1U6HA

Vinculin head (0-258) in complex with the talin vinculin binding site 2 (849-879)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
252
structure length
252
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Vinculin
publication title A vinculin binding domain from the talin rod unfolds to form a complex with the vinculin head.
pubmed doi rcsb
source organism Gallus gallus
total genus 102
structure length 252
sequence length 252
ec nomenclature
pdb deposition date 2004-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1u6hA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1u6hA01
3TJ6A 2IBFA 1H6GA 5L0GA 1DOVA 1ZVZA 4E17A 2GDCA 2B0HA 4IGGA 3S90A 1U89A 1U6HA 1RKEB 3RF3A 1SYQA 4DJ9A 4K1OA 5L0CA 1RKCA 1ZW3A 5L0JA 3H2VA 1YDIA 3ZDLA 5FZTA 3MYIA 4PR9A 1RKEA 1XWJA 1ST6A 1TR2A 5L0FA 2HSQA 2LQGA 5L0IA 1ZW2A 2X0CA 4EHPA 5L0DA 2L7AA 3VF0A 1L7CA 1T01A 5L0HA 1QKRA 3TJ5A 4P9TA 4E18A 2GWWA 4ONSA 4W8PA 3T6GB 1DOWA 3H2UA
chains in the Genus database with same CATH superfamily
3IHUA 3WG7C 3I5QA 1H6GA 4JKVA 1IW7F 3K7DA 4PFOA 4C7OB 4CS7A 2MWQA 3DXJF 4I1MA 4YL1A 1TFKB 3K66A 2IOQA 2VB6A 3EGDB 4PJMA 3B0VC 1M57C 2J9UA 4Q4ZF 4C7OA 2HV7A 2OEVA 3H2VA 1Z23A 4OD5A 4JURI 2L6HA 1D0ZA 1TWHA 2L81A 2IXPA 3HNJA 3VRCA 2MYSA 3EG9A 3EGDA 2PBEA 4J7YA 1T6IA 4MVUA 4YL3A 1ORSC 1ZW2A 4I3MA 1OCCC 4XLNF 4BEJA 4EHPA 2KSFA 5BUOA 4OIOF 4CS9C 2DGJA 4PK4A 3DWWA 5AC5A 3EJNA 5EK0A 2GWWA 3GM2A 4H4KC 3GEIA 3MYFA 4MW8A 3S84A 1LI5A 4JVSA 1MNEA 3TOLA 2VASA 2NSGA 4IB4A 3HKKA 2ICWG 1Q0MA 2O9XA 4DRJB 3LEOA 1YLMA 2B0HA 4EIYA 2J0WA 4GEHA 4I44A 4NC3A 2ZXPA 2YWAA 1VTMP 2GAQA 2HSBA 5F5HA 3ZTMA 1SMYF 3S29A 1GM5A 4CSAA 1H9TA 2JD3A 4MTGA 4XLPF 1T5OA 3KYJA 4Z9HA 4PFPA 1LE4A 1WATA 2I8BA 3IEEA 4JJFA 3SZRA 3Q6MA 4U5BE 3S27A 2VC9A 3UMIA 5L3VA 2XS1A 1BR2A 4WGYA 4XPWA 2XLWA 4N6HA 1O87A 3SXZA 5JSLA 2DB4A 3T9OA 1OW6A 2LP4A 3ZWIA 3U2MA 1HW2A 3HNKA 2D5RB 4HEAJ 3DD7A 4XPXA 3LAYA 1LI7A 2JX0A 2Y3GA 1Y6DA 1U6HA 3GODA 1ZHWA 5A69A 5IY5C 2C04A 3S28A 1Q0KA 2DYRC 3U0CA 4W8KA 5FCLA 1K04A 4JJGA 1C17M 4CBEA 1YDIA 2V26A 4DRHB 2PX3A 1Z6AA 4MVOA 3RQGA 1WGWA 2NSFA 4NTBA 5JLIA 2XLHA 3FMSA 3UMKA 1JPJA 2AU5A 4AX2A 2V3CC 1E83A 1NBBA 1T9KA 4IWBA 1QZXA 1RXQA 1JR8A 2NUPB 2W9YA 3FOOA 4NCQA 3H2UA 2VCBA 3BRJA 3CEXA 3L8JA 3MLGA 2Q9CA 3EZIA 5L0GA 3B29A 4KBLA 1OR3A 3M1CB 1CGNA 2YLDA 1RCPA 1YJGA 2P6VA 4FESA 3US6A 1QQ3A 2CNWA 1LIHA 1BR1A 2XS8A 3GM1A 4QI0A 5TJ5E 3Q6NA 2QNLA 2KYHA 4O79A 2RSEB 3U3BA 4E0HA 4UDVA 2Q9BA 3FAJA 4MS2A 3RVZA 1LE2A 3Q7GA 4O6YA 2H7BA 4FWVA 3LLIA 3A11A 1QSPA 3DM5A 3DM9B 2W4BA 3C18A 1FR0A 1G8XA 1S7ZA 3MBGA 1FMVA 2VH3A 2YLIA 256BA 3DZAA 2X0CA 3ABKC 2KW3C 3KKBA 3C7JA 3TJ5A 3KH2A 2CDQA 3NG1A 1K40A 4G0HA 3K1IA 1SF8A 3CSKA 4PJLA 2Y3BA 3QW1A 2EPKX 4ER9A 2YKZA 3NMJA 5JVEA 1M6TA 4I1OB 3PMRA 1TWCA 3ASOC 3QTHA 4IAQA 3R7CA 2XLEA 1I5NA 3QMKA 4DJ9A 5BQGA 5L3QA 3J06A 4EBBA 4O6MA 4PACA 2YL1A 3DJNB 3C8ZA 2H8AA 2HJ3A 1SZIA 3IQ5A 5DS5A 4BG0A 3U5SA 4D4XA 4HE8D 2AVKA 1MMGA 2R05A 1WOLA 1FTSA 2OCCC 1LKXA 3LJBA 3W8HA 3JTLO 2HFIA 1CGME 2OG2A 1ZHTA 5E2QA 2J9BA 3IQTA 1JMWA 4EBKA 3QVYA 3TQOA 4ZLDA 2EINC 1LVKA 3M4CA 5EGYA 4NTAA 1T6UA 1YZCA 1YYJA 3HNIA 2YRFA 4ONSA 5T3WA 3RH3A 3JSZA 3AJMA 1SR2A 3UGOA 1VYKA 2XL8A 1EA8A 4MW3A 3WAQA 3G50A 3U3FA 1N1CA 5KYWB 1A7VA 1YZAA 4GQHA 1PV3A 5AC4A 1OW8A 1R5ID 4F4BA 1EI7A 3NMKA 1PD0A 4U5HA 2IXNA 1D0XA 3ZIBA 5KYNA 1Z3IX 5L0CA 3AG1C 4J7TA 1S05A 1OCOC 3B9QA 4QDLA 4BJ5A 3KPHA 3RFYA 4PJJA 1XWJA 1ZHXA 2A6HF 4NTFA 3GEHA 2YEVA 4KC9A 2AWCA 3GM3A 4LDKA 4CIPA 1NU7D 3N24A 1HE9A 1WTYA 4G78A 4JTDB 2OOCA 3QW0A 5F28E 3FHDA 3U8VA 1HMDA 4O7GA 2XSEA 3JCUQ 4E18A 3H65A 4CS8A 2R25A 4G7OF 2Q00A 1MMAA 2KQ9A 3V5XA 1VLTA 3ABLC 3F46A 3NRHA 3E70C 4XTKA 1YVIA 1DOVA 4YWQA 4E17A 1Z63A 4YT2A 1C03A 4OIPF 1V54C 2J8WA 1FNTc 5A6BA 1C02A 1D1BA 5T1DB 4LACB 2WVQA 1M2VB 1VYIA 4K1OA 4U9EA 3LEVA 2LFFA 2QLAA 2W45A 1YA7O 1Q0DA 2P0NA 3NYJA 4J32B 4O6NA 4P6IC 3ZQYA 2CNWD 1VOMA 1PD1A 1QVXA 1M2VA 1HW1A 1ST6A 2Y69C 3B0PA 4IAOA 3KL4A 4K7BA 3SXKA 2BC5A 1V74B 2YL7A 4WGZA 3U9MA 2EPMX 4EWCA 1NU9C 1Q0GA 1F1MA 1Z5ZA 3EZHA 4DXWA 3K33A 5L0IA 4LDRA 3VF0A 2R7TA 4N4WA 2KNHA 4BJ6C 3IQ6A 1APCA 2HS5A 5T3TA 4IARA 3QZCA 2WVOA 3L34A 4LLEA 3NYLA 3POVA 1WWPA 2H7VC 4Q7CA 2PF4E 3L1MA 3AGTA 5AGFA 5BQIA 2XM4A 3RIPA 4BEMJ 3ITFA 3ECSA 4MVSA 2M4EA 4E7ZA 1D1CA 3C62A 3IPMO 4YL0A 1IZMA 3FDQA 3LS1A 4PR9A 3O39A 3UNGC 1XZQA 3ZVRA 1CPRA 2Y39A 3EHMA 2EIKC 3AOUA 3VYWA 1V55C 2HZ8A 2KC3A 4JW1A 1NSGB 2L7AA 2R7XA 5KYXB 4AL1A 2YLGA 3TULA 3X2QC 3C8GB 3CAXA 3DJUB 4JIOA 2IM8A 2HUJA 4C3BA 1CPQA 2CW0F 3Q7LA 2IXOA 3JYYA 4DBRA 2L6FA 4YT8A 4E0IA 1K05A 5KYUB 2KK1A 5KYXA 4YJWA 3C63A 1VLSA 1MQVA 2NUPA 3GWLA 5B1AC 2R7UA 3C8GA 5A6AA 3S90A 2OJQA 4YT4A 2XLOA 1ZHYA 4N6CA 5KYUA 1VMAA 2XL4A 4JC7A 4AE4B 1G4WR 1KNYA 1GS9A 3K1HA 4N06A 5L0JA 1FFTC 3HTKC 1RJ9B 2LK4A 1OQCA 5DS4A 2J7PA 2CGEA 1OXKA 1YAUO 5B3IA 4U5DE 1OCRC 3SXYA 4AE4A 1J8MF 2QTVA 3NYMA 5E3CA 1E85A 4PJNA 4DOZA 1RJ9A 2P61A 3AG2C 4Z9IA 4B6IA 3ATPA 3DAFA 3M15A 1WN0A 3W4YA 4NQFA 4FX5A 1ZU4A 3LNMB 3KMIA 3AQCA 1VB5A 2XRHA 3TJ6A 1ORJA 4ANJA 2VCCA 1JRAA 3G4ZA 3AGUA 2GDCA 1UG7A 2J45A 1Z7Qc 1O5HA 1G5ZA 1RKEB 3FOPA 4YK5A 3SP1A 5JT4A 3OEOA 3E9VA 3EGXB 2GA0A 1ZW3A 3I5PA 4X0RA 1EQ1A 5D92A 2VCAA 2NUTB 3MYIA 1PCXA 1RKEA 4XWJA 3NKDA 5GPGB 1XZPA 3I4UA 5A6BD 4CX9A 3RVYA 3U2LA 2L9JA 2Q4FA 4JEBA 5JS5A 3V5ZA 5HV9A 2NUTA 3TOMA 1Y4CA 2G3VA 4CJGA 5L0DA 5K0IA 3FAPB 5JUAA 5CIVA 1AVOB 1FAPB 3M79A 4U5GA 1LS4A 4BJ5C 2UUHA 3FVYA 3LLKA 4RDAA 4OD4A 2E87A 2GFHA 3DMDA 4CDYA 3T6JA 2HV6A 2M64A 3V7OA 2Q3TA 3EH2A 3EHNA 4G7ZF 2G3KA 4R32A 4JEAA 1HMOA 3ASNC 2B0JA 1FFHA 3B71A 2EPLX 3EQLF 3NMIA 2QY9A 5DQZA 2Z15A 1SYQA 4LERA 4C3EA 1D1AA 1AEPA 1Q0FA 3JSEO 3RQFA 1O3UA 2HKVA 3DKAA 1J8YF 5KYWA 2J9VA 5EHHA 4CS9A 4P9FA 1A0BA 2R02A 4YN0B 4YT5A 2Q7RA 3W2WA 4G7HF 1A7EA 2EIMC 2W4MA 4JCZA 2UUIA 2PNOA 2XLDA 3R2PA 4LLCA 1OKKA 2LQGA 3U8PA 3UMHA 4XQ1A 4CSAC 1A7DA 1M2OA 1T6QA 1KU2A 1KTMA 4XPYA 5E33A 4MTFA 1ZHZA 3GORA 3SXMA 1R4TA 3T6GB 3L8IA 2OKUA 5DS6A 5HSWA 2G62A 1TFOB 3AG3C 3PCVA 1MNDA 1NFNA 5COMA 3ZG1A 1OCZC 5E3AA 2QUPA 3N2ZB 2YVKA 2L6GA 1YARO 3EG9B 2XLVA 1A41A 3RF3A 3W2VA 2IXMA 5D91A 1BDJB 1RKCA 4GYTA 3ZTZA 1V4AA 3C8GD 2WZGA 3ZDLA 2PFDA 5FZTA 3JYHA 3O6XA 1HE1A 1TQGA 1ZU5A 3JZ0A 2C03A 1D0YA 1W2WA 2OU6A 2ZXOA 1VK5A 3OWTA 4L6RA 4OIRF 2ZXRA 3OA1A 1I4YA 2IYLD 2J7PD 3HJCA 1L7CA 2YHSA 4XEKA 2A0BA 2EILC 4BJ1A 2OEXA 4P9TA 4AK9A 3IQCA 1QPUA 1OW7A 1DOWA 3ZC4A 3CQZA 1ORYA 1QLEC 3DI5A 2LCHA 4U9DA 3N0TA 2P7VA 3KYIA 1GQAA 4IGGA 4A2NB 2XXAB 4DVZA 4M63A 3JT1A 2NG1A 4E7SA 2CCYA 4U5FE 4ULVA 2AWYA 2CYDA 1BBHA 3AQBA 3BEHA 4RD9A 3SYNA 4MVQA 3V5YA 4H54A 3LESA 3S0XA 2XXAA 2XLMA 2KGOA 1I4ZA 3RYLA 1NLXA 1TR2A 1FMWA 2MHRA 2NPUA 1U0BB 3DE8A 5L0FA 3U9JA 3VAYA 3NDBB 1CGOA 2A1DD 4J30B 3X1OA 1NFOA 1ZYRF 5B3SC 1QKRA 2EIJC 2YL3A 2LFDA 3VM6A 2R7WA 2R7VA 3QVZA 4KNWA 1TWAA 4K0DA 5B1BC 3ZQVA 4DBQA 3T4RA 4U5EE 2A6EF 3LUTB 4EUKB 2IBFA 3EFOB 4MVRA 2JPUA 1MMNA 1TKNA 3O10A 4KNVA 2R9RB 1RMVA 2J0XA 5A6JA 4CJOA 1H9GA 1NG1A 2R7RA 1GGQA 2A69F 3EFOA 4BJ6A 4OIQF 1LPEA 1JAFA 2J9WA 2R7SA 2HMZA 3EPVA 3GEEA 3UR3C 4NY3A 4Q5SF 1UFBA 2H7OA 5CI8A 4D4NA 4HFFB 3SNHA 1WASA 3K1IC 4JTCB 5COGA 3TD7A 2YQYA 3LS0A 3RW0A 4AL0A 5DVWA 5JRAA 5A6KA 3UGPA 3ABMC 2WZFA 2R03A 2ZXWC 4DVYP 2OQMA 4LDQA 4WJ0A 1L3PA 4XEFA 2I15A 4IJJA 5DQTA 2ZD9A 3JRMO 3HNLA 3K6BA 2R7QA 3G4XA 3PHF2 5F5FA 2FAPB 1OKKD 1AUEA 3B0UX 2R7OA 3TK0A 3M4BA 3AG4C 2HJMA 4MVZA 1YYXA 3GANA 5JP7A 1H7IA 3L0IA 4JE9A 1ZVZA 4A4AA 4ULWA 1BR4A 1OR2A 3HLZA 4BPMA 3O55A 3JRTA 1TWGA 3WHNA 1U89A 2YZSA 2ZPAA 4CDVA 1E84A 2F22A 2QE9A 2WVNA 1JOGA 3FXHA 1LS1A 1MMDA 4MQ9F 5COFA 2RD9A 2A0UA 3MFNA 4JRZA 2WB7A 3NKEA 3ZSUA 5BQHA 4CIHA 4KI2A 2PX0A 1E2XA 2ETSA 3F47A 2P1AA 2Q9AA 2X51A 3EGXA 2YL0A 1YA9A 3CZ6A 4MVMA 2HMQA 2EPOA 1T01A 2Y3HA 2KJGA 3RKOF 1BZ4A 4FAPB 3A9CA 1E86A 3S9OA 2BL2A 4ZLCA 5KYYB 4W8PA 2XM0A 1NZEA 2Y3DA 4DRIB 3GWNA 3PDMP 2J46A 1ZZPA 2EPNA 2XL6A 4WABA 2LD6A 2AP3A 4BJTA 5KYYA 1OXBA 2LSEA 3RQEA 2A68F 4JTAB 1B68A 2PP4A 4CDAA 1LM3B 4IRUA 4XEVA 2FGYA 3EH1A 3T6BA 4EKWA 4QI2A 2TMVP 3MX3A 4C3DA 4CS8C 2DYSC 3W8IA 2ASRA 1EKYA 4EBJA 4MNDA 1M56C 5CI9A 2HSQA 3LNRA 4JCHA 4MTOA 3WODF 2WZLA 4JZAA 5L0HA 3DAGA 1HY5A 1G4US 2D4UA 5DLJA 2DI3A 2OJED 2LIGA 3DE9A 4Z9JA 2BE5F 4RBNA 4U5CE 2WL8A 4HFKB 3SEOA 2FFHA 1JPNA 4OINF
chains in the Genus database with same CATH topology
3TJ6A 2IBFA 1H6GA 5L0GA 1DOVA 1ZVZA 4E17A 2GDCA 2B0HA 4IGGA 3S90A 1U89A 1U6HA 1RKEB 3RF3A 1SYQA 4DJ9A 4K1OA 5L0CA 1RKCA 1ZW3A 5L0JA 3H2VA 1YDIA 3ZDLA 5FZTA 3MYIA 4PR9A 1RKEA 1XWJA 1ST6A 1TR2A 5L0FA 2HSQA 2LQGA 5L0IA 1ZW2A 2X0CA 4EHPA 5L0DA 2L7AA 3VF0A 1L7CA 1T01A 5L0HA 1QKRA 3TJ5A 4P9TA 4E18A 2GWWA 4ONSA 4W8PA 3T6GB 1DOWA 3H2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TJ6 A;  2IBF A;  1H6G A;  5L0G A;  1DOV A;  1ZVZ A;  4E17 A;  2GDC A;  2B0H A;  4IGG A;  3S90 A;  1U89 A;  1U6H A;  1RKE B;  3RF3 A;  1SYQ A;  4DJ9 A;  4K1O A;  5L0C A;  1RKC A;  1ZW3 A;  5L0J A;  3H2V A;  1YDI A;  3ZDL A;  5FZT A;  3MYI A;  4PR9 A;  1RKE A;  1XWJ A;  1ST6 A;  1TR2 A;  5L0F A;  2HSQ A;  2LQG A;  5L0I A;  1ZW2 A;  2X0C A;  4EHP A;  5L0D A;  2L7A A;  3VF0 A;  1L7C A;  1T01 A;  5L0H A;  1QKR A;  3TJ5 A;  4P9T A;  4E18 A;  2GWW A;  4ONS A;  4W8P A;  3T6G B;  1DOW A;  3H2U A; 
#chains in the Genus database with same CATH topology
 3IHU A;  3WG7 C;  3I5Q A;  1H6G A;  4JKV A;  1IW7 F;  3K7D A;  4PFO A;  4C7O B;  4CS7 A;  2MWQ A;  3DXJ F;  4I1M A;  4YL1 A;  1TFK B;  3K66 A;  2IOQ A;  2VB6 A;  3EGD B;  4PJM A;  3B0V C;  1M57 C;  2J9U A;  4Q4Z F;  4C7O A;  2HV7 A;  2OEV A;  3H2V A;  1Z23 A;  4OD5 A;  4JUR I;  2L6H A;  1D0Z A;  1TWH A;  2L81 A;  2IXP A;  3HNJ A;  3VRC A;  2MYS A;  3EG9 A;  3EGD A;  2PBE A;  4J7Y A;  1T6I A;  4MVU A;  4YL3 A;  1ORS C;  1ZW2 A;  4I3M A;  1OCC C;  4XLN F;  4BEJ A;  4EHP A;  2KSF A;  5BUO A;  4OIO F;  4CS9 C;  2DGJ A;  4PK4 A;  3DWW A;  5AC5 A;  3EJN A;  5EK0 A;  2GWW A;  3GM2 A;  4H4K C;  3GEI A;  3MYF A;  4MW8 A;  3S84 A;  1LI5 A;  4JVS A;  1MNE A;  3TOL A;  2VAS A;  2NSG A;  4IB4 A;  3HKK A;  2ICW G;  1Q0M A;  2O9X A;  4DRJ B;  3LEO A;  1YLM A;  2B0H A;  4EIY A;  2J0W A;  4GEH A;  4I44 A;  4NC3 A;  2ZXP A;  2YWA A;  1VTM P;  2GAQ A;  2HSB A;  5F5H A;  3ZTM A;  1SMY F;  3S29 A;  1GM5 A;  4CSA A;  1H9T A;  2JD3 A;  4MTG A;  4XLP F;  1T5O A;  3KYJ A;  4Z9H A;  4PFP A;  1LE4 A;  1WAT A;  2I8B A;  3IEE A;  4JJF A;  3SZR A;  3Q6M A;  4U5B E;  3S27 A;  2VC9 A;  3UMI A;  5L3V A;  2XS1 A;  1BR2 A;  4WGY A;  4XPW A;  2XLW A;  4N6H A;  1O87 A;  3SXZ A;  5JSL A;  2DB4 A;  3T9O A;  1OW6 A;  2LP4 A;  3ZWI A;  3U2M A;  1HW2 A;  3HNK A;  2D5R B;  4HEA J;  3DD7 A;  4XPX A;  3LAY A;  1LI7 A;  2JX0 A;  2Y3G A;  1Y6D A;  1U6H A;  3GOD A;  1ZHW A;  5A69 A;  5IY5 C;  2C04 A;  3S28 A;  1Q0K A;  2DYR C;  3U0C A;  4W8K A;  5FCL A;  1K04 A;  4JJG A;  1C17 M;  4CBE A;  1YDI A;  2V26 A;  4DRH B;  2PX3 A;  1Z6A A;  4MVO A;  3RQG A;  1WGW A;  2NSF A;  4NTB A;  5JLI A;  2XLH A;  3FMS A;  3UMK A;  1JPJ A;  2AU5 A;  4AX2 A;  2V3C C;  1E83 A;  1NBB A;  1T9K A;  4IWB A;  1QZX A;  1RXQ A;  1JR8 A;  2NUP B;  2W9Y A;  3FOO A;  4NCQ A;  3H2U A;  2VCB A;  3BRJ A;  3CEX A;  3L8J A;  3MLG A;  2Q9C A;  3EZI A;  5L0G A;  3B29 A;  4KBL A;  1OR3 A;  3M1C B;  1CGN A;  2YLD A;  1RCP A;  1YJG A;  2P6V A;  4FES A;  3US6 A;  1QQ3 A;  2CNW A;  1LIH A;  1BR1 A;  2XS8 A;  3GM1 A;  4QI0 A;  5TJ5 E;  3Q6N A;  2QNL A;  2KYH A;  4O79 A;  2RSE B;  3U3B A;  4E0H A;  4UDV A;  2Q9B A;  3FAJ A;  4MS2 A;  3RVZ A;  1LE2 A;  3Q7G A;  4O6Y A;  2H7B A;  4FWV A;  3LLI A;  3A11 A;  1QSP A;  3DM5 A;  3DM9 B;  2W4B A;  3C18 A;  1FR0 A;  1G8X A;  1S7Z A;  3MBG A;  1FMV A;  2VH3 A;  2YLI A;  256B A;  3DZA A;  2X0C A;  3ABK C;  2KW3 C;  3KKB A;  3C7J A;  3TJ5 A;  3KH2 A;  2CDQ A;  3NG1 A;  1K40 A;  4G0H A;  3K1I A;  1SF8 A;  3CSK A;  4PJL A;  2Y3B A;  3QW1 A;  2EPK X;  4ER9 A;  2YKZ A;  3NMJ A;  5JVE A;  1M6T A;  4I1O B;  3PMR A;  1TWC A;  3ASO C;  3QTH A;  4IAQ A;  3R7C A;  2XLE A;  1I5N A;  3QMK A;  4DJ9 A;  5BQG A;  5L3Q A;  3J06 A;  4EBB A;  4O6M A;  4PAC A;  2YL1 A;  3DJN B;  3C8Z A;  2H8A A;  2HJ3 A;  1SZI A;  3IQ5 A;  5DS5 A;  4BG0 A;  3U5S A;  4D4X A;  4HE8 D;  2AVK A;  1MMG A;  2R05 A;  1WOL A;  1FTS A;  2OCC C;  1LKX A;  3LJB A;  3W8H A;  3JTL O;  2HFI A;  1CGM E;  2OG2 A;  1ZHT A;  5E2Q A;  2J9B A;  3IQT A;  1JMW A;  4EBK A;  3QVY A;  3TQO A;  4ZLD A;  2EIN C;  1LVK A;  3M4C A;  5EGY A;  4NTA A;  1T6U A;  1YZC A;  1YYJ A;  3HNI A;  2YRF A;  4ONS A;  5T3W A;  3RH3 A;  3JSZ A;  3AJM A;  1SR2 A;  3UGO A;  1VYK A;  2XL8 A;  1EA8 A;  4MW3 A;  3WAQ A;  3G50 A;  3U3F A;  1N1C A;  5KYW B;  1A7V A;  1YZA A;  4GQH A;  1PV3 A;  5AC4 A;  1OW8 A;  1R5I D;  4F4B A;  1EI7 A;  3NMK A;  1PD0 A;  4U5H A;  2IXN A;  1D0X A;  3ZIB A;  5KYN A;  1Z3I X;  5L0C A;  3AG1 C;  4J7T A;  1S05 A;  1OCO C;  3B9Q A;  4QDL A;  4BJ5 A;  3KPH A;  3RFY A;  4PJJ A;  1XWJ A;  1ZHX A;  2A6H F;  4NTF A;  3GEH A;  2YEV A;  4KC9 A;  2AWC A;  3GM3 A;  4LDK A;  4CIP A;  1NU7 D;  3N24 A;  1HE9 A;  1WTY A;  4G78 A;  4JTD B;  2OOC A;  3QW0 A;  5F28 E;  3FHD A;  3U8V A;  1HMD A;  4O7G A;  2XSE A;  3JCU Q;  4E18 A;  3H65 A;  4CS8 A;  2R25 A;  4G7O F;  2Q00 A;  1MMA A;  2KQ9 A;  3V5X A;  1VLT A;  3ABL C;  3F46 A;  3NRH A;  3E70 C;  4XTK A;  1YVI A;  1DOV A;  4YWQ A;  4E17 A;  1Z63 A;  4YT2 A;  1C03 A;  4OIP F;  1V54 C;  2J8W A;  1FNT c;  5A6B A;  1C02 A;  1D1B A;  5T1D B;  4LAC B;  2WVQ A;  1M2V B;  1VYI A;  4K1O A;  4U9E A;  3LEV A;  2LFF A;  2QLA A;  2W45 A;  1YA7 O;  1Q0D A;  2P0N A;  3NYJ A;  4J32 B;  4O6N A;  4P6I C;  3ZQY A;  2CNW D;  1VOM A;  1PD1 A;  1QVX A;  1M2V A;  1HW1 A;  1ST6 A;  2Y69 C;  3B0P A;  4IAO A;  3KL4 A;  4K7B A;  3SXK A;  2BC5 A;  1V74 B;  2YL7 A;  4WGZ A;  3U9M A;  2EPM X;  4EWC A;  1NU9 C;  1Q0G A;  1F1M A;  1Z5Z A;  3EZH A;  4DXW A;  3K33 A;  5L0I A;  4LDR A;  3VF0 A;  2R7T A;  4N4W A;  2KNH A;  4BJ6 C;  3IQ6 A;  1APC A;  2HS5 A;  5T3T A;  4IAR A;  3QZC A;  2WVO A;  3L34 A;  4LLE A;  3NYL A;  3POV A;  1WWP A;  2H7V C;  4Q7C A;  2PF4 E;  3L1M A;  3AGT A;  5AGF A;  5BQI A;  2XM4 A;  3RIP A;  4BEM J;  3ITF A;  3ECS A;  4MVS A;  2M4E A;  4E7Z A;  1D1C A;  3C62 A;  3IPM O;  4YL0 A;  1IZM A;  3FDQ A;  3LS1 A;  4PR9 A;  3O39 A;  3UNG C;  1XZQ A;  3ZVR A;  1CPR A;  2Y39 A;  3EHM A;  2EIK C;  3AOU A;  3VYW A;  1V55 C;  2HZ8 A;  2KC3 A;  4JW1 A;  1NSG B;  2L7A A;  2R7X A;  5KYX B;  4AL1 A;  2YLG A;  3TUL A;  3X2Q C;  3C8G B;  3CAX A;  3DJU B;  4JIO A;  2IM8 A;  2HUJ A;  4C3B A;  1CPQ A;  2CW0 F;  3Q7L A;  2IXO A;  3JYY A;  4DBR A;  2L6F A;  4YT8 A;  4E0I A;  1K05 A;  5KYU B;  2KK1 A;  5KYX A;  4YJW A;  3C63 A;  1VLS A;  1MQV A;  2NUP A;  3GWL A;  5B1A C;  2R7U A;  3C8G A;  5A6A A;  3S90 A;  2OJQ A;  4YT4 A;  2XLO A;  1ZHY A;  4N6C A;  5KYU A;  1VMA A;  2XL4 A;  4JC7 A;  4AE4 B;  1G4W R;  1KNY A;  1GS9 A;  3K1H A;  4N06 A;  5L0J A;  1FFT C;  3HTK C;  1RJ9 B;  2LK4 A;  1OQC A;  5DS4 A;  2J7P A;  2CGE A;  1OXK A;  1YAU O;  5B3I A;  4U5D E;  1OCR C;  3SXY A;  4AE4 A;  1J8M F;  2QTV A;  3NYM A;  5E3C A;  1E85 A;  4PJN A;  4DOZ A;  1RJ9 A;  2P61 A;  3AG2 C;  4Z9I A;  4B6I A;  3ATP A;  3DAF A;  3M15 A;  1WN0 A;  3W4Y A;  4NQF A;  4FX5 A;  1ZU4 A;  3LNM B;  3KMI A;  3AQC A;  1VB5 A;  2XRH A;  3TJ6 A;  1ORJ A;  4ANJ A;  2VCC A;  1JRA A;  3G4Z A;  3AGU A;  2GDC A;  1UG7 A;  2J45 A;  1Z7Q c;  1O5H A;  1G5Z A;  1RKE B;  3FOP A;  4YK5 A;  3SP1 A;  5JT4 A;  3OEO A;  3E9V A;  3EGX B;  2GA0 A;  1ZW3 A;  3I5P A;  4X0R A;  1EQ1 A;  5D92 A;  2VCA A;  2NUT B;  3MYI A;  1PCX A;  1RKE A;  4XWJ A;  3NKD A;  5GPG B;  1XZP A;  3I4U A;  5A6B D;  4CX9 A;  3RVY A;  3U2L A;  2L9J A;  2Q4F A;  4JEB A;  5JS5 A;  3V5Z A;  5HV9 A;  2NUT A;  3TOM A;  1Y4C A;  2G3V A;  4CJG A;  5L0D A;  5K0I A;  3FAP B;  5JUA A;  5CIV A;  1AVO B;  1FAP B;  3M79 A;  4U5G A;  1LS4 A;  4BJ5 C;  2UUH A;  3FVY A;  3LLK A;  4RDA A;  4OD4 A;  2E87 A;  2GFH A;  3DMD A;  4CDY A;  3T6J A;  2HV6 A;  2M64 A;  3V7O A;  2Q3T A;  3EH2 A;  3EHN A;  4G7Z F;  2G3K A;  4R32 A;  4JEA A;  1HMO A;  3ASN C;  2B0J A;  1FFH A;  3B71 A;  2EPL X;  3EQL F;  3NMI A;  2QY9 A;  5DQZ A;  2Z15 A;  1SYQ A;  4LER A;  4C3E A;  1D1A A;  1AEP A;  1Q0F A;  3JSE O;  3RQF A;  1O3U A;  2HKV A;  3DKA A;  1J8Y F;  5KYW A;  2J9V A;  5EHH A;  4CS9 A;  4P9F A;  1A0B A;  2R02 A;  4YN0 B;  4YT5 A;  2Q7R A;  3W2W A;  4G7H F;  1A7E A;  2EIM C;  2W4M A;  4JCZ A;  2UUI A;  2PNO A;  2XLD A;  3R2P A;  4LLC A;  1OKK A;  2LQG A;  3U8P A;  3UMH A;  4XQ1 A;  4CSA C;  1A7D A;  1M2O A;  1T6Q A;  1KU2 A;  1KTM A;  4XPY A;  5E33 A;  4MTF A;  1ZHZ A;  3GOR A;  3SXM A;  1R4T A;  3T6G B;  3L8I A;  2OKU A;  5DS6 A;  5HSW A;  2G62 A;  1TFO B;  3AG3 C;  3PCV A;  1MND A;  1NFN A;  5COM A;  3ZG1 A;  1OCZ C;  5E3A A;  2QUP A;  3N2Z B;  2YVK A;  2L6G A;  1YAR O;  3EG9 B;  2XLV A;  1A41 A;  3RF3 A;  3W2V A;  2IXM A;  5D91 A;  1BDJ B;  1RKC A;  4GYT A;  3ZTZ A;  1V4A A;  3C8G D;  2WZG A;  3ZDL A;  2PFD A;  5FZT A;  3JYH A;  3O6X A;  1HE1 A;  1TQG A;  1ZU5 A;  3JZ0 A;  2C03 A;  1D0Y A;  1W2W A;  2OU6 A;  2ZXO A;  1VK5 A;  3OWT A;  4L6R A;  4OIR F;  2ZXR A;  3OA1 A;  1I4Y A;  2IYL D;  2J7P D;  3HJC A;  1L7C A;  2YHS A;  4XEK A;  2A0B A;  2EIL C;  4BJ1 A;  2OEX A;  4P9T A;  4AK9 A;  3IQC A;  1QPU A;  1OW7 A;  1DOW A;  3ZC4 A;  3CQZ A;  1ORY A;  1QLE C;  3DI5 A;  2LCH A;  4U9D A;  3N0T A;  2P7V A;  3KYI A;  1GQA A;  4IGG A;  4A2N B;  2XXA B;  4DVZ A;  4M63 A;  3JT1 A;  2NG1 A;  4E7S A;  2CCY A;  4U5F E;  4ULV A;  2AWY A;  2CYD A;  1BBH A;  3AQB A;  3BEH A;  4RD9 A;  3SYN A;  4MVQ A;  3V5Y A;  4H54 A;  3LES A;  3S0X A;  2XXA A;  2XLM A;  2KGO A;  1I4Z A;  3RYL A;  1NLX A;  1TR2 A;  1FMW A;  2MHR A;  2NPU A;  1U0B B;  3DE8 A;  5L0F A;  3U9J A;  3VAY A;  3NDB B;  1CGO A;  2A1D D;  4J30 B;  3X1O A;  1NFO A;  1ZYR F;  5B3S C;  1QKR A;  2EIJ C;  2YL3 A;  2LFD A;  3VM6 A;  2R7W A;  2R7V A;  3QVZ A;  4KNW A;  1TWA A;  4K0D A;  5B1B C;  3ZQV A;  4DBQ A;  3T4R A;  4U5E E;  2A6E F;  3LUT B;  4EUK B;  2IBF A;  3EFO B;  4MVR A;  2JPU A;  1MMN A;  1TKN A;  3O10 A;  4KNV A;  2R9R B;  1RMV A;  2J0X A;  5A6J A;  4CJO A;  1H9G A;  1NG1 A;  2R7R A;  1GGQ A;  2A69 F;  3EFO A;  4BJ6 A;  4OIQ F;  1LPE A;  1JAF A;  2J9W A;  2R7S A;  2HMZ A;  3EPV A;  3GEE A;  3UR3 C;  4NY3 A;  4Q5S F;  1UFB A;  2H7O A;  5CI8 A;  4D4N A;  4HFF B;  3SNH A;  1WAS A;  3K1I C;  4JTC B;  5COG A;  3TD7 A;  2YQY A;  3LS0 A;  3RW0 A;  4AL0 A;  5DVW A;  5JRA A;  5A6K A;  3UGP A;  3ABM C;  2WZF A;  2R03 A;  2ZXW C;  4DVY P;  2OQM A;  4LDQ A;  4WJ0 A;  1L3P A;  4XEF A;  2I15 A;  4IJJ A;  5DQT A;  2ZD9 A;  3JRM O;  3HNL A;  3K6B A;  2R7Q A;  3G4X A;  3PHF 2;  5F5F A;  2FAP B;  1OKK D;  1AUE A;  3B0U X;  2R7O A;  3TK0 A;  3M4B A;  3AG4 C;  2HJM A;  4MVZ A;  1YYX A;  3GAN A;  5JP7 A;  1H7I A;  3L0I A;  4JE9 A;  1ZVZ A;  4A4A A;  4ULW A;  1BR4 A;  1OR2 A;  3HLZ A;  4BPM A;  3O55 A;  3JRT A;  1TWG A;  3WHN A;  1U89 A;  2YZS A;  2ZPA A;  4CDV A;  1E84 A;  2F22 A;  2QE9 A;  2WVN A;  1JOG A;  3FXH A;  1LS1 A;  1MMD A;  4MQ9 F;  5COF A;  2RD9 A;  2A0U A;  3MFN A;  4JRZ A;  2WB7 A;  3NKE A;  3ZSU A;  5BQH A;  4CIH A;  4KI2 A;  2PX0 A;  1E2X A;  2ETS A;  3F47 A;  2P1A A;  2Q9A A;  2X51 A;  3EGX A;  2YL0 A;  1YA9 A;  3CZ6 A;  4MVM A;  2HMQ A;  2EPO A;  1T01 A;  2Y3H A;  2KJG A;  3RKO F;  1BZ4 A;  4FAP B;  3A9C A;  1E86 A;  3S9O A;  2BL2 A;  4ZLC A;  5KYY B;  4W8P A;  2XM0 A;  1NZE A;  2Y3D A;  4DRI B;  3GWN A;  3PDM P;  2J46 A;  1ZZP A;  2EPN A;  2XL6 A;  4WAB A;  2LD6 A;  2AP3 A;  4BJT A;  5KYY A;  1OXB A;  2LSE A;  3RQE A;  2A68 F;  4JTA B;  1B68 A;  2PP4 A;  4CDA A;  1LM3 B;  4IRU A;  4XEV A;  2FGY A;  3EH1 A;  3T6B A;  4EKW A;  4QI2 A;  2TMV P;  3MX3 A;  4C3D A;  4CS8 C;  2DYS C;  3W8I A;  2ASR A;  1EKY A;  4EBJ A;  4MND A;  1M56 C;  5CI9 A;  2HSQ A;  3LNR A;  4JCH A;  4MTO A;  3WOD F;  2WZL A;  4JZA A;  5L0H A;  3DAG A;  1HY5 A;  1G4U S;  2D4U A;  5DLJ A;  2DI3 A;  2OJE D;  2LIG A;  3DE9 A;  4Z9J A;  2BE5 F;  4RBN A;  4U5C E;  2WL8 A;  4HFK B;  3SEO A;  2FFH A;  1JPN A;  4OIN F; 
#chains in the Genus database with same CATH homology
 3TJ6 A;  2IBF A;  1H6G A;  5L0G A;  1DOV A;  1ZVZ A;  4E17 A;  2GDC A;  2B0H A;  4IGG A;  3S90 A;  1U89 A;  1U6H A;  1RKE B;  3RF3 A;  1SYQ A;  4DJ9 A;  4K1O A;  5L0C A;  1RKC A;  1ZW3 A;  5L0J A;  3H2V A;  1YDI A;  3ZDL A;  5FZT A;  3MYI A;  4PR9 A;  1RKE A;  1XWJ A;  1ST6 A;  1TR2 A;  5L0F A;  2HSQ A;  2LQG A;  5L0I A;  1ZW2 A;  2X0C A;  4EHP A;  5L0D A;  2L7A A;  3VF0 A;  1L7C A;  1T01 A;  5L0H A;  1QKR A;  3TJ5 A;  4P9T A;  4E18 A;  2GWW A;  4ONS A;  4W8P A;  3T6G B;  1DOW A;  3H2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...