3DE9A

Crystal structure of a trimeric cytochrome cb562 assembly induced by nickel coordination
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
publication title Control of protein oligomerization symmetry by metal coordination: C2 and C3 symmetrical assemblies through Cu(II) and Ni(II) coordination.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3de9A00
2YLIA 2YLGA 3ZWIA 1QPUA 4IAQA 3HNKA 3FOOA 3M79A 4CIPA 1BBHA 4JEBA 5JVEA 3QW1A 3ZTZA 4N6HA 1LM3B 2YL1A 2XLOA 1NBBA 3ZQYA 5JUAA 3C63A 4CX9A 3DE8A 2XLWA 4JEAA 1GQAA 1S05A 4CDYA 1CPRA 2YKZA 2YLDA 4IB4A 2BC5A 4CDAA 3QVZA 4N4WA 1E83A 3M4CA 3NMKA 1RCPA 2YL7A 3DE9A 4IARA 4NC3A 2YL3A 1YYXA 3IQ6A 4U9DA 2J8WA 3IQ5A 1CPQA 1E85A 2XLDA 2XM0A 2XM4A 3HNJA 5AGFA 3L1MA 3M15A 1E86A 5B3IA 1YYJA 1YZAA 3U8PA 1MQVA 4CJGA 1A7VA 4EIYA 3M4BA 1E84A 256BA 4ER9A 4WGZA 1QQ3A 4WGYA 4U9EA 4D4NA 2XL6A 5JRAA 1APCA 4D4XA 4L6RA 3NMIA 5JT4A 3FOPA 2XLVA 2XLMA 4CJOA 2XLEA 1M6TA 3NMJA 5JSLA 5JS5A 3C62A 3ZQVA 3HNLA 2QLAA 1JAFA 4JKVA 3VRCA 1YZCA 3QVYA 5JP7A 2XLHA 3QW0A 1CGNA 2J9BA 3ZTMA 4JE9A 3HNIA 3TOMA 3TOLA 2XL8A 1CGOA 1EKYA 4CDVA 2YL0A 2CCYA 5JLIA 4ULVA
chains in the Genus database with same CATH superfamily
2GAQA 2VB6A 4GEHA 3ZWIA 4CS8C 4LLCA 4IAQA 5COFA 1WWPA 2JD3A 3SEOA 1WATA 3DI5A 3JT1A 4MVRA 1BDJB 3JSZA 1JR8A 2FGYA 1JPNA 4M63A 3KMIA 2IBFA 3F46A 4O6MA 4BEJA 1Q0MA 1ZU5A 1SMYF 2BE5F 2YEVA 5L0GA 1VYKA 2J45A 4JJGA 1H6GA 2UUHA 2EILC 3HJCA 1DOWA 1R4TA 1T5OA 3FMSA 2L6GA 4NQFA 3L34A 5DS6A 3V5XA 2ZXWC 1G4US 2ASRA 5L0JA 3RKOF 2XLOA 3S29A 2ZXRA 1NBBA 1LKXA 3ZQYA 4KNVA 2Y39A 1VTMP 4CX9A 2A6EF 2I15A 3QZCA 4MVUA 4XQ1A 2QUPA 3DE8A 4DRHB 2HZ8A 5KYUB 1MNDA 4O7GA 3PDMP 3JCUQ 2L7AA 4CSAC 1KNYA 2ICWG 2WL8A 3WAQA 4C7OA 3GWNA 2J0XA 2XSEA 4JJFA 3LEVA 3FAJA 3GANA 3DWWA 3OWTA 2WZLA 1HE1A 1OR3A 2HJMA 3BRJA 3BEHA 2L81A 5COMA 2O9XA 3E70C 1MMAA 5KYUA 2J9VA 3CEXA 4A4AA 5KYXB 1TKNA 2J7PD 3F47A 3FDQA 2GFHA 4LDKA 2CW0F 3TK0A 3L8IA 2OCCC 1M2VA 2HS5A 3M4CA 1E83A 3C8GB 1HW2A 2IOQA 4NC3A 3H65A 1LI7A 1N1CA 1YYXA 4OIQF 1C03A 1IW7F 1SYQA 2J8WA 3VYWA 4YT8A 2HSQA 3B0PA 2XLDA 4B6IA 4E0IA 3TD7A 5CIVA 3DJUB 2XM4A 2OQMA 3V5YA 4C3BA 3EH2A 3LAYA 4CSAA 1Y6DA 1VK5A 4DBRA 2C03A 2HMZA 2QY9A 4CIHA 3C8GA 1V74B 4DRJB 4OIPF 4NY3A 3GODA 4XPXA 4YWQA 1Z3IX 5B3SC 2HFIA 1D0XA 1BR1A 3JSEO 5DLJA 1I4ZA 2QNLA 3A11A 2D4UA 1NFOA 2H7VC 2WZFA 3NRHA 4RD9A 3RF3A 1YZAA 5B3IA 5IY5C 3QTHA 1EQ1A 3ASOC 4CS9C 1U0BB 1YA9A 4NCQA 3U5SA 5BQHA 4ER9A 3S27A 4Z9JA 2F22A 4AL1A 1QQ3A 4C3DA 3LLKA 4NTFA 4U9EA 4FESA 2VCAA 2XL6A 1APCA 1VLSA 2E87A 4KC9A 3GORA 4PJNA 3SXZA 4LDRA 4E17A 2A0BA 3C18A 2WVQA 1OCCC 3Q7GA 4MVOA 4BJ5A 4XPWA 2Q7RA 1BZ4A 2XLMA 4YJWA 4CJOA 3EZIA 3S28A 2OJED 1OXBA 1WTYA 3RQGA 4E7SA 3K1HA 4G7ZF 3M1CB 3C62A 2W4BA 4CBEA 4E7ZA 2GA0A 3HNLA 2Q00A 3AQBA 1ZW2A 1G5ZA 4EBBA 1RKEB 3LNRA 3J06A 1K05A 2HJ3A 1WGWA 5L0HA 1A7EA 2R7RA 4CS9A 5L0DA 2A68F 3QVYA 1QSPA 3EPVA 4LERA 1ZHWA 4IRUA 4JIOA 4YT5A 3SYNA 4BJ6A 3QW0A 4JTDB 1FMVA 4IGGA 1J8YF 4FX5A 4JE9A 1HY5A 5DVWA 1R5ID 2LSEA 2XL8A 3JRMO 2PFDA 3EHMA 2Z15A 4PJLA 4EHPA 4CDVA 5F5FA 4MTFA 5DQZA 3LLIA 4GYTA 2VCCA 1TWHA 1Y4CA 1FAPB 3MYFA 4HE8D 2XXAA 2Q9BA 2YLIA 1A7DA 2GDCA 2M64A 1V55C 3MBGA 4JVSA 2LCHA 4MS2A 1YDIA 4K7BA 2PX3A 3DAGA 2Y3BA 5F28E 3UNGC 2VASA 3PCVA 4AL0A 2P7VA 3LESA 4HFFB 3NYLA 1DOVA 3K66A 3G4XA 2YQYA 5A6BD 5L3VA 4DRIB 2C04A 4CIPA 1JOGA 1MNEA 3CSKA 3NDBB 2I8BA 1LPEA 1QZXA 2ZXPA 4XLPF 5JVEA 4HFKB 4OD4A 2PNOA 2AWYA 5E3AA 3GM3A 2KJGA 3V7OA 2AU5A 1O5HA 1SF8A 4JCZA 3ZTZA 4DOZA 1H9GA 3S9OA 1MMNA 2Y3DA 2OG2A 3U0CA 2IM8A 4G78A 1RJ9A 3UMIA 1PD1A 1D1AA 1LS1A 2OJQA 2YRFA 4JTCB 1S05A 1TR2A 3NKDA 1BR2A 1CPRA 3LS1A 4C7OB 2LFFA 2W4MA 3S84A 2D5RB 3B0UX 1LIHA 2YLDA 3C8GD 3JRTA 5F5HA 2J9UA 2R7OA 3W8IA 4QDLA 2YVKA 4NTAA 5GPGB 4XEKA 1L3PA 3EQLF 3PMRA 3U3FA 4BJTA 1AVOB 3ECSA 2EPMX 2MHRA 2XL4A 1IZMA 3LS0A 1RCPA 1M57C 2YL7A 4RDAA 4OINF 3FVYA 1OW7A 1Q0KA 2YL3A 4U5HA 4YT4A 3IQ6A 2H8AA 1WN0A 1D0YA 4KBLA 3ZSUA 2ZD9A 3IQ5A 4GQHA 2Q3TA 5EK0A 3NYMA 3US6A 1HMDA 3H2VA 5COGA 5FCLA 4CS8A 1OCRC 3O39A 4MTGA 3HKKA 4J32B 3SZRA 1HW1A 3AG4C 3FAPB 3DMDA 4E0HA 1Q0DA 3L1MA 3R2PA 4XTKA 1VB5A 2VCBA 3M15A 3EH1A 1E86A 3DXJF 2EPLX 1L7CA 4E18A 2W9YA 1T6UA 4K0DA 1SZIA 3O55A 2A69F 3RFYA 4AX2A 1E84A 4G7HF 3OA1A 4NTBA 2G3VA 1LS4A 3KYIA 2FFHA 3G50A 3B0VC 5KYWB 3UMKA 4PFOA 1ORSC 4LACB 2LIGA 4Z9IA 3NMIA 3ZIBA 3EGXB 2R7VA 4XWJA 1GGQA 2HUJA 5T1DB 3U9MA 5KYXA 1SR2A 2HMQA 4A2NB 5JSLA 1VLTA 3IEEA 1ZZPA 4IWBA 3EFOB 4H54A 1CGME 4K1OA 4JZAA 3SXKA 2R7WA 3WHNA 1QVXA 3TJ6A 2H7BA 1NLXA 1PD0A 1JAFA 4PFPA 4YN0B 1FNTc 3ABLC 3L8JA 3DM5A 3UMHA 1FFTC 1LE2A 4EBKA 2YZSA 3RVZA 3AGUA 1T01A 2WVNA 2Y3HA 3RH3A 3L0IA 1QLEC 2R7XA 4ZLCA 3CQZA 1AEPA 4ULWA 4BJ1A 1EKYA 5JLIA 4ULVA 1U89A 2A6HF 2IXMA 5BUOA 1H9TA 4EUKB 2XS8A 1OCOC 1GS9A 2NSFA 2MYSA 2P61A 2KQ9A 2W45A 3AG3C 3NKEA 1M56C 2EPOA 1OQCA 3KKBA 3FOOA 4W8PA 3IQTA 2P6VA 3AOUA 3AG2C 3I4UA 4MVSA 3VF0A 4XLNF 3C7JA 1S7ZA 1JRAA 3NG1A 2DI3A 2KW3C 3JYHA 3K1IC 3R7CA 4MVMA 1W2WA 5BQIA 2Y69C 1J8MF 4JEBA 2LQGA 2PBEA 4JW1A 1G8XA 1Z7Qc 3A9CA 5EGYA 4Q7CA 2EPKX 1WOLA 4PACA 5AC4A 3GEEA 1RKEA 2DYSC 2HKVA 2YL1A 1Z23A 3JZ0A 3W2VA 3SXYA 2AP3A 1NU7D 5B1AC 2CYDA 2R7SA 3X2QC 2DB4A 1WASA 4CDYA 4JTAB 1Q0GA 1H7IA 2R7TA 4U5GA 1D0ZA 3GEHA 5E33A 3UGOA 2YKZA 3DD7A 3ZVRA 4CS7A 2RSEB 4LDQA 4IB4A 3U8VA 1ZHZA 3K1IA 2LD6A 1I4YA 2EIJC 2X51A 1OXKA 4JCHA 2NUTB 5DS4A 2G3KA 2PP4A 4JC7A 4O79A 2EINC 4H4KC 2X0CA 4OIRF 3LUTB 3TJ5A 3B29A 3U2LA 4IARA 4FAPB 1TWGA 3EJNA 4MVZA 2Q9AA 1LVKA 1A41A 1CPQA 4EWCA 2KC3A 3LNMB 3SP1A 2J9WA 2OEXA 1JPJA 2OOCA 2NUTA 3HNJA 3QMKA 2XS1A 3K7DA 4EBJA 1OR2A 1OCZC 4F4BA 5T3TA 5BQGA 1NG1A 1V4AA 1C02A 1I5NA 2M4EA 3KH2A 2HSBA 4HEAJ 2CNWA 1BR4A 2KYHA 4MNDA 5DS5A 1YYJA 5E2QA 1QKRA 1NFNA 1EI7A 2WZGA 3JYYA 3DAFA 4U5CE 3U3BA 1MQVA 4MQ9F 4PR9A 5AC5A 4Q4ZF 3SNHA 256BA 3C8ZA 1A0BA 1OKKA 5A6KA 4WGYA 4D4NA 5HSWA 2P1AA 3RVYA 5JRAA 3FXHA 2VC9A 2L6FA 1RXQA 2ZXOA 4YL3A 3OEOA 4U5DE 3O10A 1YA7O 2V26A 4I3MA 3GEIA 2IXOA 4I1MA 3KPHA 1M2OA 2XLVA 3N0TA 3W4YA 5KYNA 4MW8A 2FAPB 3T6JA 1M6TA 4KNWA 3U2MA 3POVA 3NMJA 2LFDA 2VH3A 3E9VA 1YARO 1XZQA 1ZU4A 2B0JA 2RD9A 5D91A 3UR3C 5A6JA 2L6HA 3ZQVA 2QLAA 1YAUO 5CI8A 3W8HA 2EPNA 1EA8A 2AVKA 2V3CC 4BG0A 4BPMA 1ZW3A 3ITFA 5CI9A 3VRCA 4W8KA 3ZDLA 2JPUA 1G4WR 2ETSA 5DQTA 1C17M 1FTSA 5E3CA 1CGNA 2J9BA 2R7QA 4PK4A 3O6XA 4IAOA 4LLEA 3GM2A 3TOMA 1ZYRF 2ZPAA 3MX3A 1CGOA 2NUPB 1ZHTA 2J0WA 5L0FA 4QI0A 4Z9HA 3H2UA 1FFHA 2CCYA 5L3QA 2EIKC 4G7OF 1FMWA 1RKCA 3RQFA 2G62A 2YHSA 2YLGA 2R05A 2IYLD 3T6BA 5A6BA 1M2VB 1QPUA 1TQGA 1ST6A 2R02A 5B1BC 2NUPA 5KYWA 3AQCA 4YL0A 2BL2A 3HNKA 1HMOA 4J7YA 4U5FE 3MFNA 2YWAA 3DJNB 4OD5A 4Q5SF 4KI2A 1XWJA 2AWCA 3M79A 2Y3GA 3EGXA 1BBHA 3MLGA 5EHHA 4DVZA 1T6IA 4N06A 2L9JA 5KYYB 2XRHA 4N6CA 3S90A 3N24A 2OU6A 1D1CA 1VMAA 3X1OA 3B71A 4X0RA 3EFOA 3QW1A 3ZG1A 4N6HA 1B68A 1LM3B 1T6QA 4MW3A 2IXPA 3ABKC 3NYJA 3LEOA 2HV7A 3DKAA 3Q7LA 5TJ5E 1O3UA 3EGDB 3IQCA 4PJJA 3Q6MA 1JMWA 1XZPA 2KSFA 3RW0A 3C63A 3EZHA 3EG9B 4BJ5C 5JUAA 5KYYA 1TFKB 3I5QA 3IPMO 3LJBA 4DVYP 2XLWA 4JEAA 5HV9A 1KU2A 1GQAA 2WB7A 4I44A 3Q6NA 2LP4A 2JX0A 3DM9B 3ABMC 3GWLA 2CGEA 3EGDA 2J46A 2GWWA 2PF4E 4R32A 2BC5A 4J7TA 1U6HA 3T6GB 3EG9A 4XEVA 1GM5A 4CDAA 2CNWD 1VYIA 3U9JA 3VM6A 2Q9CA 3QVZA 1K40A 3IHUA 4BJ6C 4YL1A 1TFOB 4N4WA 4FWVA 1KTMA 3NMKA 5K0IA 3DE9A 1NZEA 3PHF2 4ZLDA 3GM1A 1TWCA 1MMDA 4IJJA 4U9DA 1NU9C 2IXNA 1AUEA 1OKKD 3T9OA 3ATPA 1HE9A 1K04A 3FHDA 5FZTA 4AK9A 4YT2A 2HV6A 1E85A 2NSGA 2R9RB 1Z6AA 3RIPA 3UGPA 4BEMJ 2XM0A 1O87A 2WVOA 1YJGA 3AG1C 3I5PA 1V54C 3EHNA 4EKWA 4U5BE 1LE4A 2NG1A 3WODF 4P9FA 5A69A 2DGJA 5T3WA 3TULA 2EIMC 4XEFA 5AGFA 4ONSA 1D1BA 1RMVA 4O6YA 4DXWA 1F1MA 3ZC4A 3V5ZA 2J7PA 2QTVA 2B0HA 4G0HA 3U8PA 2XXAB 2KNHA 3MYIA 2A1DD 2KGOA 2R25A 3DZAA 3HLZA 4I1OB 4CJGA 1A7VA 2QE9A 1E2XA 3M4BA 3SXMA 4ANJA 2PX0A 4EIYA 4DBQA 4MVQA 3AJMA 1ORYA 2UUIA 1NSGB 3AGTA 1VOMA 3ASNC 3JTLO 3K33A 4WGZA 5L0CA 4UDVA 1OW8A 1Z63A 3S0XA 3KL4A 3HTKC 4JRZA 3RYLA 4D4XA 4L6RA 3B9QA 5JT4A 2KK1A 3VAYA 2CDQA 3KYJA 3FOPA 1TWAA 3T4RA 2DYRC 4DJ9A 2OEVA 2Q4FA 2LK4A 2XLEA 3K6BA 4WJ0A 2OKUA 2H7OA 1Z5ZA 1UG7A 5A6AA 3N2ZB 1ZHXA 5JS5A 3RQEA 1ORJA 2R03A 4U5EE 4OIOF 1OW6A 3CZ6A 3W2WA 2A0UA 1LI5A 1Q0FA 3G4ZA 4C3EA 2NPUA 4P6IC 1T9KA 1YVIA 1PCXA 1YLMA 1RJ9B 2MWQA 3CAXA 4JKVA 1YZCA 4JURI 4P9TA 3WG7C 4AE4B 1FR0A 1UFBA 5JP7A 5D92A 2XLHA 1ZHYA 4MTOA 4WABA 4QI2A 3ZTMA 4J30B 3HNIA 4RBNA 2P0NA 3TOLA 2TMVP 4PJMA 4O6NA 3TQOA 2YL0A 1MMGA 1PV3A 5L0IA 2R7UA 1ZVZA 4XPYA 4YK5A 4AE4A
chains in the Genus database with same CATH topology
2YLIA 2YLGA 3ZWIA 1QPUA 4IAQA 3HNKA 3FOOA 3M79A 4CIPA 1BBHA 4JEBA 5JVEA 3QW1A 3ZTZA 4N6HA 1LM3B 2YL1A 2XLOA 1NBBA 3ZQYA 5JUAA 3C63A 4CX9A 3DE8A 2XLWA 4JEAA 1GQAA 1S05A 4CDYA 1CPRA 2YKZA 2YLDA 4IB4A 2BC5A 4CDAA 3QVZA 4N4WA 1E83A 3M4CA 3NMKA 1RCPA 2YL7A 3DE9A 4IARA 4NC3A 2YL3A 1YYXA 3IQ6A 4U9DA 2J8WA 3IQ5A 1CPQA 1E85A 2XLDA 2XM0A 2XM4A 3HNJA 5AGFA 3L1MA 3M15A 1E86A 5B3IA 1YYJA 1YZAA 3U8PA 1MQVA 4CJGA 1A7VA 4EIYA 3M4BA 1E84A 256BA 4ER9A 4WGZA 1QQ3A 4WGYA 4U9EA 4D4NA 2XL6A 5JRAA 1APCA 4D4XA 4L6RA 3NMIA 5JT4A 3FOPA 2XLVA 2XLMA 4CJOA 2XLEA 1M6TA 3NMJA 5JSLA 5JS5A 3C62A 3ZQVA 3HNLA 2QLAA 1JAFA 4JKVA 3VRCA 1YZCA 3QVYA 5JP7A 2XLHA 3QW0A 1CGNA 2J9BA 3ZTMA 4JE9A 3HNIA 3TOMA 3TOLA 2XL8A 1CGOA 1EKYA 4CDVA 2YL0A 2CCYA 5JLIA 4ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YLI A;  2YLG A;  3ZWI A;  1QPU A;  4IAQ A;  3HNK A;  3FOO A;  3M79 A;  4CIP A;  1BBH A;  4JEB A;  5JVE A;  3QW1 A;  3ZTZ A;  4N6H A;  1LM3 B;  2YL1 A;  2XLO A;  1NBB A;  3ZQY A;  5JUA A;  3C63 A;  4CX9 A;  3DE8 A;  2XLW A;  4JEA A;  1GQA A;  1S05 A;  4CDY A;  1CPR A;  2YKZ A;  2YLD A;  4IB4 A;  2BC5 A;  4CDA A;  3QVZ A;  4N4W A;  1E83 A;  3M4C A;  3NMK A;  1RCP A;  2YL7 A;  3DE9 A;  4IAR A;  4NC3 A;  2YL3 A;  1YYX A;  3IQ6 A;  4U9D A;  2J8W A;  3IQ5 A;  1CPQ A;  1E85 A;  2XLD A;  2XM0 A;  2XM4 A;  3HNJ A;  5AGF A;  3L1M A;  3M15 A;  1E86 A;  5B3I A;  1YYJ A;  1YZA A;  3U8P A;  1MQV A;  4CJG A;  1A7V A;  4EIY A;  3M4B A;  1E84 A;  256B A;  4ER9 A;  4WGZ A;  1QQ3 A;  4WGY A;  4U9E A;  4D4N A;  2XL6 A;  5JRA A;  1APC A;  4D4X A;  4L6R A;  3NMI A;  5JT4 A;  3FOP A;  2XLV A;  2XLM A;  4CJO A;  2XLE A;  1M6T A;  3NMJ A;  5JSL A;  5JS5 A;  3C62 A;  3ZQV A;  3HNL A;  2QLA A;  1JAF A;  4JKV A;  3VRC A;  1YZC A;  3QVY A;  5JP7 A;  2XLH A;  3QW0 A;  1CGN A;  2J9B A;  3ZTM A;  4JE9 A;  3HNI A;  3TOM A;  3TOL A;  2XL8 A;  1CGO A;  1EKY A;  4CDV A;  2YL0 A;  2CCY A;  5JLI A;  4ULV A; 
#chains in the Genus database with same CATH topology
 2GAQ A;  2VB6 A;  4GEH A;  3ZWI A;  4CS8 C;  4LLC A;  4IAQ A;  5COF A;  1WWP A;  2JD3 A;  3SEO A;  1WAT A;  3DI5 A;  3JT1 A;  4MVR A;  1BDJ B;  3JSZ A;  1JR8 A;  2FGY A;  1JPN A;  4M63 A;  3KMI A;  2IBF A;  3F46 A;  4O6M A;  4BEJ A;  1Q0M A;  1ZU5 A;  1SMY F;  2BE5 F;  2YEV A;  5L0G A;  1VYK A;  2J45 A;  4JJG A;  1H6G A;  2UUH A;  2EIL C;  3HJC A;  1DOW A;  1R4T A;  1T5O A;  3FMS A;  2L6G A;  4NQF A;  3L34 A;  5DS6 A;  3V5X A;  2ZXW C;  1G4U S;  2ASR A;  5L0J A;  3RKO F;  2XLO A;  3S29 A;  2ZXR A;  1NBB A;  1LKX A;  3ZQY A;  4KNV A;  2Y39 A;  1VTM P;  4CX9 A;  2A6E F;  2I15 A;  3QZC A;  4MVU A;  4XQ1 A;  2QUP A;  3DE8 A;  4DRH B;  2HZ8 A;  5KYU B;  1MND A;  4O7G A;  3PDM P;  3JCU Q;  2L7A A;  4CSA C;  1KNY A;  2ICW G;  2WL8 A;  3WAQ A;  4C7O A;  3GWN A;  2J0X A;  2XSE A;  4JJF A;  3LEV A;  3FAJ A;  3GAN A;  3DWW A;  3OWT A;  2WZL A;  1HE1 A;  1OR3 A;  2HJM A;  3BRJ A;  3BEH A;  2L81 A;  5COM A;  2O9X A;  3E70 C;  1MMA A;  5KYU A;  2J9V A;  3CEX A;  4A4A A;  5KYX B;  1TKN A;  2J7P D;  3F47 A;  3FDQ A;  2GFH A;  4LDK A;  2CW0 F;  3TK0 A;  3L8I A;  2OCC C;  1M2V A;  2HS5 A;  3M4C A;  1E83 A;  3C8G B;  1HW2 A;  2IOQ A;  4NC3 A;  3H65 A;  1LI7 A;  1N1C A;  1YYX A;  4OIQ F;  1C03 A;  1IW7 F;  1SYQ A;  2J8W A;  3VYW A;  4YT8 A;  2HSQ A;  3B0P A;  2XLD A;  4B6I A;  4E0I A;  3TD7 A;  5CIV A;  3DJU B;  2XM4 A;  2OQM A;  3V5Y A;  4C3B A;  3EH2 A;  3LAY A;  4CSA A;  1Y6D A;  1VK5 A;  4DBR A;  2C03 A;  2HMZ A;  2QY9 A;  4CIH A;  3C8G A;  1V74 B;  4DRJ B;  4OIP F;  4NY3 A;  3GOD A;  4XPX A;  4YWQ A;  1Z3I X;  5B3S C;  2HFI A;  1D0X A;  1BR1 A;  3JSE O;  5DLJ A;  1I4Z A;  2QNL A;  3A11 A;  2D4U A;  1NFO A;  2H7V C;  2WZF A;  3NRH A;  4RD9 A;  3RF3 A;  1YZA A;  5B3I A;  5IY5 C;  3QTH A;  1EQ1 A;  3ASO C;  4CS9 C;  1U0B B;  1YA9 A;  4NCQ A;  3U5S A;  5BQH A;  4ER9 A;  3S27 A;  4Z9J A;  2F22 A;  4AL1 A;  1QQ3 A;  4C3D A;  3LLK A;  4NTF A;  4U9E A;  4FES A;  2VCA A;  2XL6 A;  1APC A;  1VLS A;  2E87 A;  4KC9 A;  3GOR A;  4PJN A;  3SXZ A;  4LDR A;  4E17 A;  2A0B A;  3C18 A;  2WVQ A;  1OCC C;  3Q7G A;  4MVO A;  4BJ5 A;  4XPW A;  2Q7R A;  1BZ4 A;  2XLM A;  4YJW A;  4CJO A;  3EZI A;  3S28 A;  2OJE D;  1OXB A;  1WTY A;  3RQG A;  4E7S A;  3K1H A;  4G7Z F;  3M1C B;  3C62 A;  2W4B A;  4CBE A;  4E7Z A;  2GA0 A;  3HNL A;  2Q00 A;  3AQB A;  1ZW2 A;  1G5Z A;  4EBB A;  1RKE B;  3LNR A;  3J06 A;  1K05 A;  2HJ3 A;  1WGW A;  5L0H A;  1A7E A;  2R7R A;  4CS9 A;  5L0D A;  2A68 F;  3QVY A;  1QSP A;  3EPV A;  4LER A;  1ZHW A;  4IRU A;  4JIO A;  4YT5 A;  3SYN A;  4BJ6 A;  3QW0 A;  4JTD B;  1FMV A;  4IGG A;  1J8Y F;  4FX5 A;  4JE9 A;  1HY5 A;  5DVW A;  1R5I D;  2LSE A;  2XL8 A;  3JRM O;  2PFD A;  3EHM A;  2Z15 A;  4PJL A;  4EHP A;  4CDV A;  5F5F A;  4MTF A;  5DQZ A;  3LLI A;  4GYT A;  2VCC A;  1TWH A;  1Y4C A;  1FAP B;  3MYF A;  4HE8 D;  2XXA A;  2Q9B A;  2YLI A;  1A7D A;  2GDC A;  2M64 A;  1V55 C;  3MBG A;  4JVS A;  2LCH A;  4MS2 A;  1YDI A;  4K7B A;  2PX3 A;  3DAG A;  2Y3B A;  5F28 E;  3UNG C;  2VAS A;  3PCV A;  4AL0 A;  2P7V A;  3LES A;  4HFF B;  3NYL A;  1DOV A;  3K66 A;  3G4X A;  2YQY A;  5A6B D;  5L3V A;  4DRI B;  2C04 A;  4CIP A;  1JOG A;  1MNE A;  3CSK A;  3NDB B;  2I8B A;  1LPE A;  1QZX A;  2ZXP A;  4XLP F;  5JVE A;  4HFK B;  4OD4 A;  2PNO A;  2AWY A;  5E3A A;  3GM3 A;  2KJG A;  3V7O A;  2AU5 A;  1O5H A;  1SF8 A;  4JCZ A;  3ZTZ A;  4DOZ A;  1H9G A;  3S9O A;  1MMN A;  2Y3D A;  2OG2 A;  3U0C A;  2IM8 A;  4G78 A;  1RJ9 A;  3UMI A;  1PD1 A;  1D1A A;  1LS1 A;  2OJQ A;  2YRF A;  4JTC B;  1S05 A;  1TR2 A;  3NKD A;  1BR2 A;  1CPR A;  3LS1 A;  4C7O B;  2LFF A;  2W4M A;  3S84 A;  2D5R B;  3B0U X;  1LIH A;  2YLD A;  3C8G D;  3JRT A;  5F5H A;  2J9U A;  2R7O A;  3W8I A;  4QDL A;  2YVK A;  4NTA A;  5GPG B;  4XEK A;  1L3P A;  3EQL F;  3PMR A;  3U3F A;  4BJT A;  1AVO B;  3ECS A;  2EPM X;  2MHR A;  2XL4 A;  1IZM A;  3LS0 A;  1RCP A;  1M57 C;  2YL7 A;  4RDA A;  4OIN F;  3FVY A;  1OW7 A;  1Q0K A;  2YL3 A;  4U5H A;  4YT4 A;  3IQ6 A;  2H8A A;  1WN0 A;  1D0Y A;  4KBL A;  3ZSU A;  2ZD9 A;  3IQ5 A;  4GQH A;  2Q3T A;  5EK0 A;  3NYM A;  3US6 A;  1HMD A;  3H2V A;  5COG A;  5FCL A;  4CS8 A;  1OCR C;  3O39 A;  4MTG A;  3HKK A;  4J32 B;  3SZR A;  1HW1 A;  3AG4 C;  3FAP B;  3DMD A;  4E0H A;  1Q0D A;  3L1M A;  3R2P A;  4XTK A;  1VB5 A;  2VCB A;  3M15 A;  3EH1 A;  1E86 A;  3DXJ F;  2EPL X;  1L7C A;  4E18 A;  2W9Y A;  1T6U A;  4K0D A;  1SZI A;  3O55 A;  2A69 F;  3RFY A;  4AX2 A;  1E84 A;  4G7H F;  3OA1 A;  4NTB A;  2G3V A;  1LS4 A;  3KYI A;  2FFH A;  3G50 A;  3B0V C;  5KYW B;  3UMK A;  4PFO A;  1ORS C;  4LAC B;  2LIG A;  4Z9I A;  3NMI A;  3ZIB A;  3EGX B;  2R7V A;  4XWJ A;  1GGQ A;  2HUJ A;  5T1D B;  3U9M A;  5KYX A;  1SR2 A;  2HMQ A;  4A2N B;  5JSL A;  1VLT A;  3IEE A;  1ZZP A;  4IWB A;  3EFO B;  4H54 A;  1CGM E;  4K1O A;  4JZA A;  3SXK A;  2R7W A;  3WHN A;  1QVX A;  3TJ6 A;  2H7B A;  1NLX A;  1PD0 A;  1JAF A;  4PFP A;  4YN0 B;  1FNT c;  3ABL C;  3L8J A;  3DM5 A;  3UMH A;  1FFT C;  1LE2 A;  4EBK A;  2YZS A;  3RVZ A;  3AGU A;  1T01 A;  2WVN A;  2Y3H A;  3RH3 A;  3L0I A;  1QLE C;  2R7X A;  4ZLC A;  3CQZ A;  1AEP A;  4ULW A;  4BJ1 A;  1EKY A;  5JLI A;  4ULV A;  1U89 A;  2A6H F;  2IXM A;  5BUO A;  1H9T A;  4EUK B;  2XS8 A;  1OCO C;  1GS9 A;  2NSF A;  2MYS A;  2P61 A;  2KQ9 A;  2W45 A;  3AG3 C;  3NKE A;  1M56 C;  2EPO A;  1OQC A;  3KKB A;  3FOO A;  4W8P A;  3IQT A;  2P6V A;  3AOU A;  3AG2 C;  3I4U A;  4MVS A;  3VF0 A;  4XLN F;  3C7J A;  1S7Z A;  1JRA A;  3NG1 A;  2DI3 A;  2KW3 C;  3JYH A;  3K1I C;  3R7C A;  4MVM A;  1W2W A;  5BQI A;  2Y69 C;  1J8M F;  4JEB A;  2LQG A;  2PBE A;  4JW1 A;  1G8X A;  1Z7Q c;  3A9C A;  5EGY A;  4Q7C A;  2EPK X;  1WOL A;  4PAC A;  5AC4 A;  3GEE A;  1RKE A;  2DYS C;  2HKV A;  2YL1 A;  1Z23 A;  3JZ0 A;  3W2V A;  3SXY A;  2AP3 A;  1NU7 D;  5B1A C;  2CYD A;  2R7S A;  3X2Q C;  2DB4 A;  1WAS A;  4CDY A;  4JTA B;  1Q0G A;  1H7I A;  2R7T A;  4U5G A;  1D0Z A;  3GEH A;  5E33 A;  3UGO A;  2YKZ A;  3DD7 A;  3ZVR A;  4CS7 A;  2RSE B;  4LDQ A;  4IB4 A;  3U8V A;  1ZHZ A;  3K1I A;  2LD6 A;  1I4Y A;  2EIJ C;  2X51 A;  1OXK A;  4JCH A;  2NUT B;  5DS4 A;  2G3K A;  2PP4 A;  4JC7 A;  4O79 A;  2EIN C;  4H4K C;  2X0C A;  4OIR F;  3LUT B;  3TJ5 A;  3B29 A;  3U2L A;  4IAR A;  4FAP B;  1TWG A;  3EJN A;  4MVZ A;  2Q9A A;  1LVK A;  1A41 A;  1CPQ A;  4EWC A;  2KC3 A;  3LNM B;  3SP1 A;  2J9W A;  2OEX A;  1JPJ A;  2OOC A;  2NUT A;  3HNJ A;  3QMK A;  2XS1 A;  3K7D A;  4EBJ A;  1OR2 A;  1OCZ C;  4F4B A;  5T3T A;  5BQG A;  1NG1 A;  1V4A A;  1C02 A;  1I5N A;  2M4E A;  3KH2 A;  2HSB A;  4HEA J;  2CNW A;  1BR4 A;  2KYH A;  4MND A;  5DS5 A;  1YYJ A;  5E2Q A;  1QKR A;  1NFN A;  1EI7 A;  2WZG A;  3JYY A;  3DAF A;  4U5C E;  3U3B A;  1MQV A;  4MQ9 F;  4PR9 A;  5AC5 A;  4Q4Z F;  3SNH A;  256B A;  3C8Z A;  1A0B A;  1OKK A;  5A6K A;  4WGY A;  4D4N A;  5HSW A;  2P1A A;  3RVY A;  5JRA A;  3FXH A;  2VC9 A;  2L6F A;  1RXQ A;  2ZXO A;  4YL3 A;  3OEO A;  4U5D E;  3O10 A;  1YA7 O;  2V26 A;  4I3M A;  3GEI A;  2IXO A;  4I1M A;  3KPH A;  1M2O A;  2XLV A;  3N0T A;  3W4Y A;  5KYN A;  4MW8 A;  2FAP B;  3T6J A;  1M6T A;  4KNW A;  3U2M A;  3POV A;  3NMJ A;  2LFD A;  2VH3 A;  3E9V A;  1YAR O;  1XZQ A;  1ZU4 A;  2B0J A;  2RD9 A;  5D91 A;  3UR3 C;  5A6J A;  2L6H A;  3ZQV A;  2QLA A;  1YAU O;  5CI8 A;  3W8H A;  2EPN A;  1EA8 A;  2AVK A;  2V3C C;  4BG0 A;  4BPM A;  1ZW3 A;  3ITF A;  5CI9 A;  3VRC A;  4W8K A;  3ZDL A;  2JPU A;  1G4W R;  2ETS A;  5DQT A;  1C17 M;  1FTS A;  5E3C A;  1CGN A;  2J9B A;  2R7Q A;  4PK4 A;  3O6X A;  4IAO A;  4LLE A;  3GM2 A;  3TOM A;  1ZYR F;  2ZPA A;  3MX3 A;  1CGO A;  2NUP B;  1ZHT A;  2J0W A;  5L0F A;  4QI0 A;  4Z9H A;  3H2U A;  1FFH A;  2CCY A;  5L3Q A;  2EIK C;  4G7O F;  1FMW A;  1RKC A;  3RQF A;  2G62 A;  2YHS A;  2YLG A;  2R05 A;  2IYL D;  3T6B A;  5A6B A;  1M2V B;  1QPU A;  1TQG A;  1ST6 A;  2R02 A;  5B1B C;  2NUP A;  5KYW A;  3AQC A;  4YL0 A;  2BL2 A;  3HNK A;  1HMO A;  4J7Y A;  4U5F E;  3MFN A;  2YWA A;  3DJN B;  4OD5 A;  4Q5S F;  4KI2 A;  1XWJ A;  2AWC A;  3M79 A;  2Y3G A;  3EGX A;  1BBH A;  3MLG A;  5EHH A;  4DVZ A;  1T6I A;  4N06 A;  2L9J A;  5KYY B;  2XRH A;  4N6C A;  3S90 A;  3N24 A;  2OU6 A;  1D1C A;  1VMA A;  3X1O A;  3B71 A;  4X0R A;  3EFO A;  3QW1 A;  3ZG1 A;  4N6H A;  1B68 A;  1LM3 B;  1T6Q A;  4MW3 A;  2IXP A;  3ABK C;  3NYJ A;  3LEO A;  2HV7 A;  3DKA A;  3Q7L A;  5TJ5 E;  1O3U A;  3EGD B;  3IQC A;  4PJJ A;  3Q6M A;  1JMW A;  1XZP A;  2KSF A;  3RW0 A;  3C63 A;  3EZH A;  3EG9 B;  4BJ5 C;  5JUA A;  5KYY A;  1TFK B;  3I5Q A;  3IPM O;  3LJB A;  4DVY P;  2XLW A;  4JEA A;  5HV9 A;  1KU2 A;  1GQA A;  2WB7 A;  4I44 A;  3Q6N A;  2LP4 A;  2JX0 A;  3DM9 B;  3ABM C;  3GWL A;  2CGE A;  3EGD A;  2J46 A;  2GWW A;  2PF4 E;  4R32 A;  2BC5 A;  4J7T A;  1U6H A;  3T6G B;  3EG9 A;  4XEV A;  1GM5 A;  4CDA A;  2CNW D;  1VYI A;  3U9J A;  3VM6 A;  2Q9C A;  3QVZ A;  1K40 A;  3IHU A;  4BJ6 C;  4YL1 A;  1TFO B;  4N4W A;  4FWV A;  1KTM A;  3NMK A;  5K0I A;  3DE9 A;  1NZE A;  3PHF 2;  4ZLD A;  3GM1 A;  1TWC A;  1MMD A;  4IJJ A;  4U9D A;  1NU9 C;  2IXN A;  1AUE A;  1OKK D;  3T9O A;  3ATP A;  1HE9 A;  1K04 A;  3FHD A;  5FZT A;  4AK9 A;  4YT2 A;  2HV6 A;  1E85 A;  2NSG A;  2R9R B;  1Z6A A;  3RIP A;  3UGP A;  4BEM J;  2XM0 A;  1O87 A;  2WVO A;  1YJG A;  3AG1 C;  3I5P A;  1V54 C;  3EHN A;  4EKW A;  4U5B E;  1LE4 A;  2NG1 A;  3WOD F;  4P9F A;  5A69 A;  2DGJ A;  5T3W A;  3TUL A;  2EIM C;  4XEF A;  5AGF A;  4ONS A;  1D1B A;  1RMV A;  4O6Y A;  4DXW A;  1F1M A;  3ZC4 A;  3V5Z A;  2J7P A;  2QTV A;  2B0H A;  4G0H A;  3U8P A;  2XXA B;  2KNH A;  3MYI A;  2A1D D;  2KGO A;  2R25 A;  3DZA A;  3HLZ A;  4I1O B;  4CJG A;  1A7V A;  2QE9 A;  1E2X A;  3M4B A;  3SXM A;  4ANJ A;  2PX0 A;  4EIY A;  4DBQ A;  4MVQ A;  3AJM A;  1ORY A;  2UUI A;  1NSG B;  3AGT A;  1VOM A;  3ASN C;  3JTL O;  3K33 A;  4WGZ A;  5L0C A;  4UDV A;  1OW8 A;  1Z63 A;  3S0X A;  3KL4 A;  3HTK C;  4JRZ A;  3RYL A;  4D4X A;  4L6R A;  3B9Q A;  5JT4 A;  2KK1 A;  3VAY A;  2CDQ A;  3KYJ A;  3FOP A;  1TWA A;  3T4R A;  2DYR C;  4DJ9 A;  2OEV A;  2Q4F A;  2LK4 A;  2XLE A;  3K6B A;  4WJ0 A;  2OKU A;  2H7O A;  1Z5Z A;  1UG7 A;  5A6A A;  3N2Z B;  1ZHX A;  5JS5 A;  3RQE A;  1ORJ A;  2R03 A;  4U5E E;  4OIO F;  1OW6 A;  3CZ6 A;  3W2W A;  2A0U A;  1LI5 A;  1Q0F A;  3G4Z A;  4C3E A;  2NPU A;  4P6I C;  1T9K A;  1YVI A;  1PCX A;  1YLM A;  1RJ9 B;  2MWQ A;  3CAX A;  4JKV A;  1YZC A;  4JUR I;  4P9T A;  3WG7 C;  4AE4 B;  1FR0 A;  1UFB A;  5JP7 A;  5D92 A;  2XLH A;  1ZHY A;  4MTO A;  4WAB A;  4QI2 A;  3ZTM A;  4J30 B;  3HNI A;  4RBN A;  2P0N A;  3TOL A;  2TMV P;  4PJM A;  4O6N A;  3TQO A;  2YL0 A;  1MMG A;  1PV3 A;  5L0I A;  2R7U A;  1ZVZ A;  4XPY A;  4YK5 A;  4AE4 A; 
#chains in the Genus database with same CATH homology
 2YLI A;  2YLG A;  3ZWI A;  1QPU A;  4IAQ A;  3HNK A;  3FOO A;  3M79 A;  4CIP A;  1BBH A;  4JEB A;  5JVE A;  3QW1 A;  3ZTZ A;  4N6H A;  1LM3 B;  2YL1 A;  2XLO A;  1NBB A;  3ZQY A;  5JUA A;  3C63 A;  4CX9 A;  3DE8 A;  2XLW A;  4JEA A;  1GQA A;  1S05 A;  4CDY A;  1CPR A;  2YKZ A;  2YLD A;  4IB4 A;  2BC5 A;  4CDA A;  3QVZ A;  4N4W A;  1E83 A;  3M4C A;  3NMK A;  1RCP A;  2YL7 A;  3DE9 A;  4IAR A;  4NC3 A;  2YL3 A;  1YYX A;  3IQ6 A;  4U9D A;  2J8W A;  3IQ5 A;  1CPQ A;  1E85 A;  2XLD A;  2XM0 A;  2XM4 A;  3HNJ A;  5AGF A;  3L1M A;  3M15 A;  1E86 A;  5B3I A;  1YYJ A;  1YZA A;  3U8P A;  1MQV A;  4CJG A;  1A7V A;  4EIY A;  3M4B A;  1E84 A;  256B A;  4ER9 A;  4WGZ A;  1QQ3 A;  4WGY A;  4U9E A;  4D4N A;  2XL6 A;  5JRA A;  1APC A;  4D4X A;  4L6R A;  3NMI A;  5JT4 A;  3FOP A;  2XLV A;  2XLM A;  4CJO A;  2XLE A;  1M6T A;  3NMJ A;  5JSL A;  5JS5 A;  3C62 A;  3ZQV A;  3HNL A;  2QLA A;  1JAF A;  4JKV A;  3VRC A;  1YZC A;  3QVY A;  5JP7 A;  2XLH A;  3QW0 A;  1CGN A;  2J9B A;  3ZTM A;  4JE9 A;  3HNI A;  3TOM A;  3TOL A;  2XL8 A;  1CGO A;  1EKY A;  4CDV A;  2YL0 A;  2CCY A;  5JLI A;  4ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...