4GEHA

Crystal structure of mst4 dimerization domain complex with pdcd10
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
total genus 85
structure length 198
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4gehA00
4GEHA 3W8IA 3W8HA
chains in the Genus database with same CATH superfamily
3U9JA 4WGZA 1AVOB 4I44A 3OA1A 1E83A 3ZQVA 2OG2A 2E87A 2D5RB 4KNVA 3KL4A 4K7BA 3IQTA 3M79A 3Q6NA 1OXBA 1WOLA 3X1OA 4BJ6A 3K1IA 1KTMA 2CYDA 3LLIA 2ZXRA 4JEBA 5FZTA 1I5NA 3ZC4A 3TULA 1A7EA 3RQGA 4EIYA 2LIGA 4H54A 1TFKB 1SR2A 2H8AA 1TKNA 2P61A 1Q0DA 2MWQA 2M64A 2XRHA 1QPUA 3DD7A 4CS8C 1ZHWA 4CDVA 1ZHXA 1D0ZA 2A6HF 3B29A 4NTBA 2HV6A 5DQTA 5KYUA 1ORJA 5KYYA 3CEXA 5BUOA 4OIPF 2YLDA 4WGYA 1HY5A 2W45A 3GWLA 4EBKA 3QVYA 3DAFA 1VYKA 5E33A 1VK5A 5L0FA 5K0IA 4PJJA 3U2LA 1QKRA 1LE4A 4DRIB 3SYNA 3UGPA 1H9TA 4MVSA 3KMIA 4U5EE 3FVYA 3DE8A 3C63A 1B68A 4IWBA 1FFTC 2QY9A 3HTKC 4NTFA 2B0JA 4CS7A 1RCPA 2J0XA 2L9JA 1YA9A 4ANJA 5D91A 1TR2A 1CGNA 2YLGA 2XLVA 4YL0A 1BBHA 4P9FA 1WASA 2R7OA 2G62A 1JAFA 4MTOA 5KYXA 3EQLF 3NKDA 2F22A 3HNLA 1NBBA 4G78A 2PBEA 2A6EF 2WZFA 3MYIA 2A0BA 3L1MA 4RD9A 4YWQA 3DJNB 3DJUB 1OXKA 2OQMA 3G4XA 3LS1A 4I3MA 1LKXA 4K0DA 4JTAB 3S28A 3B0VC 3C8GB 3TD7A 4C7OA 1MQVA 1D1CA 4E7ZA 1YLMA 2HUJA 2NPUA 2OU6A 1HW2A 2Z15A 3BEHA 3GM2A 4DBRA 1A7VA 4HFFB 4YL1A 3RKOF 3EGXB 1I4YA 1Y6DA 4MTGA 3AQCA 3O55A 3V5XA 4U5DE 5T1DB 4U5BE 1U89A 4NTAA 1H6GA 3W4YA 1PCXA 2R05A 3GANA 3L34A 3AGTA 2CDQA 2KC3A 3NKEA 1D0YA 1MMNA 2IXMA 1G4WR 2JX0A 4I1MA 4O6YA 5JT4A 2NG1A 3C62A 1RJ9A 2HSBA 3V7OA 2B0HA 1A41A 4U9EA 1ZW2A 2YKZA 3FOPA 3MYFA 1U6HA 2XLEA 3AG2C 3L0IA 1HE1A 3NRHA 4OIOF 1DOWA 4P9TA 3I4UA 1JPJA 4HFKB 4JEAA 1YDIA 2PX0A 3CQZA 3K33A 1QSPA 1YA7O 1YZCA 2YQYA 3CSKA 1FR0A 2DB4A 1XWJA 5A6BA 3KYIA 4JTDB 2KYHA 4MVMA 1FNTc 2IM8A 4Z9IA 1Q0MA 2H7VC 1ZHZA 2YLIA 1A0BA 1BR4A 4Z9HA 3WAQA 4LDRA 1S7ZA 3UR3C 4FWVA 3DM5A 4AL0A 1PD0A 1M2VB 1RJ9B 3M4CA 3RQFA 3VF0A 2L7AA 3ABMC 1JRAA 2QUPA 2HMZA 1LM3B 1O5HA 1RXQA 5EHHA 2A0UA 2IBFA 3DM9B 4XLNF 2YL0A 1AUEA 3LLKA 4M63A 1M6TA 4OINF 3E9VA 2R7RA 2P7VA 3I5QA 4NY3A 2OJED 1QZXA 2EIJC 1H7IA 2DYRC 4C3DA 2CGEA 5L0HA 2WB7A 3Q7GA 2VCCA 3ZTZA 2IYLD 3PHF2 1L3PA 1LS4A 1VLSA 1Q0KA 5JRAA 4C7OB 1E86A 2XL6A 1Z6AA 4YK5A 5JUAA 2WZGA 4AX2A 1CPRA 2YZSA 2LP4A 4BJ5C 4EKWA 4GEHA 5E3CA 2XL8A 1OKKA 5B3SC 1IW7F 2J45A 4W8PA 3S29A 1TWHA 5JS5A 3EH2A 4BJ5A 3UGOA 1WTYA 1T01A 4J32B 2ASRA 1WWPA 3B0UX 1OCCC 4IB4A 4PFOA 4WABA 4L6RA 1BZ4A 3CZ6A 3VRCA 5DS4A 4CSAA 1EQ1A 3QW0A 3TOMA 3DE9A 2FFHA 4D4NA 4JKVA 3Q7LA 5CI8A 3QMKA 2M4EA 3FAPB 3NYJA 2Q7RA 3SP1A 1VMAA 3ZTMA 4O7GA 4LLCA 4AK9A 1ZU5A 2XSEA 2NUTA 5A6AA 2WVQA 4EBBA 1GS9A 1RKEB 1V54C 2A1DD 2DYSC 2R7QA 4PJNA 5DLJA 3DAGA 5BQHA 1JOGA 3EG9A 1JMWA 1LIHA 1NU9C 5JP7A 1V74B 1SYQA 3MBGA 4YJWA 3WHNA 4EHPA 3S0XA 2XLHA 4DVYP 2ZPAA 3AG3C 4BG0A 2EPOA 3VYWA 3ZDLA 3NG1A 2YL1A 4DXWA 1MMGA 3LUTB 3F47A 3H65A 4QI2A 2DI3A 2IXPA 1E2XA 2L6HA 1GQAA 2DGJA 2J0WA 4FAPB 2FGYA 3K6BA 4MNDA 4G7OF 2RSEB 1K40A 1PV3A 1R4TA 2J9VA 3QW1A 3UMIA 4LDKA 5COGA 3RW0A 4MVUA 1Q0FA 2XXAA 2Q4FA 2L6FA 3JSZA 2NSFA 1N1CA 3GM3A 3A11A 1O87A 3DI5A 1Z63A 3QZCA 2YWAA 3IEEA 4JCZA 4YL3A 3O6XA 4DRJB 2XM0A 4IJJA 1OCZC 4JJFA 4XEVA 2HZ8A 4J7YA 5B1AC 1G5ZA 1LVKA 2J46A 3TJ5A 4IAQA 4C3BA 5L0IA 3B9QA 3RFYA 5DQZA 4AE4B 2R02A 2HV7A 2JPUA 2J9BA 4BEMJ 3SXYA 3NMKA 3WODF 2R7SA 2EPKX 3SNHA 3U8VA 3NDBB 5DVWA 1C03A 4NQFA 2OEVA 1OCOC 1OCRC 5COFA 3JCUQ 4E0IA 3AGUA 3O39A 4N06A 3ZWIA 4U9DA 4XPXA 2IOQA 2Q9CA 2EILC 3RH3A 2ZXOA 2WL8A 1MMDA 1T9KA 1SMYF 5A6JA 4XPWA 3NYMA 4JJGA 1S05A 4ULWA 4A2NB 2OCCC 3WG7C 3KH2A 4MVZA 2CW0F 3G50A 2LSEA 2D4UA 3GEHA 4Z9JA 3U5SA 4KI2A 1EI7A 1J8YF 3EGDB 4U5HA 1E84A 3EZHA 1TQGA 4KNWA 1ZW3A 1QVXA 3AG4C 3X2QC 5DS5A 2WZLA 1QQ3A 4JURI 4JZAA 3NMIA 2R7WA 1I4ZA 4E17A 3N24A 5E2QA 3GEIA 4BJTA 3IQ5A 3C7JA 3N0TA 5F28E 2KW3C 1W2WA 2Q00A 3L8JA 2X0CA 3CAXA 3M15A 1RKCA 3M4BA 3ASOC 3HNJA 3DWWA 1OKKD 2P0NA 2EPMX 2X51A 2HJMA 2Y3HA 2Y3DA 1UG7A 2KK1A 3ABLC 3AJMA 3K7DA 4AL1A 2KNHA 4DVZA 2EINC 1QLEC 2HJ3A 4MTFA 3W8HA 4O79A 1BR2A 1K04A 2C04A 2KSFA 2KQ9A 3RVYA 2HFIA 3ASNC 1T6UA 3PMRA 4NCQA 4GQHA 5L3VA 3FMSA 3W8IA 1O3UA 4N6CA 3HNIA 5KYWA 3EJNA 1VYIA 2R7UA 2C03A 2LQGA 5EGYA 4ZLDA 3RF3A 1CGOA 2EPNA 4W8KA 4BJ1A 3TK0A 1OQCA 2HS5A 2R03A 1M57C 1U0BB 4BJ6C 2QE9A 3K1IC 4CBEA 4J30B 3J06A 1EA8A 2MYSA 3V5ZA 1ORSC 3HLZA 2XS8A 4MVQA 4RBNA 1OW8A 1WGWA 3UMHA 1Q0GA 1T5OA 3KKBA 2XLOA 4R32A 2EIMC 1YYJA 1ZHTA 2AU5A 1APCA 2I15A 2J7PD 2W4BA 2ZD9A 3U3FA 2MHRA 1MMAA 4OIRF 1JPNA 2G3KA 3RYLA 2H7BA 4DBQA 1VB5A 2LFFA 1ORYA 3JSEO 4CS9C 1E85A 3T6GB 3C8GD 3ZIBA 3U2MA 3S90A 5L3QA 1WATA 1L7CA 4XEKA 5TJ5E 4QDLA 2J8WA 4JE9A 4Q7CA 2YL7A 1ZU4A 1BR1A 2GWWA 3U8PA 4IGGA 1OR3A 1YYXA 4I1OB 3SEOA 1D1BA 2YL3A 1FFHA 2AVKA 4NC3A 4OD4A 1MNDA 4CDYA 1R5ID 3LEVA 4CSAC 4MW8A 1YZAA 3ATPA 2QLAA 4ULVA 3C8ZA 2WVOA 1VOMA 4RDAA 2OJQA 4J7TA 3FOOA 4LERA 3T9OA 4YT4A 4WJ0A 5L0CA 1M56C 4HE8D 1OW6A 4YT5A 4JVSA 4ZLCA 1T6IA 4YT8A 3TOLA 4YN0B 3K66A 3H2UA 3JYYA 1TWGA 3B0PA 2GDCA 3IHUA 2NUPB 3S27A 4U5FE 4U5GA 1T6QA 5EK0A 3LNMB 4ER9A 4LACB 3NYLA 2JD3A 4C3EA 1J8MF 2ICWG 2A69F 3JT1A 1RKEA 2VH3A 3LESA 3M1CB 4G7ZF 1G4US 2IXOA 3PCVA 2J9WA 2KGOA 2XLDA 4B6IA 2BC5A 2BL2A 3FHDA 1XZQA 3AQBA 2Q9AA 3HKKA 5F5FA 3VAYA 3US6A 3BRJA 1HMDA 1AEPA 1A7DA 4E18A 3GORA 3O10A 4MVRA 1GM5A 2P1AA 2YVKA 4Q5SF 5DS6A 1CGME 3EFOB 2CNWA 4F4BA 3DXJF 3G4ZA 3T6BA 2YRFA 3SXMA 5HV9A 4G7HF 1G8XA 4MQ9F 4OIQF 1K05A 2PX3A 1H9GA 4CIHA 5CI9A 2Y3BA 4DRHB 4E0HA 1Z5ZA 3LAYA 3V5YA 3DMDA 1FAPB 3LNRA 2Y39A 4A4AA 1D0XA 1NFNA 1OR2A 2XS1A 5JSLA 2XM4A 4CX9A 2ETSA 4O6MA 3EHNA 1V55C 1TWAA 4ONSA 1C17M 3B71A 1F1MA 2W9YA 3EGXA 3MFNA 2OKUA 2J9UA 1TFOB 1DOVA 5E3AA 2PNOA 3RIPA 4CS8A 1Z7Qc 4DJ9A 3AOUA 3F46A 2R25A 2RD9A 2H7OA 4XQ1A 1HMOA 3JYHA 2YHSA 1M2VA 1V4AA 4BEJA 3U0CA 2R7VA 4IRUA 4K1OA 2Y3GA 5IY5C 3U9MA 2IXNA 3E70C 1CPQA 2FAPB 4JTCB 5B1BC 5D92A 3W2VA 2BE5F 5KYNA 3Q6MA 2R9RB 2LD6A 3LS0A 1ZVZA 2QTVA 2HMQA 1YJGA 2Q9BA 3IQ6A 4CJGA 5A69A 1VTMP 1YARO 2OEXA 5A6KA 1KNYA 1YAUO 3SXZA 1LI7A 3GODA 4PK4A 5GPGB 3ABKC 1VLTA 3QTHA 3T4RA 2UUIA 3MX3A 4P6IC 3EG9B 3LEOA 5BQGA 1ST6A 2VB6A 1IZMA 4PR9A 2TMVP 4GYTA 4OD5A 5T3TA 2R7TA 3DZAA 3EZIA 3KPHA 4JRZA 2Q3TA 4CJOA 5L0DA 2V26A 2NUTB 3AG1C 1FTSA 3GM1A 4MS2A 2AWYA 256BA 2P6VA 1SZIA 4MW3A 3ZQYA 2LCHA 2XL4A 1NZEA 5KYUB 2WVNA 3EFOA 3R7CA 5L0GA 2NSGA 3GWNA 1WN0A 4X0RA 1EKYA 1Y4CA 1UFBA 3SZRA 5JLIA 3TJ6A 4EBJA 1XZPA 3ITFA 3POVA 1C02A 2VASA 3KYJA 3MLGA 3T6JA 3PDMP 3DKAA 2ZXWC 1FMWA 4IARA 3FAJA 3LJBA 5KYXB 1HE9A 5HSWA 2L6GA 4Q4ZF 4CDAA 5AC5A 1LS1A 1ZYRF 3N2ZB 3W2WA 2R7XA 3FXHA 3RVZA 2NUPA 4QI0A 2GA0A 2GFHA 2PF4E 2VCAA 5AC4A 3UMKA 1M2OA 5B3IA 4PFPA 3JTLO 2CNWD 3EHMA 4FX5A 3JRMO 3S84A 2A68F 3EGDA 4O6NA 4YT2A 2VCBA 2VC9A 4FESA 3ZSUA 3IPMO 3IQCA 4JCHA 3TQOA 2PFDA 4CIPA 3EH1A 4XLPF 5BQIA 5L0JA 3U3BA 1D1AA 4DOZA 2EIKC 4JC7A 4PJLA 1BDJB 1TWCA 2PP4A 1NSGB 1NU7D 2I8BA 2Y69C 4XEFA 4XPYA 3GEEA 2LFDA 3EPVA 4CS9A 5JVEA 3ZVRA 5AGFA 5CIVA 4KC9A 4U5CE 2YEVA 2XLWA 3R2PA 1PD1A 2KJGA 1YVIA 4IAOA 1RMVA 5COMA 2QNLA 2ZXPA 2OOCA 3A9CA 3OWTA 4N6HA 3ECSA 4EWCA 2XLMA 3HNKA 1OW7A 4EUKB 2V3CC 2HKVA 3H2VA 1JR8A 3I5PA 1NFOA 4H4KC 3L8IA 3OEOA 2GAQA 2AP3A 2EPLX 3RQEA 3C18A 4PJMA 2J7PA 1FMVA 3S9OA 4JIOA 1ZHYA 4G0HA 1Z23A 3FDQA 2XXAB 1ZZPA 4LDQA 4PACA 3ZG1A 2L81A 3VM6A 5KYYB 2W4MA 4JW1A 1HW1A 5T3WA 4D4XA 1GGQA 5KYWB 1NLXA 3C8GA 3QVZA 4UDVA 2O9XA 3HJCA 3NMJA 2LK4A 4XWJA 1Z3IX 5F5HA 1NG1A 1LI5A 1LE2A 1MNEA 4KBLA 1LPEA 3UNGC 4AE4A 3SXKA 4N4WA 4XTKA 4BPMA 2UUHA 2G3VA 3JZ0A 4LLEA 2CCYA 1KU2A 5FCLA 2HSQA 3JRTA 3K1HA 4MVOA 4E7SA 5A6BD 1SF8A 2AWCA 4HEAJ
chains in the Genus database with same CATH topology
4I44A 3OA1A 2OG2A 2E87A 2D5RB 4KNVA 3KL4A 4K7BA 3X1OA 3Q6NA 4BJ6A 3LLIA 2ZXRA 3ZC4A 1TKNA 2MWQA 4CS8C 3DD7A 2XRHA 1ZHWA 1ZHXA 1D0ZA 2A6HF 2HV6A 5DQTA 5KYUA 5KYYA 5BUOA 4OIPF 2W45A 3DAFA 1VYKA 5E33A 1VK5A 4PJJA 3SYNA 3UGPA 3KMIA 4U5EE 3FVYA 4IWBA 1FFTC 2QY9A 3HTKC 2B0JA 4CS7A 2J0XA 2L9JA 4ANJA 5D91A 1TR2A 2R7OA 2G62A 5KYXA 3EQLF 3NKDA 2A6EF 2WZFA 4RD9A 4YWQA 3DJNB 3DJUB 4I3MA 3LS1A 3S28A 1LKXA 4K0DA 3B0VC 4C7OA 3TD7A 1D1CA 4E7ZA 2Z15A 4DBRA 4HFFB 3RKOF 3EGXB 3AQCA 4U5DE 5T1DB 4U5BE 1PCXA 3GANA 3L34A 2CDQA 3NKEA 1D0YA 1MMNA 2IXMA 4O6YA 4I1MA 2NG1A 1RJ9A 3V7OA 3AG2C 3L0IA 3NRHA 4OIOF 3I4UA 1JPJA 4HFKB 2PX0A 3CQZA 3K33A 3CSKA 2H7VC 1ZHZA 1BR4A 1S7ZA 3UR3C 4FWVA 3DM5A 1PD0A 1M2VB 1RJ9B 3ABMC 1O5HA 5EHHA 3DM9B 4XLNF 4M63A 3LLKA 4OINF 2R7RA 3E9VA 2P7VA 3I5QA 4NY3A 1QZXA 2EIJC 2DYRC 4C3DA 2CGEA 2WB7A 3Q7GA 2IYLD 3PHF2 4C7OB 1Z6AA 2WZGA 4AX2A 2YZSA 4BJ5C 4GEHA 5E3CA 5B3SC 1OKKA 1IW7F 2J45A 3S29A 1TWHA 3EH2A 4BJ5A 3UGOA 4J32B 3B0UX 1OCCC 4PFOA 5DS4A 3CZ6A 4CSAA 2FFHA 3Q7LA 5CI8A 3QMKA 2M4EA 3NYJA 4AK9A 3SP1A 1VMAA 4O7GA 4LLCA 1ZU5A 2XSEA 2NUTA 2WVQA 4EBBA 1V54C 2R7QA 2A1DD 2DYSC 4PJNA 5DLJA 3DAGA 3EG9A 4CS9A 1NU9C 4YJWA 3S0XA 4DVYP 2ZPAA 3AG3C 4BG0A 3VYWA 3NG1A 1MMGA 3F47A 3H65A 4QI2A 2IXPA 2DGJA 2J0WA 2FGYA 3K6BA 4MNDA 4G7OF 3UMIA 2J9VA 2XXAA 3JSZA 1N1CA 1O87A 1Z63A 3QZCA 3IEEA 3O6XA 4IJJA 1OCZC 4JJFA 5B1AC 2J46A 1LVKA 4C3BA 3B9QA 3RFYA 5DQZA 4AE4B 2HV7A 2R7SA 3WODF 3SNHA 3NDBB 5DVWA 1OCOC 1OCRC 3JCUQ 3O39A 4N06A 2IOQA 2Q9CA 2EILC 3RH3A 2ZXOA 2WL8A 1MMDA 1SMYF 3NYMA 4JJGA 4ULWA 4A2NB 2OCCC 3WG7C 3KH2A 2CW0F 4KI2A 2LSEA 1J8YF 3EGDB 4U5HA 3EZHA 4KNWA 3AG4C 3X2QC 5DS5A 2WZLA 4JZAA 4JURI 2R7WA 3N24A 5E2QA 4BJTA 3N0TA 2KW3C 1W2WA 3ASOC 1OKKD 2X51A 2Y3HA 2Y3DA 3ABLC 3K7DA 2KNHA 4DVZA 2EINC 1QLEC 3W8HA 4O79A 1BR2A 2C04A 2KQ9A 3ASNC 3PMRA 5L3VA 3W8IA 5KYWA 3EJNA 1VYIA 2R7UA 2C03A 5EGYA 4ZLDA 4W8KA 4BJ1A 1M57C 4BJ6C 3K1IC 4CBEA 4J30B 2MYSA 3HLZA 4RBNA 3UMHA 1WGWA 3KKBA 2EIMC 1ZHTA 2J7PD 2W4BA 1MMAA 4OIRF 1JPNA 2G3KA 3RYLA 2H7BA 4DBQA 4CS9C 3ZIBA 5L3QA 4QDLA 4Q7CA 1ZU4A 1BR1A 4I1OB 3SEOA 1D1BA 1FFHA 4OD4A 1MNDA 3LEVA 4CSAC 2WVOA 1VOMA 4RDAA 4YT4A 4LERA 4WJ0A 1M56C 4HE8D 4YT5A 4JVSA 4ZLCA 4YT8A 4YN0B 3K66A 1TWGA 3B0PA 2NUPB 3S27A 4U5FE 4U5GA 4LACB 3NYLA 2JD3A 4C3EA 1J8MF 2A69F 3JT1A 3LESA 2VH3A 3M1CB 4G7ZF 2IXOA 2J9WA 2KGOA 4B6IA 3FHDA 3AQBA 2Q9AA 5F5FA 3VAYA 4Q5SF 5DS6A 3EFOB 2CNWA 4F4BA 3DXJF 3T6BA 4G7HF 1G8XA 4MQ9F 4OIQF 2PX3A 4CIHA 5CI9A 2Y3BA 1Z5ZA 3LAYA 3DMDA 3LNRA 2Y39A 1D0XA 4O6MA 3EHNA 1V55C 1TWAA 2W9YA 3EGXA 2J9UA 5E3AA 3RIPA 4CS8A 3F46A 2H7OA 2R7VA 3JYHA 2YHSA 1M2VA 4BEJA 4IRUA 2Y3GA 5IY5C 2IXNA 3E70C 5B1BC 5D92A 3W2VA 2BE5F 5KYNA 3Q6MA 3LS0A 2QTVA 2Q9BA 3GODA 4PK4A 3ABKC 3T4RA 3MX3A 4P6IC 3EG9B 1ST6A 2VB6A 1IZMA 4GYTA 4OD5A 5T3TA 2R7TA 3DZAA 3EZIA 2Q3TA 2V26A 2NUTB 3AG1C 1FTSA 2P6VA 1SZIA 2XL4A 1NZEA 5KYUB 2WVNA 3EFOA 4X0RA 3SZRA 3ITFA 3POVA 2VASA 3MLGA 3T6JA 2ZXWC 1FMWA 3FAJA 3LJBA 5KYXB 5HSWA 4Q4ZF 1LS1A 1ZYRF 3N2ZB 3W2WA 2R7XA 2NUPA 4QI0A 2GFHA 2PF4E 3UMKA 1M2OA 4PFPA 4FX5A 2CNWD 3EHMA 2A68F 3EGDA 4O6NA 4YT2A 4FESA 3ZSUA 4JCHA 2PFDA 3EH1A 4XLPF 1D1AA 4DOZA 2EIKC 4PJLA 1TWCA 2PP4A 1NU7D 2I8BA 2Y69C 3EPVA 3ZVRA 4KC9A 4U5CE 2YEVA 1PD1A 2KJGA 4IAOA 2ZXPA 3OWTA 3ECSA 4EWCA 2V3CC 3I5PA 4H4KC 3OEOA 4PJMA 2J7PA 1FMVA 2XXAB 1ZHYA 4G0HA 1Z23A 3FDQA 3ZG1A 5KYYB 2L81A 2W4MA 4JW1A 5T3WA 5KYWB 2O9XA 3HJCA 4XWJA 5F5HA 1Z3IX 1NG1A 1MNEA 4KBLA 3UNGC 4AE4A 4XTKA 2G3VA 4LLEA 1KU2A 5FCLA 3K1HA 3JRTA 4E7SA 1SF8A 4HEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEH A;  3W8I A;  3W8H A; 
#chains in the Genus database with same CATH topology
 3U9J A;  4WGZ A;  1AVO B;  4I44 A;  3OA1 A;  1E83 A;  3ZQV A;  2OG2 A;  2E87 A;  2D5R B;  4KNV A;  3KL4 A;  4K7B A;  3IQT A;  3M79 A;  3Q6N A;  1OXB A;  1WOL A;  3X1O A;  4BJ6 A;  3K1I A;  1KTM A;  2CYD A;  3LLI A;  2ZXR A;  4JEB A;  5FZT A;  1I5N A;  3ZC4 A;  3TUL A;  1A7E A;  3RQG A;  4EIY A;  2LIG A;  4H54 A;  1TFK B;  1SR2 A;  2H8A A;  1TKN A;  2P61 A;  1Q0D A;  2MWQ A;  2M64 A;  2XRH A;  1QPU A;  3DD7 A;  4CS8 C;  1ZHW A;  4CDV A;  1ZHX A;  1D0Z A;  2A6H F;  3B29 A;  4NTB A;  2HV6 A;  5DQT A;  5KYU A;  1ORJ A;  5KYY A;  3CEX A;  5BUO A;  4OIP F;  2YLD A;  4WGY A;  1HY5 A;  2W45 A;  3GWL A;  4EBK A;  3QVY A;  3DAF A;  1VYK A;  5E33 A;  1VK5 A;  5L0F A;  5K0I A;  4PJJ A;  3U2L A;  1QKR A;  1LE4 A;  4DRI B;  3SYN A;  3UGP A;  1H9T A;  4MVS A;  3KMI A;  4U5E E;  3FVY A;  3DE8 A;  3C63 A;  1B68 A;  4IWB A;  1FFT C;  2QY9 A;  3HTK C;  4NTF A;  2B0J A;  4CS7 A;  1RCP A;  2J0X A;  2L9J A;  1YA9 A;  4ANJ A;  5D91 A;  1TR2 A;  1CGN A;  2YLG A;  2XLV A;  4YL0 A;  1BBH A;  4P9F A;  1WAS A;  2R7O A;  2G62 A;  1JAF A;  4MTO A;  5KYX A;  3EQL F;  3NKD A;  2F22 A;  3HNL A;  1NBB A;  4G78 A;  2PBE A;  2A6E F;  2WZF A;  3MYI A;  2A0B A;  3L1M A;  4RD9 A;  4YWQ A;  3DJN B;  3DJU B;  1OXK A;  2OQM A;  3G4X A;  3LS1 A;  4I3M A;  1LKX A;  4K0D A;  4JTA B;  3S28 A;  3B0V C;  3C8G B;  3TD7 A;  4C7O A;  1MQV A;  1D1C A;  4E7Z A;  1YLM A;  2HUJ A;  2NPU A;  2OU6 A;  1HW2 A;  2Z15 A;  3BEH A;  3GM2 A;  4DBR A;  1A7V A;  4HFF B;  4YL1 A;  3RKO F;  3EGX B;  1I4Y A;  1Y6D A;  4MTG A;  3AQC A;  3O55 A;  3V5X A;  4U5D E;  5T1D B;  4U5B E;  1U89 A;  4NTA A;  1H6G A;  3W4Y A;  1PCX A;  2R05 A;  3GAN A;  3L34 A;  3AGT A;  2CDQ A;  2KC3 A;  3NKE A;  1D0Y A;  1MMN A;  2IXM A;  1G4W R;  2JX0 A;  4I1M A;  4O6Y A;  5JT4 A;  2NG1 A;  3C62 A;  1RJ9 A;  2HSB A;  3V7O A;  2B0H A;  1A41 A;  4U9E A;  1ZW2 A;  2YKZ A;  3FOP A;  3MYF A;  1U6H A;  2XLE A;  3AG2 C;  3L0I A;  1HE1 A;  3NRH A;  4OIO F;  1DOW A;  4P9T A;  3I4U A;  1JPJ A;  4HFK B;  4JEA A;  1YDI A;  2PX0 A;  3CQZ A;  3K33 A;  1QSP A;  1YA7 O;  1YZC A;  2YQY A;  3CSK A;  1FR0 A;  2DB4 A;  1XWJ A;  5A6B A;  3KYI A;  4JTD B;  2KYH A;  4MVM A;  1FNT c;  2IM8 A;  4Z9I A;  1Q0M A;  2H7V C;  1ZHZ A;  2YLI A;  1A0B A;  1BR4 A;  4Z9H A;  3WAQ A;  4LDR A;  1S7Z A;  3UR3 C;  4FWV A;  3DM5 A;  4AL0 A;  1PD0 A;  1M2V B;  1RJ9 B;  3M4C A;  3RQF A;  3VF0 A;  2L7A A;  3ABM C;  1JRA A;  2QUP A;  2HMZ A;  1LM3 B;  1O5H A;  1RXQ A;  5EHH A;  2A0U A;  2IBF A;  3DM9 B;  4XLN F;  2YL0 A;  1AUE A;  3LLK A;  4M63 A;  1M6T A;  4OIN F;  3E9V A;  2R7R A;  2P7V A;  3I5Q A;  4NY3 A;  2OJE D;  1QZX A;  2EIJ C;  1H7I A;  2DYR C;  4C3D A;  2CGE A;  5L0H A;  2WB7 A;  3Q7G A;  2VCC A;  3ZTZ A;  2IYL D;  3PHF 2;  1L3P A;  1LS4 A;  1VLS A;  1Q0K A;  5JRA A;  4C7O B;  1E86 A;  2XL6 A;  1Z6A A;  4YK5 A;  5JUA A;  2WZG A;  4AX2 A;  1CPR A;  2YZS A;  2LP4 A;  4BJ5 C;  4EKW A;  4GEH A;  5E3C A;  2XL8 A;  1OKK A;  5B3S C;  1IW7 F;  2J45 A;  4W8P A;  3S29 A;  1TWH A;  5JS5 A;  3EH2 A;  4BJ5 A;  3UGO A;  1WTY A;  1T01 A;  4J32 B;  2ASR A;  1WWP A;  3B0U X;  1OCC C;  4IB4 A;  4PFO A;  4WAB A;  4L6R A;  1BZ4 A;  3CZ6 A;  3VRC A;  5DS4 A;  4CSA A;  1EQ1 A;  3QW0 A;  3TOM A;  3DE9 A;  2FFH A;  4D4N A;  4JKV A;  3Q7L A;  5CI8 A;  3QMK A;  2M4E A;  3FAP B;  3NYJ A;  2Q7R A;  3SP1 A;  1VMA A;  3ZTM A;  4O7G A;  4LLC A;  4AK9 A;  1ZU5 A;  2XSE A;  2NUT A;  5A6A A;  2WVQ A;  4EBB A;  1GS9 A;  1RKE B;  1V54 C;  2A1D D;  2DYS C;  2R7Q A;  4PJN A;  5DLJ A;  3DAG A;  5BQH A;  1JOG A;  3EG9 A;  1JMW A;  1LIH A;  1NU9 C;  5JP7 A;  1V74 B;  1SYQ A;  3MBG A;  4YJW A;  3WHN A;  4EHP A;  3S0X A;  2XLH A;  4DVY P;  2ZPA A;  3AG3 C;  4BG0 A;  2EPO A;  3VYW A;  3ZDL A;  3NG1 A;  2YL1 A;  4DXW A;  1MMG A;  3LUT B;  3F47 A;  3H65 A;  4QI2 A;  2DI3 A;  2IXP A;  1E2X A;  2L6H A;  1GQA A;  2DGJ A;  2J0W A;  4FAP B;  2FGY A;  3K6B A;  4MND A;  4G7O F;  2RSE B;  1K40 A;  1PV3 A;  1R4T A;  2J9V A;  3QW1 A;  3UMI A;  4LDK A;  5COG A;  3RW0 A;  4MVU A;  1Q0F A;  2XXA A;  2Q4F A;  2L6F A;  3JSZ A;  2NSF A;  1N1C A;  3GM3 A;  3A11 A;  1O87 A;  3DI5 A;  1Z63 A;  3QZC A;  2YWA A;  3IEE A;  4JCZ A;  4YL3 A;  3O6X A;  4DRJ B;  2XM0 A;  4IJJ A;  1OCZ C;  4JJF A;  4XEV A;  2HZ8 A;  4J7Y A;  5B1A C;  1G5Z A;  1LVK A;  2J46 A;  3TJ5 A;  4IAQ A;  4C3B A;  5L0I A;  3B9Q A;  3RFY A;  5DQZ A;  4AE4 B;  2R02 A;  2HV7 A;  2JPU A;  2J9B A;  4BEM J;  3SXY A;  3NMK A;  3WOD F;  2R7S A;  2EPK X;  3SNH A;  3U8V A;  3NDB B;  5DVW A;  1C03 A;  4NQF A;  2OEV A;  1OCO C;  1OCR C;  5COF A;  3JCU Q;  4E0I A;  3AGU A;  3O39 A;  4N06 A;  3ZWI A;  4U9D A;  4XPX A;  2IOQ A;  2Q9C A;  2EIL C;  3RH3 A;  2ZXO A;  2WL8 A;  1MMD A;  1T9K A;  1SMY F;  5A6J A;  4XPW A;  3NYM A;  4JJG A;  1S05 A;  4ULW A;  4A2N B;  2OCC C;  3WG7 C;  3KH2 A;  4MVZ A;  2CW0 F;  3G50 A;  2LSE A;  2D4U A;  3GEH A;  4Z9J A;  3U5S A;  4KI2 A;  1EI7 A;  1J8Y F;  3EGD B;  4U5H A;  1E84 A;  3EZH A;  1TQG A;  4KNW A;  1ZW3 A;  1QVX A;  3AG4 C;  3X2Q C;  5DS5 A;  2WZL A;  1QQ3 A;  4JUR I;  4JZA A;  3NMI A;  2R7W A;  1I4Z A;  4E17 A;  3N24 A;  5E2Q A;  3GEI A;  4BJT A;  3IQ5 A;  3C7J A;  3N0T A;  5F28 E;  2KW3 C;  1W2W A;  2Q00 A;  3L8J A;  2X0C A;  3CAX A;  3M15 A;  1RKC A;  3M4B A;  3ASO C;  3HNJ A;  3DWW A;  1OKK D;  2P0N A;  2EPM X;  2X51 A;  2HJM A;  2Y3H A;  2Y3D A;  1UG7 A;  2KK1 A;  3ABL C;  3AJM A;  3K7D A;  4AL1 A;  2KNH A;  4DVZ A;  2EIN C;  1QLE C;  2HJ3 A;  4MTF A;  3W8H A;  4O79 A;  1BR2 A;  1K04 A;  2C04 A;  2KSF A;  2KQ9 A;  3RVY A;  2HFI A;  3ASN C;  1T6U A;  3PMR A;  4NCQ A;  4GQH A;  5L3V A;  3FMS A;  3W8I A;  1O3U A;  4N6C A;  3HNI A;  5KYW A;  3EJN A;  1VYI A;  2R7U A;  2C03 A;  2LQG A;  5EGY A;  4ZLD A;  3RF3 A;  1CGO A;  2EPN A;  4W8K A;  4BJ1 A;  3TK0 A;  1OQC A;  2HS5 A;  2R03 A;  1M57 C;  1U0B B;  4BJ6 C;  2QE9 A;  3K1I C;  4CBE A;  4J30 B;  3J06 A;  1EA8 A;  2MYS A;  3V5Z A;  1ORS C;  3HLZ A;  2XS8 A;  4MVQ A;  4RBN A;  1OW8 A;  1WGW A;  3UMH A;  1Q0G A;  1T5O A;  3KKB A;  2XLO A;  4R32 A;  2EIM C;  1YYJ A;  1ZHT A;  2AU5 A;  1APC A;  2I15 A;  2J7P D;  2W4B A;  2ZD9 A;  3U3F A;  2MHR A;  1MMA A;  4OIR F;  1JPN A;  2G3K A;  3RYL A;  2H7B A;  4DBQ A;  1VB5 A;  2LFF A;  1ORY A;  3JSE O;  4CS9 C;  1E85 A;  3T6G B;  3C8G D;  3ZIB A;  3U2M A;  3S90 A;  5L3Q A;  1WAT A;  1L7C A;  4XEK A;  5TJ5 E;  4QDL A;  2J8W A;  4JE9 A;  4Q7C A;  2YL7 A;  1ZU4 A;  1BR1 A;  2GWW A;  3U8P A;  4IGG A;  1OR3 A;  1YYX A;  4I1O B;  3SEO A;  1D1B A;  2YL3 A;  1FFH A;  2AVK A;  4NC3 A;  4OD4 A;  1MND A;  4CDY A;  1R5I D;  3LEV A;  4CSA C;  4MW8 A;  1YZA A;  3ATP A;  2QLA A;  4ULV A;  3C8Z A;  2WVO A;  1VOM A;  4RDA A;  2OJQ A;  4J7T A;  3FOO A;  4LER A;  3T9O A;  4YT4 A;  4WJ0 A;  5L0C A;  1M56 C;  4HE8 D;  1OW6 A;  4YT5 A;  4JVS A;  4ZLC A;  1T6I A;  4YT8 A;  3TOL A;  4YN0 B;  3K66 A;  3H2U A;  3JYY A;  1TWG A;  3B0P A;  2GDC A;  3IHU A;  2NUP B;  3S27 A;  4U5F E;  4U5G A;  1T6Q A;  5EK0 A;  3LNM B;  4ER9 A;  4LAC B;  3NYL A;  2JD3 A;  4C3E A;  1J8M F;  2ICW G;  2A69 F;  3JT1 A;  1RKE A;  2VH3 A;  3LES A;  3M1C B;  4G7Z F;  1G4U S;  2IXO A;  3PCV A;  2J9W A;  2KGO A;  2XLD A;  4B6I A;  2BC5 A;  2BL2 A;  3FHD A;  1XZQ A;  3AQB A;  2Q9A A;  3HKK A;  5F5F A;  3VAY A;  3US6 A;  3BRJ A;  1HMD A;  1AEP A;  1A7D A;  4E18 A;  3GOR A;  3O10 A;  4MVR A;  1GM5 A;  2P1A A;  2YVK A;  4Q5S F;  5DS6 A;  1CGM E;  3EFO B;  2CNW A;  4F4B A;  3DXJ F;  3G4Z A;  3T6B A;  2YRF A;  3SXM A;  5HV9 A;  4G7H F;  1G8X A;  4MQ9 F;  4OIQ F;  1K05 A;  2PX3 A;  1H9G A;  4CIH A;  5CI9 A;  2Y3B A;  4DRH B;  4E0H A;  1Z5Z A;  3LAY A;  3V5Y A;  3DMD A;  1FAP B;  3LNR A;  2Y39 A;  4A4A A;  1D0X A;  1NFN A;  1OR2 A;  2XS1 A;  5JSL A;  2XM4 A;  4CX9 A;  2ETS A;  4O6M A;  3EHN A;  1V55 C;  1TWA A;  4ONS A;  1C17 M;  3B71 A;  1F1M A;  2W9Y A;  3EGX A;  3MFN A;  2OKU A;  2J9U A;  1TFO B;  1DOV A;  5E3A A;  2PNO A;  3RIP A;  4CS8 A;  1Z7Q c;  4DJ9 A;  3AOU A;  3F46 A;  2R25 A;  2RD9 A;  2H7O A;  4XQ1 A;  1HMO A;  3JYH A;  2YHS A;  1M2V A;  1V4A A;  4BEJ A;  3U0C A;  2R7V A;  4IRU A;  4K1O A;  2Y3G A;  5IY5 C;  3U9M A;  2IXN A;  3E70 C;  1CPQ A;  2FAP B;  4JTC B;  5B1B C;  5D92 A;  3W2V A;  2BE5 F;  5KYN A;  3Q6M A;  2R9R B;  2LD6 A;  3LS0 A;  1ZVZ A;  2QTV A;  2HMQ A;  1YJG A;  2Q9B A;  3IQ6 A;  4CJG A;  5A69 A;  1VTM P;  1YAR O;  2OEX A;  5A6K A;  1KNY A;  1YAU O;  3SXZ A;  1LI7 A;  3GOD A;  4PK4 A;  5GPG B;  3ABK C;  1VLT A;  3QTH A;  3T4R A;  2UUI A;  3MX3 A;  4P6I C;  3EG9 B;  3LEO A;  5BQG A;  1ST6 A;  2VB6 A;  1IZM A;  4PR9 A;  2TMV P;  4GYT A;  4OD5 A;  5T3T A;  2R7T A;  3DZA A;  3EZI A;  3KPH A;  4JRZ A;  2Q3T A;  4CJO A;  5L0D A;  2V26 A;  2NUT B;  3AG1 C;  1FTS A;  3GM1 A;  4MS2 A;  2AWY A;  256B A;  2P6V A;  1SZI A;  4MW3 A;  3ZQY A;  2LCH A;  2XL4 A;  1NZE A;  5KYU B;  2WVN A;  3EFO A;  3R7C A;  5L0G A;  2NSG A;  3GWN A;  1WN0 A;  4X0R A;  1EKY A;  1Y4C A;  1UFB A;  3SZR A;  5JLI A;  3TJ6 A;  4EBJ A;  1XZP A;  3ITF A;  3POV A;  1C02 A;  2VAS A;  3KYJ A;  3MLG A;  3T6J A;  3PDM P;  3DKA A;  2ZXW C;  1FMW A;  4IAR A;  3FAJ A;  3LJB A;  5KYX B;  1HE9 A;  5HSW A;  2L6G A;  4Q4Z F;  4CDA A;  5AC5 A;  1LS1 A;  1ZYR F;  3N2Z B;  3W2W A;  2R7X A;  3FXH A;  3RVZ A;  2NUP A;  4QI0 A;  2GA0 A;  2GFH A;  2PF4 E;  2VCA A;  5AC4 A;  3UMK A;  1M2O A;  5B3I A;  4PFP A;  3JTL O;  2CNW D;  3EHM A;  4FX5 A;  3JRM O;  3S84 A;  2A68 F;  3EGD A;  4O6N A;  4YT2 A;  2VCB A;  2VC9 A;  4FES A;  3ZSU A;  3IPM O;  3IQC A;  4JCH A;  3TQO A;  2PFD A;  4CIP A;  3EH1 A;  4XLP F;  5BQI A;  5L0J A;  3U3B A;  1D1A A;  4DOZ A;  2EIK C;  4JC7 A;  4PJL A;  1BDJ B;  1TWC A;  2PP4 A;  1NSG B;  1NU7 D;  2I8B A;  2Y69 C;  4XEF A;  4XPY A;  3GEE A;  2LFD A;  3EPV A;  4CS9 A;  5JVE A;  3ZVR A;  5AGF A;  5CIV A;  4KC9 A;  4U5C E;  2YEV A;  2XLW A;  3R2P A;  1PD1 A;  2KJG A;  1YVI A;  4IAO A;  1RMV A;  5COM A;  2QNL A;  2ZXP A;  2OOC A;  3A9C A;  3OWT A;  4N6H A;  3ECS A;  4EWC A;  2XLM A;  3HNK A;  1OW7 A;  4EUK B;  2V3C C;  2HKV A;  3H2V A;  1JR8 A;  3I5P A;  1NFO A;  4H4K C;  3L8I A;  3OEO A;  2GAQ A;  2AP3 A;  2EPL X;  3RQE A;  3C18 A;  4PJM A;  2J7P A;  1FMV A;  3S9O A;  4JIO A;  1ZHY A;  4G0H A;  1Z23 A;  3FDQ A;  2XXA B;  1ZZP A;  4LDQ A;  4PAC A;  3ZG1 A;  2L81 A;  3VM6 A;  5KYY B;  2W4M A;  4JW1 A;  1HW1 A;  5T3W A;  4D4X A;  1GGQ A;  5KYW B;  1NLX A;  3C8G A;  3QVZ A;  4UDV A;  2O9X A;  3HJC A;  3NMJ A;  2LK4 A;  4XWJ A;  1Z3I X;  5F5H A;  1NG1 A;  1LI5 A;  1LE2 A;  1MNE A;  4KBL A;  1LPE A;  3UNG C;  4AE4 A;  3SXK A;  4N4W A;  4XTK A;  4BPM A;  2UUH A;  2G3V A;  3JZ0 A;  4LLE A;  2CCY A;  1KU2 A;  5FCL A;  2HSQ A;  3JRT A;  3K1H A;  4MVO A;  4E7S A;  5A6B D;  1SF8 A;  2AWC A;  4HEA J; 
#chains in the Genus database with same CATH homology
 4I44 A;  3OA1 A;  2OG2 A;  2E87 A;  2D5R B;  4KNV A;  3KL4 A;  4K7B A;  3X1O A;  3Q6N A;  4BJ6 A;  3LLI A;  2ZXR A;  3ZC4 A;  1TKN A;  2MWQ A;  4CS8 C;  3DD7 A;  2XRH A;  1ZHW A;  1ZHX A;  1D0Z A;  2A6H F;  2HV6 A;  5DQT A;  5KYU A;  5KYY A;  5BUO A;  4OIP F;  2W45 A;  3DAF A;  1VYK A;  5E33 A;  1VK5 A;  4PJJ A;  3SYN A;  3UGP A;  3KMI A;  4U5E E;  3FVY A;  4IWB A;  1FFT C;  2QY9 A;  3HTK C;  2B0J A;  4CS7 A;  2J0X A;  2L9J A;  4ANJ A;  5D91 A;  1TR2 A;  2R7O A;  2G62 A;  5KYX A;  3EQL F;  3NKD A;  2A6E F;  2WZF A;  4RD9 A;  4YWQ A;  3DJN B;  3DJU B;  4I3M A;  3LS1 A;  3S28 A;  1LKX A;  4K0D A;  3B0V C;  4C7O A;  3TD7 A;  1D1C A;  4E7Z A;  2Z15 A;  4DBR A;  4HFF B;  3RKO F;  3EGX B;  3AQC A;  4U5D E;  5T1D B;  4U5B E;  1PCX A;  3GAN A;  3L34 A;  2CDQ A;  3NKE A;  1D0Y A;  1MMN A;  2IXM A;  4O6Y A;  4I1M A;  2NG1 A;  1RJ9 A;  3V7O A;  3AG2 C;  3L0I A;  3NRH A;  4OIO F;  3I4U A;  1JPJ A;  4HFK B;  2PX0 A;  3CQZ A;  3K33 A;  3CSK A;  2H7V C;  1ZHZ A;  1BR4 A;  1S7Z A;  3UR3 C;  4FWV A;  3DM5 A;  1PD0 A;  1M2V B;  1RJ9 B;  3ABM C;  1O5H A;  5EHH A;  3DM9 B;  4XLN F;  4M63 A;  3LLK A;  4OIN F;  2R7R A;  3E9V A;  2P7V A;  3I5Q A;  4NY3 A;  1QZX A;  2EIJ C;  2DYR C;  4C3D A;  2CGE A;  2WB7 A;  3Q7G A;  2IYL D;  3PHF 2;  4C7O B;  1Z6A A;  2WZG A;  4AX2 A;  2YZS A;  4BJ5 C;  4GEH A;  5E3C A;  5B3S C;  1OKK A;  1IW7 F;  2J45 A;  3S29 A;  1TWH A;  3EH2 A;  4BJ5 A;  3UGO A;  4J32 B;  3B0U X;  1OCC C;  4PFO A;  5DS4 A;  3CZ6 A;  4CSA A;  2FFH A;  3Q7L A;  5CI8 A;  3QMK A;  2M4E A;  3NYJ A;  4AK9 A;  3SP1 A;  1VMA A;  4O7G A;  4LLC A;  1ZU5 A;  2XSE A;  2NUT A;  2WVQ A;  4EBB A;  1V54 C;  2R7Q A;  2A1D D;  2DYS C;  4PJN A;  5DLJ A;  3DAG A;  3EG9 A;  4CS9 A;  1NU9 C;  4YJW A;  3S0X A;  4DVY P;  2ZPA A;  3AG3 C;  4BG0 A;  3VYW A;  3NG1 A;  1MMG A;  3F47 A;  3H65 A;  4QI2 A;  2IXP A;  2DGJ A;  2J0W A;  2FGY A;  3K6B A;  4MND A;  4G7O F;  3UMI A;  2J9V A;  2XXA A;  3JSZ A;  1N1C A;  1O87 A;  1Z63 A;  3QZC A;  3IEE A;  3O6X A;  4IJJ A;  1OCZ C;  4JJF A;  5B1A C;  2J46 A;  1LVK A;  4C3B A;  3B9Q A;  3RFY A;  5DQZ A;  4AE4 B;  2HV7 A;  2R7S A;  3WOD F;  3SNH A;  3NDB B;  5DVW A;  1OCO C;  1OCR C;  3JCU Q;  3O39 A;  4N06 A;  2IOQ A;  2Q9C A;  2EIL C;  3RH3 A;  2ZXO A;  2WL8 A;  1MMD A;  1SMY F;  3NYM A;  4JJG A;  4ULW A;  4A2N B;  2OCC C;  3WG7 C;  3KH2 A;  2CW0 F;  4KI2 A;  2LSE A;  1J8Y F;  3EGD B;  4U5H A;  3EZH A;  4KNW A;  3AG4 C;  3X2Q C;  5DS5 A;  2WZL A;  4JZA A;  4JUR I;  2R7W A;  3N24 A;  5E2Q A;  4BJT A;  3N0T A;  2KW3 C;  1W2W A;  3ASO C;  1OKK D;  2X51 A;  2Y3H A;  2Y3D A;  3ABL C;  3K7D A;  2KNH A;  4DVZ A;  2EIN C;  1QLE C;  3W8H A;  4O79 A;  1BR2 A;  2C04 A;  2KQ9 A;  3ASN C;  3PMR A;  5L3V A;  3W8I A;  5KYW A;  3EJN A;  1VYI A;  2R7U A;  2C03 A;  5EGY A;  4ZLD A;  4W8K A;  4BJ1 A;  1M57 C;  4BJ6 C;  3K1I C;  4CBE A;  4J30 B;  2MYS A;  3HLZ A;  4RBN A;  3UMH A;  1WGW A;  3KKB A;  2EIM C;  1ZHT A;  2J7P D;  2W4B A;  1MMA A;  4OIR F;  1JPN A;  2G3K A;  3RYL A;  2H7B A;  4DBQ A;  4CS9 C;  3ZIB A;  5L3Q A;  4QDL A;  4Q7C A;  1ZU4 A;  1BR1 A;  4I1O B;  3SEO A;  1D1B A;  1FFH A;  4OD4 A;  1MND A;  3LEV A;  4CSA C;  2WVO A;  1VOM A;  4RDA A;  4YT4 A;  4LER A;  4WJ0 A;  1M56 C;  4HE8 D;  4YT5 A;  4JVS A;  4ZLC A;  4YT8 A;  4YN0 B;  3K66 A;  1TWG A;  3B0P A;  2NUP B;  3S27 A;  4U5F E;  4U5G A;  4LAC B;  3NYL A;  2JD3 A;  4C3E A;  1J8M F;  2A69 F;  3JT1 A;  3LES A;  2VH3 A;  3M1C B;  4G7Z F;  2IXO A;  2J9W A;  2KGO A;  4B6I A;  3FHD A;  3AQB A;  2Q9A A;  5F5F A;  3VAY A;  4Q5S F;  5DS6 A;  3EFO B;  2CNW A;  4F4B A;  3DXJ F;  3T6B A;  4G7H F;  1G8X A;  4MQ9 F;  4OIQ F;  2PX3 A;  4CIH A;  5CI9 A;  2Y3B A;  1Z5Z A;  3LAY A;  3DMD A;  3LNR A;  2Y39 A;  1D0X A;  4O6M A;  3EHN A;  1V55 C;  1TWA A;  2W9Y A;  3EGX A;  2J9U A;  5E3A A;  3RIP A;  4CS8 A;  3F46 A;  2H7O A;  2R7V A;  3JYH A;  2YHS A;  1M2V A;  4BEJ A;  4IRU A;  2Y3G A;  5IY5 C;  2IXN A;  3E70 C;  5B1B C;  5D92 A;  3W2V A;  2BE5 F;  5KYN A;  3Q6M A;  3LS0 A;  2QTV A;  2Q9B A;  3GOD A;  4PK4 A;  3ABK C;  3T4R A;  3MX3 A;  4P6I C;  3EG9 B;  1ST6 A;  2VB6 A;  1IZM A;  4GYT A;  4OD5 A;  5T3T A;  2R7T A;  3DZA A;  3EZI A;  2Q3T A;  2V26 A;  2NUT B;  3AG1 C;  1FTS A;  2P6V A;  1SZI A;  2XL4 A;  1NZE A;  5KYU B;  2WVN A;  3EFO A;  4X0R A;  3SZR A;  3ITF A;  3POV A;  2VAS A;  3MLG A;  3T6J A;  2ZXW C;  1FMW A;  3FAJ A;  3LJB A;  5KYX B;  5HSW A;  4Q4Z F;  1LS1 A;  1ZYR F;  3N2Z B;  3W2W A;  2R7X A;  2NUP A;  4QI0 A;  2GFH A;  2PF4 E;  3UMK A;  1M2O A;  4PFP A;  4FX5 A;  2CNW D;  3EHM A;  2A68 F;  3EGD A;  4O6N A;  4YT2 A;  4FES A;  3ZSU A;  4JCH A;  2PFD A;  3EH1 A;  4XLP F;  1D1A A;  4DOZ A;  2EIK C;  4PJL A;  1TWC A;  2PP4 A;  1NU7 D;  2I8B A;  2Y69 C;  3EPV A;  3ZVR A;  4KC9 A;  4U5C E;  2YEV A;  1PD1 A;  2KJG A;  4IAO A;  2ZXP A;  3OWT A;  3ECS A;  4EWC A;  2V3C C;  3I5P A;  4H4K C;  3OEO A;  4PJM A;  2J7P A;  1FMV A;  2XXA B;  1ZHY A;  4G0H A;  1Z23 A;  3FDQ A;  3ZG1 A;  5KYY B;  2L81 A;  2W4M A;  4JW1 A;  5T3W A;  5KYW B;  2O9X A;  3HJC A;  4XWJ A;  5F5H A;  1Z3I X;  1NG1 A;  1MNE A;  4KBL A;  3UNG C;  4AE4 A;  4XTK A;  2G3V A;  4LLE A;  1KU2 A;  5FCL A;  3K1H A;  3JRT A;  4E7S A;  1SF8 A;  4HEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...