UT5B 1Y33E 5JRAA 4LE1A 5A5EA 1KO8A 1XWIA 5HBGA 1Q16A 2VF2A 4YJ3B 4CJGA 1QE5A 4PJJA 2QQ0A 1F38A 3EGDA 1TQGA 3PQ8A 2HTEA 1T2FA 3SY8A 3QVWA 4LRXA 4I66A 1MH1A 1JVNA 1PKEA 3Q85A 1C7EA 3QYFA 2IWHA 3OESA 5LIRA 4F72A 1RYEA 1O6GA 2P90A 1ZHXA 1ENYA 3BZBA 1EJBA 4FFOA 1CR6A 3HFJA 4ERNA 2ZSFA 5AICA 2DQYA 1UJMA 3C3XA 4KDCA 4LGCA 2YXNA 1J0AA 4QDZA 1WY7A 2PUTA 4XVRA 2IYEA 5F2OA 1A5BB 3DH0A 4LDZA 3IPLA 1UM9B 1E9AA 1J5PA 3H2VA 4XUCA 5AK4A 3IB6A 1P7VA 4LJKA 4HNAB 1E3IA 2D4UA 3PX3A 4BNIA 2FSHA 3HUDA 4JUCA 1H0RA 3ESAA 1JFSA 4FX5A 3C97A 2Q6TA 1GYRA 3DUFB 4RKWA 1G5RA 4WDRA 4FNGA 4QXRA 4CI9A 2XNSA 4ZALA 3OP4A 2IUFA 5CIWA 5FB3A 3WR5A 1A72A 3IQZA 4TWJA 4X6LA 1OU0A 2WYUA 3LI2A 3E22A 1QRRA 1J07A 5AKJA 1YKSA 2EX4A 2BGUA 3AESA 1ZEMA 5AKZA 4KR9A 1RTKA 2O3JA 1SQ6A 1G4AE 3VR4D 4ER3A 3H5LA 3QPBA 3DG9A 4LJRA 1LI7A 2PWAA 5L95A 2BMFA 3AOUA 5EEGA 4QDTA 4QBGB 2VZ0A 2D7DA 4YHHB 3T1QA 1QS0B 4OAOA 3W5CA 3RD5A 3OD5A 1RAIA 2Y0EA 2DHDA 4ND5A 1F4VA 3PRYA 5EAIA 2H8AA 4Z4GA 2F3TA 5TEWA 4G7ZF 5K8VA 2XZLA 2BBOA 3VR4A 3F1KA 4TTVA 1UJ6A 3LWZA 3RYCB 1J49A 4K6CA 1YRBA 4O0LA 4A26A 2YZ2A 5FV7A 4OBXA 5JWOA 4E03A 2ZBDA 1G291 5KU1A 4OJQA 4G7OF 4M0KA 1GZ3A 4TLDA 4HH3C 4CKZA 3UWPA 3VNUA 4Y7DA 4RK5A 2L17A 1R8SA 4JYZA 3MYRA 3QVGA 3LV8A 4N5MA 5EQDA 4B3JA 4KE8A 4R2XA 4QXAA 5FBKA 2G3VA 4P3KA 3QFSA 1TM1E 3HLZA 2PU5A 4NMWA 1E83A 4QO7A 1LS6A 2F9MA 2WE8A 1XC7A 3LJBA 4Q05A 3G59A 1T2UA 4OGWA 1QLEC 2A6PA 3JQAB 4JXKA 4JP3A 4W1SA 3N28A 3UH1A 3V5XA 2QP4A 3VA7A 4Q9JA 1PGPA 3SVZA 1THZA 3SF8B 1BHQ1 3AZQA 4U9EA 2PUWA 5DDIP 1Z3CA 1YDWA 1ANKA 1SKQA 2WMYA 3GORA 3V7WA 4ZDJA 3PHJA 3X1YA 3QKUA 2RH5A 4EW1A 2PT6A 2BCEA 4IY1A 2JFHA 1KQPA 4CMJA 2QGFA 3EC2A 1CUFA 1O87A 3KELA 4XJVA 2Y0DA 1EE2A 4Q4LA 3NETA 3MGBA 2HGZA 1LJUA 4YROA 4A5OA 2HPHA 3U40A 3N0TA 2FWAA 2P9TA 3HM9A 1LJ8A 3EZFA 2QS9A 2AX4A 3BZUA 5KVVA 3OC0A 4UHKA 1RKQA 1T5LA 1PUXA 5J58A 3ANXA 2XEDA 2X3YA 3OEHD 1VYIA 3I72A 3DCYA 2QQFA 2HSJA 4KV9A 2ID7A 1I13A 3RVYA 1I9GA 3NEYA 3O1HB 1TUIA 2B8NA 1YJAA 1GKIA 4BIMA 3TM4A 1F60A 3OSZA 3RK0A 1XAGA 3KYJB 3MJCA 1WX1A 4D8WA 2AI3A 3AGPA 1W75A 3DTVB 3PQ2A 5K5EA 4JLAA 2R62A 2EKBA 3D1VA 4FZ5A 4N18A 4Q3LA 2RGUA 3HO8A 4PLPA 2RSLA 1TDJA 1QUFA 3Q4GA 1IUNA 5JFTA 1LPBB 2XW6A 3NJRA 3VO9A 1QYWA 2YL0A 5EMHA 1OAAA 4INZA 4L6CA 1KI2A 3ZY4A 1SBQA 3I2FA 5B1AC 3L79A 1UXGA 1QTRA 4YRJA 2PMEA 5A9TA 2ATXA 4XSHA 3ZW9A 3MTBA 5ITWA 3TRKA 3NBXX 3MB8A 1D09A 1BU5A 1MV5A 3S4YA 3I9V6 3O8CA 1W34A 3U3ZA 4RZHA 4EWCA 2BF7A 3COSA 3U4IA 1Y8QB 1Z74A 3IE0A 2VRWA 4DV1B 4HEAJ 1EBUA 4RIFA 2B36A 4LXXA 2NSGA 2W7TA 1CQJA 4DQLA 4IZIA 4DJFC 2Y76A 4DZZA 2AMLA 2JIPA 1LI5A 3AI7A 1DOAA 3K6SA 5EXTA 3AFMA 3FETA 1DGQA 2JI4A 2F62A 3HJRA 2ORVA 3AI3A 3G85A 3OZRA 3M5WA 1PKXA 2IW3A 5BW8A 2EKZA 3P2YA 1NLYA 5IJWA 2DFVA 1UBHS 3OZDA 3GF4A 1RPAA 5JEDA 2PEZA 4YASA 3S7TA 1U65A 3LT0A 4IIGA 1Z22A 2GEUA 4N7MA 2LP4A 3WRYC 4ALJA 3OUUA 4PC2A 4AKSA 4N3AA 3GLGB 1EZ1A 3N0XA 3AUSA 5AHKA 3V1NA 4GP9A 2ZUCA 4EUSA 4R9NA 2GF0A 2IIPA 3Q7TA 3KYDB 1UDWA 5CEEA 4Z53A 3U56A 1TJ5A 1NR1A 1OIXA 3OCZA 1NF8A 5FTWA 4DIOA 3L0SA 4UU7A 2PUEA 4CG1A 4JZAA 2HDHA 3NO4A 3VPGA 2A30A 2X0NA 3C6XA 3FRHA 4O4LB 2BM9A 2ADFA 3TRHA 1W581 2ZGVA 1RHKA 2AKEA 4XD7D 3EMVA 2BFCB 1B7GO 1NVVQ 2H17A 2ZTHA 1MIHA 1F8XA 2X42A 1MAHA 1ZJJA 5DISB 2BTQB 3EXIB 3LHDA 1W59A 3KAJA 2YL7A 1KNQA 3FROA 2Y9PB 3R7FA 4YCNA 1MAVA 4NONA 4ZV4A 5FOSA 1H1LA 4A2CA 4B6RA 3VOSA 1MHTA 3MM4A 5EJ8A 1POXA 1Y9JA 3M0EA 1BEUB 2VJCA 4N5NA 2OO7A 3FOBA 4FQ7A 3B3QA 2ILTA 1BA3A 2XZTA 2HSEA 5EJEA 3SZ3A 1ILWA 3DB1A 4HWSA 2FX5A 1SCAA 4NCAA 1F4PA 3HV2A 3WRVA 3RWMB 4RTRA 4G0OA 2NUPA 1E6MA 1X7XA 2Q6OA 3Q5EA 3C3WA 2GTIA 2XRZA 3E70C 1HNZB 5TDHA 1P2VA 2CCYA 1O77A 1WG8A 3WAKA 1KZHA 3JSAA 2EJCA 1RSZA 1XXHE 1XYYA 5AW9A 2ISSD 3NIFB 1RU3A 2A1UB 3BE5A 2CFRA 5EINA 1RWXA 2Q41A 1E8DA 2EKLA 3PE4A 4IWNA 5KINB 4IVNA 2YRFA 3O1JC 4B3HA 4JI7B 2QRVB 1I7PA 5A6AA 3M5DA 4Z7OB 3RJ5A 2EGUA 1SIUA 2JFNA 2VT3A 4MVJH 2LXNA 1W49A 3T3OA 5L40A 1EP2B 4GMFA 1WATA 1SRQA 3HMQA 1IL0A 1P2DA 1MABA 2RHRA 3S84A 3GPBA 2J8ZA 5CIQA 5ALSA 5JD3A 1OMOA 2YV3A 1P1RA 2H7VA 3L8FA 5K3DA 1MEOA 2W22A 1HQCA 4XIJA 1Y82A 1JLLA 1ZIYA 4BS9A 4GXQA 1AXGA 1Z2CA 3EGVA 2QYHA 4RS4A 4BC0A 1QCDA 4PX2A 1GPDG 2YYSA 3MT0A 4P98A 2E6UX 4KITB 5JANA 4V24A 5FFMA 1ZGGA 5I9MA 2IE8A 5BT9A 4AX8A 3BBLA 3R9KA 3B9RA 2X14A 1L5FA 4RFSA 1QU3A 3EARA 1YIDA 1UOEA 4FMDF 3ZE2B 5E4FA 3EXEA 3DXZA 4FI3F 1OTXA 1HDEA 4IP0A 2VNIA 1Y1QA 2VBGA 3DOIA 2IITA 1MP0A 3AJRA 3C3YA 4QOJA 4XLTA 5ALDA 1P0PA 4XB1A 1DXQA 1RJFA 1YJQA 4EG6A 2V7TA 4P4LA 1VMEA 3TZ6A 3OT5A 4I1YA 2V9CA 1X92A 2OCCC 1KJ8A 3BRQA 1J39A 3QVMA 3ADDA 1IAQA 4ZEXA 4ZVRA 2LZ0A 2EFYA 3FMGA 5FFFA 2BTOA 3B9QA 3FAZA 3IE1A 1QG6A 3ZUGA 4DIUA 5AOAA 1VJ0A 3GIWA 4M1KA 3SNHA 4P36A 3DVRX 3KEFA 4XDZA 2XI4A 1KYYA 2E55A 4O4JA 3K1HA 3KKPA 4EF6A 1UADA 1G7SA 2ZR0A 2Y93A 2UVQA 2XYRA 1L6IA 1EK6A 3MT8A 1PZNA 1GGMA 1A41A 4ACAA 3OLVA 5IAKA 1Q0GA 2FSVA 3DVQX 1FQKA 3BQMB 4RGYA 4HOYA 2P6OA 1HE3A 4C87A 3KSMA 4Y9TA 4HXEB 1SMKA 3H0EA 3LTEA 4BXOB 1VGVA 2QU7A 3HCEA 1KNXA 3UK1A 1MG0A 1DLIA 5IX8A 2XLDA 1T15A 4D9GA 1TMYA 3KTFA 4Q4CA 2QXUA 2FX3A 1BWRA 3AVQA 5K6AC 3SJ7A 3AW9A 4EIWA 3ETDA 1BOOA 3QTTA 4GR9A 1SUCA 7REQB 4GBJA 2NPIA 2JBWA 1WSBA 1ZHWA 3OBBA 5BSFA 5TXGA 3TIVA 1GDDA 1X7ZA 4ERXA 4GLJA 5IF9A 1GVNB 3O8OA 2ASVA 4XUEA 5LOVB 3WSWA 4B3TB 2ZU0C 4F60A 1HK7A 3NAGA 4LWZA 1KAOA 4FYKA 5FNVA 3ZHTA 3GROA 4RK6A 4CXMA 2WM2A 3W4IA 3ZHBA 2RK4A 4MS1A 4J91A 3D7NA 3MOGA 5BNWA 3GCWA 5D6NA 1MGPA 4P7BA 1KJIA 1HT3A 5CVVA 1FTNA 4ALIA 2ICWG 4FKZA 5TIIA 1EYZA 3V4PB 4Y9SA 1WBBA 3F9CA 3H13A 2CEAA 4IV5A 2EQ5A 4DLRA 5BWLA 1DARA 5U9CA 3A9CA 3DAPA 3OTWA 3L8JA 1EM8A 4QNRA 2FG7C 2PWYA 2C2MA 3JZDA 3ZTMA 4JLVA 1X7YA 5CA1A 2XUIA 3TLMA 1D0SA 2Z9CA 3VPCA 4J2HA 5A7HA 1L5QA 4P9NA 3JY6A 1EFCA 1NJFA 3IOYA 4QDKA 4MINA 4A2PA 4IIYA 2QLBA 5AK6A 4EF4A 2P0EA 4NTZA 4N1AA 4B74A 3OWHA 2XUQA 3Q6MA 2NZUG 3EDCA 2Z8YM 1E5LA 1RJ9A 2PU7A 1IRXA 2BJWA 4MS4A 1BCRA 4O2RA 3U3OA 1IWPB 3DVLA 3O7WA 2VDRB 4I6GA 2JK1A 1G7TA 1QFXA 1N7GA 3DO5A 2OY0A 3TKLA 3ZX4A 3EIOA 2QNRA 1NDUA 2KJQA 4FCTA 2J08A 5LQUA 2A5FA 1VKOA 1GWNA 4N47A 5DFAA 3IMGA 1BDBA 1MX5A 3WIVA 1TJPB 3PCXA 4KG7A 5JH7F 5IKPA 3S29A 2WTUA 3B70A 2F9LA 5F9FA 1NBEA 3MWEB 4JTAB 2NP7A 1WQ4A 1TCBA 4WXRA 4HDOB 4D4NA 3D02A 4OV6B 4GUAA 2JZCA 1VPWA 1DHTA 1SF8A 4NR0A 1RQLA 3UC5A 2G04A 4LDJA 4WOCA 3BB3A 5JMWA 1FFXB 1YQQA 2VUTA 3IQ5A 3IP8A 3C3DA 1G9TA 2WILA 3RIYA 1RWNA 2CN1A 4PC1A 1T1IA 1VK5A 4HDCA 1R27A 4LF4B 4REQA 1KQFA 4QU9A 4F12A 2Y1GA 1VL6A 3AR9A 3L06A 2EAUA 3O93A 4EABA 3IQXA 7GPBA 4Y2TA 3ICCA 4DV4B 3L1IA 3HEMA 1VKZA 4C2UA 1CUUA 2FMTA 1H2EA 3MGKA 3F4BA 4JX8A 2R6AA 4H7PA 1ZW3A 2HV7A 1R6UA 4WADA 2CV1A 3Q3VA 1P2UA 5CB4A 3DAFA 1FFAA 4Z3DA 2QMHA 4V0RA 3IUSA 1ND5A 3MJ4A 1Z4LA 5CDFE 1N6HA 3WLKX 4OINF 1LI4A 5HOEA 1PNVA 1QAOA 2GEKA 3LKBA 1LE4A 3A9VA 4PBRA 2NM0A 2FE1A 1N9KA 1RC8A 1XA3A 3I9KA 5L51A 2G0AA 2XT0A 4JBLA 2OXEA 1X8LA 3LUFA 3LUHA 5KREA 1WDLA 2NU6A 3AH8A 4XEHA 1JBQA 3KSZO 1Q0FA 5A04A 4MVJE 4PWYA 4R9RA 4RXUA 1RLIA 1IHUA 4KXXA 2C2BA 3PLNA 4YRKA 4ZWNA 1JI0A 1S9DA 1UC4B 3D7LA 5AQEA 1SOWA 2WQZA 2Y67A 2W6QA 4KX3A 1Q5PA 5E1OA 2VL7A 4O4HB 4RZUA 1FS6A 2ZTVA 3BKWA 1GZ6A 3I61A 2W43A 4XQCA 1APCA 1SVSA 2DGJA 5I9IA 2B8TA 3T3EA 1NI4B 3FI9A 3T7TA 1WPQA 2AYZA 1QGED 1RWWA 3CT4A 2R7WA 2ZXPA 1ISMA 3VSAA 1H6BA 1SPXA 2C95A 4UOZA 5JU6A 2YLIA 4OOFA 1ORRA 4JR2A 4GEKA 4KVZA 3CTMA 3W34A 2YNMD 4JNKA 4ZQIA 4DIFA 5DX1A 2MHCA 3EDYA 1EHYA 2J9RA 2K4MA 3IOMA 1SJ9A 4YFYA 1ZD5A 5J2UF 1Y5MA 4S1TA 2P1DA 4XPZA 5CVTA 2VRCD 3VR6H 2V1XA 3LLVA 2YNMA 3H2BA 5SZHB 4Z54A 2CNWA 4MLCA 4FYXA 3CEXA 4R32A 2R44A 2H51A 5AFSA 2I4MA 2LIGA 4MRAA 4YP1A 3UN1A 4BWYA 5HK9A 4FCCA 3VDRA 4OY3A 2JHFA 4K9LA 1K0FA 3CPSA 2VRCA 4B44A 1FTSA 2IDZA 3Q11A 1W5TA 1XNHA 2WSBA 2AG6A 4HB2A 1QX3A 1CUZA 4FHEA 3OHMA 4J2TA 1XKXA 1H6AA 3OMLA 1MRZA 1AS0A 5BNIA 2WE7A 1UEIA 4GMGA 1OC4A 2H7CA 3KQPA 4KBYA 1V8DA 1AHHA 2AVKA 1YE8A 2BHLA 5HBRA 5DCUA 2GOYA 2PKWA 2CW5A 1WKCA 2DHRA 3NHKA 3LVQE 3OU7A 1H2HA 5L7WA 4K9NA 4PZDA 2GI4A 4HYYA 3FYSA 4Z0NA 2EJWA 2SKEA 3WI7A 1LJLA 2KQ9A 3CC8A 2OEXA 2HX1A 1U04A 1WR8A 1PQWA 3STWA 1YVEI 3AG2C 3SU8A 4MRPA 3TSYA 1NONA 2LCIA 2HBQA 3A26A 3LVFO 3OUZA 1XDUA 2WWTA 2ZYHA 1AO0A 2PJZA 2XMRA 2X0CA 4JTCB 3GH3A 4JE9A 1ZH6A 2QLFA 5IASA 2PIAA 3IVRA 3ORSA 3ABSB 1Y89A 1VYHA 3V34A 2KGOA 1JAFA 3E84A 2BDTA 1CY8A 3I5MA 2CL6X 2BKLA 5T7BA 1VYKA 1YR7A 2P2SA 2QU8A 4BUZA 2XOKD 4LYHA 2YYYA 3D6HA 1ZM9A 1ZUD1 5FAXA 3GI1A 1DG3A 3DEYX 5FD8A 1AGPA 1R66A 4TQAA 4UFPA 4L57A 3EF1A 2JPDA 2VC9A 2VCEA 4YDSA 2AGVA 1KAEA 5DRTA 5DNEA 1XMOB 4V3BA 1DMRA 2TMGA 3T5CA 3KUKA 2ANCA 3KJNA 4RIGA 2DJIA 3KJZA 4TL7A 4V0KA 3TVDA 2EZTA 2YJ5A 4RXMA 3WNCA 2B34A 2IUYA 2ZJOA 1P4HA 1B8VA 4XUGB 4Q3DA 3PEWA 3TQTA 4WUTA 1K68A 4Q1FA 4DSUA 1YJBA 4XDHA 5I51A 4P2BA 3FTFA 1XD2B 3B1KA 2VDWB 3RASA 1L9XA 2UUBB 2WWWA 3W6NA 4IXWA 2PTGA 4PLCA 2LFDA 3A28A 4NARA 4ITUA 2VEOA 4MEAA 1EINA 5J5AA 2JPUA 3AV0B 3TZCA 3RU2A 3JYPA 2GFIA 4A8HA 4R8LA 2A84A 3PX2A 1WY5A 3G9XA 1FJGB 4MH0R 4R5HA 4OOEA 4QODA 5JI2E 2JFQA 5L6LB 3ZDBA 1ULZA 1J7JA 3AV3A 2YBDA 1G20A 2DB3A 1YUMA 4GM0A 4RENA 4XYLA 4J03A 2WT8A 2ZKLA 3DDNA 3D8SA 2HXGA 2V4UA 4DYHA 2FUKA 4JL6A 2XYPA 2JNWA 1RZRA 4DA6A 4RIIA 3ODGA 3CSDA 1E84A 3JTMA 4IJUA 2BF4A 3W2TA 3TO5A 2OTCA 4A6EA 4E51A 1V8BA 5I47A 1OPXA 4QGHA 4G5SA 1YACA 2AA3A 1JG4A 1YTLA 4EDHA 1NUQA 1QPBA 5SY6A 3LX4A 1R4ZA 1MCZA 4JC5A 8LDHA 2QUAA 3D4OA 3P27A 3U4QB 1YCGA 3E0QA 3MWGA 1QH8B 2WZDA 5T67A 5JAUA 3K5WA 1XAIA 3JQRA 3EZYA 2EPLX 4BPMA 4R2IA 1I30A 1QYRA 5BQXA 4BUJA 4UHFA 2EW2A 1FA9A 2R7TA 2WFZA 1JEQA 2DETA 1DELA 1DAKA 4PX3A 4YQEA 2GLUA 3OT1B 4XPIA 2PXHA 3MS4A 4HQNA 4LMAA 3O3MB 1D1QA 3EW9A 5LYJF 1U9ZA 5HPYB 4B83A 4G5QA 2V65A 4D5GA 4H59A 5BWNA 1Z07A 3U7FB 1C3OA 3WWYA 3DZCA 3EDOA 2J0WA 1YB7A 4DLSA 4LPKA 1AX9A 4INOA 3WL5A 1D0XA 3ITDA 3KTOA 3LBIA 5B1DA 4DM7A 1YB4A 2QMQA 2F64A 4G67A 4G89A 1UKYA 1GG5A 1IATA 1Y8RB 1JECA 2DPYA 1M3SA 3TN7A 5B6IA 2B37A 3SM9A 1W8DA 1YRAA 3AETA 4R83A 1VKRA 4RYDA 4RGBA 4C7BA 4GC9A 5LYYA 1N2OA 5KNBD 4HTFA 1RBMA 1ZSNA 3QQ5A 4YAEA 4RJKA 3EVZA 2OHFA 3MSCA 1PNOA 3D59A 3OFKA 4FBGA 4C21A 2FYTA 1XFDA 5JS5A 3W8IA 5L4SA 1XWWA 3A3OA 4NBTA 1C8KA 4G2TA 2H7VC 5DM4A 2G09A 3LUAA 3F7TA 4XWKA 1ESMA 4OB7A 2GXUA 4X3CA 3GJ6A 3AERA 2IXAA 1V4NA 2O5RA 3AF2A 3P71T 3NG1A 5C8XA 1ADFA 4MAFA 5B3LA 4DDTA 5HZMA 2C4VA 5GOZA 3J80A 2PFGA 3JQ7A 3TR6A 3I9NA 1BS9A 1J6UA 4MRVA 3IVMA 3E53A 3IUMA 2QUJA 5D91A 5FOQA 5IKMA 3C6BA 2P79A 4NZMA 4DMGA 4QGBA 4MO2A 1FVXA 1EE9A 2YWXA 3L04A 2AKYA 3BB4A 4TV8F 4HAOA 3CISA 2JCGA 5ARCA 1D9ZA 3B6JA 1K08A 4UCWA 3IIMA 1J97A 4H2DA 3IR7A 3K66A 4ETIA 4DDUA 1CB7A 3GR6A 4KXVA 2A0WA 3M89A 1ZUHA 1PE0A 2D59A 3KOUA 1QH1A 3GRVA 4UUOA 4QPDA 3T3IA 4DXWA 2PXAA 3TOMA 3A4VA 2DWCA 5A4DA 1V48A 3DD7A 1QHYA 4ODIA 2IOFK 2W6ID 2JHCA 2AXQA 1YK1A 1WUHS 4WOPA 4EL5A 1XCBA 1LSUA 4UTPA 3LIPA 4XAQA 1S2DA 3SDBA 2FSVC 3OJLA 1YR9A 1SQSA 1HDGO 5C7YA 3SP1A 5CFZA 3EGEA 1ZCZA 2Q9CA 3B2NA 4QLOA 3DUWA 1P1IA 4HYTA 2P6MA 2W6IA 2ZBRA 3DQQA 5CG1A 1LV8A 1KPIA 4OI1A 3STYA 2WTBA 4DG9A 4E4RA 4CMBA 1SU6A 4KE6A 1P5JA 3FAPB 4N0DA 3WGYA 2J59A 1LRLA 3TBHA 1V54C 2RMKA 2IUEA 4HK4A 1I6KA 3SQXA 2Q3JA 4IX9A 1EQ2A 2BY4A 4PPGA 3TPCA 2BP7B 2E6KA 3KKLA 2ZXUA 1THTA 2F90A 1W19A 4ER7A 4DNPA 4R8MA 5LQNA 1IWOA 3T6JA 1KJWA 3E5RA 5JAMA 4NMHA 2WP8J 1HE9A 2QTNA 1YR2A 4EHIA 4RM2A 2JLUA 2HK8A 2MIIA 2YR0A 5CLIA 2VHTA 4FCWA 4OBBA 3CKMA 4I55A 4NPHA 3LPMA 3K6KA 2RHHA 4GI2A 1YE3A 3RKSA 3Q0EA 3ASNC 2ZTMA 3CF2A 2AFIA 1RI4A 2GDJA 2L6FA 3CZPA 4TUYB 1U0EA 1YS4A 1KEEA 1NQ5A 3WHPA 3J7AC 1KZ1A 5JCZA 4RPGA 3WAGA 3W9SA 4COKA 1U8XX 5IMBA 3FKJA 1CQPA 3W1EA 1XHEA 2FLVA 1DSSG 4G0HA 5J3JA 1U8AA 4C22A 3HXTA 3WQQA 4KR6A 3NYQA 1PWEA 3EDRA 1JMWA 4TXLA 4M54A 2NTNA 3QMWA 1Y3CE 3NWEA 1Q44A 2R47A 2FPRA 2H3HA 3PXXA 4Y3UA 1RWPA 3GJ8A 5JYDA 4PC3A 1CFJA 2QTGA 2GAOA 2HRCA 2VRBA 3EZNA 4K6HA 4HPWA 3GVXA 5FOVA 3PIIA 3NUQA 4FNMA 3FZGA 1VLHA 2XBLA 3NVDA 3GPIA 5F7XA 3RARA 2OKCA 1FNNA 2J5BA 4EB0A 2NZYA 1B1CA 3EJNA 4PG4A 3ZOKA 2ORWA 1GEEA 2PAFA 4F2GA 3LRTA 6NULA 1X8XA 3D6NB 5EHQA 4G9EA 3QSYA 2A4KA 5C5IA 3ROXA 3UWMA 1YI8A 1QLWA 3T12A 5AVVA 4PBTA 2V7EA 3ISJA 3FGOA 4D3SA 2YVQA 3GQVA 4JASB 4L9RA 1J56A 1IQRA 2RHJA 1CERA 3BCHA 3NRBA 4FE3A 2BYTA 1PL8A 1QX4A 4E5PA 1M0TA 5LA6F 2F43B 2NVOA 5G4KA 4IIDA 4UHCA 3JZ0A 3TLBA 2RHWA 1Z8HA 1NQTA 2YWDA 2OOKA 2PZ8A 2ZYWX 3Q8MA 3FPCA 1GSIA 4RJJA 1V16A 4BPBA 4MVJF 2B94A 2R7KA 1WD5A 2WV9A 5I7HA 4OMFG 5F7OA 1NBIA 1KH2A 3GLGE 1X42A 3OPMA 3TPZA 2SKCA 3TNFA 2EU8A 3TOCA 1VJGA 1VJ5A 4KO2S 3TI9A 1ONNA 1AE1A 3H2HA 3GZNB 1N5IA 3ZHXA 4FZRA 3DR3A 1L6RA 3Q2IA 4Z0TA 1KY3A 4NZOA 2C7RA 4B35A 1E2QA 4QBHA 2QM8A 4Y8VA 4EYGA 3DKIA 4CMCA 4YUVA 1WMEA 2DRIA 3RSQA 1PWXA 5FQNA 1QO0D 2OC9A 5CUQA 1NLXA 1H0SA 4I1RA 3RVBA 3R5KA 4DZRA 1H8HA 3H17A 1L5HA 3W5DA 3C5HA 1CF2O 2OBNA 1ZXXA 2H1HA 3OFSA 1WRBA 1L4HA 3WJAA 4OHKA 3SXMA 1C7JA 2GSWA 1OQAA 3L77A 1WNFA 1ZK1A 4L8YA 4V03A 5HE9A 4KQ9A 4FJ0A 2VPQA 2WAOA 1QO0A 3BMCB 4TMKA 3RS8A 3HL4A 4ZQBA 2B99A 1USIA 3K92A 5KU7A 4AS2A 4KU4A 2JLAA 4GPIB 4CM1A 1E3TA 1T26A 3E8MA 4GZLA 4LJ5A 4Z0PA 2EIHA 4TZKA 2Q5OA 1PWHA 2VBCA 4Q5SF 1SBHA 4LYAA 5JW6A 2ZXRA 3P9QA 3DWFA 3U3XA 4EPXA 1HKUA 1W6RA 4KQJA 3MTIA 1SD1A 3OJ0A 2GCGA 2DPMA 3EVCA 3Q98A 4BL5A 4QBTA 2IXBA 3O5AA 4AVYA 4R84A 1XJQA 2VEDA 4BVEA 1ODJA 3TCNA 1AKEA 1N4AA 5AI5A 4HGOA 2Z09A 4TGLA 4V1CA 2HUNA 1NXVA 3B6EA 2AEFA 3ZG1A 4D3YA 1UAAA 4MVUA 1T6ZA 3PC8A 3MYFA 2VOEA 4ILEA 3M5PA 2HHHB 4HBZA 4OD4A 2H3EA 3EW7A 3R5SA 4D4HA 1DOWA 2CUTA 5REQB 3U4CA 1MEJA 5H70A 1KK1A 5KYYB 4BVGA 5KNCD 3IB3A 4BEBA 1PI3A 4JEAA 1ODSA 5CEJA 4A82A 2RHDA 5EWJA 2G5PA 5K20A 2YNMC 4PQEA 1QZTA 3W2WA 3MYYA 4M0MA 2G1PA 3UK0A 3C8GD 1WZEA 3L07A 1X7WA 1ZN2A 1SH7A 4G8DA 4E5UA 3JW8A 5F5XA 2DFPA 1QUEA 5IJ0B 2R8PA 5KNCA 1FFBA 1QTIA 1XE3A 1N5DA 2X77A 1RP1A 4ACBA 3KHTA 4YJFB 2CVPA 5DN9A 1LSJA 2O6HA 3K0BA 1TW3A 4ZFNA 3CUSA 3RVOA 1T34A 3C8GA 4XW2A 5BV2P 2XB4A 4O1IA 4FR0A 4F46A 5AI8A 4NU0A 2C03A 4DTIA 4MK4A 1NMXA 3CEJA 1F2VA 4M1OA 1IBCA 4EA9A 1ONOA 2JA1A 2JGFA 4LCBA 1T9GS 5IABA 5AW7A 4XB6B 2ZSDA 4NS1A 1RM4A 4JLJA 1S8OA 1DRKA 3FF1A 3GMDA 2XLCA 2XQJA 4BDSA 3C7TA 2A9QA 2WHEA 3I05A 2FRXA 3H1TA 4MVSA 5DXFA 2BBSA 1M2EA 4EGSA 5FIUA 1O3UA 3FCEA 5A0TA 3DE1X 2VUIB 2YC2C 4Z3OA 2HBZA 3DAYA 4F4FA 3L7JA 5HQ3A 3A1FA 3DE4X 3I12A 5AI0A 2E18A 1GIAA 4HDNA 2NU7A 4BVBA 4D43A 1V11B 2CVOA 1BXKA 1Z0IA 5FP0A 4ZC1A 3KDAA 8MHTA 1I5NA 2H7BA 4R1PA 2O7QA 1NN1A 3O4FA 2VAPA 3MTGA 5DTMA 1SXJD 1HQYE 4Q03A 3PGVA 1CIVA 1HOXA 3O3NB 2PKEA 4KSCA 5BVGA 5E1BA 5BN5A 5DHSA 3DZKA 1WF6A 1SCUA 2QTRA 2KK1A 2Q0QA 5FTNA 3AEZA 1XGKA 3CMCO 2ONKA 1KO7A 1CJTC 2FZCA 3KZNA 1XLTA 1SXJA 1PWZA 1JA1A 1JE1A 3IDFA 1GQQA 1HMOA 2OSVA 4OHXA 4BKUA 2YY6A 4L95C 3OPYB 1L4FA 1Q84A 4JBHA 1TLTA 3W5AA 3KOOA 3KR9A 5HRUA 2HCFA 2V5UA 3KKBA 3KQMA 3V42A 4AJJA 2GK3A 3IPCA 3W90A 3ILSA 4CQLB 4D1YA 2Q0XA 3O4HA 4LF9B 1CUAA 3Q7IA 4M8SA 3AI1A 3FPBA 1G8XA 3VKHA 4NBSA 3CY6A 4OQZA 4YACA 3JSEO 8ATCA 1FNMA 2A33A 3CA8A 3M4XA 3ESQA 1I3KA 4HUJA 3H4IA 2QD3A 2OBYA 4ESEA 7MDHA 4PN7A 4DLPA 4WT7A 3KE8A 3GEGA 5TE9A 4RXTA 1G5FA 4M0LA 2V59A 1FPMA 4EELA 3ITFA 3GCZA 5F5NA 2C77A 3U6KA 4ER0A 1LPEA 2DF8A 2Z2IA 1YA7O 4QUIA 1PZEA 1NSFA 3LMKA 4AL4A 2HPVA 5FH9A 4IEEA 5GJBA 4NTBA 1KERA 2PMFA 1J7KA 1AGXA 2DCMA 1P2BA 5DQTA 2HA3A 4V02A 3P0RA 1YC2A 3G2OA 2GF9A 3VISA 1UJ4A 4F96A 4F4DA 2OC4A 4N6HA 2WTAA 1QZ3A 2EIKC 4ID9A 4JJGA 1OZGA 1RI1A 1Y63A 1YU6A 1GV0A 3H11B 2YMPA 4K6OA 4HDSA 3UWKA 4OJKA 1XZHA 4J07A 3VZQA 3ULKA 4NYJR 5E38A 3BL5A 5HZHA 1HEYA 4E5NA 3JPWA 4LHVA 4FS3A 4PNPA 2DTEA 2FMFA 3R40A 2CLMB 4KN9S 2GJAA 4M0DA 1ZX1A 4D2IA 3L0YA 1T5OA 5CYFA 3DDCA 2VHZA 1RABA 4MUNA 3IALA 3EG5A 1EX1A 2WTXA 1IFXA 1WUYA 3PGA1 3C63A 2Q2VA 1HFKA 1FOEB 3H2KA 2OU6A 1ZCBA 3QKWA 4P6IC 3WZMA 2BGIA 3QW1A 1A95A 5GIPE 4Y2PA 10MHA 1EK0A 4ZZ2A 4GBED 4QEKA 2EFGA 2VH5R 4CF3A 1Q7BA 3E9MA 5BN1A 3B85A 1ZUNB 3S5JA 2RGCA 1N3LA 1NAHA 2OXTA 2HMZA 2AH5A 1IK6A 4G0ZA 4OK5A 1FK8A 5KWSA 1QYDA 1FX0A 2CV0A 4RF3A 1XEFA 1K98A 3VKGA 1THGA 1XN4A 4Q3EA 2QW1A 3MELA 1ORIA 4C29A 2NPUA 1NI5A 1QTNA 3D4NA 2WWGA 5SY4A 3DLTA 5P21A 2IKQA 2QORA 2V7PA 4HN9A 1ACLA 4ZT6A 1M6YA 5IBRA 1LV7A 1ETHA 3VAAA 4QECA 4WW0A 1OY1A 3KFVA 1PR6A 3FJOA 3MBIA 5EUQB 4EI8A 1WXDA 1N8KA 1SUDA 1OU4A 4ZOLA 1XU9A 2CBZA 1JG2A 4HRAA 3NDBB 4MQ9F 1LSSA 4Q4HA 4C9BA 3QTLA 3QUTA 4OQNA 5JSUA 3HY3A 4IIJF 1DWPA 1K75A 4Q7JB 3NYWA 3JYOA 3QLVA 3FNHA 5JG7A 4EA6A 1Y6RA 3JRTA 3DL7A 1JFFA 1V2GA 2ZJAA 3GD5A 5CFMA 2LNDA 1HYQA 1U3VA 4IDQA 2IEYA 1A2QA 4RTLA 5EZ5A 4DR6B 1MC5A 3ROEA 1RYBA 4MUBA 1QE0A 2C7BA 5JVEA 3CX7A 4XGNA 2ERXA 4AKEA 5CBKA 3GDGA 3OO1A 3MTEA 1NYQA 3ZDFA 5BSWA 1XDBA 1EFDN 1A88A 3TJ5A 2FN8A 5LXTB 3N8IA 1K2VN 1G21B 4TVBA 3NDRA 3K0EA 2VNJA 4MEBA 4NX2A 1TIPA 3GXBA 5CDHA 4MR9B 4MW2A 3A36A 4QATA 3M3DA 1IWBB 1Z4QA 5AMXA 1GUYA 2HTFA 5DI3B 4EKEA 3EJ6A 2GAJA 1UMCA 2FAXA 1CF4A 1YMUA 1YAUO 2GUWA 4Y6OA 4DIDA 4AF6A 4H15A 2XL8A 5L8VA 2Q5JA 4CJXA 3M1LA 2QL6A 4KBLA 1OLSB 3LBAA 4CTOA 1SC3A 3KB8A 1CCWA 4TSKA 5JS6A 4M9UA 5DZSA 4QAQA 1SC6A 4PPNA 4NNJA 3H2JA 1QC5B 1MMNA 2IIVA 2XRMA 1VFNA 1QONA 3RQGA 4IGGA 4OIQF 2GM3A 3N75A 2R6FA 1OR3A 4FR5A 1TGVA 3VR1A 1T8YA 4DV5B 1EI7A 3BGSA 5CJ2A 1E66A 4OYRA 4R6XA 4GPZA 2W4BA 1MOZA 2X1LA 1YVRA 1P1CA 4M60A 4CJOA 3QTBA 2EGHA 4ZIRA 4U0KA 3CS3A 3E3MA 1RMVA 5DOVA 5C4MA 4NDAA 1QB8A 1C7ZA 4MKRA 3RRFA 1GL9B 1PVVA 1E86A 2P69A 2A14A 1OLXB 1EZ4A 1QB7A 4B3IA 3GNQA 3KXLA 1B15A 1QVZA 4CEIA 4RHTA 1ZUWA 4FCVA 3QOFA 4MV5A 3EVDA 4M2LA 4K87A 1DQYA 1DQZA 4LWPA 2YZMA 1PFVA 3NASA 4TLMB 4DV6B 1WXEA 2I4TA 2YWRA 5A2GA 1OF1A 3KUDA 2OPHA 3L05A 4CIWA 3IA2A 4QEDA 3TW4A 4KNYA 4UCQA 2EWMA 4KE9A 3TXAA 5GJVC 3VYTB 4C1BA 3N07A 4DBRA 2ZRDA 5CVJA 1BMFD 2H1WA 5CNMA 5IFKA 3HNPA 5B3IA 1V5IA 3VDMA 2DBRA 1T8TA 1BD3A 1W0KD 2Q4BA 2DI3A 2O4CA 3WKCA 1KI6B 4FIDA 1SUFA 3ZXUB 2OHXA 1QHHA 4DAOA 3QPDA 4M9QA 1KMCA 2R1VB 1PK8A 2PZBA 1JDVA 4FYWA 5JMOA 2BONA 4ZCSA 4W9RA 1BMFA 3GRRA 4FDTA 3TF5A 4R1TA 2J9YB 2QVLA 3UJDA 4QT0A 4U8GA 4O5AA 3SIRA 1W0KA 3QU4A 3LX6A 3VHQA 3EG9A 3W6UA 3JAWA 3WQRA 2R00A 6ADHA 1PNRA 5FOTA 2M32A 1GYQA 3N8DA 4F3KA 2LIVA 5IN4A 5MN5A 2JGIA 3ICPA 1DDGA 5CVCA 3B71A 1WMAA 4D26A 2P3SA 1Y3IA 5ALXA 2QENA 2YXDA 1WN0A 3ZHCA 1ZM2A 4M1QA 3O31A 5K8UA 4QUEA 2J9FA 2CNOA 3DNFA 3L02A 1BGVA 4MJLA 3KHUA 4GZ5A 1FW8A 2Q1UA 5LBTA 5BO5A 4MVXA 3IVXA 2HH9A 1CJCA 3E18A 3NYJA 4I1VA 4YP9A 1I1OA 1V3UA 4WK0B 3OM9A 2JL1A 5F76A 2KPOA 3C8UA 2M6KA 2UXDB 4JI5B 3TH5A 2FLKA 2FN7A 4YUWA 2JEZA 4HJRA 4RM3A 4TRNA 1CGME 1LBIA 3S9OA 2CCJA 2IH5A 1UC5B 1JDBB 4TKVA 1ISFA 3RU9A 1U1FA 3KP1A 4OXKA 1IQ0A 3UICA 1YL6A 3NEJA 2R7XA 3FOWA 1NX6A 1NNUA 3W0LB 3L7KA 1IXSB 5KKCA 3KR1A 2JVJA 4TLBA 4LOKA 4HDKB 4IB4A 3JAKA 4I9UA 2QTBA 1CQWA 3NNDA 2P9CA 3N8HA 4CLRA 4R3WA 3ZDCA 2HHJA 5L0CA 1R6AA 5TGDA 4MW6A 1K3UB 3I8SA 3AILA 4C08A 3SXYA 4D9NA 1HE4A 2HUPA 1A4IA 4E6EA 5TMBA 4URXR 2X0KA 4JT2A 2ZE8A 3SHFA 5D00A 3GA5A 1T3LA 2ZBPA 3MT9A 1CHNA 4ZV7A 3DWEX 1QP8A 4PTYA 2AQHA 2FKAA 4DRHB 2QL7A 3QENA 5FX2A 1CZHA 5GOTA 1E2XA 1Y6JA 1BMDA 2FWPA 1E6CA 2WLSA 1XB2A 1H65A 1MO3A 3I0MA 5SV2A 2RI6A 2FQWA 4YQZA 1O57A 1CDOA 3BX1A 1KHTA 2WWRA 3EA0A 3GEEA 2X2EA 3C15C 4Q9HA 4FFPA 4A03A 1GLNA 3DZ8A 4R98A 1J42A 5TT1A 1SKBA 2I7DA 3AK4A 2I6TA 2V7WA 1I5OA 2H4ZA 5T8KC 4N4AA 4ZREA 4P83A 4URWR 3PC8C 4QJIA 4UPDA 3BF7A 3GY0A 1IN5A 1O9HA 3D54D 2QRQA 5DM0A 2J67A 2YN4A 3P0HA 3PVCA 1OB2A 2HJ9A 3K70D 1PTJA 3IKJA 2P65A 2PLWA 1UK7A 4UAJA 3IFSA 3M82A 1G3UA 1JDTA 2LGJA 1US8B 1DRUA 3G2HA 1MQ8B 4L4ZA 5I9SA 2HR1A 4D25A 4IMJB 2REQB 4U2FA 2GDCA 3QKSB 4GWKA 2VP9A 1NW3A 1M2VB 2J0QA 3SEAA 4UD6A 3ERCA 1XMSA 2JGDA 4HB3A 2VTEA 1A7KA 1MB2A 3BIJA 5CYPA 4MUGA 3VPHA 4KWTA 4BNGA 2WIBA 1DJNA 4C6RA 1KO5A 1TK9A 3HN7A 2H5EA 2BTEA 3ONEA 3Q6IA 1XRPA 1N34B 3E6AA 5J1SB 1NVGA 3RABA 2XCRB 3PI6A 4ZJPA 4E0HA 2J3HA 2BVNA 4WY5A 4YIHA 4OHUA 3RGGA 5ALVA 4BNWA 1JSXA 2QAIA 1C1DB 4DNQA 3U2QA 4XI9A 3B6KA 1G5ZA 3AW8A 5CGQB 2JLRA 3TLZA 2AS0A 4KLAA 3FHOA 3A1WA 4ADSG 1V9LA 1LC0A 1TTQB 3WFIA 3F74A 4M38A 1HSOA 4MKZA 4E5DA 4Y6GB 1TCUA 5EJ4A 4UEQA 2G40A 3DL2A 3BWCA 5LDHA 2DAPA 1ZGHA 4MCAA 2GR9A 5M04A 3VC7A 2PV7A 1PAUA 5EHIA 4YJ2A 3TLEA 1RKBA 3CGWA 1TQ4A 3K3PA 3SG0A 5C81A 4L73A 5E4JA 4EK9A 2FNAA 3EWAA 3BSWA 4YL3A 4YGXB 5SYAA 4YAIA 3GRUA 1C1YA 2VCHA 3T0IA 5AVJA 2VP0A 2IYFA 1V0JA 1N0HA 3EDQA 4PZ0A 3GLHB 3V1TC 1WW3A 4G8BA 1ZHHA 2I7XA 3CHYA 3DL0A 4ND4A 4O8CA 1VBKA 3DPSA 2DPHA 2OB1A 1ZNWA 2CNWD 3F9IA 3PK0A 2QGNA 4X93A 5B2EA 4M6WB 4W4TA 5M7EA 2VHVA 2X19A 2XWJI 4C1NA 1GCAA 4WA8A 4GXTA 4KPEC 5KOYA 5EMJA 1VJRA 3MWDB 2WM3A 3ESCA 4BO8A 1XLTC 3WAJA 3BWYA 1SXJC 3H5RA 5E6RB 3RVQA 2D5RB 3BA6A 2IBSA 3LDGA 4ZI3A 3H5AA 2PLNA 3Q10A 4JELA 2FUG6 4KC0A 5G41A 3PF9A 1VM6A 1W2HA 5F98A 2Z4RA 1NP7A 2YL3A 4DWVA 4BE7B 4TTQA 5EZSA 1ENOA 3ZHYA 3SHWA 4GKVA 4P86A 1ODTC 3DKVA 4A8JA 4C78A 3QA9A 4RMHA 5E3HA 3B53X 4S1PA 2OM2A 3BGIA 2H2GA 5AHXA 3O26A 1EFLA 4RE6A 1OWPA 4TPKA 2X23A 3QE4A 3GDFA 3KQWA 5JD4A 3T5PA 5AR1A 1SNYA 5FI5A 3P9KA 3WLAA 1W30A 4WL0A 1W1UA 4N54A 3ROGA 3CZRA 4L0DA 5D8DA 4FGSA 3I2HA 2WJJA 3VTAA 2LCFA 3UZUA 3S55A 1E2HA 1G6Q1 3VJLA 1EKXA 3H99A 2OZPA 3WOVA 1T8SA 4BQFA 4L16A 3I2JA 1X14A 3IR5A 3QKRA 2IYXA 5F77A 3TGPA 1K97A 2GJ9A 3RIEA 2XLOA 5HZGA 3F6YA 4MZDA 2Q50A 3MMSA 1H4SA 1D4AA 2XOEA 4LHEA 3EEQA 2PRIA 1ZESA 4M1WA 3QU9A 1SQGA 3UUFA 5T3WA 4RJ2A 3DMDA 1AM4D 2BW0A 3COYA 2W6ZA 3K6RA 2V5AA 3T15A 5JZVA 1MB0A 3LXUX 4F85A 4NZNA 4WCFA 1WZNA 1JPUA 1MIOA 4Z0HO 3F9RA 4PAMA 4WK4B 5EXPA 2N9UA 3BXOA 2X13A 1B42A 1QP7A 4BEJA 5ESDA 4NG5A 4BTLA 1NDHA 2A1IA 4ETWA 2I4LA 1TVKA 3OJXA 4ZLCA 2WJIA 1K5GA 1GCGA 4K0RA 1GN8A 3IT2A 2YH2A 1F0KA 4FWVA 2IDJA 1XEWX 3EB9A 1BFDA 5KTTA 1OX4B 1MNAA 3K09A 3MJFA 2NTYC 2REXB 2CL0X 2FPKA 4BQEA 3LU1A 4NMXB 3TJZA 3PNSA 4I2VA 2GPTA 1Y4CA 4UBLA 1FRNA 1X77A 1JR8A 5JZ9A 4YUAA 4B71A 3TINA 3W04A 4E70A 5EKXA 4YJGB 2GM9A 2Z56A 1BN7A 1PZXA 1YFKA 3AF0A 3QE3A 1RZRD 3DOOA 2O59A 5I9BA 5BQHA 2DX7A 4DY6A 4LG1A 2IYOA 3PDWA 1DT3A 2JGKA 2BFAA 3F98A 4MWEA 3BTOA 1DLJA 4P3XA 2NAFA 4C6HA 3GOQA 2AE1A 2H2WA 2XKAA 4GZ6A 4HGYA 1E77A 4OKIA 4DJAA 1EB8A 1NFRA 1YR8A 1PJLA 5CNJA 3JD4A 4KI7A 4KHPB 1M76A 3DKRA 2A7QA 5JSZB 1BX0A 4KBGA 2FLWA 4CFZA 2WUWE 4N82A 4P80A 2XXAB 1M34A 2I2BA 3EGOA 5EIEA 3LUJA 3KYCB 1F3LA 2WDZA 1GDTA 1FF9A 4M0EA 3QLVC 5T3YA 1S7GA 1TIKA 4BNJA 4X97A 4XTRA 5AQ1A 4B4DA 3SXUB 4KGDA 5C51B 3ZQUA 4YV1A 4CM6A 4JKVA 4Y6PA 3OETA 3IEXA 4LXGA 4QYIB 3X3HA 5HMLA 1KETA 5BRNA 1GY8A 2OYRA 4GX0A 3DZFA 4G8CA 3MAJA 3DQPA 4WOKA 3VZCA 4DCJA 1AQLA 2OXFA 1TUBB 2RK6A 4JQYA 1XCOA 2KLBA 4IAQA 4MRRA 5EJ5A 4A36A 5IN5A 1PFQA 1E2UA 2G07A 1YDFA 1BHO1 5EXDA 3UWOA 3HSYA 3SOPA 2J4FA 2XLBA 4HC4A 4YK7A 2WRZA 3DONA 2OYSA 4JC8A 2CE7A 5KYXA 3H1GA 1U98A 4PN3A 2W6OA 5D5QA 4LLEA 4DDHA 3RVMA 4PCLA 1J9ZA 3BIXA 4R0VA 2HFJA 2E37A 3M5CA 3SQDA 4KSBA 5A3JA 1W4ZA 1K6XA 5C1IA 1GILA 1XPOA 1DZ3A 1QYIA 1VHQA 3SC2A 3OIGA 4UM9B 2ID8A 1E7MA 5K8TA 4J7UA 3DULA 4K3VA 5DBFA 2A2ZA 1A8QA 4Q3BA 5AK5A 3TW8B 1HURA 1S2GA 1P1HA 4F4BA 5DNVA 1E3WA 2NU8B 3MBKA 1XNQB 1PX2A 3RYIB 4C4SA 2FZEA 3ZDYB 4QOIA 2PUGA 2YHIB 3GD7A 2Y39A 3FE2A 4LVCA 1BXZA 5JNSA 1Y9AA 3R4CA 2W42A 2HFIA 4FN5A 2CZQA 2FSSA 1YQTA 1EVEA 3T52A 1QGZA 1JR3E 2WZFA 1T4CA 4AIIA 2BJHA 3CLKA 2I8AA 3ZNNA 1UIMA 1SRRA 4BATA 1S9HA 3M6AA 3V3KA 1NJGA 3MLAA 5AVTA 3NBMA 4X0EA 3F73A 3Q0TA 1FP4B 1T9HA 3P8ZA 5AVUA 4DCCA 3U7QA 4D4KA 4CGYA 1RHMA 2FOIA 1FAPB 4OEHA 2AOTB 3VNBA 2C4KA 4JUDX 1Y3BE 5JV5A 3D4IA 1R5ID 3PTZA 4LOHA 3T7CA 4MV1A 2JIDA 2A9FA 4MVYA 3F97A 4UTOA 3HJTA 1CJUC 5IPFA 5K0LA 1C4WA 1N2GA 3KLMX 1ORWA 5BOVA 2ZREA 1XZFA 4U3JB 4A3SA 3A1EA 2E4ZA 5J23A 1P4JA 2DR0A 4RZ2A 1R4AA 1EX7A 1ZMOA 2YW9A 4U7TB 1MQ9A 4BNDA 2FSPA 3JWJA 1W48A 3OJFA 4JXXA 1PJ4A 3GN1A 1N0IA 2Y6UA 4XJSA 2KYRA 1TQHA 4FFVA 1NGSA 1RQGA 1H85A 1ULAA 1II8A 3UWSA 5CX1A 4RZ3A 4TWZA 1M0EA 4MHSA 4E6PA 1FS5A 3TRIA 4WBNB 4WJLA 2WVGA 1CUEA 2BI8A 5J63A 4KNWA 2R8XA 3D6MA 2E2WA 2FWJA 1TA0A 2FRDA 4UNPA 4FYVA 2ZRJA 4UE3S 3ELDA 1M6TA 1YBVA 2Q3MA 1UC8A 4F6RB 3HI4A 3A58B 1WDTA 4OP3A 2Q9UA 4D57A 2FE4A 3T0FA 5C37A 1UJNA 3HLKA 2QMEA 2WBLC 3EWNA 4A4DA 1SC1A 1SCNE 4Q4JB 4CUJA 3OY7A 3B36A 2TS1A 4JH0A 1T9AA 1VP3A 1OAOA 4RZQA 2DWPA 2ZUDA 3DOEA 2EZ9A 2W0MA 6CHYA 3I04A 5JRJA 5FOUA 5CYOA 3C87A 5FWDA 2R00C 1IPHA 2HMYB 2OCLA 4TM8A 3GBPA 2R6HA 2FHSA 6REQA 2F8SA 1LKXA 1KP2A 2PZMA 2R6CA 1T6XA 1L1RA 3H7IA 3DFKA 1XQVA 3W3AH 4PSVA 3IQHX 2PQMA 2VK1A 3CNLA 2HSZA 4MGZR 3RM3A 2MR5A 2DSTA 3TLGB 4J9UE 3UJBA 2IOYA 4A2WA 2FWMX 1YI1A 3U31A 1JRLA 4GYWA 2OA0A 1DWQA 3L1VA 2XMGA 1L4LA 1E7RA 3CR8A 4BFVA 5HA5A 1FSSA 1FC0A 4DVGA 3DR5A 3C7JA 3U37A 4TKLA 2JJQA 1L8LA 3DXXA 3Q3CA 2C5LA 4K9DA 4OD5A 3WGZA 4EQ6B 1JLKA 2J45A 2VJLA 4PZUA 2R4UA 2HJWA 4BGEA 1S1CA 3OLWA 1G4WR 3PQEA 1ECGA 4DA0A 2YJ3A 3M1AA 5ALPA 2CJFA 1JWBB 1ZN7A 4NENA 1QQ5A 1HEUA 3HWWA 3HJAA 1ZWLA 5LZ4A 1ZFNA 1NR5A 1E4VA 4ON9A 1VGRA 3QRWA 1YOVB 2H1SA 4KHZA 5KC8A 5KX5A 3M4JA 2CHQA 2QUZA 4HYEA 2EZ4A 3AP1A 1EVIA 3BH7A 3UMFA 2HIAA 3RDPA 4AJ9A 2AUMA 1Y5RA 2XYVA 3FPHA 4EENA 3U3BA 1JEYB 1T0PA 5L3SB 1GTG1 3H4VA 2QP9X 1SQFA 3GT7A 1P2SA 3CMMA 2ZWAA 3GHYA 4CMIB 2ZS8A 4X1KA 2AWYA 4L9WA 3V7FA 4UU0A 1RE1A 1CP3A 1TKCA 1JQBA 3WYGA 4LZOA 4X92A 3PC7A 2P3LA 1W25A 1U63A 4CDGA 4QYTA 4ZD6A 2GAFA 3H9QA 3RUAA 2I7CA 2RC6A 2FJUA 3NHYA 4X71A 1IEVA 1R4TA 1D07A 1UBSB 2F3RA 1L7BA 2DY0A 2QJTA 3SFVA 3AUUA 2VIIA 1DUVG 2L82A 4XPWA 1OWLA 2BELA 3DDUA 5IYZF 1Q0DA 1ZJ5A 1GG9A 5C31A 2D0PB 2P0AA 4D0LB 4GNKA 3E9QA 2QN7A 1BW9A 3KR0A 3HKDB 4NK5A 2C5AA 3L1MA 4AN1A 2B0HA 4Z7NB 3BTUA 4D9KA 4E13A 1JEDA 2ZB3A 2IBMA 3E3LA 2PL9A 3CGGA 4B48A 4KFCA 4YB8A 2I2XB 4QDJA 2Z4TA 4Q37A 1NVUQ 4X91A 4NV0A 3B3GA 4CS7A 1E1LA 2NSDA 1ACMA 1RXCA 1ZGCA 3SDSA 4CMKA 1MMAA 3M6VA 4NBRA 3EZGA 1HQKA 2GCPA 1PTJC 1IOVA 4RKRA 3UXYA 1CIJA 4JJAA 4KRXA 1N6RA 4NYMR 3GPDG 5TARA 1C29B 4WBSA 4AJEA 4K1OA 5KB3A 3I5UA 4PFSA 1C41A 4UW9A 1UXKA 2HO4A 2OZLB 1H8HD 2R7VA 3AIMA 3PYLA 2P2NA 1E32A 2RG1A 3K70C 4ZJZA 3EEIA 2ZT7A 2OHHA 1KOFA 3GFRA 3MNFA 2XADA 5DS5A 4B2PA 1N2JA 1FYFA 4LOIA 2NUTA 4B2LA 5L45A 2ZJ2A 5D1NA 4B4OA 1UKAA 2OHJA 4BAGA 2ZJ8A 3N1UA 4BFXA 4Q1EA 4B81A 4WNAA 3GA7A 4RJIA 3NHLA 4RD2A 4OM8A 4BMVA 2A7XA 2EERA 1G9XA 1WNTA 1J2YA 2GBPA 2VAXA 1RQ7A 3KQSA 1RXYA 4G86A 1X9GA 2VJYA 3U2MA 1R0XA 5C1BA 3K0FA 1O5IA 1JJBA 4FGZA 2G1AA 1OBHA 4F21A 1G21E 1CC1S 2O7RA 1GAJA 1C7FA 3HXQA 1QANA 1D4FA 2P5SA 3CN7A 4LK3A 4MAMA 2RGGA 2QSUA 2O8DA 4BVKA 2ZRCA 4J0GA 2RK3A 3DJYA 2O4UX 2PKQP 3GLFA 1NVTA 1P4GA 1GA6A 4MA0A 2P1RA 2EV9A 5TEVA 2PH3A 4BMXA 3OKCA 2NNLD 4WASA 1REQA 3V7NA 1IPFA 4LJAA 3MCUA 4OHRA 5ADWA 1Z7YA 1KDTA 4Q4AB 4E18A 5B4TA 3ZHSA 4MWTA 3KKMA 4AZTA 1QMGA 1Y5LA 1FMTA 4ZOBA 2R65A 1V41E 2BR5A 3EQ2A 3ZY5A 5T8KA 3F3SA 4G24A 2HLDA 1I32A 2GRJA 3CW2A 1QRAA 3DMYA 4LI0A 5AW0A 5H80A 2IZOA 4OSOA 2H16A 4OJTA 1ORYA 4Y9DA 5FORA 3PR3A 3OVMA 2IX3A 1AUEA 3RYFB 2PH5A 3ABZA 4MPTA 2P2GA 4HBGA 5EN4A 1OE0A 1R3DA 5CDGA 1XMVA 1Y6GA 3GZTB 4RMGA 4KAAA 3D7KA 4BP1A 3OCJA 1WMSA 3W8RA 4CG2A 2Q6VA 1KSGA 4E2XA 1XD8A 3B13B 1ZD2P 3ZEAA 5DHTA 5F1YA 3DQZA 5CAEA 3LBNA 3VC1A 3EGDB 2ZSJA 3W2FA 4WQMA 2J0EA 1RLOA 1FVOA 2XWQA 1MH9A 1VPVA 4RVGA 3Q1KA 3K7DA 3REFA 2XODA 3FWHA 2MCFA 1FMWA 3N8NA 4R01A 3ZZ0A 3C4JA 2ZIFA 3UR3C 4GF5A 3EPRA 1T13A 5HG0A 2WMOB 4A8JC 1WXFA 2ZAYA 3PDUA 3CZMA 2LE0A 5L0FA 1FXWA 3MUNA 3OPVA 4RV4A 2RI1A 1TC1A 2H29A 3A6JA 1DFIA 1KP9A 3ZCPA 4KFTA 1QE3A 1MOQA 3BEHA 2IBFA 1YA6A 5A2QA 2OZEA 4RORA 4KC9A 1RRGA 1FFGA 2WKQA 1E5DA 2MSLA 2BHNA 2QHXA 3DT6A 3Q2OA 4R54A 2C20A 1T2NA 1ADJA 1K9VF 1UZAA 1I1HA 1EFUA 2QMZA 2G88A 3LIIA 4AROA 3H5OA 3NANA 4MR8A 3LEOA 1BVYF 2Z1MA 1MX3A 3KZMA 3QITA 3BMOA 2GRUA 2BEKA 4EY4A 3E22B 3ZWNA 4FOSA 2JAQA 2WG0A 1RWOA 4M21A 4K1LA 3AESB 1B6GA 1E7WA 4J7CA 3CBQA 5HFAA 1J0BA 3IIKA 4US0R 4UNQA 2GCOB 4EKYA 2AWCA 4U2EA 1FFCA 2N75A 3WY9A 5BV8A 1U0TA 2WF7A 4E5VA 5FKJA 1T25A 5B3JA 3A37A 3EYWA 3LT4A 1XTSA 5AW2A 2D74A 1UOPA 1ECFA 4WCFC 1FDOA 2AG5A 4MMYB 2WLTA 1X80A 3RNLA 5EESA 4JCZA 4XARA 2ORED 5ALQA 4ZVUA 2EHDA 5KOHA 1A3CA 2R7MA 3LPNA 5E7IA 2QG9A 1Z28A 4G0WA 2OFPA 1GPNA 5T4FA 1EX6A 1FP1D 2NQ8A 4H0CA 3FNEA 3AHHA 1L5RA 1JB1A 4UJ3A 2L0XA 1V7ZA 1KMMA 4H35A 1KC3A 2VHCA 1U2RA 3K09C 1MMGA 4RELA 2XQIA 4LJ8A 1QHNA 1PO7A 1QH9A 4E88A 3LC2O 1VFPA 3M3HA 5HFNA 5B7GA 3QVGB 1NL3A 3VU1A 4C4ZA 3OSUA 3LVRE 1U1GA 3K0HA 4QJBA 2I1LA 2Q7DA 5JROA 5ITVA 4YJ3F 1QG0A 3CPEA 1M2KA 4QYWA 3EFOB 4HH1A 2PFKA 4E0BA 3EBLA 5HM8A 2ZS7A 3DEAA 5CB0A 4AF8A 4XE5A 1LDGA 4OMUA 3DE3X 1FYWA 2R7UA 1SK9A 1FTQA 3R5TA 1YONA 1YZQA 3OIDA 4HMQA 4XR4A 2OECA 4U63A 4TLCA 2IV2X 5B58T 4IWXA 1JAHA 4CETA 2FMXA 3BCSA 1R2QA 2OT3B 2W2KA 2FZVA 4MULA 2O2JA 1YNOA 4F4IA 1FS4A 3BRWD 1JV2B 1PS8A 4CN8A 3O1LA 3DVAB 5FWXB 2C94A 1JIKA 3GGPA 1LS1A 1J9EA 2OGSA 2BD0A 4DDWA 3MB5A 4R7GA 4ANJA 2GN8A 3C45A 2BEWA 3JYYA 2PL5A 3R0VA 5L0DA 3EASA 4ZT7A 5TV2A 3BRWA 3DV9A 1P7WA 3KEQA 3NC4A 4OQQA 2HDOA 4WKOA 4HD8A 3GLTA 4P0TA 5JHGB 3QE0A 4BASA 4XOUA 2XF2A 3ZNQA 1GGJA 2C2HA 4TVOA 2HIGA 4HF7A 3HNJA 1DC6A 2HSWA 2V7XA 1R0CA 1FJHA 5ER6A 2EQBA 3QVLA 2OAEA 2XGSA 1KS2A 1OI3A 3KXKA 2O8BB 3N0RA 3WYNA 2HZBA 4YRQA 2ECOA 2R1ZA 4N01A 3K05A 1KWKA 1ZK4A 1QR6A 5FO1A 1P0IA 4U5GA 3WYCA 5CH3A 4M4SA 4U2KA 3RVSA 4F8YA 3PFNA 2YJ4A 4L8VA 5IAOA 1UXOA 4OATA 2XNHA 5IVIA 1FEZA 1E2LA 3LUCA 4RNDB 3WTBA 3LUTB 3FYCA 4JT9A 1SHJA 3THOA 2JVKA 5F7ZA 2E9SA 3VPDA 2FF7A 3A1CA 2HSGA 4D4GA 3JQ6A 3ED1A 4GXNA 5BQOA 4ILKA 2IEZA 1J8FA 1CETA 3I76A 3NIGB 3L4JA 4ZEWA 3JVUA 4A9AA 1AK9A 5ANRB 4RD3A 1FBTA 4JL8A 3SZLA 1H22A 2FR0A 4GO1A 4X44A 1NBOA 4QU0A 4KVGA 5JT1A 1OXVA 4FGLA 2NTJA 1F5SA 4YAFA 2OPBA 4QTXA 1PSZA 5IFLA 4N4WA 3FX2A 1E0DA 3V1KA 1W85A 3RSCA 3JCUQ 1XTVA 1FJ2A 3N2LA 2IEDA 3TVTA 4N0MA 4O2LA 2VH2A 4X7PA 2LD4A 4MLZA 4CIPA 5B1HA 3VHXA 1NN5A 1NVWQ 4J3NA 3UNXA 1K06A 2FEMA 3R3SA 1FE8A 1CQJB 3F78A 5GONA 1IN1A 4DLTA 1U3FA 4I4TB 3P5SA 4QDXA 2H00A 3TSWA 3K6SB 3B1FA 4I46A 3AJMA 3MS7A 4JQOA 3KRTA 5DVWA 2LD6A 1SURA 5I8PA 2WPNA 2RIRA 1FXSA 3F0TA 4HCJA 2DPLA 4JLSA 4F5ZA 3SKXA 3FSGD 3UJ3X 3G0OA 3FWZA 4LRWA 1CVLA 2A6EF 5HQTA 4UQPA 5D2CA 5FCLA 3ZLTA 4JC7A 3FYDA 3L8HA 2J3JA 3ZV7A 4DABA 4NOLA 3L0DA 4JB2A 5CXUA 2Z04A 1OBFO 3FSGA 3ENZA 3D6JA 1TI7A 3VBEA 4E33A 3S1AA 5AM4A 1CXZA 2FRDC 1CRQA 2B78A 5DM1A 1GPH1 3CINA 3DE9A 2JCBA 3UTDA 1OW8A 1VTMP 2Z3WA 1LPNA 1TOAA 3QU7A 3DVSX 3QMKA 3UMIA 5K3EA 4JJ8A 2AF4C 3QX8A 3P9CA 4P9TA 1JXOA 3FPJA 1OAOC 4GI5A 1XBTA 3V4FA 2BI7A 3LPCA 4YMIA 4N9WA 1FRZA 5CT6A 4NCBA 1B0UA 4YMWA 1XKLA 3WXMA 1D03A 1PJ3A 4EMUA 3GDHA 3BFVA 3GB9A 2BZSA 2OP1A 2YJ6A 2ZM6B 3DBOB 3EXAA 2V7BA 4REOA 3HH8A 2I66A 4RKYA 3A9TA 2O2CA 4MGHA 4KAXA 3AY3A 2UAGA 1XZEA 2OOSA 4QICA 5COGA 2YDXA 2Z6AA 2WT9A 1TKNA 1J0DA 1XDWA 1L7QA 1OV6A 1T1EA 1X7XB 1BMQA 2QSZA 4ZTZB 1YSCA 4MQEA 1XU7A 1AMUA 1K92A 3I2IA 3A4IA 2IYAA 3MRVA 2P68A 3AINA 3IHUA 4P34A 2W8BA 3LUKA 5H4HA 1XDZA 4D82A 3FGZA 3KUCA 4NAUA 1N3YA 2BFEA 4P3PA 3ZJYA 1NATA 3RSGA 4RJTA 2OK7A 2CXUA 4UULA 4AWBA 5HM6A 4LXUA 4NU5A 2WJGA 2F6RA 1QRSA 1BVHA 2IXEA 4CM7A 3HHPA 4C0LA 1PJQA 3DFZA 4U5XA 1P44A 1U7WA 2FU5C 1IUOA 2HHAA 4LTNA 4DR1B 1RYNA 2QVZX 4BE9A 1FMVA 2G17A 3HA5A 1MABB 2R05A 5C7LO 1CV2A 3UB3A 3P7MA 4J6FA 1AB5A 2DMRA 1JLLB 5FUBA 3LBHA 3VNVA 5IT5A 3TE7A 2I1WA 3H1FA 2XWBF 4N41A 4D9MA 1EFAA 4MQLA 3ONDA 3QKTA 3N39C 2PA3A 3E81A 4TZ6A 2LIPA 2P1AA 1UBNA 4U2DA 5EGSA 1C80A 1XEXB 3OQ6A 1JH9A 3EXEB 3NH9A 3HFRA 1AMOA 4WGYA 2XJ4A 1YB1A 1IOWA 3A4LA 3C3PA 3OCCA 5JAOA 2ETVA 4O4LF 1Z25A 2HA0A 2A0KA 3ZQ6A 3UFXB 3F7NA 4ENSA 3CUWA 4IIEA 5AH0A 5IDVA 1MENA 4X8LA 1SN7A 3E5NA 1F2TA 4D6PA 1X74A 4RA6A 4JLMA 4X9XA 1ZC3A 3CCBA 4DC9A 2HMUA 1TA4A 2P0NA 1P8AA 3NMJA 2ZT8A 2HQSA 3Q9NA 2ZXOA 3P9RA 4ABTA 3UCFA 4X1OA 4NBWA 3AIOA 5ICFA 3FB4A 3JQ8A 2ZWIA 5HUHA 3EVAA 3TAHA 5DBIA 3FOCA 4TV9A 1E3LA 3CH7A 1A9SA 3ROFA 2O1SA 1G8PA 5DM70 1B1AA 4DR4B 1CZUA 2YHBA 4JZKA 1I9CA 3K8YA 1G8GA 3HRIA 1G4US 2XXBA 3MPUA 1ECPA 3LO5A 3HTXA 4TS3A 2QRJA 3GFSA 3LLKA 4LDRA 1EH5A 5EE0A 1Y4ZA 5IJXA 2VATA 1CUXA 1U8UA 2H1OA 4ARZA 1NP6A 4EIYA 1MTZA 1FSZA 3EZ6A 2FOXA 3L8DA 1A9ZA 4G5YA 1CB0A 1FMFA 1U9IA 2PMBA 3BXPA 1EWQA 1Z2NX 1B4DA 3NP9A 2CUZA 4FYPA 5LBUA 3DDWA 3ZHZA 4MKIA 4EJSA 4WH0A 1JR2A 3FYTA 2NX2A 4HR7A 4MUAA 3W79A 4ZOQI 4I3GA 3SS9X 4DSOA 4L51A 3G9UA 2W2OA 3AVPA 4DC0A 1PG5A 3CRW1 2WZLA 4F56A 5IG2A 5I9LA 1PWYE 1V3TA 4FJ2A 2PVPA 4KE7A 3VZDA 2Z58A 3AG3C 3KT8A 3OAAA 1X7ZB 3LCJA 2CYCA 1TK3A 2ST1A 3O8OB 1RLMA 1CSEE 1DJOA 3EF3A 3D4PA 3N2ZB 1OXSC 3B51X 2P8SA 3LD9A 4BRSA 3OJEA 1KJQA 4W99A 4EY7A 1Q0RA 3CEMA 2C7PA 3D0QA 4H0FA 1X1TA 3HNIA 3PVSA 1YL7A 1UXJA 3ON5A 4NBVA 3TGWA 1VL0A 4LKOA 4ABYA 3RUIA 5E2QA 2XUGA 4B84A 3AM4A 1HYGA 4ISCA 2OESA 2PY6A 1MT0A 4KOAA 3V7YA 2Z57A 2R8ZA 1X7YB 5CA1B 4FOPA 4CCYA 4LZNA 2WFAA 2WNSA 4QSMA 3N7AA 2WFLA 3RJ9A 3ZI4A 3D8TA 3QXHA 3O8RA 1AOXA 5U4QA 2E3JA 3SLGA 3R0XA 1XCMA 3EMBA 3AG5A 4XYMA 2LTAA 4MNTA 3F96A 3G5UA 4EYEA 2EVWX 1ADBA 2X2FA 2PE5A 2ID9A 2PQ6A 1B41A 1BCRB 4YS6A 2G62A 2F1HA 5EIWA 2UXBB 1GT91 3R6WA 1JAYA 2Z6UA 2IYWA 4D81A 4KPUA 4DYDA 5J40A 4O6MA 3WNQA 5AKLA 1J25A 1FRVA 1G2PA 2IU4A 3L6EA 5H02A 2UYGA 2I6SA 2FSUA 1QIKA 1TB4A 3LESA 2Z2JA 2BKAA 3HL0A 5KKNB 4D0RA 1X3LA 2D8AA 2QGZA 1NW9B 1XDSA 4C3OB 3SVTA 4HEA6 1RHJA 1NW4A 4UEJA 3SHTA 1X9IA 3SD7A 2VR1A 2ON6A 4F71A 4D3XA 2FV8A 3R7LA 3EIUA 3ZWBA 4PZYA 2VZEA 2NVWA 2PJUA 2GZHA 5KS2A 3UV3A 5TQVA 5JAZA 3BHJA 2D00A 4A5SA 4YRBA 1Z7WA 4KJZA 4W7IA 3B1WA 4JN6B 4IYJA 3K8QA 1FU8A 3AU8A 4DV2B 1OZFA 2E1RA 4JKIA 4KUEA 4JI3B 4P5EA 3L3BA 2HYDA 4REQB 3BF8A 1H42A 1GAWA 3NTXA 1OC2A 1LK5A 2EW1A 1QAQA 2L81A 1GS9A 4CIBA 3LY5A 2BFFB 1FFYA 5EJGA 3QXXA 4P3YA 2DH5A 3TNDA 2GN1A 3IP9A 5EQJB 2ZRAA 4KRGA 4F8JA 2G3KA 3FVYA 3QVVA 1OFTA 3DMHA 16PKA 2WYWA 1TTPB 3QVTA 1ISHA 4K8OA 4BLPA 4DCTA 1PT8A 1TJNA 2QJRA 4B76A 1U0OC 3WTCA 1PQUA 5ITZA 3FOFC 2AUTA 2ODNA 3JQFA 1AVOB 1TZJA 3DZDA 4OI2A 3VHLB 3DO6A 3H83A 3NDPA 4PZEA 3ZOZA 1NPYA 3WP0A 2YKGA 1ZZGA 4ND8A 4AMVA 3X2SA 5B3JC 2JKZA 2JH8A 4DLKA 4MI6A 5BQIA 1Z45A 2YVKA 1Q7CA 4YRNA 3CNEA 1C1XB 3SQLA 2GLTA 2I2DA 3BQNB 5LZ2A 3R7WB 4Z4EA 2NU6B 3HGMA 3I9V1 3KKKA 4MWZA 4QUGA 4TWBA 3ADPA 1WHSB 4RGVA 1Z26A 3N8GA 4AZVA 1YS1X 1BCSA 5ICCA 3F8WA 1PQYA 4A8TA 5E2IA 3LC0A 4CHGA 2VA8A 1GQ2A 3ET5A 2F59A 1P0FA 4ZOAA 3P0IA 4FYJA 1P6QA 3EBOA 3CV3A 4UTZA 2PQ2A 2O7VA 2H1IA 4GOND 2L6GA 2R6DA 1HNXB 4DRYA 3PQ4A 3ECAA 1NZJA 3RFUA 2GN4A 2C4WA 4G6ZA 4EY8A 5D3MB 2WAYA 1TT7A 1C9NA 1YDGA 3OE5A 3PWKA 4CM8B 1OJLA 2QN6A 1XZJA 4KH1A 3P0FA 5BV1A 5FUVA 1VOTA 1PDWA 4R8RA 5JO9A 1E7QA 4RACA 1OROA 3CT6A 1Z4NA 3PFBA 1XHFA 4X20B 4AJOA 1B8NA 2EF0A 3OCXA 3AWIA 3L6BA 1YCHA 5GQSA 2ESRA 2VH1A 5FI3A 4OLBA 4BWVA 4INJA 7ABPA 4Q7MB 4R0NA 4XVUA 2BAGA 3O2QB 2ENWA 3LYLA 1M6VB 3F6SA 5ISMA 4H60A 5C8ZA 3WGNA 2BR3A 1FFHA 3EEBA 5DS4A 2VLBA 4H16A 5F4ZA 1KFBB 3ZX5A 2Q00A 3FMIA 2QL5A 2EFDB 4RVOA 1R9GA 4NPCA 3GWGA 1EUZA 1GPBA 1YZFA 4J1TA 5DYIA 1B6TA 1ZJ4A 5C7IO