1U6HA

Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
252
structure length
252
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title A vinculin binding domain from the talin rod unfolds to form a complex with the vinculin head.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 102
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2004-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1u6hA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1u6hA01
1YDIA 3H2VA 5FZTA 2GDCA 3TJ6A 2B0HA 4IGGA 2L7AA 5L0HA 3H2UA 1RKEB 2IBFA 4PR9A 4EHPA 5L0JA 1ST6A 1TR2A 1DOWA 3MYIA 3TJ5A 1QKRA 3RF3A 4E17A 5L0GA 4E18A 1U6HA 3S90A 1U89A 1ZW3A 3VF0A 1L7CA 1H6GA 1RKEA 5L0CA 3ZDLA 1SYQA 2LQGA 5L0DA 4W8PA 1ZVZA 3T6GB 1T01A 4P9TA 1XWJA 5L0IA 4ONSA 5L0FA 1ZW2A 2HSQA 1DOVA 2GWWA 4K1OA 4DJ9A 2X0CA 1RKCA
chains in the Genus database with same CATH superfamily
3SNHA 4JW1A 2PFDA 4CS7A 1OXBA 2EIKC 1D1AA 3HJCA 3NYJA 3K1IA 1EI7A 1M2OA 4LDQA 3DXJF 5F28E 2R03A 1WWPA 2W9YA 2DB4A 3DAFA 3O55A 3EG9B 2PNOA 2VASA 4GEHA 1JPNA 2R7QA 3NYLA 2NUTB 3JYHA 1E2XA 1H6GA 1D0YA 1Y6DA 5E3CA 5JP7A 2G3VA 3EHMA 3EH1A 3IQ5A 4DXWA 4CDVA 1OCRC 1Z23A 2XLVA 3B0VC 5BQIA 1TWGA 2Y69C 1ZHWA 4XEFA 1I5NA 1FAPB 2HMZA 4EWCA 4NQFA 3W8HA 2EINC 3HNIA 3C7JA 3LNRA 2W4MA 3MYFA 2NG1A 1R4TA 1GS9A 2G3KA 1TKNA 2HV6A 2Q9CA 3C8GB 3JRTA 3NG1A 3QTHA 3U8PA 4YN0B 3HTKC 5HV9A 2A1DD 3BRJA 1BR1A 4JRZA 1A7VA 3GEHA 3LUTB 4GYTA 4IARA 4JZAA 5K0IA 1R5ID 3LESA 3MYIA 3N24A 1U0BB 3ZTZA 3EGXB 1TWAA 4C3DA 2HMQA 1F1MA 2HZ8A 2I15A 2YHSA 2R25A 4QI0A 5L0CA 1HMOA 4CJOA 5EGYA 3DWWA 5DS5A 2QTVA 1SMYF 4C7OB 2Q3TA 5D91A 4CS9A 4ONSA 1HY5A 5JSLA 1V55C 1M57C 4IAOA 4HEAJ 2D5RB 3EPVA 4ULWA 4XTKA 4LERA 2P61A 1L3PA 3T6BA 2NUTA 3V5ZA 2PX3A 5CI9A 2BE5F 4MTGA 1YA7O 4NTBA 5CIVA 1BZ4A 3LAYA 4A2NB 5AC4A 4CIHA 4NTFA 2J9BA 3RH3A 3V5XA 5HSWA 4JEAA 4EIYA 2XXAB 4DOZA 1H9GA 2IBFA 3L8JA 5BQGA 1Z5ZA 4FAPB 5F5HA 2KNHA 4DVZA 1K05A 2WZFA 4P6IC 2J9UA 3RQEA 4AL0A 3RF3A 4XPYA 2E87A 4PJNA 1T6IA 2IYLD 1LE2A 3O6XA 4W8KA 3S90A 2CYDA 2IXOA 1C17M 2XLEA 1Q0GA 3O10A 4JEBA 2R7XA 4JTCB 2RSEB 3GM2A 3S84A 2HKVA 2JD3A 2LP4A 3S0XA 1T9KA 3I5PA 4IB4A 1CGNA 4IJJA 3BEHA 3N0TA 4LDKA 2J0XA 1LKXA 2OEXA 3FXHA 4UDVA 2C03A 2KK1A 2NSGA 5E33A 2R7TA 2J8WA 3HKKA 4YL3A 1LI5A 2XM4A 1YJGA 3H65A 3KH2A 1IZMA 3L1MA 3WHNA 2GA0A 4IRUA 2AVKA 1ZYRF 1BBHA 5TJ5E 4AK9A 1KU2A 3F47A 3M79A 2UUIA 3AGUA 4I1MA 3Q6MA 3C18A 4E7ZA 1OW7A 4H4KC 4BJ6A 3U2MA 4E17A 4MS2A 2ZD9A 1OKKA 1TWHA 5T1DB 4YWQA 1MNEA 2VCBA 4G7HF 3VF0A 3QVYA 1ORYA 3LNMB 2L6HA 4K7BA 2P1AA 4JC7A 3C8GD 3RVZA 4CBEA 2LQGA 5KYWB 4MVQA 2GFHA 5IY5C 2YWAA 5A6JA 1FR0A 4AX2A 4U9DA 1C02A 2CW0F 2Y3GA 4O6YA 3W2WA 4DVYP 2J46A 3K1HA 1QVXA 3NKDA 2MWQA 1JMWA 1PV3A 2HV7A 1LS4A 2F22A 4ANJA 2XSEA 2CDQA 2EPKX 2CGEA 2GDCA 2J7PA 4OD5A 3VYWA 5JT4A 5JUAA 2H8AA 3TK0A 1JR8A 1RKEB 1G5ZA 5A6BD 4PR9A 2YZSA 4DBQA 3FMSA 1KTMA 3C62A 4JE9A 4GQHA 3U9MA 4JVSA 1FFTC 3L0IA 3IHUA 3PCVA 4PK4A 2QY9A 4XWJA 1ZW3A 3TD7A 1L7CA 4ULVA 4Q5SF 4QDLA 3U5SA 1VMAA 2D4UA 1NBBA 3HNJA 4JJFA 4DRJB 2AWYA 2ZXPA 3FOOA 3KYIA 1YZCA 4W8PA 5B3SC 2KYHA 3PHF2 3U0CA 4ZLDA 3JTLO 3DJNB 3GM1A 1SZIA 1A7DA 1S05A 1JRAA 2PP4A 3GORA 3OA1A 4JTAB 2J45A 3G50A 3V7OA 4YT4A 1OCCC 1CPRA 4BEJA 2KJGA 1J8YF 3DE9A 1M56C 2QUPA 1T6UA 3E9VA 3UNGC 1MQVA 4B6IA 4BJ5C 2L9JA 3US6A 5KYWA 1EKYA 1VK5A 2EPLX 2XL4A 1EQ1A 3SXZA 1YDIA 4C3EA 5FZTA 3TOMA 2EPNA 2XRHA 2XLHA 3QMKA 3U3FA 3CEXA 3B0UX 2R7VA 3B71A 1HMDA 2YQYA 3UGOA 4BJ1A 2YKZA 1H9TA 2ZPAA 3SXMA 4YT5A 1V54C 2BC5A 1QPUA 2HSBA 1D0ZA 1MNDA 2O9XA 2P6VA 3UR3C 2A6HF 3MX3A 1U89A 4WGZA 3OWTA 3ZG1A 1RKEA 2OKUA 3S9OA 1AUEA 4NC3A 2IM8A 4WABA 3W8IA 3B9QA 5EK0A 3J06A 1XWJA 3NDBB 1G8XA 2EPMX 2OU6A 2Q7RA 5F5FA 3LLKA 2P7VA 4PJMA 1E84A 2XLWA 1T5OA 2R05A 3EHNA 3EH2A 4HFKB 4AL1A 2WZGA 4Q4ZF 3CSKA 256BA 5L0HA 3HNKA 3DJUB 3DM5A 3H2UA 4I3MA 1ZHYA 4EBBA 3EZIA 3JSEO 4WJ0A 1YLMA 2LIGA 3C63A 5AC5A 4CS8A 1ST6A 2YLIA 1SR2A 3IQTA 3E70C 3QVZA 5L3VA 3DMDA 2AP3A 2J9VA 1TQGA 3TQOA 1A7EA 4JCZA 2OCCC 2B0JA 2HFIA 3S28A 2RD9A 4U5BE 3RQGA 1BDJB 1SF8A 2YL0A 2GAQA 4AE4A 4CJGA 1UG7A 1NZEA 3QW0A 4O79A 4ZLCA 2W45A 2ZXWC 3VM6A 1FTSA 3M4CA 4EBJA 3DE8A 1LPEA 2HJ3A 2R02A 2Y3BA 1JAFA 1OXKA 3VAYA 5KYUA 3IEEA 1ZHZA 3ZWIA 2H7BA 3H2VA 2Q9BA 1VYKA 5E3AA 3SZRA 5DQTA 4MVUA 2WVQA 3GEIA 2XS1A 3K1IC 4CSAC 3GM3A 1TR2A 3JSZA 2VB6A 4I1OB 3DM9B 3TOLA 4CDYA 2R7RA 2KQ9A 4EBKA 5DQZA 2CNWA 1RMVA 4XLPF 1LE4A 2QLAA 2HJMA 3ZDLA 4MNDA 1YYJA 3LEOA 3RKOF 1WN0A 3K7DA 5KYYA 5T3TA 1D1BA 3ABKC 4JCHA 3T6GB 1BR2A 3S27A 3T9OA 3TJ5A 3UMIA 4MQ9F 1YVIA 4YL0A 2NUPA 4XQ1A 2Y3HA 4J7YA 5KYNA 1Z3IX 1E83A 2M64A 3QW1A 1NLXA 3NMIA 3RYLA 4PJLA 1GQAA 4FX5A 4OINF 4JKVA 4DBRA 2VCAA 3UMKA 3FAJA 3RVYA 1O3UA 2CCYA 4Z9HA 1WTYA 4LLEA 5A6AA 2FGYA 1QLEC 3Q7LA 2XL8A 2DYSC 1CGME 3RFYA 3U2LA 2A0BA 2VH3A 2Z15A 3VRCA 2R9RB 4MVMA 4M63A 2YLGA 3HNLA 3KKBA 3RW0A 3KPHA 4CS9C 4PFOA 1HW2A 2QNLA 3FHDA 1C03A 1FNTc 4KBLA 1CGOA 4DJ9A 2X0CA 1IW7F 5E2QA 3WG7C 3IPMO 4MVOA 3RQFA 1Z6AA 4JURI 2L7AA 2VCCA 4Q7CA 1Q0KA 5B1BC 4WGYA 4RD9A 1RXQA 2C04A 4N06A 1DOWA 3ASNC 4DRHB 1EA8A 2YL3A 4E18A 5DVWA 2JX0A 3ABLC 4OIOF 2R7SA 3ABMC 1OKKD 3EGDA 3U9JA 2G62A 3T6JA 5DS4A 1B68A 1OR2A 2NSFA 2EPOA 1A41A 3KYJA 3QZCA 5L0FA 2R7WA 1ZW2A 2J9WA 2UUHA 3Q7GA 2EIMC 4P9FA 4KNWA 1YAUO 3AG3C 2GWWA 4K1OA 4EKWA 4BPMA 1NG1A 4MW8A 3GWLA 2LK4A 2L81A 1ORJA 1OW6A 2LFFA 1ZHXA 2QE9A 3NMJA 3WODF 1E85A 3OEOA 4U9EA 5AGFA 2B0HA 4IGGA 1HE1A 1OCZC 4FESA 3X2QC 5BUOA 4I44A 4OIRF 4XEVA 1QQ3A 1VYIA 2J7PD 3GEEA 1LI7A 2NPUA 3AG2C 3C8ZA 3MFNA 4AE4B 4BJ6C 1KNYA 4F4BA 1K40A 5L3QA 1VLSA 3EFOB 2ETSA 2LD6A 4EUKB 2W4BA 3ZSUA 1VLTA 4O6NA 4C3BA 1NFNA 2DI3A 4RDAA 4U5DE 5GPGB 1Z7Qc 2LCHA 1T01A 2HUJA 3AG1C 3LS0A 3M4BA 3WAQA 2V26A 3ZQYA 1HW1A 2IOQA 2AWCA 2HSQA 2WVNA 3DKAA 4KC9A 2V3CC 1DOVA 1XZPA 2KSFA 2YL1A 4YK5A 3L34A 1S7ZA 4MTFA 1LS1A 4A4AA 2OEVA 3R7CA 3X1OA 3FDQA 2FAPB 5CI8A 1TWCA 2XM0A 3AQBA 3SP1A 1I4ZA 5EHHA 1WOLA 1VOMA 1D1CA 2OG2A 5T3WA 3EZHA 3FVYA 2Y3DA 2MHRA 3MBGA 3NMKA 4CSAA 3EJNA 3I4UA 4EHPA 4E0HA 4XEKA 4IAQA 2IXMA 2PF4E 5JRAA 2M4EA 5D92A 5KYYB 4H54A 2OJED 3NKEA 4O7GA 5DS6A 3JZ0A 2LSEA 1FFHA 1JOGA 1AEPA 2Y39A 4N6CA 5KYUB 2NUPB 3KL4A 1RJ9A 1LIHA 4CX9A 4K0DA 4DRIB 5B3IA 2IXPA 2WB7A 2AU5A 3O39A 3EFOA 4L6RA 2H7VC 2Q4FA 4U5HA 4XLNF 4Z9IA 3GWNA 3V5YA 4MVZA 4N4WA 4XPWA 4BG0A 3ECSA 4MTOA 1MMGA 1BR4A 1MMDA 3IQCA 5KYXA 5JVEA 1MMNA 5A6KA 2HS5A 1ZZPA 2R7UA 5A69A 1HE9A 1AVOB 3B29A 3DZAA 4U5FE 5L0JA 4BJTA 1PD0A 1FMVA 2EILC 2ICWG 3UGPA 1LVKA 2LFDA 4G78A 5FCLA 4U5CE 1Z63A 3T4RA 2A69F 3AQCA 2KC3A 1K04A 1PD1A 2YLDA 3MLGA 3Q6NA 5L0DA 1GM5A 2PX0A 4IWBA 3EG9A 4P9TA 5L0IA 3CQZA 4YT2A 3TULA 4G7ZF 4PACA 4RBNA 3EQLF 2L6GA 2A68F 4FWVA 2X51A 4J32B 2MYSA 1APCA 1YYXA 3ZTMA 1RKCA 4HE8D 3UMHA 4G0HA 1OW8A 3GODA 4ER9A 1WATA 1H7IA 1UFBA 3DD7A 4YL1A 1QSPA 4MW3A 2YL7A 4MVRA 3EGDB 1Q0DA 5L0GA 1QKRA 3ITFA 3AOUA 4CS8C 3C8GA 4U5EE 1U6HA 3FOPA 1Q0FA 2ASRA 3ZVRA 1TFKB 3K6BA 4JIOA 4CDAA 2WVOA 2XLOA 1TFOB 1ORSC 2YRFA 1Q0MA 1M2VB 1G4WR 1MMAA 3I5QA 2CNWD 2L6FA 1W2WA 2VC9A 3S29A 5JS5A 3PDMP 1NSGB 2ZXRA 1NU9C 1VB5A 3LJBA 3EGXA 3ZIBA 4U5GA 2BL2A 1OCOC 3DI5A 3KMIA 4N6HA 4Z9JA 1OR3A 4BJ5A 2YVKA 3CZ6A 1NU7D 2KW3C 2A0UA 3AJMA 3RIPA 3N2ZB 4KNVA 4NCQA 2YEVA 4R32A 4E0IA 4LLCA 3ASOC 3IQ6A 4CIPA 5A6BA 4C7OA 1NFOA 5B1AC 4O6MA 4YJWA 4LDRA 1N1CA 2J0WA 3ATPA 3CAXA 1LM3B 3JCUQ 4MVSA 3TJ6A 2TMVP 4G7OF 2Q9AA 2OQMA 4J7TA 3NYMA 1A0BA 2Q00A 1JPJA 4PFPA 1PCXA 2JPUA 1CPQA 3L8IA 3LS1A 3AGTA 3NRHA 4PJJA 4KI2A 3SEOA 3K33A 2XXAA 4HFFB 4NY3A 5COGA 1GGQA 2XLMA 2PBEA 1ZVZA 4BEMJ 2R7OA 3U8VA 3W2VA 3M15A 2A6EF 3A11A 3JT1A 4LACB 1O87A 4X0RA 5BQHA 2ZXOA 1I4YA 2FFHA 4OIPF 1M2VA 3PMRA 3M1CB 3JYYA 4JTDB 3F46A 4D4XA 1YA9A 2H7OA 3SYNA 2KGOA 3R2PA 1YZAA 2I8BA 4JJGA 2XL6A 4D4NA 3HLZA 4XPXA 3B0PA 1ZU4A 5COMA 3JRMO 1RJ9B 2DGJA 1YARO 1RCPA 1G4US 1WASA 2IXNA 3G4ZA 3FAPB 1XZQA 3G4XA 5COFA 2DYRC 2OOCA 4J30B 4NTAA 2OJQA 3GANA 3SXYA 3U3BA 3ZQVA 3AG4C 3ZC4A 1O5HA 1WGWA 1D0XA 1SYQA 2P0NA 1T6QA 1FMWA 4OD4A 5DLJA 1E86A 2WZLA 4OIQF 3A9CA 1V74B 3SXKA 3W4YA 4QI2A 4E7SA 1ZU5A 3LEVA 1V4AA 1QZXA 1ZHTA 3K66A 2XLDA 5KYXB 2XS8A 2EIJC 1M6TA 1J8MF 1Y4CA 3POVA 3LLIA 5JLIA 2WL8A 1VTMP 4YT8A 3DAGA 1OQCA
chains in the Genus database with same CATH topology
1YDIA 3H2VA 5FZTA 2GDCA 3TJ6A 2B0HA 4IGGA 2L7AA 5L0HA 3H2UA 1RKEB 2IBFA 4PR9A 4EHPA 5L0JA 1ST6A 1TR2A 1DOWA 3MYIA 3TJ5A 1QKRA 3RF3A 4E17A 5L0GA 4E18A 1U6HA 3S90A 1U89A 1ZW3A 3VF0A 1L7CA 1H6GA 1RKEA 5L0CA 3ZDLA 1SYQA 2LQGA 5L0DA 4W8PA 1ZVZA 3T6GB 1T01A 4P9TA 1XWJA 5L0IA 4ONSA 5L0FA 1ZW2A 2HSQA 1DOVA 2GWWA 4K1OA 4DJ9A 2X0CA 1RKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  3H2V A;  5FZT A;  2GDC A;  3TJ6 A;  2B0H A;  4IGG A;  2L7A A;  5L0H A;  3H2U A;  1RKE B;  2IBF A;  4PR9 A;  4EHP A;  5L0J A;  1ST6 A;  1TR2 A;  1DOW A;  3MYI A;  3TJ5 A;  1QKR A;  3RF3 A;  4E17 A;  5L0G A;  4E18 A;  1U6H A;  3S90 A;  1U89 A;  1ZW3 A;  3VF0 A;  1L7C A;  1H6G A;  1RKE A;  5L0C A;  3ZDL A;  1SYQ A;  2LQG A;  5L0D A;  4W8P A;  1ZVZ A;  3T6G B;  1T01 A;  4P9T A;  1XWJ A;  5L0I A;  4ONS A;  5L0F A;  1ZW2 A;  2HSQ A;  1DOV A;  2GWW A;  4K1O A;  4DJ9 A;  2X0C A;  1RKC A; 
#chains in the Genus database with same CATH topology
 3SNH A;  4JW1 A;  2PFD A;  4CS7 A;  1OXB A;  2EIK C;  1D1A A;  3HJC A;  3NYJ A;  3K1I A;  1EI7 A;  1M2O A;  4LDQ A;  3DXJ F;  5F28 E;  2R03 A;  1WWP A;  2W9Y A;  2DB4 A;  3DAF A;  3O55 A;  3EG9 B;  2PNO A;  2VAS A;  4GEH A;  1JPN A;  2R7Q A;  3NYL A;  2NUT B;  3JYH A;  1E2X A;  1H6G A;  1D0Y A;  1Y6D A;  5E3C A;  5JP7 A;  2G3V A;  3EHM A;  3EH1 A;  3IQ5 A;  4DXW A;  4CDV A;  1OCR C;  1Z23 A;  2XLV A;  3B0V C;  5BQI A;  1TWG A;  2Y69 C;  1ZHW A;  4XEF A;  1I5N A;  1FAP B;  2HMZ A;  4EWC A;  4NQF A;  3W8H A;  2EIN C;  3HNI A;  3C7J A;  3LNR A;  2W4M A;  3MYF A;  2NG1 A;  1R4T A;  1GS9 A;  2G3K A;  1TKN A;  2HV6 A;  2Q9C A;  3C8G B;  3JRT A;  3NG1 A;  3QTH A;  3U8P A;  4YN0 B;  3HTK C;  5HV9 A;  2A1D D;  3BRJ A;  1BR1 A;  4JRZ A;  1A7V A;  3GEH A;  3LUT B;  4GYT A;  4IAR A;  4JZA A;  5K0I A;  1R5I D;  3LES A;  3MYI A;  3N24 A;  1U0B B;  3ZTZ A;  3EGX B;  1TWA A;  4C3D A;  2HMQ A;  1F1M A;  2HZ8 A;  2I15 A;  2YHS A;  2R25 A;  4QI0 A;  5L0C A;  1HMO A;  4CJO A;  5EGY A;  3DWW A;  5DS5 A;  2QTV A;  1SMY F;  4C7O B;  2Q3T A;  5D91 A;  4CS9 A;  4ONS A;  1HY5 A;  5JSL A;  1V55 C;  1M57 C;  4IAO A;  4HEA J;  2D5R B;  3EPV A;  4ULW A;  4XTK A;  4LER A;  2P61 A;  1L3P A;  3T6B A;  2NUT A;  3V5Z A;  2PX3 A;  5CI9 A;  2BE5 F;  4MTG A;  1YA7 O;  4NTB A;  5CIV A;  1BZ4 A;  3LAY A;  4A2N B;  5AC4 A;  4CIH A;  4NTF A;  2J9B A;  3RH3 A;  3V5X A;  5HSW A;  4JEA A;  4EIY A;  2XXA B;  4DOZ A;  1H9G A;  2IBF A;  3L8J A;  5BQG A;  1Z5Z A;  4FAP B;  5F5H A;  2KNH A;  4DVZ A;  1K05 A;  2WZF A;  4P6I C;  2J9U A;  3RQE A;  4AL0 A;  3RF3 A;  4XPY A;  2E87 A;  4PJN A;  1T6I A;  2IYL D;  1LE2 A;  3O6X A;  4W8K A;  3S90 A;  2CYD A;  2IXO A;  1C17 M;  2XLE A;  1Q0G A;  3O10 A;  4JEB A;  2R7X A;  4JTC B;  2RSE B;  3GM2 A;  3S84 A;  2HKV A;  2JD3 A;  2LP4 A;  3S0X A;  1T9K A;  3I5P A;  4IB4 A;  1CGN A;  4IJJ A;  3BEH A;  3N0T A;  4LDK A;  2J0X A;  1LKX A;  2OEX A;  3FXH A;  4UDV A;  2C03 A;  2KK1 A;  2NSG A;  5E33 A;  2R7T A;  2J8W A;  3HKK A;  4YL3 A;  1LI5 A;  2XM4 A;  1YJG A;  3H65 A;  3KH2 A;  1IZM A;  3L1M A;  3WHN A;  2GA0 A;  4IRU A;  2AVK A;  1ZYR F;  1BBH A;  5TJ5 E;  4AK9 A;  1KU2 A;  3F47 A;  3M79 A;  2UUI A;  3AGU A;  4I1M A;  3Q6M A;  3C18 A;  4E7Z A;  1OW7 A;  4H4K C;  4BJ6 A;  3U2M A;  4E17 A;  4MS2 A;  2ZD9 A;  1OKK A;  1TWH A;  5T1D B;  4YWQ A;  1MNE A;  2VCB A;  4G7H F;  3VF0 A;  3QVY A;  1ORY A;  3LNM B;  2L6H A;  4K7B A;  2P1A A;  4JC7 A;  3C8G D;  3RVZ A;  4CBE A;  2LQG A;  5KYW B;  4MVQ A;  2GFH A;  5IY5 C;  2YWA A;  5A6J A;  1FR0 A;  4AX2 A;  4U9D A;  1C02 A;  2CW0 F;  2Y3G A;  4O6Y A;  3W2W A;  4DVY P;  2J46 A;  3K1H A;  1QVX A;  3NKD A;  2MWQ A;  1JMW A;  1PV3 A;  2HV7 A;  1LS4 A;  2F22 A;  4ANJ A;  2XSE A;  2CDQ A;  2EPK X;  2CGE A;  2GDC A;  2J7P A;  4OD5 A;  3VYW A;  5JT4 A;  5JUA A;  2H8A A;  3TK0 A;  1JR8 A;  1RKE B;  1G5Z A;  5A6B D;  4PR9 A;  2YZS A;  4DBQ A;  3FMS A;  1KTM A;  3C62 A;  4JE9 A;  4GQH A;  3U9M A;  4JVS A;  1FFT C;  3L0I A;  3IHU A;  3PCV A;  4PK4 A;  2QY9 A;  4XWJ A;  1ZW3 A;  3TD7 A;  1L7C A;  4ULV A;  4Q5S F;  4QDL A;  3U5S A;  1VMA A;  2D4U A;  1NBB A;  3HNJ A;  4JJF A;  4DRJ B;  2AWY A;  2ZXP A;  3FOO A;  3KYI A;  1YZC A;  4W8P A;  5B3S C;  2KYH A;  3PHF 2;  3U0C A;  4ZLD A;  3JTL O;  3DJN B;  3GM1 A;  1SZI A;  1A7D A;  1S05 A;  1JRA A;  2PP4 A;  3GOR A;  3OA1 A;  4JTA B;  2J45 A;  3G50 A;  3V7O A;  4YT4 A;  1OCC C;  1CPR A;  4BEJ A;  2KJG A;  1J8Y F;  3DE9 A;  1M56 C;  2QUP A;  1T6U A;  3E9V A;  3UNG C;  1MQV A;  4B6I A;  4BJ5 C;  2L9J A;  3US6 A;  5KYW A;  1EKY A;  1VK5 A;  2EPL X;  2XL4 A;  1EQ1 A;  3SXZ A;  1YDI A;  4C3E A;  5FZT A;  3TOM A;  2EPN A;  2XRH A;  2XLH A;  3QMK A;  3U3F A;  3CEX A;  3B0U X;  2R7V A;  3B71 A;  1HMD A;  2YQY A;  3UGO A;  4BJ1 A;  2YKZ A;  1H9T A;  2ZPA A;  3SXM A;  4YT5 A;  1V54 C;  2BC5 A;  1QPU A;  2HSB A;  1D0Z A;  1MND A;  2O9X A;  2P6V A;  3UR3 C;  2A6H F;  3MX3 A;  1U89 A;  4WGZ A;  3OWT A;  3ZG1 A;  1RKE A;  2OKU A;  3S9O A;  1AUE A;  4NC3 A;  2IM8 A;  4WAB A;  3W8I A;  3B9Q A;  5EK0 A;  3J06 A;  1XWJ A;  3NDB B;  1G8X A;  2EPM X;  2OU6 A;  2Q7R A;  5F5F A;  3LLK A;  2P7V A;  4PJM A;  1E84 A;  2XLW A;  1T5O A;  2R05 A;  3EHN A;  3EH2 A;  4HFK B;  4AL1 A;  2WZG A;  4Q4Z F;  3CSK A;  256B A;  5L0H A;  3HNK A;  3DJU B;  3DM5 A;  3H2U A;  4I3M A;  1ZHY A;  4EBB A;  3EZI A;  3JSE O;  4WJ0 A;  1YLM A;  2LIG A;  3C63 A;  5AC5 A;  4CS8 A;  1ST6 A;  2YLI A;  1SR2 A;  3IQT A;  3E70 C;  3QVZ A;  5L3V A;  3DMD A;  2AP3 A;  2J9V A;  1TQG A;  3TQO A;  1A7E A;  4JCZ A;  2OCC C;  2B0J A;  2HFI A;  3S28 A;  2RD9 A;  4U5B E;  3RQG A;  1BDJ B;  1SF8 A;  2YL0 A;  2GAQ A;  4AE4 A;  4CJG A;  1UG7 A;  1NZE A;  3QW0 A;  4O79 A;  4ZLC A;  2W45 A;  2ZXW C;  3VM6 A;  1FTS A;  3M4C A;  4EBJ A;  3DE8 A;  1LPE A;  2HJ3 A;  2R02 A;  2Y3B A;  1JAF A;  1OXK A;  3VAY A;  5KYU A;  3IEE A;  1ZHZ A;  3ZWI A;  2H7B A;  3H2V A;  2Q9B A;  1VYK A;  5E3A A;  3SZR A;  5DQT A;  4MVU A;  2WVQ A;  3GEI A;  2XS1 A;  3K1I C;  4CSA C;  3GM3 A;  1TR2 A;  3JSZ A;  2VB6 A;  4I1O B;  3DM9 B;  3TOL A;  4CDY A;  2R7R A;  2KQ9 A;  4EBK A;  5DQZ A;  2CNW A;  1RMV A;  4XLP F;  1LE4 A;  2QLA A;  2HJM A;  3ZDL A;  4MND A;  1YYJ A;  3LEO A;  3RKO F;  1WN0 A;  3K7D A;  5KYY A;  5T3T A;  1D1B A;  3ABK C;  4JCH A;  3T6G B;  1BR2 A;  3S27 A;  3T9O A;  3TJ5 A;  3UMI A;  4MQ9 F;  1YVI A;  4YL0 A;  2NUP A;  4XQ1 A;  2Y3H A;  4J7Y A;  5KYN A;  1Z3I X;  1E83 A;  2M64 A;  3QW1 A;  1NLX A;  3NMI A;  3RYL A;  4PJL A;  1GQA A;  4FX5 A;  4OIN F;  4JKV A;  4DBR A;  2VCA A;  3UMK A;  3FAJ A;  3RVY A;  1O3U A;  2CCY A;  4Z9H A;  1WTY A;  4LLE A;  5A6A A;  2FGY A;  1QLE C;  3Q7L A;  2XL8 A;  2DYS C;  1CGM E;  3RFY A;  3U2L A;  2A0B A;  2VH3 A;  2Z15 A;  3VRC A;  2R9R B;  4MVM A;  4M63 A;  2YLG A;  3HNL A;  3KKB A;  3RW0 A;  3KPH A;  4CS9 C;  4PFO A;  1HW2 A;  2QNL A;  3FHD A;  1C03 A;  1FNT c;  4KBL A;  1CGO A;  4DJ9 A;  2X0C A;  1IW7 F;  5E2Q A;  3WG7 C;  3IPM O;  4MVO A;  3RQF A;  1Z6A A;  4JUR I;  2L7A A;  2VCC A;  4Q7C A;  1Q0K A;  5B1B C;  4WGY A;  4RD9 A;  1RXQ A;  2C04 A;  4N06 A;  1DOW A;  3ASN C;  4DRH B;  1EA8 A;  2YL3 A;  4E18 A;  5DVW A;  2JX0 A;  3ABL C;  4OIO F;  2R7S A;  3ABM C;  1OKK D;  3EGD A;  3U9J A;  2G62 A;  3T6J A;  5DS4 A;  1B68 A;  1OR2 A;  2NSF A;  2EPO A;  1A41 A;  3KYJ A;  3QZC A;  5L0F A;  2R7W A;  1ZW2 A;  2J9W A;  2UUH A;  3Q7G A;  2EIM C;  4P9F A;  4KNW A;  1YAU O;  3AG3 C;  2GWW A;  4K1O A;  4EKW A;  4BPM A;  1NG1 A;  4MW8 A;  3GWL A;  2LK4 A;  2L81 A;  1ORJ A;  1OW6 A;  2LFF A;  1ZHX A;  2QE9 A;  3NMJ A;  3WOD F;  1E85 A;  3OEO A;  4U9E A;  5AGF A;  2B0H A;  4IGG A;  1HE1 A;  1OCZ C;  4FES A;  3X2Q C;  5BUO A;  4I44 A;  4OIR F;  4XEV A;  1QQ3 A;  1VYI A;  2J7P D;  3GEE A;  1LI7 A;  2NPU A;  3AG2 C;  3C8Z A;  3MFN A;  4AE4 B;  4BJ6 C;  1KNY A;  4F4B A;  1K40 A;  5L3Q A;  1VLS A;  3EFO B;  2ETS A;  2LD6 A;  4EUK B;  2W4B A;  3ZSU A;  1VLT A;  4O6N A;  4C3B A;  1NFN A;  2DI3 A;  4RDA A;  4U5D E;  5GPG B;  1Z7Q c;  2LCH A;  1T01 A;  2HUJ A;  3AG1 C;  3LS0 A;  3M4B A;  3WAQ A;  2V26 A;  3ZQY A;  1HW1 A;  2IOQ A;  2AWC A;  2HSQ A;  2WVN A;  3DKA A;  4KC9 A;  2V3C C;  1DOV A;  1XZP A;  2KSF A;  2YL1 A;  4YK5 A;  3L34 A;  1S7Z A;  4MTF A;  1LS1 A;  4A4A A;  2OEV A;  3R7C A;  3X1O A;  3FDQ A;  2FAP B;  5CI8 A;  1TWC A;  2XM0 A;  3AQB A;  3SP1 A;  1I4Z A;  5EHH A;  1WOL A;  1VOM A;  1D1C A;  2OG2 A;  5T3W A;  3EZH A;  3FVY A;  2Y3D A;  2MHR A;  3MBG A;  3NMK A;  4CSA A;  3EJN A;  3I4U A;  4EHP A;  4E0H A;  4XEK A;  4IAQ A;  2IXM A;  2PF4 E;  5JRA A;  2M4E A;  5D92 A;  5KYY B;  4H54 A;  2OJE D;  3NKE A;  4O7G A;  5DS6 A;  3JZ0 A;  2LSE A;  1FFH A;  1JOG A;  1AEP A;  2Y39 A;  4N6C A;  5KYU B;  2NUP B;  3KL4 A;  1RJ9 A;  1LIH A;  4CX9 A;  4K0D A;  4DRI B;  5B3I A;  2IXP A;  2WB7 A;  2AU5 A;  3O39 A;  3EFO A;  4L6R A;  2H7V C;  2Q4F A;  4U5H A;  4XLN F;  4Z9I A;  3GWN A;  3V5Y A;  4MVZ A;  4N4W A;  4XPW A;  4BG0 A;  3ECS A;  4MTO A;  1MMG A;  1BR4 A;  1MMD A;  3IQC A;  5KYX A;  5JVE A;  1MMN A;  5A6K A;  2HS5 A;  1ZZP A;  2R7U A;  5A69 A;  1HE9 A;  1AVO B;  3B29 A;  3DZA A;  4U5F E;  5L0J A;  4BJT A;  1PD0 A;  1FMV A;  2EIL C;  2ICW G;  3UGP A;  1LVK A;  2LFD A;  4G78 A;  5FCL A;  4U5C E;  1Z63 A;  3T4R A;  2A69 F;  3AQC A;  2KC3 A;  1K04 A;  1PD1 A;  2YLD A;  3MLG A;  3Q6N A;  5L0D A;  1GM5 A;  2PX0 A;  4IWB A;  3EG9 A;  4P9T A;  5L0I A;  3CQZ A;  4YT2 A;  3TUL A;  4G7Z F;  4PAC A;  4RBN A;  3EQL F;  2L6G A;  2A68 F;  4FWV A;  2X51 A;  4J32 B;  2MYS A;  1APC A;  1YYX A;  3ZTM A;  1RKC A;  4HE8 D;  3UMH A;  4G0H A;  1OW8 A;  3GOD A;  4ER9 A;  1WAT A;  1H7I A;  1UFB A;  3DD7 A;  4YL1 A;  1QSP A;  4MW3 A;  2YL7 A;  4MVR A;  3EGD B;  1Q0D A;  5L0G A;  1QKR A;  3ITF A;  3AOU A;  4CS8 C;  3C8G A;  4U5E E;  1U6H A;  3FOP A;  1Q0F A;  2ASR A;  3ZVR A;  1TFK B;  3K6B A;  4JIO A;  4CDA A;  2WVO A;  2XLO A;  1TFO B;  1ORS C;  2YRF A;  1Q0M A;  1M2V B;  1G4W R;  1MMA A;  3I5Q A;  2CNW D;  2L6F A;  1W2W A;  2VC9 A;  3S29 A;  5JS5 A;  3PDM P;  1NSG B;  2ZXR A;  1NU9 C;  1VB5 A;  3LJB A;  3EGX A;  3ZIB A;  4U5G A;  2BL2 A;  1OCO C;  3DI5 A;  3KMI A;  4N6H A;  4Z9J A;  1OR3 A;  4BJ5 A;  2YVK A;  3CZ6 A;  1NU7 D;  2KW3 C;  2A0U A;  3AJM A;  3RIP A;  3N2Z B;  4KNV A;  4NCQ A;  2YEV A;  4R32 A;  4E0I A;  4LLC A;  3ASO C;  3IQ6 A;  4CIP A;  5A6B A;  4C7O A;  1NFO A;  5B1A C;  4O6M A;  4YJW A;  4LDR A;  1N1C A;  2J0W A;  3ATP A;  3CAX A;  1LM3 B;  3JCU Q;  4MVS A;  3TJ6 A;  2TMV P;  4G7O F;  2Q9A A;  2OQM A;  4J7T A;  3NYM A;  1A0B A;  2Q00 A;  1JPJ A;  4PFP A;  1PCX A;  2JPU A;  1CPQ A;  3L8I A;  3LS1 A;  3AGT A;  3NRH A;  4PJJ A;  4KI2 A;  3SEO A;  3K33 A;  2XXA A;  4HFF B;  4NY3 A;  5COG A;  1GGQ A;  2XLM A;  2PBE A;  1ZVZ A;  4BEM J;  2R7O A;  3U8V A;  3W2V A;  3M15 A;  2A6E F;  3A11 A;  3JT1 A;  4LAC B;  1O87 A;  4X0R A;  5BQH A;  2ZXO A;  1I4Y A;  2FFH A;  4OIP F;  1M2V A;  3PMR A;  3M1C B;  3JYY A;  4JTD B;  3F46 A;  4D4X A;  1YA9 A;  2H7O A;  3SYN A;  2KGO A;  3R2P A;  1YZA A;  2I8B A;  4JJG A;  2XL6 A;  4D4N A;  3HLZ A;  4XPX A;  3B0P A;  1ZU4 A;  5COM A;  3JRM O;  1RJ9 B;  2DGJ A;  1YAR O;  1RCP A;  1G4U S;  1WAS A;  2IXN A;  3G4Z A;  3FAP B;  1XZQ A;  3G4X A;  5COF A;  2DYR C;  2OOC A;  4J30 B;  4NTA A;  2OJQ A;  3GAN A;  3SXY A;  3U3B A;  3ZQV A;  3AG4 C;  3ZC4 A;  1O5H A;  1WGW A;  1D0X A;  1SYQ A;  2P0N A;  1T6Q A;  1FMW A;  4OD4 A;  5DLJ A;  1E86 A;  2WZL A;  4OIQ F;  3A9C A;  1V74 B;  3SXK A;  3W4Y A;  4QI2 A;  4E7S A;  1ZU5 A;  3LEV A;  1V4A A;  1QZX A;  1ZHT A;  3K66 A;  2XLD A;  5KYX B;  2XS8 A;  2EIJ C;  1M6T A;  1J8M F;  1Y4C A;  3POV A;  3LLI A;  5JLI A;  2WL8 A;  1VTM P;  4YT8 A;  3DAG A;  1OQC A; 
#chains in the Genus database with same CATH homology
 1YDI A;  3H2V A;  5FZT A;  2GDC A;  3TJ6 A;  2B0H A;  4IGG A;  2L7A A;  5L0H A;  3H2U A;  1RKE B;  2IBF A;  4PR9 A;  4EHP A;  5L0J A;  1ST6 A;  1TR2 A;  1DOW A;  3MYI A;  3TJ5 A;  1QKR A;  3RF3 A;  4E17 A;  5L0G A;  4E18 A;  1U6H A;  3S90 A;  1U89 A;  1ZW3 A;  3VF0 A;  1L7C A;  1H6G A;  1RKE A;  5L0C A;  3ZDL A;  1SYQ A;  2LQG A;  5L0D A;  4W8P A;  1ZVZ A;  3T6G B;  1T01 A;  4P9T A;  1XWJ A;  5L0I A;  4ONS A;  5L0F A;  1ZW2 A;  2HSQ A;  1DOV A;  2GWW A;  4K1O A;  4DJ9 A;  2X0C A;  1RKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...