2W4MA

The crystal structure of human n-acetylneuraminic acid phosphatase, nanp
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
250
structure length
250
Chain Sequence
NLYFQSMGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLLLLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACYLNEURAMINATE-9-PHOSPHATASE
publication title The Crystal Structure of Human N-Acetylneuraminic Acid Phosphatase, Nanp
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 96
structure length 250
sequence length 250
ec nomenclature ec 3.1.3.29: N-acylneuraminate-9-phosphatase.
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.710 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2w4mA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w4mA01
1RMTA 4UMEA 5AKEA 2JARA 2C8LA 4OCZA 2CFRA 3W5BA 3PDWA 3NRJA 4KN8A 4CF4A 3NIWA 1RDFA 3E84A 5IT4A 3N07A 5A3SA 3EPRA 3KZXA 3SF0A 2X4DA 2I6XA 3QGMA 5AKLA 2G08A 4KYTA 3L8EA 1ZOLA 4YIKA 3RFUA 4YIHA 2B8EA 4UATA 2GFHA 2PQ0A 3MN1A 5ALJA 1ZRNA 3I28A 3L0BA 2O2XA 3W5CA 5AVUA 1CQZA 3W5DA 1RLMA 2HHLA 2G0AA 1WPGA 5ALWA 2R8XA 2DQSA 5ALOA 4IFTA 3OCVA 3UM9A 2FI1A 4QQFA 3VAYA 2AUTA 4AS2A 4XOUA 1Z5GA 2WF8A 4L6AA 2JAOA 2B8JA 5ALHA 1RLOA 2PR7A 4J03A 3WK4A 2ZOSA 5ALZA 2EARA 3ZX4A 3A1DA 5ALNA 4CE6A 4HAIA 3ZWDA 3L8FA 2ZBEA 5AW2A 1YJ5A 1Z4LA 1L7OA 2I33A 3J7TA 3RF6A 2ODAA 4UASA 2BDUA 4HGRA 2I55A 5AIBA 3U19A 2YJ6A 1YV9A 4Y2YA 4E88A 2YFYA 5AVSA 3L8HA 4EENA 2HO4A 4ZEWA 3WK7A 5AM2A 3L1UA 2R8EA 3ZUPA 3N1UA 2W4MA 2ZBDA 5E0OA 1EK1A 4I9FA 2EATA 5AM5A 5AVWA 2B1RA 3L1VA 3WKBA 3ZTYA 3IJ5A 3B8EA 5JJBA 3MC1A 2B82A 3SLRA 2IYEA 3EF0A 3MPOA 1Z4IA 3SD7A 2JAUA 3IB6A 3WKEA 2IOFK 1PW5A 4UU1A 2MU1A 1Y8AA 5AIAA 5AM4A 2FPUA 1ZD2P 3ZVMA 2OA0A 4Y2JA 1U2TA 4KX3A 3N5KA 1TE2A 5ALLA 4MWOA 4F71A 3NALA 1RLTA 1S2OA 2O9JA 3NASA 1JUDA 1NRWA 2WM8A 4UM5A 4KNVA 5AK5A 4H1WA 3D6JA 4ZEVA 1Z4PX 5T41A 2HI0A 1ZJJA 4NWIA 2NO4A 3U13A 5AW8A 1U7OA 3U26A 5IS2A 5AW5A 4HGNA 4YCLA 4KNWA 3QUBA 2I34A 5AKXA 1ZS9A 5ALEA 3L0CA 4NFLA 3FPSA 2ZG6A 4GIBA 4DWOA 1NF2A 1SWWA 3DNPA 4FE3A 4XPZA 2FDRA 3R9KA 3NAMA 1SWVA 1T9ZA 5AW4A 1U7PA 4UW9A 2FPRA 5FP0A 3U7EB 5A3RA 1L8LA 4BEWA 2G1AA 3DAOA 1QQ6A 1RKVA 1WR8A 1U02A 1L7NA 3R4CA 1ZD5A 4BBJA 2P69A 3ET4A 3L5KA 4G9BA 2B1QA 3ZI4A 4FYPA 2GO7A 3AR3A 3I1YA 2HF7A 2CN1A 1VJRA 2W43A 4FFDA 4CF5A 2FEAA 2WFAA 3U7HB 5AKHA 3WK5A 3ZTWA 2FPSA 1IWOA 3ESQA 2YJ5A 1NNLA 3KOOA 3AR5A 4Y2PA 4JB3A 1J97A 5ALXA 5AKIA 5AICA 2BDEA 2AH5A 5ALUA 4Y2QA 3DV9A 5AESA 4EX7A 2HEGA 2HSZA 4Y2UA 3SKYA 5ALMA 4Y2RA 2NYVA 5AM3A 5AVQA 5AI4A 3M1YA 3U7GA 1QQ7A 2GHTA 3A1EA 1RMQA 4BKMA 4L57A 3W5AA 3B9RA 1XPJA 1X42A 2YMMA 1N8NA 1Z4JA 4JDPA 4OD0A 4RESA 1Z4OA 3FZQA 4DW8A 3I76A 2B30A 2G09A 1QYIA 2OBBA 4DFDA 3GYGA 4UU0A 5AI5A 4C4RA 4J2TA 5AKYA 3N28A 1VFPA 2FUCA 1XP5A 4UAVA 1L7MA 3WKDA 2ZBGA 3F9RA 2WF6A 5AW6A 3KD3A 1Q91A 4O8CA 4BX0A 4F72A 3MMZA 2HOQA 4HGQA 2YMQA 1TJ4A 3FVVA 5AKKA 5AVZA 3SHQA 3QNMA 3E81A 3WKAA 2WF9A 4G63A 4BX2A 5AW7A 4NABA 4EELA 2B0CA 1YS9A 3A1CA 1XVIA 3PGVA 3OCZA 3OCYA 4ZEXA 3QUTA 2JAWA 2RAVA 4XE5A 4EEKA 2Q4RA 3B9BA 1T5TA 5ALDA 2JGAA 1TJ3A 5AW3A 1WZCA 1L6RA 3SKXA 2FPWA 3NUQA 2D2VA 2OM6A 3QUCA 4C4TA 5ALTA 1MH9A 4UMFA 2G07A 3WKCA 2YMLA 3QYPA 3E8MA 4OFZA 2YJ4A 1TA0A 2FPXA 5AHXA 5AM0A 5ALYA 3M9LA 4HGPA 3QX7A 1Z5UA 3ED5A 2C8KA 5ALFA 3WK6A 3FM9A 3PGLA 5A3QA 1RQNA 2RBKA 2C9MA 4CF3A 2YBDA 3UMGA 3ZVLA 1RC8A 1S8OA 5ALIA 3E58A 1RPZA 3QU9A 4Y2VA 4PNHA 4CNQA 4BNDB 3UMCA 4AS3A 2I7DA 2Q4TA 3CZ4A 3EWIA 2WHEA 4BEVA 1LTQA 3CNHA 2EAUA 3IRUA 2RARA 3DDHA 2WF5A 1T5SA 5AVYA 5ALQA 1L7PA 3WGVA 4AP9A 1RRCA 2C4NA 2YN4A 2W11A 4UMVA 3L7YA 1FEZA 4I9GA 3ONNA 3NANA 4RETA 2QLTA 3QU2A 1K1EA 2G06A 4BX3A 2P9JA 3L8GA 5AVTA 1KYTA 1Z4QA 4EZEA 5AW1A 5AKGA 1QQ5A 3KC2A 2I54A 3OCWA 4Y2XA 5ALRA 1O08A 4HYTA 1Z88A 1YMQA 3K1ZA 4MUMA 3AR9A 3AR6A 1RMYA 3HYCA 4EX6A 4UARA 4UMDA 3WK9A 4UAUA 3ZWKA 1O03A 2VKQA 2AGVA 3FPBA 1L8OA 2BY4A 1U2SA 3QU4A 2G80A 2ZXEA 3ZX5A 3AR8A 2OYCA 1YNSA 1AQ6A 4XQ0A 1Z4MA 5AK4A 5IT0A 3QXGA 1RQLA 1Z4KA 3FGOA 5AVRA 1CR6A 1F5SA 4GXTA 5AK3A 3KDPA 3ESRA 2RB5A 4BYGA 3AR4A 3PCTA 2Q5EA 2GHQA 5ALPA 2YMPA 1RKUA 4L6CA 5AI8A 5AKJA 2P27A 3EF1A 4OHFA 2HCFA 4NV0A 3AR2A 3OCUA 5AI9A 1QH9A 4NAVA 3L0YA 3I6BA 4BNDA 2ZBFA 3P96A 5AK6A 2PKEA 4YCMA 3WK8A 3QLEA 4Y2TA 1SU4A 1WVIA 2IOHA 3R09A 4C4SA 3QU7A 3S6JA 2YJ3A 1J8DA 4Y2SA 2P11A 5ALSA 1VJ5A 1Z4NA 2AMYA 1YDFA 3OCXA 3ZU6A 4Y3UA 4DCCA 1LVHA 2IA5A 5AKZA 2CFTA 3A3YA 4YCNA 2HX1A 3ZW7A 4YGYA 1N9KA 3BA6A 3BWVA 3UMBA 3AR7A 5ALVA 3OPXA 1RKQA 4HGOA 3U7FB 2R8YA 2YY6A 5AVXA 2CFSA 1TJ5A 5AM1A 2GMWA 3TLMA 2FUEA 2IOFA 3N8GA 1Q92A 5ALGA 4B6JA 5AW9A 3HLTA 4KX5A 3OTQA 1EK2A 2C88A 2MSNA 3QUQA 1ZD4A 5AW0A 3SMVA 5AI6A 2HF2A 4QJBA 4UM7A 3ZVNA 3KBBA 2HDOA 4IG4A 5ALKA 5AI0A 2R8ZA 1ZRMA 4YH1A 3WGUA 5AVVA 1ZD3A 3ET5A 2QYHA 3QU5A 2NO5A 2WF7A
chains in the Genus database with same CATH superfamily
1E3DA 1MFZA 3E9YA 2QZJA 5L7YA 4M1KA 4KKVA 1F0PA 1Y9AA 4MV8A 3EUFA 3QW2A 5DP1A 4O2AF 2WTMA 2PD6A 3NZEA 3FZNA 3FGNA 4EBKA 1MEOA 2GKOA 4U5CE 1NNEA 4LFBB 3D7KA 5K8JB 5CA1F 4S3MA 3L4EA 4EUEA 2JCSA 3TTTA 1XEWX 2QJRA 4NK4A 3F5MA 2X8JB 4JP8A 4HGRA 4O02B 3UKOA 3IP1A 1YE5A 2AI1A 3ZE6A 2BRUC 4CUZA 4DV1B 4LUCA 3WLIA 4JCZA 4I9FA 3UZUA 3FNGA 4H4CA 2P1ZA 3SLRA 1I3KA 3PI6A 2DJIA 3U7JA 2Y4NA 1AIPA 4CQMB 2TRSB 3K09C 1U2DC 3QBEA 2GZAA 4DAOA 5CEJA 3DONA 1C7IA 2HFJA 2Z8YM 1LPEA 2FG6C 3K9FC 4S2EA 3ZE0B 3ATPA 4E31A 2V0NA 4DB2A 3CF2A 3WVNA 1V16A 4XPZA 3W5VA 4WERA 2IYPA 1K7YA 2P78A 3GMSA 1V25A 3B1WA 2ON6A 4M1YA 3SJ7A 4IP0A 1T2VA 1D1SA 1QHHB 5DGHA 1H4SA 3F73A 3AR3A 1MB0A 3HA3A 1E5LA 2E0IA 3SXYA 2HMUA 4NYJQ 4LWPA 2AFIB 5TEWA 2G82A 4W4TA 3LLUA 2Q41A 4WRRA 5KNLA 4LJ7A 1V8BA 2B3DA 5DH9A 4EOGA 4X3OA 2HYIC 4ATNA 3T7CA 2VHXA 2IU0A 2QMQA 1KYQA 2D06A 1TQ4A 2EL9A 2IKSA 1OBOA 3H5AA 4EJ2A 2P9GA 3DE8A 3DC7A 3GJ4A 4X9XA 1AX9A 3OZXA 4YAFA 3M5CA 4R01A 4E5KA 1OR8A 5C1IA 2Z3WA 3OPYI 4CTKA 4M22A 1WN0A 1V37A 4QGSA 1TEZA 1DNPA 5K0JA 1KSGA 4IX1A 5CFPA 5JAHA 3GLRA 5BYAA 5FPTA 1H0RA 3W9BA 1XO1A 2OSBA 2VJQA 3P1JA 3S9OA 3COYA 3EZ7A 4PG5A 4HGPA 1PJRA 4GZLA 3KT6A 4C76A 3BAZA 2A5GA 2C78A 5CFZA 3WAJA 1XD8A 1XZNA 3S1AA 1ONNA 5IT9A 2VO1A 2VNSA 3QZCA 1CPYA 1OLXB 1XUOA 3K31A 2XAUA 4OB7A 1SU7A 1O95A 1YR8A 1PG5A 2VYND 4FGWA 2DKNA 3B38A 3T9FA 4BMDA 3KJIA 3QQ5A 4GRDA 1YTUA 2C3UA 1YJCA 1L7XA 4GEKA 3OJ0A 2CNWA 4ZK6A 2X2EA 2H57A 1LJ8A 3FY4A 4BO7A 4UEJA 4B45A 1G21B 1FMJA 4AYWA 3RHFA 2Z2YA 4CI0B 2GN0A 2O8NA 3UAWA 5KMGA 3VTKA 4AVYA 3B89A 1KJQA 2GHQA 3I39X 1C7ZA 1OY1A 1VJCA 1N1MA 3HMKA 1XJCA 2H0AA 4R81A 1ULZA 3FYUB 3RF7A 3IVAA 3VH2A 1JLLB 3SF8B 3UO8B 3ZIAA 3R09A 3L43A 2WPDA 5KNCD 2OXCA 1CUZA 1D1TA 1R12A 4F3TA 4KITB 4G24A 3A1WA 1BD3A 2K87A 4H0NA 4RJ2A 3LZ6A 5IWAB 2NO1A 4RTPA 1I0LA 3AP3A 2YQYA 3WWPA 4Z5XA 4GR5A 3O2JA 1DCTA 4P93A 2PV0A 4P9FA 2WVGA 3O55A 4Q4LA 2HU7A 2X58A 1HM5A 2PZJA 3HY3A 4ZT4A 4QJBA 1RBYA 2AOWA 1EVQA 3BE5A 1HDEA 3P4YA 3SYNA 3CVJA 4O08A 4ANJA 3DDWA 3ACBA 2WU0A 2JH8A 3MNFA 5DMHA 4HDAA 2JEZA 1GZ5A 3FZYA 1D8AA 4IJ6A 1XHLA 2L17A 1DHRA 2I6FA 4KMRA 3OEOA 5K8UA 2OXFA 3ZCTA 1WJGA 3PFBA 1G6KA 5KINB 5EJ5A 3DHWC 3UATA 5A71A 2O3TA 3BCRA 2DSTA 3LQ4A 2OZPA 5EZ6B 4K9QA 5AW2A 3SMQA 1KO5A 5HK8A 3KYCA 3G2NA 4D44A 1XA4A 4KZPA 1ISHA 1EWVA 2GLUA 3TJ6A 2XZPA 2FA9A 2Z4TA 3LFHA 1OILA 4FGKA 2G04A 3TFWA 2VK2A 5LMUB 3SZRA 2OCPA 4DA9A 1JHXA 3WA6A 3QLUC 4B8ZA 2YXDA 3I9FA 3DVQX 5LMCA 1RAGA 4ZPJA 2PNJA 2QAJA 3QEMB 2WM8A 4UM5A 1E2MA 5EKSA 1A5AB 3A9UA 2AZ4A 5K51A 4HNAB 4FDVA 1ZNWA 3PNSA 4FYWA 1U8CB 2POQX 4BQFA 1RWVA 2ORIA 2QU8A 3UGQA 2ADMA 4UQOA 1C7RA 4EG7A 4EI7A 4Z4QA 1WKVA 4BP3A 2RGWA 5D01A 1U9IA 3V42A 4JLNA 4O4LF 1T26A 1XQ1A 2E3JA 4L9AA 4Y2PA 4BFUA 2I8BA 5F5HA 1X1EA 3R0QA 4EX7A 4DGQA 3AP2A 3TO5A 3ITEA 4JLWA 1O5OA 1TJYA 3NHLA 3ZV5A 5IDWA 2QS9A 2FTKE 3LY5A 4QYXA 2JAHA 4GX0A 3I92A 5BVGA 1H1DA 1E9RA 2CLKB 1AV7A 3L6OO 3A6KA 3LD9A 2FW0A 3HXOA 5AHWA 4X20A 1N2HA 1E6MA 5CNIA 3B1YA 5LP6A 1KJNA 3HCEA 4F1WA 2WF6A 4XDGA 1EHCA 1D5WA 3PC4A 1LSSA 3OA1A 4UBOA 2IWHA 5AKKA 1NE2A 3DBRA 1ZIOA 1EFVB 1YS9A 1S05A 3L0PA 1OBFO 1H5QA 3OD1A 2QL7A 3IVMA 4JGIA 3M3HA 2DBQA 4YNBA 3ESYA 4XWKA 2VAMA 2Z9BA 4QAJA 4G2TA 2LVBA 3ZNOA 5KNBH 1TXGA 4TTAA 1MW8X 3JQ9C 4IMPA 3VR6D 3ACCA 4D74A 4CODB 3ZVLA 1S89A 5B58C 2D74A 1VPLA 3W2GA 1FYWA 4XRRA 3FDQA 4YJ3F 1OX4A 4L15A 3V00A 5C8VA 3IRUA 3UFBA 2WVHA 1RWNA 1B0AA 4DIMA 4IGIA 4TT8A 5TC4A 4L3VA 2ROQA 4I9GA 3QKRA 4J43A 1T0UA 5EHHA 1YZNA 2J3LA 4XGNA 3OUTA 3HXTA 3WICA 1IEXA 1B6RA 2XNDD 5D7BA 5U1PA 5D84A 3OFNA 5CX1A 4XGQA 2HJ9A 5K1ZA 4JTDB 4FGJA 3BGVA 3FDFA 1Z18A 1C14A 1AZTA 4FBLA 1P4SA 4RACA 3O47A 1ZUNA 3RK4A 2JFOA 3JQBA 4HP8A 4L6CA 2HRBA 1Z9BA 1JXMA 1DAPA 4L3WA 5COQA 2I80A 4LYJA 3U1BA 4GOND 3NEJA 4AWBA 1PDVA 2V7VA 3CE6A 3E03A 5E95A 3GA5A 4MV3A 2IXOA 3DNFA 2FLVA 2EIHA 3ERCA 1UJMA 3BB4A 2O8EA 3BTUA 2CFTA 2LKCA 5CXXA 3IELA 1YQWA 2O3JA 3EAQA 5I7FA 2WWRA 4MLDA 1QM5A 1G60A 4PZEA 4J7CA 1FYFA 2BSXA 4XPXA 4MWEA 3F47A 2D1SA 2O14A 1L9XA 2HDOA 4IPTA 2C5AA 3TSZA 5H3HA 2FSVC 1V0JA 3RTBA 2PUGA 1FMLA 5HGXA 4H6WA 1WD7A 2GXQA 3G4ZA 3BQ9A 5JCZA 2PH1A 1AEPA 4BRWA 2C8VA 2JJMA 4F38A 3UAVA 4RU1A 1UPAA 2OZLB 4NTFA 4JW1A 1ECJA 1HXHA 3UCEA 1Z22A 3OY2A 3GLIE 3ZJUA 3G8CA 1S5PA 3GAAA 3ER9A 1ULUA 1WXEA 3E6AA 1RM0A 2AOUA 2ZOSA 3AQIA 2QVCA 3MAAC 4FW9A 5BSEA 2QMUA 5CFLA 3MWKA 4TPKA 1BW9B 3OLYA 3PHGA 1GITA 1OGIA 5F3WB 3LLVA 1E2QA 2PUCA 3L6CA 3M4XA 1K6XA 3GPIA 2NX2A 4V24A 4PGAA 4IDAA 3ZHVA 1ZI8A 1BRMA 2P1AA 3SWWA 1N3BA 3IJ5A 4B8YA 3AX6A 4B6SA 4ZO4A 3UHPA 1T29A 2Q0XA 2BCGY 4XYMA 3QXXA 4MUIA 1P5RA 2MU1A 4UXIA 3ZOZA 4AQDA 1P45A 2O9JA 4DPKA 4CT4B 3A1SA 3KLMX 3EIEA 4ROSA 3AI1A 4JI1B 2C0QA 2VJOA 5TJ5E 3FVYA 2D7JA 1ISIA 3QKWA 4YCCA 4GR4A 5L51A 4BRSA 2QTLA 3BRWD 5LBTA 3NYIA 4U2DA 1RRFA 2UDPA 4QPPA 2H1OA 1E2NA 4QA9A 4YUVA 3AQ4A 3UJ3X 1R6DA 2O23A 4V0LA 4LJ8A 2PIAA 4BX9A 3JWIA 1I5OA 3R40A 5AKHA 1UOQA 1YA4A 2PKQP 4BU1A 4ZYLA 1SR2A 1EK6A 2GN1A 4EFMA 5ALMA 4JC8A 4JI8B 1A4IA 5B1YA 1E1CB 2PY6A 3WIVA 1ZD1A 4U00A 1UXHA 2KW5A 3FE2A 4DDHA 2BKVA 2CCGA 1LBTA 1HNXB 1FS4A 1Q91A 1DT5A 4R1MA 3BHIA 2ZXRA 4ECAA 4D4IA 2ZUWA 4RTMA 2O8BA 4AY6A 1JL3A 3RQSA 3PXAA 4REOA 1WXXA 4OG2A 1NFFA 2F3RA 3HFGA 3AKZA 3TUIC 1GM5A 1VLZA 3D6UA 4BQQA 3GAMA 2A9FA 3TZQA 1E98A 3CLUD 2XMGA 3DLBA 2J32A 4P54A 2VH2A 2HMVA 2OCCC 4FZJA 4J6EA 1PTKA 4CS7A 4N0PA 4K9PA 1PSDA 1NT4A 3C8MA 1CUIA 2VH3A 2HSGA 2XL8A 4BVGA 4K9MA 3TOCA 2QG4A 2AQIA 3IBGA 1T9BA 5CLJA 3KFXA 5KOJA 5G3ZA 1QH8A 2XQKA 4XDHA 1RBQA 3LUHA 4RPLA 4ZVUA 1BHSA 1FP7A 2I3ZA 2XLBA 4HYTA 1CZLA 3BFXA 4MWSA 2NU6A 4J30B 2MWQA 3ZBPA 4AJPA 3LPMA 2Z6AA 3CHYA 2VPIA 1SKYE 4CV1A 5K01A 4TLCA 2OZKA 4JI2B 4LCBA 5A2GA 1KK0A 1O54A 5I9BA 3PU6A 5JV5A 2Z3VA 4MKFA 4MKRA 3TQFA 2VP2A 3CRZA 3FX2A 1KRXA 3C3DA 1ICIA 4MSUA 1NA5A 2NXJA 5CCBA 2Q1SA 2FR8C 1VTKA 2HXYA 2IHKA 5U4QA 4MWDA 2OOSA 1L8AA 2EPOA 2V58A 4XEVA 3Q0IA 4D56A 4DCPA 3AETA 3OT5A 2H4XA 1IBCA 1R6TA 1DDOA 1EMDA 3OPXA 4ZZ2A 5LQCA 1Y6FA 5B1DA 3ROMA 5IT5A 5IVDA 1SKAA 4BC0A 3SQNA 2GRUA 4FFSA 2I99A 5AW0A 3PEEA 3IQIX 3D59A 5IKXA 5MGBA 1Y8ZA 1F12A 2B34A 2GPWA 5IXJA 4ZP1A 4HLUC 1LRLA 2YWRA 2VHQA 3GJ8A 4OM8A 3SF0A 4E6EA 5H16A 4WBNB 4YIHA 8OHMA 1N7IA 2QA5A 2PIDA 4LOJA 5KTMA 3AM1A 2TS1A 2O0KA 1Z12A 4JJ7A 3UWSA 3WJ7A 5KKNB 3KWMA 4IIYA 1R9MA 5K6AC 4X91A 1LV7A 1NOIA 3DO5A 4QQKA 2XUGA 3CB4A 2BBSA 3TEJA 4HVTA 1BWPA 5DNCA 1F8XA 5DLDA 4U7PB 4G0XA 1EM6A 3AOGA 1YV9A 2ZJ0A 2PUJA 4IG9A 1MEEA 3ZWWA 1LPNA 1T3TA 4KIUA 2BL4A 2JJQA 2OYRA 1Y89A 5JYEA 4UVHA 4CKWB 3OQNA 3AEYA 4EPRA 4M46A 1E4VA 4HX5A 5M04A 2P7VA 3NDPA 5E7JA 1N0IA 1KNYA 3PNKA 1EG7A 3UAZA 3FTDA 1RTTA 1LZKA 2JL1A 1S8FA 3O39A 5AKXA 3KDSE 4MV1A 2PGDA 4WZZA 3IUMA 3PUJA 5I01A 4NEGA 4R2LA 5KCZA 2QRQA 3OX1A 3GJQA 5J23A 4B31A 2VNHA 3E9RA 2FCAA 2D54A 1OJLA 1KI6B 3KVOA 1BA3A 2VT3A 3T1NA 4FKZA 2XSEA 3FH0A 5HFAA 3DEYX 1O95D 4ZODA 4B6OA 3JAMA 1FTQA 1RI1A 1SR8A 4RJIA 1XPJA 4ZI7F 4LBVA 2YDYA 1QZTA 3WLTA 2FEXA 2VG8A 3O21A 3JD4A 1PR9A 4WCFA 4C0BA 4ZVTA 4GPIB 1T6UA 4BUZA 3VI4B 3KUXA 3U4GA 4LTDA 1W0JA 5F35A 5BSFA 3L06A 4UUQA 3OZWA 2P6OA 5T4EA 1T1EA 3V4LA 3BOSA 3IUBA 3NGLA 1Z6GA 3RFYA 1ZSVA 3TS1A 1GO2A 5DW3A 3ZIAD 4GLBA 3BFJA 1TTHA 4RA6A 4MP3A 1CUUA 3R9XA 3UK1A 1ZY2A 3DMPA 3COWA 2HAEA 3QFCA 1YA7O 1VCNA 3Q3JB 3M6MD 3HUEA 3L92A 3EZ9A 3H04A 4NZNA 3T7RA 2GTPA 4KAFA 4RXMA 5A3QA 5LDGA 4WBSA 2UVPB 4FEGA 2YWXA 1Y6QA 3SJAA 2Q3CA 4Q7KA 1G8XA 1A9XB 3R75A 1M2NA 4MGYR 3AM5A 4DJEC 3WV5A 3NMJA 4F5EA 4UMVA 4P82A 5LNK6 2NVOA 2HSQA 3TUJC 2IZ0A 2ZS8A 1XNJA 4PAGA 1EYZA 2OAQ1 4JZKA 4NVRA 3C3MA 5BRNA 3V1TC 2VDNB 4MV9A 4JJGA 4LCJA 4BLPA 1HFEL 2BF4A 1LQUA 3H1AA 2TMKA 2BY4A 2TECE 3QU4A 4US1R 2HF8A 4YJGB 3NHJA 3FR8A 2ZJYA 4R4JA 1P8JA 5HV9A 1CR6A 2H7VA 5CA1B 2B99A 1F2VA 2EOAA 1XDUA 4IQGA 3MWDA 4HO1X 1MMNA 1RU3A 3IT3A 3UW1A 2Q5EA 2PCLA 3D6MA 1T8PA 3K70C 3WGTA 1BE0A 1YOBA 1UBEA 3TLKA 5LQUA 1I6LA 5MDHA 1E9DA 5KOHA 1GXSB 4MI1A 5DHPA 3C1AA 3Q7QA 4CGZA 4G23A 1CR4A 2QXYA 1NE7A 2OD7A 4RV4A 4I8DA 4W8PA 2ZJAA 2JCGA 3HO1A 4P6VF 1M2OA 5KO2A 3MILA 4YB8A 2LBPA 1WETA 3OWHA 4FWIB 3RRZA 5CR9A 1D0XA 4FLEA 2QLBA 1DG9A 2Z8YA 1N8TA 3TZBA 3I4LA 2OVFA 1UKCA 2HUPA 5B3JC 5LN1A 1E99A 2WJYA 2HWUA 1XTUA 3WS7A 4L9RA 2V0CA 1ISPA 1WHTB 5HA5A 3MTEA 2NU8A 1OWLA 1GYPA 5CB4B 3OOEA 1FX0B 2J3QA 1P0CA 2YXPX 2VHWA 4XD7A 4XX0B 4A16A 2XCUA 2NZVG 1UBHS 1A5ZA 1Q3HA 2G4LA 3ZWXA 3T7TA 1T2EA 1JHPA 5B37A 3KJNA 5EJ7A 1R3DA 1MRSA 3R3VA 1JVNA 4W7SA 5AUOB 2P9BA 2QD5A 5KDLA 4MDEA 2AV6A 3R0XA 1WUHS 1ZP6A 4H60A 4WOKA 2A14A 4IGFA 3DZAA 3QKSA 3A25A 1LLFA 1IULA 2W22A 1MCZA 2PM8A 1HWYA 5JRAA 4DMCA 3KQKA 2AD5A 1QAMA 2XCOA 4HZGA 1FFXA 1JILA 4AY4A 1MAHA 2XDQA 3JQGB 5BSWA 1C7FA 3C63A 2D2EA 3ZHTA 3EPVA 5EQTA 3R3UA 2CDRA 2CJWB 3MUOA 4CETA 3N2GA 2FUKA 1ZGZA 2F17A 5MN4A 3R5KA 4CTJA 3L79A 3WFIA 4BVHA 2C5SA 3ZD8A 2WSYB 4LXGA 2BWJA 1ND5A 1UJ5A 1VHTA 1VYUA 4FHEA 4Q12A 3N0VA 1EPUA 3S2GA 4GBED 4ZVQA 2OHVA 2F43A 4UBLA 3TRFA 1LBEA 3WLKX 3CRQA 3U7HB 2E6KA 3LVQE 3EZ6A 1PNQA 4U02A 4O4HA 1D9ZA 1OFHA 2WU3A 2QRLA 4LSZA 4K2HA 2X77A 4IIXA 4HAYA 4XDZA 3OFND 2IU4A 3WX0A 1E9BA 4BB9A 3RJTA 3KD3A 4MGHA 3MTDA 1SUAA 4CMGA 1M54A 1ZCJA 1JEYB 4B81A 1E4EB 1Z5ZA 4YAOA 3OC6A 1Z2CA 2XECA 1LLCA 2DXIA 1Q57A 3ABMC 1G1AA 1HDCA 2G07A 3NUGA 2OWDA 2OGTA 3IQ5A 4OQQA 5BW5A 1PGQA 1PX0A 3M81A 4MW7A 2L81A 1GQOA 1PUIA 1T0HB 1U7XA 4CF3A 2D62A 2WA1A 4MCJA 1QFMA 4C2BA 4Q9DA 1MV8A 5K6RA 3BG5A 4PGGA 1IPEA 3ESZA 4QARA 2ZYSA 4KUGA 3KEMA 3U1TA 5BN5B 4LAFA 1OXTA 2F1HA 4JELA 1T15A 4EVIA 4MPDA 4E2YA 4W8OA 4KXWA 3D0RA 1BBHA 2AFHA 2QLTA 3CCCA 2RDMA 1E3LA 4P3XA 5DB4A 1BR2A 1AK2A 1Y8QA 2C1ZA 3AR9A 3CH4B 4YQZA 1YQXA 1TQ2A 3EQ6A 2C83A 3CLHA 3FCCA 5AK4A 3EE6A 1HLDA 4U0KA 1X8XA 3H1PA 1DBRA 4QQNA 2NO9A 4GZ3A 1Z08A 2I0FA 3KYJB 1QP4A 3CXRA 3GK3A 1WL8A 2P27A 2RGRA 2DBYA 1Z26A 3TW8A 5K3FB 1YDEA 1KXZA 1YR9A 4LJKA 3Q1LA 2ZD9A 1JQJC 2V6JA 2CFIA 3B51X 3MG9A 2GYVA 4B6RA 3GUCA 4BMYA 1UODA 1VKNA 2EP7A 1QHNA 1DKLA 4H17A 3VSEA 4Z54A 1XTBA 1FRQA 2PGIA 1U7TA 3C14C 4PLTA 4WESB 5BRAA 4NTBA 4LLEA 3DAFA 1CFZA 3GP5A 1CY2A 1YR6A 3UTCA 3ZK9A 3OIYA 3HR4A 3M4ZA 1FU7A 5AI6A 3PLRA 1G18A 3FB1A 1XVAA 2NP7A 4NYMR 2BDTA 2WHQA 1ZJ4A 5BOVA 1HZJA 1ZHHA 4U7FA 1EJ6A 2NUPA 2BH9A 4ILEA 2NXEA 5IT4A 2NU9A 4RM3A 4AF6A 1STOA 1NW5A 1PWHA 3T5MA 3ESDA 3UOAB 2LCHA 4G1EB 4O4LB 3ZS8A 1C29B 1CQZA 1EFPA 2HHHB 3GIDA 5GMOA 2WWIA 1BEEA 1YHYA 2Z8ZA 4KXQA 1J8VA 5ALZA 1IG0A 3JQFA 1NBBA 3A11A 3DDZX 4QUEA 4EY4A 4MR8B 1GTL1 1KFCB 4DJDC 2AHOA 1E2BA 1IN1A 3QFTA 4ETWA 2DF8A 1OWMA 3EGOA 3WMFA 3BMOA 3C41J 3PENA 1JA0A 1G38A 2JFHA 4U5BE 3TLXA 1XF9A 3AHEA 2H06A 1BS9A 1DZIA 3SXUB 2QX7A 1N78A 2QZPA 1UP6A 3ICWA 3ILVA 3GLTA 1YR3A 2VP9A 5IJWA 4NWIA 4HFKB 4FE7A 4GX2A 3PJRA 2WINI 2C2XA 4HYYA 2GDJA 4IZ6A 4LXIA 1OAKA 3RARA 1YTLA 3DP9A 3R9KA 4QT0A 2PV7A 2BR3A 2GRAA 3GNTA 4WA8A 4X6YA 4PFQA 1RIIA 1LI4A 4RCYA 5AH0A 1FLDA 3BXOA 5D1HA 1A3CA 1HEYA 1Q20A 1KC3A 2WFMA 2GO7A 1CS0A 3DMFA 4JK3A 2ZJ1A 5KYUB 2I6SA 4YCJA 1E2UA 3HDGA 5ALXA 2FYTA 3A1UA 2CDNA 1NVXQ 3WISA 3R76A 1ZSNA 4PXSA 2O2SA 4JVSA 1B6SA 16PKA 1L5HB 3PC8C 1XWFA 3RAFC 4WVLA 3D7RA 4DSNA 2CUNA 1MABB 1T4BA 4KRFA 1J0EA 3L18A 3GORA 2PZAA 2QTFA 3NM5A 3WKDA 2B2NA 1P3DA 3MF4A 4N5IX 1XHFA 3QF7A 1XEWY 2PZFA 4YMTA 4ZO7A 5H5JA 1M6NA 1GLNA 1YULA 1ZEMA 2X4LA 2XNCA 3L93A 3WFZA 3U17A 4D8WA 2GVZC 3HJCA 3MMSA 2Y77A 3QLJA 2CEAA 5AJWA 1FSPA 3JQRA 3JQEA 5DISB 2FSSA 4HMPA 3NIGB 4MVJE 5DX8A 5IANA 4F5WA 3GVCA 4X97A 5CVCA 5ALIA 4XYGA 1KMQA 3QBTA 1Z0SA 1JG1A 3JRNA 4FHCA 4F4IA 4J16A 1C4WA 3TQHA 1DEAA 3DP7A 4PQYA 2BHNA 2GERA 4JMPA 3T9OA 2ANCA 2G72A 4KO8A 4NPAA 4KSCA 3WIBA 4F21A 2TMYA 3IR6A 5EXPA 2FSUA 5TE9A 2RAUA 4HAVA 3K72B 4Q1DA 1SBZA 1UH5A 4UUOA 2JGDB 3KIPA 1E6EA 5JNTA 1LBSA 4C0AC 5IN5A 3A14A 4I14A 1JFFA 3AHIA 4G1CA 2YH2A 2FWBA 3W3ZB 4E17A 3TW6A 2J4CA 1PUXA 3L0YA 4C88A 4QDKA 3GUZA 1MXFA 3EZHA 4Q37A 3N0TA 3NAGA 2PO7A 1W73A 1CZHA 2VA9A 1VJ5A 2F8MA 5G3YA 4MV6A 5ILGA 1I2DA 2O5RA 1CRLA 1X9GA 4KIGA 1DXHA 2QKYA 4JKVA 2G0TA 3LY7A 4YAKA 2WKPA 3EHEA 2IF0A 3V2UA 4CMEA 1XA0A 1HF3A 3ADOA 4MMXB 2P9HA 1XBTA 1ID8A 1QIDA 3RS2A 1S7CA 3LGSA 3U1VA 4E13A 1Q0KA 2VZ0A 1UOEA 4W1SA 1PR5A 1QIMA 2QTMA 2X4DA 4BFCA 2PG3A 4Q1EA 4P6IC 4JUBA 1LFAA 3LQKA 1SZCA 2R7OA 2VPTA 3TIFA 3UC5A 4X1YA 4AIIA 3AOUA 4HXEB 4NECA 2BOVA 4N47A 2NWQA 4MW1A 3TR0A 4LHZA 4UOEA 4XWOA 1OGYA 5KDDA 3UT5B 4TN1A 1G6OA 3KXLA 3ROQA 2WJ4A 1W2WB 3G5UA 1AUPA 3PEFA 4ZHSA 1BXKA 2WYOA 3KSDO 5JADA 3C8HA 2V3CC 4YX9A 4FZRA 5DTMA 2W8BB 1F38A 1F3LA 1W0JD 4LV5B 4R9SA 1DCFA 2WRZA 5H3CA 4Q9JA 4PACA 4OREX 4Q3BA 1GDTA 1YR7A 5DV9A 4PRYA 2CV0A 2F3UA 2WVAA 2Q3FA 2R7MA 3IHTA 1WPXA 3LKDA 5HIJA 1TO1E 5AW5A 5IAJA 3PXXA 3HVJA 1XTQA 3EQ8A 2JGEA 3T1QA 1ZK0A 1SXJD 3UWDA 5K4GA 4D0LB 5K05A 1SKMA 3AEKA 4D9BA 3REFA 4IWBA 1X3SA 4XB6B 5IARA 4ZVSA 1DTWB 3LQ1A 4DA8A 3E23A 2PCJA 3E0XA 3N2NA 5LMNB 1SMYF 1D6JA 4RK7A 4JCHA 4QYIA 1WPRA 4K88A 5HXAA 2QQGA 3AUKA 3TEMA 3E5RA 3AJ9A 4WAUA 2EC5A 3NAZA 1WD5A 4E33A 3MBGA 1MIOB 3CX4A 4TWBA 2A4MA 1SQFA 2QORA 4HWPA 3N8NA 1QCCA 1A0OA 2I87A 5B7QA 3N28A 4AAYA 4DZTA 4H31A 2VPQA 4OP3A 1FSGA 2O7VA 2RBEA 4RPKA 2XB8A 3I83A 2BD0A 2ATCA 3JWEA 4IUCS 2QROA 4O8CA 4F72A 2WSSD 4R98A 3VJMA 4L5JA 3H7IA 4F9EA 1ZUWA 1EBFA 2UYCA 1XTIA 3AC0A 3T3MB 1BVRA 3ZY3A 2A68F 1EXMA 1RWOA 5M5BA 3HRKA 3W77A 4B46A 3RS9A 3UJBA 3A1TA 1GCGA 1W47A 4OFZA 1NW6A 4R0NA 3NJ4A 3FCOA 2J9YB 1YKGA 1GPUA 3RS8A 3BK2A 2O20A 1QOPB 2VTEA 5ECYA 1N0VC 1U90A 1TTQB 5JJCA 1M34A 2FEWB 9ABPA 4PANA 4A5SA 4M9SA 2YQ4A 2IUTA 4FDMA 3ZLBA 5LNK1 1KQFA 1RS0A 2PFKA 5KS2A 5EMLA 3C5VA 2AA3A 2NO0A 4PSUA 4UNSA 2BKLA 4PLFA 4RS3A 5EERA 4YL0A 4BX3A 2HIAA 3OM0A 3DOFA 1N57A 2FZGA 1O08A 4CJGA 3X1ZA 2GS9A 4DCNA 4QXQA 3HFSA 2H1IA 4EB0A 3U9TA 3FYUC 5GOZA 1JSRA 3C6ZA 1A9SA 1TIBA 4A8JC 5TJ9A 5B7PA 4NXNB 3T9CA 3G7SA 3VUFA 3DWGA 1U63A 2GD0A 4F3YA 4IB4A 3I8XA 3L8MA 4PC3A 4OB8A 4IJMA 2GJ9A 2WZLA 2Q45A 3HJTA 1AXEA 4Z4EA 3W6UA 2QB5A 3FTNA 3P9YA 4QYMA 4RVOA 2X2FA 3GEEA 2AMYA 4S1PA 4ITVA 4BAGA 4QI0A 5AHKA 1UT8A 3CX7A 1D2EA 5JAMA 2O06A 1WUYA 4DKJA 2VJLA 2WR8A 3QWHA 1MNQA 2ZPAA 1CY7A 5KWVA 4KDEA 4X7MA 2PMKA 2FKNA 1ZVZA 3MTGA 3ZCVA 3RSOA 5L0JA 5CB4F 2BW0A 1DAEA 4HYEA 3KZCA 4DVYP 1KIMA 2XE7A 1ATIA 4O1HA 5JH7A 3JRXA 3RWMB 4BNGA 4I55B 4J0EA 5TMPA 2A67A 3TIGA 2J0EA 3HB7A 3TTXA 1KK2A 4U5QA 2RHGB 1JDBB 2IF2A 1NXOA 2C7GA 2V4UA 3DOOA 3PNVA 2I2AA 3SLGA 3C98A 4ZI7B 4Q9KA 2YS7A 4DUGA 1JLMA 3DEAA 2X41A 5B1HA 2IX3A 4GPEA 1W48A 3ORHA 4EZBA 5BV7A 2PZGA 3AUFA 1Z0KA 4NZZA 3PEVA 3FNRA 4KOEC 1DKMA 1WDMA 5JYCA 1OW8A 3O8OB 1Q0HA 3AHJA 1ZCZA 1L5YA 4YUYA 3KTOA 5GAJA 1T6YA 3IMGA 2R1VA 4HADA 4NCKA 3LUJA 4B4UA 2B37A 3HB0A 1KDVA 3R6DA 3WLSA 2JX0A 2RHLA 1YZ3A 3MS2A 3RQFA 4LQCA 1A7VA 2EP5A 3F9IA 2AC7A 3A2MA 4A3SA 4OFWA 3RUAA 5JZSA 1YNOA 2IS2A 5KKCA 1TUBA 2ECFA 5ADVA 5COBA 3TYXA 4CCSA 5IG2A 3CRVA 1NW8A 3UWPA 2VL7A 1F8FA 1OPRA 1FVFA 2FPGA 3OFSA 4MTGA 5T64A 4FQ5A 4DCMA 2H0QA 4RD6A 2R6ZA 2WFLA 2H63A 4G9BA 2XADA 3L0IA 2FEAA 2XQGA 4NICA 4U9HS 4Y9SA 2CXSA 2ZYAA 2WJAA 4IOLA 3T9EA 2IY7A 3MMPA 5AI4A 4AE4B 4AM8A 1DIRA 1U11A 3IFSA 4KXUA 5D3KA 4EF6A 1XXHE 1SKUA 3DG9A 3O4HA 3AERB 2YNMD 4XVCA 4YN0B 1MQ8B 4AG6A 1XJ5A 2R47A 2C07A 3LLKA 1OHHA 1MQVA 2J5QA 2QRVB 4KQFA 1EM8B 1RZVA 1CZNA 2II6A 3CT6A 4JJIA 4MYCA 3GQVA 3GCWA 1JLKA 3B5EA 4KQCA 5FH9A 4CDAA 1AKNA 1RYDA 3PGVA 3W4YA 5F2KA 2XF2A 3O1HB 3QVLA 3CSDA 5HP4A 4GZ5A 3ZGNA 4A8JB 1ODCA 3WB1A 1G3RA 2X4IA 3HNOA 3A6ZA 1X77A 2NPIA 1M8JA 4BNHA 2VJDA 3VNUA 4U9UA 4DUYB 4BO1A 1ZINA 1RKXA 2HA4A 3LKZA 4FMCF 1VIAA 4HGYA 1Y6GA 1YASA 4RL6A 1IFXA 2W98A 3BBPA 1GN8A 3TNFA 1P9RA 4QJIA 3O4VA 1SUSA 2VDWA 3IVCA 3WNBA 3HHEA 1MMAA 2ZSJA 1A7UA 1D2MA 4MGZR 5G2OA 5FB3A 3DFUA 2AW5A 2ZSIA 5ARDA 4KK4A 1OW7A 1ZUD1 4JRZA 3JASB 1SRRA 2P9JA 3SC4A 3HKDA 4LQDA 1KYTA 5AKGA 4F3CA 5L0GA 5ALRA 2YCLA 3GJ3A 1WBBA 3S8EA 2WT4A 5EXTA 4L6RA 2G80A 4R6WA 1QIJA 1QWSA 1IMOA 4KXVA 5IPFA 1Z0ZA 4HH3C 4P5PA 5ETJA 3OZ7A 2JZOA 2DBZA 4BRZA 1Z7BA 4JR0A 4BY9E 4EDHA 3PTLA 1DO2A 3E7WA 2CB9A 2NZJA 5JDIC 4AJIA 3ZBUA 1PYOA 4WCDA 2V7TA 4C7OA 1FVOA 3WLRA 4JSRA 3EG9B 4PNZA 1SY7A 2HZBA 3RC9A 5TARA 5F5LA 4Q4ZF 5GONA 3WYNA 1U8XX 4MVCA 1MDFA 3AG6A 2C4VA 1ZQ1A 1J0DA 3NYQA 3UPDA 4KE9A 3CH5A 4IMRA 5BPFA 2I3DA 4GP6A 1H4QA 2IXBA 4PCAA 2OCLA 3VPXA 3HKKA 3G0DA 1HA3A 2X5JO 1P73A 5SYMA 2XYRA 5EIBC 1QGUB 5C7IO 1MVLA 4QHTA 3W5HA 3HVKA 5AHRA 5HE9A 4E3WA 5ECWA 2VBFA 1U7DA 4WKNA 4H15A 1TZBA 2G0AA 4NU8X 3I2KA 3UXMA 1QFXA 3VSDA 2QTCA 4B0OA 4J9UE 3DAPA 3EQLF 4IIBA 5DLQC 1G9TA 4UNRA 1TK9A 4F91B 3PHHA 1PJLA 4YPFA 1G8HA 2L0XA 3TI9A 1P5ZB 2XGJA 3E22A 1VC2A 2H3EA 4L51A 1DMSA 3C8ZA 4NBUA 4AMYA 1OAAA 3KMIA 2W4BA 1E2PA 3OLZA 1UR5A 4LFAB 1ADBA 3UB3A 3GG2A 3SOZA 2J5BA 1TJNA 1TB4A 1JWAB 4TTQA 4OMUA 5AXAA 1A0BA 5AM4A 4JJFA 3FNHA 1EDBA 3THWB 1XIVA 3O73A 3UCFA 4P5DA 3EWAA 3RUDA 1EUQA 5BV1A 1BDIA 4JCCA 4EGJA 5AXBA 5JFTA 3N2YA 1YQTA 4AJKA 1I3CA 3U31A 3T95A 4LV8B 4CM8B 4RJLA 5ALEA 3T7JA 4B3CA 1B14A 3H0EA 1UEIA 3IOCA 3T38A 3ZE2B 4ZZ1A 1L7CA 1LX7A 1C8KA 1OIXA 1O6GA 3FF1A 3K0AB 3MX3A 3ZI4A 1YB6A 2NNLD 4IARA 4FHDA 5BMOA 2IM8A 3KPJA 3GFFA 3P97A 4L7QA 5E9JA 3WA7A 2CVOA 3ETEA 1QRDA 2TYSB 4CIWA 2IT1A 1E2JA 3CUTA 1E7QA 4NSNA 3BEDA 4NENA 5L6LB 2LCIA 2IXMA 3KZNA 1W46A 4F6RA 3GANA 5JEDA 1S8AA 3LCRA 1RMVA 3M0EA 3RSZA 4RLSA 3ZH9B 3A32A 3CW8X 4GMHA 3AUXA 3DZFA 4ND8A 1XROA 3F98A 1H8EA 4PPGA 2HR1A 4F3RA 4BB5A 4KBLA 3GG9A 3KT0A 4NBSA 4PHHA 3PFKA 3K6BA 5EE9A 5EESA 5DLYA 1SHJA 2WLSA 2VT6A 5IAOA 4KMMA 1A72A 1XZGA 3R3WA 3SHTA 3V2GA 2ZZNA 4PX3A 1KRWA 4QO7A 3H87A 4N3BA 2VNKA 2W9YA 1FJHA 3KSBC 5BNWA 5LLTA 2VXOA 1EK0A 5KOYA 1UANA 1MEJA 1R4AA 4MRMB 1V9SA 4LZPA 1CEYA 2GEKA 5B2EA 2WPNA 4DCUA 5BSTA 3CC8A 1ZGBA 2PA3A 2J9BA 1WA5A 4NPHA 4BNDB 1UFRA 3T7SA 1UKVY 4H3VA 3K5HA 1H3NA 2JBWA 3QY0A 5JTTA 3OEHA 4EO7A 4OIFA 4PV7A 3WSWA 2GAOA 1QZZA 2XLEA 2EEPA 5J2UA 3AFOA 4BQEA 3IB3A 4TM8A 3NXKA 4NESA 2Y99A 2RI0A 1GZDA 3C0KA 3OAAA 1XSEA 4ZZ3A 1VMDA 3FTPA 4I81A 4EHLA 2BMVA 1QQTA 3IOYA 4RFSA 4CLDA 1CJCA 4JLJA 1ENPA 2VTDA 4JX8A 4IHJF 1TJPB 3FNIA 4CFSA 2O54A 2GK4A 5CBKA 5C53B 5EA2A 4L16A 3ELUA 1XZQA 4LYHA 1WSDA 4UD6A 4F6CA 4CNBA 3IOEA 3PL5A 2JCBA 4OA8A 1G5PA 1T8SA 3QG1A 4M0DA 1LPMA 1CRWG 1E3WB 5HRUA 1KZ4A 1I4OA 4UTPA 2OBNA 1K5HA 2YRFA 1Y8RA 1YCFA 3AY6A 2ZTVA 2F1RA 5DRYA 3VZRA 1X80A 10MHA 3H9CA 3HEBA 3SQWA 2YC2C 5HZGA 4NV1A 1VA4A 3E9QA 2P3SA 5B4UA 4MI9A 1RMTA 1SH7A 5G1PA 4CFYA 1D4AA 3NRJA 1RKCA 2P6MA 1GPMA 1QO0A 3OX4A 4MVOA 4CBVA 4IH4A 1RKBA 4G0PA 4MO2A 2Z95A 2ZXPA 1CDZA 1EB8A 2ZIZA 1NZEA 4G09A 3QOFA 1ETHA 3ZTZA 1QYCA 4NS4A 5HUHA 3UR3C 3ND8A 5I8ZA 1SBTA 1T8RA 2YICA 4MVMA 3TJMA 3B0PA 2FMFA 2F2TA 1J42A 3C3XA 4JQYA 4CXMA 4CU2A 4IWXA 1AO3A 3RF6A 4R2XA 3H05A 1N8SA 5KYXA 3WK7A 3PR1A 2A1IA 3LLCA 4D41A 4CM6A 5JJKA 4U5EE 4B1FA 4ESVA 2R6AA 2O7NA 5CDGA 4AJHA 4FAPB 1S01A 2K6GA 3IQHX 2ZIXB 5TQ2A 1C3LA 5AIAA 3IO5A 5DKFA 3ITKA 1TE2A 3DVLA 2OGUA 2PWYA 4R16A 1EXDA 1ZNYA 1Z0FA 2R25B 5IS2A 3DLCA 1CB7A 1NJ8A 4L8WB 3S29A 2WTBA 4JP2A 1A82A 3S7TA 1ZCBA 2VYCA 4UW9A 4YJFA 4XRGA 4ZI2A 4GI2A 2ID7A 4FR2A 1GRRA 1QG0A 2HRQA 5G4LA 1M76A 4FNGA 3H2BA 3HI6A 2GO1A 4HEQA 3NHWA 1N0WA 4OK6A 4MQ5A 3TNLA 3EOZA 1HTBA 2R11A 3FUXA 2R79A 1NW9B 2EGGA 1IWOA 1H6CA 2PZLA 3UWMA 4ZO6A 3ODGA 5FKJA 5CFNA 4HDSA 5KDOA 3B5JA 2WZDA 3EUWA 1B41A 3CM0A 4Q9NA 1CV2A 4I5DA 4PY2A 1UDAA 1ABFA 4P22A 3EGDB 5LZ4A 3GYGA 3LX5A 4Y18A 1OCZC 1KK3A 3DWEX 4JLOA 3ZLUA 4F56A 2P41A 3CT4A 2X4GA 3HP4A 1E7WA 5KCMA 2ZWIA 1N2BA 4MS3B 3JVVA 1QE5A 2QU7A 1DFIA 5B6JA 5K20A 4RLFA 3SDBA 1KVRA 1UQUA 3MOIA 4BZWA 2C2ZA 4JITA 1SCKA 3FBGA 3H8JA 2RHWA 4I1PA 1NSYA 4P58A 2J7PA 1GGNA 1XNRB 1F14A 3GBPA 2C9MA 2I3AA 1ST3A 2XRFA 4BNMA 4MAMA 2NSLA 1O87A 4B3HA 4X00A 3VZBA 3X2QC 3NBZC 3FSRA 2Y68A 3U3JA 4BEVA 5AVYA 4DIDA 2HTFA 1CQIA 5I7WA 3DBLA 1TKBA 1IZ9A 1X7YA 3HRIA 2Q0SA 2W11A 2ISQA 3T3NA 3F7TA 5B7GA 3PA6A 2EJCA 1ZHXA 4A1OA 1LDMA 4KWCA 2FFBA 1K3TA 3HN2A 3MOGA 3VBEA 3OBBA 3B1XA 2V6MA 2WOJA 3HDYA 3COPA 2OO5C 3ZWKA 1Y3DE 2YIJA 2VNAA 1A2BA 2XTNA 4EYQA 4MVJG 1X0VA 3EY9A 3BTVA 2O3QA 1Z4MA 3KOWA 4NAHA 2P2YA 4I50A 1EVYA 1T1RA 2RB5A 1KYYA 2HYDA 2QQ0A 1OFVA 3F6SA 4DUGD 4K03A 1XLVA 2G6BA 3NQ41 4P5EA 1DARA 4NZ9A 1H65A 1Q1QA 4RCVA 5A0FA 3ZHXA 2MT9A 2HJHA 1Q0SA 3OCXA 3NOXA 3CKMA 3W0LB 2YL1A 2JFYA 2GLXA 4YCNA 2IHYA 1E2KA 2VDPB 3M6WA 4AL4A 2R5WA 3NYWA 4LJAA 4DJ9A 3ZIDA 3S81A 2WVJA 2POCA 3TR5A 1TVCA 5ALKA 3ZY5A 3OQHA 2C5EA 1COZA 4E5PA 1FUYB 3ZDRA 1KAEA 1QWOA 1C80A 4B32A 2JCXA 1G66A 3FWZA 4YFYA 3WDKA 5CG1A 4X7RA 4I55F 2H7CA 4O3FA 3EQZA 1P18A 3QVTA 3F5DA 3R5FA 2WICA 1Z74A 4JL5A 3DH0A 5KPDA 5KUTA 1NRJB 3WRWA 3JQAA 3BJIC 5CJ2A 3LRXA 1M6VA 4UFPA 2OLKA 3ZGLA 1MU0A 5CT9A 3MRTA 1J56A 2XE6A 1MX1A 2FWNA 2RIPA 1E2IA 1HH4A 1NAIA 2NUAA 2MOKA 2CNWD 4US2R 4B40A 2F1KA 4YJDA 5CD1A 3DA8A 5CVEA 3E53A 1N2CB 3FN4A 1Q1EA 2XVXA 1WMSA 3D3WB 1A77A 5I4BA 1T4CA 2QTVB 2I4LA 2R8PA 1MT0A 3L7JA 3BWYA 1ZM7A 4AU1A 1YI0A 3B8EA 3F90A 5A4MS 5JARA 3OZIA 2FPUA 3LP6A 4KX3A 3A70A 2E87A 3BERA 1C30A 1WCV1 2WMYA 5BWNA 4YYZA 1HSZA 1J9EA 1AURA 1DINA 1Y63A 2WPDD 2FFRA 1A9RA 3GLFA 2LIGA 5WRFA 4D9FA 4MCAA 2RE8A 1KERA 1T8YA 4ZDJA 5EJMA 4MAAA 4F7WA 4DOMA 3HI4A 1MX3A 7AT1A 1CR1A 2UZ4A 2QRPA 1L5KA 4HQ6A 3WADA 3UA4A 3UMRA 2A0WA 2VJMB 5T6BA 4IGGA 3F3SA 1J2UA 4M55A 2GAFA 3ZTWA 1BDJA 2V45A 3RK0A 5JJLA 3GLVA 4MVWA 5D5PA 2QVLA 4PPFA 4ARVA 2FZEA 3CJTA 4HAUA 4Y2QA 1QP0A 2XIJA 3MB5A 4GDMA 4BJ5C 1HY5A 3O5AA 4KQ6A 3T1YB 2OHGA 1KEPA 1H9AA 4KB5A 1R5BA 3SSAA 2QPLA 1K98A 1PZGA 3JAWB 2VZ9A 4R8KA 1ZH6A 4B76A 4NJMA 3O3OB 5GIPE 3NYRA 3DOCA 1Z39A 2IYUA 2QTBA 4TMVA 2MHRA 4I1SA 3IC5A 1V3QE 1VHLA 4KSBA 5JQWA 4AQYB 4OY3A 4G63A 2K4MA 5IWCA 3FWYA 5EGSA 5CMLA 1MOZA 5EIAA 2BSQA 2JLRA 1W35A 3TSAA 3ODPA 3LF1A 4MQBA 5T5QA 4B0PA 1SBYA 4YDHB 3VKVA 1F0KA 1KSHA 4CS8A 3UEOA 5E2QA 3U3RA 4CDYA 1V5EA 2AI3A 2H9IA 3EMVA 3AVYA 5IFKA 3TDNA 2O2DA 5K0IA 3TULA 3TM4A 4U6NA 4RZHA 2Q4EA 3NORA 1B3BA 2AWCA 1WUKS 4ZVPA 3FM9A 3TIVA 3U9MA 1BJKA 3CPHA 1PT9A 3DEIA 1QBGA 3OG9A 4P36A 1R18A 3QVMA 4A0GA 4N0EA 4AS3A 5JTUA 4UU7A 3RBZA 2YFQA 4JYCA 2XMSA 2JIDA 3HNIA 3V4OA 2Z5FA 1CHDA 3FCXA 3O95A 3STTA 4TV8A 5JVDA 5DS5A 4RD1A 3S8MA 1PGOA 4FLMA 4TXJA 4U5GA 3GLSA 1XLTA 3MD9A 4E2XA 3JARA 1BQEA 1IJBA 2N46A 4YMSA 5K3EA 1JJIA 3QVVA 2ZUVA 4CYMA 5C5CA 1IQPA 4E5YA 3S1SA 2I22A 3NC1C 1MB2A 4ZIRB 2ONYA 1E9VA 2EPNA 4NAVA 4GX1A 2XNJA 3IUYA 2QX9A 1H0SA 4YCMA 1JPVA 3SX2A 2ODTX 1O5IA 3MBOA 4BO6A 2MIIA 2AXQA 3ER8A 3HXKA 3W34A 2G1KA 3LS2A 2IA5A 2XUFA 3U4QB 1LF0A 3V8PA 3NWBA 5BN4B 4S12A 4CMIA 3T41A 5C80A 1OQAA 4WMLA 3EMDA 2I6TA 3W5SA 1XQ6A 2G4CA 4IO1A 3H13A 3PNOA 4US0R 1UBCA 1Q83A 3MJFA 4EGQA 4ZDKA 2EIKC 3OUZA 4BNXA 2H2WA 3IBTA 4JGGA 4PHGA 4KN8A 4ZGGA 2REOA 3B3JA 4MUYA 1W29A 1SXJB 3TTYA 2H4WA 5IJ9B 1TF5A 4MA0A 5H68A 4ME6A 5HMMA 1SHLA 4D0GA 2ALJA 2HJGA 4PYQA 3RFVA 3FYHA 1ZDMA 1E69A 2C82A 1GZHB 2ZCVA 3N7UA 4Y6SA 1R9GA 1NR5A 3CZPA 3C48A 2X2PA 4TQ9A 1XD2A 4AJJA 3E5NA 3ENVA 3G1WA 1DUIA 1YQEA 4DAEA 4BO4A 1FP2A 3V5XA 4RGVA 1MG5A 5JBNA 2O48X 2EW1A 3WMEA 1E63A 3VU8A 2PJZA 4WABA 1XL0A 3WJ2A 1JUDA 3IT0A 3B0VC 3FRIA 1Z4PX 1MB4A 2GD6A 1JJAA 4FR5A 3FLEA 3U26A 3CTMA 1V7PC 3R5JA 1K4MA 4MV0A 4FCTA 4RHCA 1H9GA 2CCKA 1BYIA 3DNPA 4FMCB 3HCFA 3PVCA 1EBBA 4I2VA 5JQGA 5HK9A 3DKPA 4EHBA 1DKUA 4BJ6C 4KWTA 2B8WA 2P5TB 2JHFA 1DCMA 1G6Q1 5KHLB 3ZU5A 4PJNA 2JGJA 3GCGA 4BLUA 4PAOA 2C0PA 1QUFA 5B53A 4AFNA 2C2WA 4LACB 4MS4B 1NT2A 4OK3A 3HLYA 4HYQA 3AONB 1SRQA 2FMKA 4QYTA 1AXGA 1I0ZA 4UU0A 3N8DA 5LLSA 3HH8A 2NSYA 3H5NA 3WLAA 5G1NA 4CLOA 1TEXA 2EDCA 1LCIA 3GMDA 4FJ2A 5DQTA 4MVRA 5HJ5A 1M6YA 2VI5A 3H2SA 1WVMA 2IE0A 5I6DA 2Q5OA 1SKBA 1FRZA 4J90A 4FD3A 1BFUA 3CMCO 3NKLA 3LGXA 3LYHA 5CPBA 1QTNA 1EX1A 4ULVA 2HBYA 2OILA 4WZAE 4ENUA 4QECA 1M2GA 4KP7A 4YJKA 3GJYA 1HRKA 3DPIA 4BNVA 5JCXA 1Z3IX 3H9BA 1DOAA 4MULA 2QAGA 1YA8A 5DVZA 4QU0A 2ATXA 3PDIB 3TKAA 1THGA 3IDQA 1FCJA 3D8NA 2FSPA 3PCRB 2YW9A 1J8FA 4K9LA 1RP7A 4DSUA 3QOXA 1TM5E 2HSEA 3L7YA 4JI7B 2QRKA 3QQPA 3S1LA 1TYEB 3PPWA 3V33A 3CVVA 4QDXA 1QFYA 1SBNE 4JP3A 4MZDA 3PR2B 5BUOA 1TLTA 1D0ZA 4EX6A 4CIAA 1NVAA 3T5GA 3ZHBA 2W6NA 1V11B 1N0UA 3QNWA 2YHBA 3SZLA 1DKQA 1ZICA 3PSAA 4LRWA 4ML3A 1U1DA 3WQHA 3TAUA 1AHNA 2X9LA 3EHDA 4RPIA 2R6FA 2FX3A 1UZLA 4J7TA 2Z5LA 4P3PA 1XELA 1CDEA 3VX4A 2XMZA 1QSGA 4FFVA 2C2OA 4OQDA 4Y9DA 4J0JA 5BWOA 2A0UA 1DAHA 3MK31 4MDYA 3M33A 2CLLB 2COEA 1ZRHA 1LVHA 2XWSA 3NEAA 4DXHA 4ZARA 1PL0A 3HMQA 3AEZA 4W9MC 3WL3A 2E4ZA 2ZYUX 2C88A 2V6FA 2GEUA 4DIBA 3F6BX 2LRHA 1A8IA 4C5AA 5I45A 3NVAA 4PSVA 1V7ZA 3VPBA 2PWZA 3HCAA 4N12A 2J5KA 3N0WA 3RODA 2YZ2A 4CF7A 4IOMA 3OJEA 1FXWA 3I3OA 4CW7A 4B2IA 4TXHA 4JUIA 2V5VA 3RYIB 1E1LA 3PWKA 1UQTA 3BMNB 1Q0PA 4FYJA 1V74B 3P32A 2FN4A 4QVKA 4U7GA 1AKUA 2PUEA 5DBIA 3CRNA 1PT5A 1SXIA 2YJNA 1A8PA 3NYLA 5DRTA 1PQWA 2JFXA 2DERA 1Z34A 2BKEA 3PRYA 4L22A 3N53A 2MYNA 1PEDA 1QMPA 1NI4B 1OT5A 4JWTA 4JTCB 1IEQA 4I4TA 5A4FS 4XW2A 3F6PA 4L4YA 4WNAB 1LKXA 3NT4A 3WWCA 4FI3F 1YCDA 2IHVA 4JT8A 1JRLA 4JS0A 3D6JA 3WMXA 2YVAA 2B1GA 4JV5B 1UBRS 3K6JA 3ILYA 4ND5A 2OC9A 2BEJA 1UDXA 5AJZA 4FDTA 5F1PA 4TYNA 3VV3A 1POWA 4UVIA 5U9CA 4CIPA 5IZCC 3KYDA 3IULA 3OU6A 1EE2A 2X0EA 3K16A 3ET4A 1I14A 4FC7A 4S24A 5F77A 1HR0B 2DKFA 3DE4X 1J97A 1CEQA 1AKRA 3HJHA 1V1MA 3IAXA 2Y93A 2VAWA 1SXGA 1HUQA 4WLEA 5DHTA 1Z6QA 1DOZA 1G4US 2AOTB 4DFDA 2YL0A 4CG0A 5AKYA 4YASA 1I0IA 1XP5A 3SX0A 2BYTA 1DZ3A 1VG9B 5G4KA 3ROFA 3ELWA 2X2OA 4G5RA 4JBHA 1GHTA 4A8HA 4BGEA 4IHJB 5AVOA 2Z9CA 1LK0A 1KH2A 2D3WA 3LUBA 4CCYB 1ORYA 4YCBA 3K6RA 5ALDA 1TA4A 5MHTA 3GLHB 3ROKA 2GYYA 3C7AA 5BNIA 1OOEA 3ZDBA 5BVHB 4DQXA 3JALB 2XB9A 4ZTZB 1HG0A 2FWMX 4NX2A 5FI0B 1XA3A 3R7NA 1EWRA 3EZFA 4WFIA 5LBUA 2R60A 5BSMA 4LHSA 1CJSA 3GXBA 1ZZEA 4K3VA 4UJ5A 1E2DA 3DD7A 2ZRCA 1V47A 3AB8A 4AP9A 2IDZA 2FZ5A 4BO8A 2WIDA 4ZAFA 3R3SA 5CA0B 4V0ME 1E3EA 4BB6A 1LJUA 1Y9DA 3HDVA 2G5GX 1KDPA 3CUYA 2VHUA 3CZMA 5FADA 4C2UA 2Y92A 4GQHA 4RDCA 4YRMA 3ENKA 3SPXA 3K0CC 3JQAD 2NV2B 4D80A 3H17A 2WILA 4RTRA 4FYYA 4WY2A 4J7UA 1U7HA 1C02A 1DKNA 4E12A 1SUFA 1BC5A 1PL6A 3QBVA 5C51B 1VM6A 2DPHA 3A10A 5H70A 2DETA 2L6GA 3PQFA 2YIDA 4N5LA 1JJBA 5HSWA 1IC6A 4PGHA 2C29D 2PP4A 1AF4A 1NG9A 4H7PA 2HFKA 2QTHA 3TE7A 1Q7GA 3COSA 5IEBA 2D4UA 1C3OB 2E5FA 2AG5A 4CIDA 3QENA 3KE9A 1QQ3A 2ONKA 2FE1A 3Q4GA 5ICMA 2BONA 4NOJA 1YH3A 2YW2A 1C41A 1AK9A 4JL8A 3PNBA 4CLRB 3CXUA 2UU9B 2I2WA 2IPXA 5TQ0A 1FDUA 1CPQA 1GPWB 1ABEA 1U6JA 4PRLA 4YH1A 1FDOA 3BD7A 2HDNB 4K6OA 3A26A 1J0XO 3DUWA 2AG6A 4N76A 1JDBC 1PD1A 1IOWA 1G8MA 3QGMA 1GU0A 1K88A 3B2NA 3DMTA 5JZMA 1JG4A 1DVRA 3OM9A 2XQIA 3H84A 1EHIA 4HL6A 3OHMA 3ZXXA 3DVAA 3QFSA 5AYVA 2WSMA 3OICA 4V0KA 1W75A 3K2EA 4KQ9A 4YV7A 1R6BX 2XJ4A 5JI3E 3N8HA 3PQDA 1HDGO 2H8KA 4M2LA 1RRVA 1JH9A 4OA5A 5KYKA 5HIKA 1OXXK 4QD3A 4WE3A 1WTYA 1RYMA 2C4TA 5E3HA 3RSLA 1QLHA 3ZWNA 5I4CA 2FRDC 4PO8A 5E0OA 2P6PA 2RIRA 3LM8A 2HMZA 2WIKA 1ENYA 3PJDA 3HYNA 2Q9BA 4YTEA 1E7YA 4CTMA 1ANKA 2LTAA 3HCPA 4NJEB 4LF8B 3GZNA 3X1JA 4YC7A 4P86A 1NSFA 4GMDA 3R5XA 4DEYA 2WYWA 5HF9A 4KQIA 3CLUC 3EAGA 4WI1A 5L7WA 4J7XA 3IHKA 4Q1BA 7ADHA 5HIIA 4XH9B 3ZWBA 2QMOA 4OHVA 5HJ2A 1FXUA 2EP8A 1NASA 2G9NA 4U9EA 2B20A 2Y0PA 5BNZA 3UJPA 4BAZA 1MZPA 2I6GA 2PTGA 1QK3A 2YFKA 1P62B 5BXQC 3ZR4B 3UQZA 1EP9A 3GQBA 2YV3A 1AMOA 5EUBA 4EJFA 4H7DA 2MYPA 2BFPA 3SP1A 4EG3A 4XD7D 4DIEA 2GTHA 2A59A 3WGLA 3JAKA 4BE7B 4RKWA 1ONPA 1SVIA 2Y67A 3L9XA 2OBFA 4BNUA 1YJQA 2LFDA 1VCOA 2C92A 2X6QA 3EGCA 1E94E 2IIBA 2JHGA 5EUQB 4TTIA 5AW6A 2J9VA 3R0VA 4LRUA 1PX2A 4M9QA 4FP9A 1L1RA 5EG5A 5K3SA 1GNVA 1P2BA 4NABA 3T9DA 3HBJA 1WF3A 4IGAA 4CTNA 2DWOA 2WNSA 4AG5A 3LESA 4F60A 3EOAI 3QVXA 4WK6A 4V1CI 2OK7A 2WU4A 3GFVA 1H22A 3FPAA 1UDWA 1VB5A 3SBEA 1DEXA 4GXQA 1IY1A 1Y0BA 2XT6A 4TKMA 3HDHA 4RMJA 1X7WB 5L3QA 2A5YB 4DM7A 2F3QA 4YJWA 3O1IC 5A9SB 4Z9BA 4R9RA 3Q0EA 2YN4A 3IV7A 1JW9B 3DPUA 2WLTA 5A9RA 2GFIA 3AXSA 3AMVA 2XUJA 3ND5A 4W63A 5TNXA 1QR2A 4ID3A 5AOBA 4EDFA 3CEXA 3CEHA 1R4MB 1FMTA 2LD6A 2XL6A 4KQKA 4X44A 3OOHA 3WK9A 4YYEA 1PQUA 4ZKEA 4O7GA 2M6SA 1NPYA 2V0GA 5HFNA 4C7BA 3GRCA 3O74A 3WNQA 1LRKA 3WFJA 3GM2A 2R00A 5DW0A 1GZ6A 2PKQO 3P71T 4YRBA 4U7DA 3PWSA 4U7WA 2JCVA 3Q5GA 3RASA 4DLTA 4EFLA 5EPEA 2Y9MB 3OE7A 3LA8A 2P9EA 2BFEB 5JHGB 4XM2A 1ZL2A 4JOCA 4H1TA 2GJKA 3GFTA 3G1TA 4HDKA 3AUSA 5HQTA 5LXTA 3H1TA 3P9ZA 4Z2YA 3RVDA 3CUKA 4XQGA 2H6EA 3RS5A 1PIWA 2QNRA 121PA 5FNZA 4D1YA 3HJNA 4OAQA 3KXKA 2BFOA 4EY5A 3SS8A 1NI5A 5FOTA 1GCOA 1W85A 4RDHA 4Y7DA 1EDZA 2JRLA 5BWMA 3B9PA 1WZNA 4K05A 4YWJA 2CFOA 1I33A 2PUFA 3EJ6A 4A2PA 3WE7A 1FQJA 4LDAA 4RNDB 2IVFA 1N33B 4BKOA 3NHAA 1DAOA 1S02A 3N3BC 1DKPA 4L75A 4LE1A 5PGMA 1ZIPA 3GLGB 2GN6A 3WHLA 2J3KA 2YL7A 1QPZA 2I9PA 5H8WA 1ZZGA 1ECFA 4NNOA 1GT91 5T4FA 2P7HA 4F5DA 3GRUA 4OMFG 4PO3X 4WUVA 4MH0R 3UJ9A 1NMXA 4N4AA 1SHTX 3ZHCA 3QE4A 1M5TA 1VQ1A 3L07A 2H5LA 3PDMP 2NXWA 5BNTA 1A8QA 2X7XA 3I8OA 3KQMA 4E2ZA 4IOJA 4EI2A 1LVKA 1E2FA 1TECE 2FRVA 7ABPA 1U2GA 3JQ8B 2FPPA 4WFQA 4FMDF 3IHUA 5IKOA 2BEUA 4ARIA 5ENVA 3QBJA 4AX4A 3G6WA 3ST7A 3G2LA 1IIBA 4ZEVA 4MPTA 1VJGA 2Z8XA 2JIMA 4AI6A 1NLFA 3GRPA 3LUFA 1P0PA 2PLNA 2BZSA 3GRKA 1HKUA 4PX5A 4UE2A 3IP8A 4XJTA 1J25A 2P0NA 5DSXA 5JALA 3DAOA 3QWBA 1QRSA 3E9EA 2UUHA 5IJZA 3NBAA 1Y3CE 2WIFA 3D8RA 2QXUA 4N65A 4OD4A 2JATA 5BQOA 4D43A 2D1FA 4LDPA 2R751 2HQSA 4ODIA 3PX2A 1CFJA 4JT2A 4MTLA 3W8RA 2HDWA 3C3CA 3P2OA 5AVJA 1CIVA 2B21A 4ALIA 1X42A 2YMMA 3B6EA 1Y5IA 5LL6P 3OO1A 1WBDA 3MRVA 1REQB 1N5MA 2HBQA 1QYIA 2WD8A 1LDYA 3VGPA 3W05A 4LMAA 3JTLO 4H3KB 1QP7A 4DR7B 4P4UA 3RB8A 4EJMA 1XTPA 2JAXA 4ABYA 1W7AA 3HWRA 4A0FA 2OECA 5KHAA 4IIUA 1SF8A 5DXAA 1JIKA 2VP6A 1Y7LA 2ZREA 5I7UA 5FO1A 3PD0A 3MGBA 4CR8A 2BVNA 2YYSA 3VJKA 4FMPA 5T8KC 1B8UA 1BSVA 3BF8A 1SC1A 3HKCA 4MVJI 1GV1A 2NT3A 4O4JF 3IPLA 2G8LA 3PYLA 1NJ1A 1VE5A 3RT1A 1EFTA 4JOSA 1L9KA 5TMEA 4K1LA 2CL0X 2CZGA 3MJTA 4ZQFA 4B6EA 1S4QA 1PYGA 1MR3F 2HIHA 4L5CA 1DWOA 2XWQA 5JC8A 3TH5A 4LX8A 3BMCB 2KC3A 1AA9A 1OXUA 1YWGO 5IDYA 4DNOA 3KEGA 4CS9A 1KIAA 5E1MA 4N54A 1UDCA 4AJ4A 5GQSA 4BJ3A 1MF7A 4BNJA 4XPWA 4Z6KA 2HJMA 2CWDA 3KB6A 4HJRA 1GAEO 3GEIA 1JQKA 4EIYA 1URPA 5IBCA 4JJEA 1KEEA 2NSHA 2CCYA 3DFKA 4KOAA 3T9AA 2VHVA 4O4HF 2NYUA 3WOVA 3LIIA 1F2UB 2FOLA 1AUXA 3FOEC 1NBME 2IK8A 2V7GA 1ACMA 3BORA 3ZJYA 1E0SA 1EUCA 1IHYA 3ZEAA 4GG1A 3QE9Y 1U3UA 2OLJA 4JB8A 1YHNA 5ERGB 3LRTA 2P91A 4GVLA 3EVNA 3L82B 5L4NA 4YP5A 3UMBA 1I51A 5DX1A 1JHRA 2VQ6A 4YT5A 1LGYA 2OV2A 1WXQA 3W2EA 2CDQA 4OLBA 2HF2A 2WUVA 2O1WA 4FCWA 3WB0A 1ZD3A 3TW0A 1IRXA 3FAZA 4QQRA 4N06A 2IEDA 4HUQB 1UKZA 4MV7A 5E2AA 2H59A 3V7WA 5HGJA 1ABBA 2L6FA 2OORA 4PNEA 5KSWB 3VO8A 1I2BA 1NBWB 3FMGA 4V0NA 4B4VA 3WLQA 1DKRA 1CR0A 4R8RA 1XCGB 2P5SA 3R3JA 4LC0A 4KQ1A 2J59A 3EB9A 3VU9B 4HSEA 4BFSA 4KUEA 4X62B 3B1ZA 2WM9B 4RFLA 4XIIA 3KKOA 4IM7A 3UHOA 5ITZA 3R6LA 2D1YA 4GMGA 2Q6TA 4BP1A 2D5RB 3TMKA 5DF1A 3ZG1A 4IY1A 3I6IA 2UYYA 3ROTA 4FI3C 2A9VA 3CBGA 3KR9A 5K6TA 3ZG6A 1N6PA 4WINA 3I53A 1EKXA 4B44A 2FRXA 3TDMA 4NP6A 2XHZA 4WZBB 1UC9A 1NGSA 3DFMA 5E3CA 5L53A 3ECSA 3QKUA 1AG9A 4LKOA 4EJSC 4PQEA 5F23A 2REXB 4PLYA 4D6PA 3NMKA 3KETA 3GNLA 1P0IA 1JFTA 4C7VA 3GGDA 1BQ4A 3OQJA 5G0TA 4S0XA 3NDBB 2W2KA 4DGSA 1HLPA 4KO4S 2XMQA 5BNFA 2OKUA 1A4RA 1SULA 3TNJA 4MGEA 2PWPA 5THQA 1ZEJA 1Y3FE 2L9JA 2I4TA 4QIHA 2GDZA 4M6WB 1GLVA 2P2DA 4ZYWA 1OVMA 1P0MA 3AP1A 3LNMB 2H7BA 3UV3A 3IQWA 3I05A 3GD7A 2B7CA 1SZPA 2OV1A 3KUCA 5A5GA 3UY4A 3CH7A 4L57A 2VPXA 3T61A 4LN1A 1Z0JA 2VSQA 4GLJA 4OD5A 3NV9A 3X2SA 1U0SY 4C30A 2GASA 3SXKA 4E32A 4GOJA 3MIZA 2BEVA 2I78A 1Y1QA 2WJPA 2HS5A 4HB4A 4G78A 4ARUA 3DI5A 1EI7A 4KXYA 3I72A 4Y6LA 5EHXA 1VE1A 1GILA 4WA7A 1IDOA 2P30A 4YHBA 1ND6A 5DLPA 4Q6WA 5EYPB 5BVGB 1YU6A 2YBEA 1ZYUA 5CJPA 3G9UA 4UULA 1VMAA 2BFBB 4PTZA 4E4RA 4JT9A 4X20B 1M7BA 5LP6B 3K0HA 3S5UA 2FPXA 2AFIE 2YQ5A 4BQRA 3O93A 2R7LA 4J0IA 1AB6A 1MA3A 1Z0DA 4PG4A 3G13A 2OOCA 5KQGA 1GAQA 2FF5A 3LC7O 1M83A 3HS3A 1NX6A 3C43A 1T25A 3JSXA 3BT7A 1SOAA 3V3TA 3MTIA 2XVYA 1EHYA 3TOVA 4BMNA 3S68A 5CA0F 2XZDA 3IEXA 5H83A 1MQSA 4AMVA 4P8RA 5FTMA 4Q9HA 3V7YA 4ES6A 3AU9A 4L8FA 3QVYA 2P2GA 2QJWA 3IUNA 4PZZA 1PF7E 4GMKA 1M73E 1WRBA 4CQLB 2SKEA 3SS7X 4PZAA 1SFRA 1OX4B 3EXFA 4HXGA 1T5BA 1TQ6A 3ZLTA 1V45E 1F17A 2FPIA 3NJ8A 3VBCA 3KG2A 5B36A 1XZCA 5DPMA 4Z86A 3LVRE 4IUDS 3G6KA 3FOCA 1Q77A 1P31A 2V6BA 2BMWA 1KOJA 1CF9A 3OWTA 1RAAA 1DIAA 1VRVA 3O90A 4ZOQI 1A2KC 2XRZA 3C74A 1U6KA 5CX1B 1QF9A 5SZIA 1QO9A 3CRRA 1GNPA 4BLOA 1O8CA 4OJNA 2UZAA 4NBKA 4H1UA 3LRPA 3OEYA 3PGMA 1DJPA 1YXMA 1HDIA 3CUEF 3H8SA 4HJXA 2VKTA 5CVJA 2OSVA 4JR2A 3IIEA 4YJ2A 1IPFA 4Z99A 2VWQA 3AI3A 4P7BA 5T6MA 3AJEA 1P7CA 2PGAA 4KV7A 3MWGA 1DXYA 1G21E 2QYHA 1LZLA 4HGZA 3OT4A 2WF7A 1LF5A 4EJSB 4RPCA 3SXPA 2A6EF 3NIWA 2KQ9A 1YRYE 1FNMA 1ZHYA 2X0JA 4UTRA 3ABIA 3CZCA 1Q1AA 2I6XA 2YHIA 2A9QA 3QVOA 2CE2X 1LK5A 4K8OA 3UXHA 1T6ZA 1AOXA 1IEVA 3TXXA 1EQ1A 5HR5A 4R1QA 5AVUA 2V5UA 3GCXA 1WW3A 1C9DB 2ZRFA 4I3MA 1I1NA 5ELMA 2X0IA 4DNPA 1RLOA 4M9ZA 5HCUA 3TLYA 2WI8A 5FLYA 4BFVA 3VHLB 4N0MA 5KSOA 5BWLA 1TFOB 5EJ4A 2CDCA 5JS8A 4WK0B 1KO4A 2F9FA 3WDMA 3CW2A 1SEVA 3RU2A 1RHQA 3T4EA 3K5PA 2V7XA 1I1QB 5EUMA 2OVBA 2XITA 1Z4IA 1QRUA 5KC8A 5FO0A 3V2HA 2AOUB 3CZ9A 4CM7A 1RI5A 1JPJA 3IALA 3OTHA 5LU8A 2CMGA 4KQEA 3THSA 2DCUA 3BKWA 4Z0PA 5CB0A 4N8SA 3CWQA 1NBAA 3SJZA 5IM5A 2W7TA 5JAPA 2C97A 1KORA 1AVTA 4I99A 2PS0A 1FR0A 1RCUA 1NNUA 4V0SA 2A1TS 2BI4A 1XMQB 2QMHA 2ZB2A 3LJBA 3ADPA 3ZGYA 1KI3A 3S4YA 1HE3A 4G8DA 3RJ5A 2CJYA 5LB2A 3ETNA 3ZWVA 3ILHA 4L8LA 3AKYA 4O63O 2VSYA 1VLHA 4OL0A 2X0RA 4M0PA 4N6GA 3G82C 3IBSA 4NG5A 1RWWA 2INGX 2YWFA 4K40A 3RC1A 2UZ3A 4A2NB 4DDWA 1KWGA 4UHDA 2VATA 5K0CA 4Q3OA 1PR2A 2FW8A 4I6JA 2IYWA 5EHQA 4Z49A 1ZYRF 1MLDA 3LCCA 3BWDD 1RP1A 3O91A 3MBIA 3RU7A 3G8AA 1QIEA 4EBFA 4KVFA 2RHCA 2A69F 4K2AA 4R9VA 5C37A 2OR3A 3CLSD 4MVQA 1KE2A 2NP6A 2GPTA 1JHVA 4OU4A 2UVDA 4TWRA 2FQQA 4WV3A 3TINA 4KG7A 1JU3A 4M4SA 4PLHA 2XNKA 1NZDA 1MT3A 2PX0A 1JKXA 4G7HF 1M7GA 1VMIA 3KUDA 1CLEA 5B6PA 3X0DA 3DMNA 1B6TA 3GL9A 4KWHA 3HBFA 4EY7A 2AB0A 4S04A 1NDHA 2VC2B 1S8OA 1AHPA 4MRVA 3SR4A 4QOSA 1LTQA 3U39A 5MFZA 5DMXA 2OHIA 3GN2A 4QUAA 3ZWAA 4RF4A 1QH1A 3R7WA 3KKEA 3LCUA 1N75A 1ENOA 5JCPA 3FSGA 1XTSA 3KELA 3IX7A 2CMDA 1XMPA 4CGYA 4BWYA 4J75A 3AR6A 1O03A 3FPBA 2YIMA 5C8YF 4GW3A 2D1TA 4QRHA 2FWAA 4PLCA 4C3VA 5L8VA 1PFVA 5IUKC 1L4NA 1YAHA 4D8XA 4HDRA 1VL5A 1UFQA 1AGNA 3AR4A 4LRTB 3GEPA 4MVUA 3POVA 2YMPA 2O1EA 1QH8B 3QVKA 1KR5A 4RAOA 1OHHD 2F6RA 2ZBFA 3EIUA 4O2BA 1DOWA 1MDBA 1JE1A 1RLJA 2IOHA 4Q7CA 3HWWA 2NU6B 1JR2A 5AJHA 1W5TA 3IQFA 2IZ6A 1GUAA 3CINA 1MO5A 2PKCA 3DBHB 4LC1A 3VSBA 5EP1A 5IJAA 3LPAA 1RKEB 2IDJA 3ICQB 2AD1A 1K8YB 5IVKA 1RXWA 2ZI7A 1E89A 1PT8A 2OEPA 1NM5A 4B6FA 1SXJC 1QHIA 4QTZA 1P1HA 2PFDA 2JHAA 1H93A 3H7AA 3CCFA 3GFOA 2R4UA 1UXOA 4HN4B 4AUNA 4DREA 2ZM5A 3LT4A 1VHJA 2Q6IA 3AETB 2D8AA 3IH5A 3KT3A 1E1DA 4AULA 1ZOLA 5JCOC 2OBMA 5E9QA 3EFOB 4RABA 2GJSA 2XLDA 3TFQA 1DUSA 1T2UA 3AT1A 5DLJA 5DFAA 1TLLA 1TYBE 3C7TA 2WF8A 1GTZA 3CBQA 2PR7A 4IGKA 3D1LA 4LK3A 5ALNA 1GKYA 4AK9A 3EVFA 4KQXA 2WSBA 5D5HA 1JZQA 4GD3Q 3W5IA 4EWCA 1FLVA 1MXHA 4GL2A 2LV8A 5I4IA 4Q3CA 2EFHB 1TT5B 3WYCA 2B4TO 5CITA 3RADC 5FEUA 5KQRA 3VNQA 4O4IA 2C57A 3F6CA 2CV1A 1I32A 1L4MA 4K9DA 3EIOA 4I6GA 2IEIA 3ILXA 4OHYA 3KKQA 4IRUA 3PXCX 3DBVO 4B79A 3EC7A 4XSGA 5KEIA 1PTJC 1UFBA 4A73A 1ZCAA 1V3UA 1WY5A 3EFHA 5ERXA 3LL4A 1QONA 1XVUA 2GNOA 1CTQA 1JWLA 1UBOS 1DRJA 5GTDA 4ZKDA 3RRMA 2FLKA 4MLPA 4PYIA 1JLRA 1E7SA 2IGBA 2GHIA 2WIBA 2PUDA 2W4IA 1NSTA 4OHBA 4YJHA 2Q1XA 3IVXA 2FNAA 1NN5A 2Q2VA 2C1XA 4Y2UA 4OHOA 1M2VA 3P4UA 3F2VA 3U4DA 5JUWA 2ZB7A 3U4AA 4DRJB 4MS1A 2HGSA 4IDBA 4J1QA 2HLDA 7GPBA 3KWFA 3WRYC 1IE3A 5JZOA 4FIZA 5G1OA 1SCUA 1VDZA 4OQFA 5A6SB 1RWMA 4DQVA 2H4JA 2QN3A 4C0JA 4RO0A 3GYBA 2FJ0A 3AHGA 1MUUA 3G0GA 1VL2A 4C0HA 1ZIXA 421PA 3AV0B 1QP8A 1ZWLA 4X63A 3U5ZB 3G5MA 4IJUA 3CF0A 5IDVA 2GK3A 1KYVA 5ILQA 4W7HA 2Q3HA 3A2LA 2Q3JA 1U31A 3H8WA 1TM1E 4DR1B 1IOVA 2I7XA 3T15A 5SZJA 2BE9A 4YP0A 2Q4BA 4MX8A 5CBPB 4CI9A 1DS6A 4MP8A 4QUKA 1NFQA 4E7OA 4NH0A 4CN8A 4QXOA 4RA6B 3NATA 4TS3A 3R9XB 2ZT8A 1NR1A 2RAFA 3G68A 4NBRA 2IS1A 2OJQA 1YR2A 1D9XA 2IXNA 1WUTA 4AIRA 1SPBS 2XCLA 4MYTA 1JWBB 2N42A 1TC2A 4KQJA 4B82A 3WYFA 3H99A 3AR8A 3H3FA 2BELA 4C4XA 1TADA 1Q6ZA 2PK3A 5EJ8A 3LDUA 2ZB8A 1DLJA 4N3AA 4FJ0A 4Q1FA 3CLKA 3ZDFA 3DOUA 2M4EA 3V48A 3L1IA 3EGXB 1ELOA 3E1GA 1RYZA 3WLLA 1F8YA 1H8ED 3AM3A 1BDMA 3IMCA 4NC3A 4CKXA 5JPDA 1PK8A 1U3VA 5HQ3A 3EMBA 3IUPA 4BKQA 2ZDGA 2A94A 3P9KA 2DQ4A 3P0JA 4R7ZA 5KJ6A 4FMDB 1JG6A