4GEHA

Crystal structure of mst4 dimerization domain complex with pdcd10
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
198
structure length
198
Chain Sequence
TSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/transferase
molecule keywords Programmed cell death protein 10
publication title Structural mechanism of CCM3 heterodimerization with GCKIII kinases
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 198
sequence length 198
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06840 DUF1241 Protein of unknown function (DUF1241)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1950 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4gehA00
4GEHA 3W8HA 3W8IA
chains in the Genus database with same CATH superfamily
4U5FE 2M64A 2YL0A 4EBKA 3PDMP 4FESA 2KW3C 2UUHA 1YAUO 4OD4A 1G5ZA 3U0CA 3BRJA 4JRZA 3TOLA 1NSGB 3QW1A 5B3SC 1A7DA 1JRAA 3KL4A 4AX2A 4MVZA 2OEVA 2E87A 1EA8A 3EGDB 2QNLA 2YVKA 2XL8A 3HNKA 3C8GD 2HJ3A 2L6GA 3LEVA 3RQGA 5JLIA 2V26A 4G7ZF 2HJMA 2YL1A 1MMNA 5COMA 4MVMA 3AG3C 3E9VA 3LNMB 4E17A 1OW6A 1YJGA 3EGXB 4JE9A 3SXMA 4XLPF 2YL7A 2OU6A 3LLKA 4GQHA 5CI8A 5TJ5E 3GM3A 2WB7A 4I3MA 4C3EA 4CBEA 5F5FA 2EPMX 1CGME 5FZTA 1ORYA 3T6JA 2L81A 2Y3GA 3C63A 4K7BA 3T6BA 3NKEA 1E83A 3LS1A 1W2WA 3F46A 3V5XA 2J9VA 1VYIA 2XXAB 4RDAA 3O55A 4NTBA 4MTGA 3U3BA 1Z23A 2OJED 3WG7C 2EPKX 3IEEA 2BE5F 2OOCA 2HFIA 2Y3DA 5A6BD 1FMWA 3M4CA 4JZAA 3W2WA 1T6UA 2R9RB 3ITFA 1FFTC 4MVRA 2H8AA 2I15A 2VASA 3DM9B 3EZIA 2OQMA 3FAJA 3M79A 4MS2A 4EHPA 4Q4ZF 3T9OA 3B0UX 2L9JA 3G50A 2VCBA 2YLGA 2PP4A 5E3CA 1RMVA 4KNWA 4K0DA 2XLEA 3GORA 5KYXB 4AL0A 2XLMA 3LUTB 2QY9A 4JVSA 1BZ4A 3V5ZA 2B0HA 3ECSA 4NTAA 1Z3IX 2HUJA 2L6FA 1C02A 2GAQA 2HV6A 2R7SA 3LESA 3PHF2 4W8KA 2EILC 2HMQA 4Z9JA 2R03A 2B0JA 3DZAA 1F1MA 4O79A 3RW0A 4BJTA 3JYYA 5FCLA 1XZPA 3F47A 3LNRA 1HY5A 5JUAA 3NYMA 1NLXA 2NUPB 5DQTA 2JD3A 2HZ8A 4L6RA 3QZCA 1NZEA 3RIPA 3NKDA 1VMAA 2R7QA 4AE4A 3LLIA 2NUTA 2YRFA 1LI5A 3IQ6A 4LDQA 2YWAA 1S7ZA 4Z9HA 1CGOA 4CJOA 3DJUB 2ZXWC 3U2MA 1TQGA 1NFNA 4WGYA 3B29A 3X1OA 2YHSA 4IRUA 3MYIA 5L0GA 3B0VC 2IBFA 4YL1A 1LE2A 5F5HA 4LLEA 3J06A 3GEEA 4X0RA 3W4YA 2R7XA 1D1CA 4MTOA 2YQYA 5AC4A 2IXMA 3AQBA 4N4WA 4ULWA 3ZIBA 4DRHB 4D4NA 1BBHA 4IJJA 2Y39A 3K1IC 3TJ5A 2HSBA 3JRTA 4JTDB 4ONSA 2VH3A 1QKRA 2WVQA 4YT5A 5CI9A 1DOVA 2VCCA 4G0HA 1GS9A 3L34A 3X2QC 4OIQF 4PK4A 1D1BA 1VB5A 1YZCA 4BJ5A 1ZYRF 1Y6DA 1J8YF 4H54A 1R4TA 2XS1A 2AVKA 3HJCA 2LD6A 1A7EA 1KU2A 3S9OA 1AEPA 3UMHA 3S90A 2VC9A 2XLHA 4NQFA 1ZU5A 1PV3A 3U3FA 2A68F 256BA 4E7ZA 4DBQA 3ABMC 2KGOA 4AL1A 3S29A 3QVZA 4FX5A 2J7PA 5A6BA 2NPUA 2P6VA 4W8PA 1BR1A 4YT2A 1QQ3A 1TR2A 2F22A 3DE9A 3JT1A 2GA0A 1BR4A 3B71A 3M4BA 5JP7A 3HLZA 4U5DE 1OW8A 3IQ5A 1Z5ZA 1SYQA 5E33A 2JX0A 4IARA 4XEFA 3EPVA 4CS9A 3BEHA 2JPUA 3LAYA 2FFHA 2DB4A 3RF3A 2EIKC 3AGTA 3K33A 2VB6A 3ZWIA 4E18A 3TOMA 1LKXA 3TK0A 1FFHA 5CIVA 2YLDA 3NMJA 4P6IC 2A69F 5L3VA 2OG2A 2LSEA 2HS5A 1I4ZA 2J9BA 2OEXA 3PMRA 4I1OB 1ZU4A 2EIMC 4J32B 1T5OA 3SYNA 3KPHA 1Z6AA 1K40A 1RXQA 4IAQA 3HNLA 4M63A 4NTFA 4WJ0A 4XTKA 5L3QA 3UMKA 3EH2A 1YA9A 2A6HF 3L1MA 3LJBA 5B1BC 3U9MA 3UGOA 5D91A 1Z63A 3CZ6A 4XQ1A 3H2UA 3MBGA 1PCXA 2CNWD 3C62A 4R32A 2XLVA 2Q3TA 4A2NB 1TFKB 4EKWA 3ABLC 1VK5A 2Q00A 3HNJA 3RFYA 4AE4B 2AU5A 5KYYA 2XLWA 2NUTB 4AK9A 5DS5A 2PNOA 2X0CA 5COGA 4U5HA 1TWCA 2Y3HA 2TMVP 3N0TA 3EZHA 1V74B 5JT4A 1PD0A 3T6GB 2EIJC 2YLIA 3S0XA 2QTVA 3ZQVA 2XLOA 1V55C 1WASA 1OW7A 4FWVA 2WVNA 2HKVA 2RD9A 3WAQA 4U9DA 1D0ZA 1ZZPA 3N2ZB 3NDBB 1QZXA 2L6HA 4JW1A 1ORSC 3GEIA 4XWJA 3TD7A 4BPMA 1HMOA 2WL8A 4DVYP 5L0JA 2CYDA 3GM1A 5BQIA 2PX0A 2ICWG 3CEXA 4DJ9A 4EUKB 2Y3BA 1NG1A 1QVXA 4FAPB 4PFOA 5HSWA 1NU9C 4C3DA 3WODF 3UGPA 2CGEA 4K1OA 5DVWA 4DRJB 2YKZA 2IXNA 2AWCA 2HV7A 2MWQA 2R7OA 1HE9A 3EHMA 4QI2A 1I5NA 2PBEA 2LIGA 2WZGA 2W4BA 1YVIA 1ZW3A 2RSEB 4P9FA 3G4XA 2LK4A 1K04A 1TWHA 3KH2A 4JURI 3IHUA 1GM5A 2G3KA 4ER9A 4DOZA 4PJJA 3PCVA 3NYLA 3Q7LA 5L0FA 4PJLA 4U5BE 2ASRA 3GANA 1FAPB 1VYKA 1OKKD 3K66A 3L8IA 2AP3A 3KYJA 4JC7A 3C7JA 5KYWA 3QW0A 4G78A 1D0YA 1OXKA 3GODA 1VLSA 4JKVA 2YL3A 1OCCC 1VLTA 1ZHZA 4MVQA 4O6MA 5D92A 4BJ1A 2R25A 4MVOA 2C04A 1S05A 1U89A 1APCA 1Q0DA 4N6HA 3SXZA 3ZC4A 2LFDA 2XM0A 3AOUA 3I5PA 3EFOA 4P9TA 3DI5A 4CS8C 4IGGA 5F28E 1LIHA 2Q9CA 3S27A 5KYNA 3AJMA 5T3WA 1Z7Qc 1T6QA 2CDQA 2UUIA 1WN0A 3AGUA 3NMIA 5T3TA 1E85A 3RYLA 4KBLA 1J8MF 1G4WR 2LP4A 2CNWA 2KNHA 2A1DD 3JRMO 4C7OA 1SF8A 2QUPA 2PFDA 3KKBA 1E2XA 5JSLA 4D4XA 2ZXPA 1WGWA 1VTMP 2EPLX 4O7GA 1R5ID 4OIPF 3TQOA 3C8GA 2W9YA 2Q9BA 4MVSA 1L7CA 5T1DB 3R2PA 3S28A 1H9GA 1UG7A 1YYXA 1K05A 2IXOA 3EJNA 3FOPA 3K1IA 3RVYA 2KC3A 4YJWA 4BJ6C 3DM5A 3QVYA 4BG0A 1SMYF 4ZLDA 5KYYB 2R05A 3UNGC 3B9QA 3U5SA 2O9XA 1T01A 2P0NA 2J0WA 2KQ9A 3NG1A 4DXWA 4YT8A 5K0IA 3DJNB 1LE4A 4GEHA 5JRAA 2Z15A 4E0HA 1EQ1A 1Q0MA 3UMIA 1EKYA 4JEAA 4DRIB 1LS1A 3GWNA 1JR8A 5DLJA 2R7RA 5A6KA 3ASNC 2H7OA 2AWYA 3POVA 2I8BA 2WZFA 3EHNA 4G7OF 5L0IA 1A0BA 4O6NA 1OCRC 4YWQA 4DVZA 4ULVA 3JSEO 1JOGA 2G62A 4HE8D 3NRHA 4U5CE 4WGZA 4JTCB 1T6IA 2X51A 4YL3A 3FHDA 1V4AA 4LACB 5KYUA 5EGYA 4EBJA 4HEAJ 5HV9A 3VAYA 1LS4A 3L8JA 2FAPB 3N24A 2YEVA 1HE1A 4MNDA 1YZAA 1LVKA 1M6TA 4JIOA 1ZHTA 4XEKA 3TJ6A 1QSPA 3RVZA 3ZVRA 3SEOA 2XRHA 3SXKA 5KYXA 2P1AA 3CAXA 2ETSA 3FXHA 4BEMJ 1KTMA 2ZXRA 2EPOA 1H9TA 3LEOA 1CGNA 2NSFA 3VYWA 1OKKA 4XPWA 1V54C 1RKEA 3DE8A 3VRCA 2R7WA 5EHHA 4KC9A 1D1AA 1IZMA 3C18A 4CJGA 2GFHA 1Y4CA 3L0IA 2HMZA 3KMIA 3AG1C 3K1HA 2Y69C 3EQLF 3Q7GA 3ABKC 4JEBA 4YL0A 4A4AA 5KYWB 1NFOA 2EPNA 3K6BA 3ZG1A 3OA1A 2M4EA 4H4KC 4LLCA 3UR3C 3I4UA 1HW2A 1D0XA 1MMDA 2XS8A 3O6XA 1OR2A 3SZRA 2OKUA 3JSZA 3DMDA 3QTHA 4YT4A 2LQGA 2GDCA 4NC3A 4XEVA 3EFOB 4EIYA 3S84A 4Q5SF 3GEHA 5L0DA 1MMAA 2G3VA 3IQCA 4LERA 5E2QA 1JAFA 3ZTMA 1A41A 3DAFA 5BQGA 4IB4A 1UFBA 2V3CC 1FTSA 2IXPA 3MFNA 4C3BA 1DOWA 3VM6A 3U8VA 5B1AC 1MMGA 3H65A 4JJGA 4WABA 4CDVA 4C7OB 1NBBA 3ZSUA 2DGJA 1L3PA 1YARO 3CQZA 4Z9IA 4ZLCA 3C8GB 2J0XA 3FDQA 1ZHYA 4CIPA 1E86A 2KJGA 1ZVZA 2DYSC 1FMVA 1RJ9A 1BDJB 2XLDA 3H2VA 4JCHA 5A6AA 1PD1A 1LI7A 2WVOA 4RBNA 5E3AA 3FMSA 1H7IA 3KYIA 1ST6A 1C17M 2IOQA 4MTFA 2DYRC 4CSAA 1XZQA 4OIRF 1G8XA 4RD9A 2PX3A 4CSAC 3GWLA 4PJMA 3K7DA 5BUOA 1IW7F 2P61A 1EI7A 4MQ9F 1OR3A 3MYFA 2NG1A 2DI3A 1YDIA 2EINC 3Q6NA 3ZQYA 1T9KA 1MNDA 1SR2A 3A9CA 4J30B 1AVOB 1TWAA 3TULA 1M2VA 2XL6A 1A7VA 3JYHA 4MW8A 5L0HA 3ZTZA 5JS5A 2OCCC 2Q7RA 2LFFA 2KK1A 3JTLO 1U6HA 2BC5A 4GYTA 2ZPAA 3JCUQ 2IYLD 3OWTA 4XPXA 3RKOF 3SNHA 4E0IA 2J7PD 5KYUB 2LCHA 3MLGA 1MQVA 2GWWA 4IWBA 5COFA 5AC5A 3RQEA 3ZDLA 1ZW2A 3RQFA 4E7SA 2J46A 4CS8A 1LPEA 2BL2A 3EG9A 2PF4E 3DKAA 3R7CA 1TFOB 2QE9A 4F4BA 1GGQA 3I5QA 2XM4A 4KI2A 2R02A 3HTKC 4PJNA 5B3IA 1AUEA 3FVYA 1RKEB 3NYJA 2C03A 4YN0B 4MVUA 3A11A 1WTYA 4EWCA 1ZHXA 5AGFA 1ZHWA 3SXYA 4B6IA 1MNEA 1Q0KA 1YYJA 3AG4C 3DXJF 2W4MA 3IPMO 4NCQA 1YLMA 3US6A 1RKCA 3EGDA 4HFKB 3SP1A 4LDRA 4U5EE 4BJ6A 4CDYA 3M15A 3VF0A 1YA7O 1LM3B 1Q0GA 4OD5A 3U2LA 3O39A 4KNVA 3AQCA 3NMKA 5IY5C 4J7YA 2MYSA 2NSGA 2OJQA 4IAOA 4ANJA 2R7VA 1H6GA 1G4US 2L7AA 3EGXA 4QDLA 4PACA 4G7HF 4NY3A 2R7TA 3HNIA 4UDVA 2D5RB 5DS4A 1KNYA 1O3UA 1VOMA 1JPNA 3E70C 3FAPB 1O5HA 3JZ0A 4J7TA 3V7OA 2Q4FA 2HSQA 2IM8A 2R7UA 4MW3A 2A0BA 3CSKA 3HKKA 2FGYA 1OCZC 2A6EF 3AG2C 3DWWA 2A0UA 2ZXOA 1M57C 4I44A 4JJFA 2J9WA 4XLNF 3WHNA 2XXAA 3T4RA 1U0BB 1TWGA 2QLAA 1CPRA 1RJ9B 4O6YA 3Q6MA 3DD7A 4QI0A 4PFPA 5BQHA 4U5GA 1WATA 4OIOF 2H7BA 2J8WA 1BR2A 4N6CA 1HW1A 2ZD9A 3GM2A 4CX9A 1FNTc 4XPYA 3IQTA 1JMWA 4DBRA 3FOOA 5EK0A 2YZSA 3C8ZA 3O10A 5L0CA 4BJ5C 1GQAA 5DQZA 2XL4A 1M2OA 3U9JA 3W8HA 5A69A 4I1MA 1M56C 5A6JA 1C03A 3B0PA 2W45A 1RCPA 1HMDA 3RH3A 3EH1A 1QLEC 5JVEA 5DS6A 2D4UA 1XWJA 2CCYA 1M2VB 4Q7CA 4JTAB 1E84A 1TKNA 4CIHA 1CPQA 2J45A 1OCOC 2P7VA 4OINF 1Q0FA 1B68A 3LS0A 5GPGB 2KSFA 2NUPA 3OEOA 4YK5A 2CW0F 4CDAA 3ATPA 1FR0A 1I4YA 4BEJA 4CS9C 1ORJA 2Q9AA 4N06A 3G4ZA 2H7VC 2WZLA 1OQCA 1QPUA 1WWPA 3MX3A 3EG9B 2J9UA 3V5YA 2KYHA 1OXBA 4HFFB 1JPJA 1O87A 1N1CA 3DAGA 4U9EA 3M1CB 3W8IA 4CS7A 1WOLA 4PR9A 1SZIA 4JCZA 3QMKA 4LDKA 3U8PA 4EBBA 2VCAA 1NU7D 3W2VA 2MHRA 3ASOC 2XSEA
chains in the Genus database with same CATH topology
4U5FE 4FESA 2KW3C 4OD4A 5B3SC 3KL4A 4AX2A 2E87A 3EGDB 3LEVA 2V26A 4G7ZF 1MMNA 3AG3C 3E9VA 3EGXB 4XLPF 3LLKA 4CBEA 5CI8A 2WB7A 4I3MA 4C3EA 5F5FA 3T6JA 2L81A 2Y3GA 4K7BA 3T6BA 3NKEA 3LS1A 1W2WA 3F46A 2J9VA 1VYIA 2XXAB 4RDAA 1Z23A 3WG7C 3IEEA 2BE5F 2Y3DA 1FMWA 4JZAA 3W2WA 3ITFA 1FFTC 2VASA 3EZIA 3FAJA 3DM9B 4Q4ZF 3B0UX 2L9JA 5E3CA 2PP4A 4KNWA 4K0DA 5KYXB 2QY9A 4JVSA 3ECSA 1Z3IX 2HV6A 2R7SA 3LESA 3PHF2 4W8KA 2EILC 4BJTA 4O79A 2B0JA 3DZAA 5FCLA 3F47A 3LNRA 3NYMA 2NUPB 5DQTA 2JD3A 3QZCA 1NZEA 3RIPA 3NKDA 1VMAA 2R7QA 4AE4A 3LLIA 2NUTA 1S7ZA 3DJUB 2ZXWC 3X1OA 2YHSA 4IRUA 3B0VC 5F5HA 4LLEA 4X0RA 2R7XA 1D1CA 2IXMA 3AQBA 4ULWA 3ZIBA 4IJJA 2Y39A 3K1IC 3JRTA 2VH3A 2WVQA 4YT5A 5CI9A 4G0HA 3X2QC 3L34A 4OIQF 4PK4A 1D1BA 4BJ5A 1ZYRF 1J8YF 3HJCA 1KU2A 3UMHA 1ZU5A 2A68F 4E7ZA 4DBQA 3ABMC 2KGOA 3S29A 4FX5A 2J7PA 2P6VA 1BR1A 4YT2A 1TR2A 3JT1A 1BR4A 3HLZA 4U5DE 1Z5ZA 5E33A 4CS9A 3EPVA 3LAYA 2FFHA 2EIKC 3K33A 2VB6A 1LKXA 1FFHA 4P6IC 5L3VA 2A69F 2OG2A 2LSEA 3PMRA 4J32B 4I1OB 1ZU4A 2EIMC 3SYNA 4WJ0A 1Z6AA 4XTKA 4M63A 5L3QA 3UMKA 3EH2A 5B1BC 2A6HF 3LJBA 3UGOA 5D91A 1Z63A 3CZ6A 1PCXA 2CNWD 2Q3TA 4A2NB 3ABLC 1VK5A 3RFYA 4AE4B 5KYYA 2NUTB 4AK9A 5DS5A 4U5HA 1TWCA 2Y3HA 3N0TA 3EZHA 1PD0A 2EIJC 3S0XA 2QTVA 1V55C 4FWVA 2WVNA 1D0ZA 3N2ZB 3NDBB 1QZXA 4JW1A 4XWJA 3TD7A 2WL8A 4DVYP 2PX0A 2Y3BA 1NG1A 5HSWA 4PFOA 1NU9C 4C3DA 3WODF 3UGPA 2CGEA 5DVWA 2IXNA 2HV7A 2MWQA 2R7OA 4QI2A 3EHMA 2WZGA 2W4BA 3KH2A 4JURI 1TWHA 2G3KA 4DOZA 4PJJA 3Q7LA 3NYLA 4PJLA 4U5BE 3GANA 1VYKA 1OKKD 3K66A 5KYWA 1D0YA 3GODA 1OCCC 1ZHZA 5D92A 4BJ1A 4O6MA 2C04A 3ZC4A 4CS8C 3I5PA 3EFOA 5KYNA 3S27A 2Q9CA 5T3WA 2CDQA 5T3TA 3RYLA 4KBLA 1J8MF 2CNWA 2KNHA 2A1DD 4C7OA 1SF8A 2PFDA 3KKBA 2ZXPA 1WGWA 4O7GA 4OIPF 2W9YA 2Q9BA 3S28A 5T1DB 2IXOA 3EJNA 4YJWA 4BJ6C 3DM5A 4BG0A 1SMYF 4ZLDA 5KYYB 3UNGC 3B9QA 2O9XA 3NG1A 2J0WA 2KQ9A 4YT8A 3DJNB 4GEHA 2Z15A 3UMIA 1LS1A 2R7RA 5DLJA 3ASNC 2H7OA 4G7OF 3POVA 2I8BA 2WZFA 3EHNA 4O6NA 4YWQA 1OCRC 4DVZA 4HE8D 2G62A 3NRHA 4U5CE 2X51A 5KYUA 3FHDA 4LACB 5EGYA 4HEAJ 3N24A 2YEVA 4MNDA 1LVKA 1ZHTA 3SEOA 2XRHA 5KYXA 2ZXRA 3VYWA 1OKKA 1V54C 2R7WA 5EHHA 4KC9A 1D1AA 1IZMA 2GFHA 3L0IA 3KMIA 3AG1C 3K1HA 2Y69C 3EQLF 3Q7GA 3ABKC 5KYWB 3ZG1A 3K6BA 3OA1A 2M4EA 4H4KC 4LLCA 3UR3C 3I4UA 1D0XA 1MMDA 3O6XA 3SZRA 3JSZA 3DMDA 4YT4A 3EFOB 4Q5SF 1MMAA 2G3VA 4LERA 5E2QA 3DAFA 2V3CC 1FTSA 2IXPA 4C3BA 5B1AC 1MMGA 3H65A 4JJGA 4C7OB 3ZSUA 2DGJA 3CQZA 4ZLCA 2J0XA 3FDQA 1ZHYA 2KJGA 2DYSC 1FMVA 1RJ9A 4JCHA 1PD1A 2WVOA 4RBNA 5E3AA 1ST6A 2IOQA 2DYRC 4CSAA 4OIRF 1G8XA 4RD9A 2PX3A 4CSAC 4PJMA 3K7DA 5BUOA 1IW7F 4MQ9F 2NG1A 2EINC 3Q6NA 1MNDA 4J30B 1TWAA 1M2VA 3JYHA 2OCCC 4GYTA 2ZPAA 3JCUQ 2IYLD 3OWTA 3SNHA 3RKOF 2J7PD 5KYUB 3MLGA 4IWBA 4E7SA 2J46A 4CS8A 3EG9A 2PF4E 4F4BA 3I5QA 4KI2A 3HTKC 4PJNA 3NYJA 3FVYA 2C03A 4YN0B 4EWCA 1ZHXA 1ZHWA 4B6IA 1MNEA 3DXJF 3AG4C 3ZVRA 2W4MA 3EGDA 4HFKB 3SP1A 4U5EE 4BJ6A 4OD5A 3O39A 4KNVA 3AQCA 5IY5C 2MYSA 4IAOA 4ANJA 2R7VA 3EGXA 4QDLA 4G7HF 4NY3A 2R7TA 2D5RB 5DS4A 1VOMA 1JPNA 3E70C 1O5HA 3V7OA 2R7UA 3CSKA 2FGYA 1OCZC 2A6EF 3AG2C 3VAYA 2ZXOA 4I44A 1M57C 4XLNF 4JJFA 2J9WA 2XXAA 3T4RA 1TWGA 1RJ9B 4O6YA 3Q6MA 3DD7A 4QI0A 4PFPA 4U5GA 4OIOF 2H7BA 1BR2A 4DBRA 2YZSA 4BJ5C 5DQZA 2XL4A 1M2OA 3W8HA 4I1MA 1M56C 3B0PA 2W45A 3RH3A 3EH1A 1QLEC 5DS6A 1M2VB 4Q7CA 1TKNA 4CIHA 2J45A 1OCOC 2P7VA 4OINF 3LS0A 2NUPA 3OEOA 2CW0F 4BEJA 4CS9C 2Q9AA 4N06A 2H7VC 2WZLA 3MX3A 3EG9B 2J9UA 4HFFB 3W8IA 1JPJA 1O87A 1N1CA 3DAGA 3M1CB 4CS7A 1SZIA 3QMKA 4EBBA 1NU7D 3W2VA 3ASOC 2XSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GEH A;  3W8H A;  3W8I A; 
#chains in the Genus database with same CATH topology
 4U5F E;  2M64 A;  2YL0 A;  4EBK A;  3PDM P;  4FES A;  2KW3 C;  2UUH A;  1YAU O;  4OD4 A;  1G5Z A;  3U0C A;  3BRJ A;  4JRZ A;  3TOL A;  1NSG B;  3QW1 A;  5B3S C;  1A7D A;  1JRA A;  3KL4 A;  4AX2 A;  4MVZ A;  2OEV A;  2E87 A;  1EA8 A;  3EGD B;  2QNL A;  2YVK A;  2XL8 A;  3HNK A;  3C8G D;  2HJ3 A;  2L6G A;  3LEV A;  3RQG A;  5JLI A;  2V26 A;  4G7Z F;  2HJM A;  2YL1 A;  1MMN A;  5COM A;  4MVM A;  3AG3 C;  3E9V A;  3LNM B;  4E17 A;  1OW6 A;  1YJG A;  3EGX B;  4JE9 A;  3SXM A;  4XLP F;  2YL7 A;  2OU6 A;  3LLK A;  4GQH A;  5CI8 A;  5TJ5 E;  3GM3 A;  2WB7 A;  4I3M A;  4C3E A;  4CBE A;  5F5F A;  2EPM X;  1CGM E;  5FZT A;  1ORY A;  3T6J A;  2L81 A;  2Y3G A;  3C63 A;  4K7B A;  3T6B A;  3NKE A;  1E83 A;  3LS1 A;  1W2W A;  3F46 A;  3V5X A;  2J9V A;  1VYI A;  2XXA B;  4RDA A;  3O55 A;  4NTB A;  4MTG A;  3U3B A;  1Z23 A;  2OJE D;  3WG7 C;  2EPK X;  3IEE A;  2BE5 F;  2OOC A;  2HFI A;  2Y3D A;  5A6B D;  1FMW A;  3M4C A;  4JZA A;  3W2W A;  1T6U A;  2R9R B;  3ITF A;  1FFT C;  4MVR A;  2H8A A;  2I15 A;  2VAS A;  3DM9 B;  3EZI A;  2OQM A;  3FAJ A;  3M79 A;  4MS2 A;  4EHP A;  4Q4Z F;  3T9O A;  3B0U X;  2L9J A;  3G50 A;  2VCB A;  2YLG A;  2PP4 A;  5E3C A;  1RMV A;  4KNW A;  4K0D A;  2XLE A;  3GOR A;  5KYX B;  4AL0 A;  2XLM A;  3LUT B;  2QY9 A;  4JVS A;  1BZ4 A;  3V5Z A;  2B0H A;  3ECS A;  4NTA A;  1Z3I X;  2HUJ A;  2L6F A;  1C02 A;  2GAQ A;  2HV6 A;  2R7S A;  3LES A;  3PHF 2;  4W8K A;  2EIL C;  2HMQ A;  4Z9J A;  2R03 A;  2B0J A;  3DZA A;  1F1M A;  4O79 A;  3RW0 A;  4BJT A;  3JYY A;  5FCL A;  1XZP A;  3F47 A;  3LNR A;  1HY5 A;  5JUA A;  3NYM A;  1NLX A;  2NUP B;  5DQT A;  2JD3 A;  2HZ8 A;  4L6R A;  3QZC A;  1NZE A;  3RIP A;  3NKD A;  1VMA A;  2R7Q A;  4AE4 A;  3LLI A;  2NUT A;  2YRF A;  1LI5 A;  3IQ6 A;  4LDQ A;  2YWA A;  1S7Z A;  4Z9H A;  1CGO A;  4CJO A;  3DJU B;  2ZXW C;  3U2M A;  1TQG A;  1NFN A;  4WGY A;  3B29 A;  3X1O A;  2YHS A;  4IRU A;  3MYI A;  5L0G A;  3B0V C;  2IBF A;  4YL1 A;  1LE2 A;  5F5H A;  4LLE A;  3J06 A;  3GEE A;  4X0R A;  3W4Y A;  2R7X A;  1D1C A;  4MTO A;  2YQY A;  5AC4 A;  2IXM A;  3AQB A;  4N4W A;  4ULW A;  3ZIB A;  4DRH B;  4D4N A;  1BBH A;  4IJJ A;  2Y39 A;  3K1I C;  3TJ5 A;  2HSB A;  3JRT A;  4JTD B;  4ONS A;  2VH3 A;  1QKR A;  2WVQ A;  4YT5 A;  5CI9 A;  1DOV A;  2VCC A;  4G0H A;  1GS9 A;  3L34 A;  3X2Q C;  4OIQ F;  4PK4 A;  1D1B A;  1VB5 A;  1YZC A;  4BJ5 A;  1ZYR F;  1Y6D A;  1J8Y F;  4H54 A;  1R4T A;  2XS1 A;  2AVK A;  3HJC A;  2LD6 A;  1A7E A;  1KU2 A;  3S9O A;  1AEP A;  3UMH A;  3S90 A;  2VC9 A;  2XLH A;  4NQF A;  1ZU5 A;  1PV3 A;  3U3F A;  2A68 F;  256B A;  4E7Z A;  4DBQ A;  3ABM C;  2KGO A;  4AL1 A;  3S29 A;  3QVZ A;  4FX5 A;  2J7P A;  5A6B A;  2NPU A;  2P6V A;  4W8P A;  1BR1 A;  4YT2 A;  1QQ3 A;  1TR2 A;  2F22 A;  3DE9 A;  3JT1 A;  2GA0 A;  1BR4 A;  3B71 A;  3M4B A;  5JP7 A;  3HLZ A;  4U5D E;  1OW8 A;  3IQ5 A;  1Z5Z A;  1SYQ A;  5E33 A;  2JX0 A;  4IAR A;  4XEF A;  3EPV A;  4CS9 A;  3BEH A;  2JPU A;  3LAY A;  2FFH A;  2DB4 A;  3RF3 A;  2EIK C;  3AGT A;  3K33 A;  2VB6 A;  3ZWI A;  4E18 A;  3TOM A;  1LKX A;  3TK0 A;  1FFH A;  5CIV A;  2YLD A;  3NMJ A;  4P6I C;  2A69 F;  5L3V A;  2OG2 A;  2LSE A;  2HS5 A;  1I4Z A;  2J9B A;  2OEX A;  3PMR A;  4I1O B;  1ZU4 A;  2EIM C;  4J32 B;  1T5O A;  3SYN A;  3KPH A;  1Z6A A;  1K40 A;  1RXQ A;  4IAQ A;  3HNL A;  4M63 A;  4NTF A;  4WJ0 A;  4XTK A;  5L3Q A;  3UMK A;  3EH2 A;  1YA9 A;  2A6H F;  3L1M A;  3LJB A;  5B1B C;  3U9M A;  3UGO A;  5D91 A;  1Z63 A;  3CZ6 A;  4XQ1 A;  3H2U A;  3MBG A;  1PCX A;  2CNW D;  3C62 A;  4R32 A;  2XLV A;  2Q3T A;  4A2N B;  1TFK B;  4EKW A;  3ABL C;  1VK5 A;  2Q00 A;  3HNJ A;  3RFY A;  4AE4 B;  2AU5 A;  5KYY A;  2XLW A;  2NUT B;  4AK9 A;  5DS5 A;  2PNO A;  2X0C A;  5COG A;  4U5H A;  1TWC A;  2Y3H A;  2TMV P;  3N0T A;  3EZH A;  1V74 B;  5JT4 A;  1PD0 A;  3T6G B;  2EIJ C;  2YLI A;  3S0X A;  2QTV A;  3ZQV A;  2XLO A;  1V55 C;  1WAS A;  1OW7 A;  4FWV A;  2WVN A;  2HKV A;  2RD9 A;  3WAQ A;  4U9D A;  1D0Z A;  1ZZP A;  3N2Z B;  3NDB B;  1QZX A;  2L6H A;  4JW1 A;  1ORS C;  3GEI A;  4XWJ A;  3TD7 A;  4BPM A;  1HMO A;  2WL8 A;  4DVY P;  5L0J A;  2CYD A;  3GM1 A;  5BQI A;  2PX0 A;  2ICW G;  3CEX A;  4DJ9 A;  4EUK B;  2Y3B A;  1NG1 A;  1QVX A;  4FAP B;  4PFO A;  5HSW A;  1NU9 C;  4C3D A;  3WOD F;  3UGP A;  2CGE A;  4K1O A;  5DVW A;  4DRJ B;  2YKZ A;  2IXN A;  2AWC A;  2HV7 A;  2MWQ A;  2R7O A;  1HE9 A;  3EHM A;  4QI2 A;  1I5N A;  2PBE A;  2LIG A;  2WZG A;  2W4B A;  1YVI A;  1ZW3 A;  2RSE B;  4P9F A;  3G4X A;  2LK4 A;  1K04 A;  1TWH A;  3KH2 A;  4JUR I;  3IHU A;  1GM5 A;  2G3K A;  4ER9 A;  4DOZ A;  4PJJ A;  3PCV A;  3NYL A;  3Q7L A;  5L0F A;  4PJL A;  4U5B E;  2ASR A;  3GAN A;  1FAP B;  1VYK A;  1OKK D;  3K66 A;  3L8I A;  2AP3 A;  3KYJ A;  4JC7 A;  3C7J A;  5KYW A;  3QW0 A;  4G78 A;  1D0Y A;  1OXK A;  3GOD A;  1VLS A;  4JKV A;  2YL3 A;  1OCC C;  1VLT A;  1ZHZ A;  4MVQ A;  4O6M A;  5D92 A;  4BJ1 A;  2R25 A;  4MVO A;  2C04 A;  1S05 A;  1U89 A;  1APC A;  1Q0D A;  4N6H A;  3SXZ A;  3ZC4 A;  2LFD A;  2XM0 A;  3AOU A;  3I5P A;  3EFO A;  4P9T A;  3DI5 A;  4CS8 C;  4IGG A;  5F28 E;  1LIH A;  2Q9C A;  3S27 A;  5KYN A;  3AJM A;  5T3W A;  1Z7Q c;  1T6Q A;  2CDQ A;  2UUI A;  1WN0 A;  3AGU A;  3NMI A;  5T3T A;  1E85 A;  3RYL A;  4KBL A;  1J8M F;  1G4W R;  2LP4 A;  2CNW A;  2KNH A;  2A1D D;  3JRM O;  4C7O A;  1SF8 A;  2QUP A;  2PFD A;  3KKB A;  1E2X A;  5JSL A;  4D4X A;  2ZXP A;  1WGW A;  1VTM P;  2EPL X;  4O7G A;  1R5I D;  4OIP F;  3TQO A;  3C8G A;  2W9Y A;  2Q9B A;  4MVS A;  1L7C A;  5T1D B;  3R2P A;  3S28 A;  1H9G A;  1UG7 A;  1YYX A;  1K05 A;  2IXO A;  3EJN A;  3FOP A;  3K1I A;  3RVY A;  2KC3 A;  4YJW A;  4BJ6 C;  3DM5 A;  3QVY A;  4BG0 A;  1SMY F;  4ZLD A;  5KYY B;  2R05 A;  3UNG C;  3B9Q A;  3U5S A;  2O9X A;  1T01 A;  2P0N A;  2J0W A;  2KQ9 A;  3NG1 A;  4DXW A;  4YT8 A;  5K0I A;  3DJN B;  1LE4 A;  4GEH A;  5JRA A;  2Z15 A;  4E0H A;  1EQ1 A;  1Q0M A;  3UMI A;  1EKY A;  4JEA A;  4DRI B;  1LS1 A;  3GWN A;  1JR8 A;  5DLJ A;  2R7R A;  5A6K A;  3ASN C;  2H7O A;  2AWY A;  3POV A;  2I8B A;  2WZF A;  3EHN A;  4G7O F;  5L0I A;  1A0B A;  4O6N A;  1OCR C;  4YWQ A;  4DVZ A;  4ULV A;  3JSE O;  1JOG A;  2G62 A;  4HE8 D;  3NRH A;  4U5C E;  4WGZ A;  4JTC B;  1T6I A;  2X51 A;  4YL3 A;  3FHD A;  1V4A A;  4LAC B;  5KYU A;  5EGY A;  4EBJ A;  4HEA J;  5HV9 A;  3VAY A;  1LS4 A;  3L8J A;  2FAP B;  3N24 A;  2YEV A;  1HE1 A;  4MND A;  1YZA A;  1LVK A;  1M6T A;  4JIO A;  1ZHT A;  4XEK A;  3TJ6 A;  1QSP A;  3RVZ A;  3ZVR A;  3SEO A;  2XRH A;  3SXK A;  5KYX A;  2P1A A;  3CAX A;  2ETS A;  3FXH A;  4BEM J;  1KTM A;  2ZXR A;  2EPO A;  1H9T A;  3LEO A;  1CGN A;  2NSF A;  3VYW A;  1OKK A;  4XPW A;  1V54 C;  1RKE A;  3DE8 A;  3VRC A;  2R7W A;  5EHH A;  4KC9 A;  1D1A A;  1IZM A;  3C18 A;  4CJG A;  2GFH A;  1Y4C A;  3L0I A;  2HMZ A;  3KMI A;  3AG1 C;  3K1H A;  2Y69 C;  3EQL F;  3Q7G A;  3ABK C;  4JEB A;  4YL0 A;  4A4A A;  5KYW B;  1NFO A;  2EPN A;  3K6B A;  3ZG1 A;  3OA1 A;  2M4E A;  4H4K C;  4LLC A;  3UR3 C;  3I4U A;  1HW2 A;  1D0X A;  1MMD A;  2XS8 A;  3O6X A;  1OR2 A;  3SZR A;  2OKU A;  3JSZ A;  3DMD A;  3QTH A;  4YT4 A;  2LQG A;  2GDC A;  4NC3 A;  4XEV A;  3EFO B;  4EIY A;  3S84 A;  4Q5S F;  3GEH A;  5L0D A;  1MMA A;  2G3V A;  3IQC A;  4LER A;  5E2Q A;  1JAF A;  3ZTM A;  1A41 A;  3DAF A;  5BQG A;  4IB4 A;  1UFB A;  2V3C C;  1FTS A;  2IXP A;  3MFN A;  4C3B A;  1DOW A;  3VM6 A;  3U8V A;  5B1A C;  1MMG A;  3H65 A;  4JJG A;  4WAB A;  4CDV A;  4C7O B;  1NBB A;  3ZSU A;  2DGJ A;  1L3P A;  1YAR O;  3CQZ A;  4Z9I A;  4ZLC A;  3C8G B;  2J0X A;  3FDQ A;  1ZHY A;  4CIP A;  1E86 A;  2KJG A;  1ZVZ A;  2DYS C;  1FMV A;  1RJ9 A;  1BDJ B;  2XLD A;  3H2V A;  4JCH A;  5A6A A;  1PD1 A;  1LI7 A;  2WVO A;  4RBN A;  5E3A A;  3FMS A;  1H7I A;  3KYI A;  1ST6 A;  1C17 M;  2IOQ A;  4MTF A;  2DYR C;  4CSA A;  1XZQ A;  4OIR F;  1G8X A;  4RD9 A;  2PX3 A;  4CSA C;  3GWL A;  4PJM A;  3K7D A;  5BUO A;  1IW7 F;  2P61 A;  1EI7 A;  4MQ9 F;  1OR3 A;  3MYF A;  2NG1 A;  2DI3 A;  1YDI A;  2EIN C;  3Q6N A;  3ZQY A;  1T9K A;  1MND A;  1SR2 A;  3A9C A;  4J30 B;  1AVO B;  1TWA A;  3TUL A;  1M2V A;  2XL6 A;  1A7V A;  3JYH A;  4MW8 A;  5L0H A;  3ZTZ A;  5JS5 A;  2OCC C;  2Q7R A;  2LFF A;  2KK1 A;  3JTL O;  1U6H A;  2BC5 A;  4GYT A;  2ZPA A;  3JCU Q;  2IYL D;  3OWT A;  4XPX A;  3RKO F;  3SNH A;  4E0I A;  2J7P D;  5KYU B;  2LCH A;  3MLG A;  1MQV A;  2GWW A;  4IWB A;  5COF A;  5AC5 A;  3RQE A;  3ZDL A;  1ZW2 A;  3RQF A;  4E7S A;  2J46 A;  4CS8 A;  1LPE A;  2BL2 A;  3EG9 A;  2PF4 E;  3DKA A;  3R7C A;  1TFO B;  2QE9 A;  4F4B A;  1GGQ A;  3I5Q A;  2XM4 A;  4KI2 A;  2R02 A;  3HTK C;  4PJN A;  5B3I A;  1AUE A;  3FVY A;  1RKE B;  3NYJ A;  2C03 A;  4YN0 B;  4MVU A;  3A11 A;  1WTY A;  4EWC A;  1ZHX A;  5AGF A;  1ZHW A;  3SXY A;  4B6I A;  1MNE A;  1Q0K A;  1YYJ A;  3AG4 C;  3DXJ F;  2W4M A;  3IPM O;  4NCQ A;  1YLM A;  3US6 A;  1RKC A;  3EGD A;  4HFK B;  3SP1 A;  4LDR A;  4U5E E;  4BJ6 A;  4CDY A;  3M15 A;  3VF0 A;  1YA7 O;  1LM3 B;  1Q0G A;  4OD5 A;  3U2L A;  3O39 A;  4KNV A;  3AQC A;  3NMK A;  5IY5 C;  4J7Y A;  2MYS A;  2NSG A;  2OJQ A;  4IAO A;  4ANJ A;  2R7V A;  1H6G A;  1G4U S;  2L7A A;  3EGX A;  4QDL A;  4PAC A;  4G7H F;  4NY3 A;  2R7T A;  3HNI A;  4UDV A;  2D5R B;  5DS4 A;  1KNY A;  1O3U A;  1VOM A;  1JPN A;  3E70 C;  3FAP B;  1O5H A;  3JZ0 A;  4J7T A;  3V7O A;  2Q4F A;  2HSQ A;  2IM8 A;  2R7U A;  4MW3 A;  2A0B A;  3CSK A;  3HKK A;  2FGY A;  1OCZ C;  2A6E F;  3AG2 C;  3DWW A;  2A0U A;  2ZXO A;  1M57 C;  4I44 A;  4JJF A;  2J9W A;  4XLN F;  3WHN A;  2XXA A;  3T4R A;  1U0B B;  1TWG A;  2QLA A;  1CPR A;  1RJ9 B;  4O6Y A;  3Q6M A;  3DD7 A;  4QI0 A;  4PFP A;  5BQH A;  4U5G A;  1WAT A;  4OIO F;  2H7B A;  2J8W A;  1BR2 A;  4N6C A;  1HW1 A;  2ZD9 A;  3GM2 A;  4CX9 A;  1FNT c;  4XPY A;  3IQT A;  1JMW A;  4DBR A;  3FOO A;  5EK0 A;  2YZS A;  3C8Z A;  3O10 A;  5L0C A;  4BJ5 C;  1GQA A;  5DQZ A;  2XL4 A;  1M2O A;  3U9J A;  3W8H A;  5A69 A;  4I1M A;  1M56 C;  5A6J A;  1C03 A;  3B0P A;  2W45 A;  1RCP A;  1HMD A;  3RH3 A;  3EH1 A;  1QLE C;  5JVE A;  5DS6 A;  2D4U A;  1XWJ A;  2CCY A;  1M2V B;  4Q7C A;  4JTA B;  1E84 A;  1TKN A;  4CIH A;  1CPQ A;  2J45 A;  1OCO C;  2P7V A;  4OIN F;  1Q0F A;  1B68 A;  3LS0 A;  5GPG B;  2KSF A;  2NUP A;  3OEO A;  4YK5 A;  2CW0 F;  4CDA A;  3ATP A;  1FR0 A;  1I4Y A;  4BEJ A;  4CS9 C;  1ORJ A;  2Q9A A;  4N06 A;  3G4Z A;  2H7V C;  2WZL A;  1OQC A;  1QPU A;  1WWP A;  3MX3 A;  3EG9 B;  2J9U A;  3V5Y A;  2KYH A;  1OXB A;  4HFF B;  1JPJ A;  1O87 A;  1N1C A;  3DAG A;  4U9E A;  3M1C B;  3W8I A;  4CS7 A;  1WOL A;  4PR9 A;  1SZI A;  4JCZ A;  3QMK A;  4LDK A;  3U8P A;  4EBB A;  2VCA A;  1NU7 D;  3W2V A;  2MHR A;  3ASO C;  2XSE A; 
#chains in the Genus database with same CATH homology
 4U5F E;  4FES A;  2KW3 C;  4OD4 A;  5B3S C;  3KL4 A;  4AX2 A;  2E87 A;  3EGD B;  3LEV A;  2V26 A;  4G7Z F;  1MMN A;  3AG3 C;  3E9V A;  3EGX B;  4XLP F;  3LLK A;  4CBE A;  5CI8 A;  2WB7 A;  4I3M A;  4C3E A;  5F5F A;  3T6J A;  2L81 A;  2Y3G A;  4K7B A;  3T6B A;  3NKE A;  3LS1 A;  1W2W A;  3F46 A;  2J9V A;  1VYI A;  2XXA B;  4RDA A;  1Z23 A;  3WG7 C;  3IEE A;  2BE5 F;  2Y3D A;  1FMW A;  4JZA A;  3W2W A;  3ITF A;  1FFT C;  2VAS A;  3EZI A;  3FAJ A;  3DM9 B;  4Q4Z F;  3B0U X;  2L9J A;  5E3C A;  2PP4 A;  4KNW A;  4K0D A;  5KYX B;  2QY9 A;  4JVS A;  3ECS A;  1Z3I X;  2HV6 A;  2R7S A;  3LES A;  3PHF 2;  4W8K A;  2EIL C;  4BJT A;  4O79 A;  2B0J A;  3DZA A;  5FCL A;  3F47 A;  3LNR A;  3NYM A;  2NUP B;  5DQT A;  2JD3 A;  3QZC A;  1NZE A;  3RIP A;  3NKD A;  1VMA A;  2R7Q A;  4AE4 A;  3LLI A;  2NUT A;  1S7Z A;  3DJU B;  2ZXW C;  3X1O A;  2YHS A;  4IRU A;  3B0V C;  5F5H A;  4LLE A;  4X0R A;  2R7X A;  1D1C A;  2IXM A;  3AQB A;  4ULW A;  3ZIB A;  4IJJ A;  2Y39 A;  3K1I C;  3JRT A;  2VH3 A;  2WVQ A;  4YT5 A;  5CI9 A;  4G0H A;  3X2Q C;  3L34 A;  4OIQ F;  4PK4 A;  1D1B A;  4BJ5 A;  1ZYR F;  1J8Y F;  3HJC A;  1KU2 A;  3UMH A;  1ZU5 A;  2A68 F;  4E7Z A;  4DBQ A;  3ABM C;  2KGO A;  3S29 A;  4FX5 A;  2J7P A;  2P6V A;  1BR1 A;  4YT2 A;  1TR2 A;  3JT1 A;  1BR4 A;  3HLZ A;  4U5D E;  1Z5Z A;  5E33 A;  4CS9 A;  3EPV A;  3LAY A;  2FFH A;  2EIK C;  3K33 A;  2VB6 A;  1LKX A;  1FFH A;  4P6I C;  5L3V A;  2A69 F;  2OG2 A;  2LSE A;  3PMR A;  4J32 B;  4I1O B;  1ZU4 A;  2EIM C;  3SYN A;  4WJ0 A;  1Z6A A;  4XTK A;  4M63 A;  5L3Q A;  3UMK A;  3EH2 A;  5B1B C;  2A6H F;  3LJB A;  3UGO A;  5D91 A;  1Z63 A;  3CZ6 A;  1PCX A;  2CNW D;  2Q3T A;  4A2N B;  3ABL C;  1VK5 A;  3RFY A;  4AE4 B;  5KYY A;  2NUT B;  4AK9 A;  5DS5 A;  4U5H A;  1TWC A;  2Y3H A;  3N0T A;  3EZH A;  1PD0 A;  2EIJ C;  3S0X A;  2QTV A;  1V55 C;  4FWV A;  2WVN A;  1D0Z A;  3N2Z B;  3NDB B;  1QZX A;  4JW1 A;  4XWJ A;  3TD7 A;  2WL8 A;  4DVY P;  2PX0 A;  2Y3B A;  1NG1 A;  5HSW A;  4PFO A;  1NU9 C;  4C3D A;  3WOD F;  3UGP A;  2CGE A;  5DVW A;  2IXN A;  2HV7 A;  2MWQ A;  2R7O A;  4QI2 A;  3EHM A;  2WZG A;  2W4B A;  3KH2 A;  4JUR I;  1TWH A;  2G3K A;  4DOZ A;  4PJJ A;  3Q7L A;  3NYL A;  4PJL A;  4U5B E;  3GAN A;  1VYK A;  1OKK D;  3K66 A;  5KYW A;  1D0Y A;  3GOD A;  1OCC C;  1ZHZ A;  5D92 A;  4BJ1 A;  4O6M A;  2C04 A;  3ZC4 A;  4CS8 C;  3I5P A;  3EFO A;  5KYN A;  3S27 A;  2Q9C A;  5T3W A;  2CDQ A;  5T3T A;  3RYL A;  4KBL A;  1J8M F;  2CNW A;  2KNH A;  2A1D D;  4C7O A;  1SF8 A;  2PFD A;  3KKB A;  2ZXP A;  1WGW A;  4O7G A;  4OIP F;  2W9Y A;  2Q9B A;  3S28 A;  5T1D B;  2IXO A;  3EJN A;  4YJW A;  4BJ6 C;  3DM5 A;  4BG0 A;  1SMY F;  4ZLD A;  5KYY B;  3UNG C;  3B9Q A;  2O9X A;  3NG1 A;  2J0W A;  2KQ9 A;  4YT8 A;  3DJN B;  4GEH A;  2Z15 A;  3UMI A;  1LS1 A;  2R7R A;  5DLJ A;  3ASN C;  2H7O A;  4G7O F;  3POV A;  2I8B A;  2WZF A;  3EHN A;  4O6N A;  4YWQ A;  1OCR C;  4DVZ A;  4HE8 D;  2G62 A;  3NRH A;  4U5C E;  2X51 A;  5KYU A;  3FHD A;  4LAC B;  5EGY A;  4HEA J;  3N24 A;  2YEV A;  4MND A;  1LVK A;  1ZHT A;  3SEO A;  2XRH A;  5KYX A;  2ZXR A;  3VYW A;  1OKK A;  1V54 C;  2R7W A;  5EHH A;  4KC9 A;  1D1A A;  1IZM A;  2GFH A;  3L0I A;  3KMI A;  3AG1 C;  3K1H A;  2Y69 C;  3EQL F;  3Q7G A;  3ABK C;  5KYW B;  3ZG1 A;  3K6B A;  3OA1 A;  2M4E A;  4H4K C;  4LLC A;  3UR3 C;  3I4U A;  1D0X A;  1MMD A;  3O6X A;  3SZR A;  3JSZ A;  3DMD A;  4YT4 A;  3EFO B;  4Q5S F;  1MMA A;  2G3V A;  4LER A;  5E2Q A;  3DAF A;  2V3C C;  1FTS A;  2IXP A;  4C3B A;  5B1A C;  1MMG A;  3H65 A;  4JJG A;  4C7O B;  3ZSU A;  2DGJ A;  3CQZ A;  4ZLC A;  2J0X A;  3FDQ A;  1ZHY A;  2KJG A;  2DYS C;  1FMV A;  1RJ9 A;  4JCH A;  1PD1 A;  2WVO A;  4RBN A;  5E3A A;  1ST6 A;  2IOQ A;  2DYR C;  4CSA A;  4OIR F;  1G8X A;  4RD9 A;  2PX3 A;  4CSA C;  4PJM A;  3K7D A;  5BUO A;  1IW7 F;  4MQ9 F;  2NG1 A;  2EIN C;  3Q6N A;  1MND A;  4J30 B;  1TWA A;  1M2V A;  3JYH A;  2OCC C;  4GYT A;  2ZPA A;  3JCU Q;  2IYL D;  3OWT A;  3SNH A;  3RKO F;  2J7P D;  5KYU B;  3MLG A;  4IWB A;  4E7S A;  2J46 A;  4CS8 A;  3EG9 A;  2PF4 E;  4F4B A;  3I5Q A;  4KI2 A;  3HTK C;  4PJN A;  3NYJ A;  3FVY A;  2C03 A;  4YN0 B;  4EWC A;  1ZHX A;  1ZHW A;  4B6I A;  1MNE A;  3DXJ F;  3AG4 C;  3ZVR A;  2W4M A;  3EGD A;  4HFK B;  3SP1 A;  4U5E E;  4BJ6 A;  4OD5 A;  3O39 A;  4KNV A;  3AQC A;  5IY5 C;  2MYS A;  4IAO A;  4ANJ A;  2R7V A;  3EGX A;  4QDL A;  4G7H F;  4NY3 A;  2R7T A;  2D5R B;  5DS4 A;  1VOM A;  1JPN A;  3E70 C;  1O5H A;  3V7O A;  2R7U A;  3CSK A;  2FGY A;  1OCZ C;  2A6E F;  3AG2 C;  3VAY A;  2ZXO A;  4I44 A;  1M57 C;  4XLN F;  4JJF A;  2J9W A;  2XXA A;  3T4R A;  1TWG A;  1RJ9 B;  4O6Y A;  3Q6M A;  3DD7 A;  4QI0 A;  4PFP A;  4U5G A;  4OIO F;  2H7B A;  1BR2 A;  4DBR A;  2YZS A;  4BJ5 C;  5DQZ A;  2XL4 A;  1M2O A;  3W8H A;  4I1M A;  1M56 C;  3B0P A;  2W45 A;  3RH3 A;  3EH1 A;  1QLE C;  5DS6 A;  1M2V B;  4Q7C A;  1TKN A;  4CIH A;  2J45 A;  1OCO C;  2P7V A;  4OIN F;  3LS0 A;  2NUP A;  3OEO A;  2CW0 F;  4BEJ A;  4CS9 C;  2Q9A A;  4N06 A;  2H7V C;  2WZL A;  3MX3 A;  3EG9 B;  2J9U A;  4HFF B;  3W8I A;  1JPJ A;  1O87 A;  1N1C A;  3DAG A;  3M1C B;  4CS7 A;  1SZI A;  3QMK A;  4EBB A;  1NU7 D;  3W2V A;  3ASO C;  2XSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...