3DE9A

Crystal structure of a trimeric cytochrome cb562 assembly induced by nickel coordination
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Control of protein oligomerization symmetry by metal coordination: C2 and C3 symmetrical assemblies through Cu(II) and Ni(II) coordination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3de9A00
1QPUA 1MQVA 3DE8A 4CIPA 1CPRA 3TOLA 4WGYA 4N6HA 3FOPA 4IAQA 3NMIA 3TOMA 5JVEA 2XL8A 5JT4A 1E86A 3HNLA 5JLIA 1BBHA 3HNJA 4JEBA 3VRCA 1A7VA 1YYJA 3NMKA 1EKYA 5JSLA 2QLAA 3IQ6A 3NMJA 4IB4A 1YZAA 2YLDA 3M79A 2YLGA 2XL6A 4U9EA 3HNIA 3C62A 2YL0A 1APCA 5B3IA 4CDYA 1E84A 4CJGA 4ER9A 3ZTMA 2XLHA 3IQ5A 3ZWIA 4NC3A 5JP7A 3QW0A 1M6TA 4CDVA 4CX9A 4JEAA 5JRAA 1GQAA 2XLWA 3QVZA 1CGOA 3HNKA 3QW1A 1QQ3A 3QVYA 2XLDA 2BC5A 5JS5A 2XLVA 3DE9A 2XLEA 2XM0A 4N4WA 1JAFA 1CPQA 4IARA 3ZTZA 3M4CA 2J8WA 2CCYA 2XLMA 2YL7A 4U9DA 1LM3B 2YL3A 2YL1A 2YKZA 4L6RA 3M15A 1YZCA 3M4BA 2YLIA 3U8PA 2XM4A 1NBBA 3ZQYA 4WGZA 1YYXA 3FOOA 4CDAA 3C63A 2J9BA 1CGNA 4ULVA 4EIYA 1E83A 256BA 4CJOA 3L1MA 2XLOA 4JKVA 4D4XA 4D4NA 1E85A 5JUAA 1RCPA 3ZQVA 5AGFA 1S05A 4JE9A
chains in the Genus database with same CATH superfamily
3LEVA 3RIPA 1MQVA 2R03A 1A7EA 4DVZA 2XL4A 1NSGB 3DE8A 4BJ6A 3SNHA 3UMIA 1R4TA 2OU6A 4JC7A 1VYIA 4MW8A 5T3TA 3DAGA 4IAQA 3NMIA 2R7RA 2DYRC 1UFBA 3EZIA 4U5DE 3DMDA 2VCCA 3LS0A 1XZQA 1FMWA 2HKVA 1BBHA 2A68F 2G62A 1JOGA 3HNJA 3K66A 3OWTA 4JEBA 4G0HA 4C3BA 4WABA 1FMVA 4WJ0A 2PX3A 3KMIA 3EFOA 2LK4A 1TQGA 3UGPA 1EA8A 3W4YA 2PNOA 4IWBA 2H8AA 4JJFA 5JSLA 1B68A 4XEFA 4OINF 4EBJA 3VYWA 1VLTA 1JPNA 2NSGA 3IQ6A 2R7TA 3NMJA 4AL1A 2J0XA 4IB4A 1IZMA 3B9QA 1D0YA 1AEPA 2H7BA 2OOCA 2W4BA 4EBBA 2HZ8A 2I8BA 3L8JA 2YLDA 1E2XA 1JPJA 1Z5ZA 4KNVA 1D1CA 2MWQA 2H7OA 2EILC 4U9EA 1NG1A 2YRFA 3C62A 2FAPB 4LDRA 3US6A 3LLIA 1ORSC 4YT5A 1E84A 1JR8A 5A6AA 4NTAA 2H7VC 2OKUA 4NTFA 2CYDA 4J7TA 2WVQA 1L3PA 3EQLF 3X1OA 5DS6A 3CQZA 3ZWIA 1HMDA 2R7UA 4NC3A 1YVIA 2R7VA 1WGWA 3JCUQ 4U5GA 1XWJA 1VTMP 1GGQA 1M6TA 1WOLA 3KL4A 3LESA 4JEAA 2NUPB 1GQAA 3T9OA 2Y69C 5L0DA 3QW1A 4XLNF 3T6GB 3NRHA 4CS8C 5AC4A 5CIVA 5D92A 3C7JA 4JURI 3LJBA 2BC5A 4YJWA 4JTAB 4ULWA 1Q0FA 2Y3BA 1Z6AA 4O6MA 1FFHA 4JIOA 1QSPA 3S27A 4BJ6C 3T6BA 3S84A 1K04A 3GM1A 4I44A 4LLEA 4BJ1A 5EGYA 2EPLX 2DGJA 4N4WA 3RW0A 3DZAA 3ZIBA 4IARA 1LE4A 2M4EA 2ETSA 3UMHA 1M57C 1RJ9A 5B3SC 4MTGA 1D1AA 3MLGA 1D0ZA 3EG9B 3GANA 2LD6A 2ZXRA 2YWAA 5E3CA 2XLMA 2JPUA 2YL7A 2P1AA 4JTCB 3H2VA 3K33A 1Y4CA 5BQHA 1K05A 3I5PA 2R7WA 1A41A 1UG7A 2YVKA 3IHUA 2R05A 1AUEA 1OR3A 3RQGA 4EUKB 4GYTA 4U5HA 2CW0F 2J0WA 5A6BA 3K1IA 2IXOA 2KW3C 2ZXOA 2AVKA 5CI9A 1PV3A 4HFKB 4PFPA 2NSFA 4DRIB 2L6FA 2L6HA 3C63A 5L0JA 1TWAA 1ZHXA 4BG0A 4F4BA 2HV7A 1JMWA 3B0UX 2TMVP 2NG1A 3GWNA 4PR9A 3AGTA 3JSZA 2J9UA 3U9MA 4ZLDA 1OXKA 3PMRA 5IY5C 3OEOA 3G4XA 4O7GA 1HE9A 1KU2A 4CJOA 4I1MA 5A69A 2NPUA 4ANJA 2QY9A 3L1MA 4Q5SF 2J45A 2IM8A 2IXPA 4JRZA 5AC5A 4PJLA 2R7OA 2R7QA 1RXQA 3SXKA 3DXJF 1KNYA 4HE8D 4NY3A 4CBEA 4D4NA 1VB5A 2C03A 5JUAA 1RCPA 1Z63A 1N1CA 5A6KA 1MMDA 1O87A 1VYKA 2IXNA 1I4YA 4XEVA 3B71A 5F5HA 3DM9B 5AGFA 3FAPB 1LE2A 2VH3A 3GORA 3W8IA 1IW7F 1HW1A 3J06A 2P7VA 3E70C 4MS2A 2WVOA 1CPRA 1OKKA 5FCLA 3JTLO 3CEXA 1FR0A 4N6HA 1M2VA 5F28E 2VC9A 3BEHA 2ZXWC 1FNTc 3TOMA 3RYLA 5E3AA 4A4AA 3O55A 5JT4A 2J9WA 3HTKC 2AU5A 3ZSUA 4K7BA 2LSEA 3JRMO 2KQ9A 2B0JA 5FZTA 2V3CC 3F46A 5L0GA 2D5RB 3EGXB 3HKKA 2PF4E 4JW1A 3EHMA 4R32A 5BQIA 1EKYA 4JCZA 4LDKA 1V4AA 5B1BC 2QLAA 3K1IC 1Q0DA 3WG7C 4C3DA 1TR2A 1NFNA 2WZGA 4I1OB 4GQHA 4MTOA 4QDLA 5L0FA 2VCAA 1J8MF 2Q9AA 3JZ0A 4MVUA 3M79A 2YLGA 2HMQA 5KYUA 3RQFA 4AE4A 1TFKB 3K7DA 3LAYA 2R25A 3HNIA 3SXZA 2R7SA 3AQCA 1APCA 4PACA 3U0CA 1NFOA 3DJUB 4PJNA 1F1MA 1U6HA 2Y39A 4YN0B 4MVQA 3R7CA 4YT2A 2Y3GA 4W8PA 1MMNA 4K1OA 3ZTMA 4DOZA 3N2ZB 2R02A 1WATA 1VLSA 3Q6NA 2JX0A 4E0IA 1H9TA 1G4US 4OIQF 1BR1A 4MNDA 5JP7A 1Q0KA 3QW0A 4CX9A 1WTYA 3LEOA 4E7SA 4NQFA 3ITFA 1YLMA 3AG2C 3ABKC 2EIKC 4N6CA 2XRHA 5KYUB 4H54A 3T4RA 2NUPA 3DAFA 4AE4B 5JS5A 1VOMA 3QZCA 4YT8A 4RDAA 2PP4A 1H7IA 3DE9A 1FTSA 2A0UA 5T3WA 3HJCA 2XLEA 2KNHA 1ZW2A 2XM0A 5A6BD 2PBEA 1FAPB 4G7OF 1CPQA 1D0XA 3E9VA 4CSAC 3SP1A 4JCHA 3T6JA 1GM5A 3V5ZA 1ZU5A 1M2OA 2IBFA 2J8WA 2IXMA 3DKAA 2EPMX 1BR2A 5COFA 2YEVA 2A69F 2V26A 4U9DA 2XS8A 1Q0GA 1SZIA 2YL1A 3GEHA 4L6RA 5TJ5E 3TJ6A 1K40A 3M15A 1YZCA 2LP4A 3DWWA 1SMYF 3EG9A 4KNWA 4Z9IA 3L8IA 2QNLA 3JSEO 3RH3A 5CI8A 3U8PA 2M64A 4ZLCA 3L0IA 4EWCA 4C7OA 3ZC4A 3IEEA 2XSEA 4U5BE 2DYSC 1J8YF 4WGZA 1ORYA 3TQOA 3G4ZA 2CNWA 3RVZA 3MBGA 1Z3IX 4PJJA 2W9YA 2J9BA 1CGNA 2HS5A 1XZPA 3O39A 1T6IA 3M1CB 3TJ5A 4BEMJ 1Z23A 4EIYA 1OCZC 3IQCA 2ZPAA 1WWPA 1YAUO 4OD4A 1NLXA 1T6QA 2KJGA 5KYNA 3H2UA 2A1DD 3Q6MA 3DM5A 4JKVA 4E17A 1TWGA 4MVMA 4C7OB 4DVYP 1HW2A 1RKEA 3ZQVA 2Y3HA 4FESA 4OD5A 2ZXPA 2YHSA 2CDQA 2RD9A 1S05A 4XWJA 3U8VA 4JE9A 1T6UA 2J7PD 3FMSA 5GPGB 3JT1A 4M63A 4XPYA 3ASOC 3GODA 2L6GA 4PK4A 1V55C 3K1HA 4WGYA 4X0RA 1OR2A 1VK5A 3FOPA 5JVEA 2GWWA 4KBLA 1FFTC 2WL8A 1NZEA 1MNDA 2P0NA 2XL8A 5T1DB 3S29A 3ZG1A 4CS9A 3ABLC 5JLIA 2J9VA 1RMVA 3KYIA 3VRCA 1MMAA 2UUHA 3R2PA 3TD7A 4C3EA 1A7VA 1YYJA 1RKEB 1G4WR 3EPVA 4OIRF 3IQTA 1QZXA 3U2LA 3C8GA 3A11A 4BPMA 1MNEA 2LFFA 3K6BA 2Q9BA 4HFFB 1W2WA 4U5EE 5EK0A 3UR3C 4B6IA 3W2WA 2BL2A 3DD7A 3EGXA 1YZAA 3JRTA 2ASRA 4MVZA 3ZVRA 3FAJA 3NKDA 5HV9A 3RF3A 4G78A 4O6YA 1D1BA 2XL6A 3AG4C 4LERA 2GA0A 2VCBA 1LPEA 4JZAA 3AOUA 1DOVA 1OW8A 3AQBA 3LNMB 1QVXA 1BDJB 3AJMA 4ONSA 4ER9A 1I5NA 3NYLA 2G3VA 2XLHA 3MYIA 3WAQA 4O6NA 3SXYA 4AK9A 1V54C 3C8GB 4JVSA 2EIMC 4YWQA 4J32B 1YDIA 3FVYA 1OQCA 3TULA 1ZHWA 2GAQA 4P9FA 5JRAA 2OJQA 2XLWA 5BQGA 3HNKA 5K0IA 3KPHA 4XLPF 3HLZA 1SYQA 2OQMA 3S0XA 2XLDA 2FGYA 1G8XA 1SR2A 3Q7LA 4O79A 1V74B 4Q7CA 5KYWA 5DS5A 2F22A 1SF8A 3VAYA 2A6HF 2GFHA 4MW3A 5D91A 3SYNA 3WODF 3ZDLA 4AX2A 4KC9A 3U5SA 1O3UA 2MYSA 4I3MA 1WASA 3AG1C 4LDQA 4IRUA 3ZTZA 4LLCA 3M4CA 4CS9C 2CNWD 1ZZPA 2CCYA 3O6XA 3U9JA 3DI5A 5A6JA 1PD1A 3RQEA 5E33A 4DRJB 2YL3A 2X0CA 2W45A 3GEEA 2HV6A 3GM2A 3F47A 2P61A 3N0TA 5DQTA 2VASA 1ST6A 2P6VA 2EPNA 5KYWB 4EBKA 2YQYA 3X2QC 2KYHA 1NBBA 2AWCA 2RSEB 1VMAA 3I4UA 1YYXA 4CDAA 3QTHA 1HY5A 2OCCC 2OEVA 2HJ3A 2EIJC 3W8HA 4MVSA 4ULVA 3NYJA 2AWYA 1Q0MA 4XTKA 3VF0A 2LCHA 1YA7O 2QE9A 3NDBB 2Q00A 4U5FE 4QI2A 1LI7A 256BA 1AVOB 3RKOF 5KYXB 5L3QA 1LI5A 2C04A 3NKEA 3NYMA 2XLOA 4OIPF 4E7ZA 3KYJA 4BJ5A 3TK0A 1E85A 4XEKA 1TFOB 4N06A 4BEJA 4E0HA 4Z9JA 4DBRA 4NTBA 1U89A 1OCRC 4NCQA 1R5ID 1ZYRF 2R9RB 3GM3A 1QPUA 4G7ZF 2CGEA 2X51A 5COGA 1L7CA 1YA9A 2L81A 3ASNC 3BRJA 3OA1A 4CIPA 3C8GD 1O5HA 3TOLA 3L34A 2I15A 2WVNA 3RFYA 3GEIA 3S9OA 3AGUA 5L0CA 1OCCC 4LACB 4MTFA 1PD0A 2MHRA 4FX5A 3LLKA 1TWCA 5L0IA 3EH1A 5HSWA 3G50A 4YK5A 2HFIA 1RKCA 2HJMA 3EFOB 3HNLA 4QI0A 4JJGA 1E86A 3U3BA 4GEHA 1BZ4A 4IJJA 3CSKA 2WZFA 5DS4A 2KK1A 1OKKD 5F5FA 2PX0A 4FAPB 3U3FA 1ORJA 5COMA 2Q7RA 5KYYA 3V5XA 3NMKA 3ATPA 3PHF2 2GDCA 3UMKA 1S7ZA 2D4UA 3IPMO 1OW6A 3KKBA 3UGOA 3I5QA 1MMGA 3O10A 2OG2A 1NU7D 5L3VA 4UDVA 1NU9C 3EZHA 4YL0A 4DBQA 1ZU4A 1LVKA 3LS1A 3V7OA 2DB4A 3WHNA 1C02A 3Q7GA 1DOWA 4J30B 4KI2A 1I4ZA 3VM6A 1WN0A 2Z15A 1ZHZA 3AG3C 4U5CE 1BR4A 2A6EF 2EPOA 2HSQA 2YL0A 5B3IA 2AP3A 2ZD9A 4MVOA 4RD9A 4CDYA 2Q9CA 1M56C 2WB7A 3EGDA 1ZHYA 1LKXA 1T5OA 4CJGA 1A0BA 2Q4FA 2UUIA 5KYYB 4XQ1A 2IOQA 3MYFA 1QKRA 3IQ5A 2KSFA 3KH2A 3MFNA 4HEAJ 5B1AC 3POVA 4MVRA 3DJNB 1U0BB 1ZW3A 2HMZA 3EJNA 2QTVA 4P6IC 4BJ5C 4CDVA 4Q4ZF 1H6GA 1Y6DA 3JYHA 4K0DA 5DQZA 4CS7A 1H9GA 1CGOA 3FHDA 3LUTB 3QVZA 4CIHA 5DVWA 2XXAA 3CZ6A 2NUTA 3SEOA 2OEXA 1QQ3A 1LIHA 2LQGA 3CAXA 3QVYA 1CGME 2O9XA 2YZSA 3SZRA 3W2VA 3EHNA 1A7DA 1TWHA 1RJ9B 2XLVA 3S90A 3C8ZA 3EGDB 2LIGA 2G3KA 2DI3A 3B29A 1LS1A 1JAFA 3LNRA 4FWVA 5DLJA 2B0HA 2W4MA 3PDMP 3H65A 2KGOA 3U2MA 4P9TA 1Z7Qc 4MQ9F 1EI7A 3UNGC 2L7AA 4H4KC 2IYLD 1YARO 2XXAB 5L0HA 4E18A 2A0BA 2NUTB 1LM3B 4PJMA 3SXMA 1T01A 1LS4A 2EPKX 1HMOA 2KC3A 2VB6A 2JD3A 2YKZA 4IGGA 4YL3A 3RVYA 1C03A 1EQ1A 3M4BA 3MX3A 2E87A 2YLIA 5E2QA 1ZVZA 2XM4A 1HE1A 2WZLA 4W8KA 2QUPA 4AL0A 1TKNA 4BJTA 3ZQYA 1OCOC 4OIOF 5BUOA 1PCXA 3B0VC 2XS1A 3A9CA 2ICWG 3FOOA 3FXHA 4DJ9A 4YL1A 3NG1A 4RBNA 4YT4A 2FFHA 4G7HF 4J7YA 4XPXA 1T9KA 3JYYA 3QMKA 3C18A 2LFDA 3PCVA 4PFOA 4CSAA 2L9JA 1YJGA 4Z9HA 1OXBA 4IAOA 4EHPA 1E83A 2PFDA 4XPWA 2HUJA 4A2NB 1QLEC 3N24A 2BE5F 1GS9A 2J7PA 2Y3DA 3ABMC 3B0PA 1JRAA 1OW7A 4DRHB 4DXWA 4D4XA 5EHHA 3S28A 1C17M 2J46A 3EH2A 1KTMA 2OJED 3GWLA 3V5YA 5KYXA 1G5ZA 4CS8A 4JTDB 3FDQA 4EKWA 2HSBA 2Q3TA 2EINC 2R7XA 1M2VB 1ZHTA 3ECSA
chains in the Genus database with same CATH topology
1QPUA 1MQVA 3DE8A 4CIPA 1CPRA 3TOLA 4WGYA 4N6HA 3FOPA 4IAQA 3NMIA 3TOMA 5JVEA 2XL8A 5JT4A 1E86A 3HNLA 5JLIA 1BBHA 3HNJA 4JEBA 3VRCA 1A7VA 1YYJA 3NMKA 1EKYA 5JSLA 2QLAA 3IQ6A 3NMJA 4IB4A 1YZAA 2YLDA 3M79A 2YLGA 2XL6A 4U9EA 3HNIA 3C62A 2YL0A 1APCA 5B3IA 4CDYA 1E84A 4CJGA 4ER9A 3ZTMA 2XLHA 3IQ5A 3ZWIA 4NC3A 5JP7A 3QW0A 1M6TA 4CDVA 4CX9A 4JEAA 5JRAA 1GQAA 2XLWA 3QVZA 1CGOA 3HNKA 3QW1A 1QQ3A 3QVYA 2XLDA 2BC5A 5JS5A 2XLVA 3DE9A 2XLEA 2XM0A 4N4WA 1JAFA 1CPQA 4IARA 3ZTZA 3M4CA 2J8WA 2CCYA 2XLMA 2YL7A 4U9DA 1LM3B 2YL3A 2YL1A 2YKZA 4L6RA 3M15A 1YZCA 3M4BA 2YLIA 3U8PA 2XM4A 1NBBA 3ZQYA 4WGZA 1YYXA 3FOOA 4CDAA 3C63A 2J9BA 1CGNA 4ULVA 4EIYA 1E83A 256BA 4CJOA 3L1MA 2XLOA 4JKVA 4D4XA 4D4NA 1E85A 5JUAA 1RCPA 3ZQVA 5AGFA 1S05A 4JE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPU A;  1MQV A;  3DE8 A;  4CIP A;  1CPR A;  3TOL A;  4WGY A;  4N6H A;  3FOP A;  4IAQ A;  3NMI A;  3TOM A;  5JVE A;  2XL8 A;  5JT4 A;  1E86 A;  3HNL A;  5JLI A;  1BBH A;  3HNJ A;  4JEB A;  3VRC A;  1A7V A;  1YYJ A;  3NMK A;  1EKY A;  5JSL A;  2QLA A;  3IQ6 A;  3NMJ A;  4IB4 A;  1YZA A;  2YLD A;  3M79 A;  2YLG A;  2XL6 A;  4U9E A;  3HNI A;  3C62 A;  2YL0 A;  1APC A;  5B3I A;  4CDY A;  1E84 A;  4CJG A;  4ER9 A;  3ZTM A;  2XLH A;  3IQ5 A;  3ZWI A;  4NC3 A;  5JP7 A;  3QW0 A;  1M6T A;  4CDV A;  4CX9 A;  4JEA A;  5JRA A;  1GQA A;  2XLW A;  3QVZ A;  1CGO A;  3HNK A;  3QW1 A;  1QQ3 A;  3QVY A;  2XLD A;  2BC5 A;  5JS5 A;  2XLV A;  3DE9 A;  2XLE A;  2XM0 A;  4N4W A;  1JAF A;  1CPQ A;  4IAR A;  3ZTZ A;  3M4C A;  2J8W A;  2CCY A;  2XLM A;  2YL7 A;  4U9D A;  1LM3 B;  2YL3 A;  2YL1 A;  2YKZ A;  4L6R A;  3M15 A;  1YZC A;  3M4B A;  2YLI A;  3U8P A;  2XM4 A;  1NBB A;  3ZQY A;  4WGZ A;  1YYX A;  3FOO A;  4CDA A;  3C63 A;  2J9B A;  1CGN A;  4ULV A;  4EIY A;  1E83 A;  256B A;  4CJO A;  3L1M A;  2XLO A;  4JKV A;  4D4X A;  4D4N A;  1E85 A;  5JUA A;  1RCP A;  3ZQV A;  5AGF A;  1S05 A;  4JE9 A; 
#chains in the Genus database with same CATH topology
 3LEV A;  3RIP A;  1MQV A;  2R03 A;  1A7E A;  4DVZ A;  2XL4 A;  1NSG B;  3DE8 A;  4BJ6 A;  3SNH A;  3UMI A;  1R4T A;  2OU6 A;  4JC7 A;  1VYI A;  4MW8 A;  5T3T A;  3DAG A;  4IAQ A;  3NMI A;  2R7R A;  2DYR C;  1UFB A;  3EZI A;  4U5D E;  3DMD A;  2VCC A;  3LS0 A;  1XZQ A;  1FMW A;  2HKV A;  1BBH A;  2A68 F;  2G62 A;  1JOG A;  3HNJ A;  3K66 A;  3OWT A;  4JEB A;  4G0H A;  4C3B A;  4WAB A;  1FMV A;  4WJ0 A;  2PX3 A;  3KMI A;  3EFO A;  2LK4 A;  1TQG A;  3UGP A;  1EA8 A;  3W4Y A;  2PNO A;  4IWB A;  2H8A A;  4JJF A;  5JSL A;  1B68 A;  4XEF A;  4OIN F;  4EBJ A;  3VYW A;  1VLT A;  1JPN A;  2NSG A;  3IQ6 A;  2R7T A;  3NMJ A;  4AL1 A;  2J0X A;  4IB4 A;  1IZM A;  3B9Q A;  1D0Y A;  1AEP A;  2H7B A;  2OOC A;  2W4B A;  4EBB A;  2HZ8 A;  2I8B A;  3L8J A;  2YLD A;  1E2X A;  1JPJ A;  1Z5Z A;  4KNV A;  1D1C A;  2MWQ A;  2H7O A;  2EIL C;  4U9E A;  1NG1 A;  2YRF A;  3C62 A;  2FAP B;  4LDR A;  3US6 A;  3LLI A;  1ORS C;  4YT5 A;  1E84 A;  1JR8 A;  5A6A A;  4NTA A;  2H7V C;  2OKU A;  4NTF A;  2CYD A;  4J7T A;  2WVQ A;  1L3P A;  3EQL F;  3X1O A;  5DS6 A;  3CQZ A;  3ZWI A;  1HMD A;  2R7U A;  4NC3 A;  1YVI A;  2R7V A;  1WGW A;  3JCU Q;  4U5G A;  1XWJ A;  1VTM P;  1GGQ A;  1M6T A;  1WOL A;  3KL4 A;  3LES A;  4JEA A;  2NUP B;  1GQA A;  3T9O A;  2Y69 C;  5L0D A;  3QW1 A;  4XLN F;  3T6G B;  3NRH A;  4CS8 C;  5AC4 A;  5CIV A;  5D92 A;  3C7J A;  4JUR I;  3LJB A;  2BC5 A;  4YJW A;  4JTA B;  4ULW A;  1Q0F A;  2Y3B A;  1Z6A A;  4O6M A;  1FFH A;  4JIO A;  1QSP A;  3S27 A;  4BJ6 C;  3T6B A;  3S84 A;  1K04 A;  3GM1 A;  4I44 A;  4LLE A;  4BJ1 A;  5EGY A;  2EPL X;  2DGJ A;  4N4W A;  3RW0 A;  3DZA A;  3ZIB A;  4IAR A;  1LE4 A;  2M4E A;  2ETS A;  3UMH A;  1M57 C;  1RJ9 A;  5B3S C;  4MTG A;  1D1A A;  3MLG A;  1D0Z A;  3EG9 B;  3GAN A;  2LD6 A;  2ZXR A;  2YWA A;  5E3C A;  2XLM A;  2JPU A;  2YL7 A;  2P1A A;  4JTC B;  3H2V A;  3K33 A;  1Y4C A;  5BQH A;  1K05 A;  3I5P A;  2R7W A;  1A41 A;  1UG7 A;  2YVK A;  3IHU A;  2R05 A;  1AUE A;  1OR3 A;  3RQG A;  4EUK B;  4GYT A;  4U5H A;  2CW0 F;  2J0W A;  5A6B A;  3K1I A;  2IXO A;  2KW3 C;  2ZXO A;  2AVK A;  5CI9 A;  1PV3 A;  4HFK B;  4PFP A;  2NSF A;  4DRI B;  2L6F A;  2L6H A;  3C63 A;  5L0J A;  1TWA A;  1ZHX A;  4BG0 A;  4F4B A;  2HV7 A;  1JMW A;  3B0U X;  2TMV P;  2NG1 A;  3GWN A;  4PR9 A;  3AGT A;  3JSZ A;  2J9U A;  3U9M A;  4ZLD A;  1OXK A;  3PMR A;  5IY5 C;  3OEO A;  3G4X A;  4O7G A;  1HE9 A;  1KU2 A;  4CJO A;  4I1M A;  5A69 A;  2NPU A;  4ANJ A;  2QY9 A;  3L1M A;  4Q5S F;  2J45 A;  2IM8 A;  2IXP A;  4JRZ A;  5AC5 A;  4PJL A;  2R7O A;  2R7Q A;  1RXQ A;  3SXK A;  3DXJ F;  1KNY A;  4HE8 D;  4NY3 A;  4CBE A;  4D4N A;  1VB5 A;  2C03 A;  5JUA A;  1RCP A;  1Z63 A;  1N1C A;  5A6K A;  1MMD A;  1O87 A;  1VYK A;  2IXN A;  1I4Y A;  4XEV A;  3B71 A;  5F5H A;  3DM9 B;  5AGF A;  3FAP B;  1LE2 A;  2VH3 A;  3GOR A;  3W8I A;  1IW7 F;  1HW1 A;  3J06 A;  2P7V A;  3E70 C;  4MS2 A;  2WVO A;  1CPR A;  1OKK A;  5FCL A;  3JTL O;  3CEX A;  1FR0 A;  4N6H A;  1M2V A;  5F28 E;  2VC9 A;  3BEH A;  2ZXW C;  1FNT c;  3TOM A;  3RYL A;  5E3A A;  4A4A A;  3O55 A;  5JT4 A;  2J9W A;  3HTK C;  2AU5 A;  3ZSU A;  4K7B A;  2LSE A;  3JRM O;  2KQ9 A;  2B0J A;  5FZT A;  2V3C C;  3F46 A;  5L0G A;  2D5R B;  3EGX B;  3HKK A;  2PF4 E;  4JW1 A;  3EHM A;  4R32 A;  5BQI A;  1EKY A;  4JCZ A;  4LDK A;  1V4A A;  5B1B C;  2QLA A;  3K1I C;  1Q0D A;  3WG7 C;  4C3D A;  1TR2 A;  1NFN A;  2WZG A;  4I1O B;  4GQH A;  4MTO A;  4QDL A;  5L0F A;  2VCA A;  1J8M F;  2Q9A A;  3JZ0 A;  4MVU A;  3M79 A;  2YLG A;  2HMQ A;  5KYU A;  3RQF A;  4AE4 A;  1TFK B;  3K7D A;  3LAY A;  2R25 A;  3HNI A;  3SXZ A;  2R7S A;  3AQC A;  1APC A;  4PAC A;  3U0C A;  1NFO A;  3DJU B;  4PJN A;  1F1M A;  1U6H A;  2Y39 A;  4YN0 B;  4MVQ A;  3R7C A;  4YT2 A;  2Y3G A;  4W8P A;  1MMN A;  4K1O A;  3ZTM A;  4DOZ A;  3N2Z B;  2R02 A;  1WAT A;  1VLS A;  3Q6N A;  2JX0 A;  4E0I A;  1H9T A;  1G4U S;  4OIQ F;  1BR1 A;  4MND A;  5JP7 A;  1Q0K A;  3QW0 A;  4CX9 A;  1WTY A;  3LEO A;  4E7S A;  4NQF A;  3ITF A;  1YLM A;  3AG2 C;  3ABK C;  2EIK C;  4N6C A;  2XRH A;  5KYU B;  4H54 A;  3T4R A;  2NUP A;  3DAF A;  4AE4 B;  5JS5 A;  1VOM A;  3QZC A;  4YT8 A;  4RDA A;  2PP4 A;  1H7I A;  3DE9 A;  1FTS A;  2A0U A;  5T3W A;  3HJC A;  2XLE A;  2KNH A;  1ZW2 A;  2XM0 A;  5A6B D;  2PBE A;  1FAP B;  4G7O F;  1CPQ A;  1D0X A;  3E9V A;  4CSA C;  3SP1 A;  4JCH A;  3T6J A;  1GM5 A;  3V5Z A;  1ZU5 A;  1M2O A;  2IBF A;  2J8W A;  2IXM A;  3DKA A;  2EPM X;  1BR2 A;  5COF A;  2YEV A;  2A69 F;  2V26 A;  4U9D A;  2XS8 A;  1Q0G A;  1SZI A;  2YL1 A;  3GEH A;  4L6R A;  5TJ5 E;  3TJ6 A;  1K40 A;  3M15 A;  1YZC A;  2LP4 A;  3DWW A;  1SMY F;  3EG9 A;  4KNW A;  4Z9I A;  3L8I A;  2QNL A;  3JSE O;  3RH3 A;  5CI8 A;  3U8P A;  2M64 A;  4ZLC A;  3L0I A;  4EWC A;  4C7O A;  3ZC4 A;  3IEE A;  2XSE A;  4U5B E;  2DYS C;  1J8Y F;  4WGZ A;  1ORY A;  3TQO A;  3G4Z A;  2CNW A;  3RVZ A;  3MBG A;  1Z3I X;  4PJJ A;  2W9Y A;  2J9B A;  1CGN A;  2HS5 A;  1XZP A;  3O39 A;  1T6I A;  3M1C B;  3TJ5 A;  4BEM J;  1Z23 A;  4EIY A;  1OCZ C;  3IQC A;  2ZPA A;  1WWP A;  1YAU O;  4OD4 A;  1NLX A;  1T6Q A;  2KJG A;  5KYN A;  3H2U A;  2A1D D;  3Q6M A;  3DM5 A;  4JKV A;  4E17 A;  1TWG A;  4MVM A;  4C7O B;  4DVY P;  1HW2 A;  1RKE A;  3ZQV A;  2Y3H A;  4FES A;  4OD5 A;  2ZXP A;  2YHS A;  2CDQ A;  2RD9 A;  1S05 A;  4XWJ A;  3U8V A;  4JE9 A;  1T6U A;  2J7P D;  3FMS A;  5GPG B;  3JT1 A;  4M63 A;  4XPY A;  3ASO C;  3GOD A;  2L6G A;  4PK4 A;  1V55 C;  3K1H A;  4WGY A;  4X0R A;  1OR2 A;  1VK5 A;  3FOP A;  5JVE A;  2GWW A;  4KBL A;  1FFT C;  2WL8 A;  1NZE A;  1MND A;  2P0N A;  2XL8 A;  5T1D B;  3S29 A;  3ZG1 A;  4CS9 A;  3ABL C;  5JLI A;  2J9V A;  1RMV A;  3KYI A;  3VRC A;  1MMA A;  2UUH A;  3R2P A;  3TD7 A;  4C3E A;  1A7V A;  1YYJ A;  1RKE B;  1G4W R;  3EPV A;  4OIR F;  3IQT A;  1QZX A;  3U2L A;  3C8G A;  3A11 A;  4BPM A;  1MNE A;  2LFF A;  3K6B A;  2Q9B A;  4HFF B;  1W2W A;  4U5E E;  5EK0 A;  3UR3 C;  4B6I A;  3W2W A;  2BL2 A;  3DD7 A;  3EGX A;  1YZA A;  3JRT A;  2ASR A;  4MVZ A;  3ZVR A;  3FAJ A;  3NKD A;  5HV9 A;  3RF3 A;  4G78 A;  4O6Y A;  1D1B A;  2XL6 A;  3AG4 C;  4LER A;  2GA0 A;  2VCB A;  1LPE A;  4JZA A;  3AOU A;  1DOV A;  1OW8 A;  3AQB A;  3LNM B;  1QVX A;  1BDJ B;  3AJM A;  4ONS A;  4ER9 A;  1I5N A;  3NYL A;  2G3V A;  2XLH A;  3MYI A;  3WAQ A;  4O6N A;  3SXY A;  4AK9 A;  1V54 C;  3C8G B;  4JVS A;  2EIM C;  4YWQ A;  4J32 B;  1YDI A;  3FVY A;  1OQC A;  3TUL A;  1ZHW A;  2GAQ A;  4P9F A;  5JRA A;  2OJQ A;  2XLW A;  5BQG A;  3HNK A;  5K0I A;  3KPH A;  4XLP F;  3HLZ A;  1SYQ A;  2OQM A;  3S0X A;  2XLD A;  2FGY A;  1G8X A;  1SR2 A;  3Q7L A;  4O79 A;  1V74 B;  4Q7C A;  5KYW A;  5DS5 A;  2F22 A;  1SF8 A;  3VAY A;  2A6H F;  2GFH A;  4MW3 A;  5D91 A;  3SYN A;  3WOD F;  3ZDL A;  4AX2 A;  4KC9 A;  3U5S A;  1O3U A;  2MYS A;  4I3M A;  1WAS A;  3AG1 C;  4LDQ A;  4IRU A;  3ZTZ A;  4LLC A;  3M4C A;  4CS9 C;  2CNW D;  1ZZP A;  2CCY A;  3O6X A;  3U9J A;  3DI5 A;  5A6J A;  1PD1 A;  3RQE A;  5E33 A;  4DRJ B;  2YL3 A;  2X0C A;  2W45 A;  3GEE A;  2HV6 A;  3GM2 A;  3F47 A;  2P61 A;  3N0T A;  5DQT A;  2VAS A;  1ST6 A;  2P6V A;  2EPN A;  5KYW B;  4EBK A;  2YQY A;  3X2Q C;  2KYH A;  1NBB A;  2AWC A;  2RSE B;  1VMA A;  3I4U A;  1YYX A;  4CDA A;  3QTH A;  1HY5 A;  2OCC C;  2OEV A;  2HJ3 A;  2EIJ C;  3W8H A;  4MVS A;  4ULV A;  3NYJ A;  2AWY A;  1Q0M A;  4XTK A;  3VF0 A;  2LCH A;  1YA7 O;  2QE9 A;  3NDB B;  2Q00 A;  4U5F E;  4QI2 A;  1LI7 A;  256B A;  1AVO B;  3RKO F;  5KYX B;  5L3Q A;  1LI5 A;  2C04 A;  3NKE A;  3NYM A;  2XLO A;  4OIP F;  4E7Z A;  3KYJ A;  4BJ5 A;  3TK0 A;  1E85 A;  4XEK A;  1TFO B;  4N06 A;  4BEJ A;  4E0H A;  4Z9J A;  4DBR A;  4NTB A;  1U89 A;  1OCR C;  4NCQ A;  1R5I D;  1ZYR F;  2R9R B;  3GM3 A;  1QPU A;  4G7Z F;  2CGE A;  2X51 A;  5COG A;  1L7C A;  1YA9 A;  2L81 A;  3ASN C;  3BRJ A;  3OA1 A;  4CIP A;  3C8G D;  1O5H A;  3TOL A;  3L34 A;  2I15 A;  2WVN A;  3RFY A;  3GEI A;  3S9O A;  3AGU A;  5L0C A;  1OCC C;  4LAC B;  4MTF A;  1PD0 A;  2MHR A;  4FX5 A;  3LLK A;  1TWC A;  5L0I A;  3EH1 A;  5HSW A;  3G50 A;  4YK5 A;  2HFI A;  1RKC A;  2HJM A;  3EFO B;  3HNL A;  4QI0 A;  4JJG A;  1E86 A;  3U3B A;  4GEH A;  1BZ4 A;  4IJJ A;  3CSK A;  2WZF A;  5DS4 A;  2KK1 A;  1OKK D;  5F5F A;  2PX0 A;  4FAP B;  3U3F A;  1ORJ A;  5COM A;  2Q7R A;  5KYY A;  3V5X A;  3NMK A;  3ATP A;  3PHF 2;  2GDC A;  3UMK A;  1S7Z A;  2D4U A;  3IPM O;  1OW6 A;  3KKB A;  3UGO A;  3I5Q A;  1MMG A;  3O10 A;  2OG2 A;  1NU7 D;  5L3V A;  4UDV A;  1NU9 C;  3EZH A;  4YL0 A;  4DBQ A;  1ZU4 A;  1LVK A;  3LS1 A;  3V7O A;  2DB4 A;  3WHN A;  1C02 A;  3Q7G A;  1DOW A;  4J30 B;  4KI2 A;  1I4Z A;  3VM6 A;  1WN0 A;  2Z15 A;  1ZHZ A;  3AG3 C;  4U5C E;  1BR4 A;  2A6E F;  2EPO A;  2HSQ A;  2YL0 A;  5B3I A;  2AP3 A;  2ZD9 A;  4MVO A;  4RD9 A;  4CDY A;  2Q9C A;  1M56 C;  2WB7 A;  3EGD A;  1ZHY A;  1LKX A;  1T5O A;  4CJG A;  1A0B A;  2Q4F A;  2UUI A;  5KYY B;  4XQ1 A;  2IOQ A;  3MYF A;  1QKR A;  3IQ5 A;  2KSF A;  3KH2 A;  3MFN A;  4HEA J;  5B1A C;  3POV A;  4MVR A;  3DJN B;  1U0B B;  1ZW3 A;  2HMZ A;  3EJN A;  2QTV A;  4P6I C;  4BJ5 C;  4CDV A;  4Q4Z F;  1H6G A;  1Y6D A;  3JYH A;  4K0D A;  5DQZ A;  4CS7 A;  1H9G A;  1CGO A;  3FHD A;  3LUT B;  3QVZ A;  4CIH A;  5DVW A;  2XXA A;  3CZ6 A;  2NUT A;  3SEO A;  2OEX A;  1QQ3 A;  1LIH A;  2LQG A;  3CAX A;  3QVY A;  1CGM E;  2O9X A;  2YZS A;  3SZR A;  3W2V A;  3EHN A;  1A7D A;  1TWH A;  1RJ9 B;  2XLV A;  3S90 A;  3C8Z A;  3EGD B;  2LIG A;  2G3K A;  2DI3 A;  3B29 A;  1LS1 A;  1JAF A;  3LNR A;  4FWV A;  5DLJ A;  2B0H A;  2W4M A;  3PDM P;  3H65 A;  2KGO A;  3U2M A;  4P9T A;  1Z7Q c;  4MQ9 F;  1EI7 A;  3UNG C;  2L7A A;  4H4K C;  2IYL D;  1YAR O;  2XXA B;  5L0H A;  4E18 A;  2A0B A;  2NUT B;  1LM3 B;  4PJM A;  3SXM A;  1T01 A;  1LS4 A;  2EPK X;  1HMO A;  2KC3 A;  2VB6 A;  2JD3 A;  2YKZ A;  4IGG A;  4YL3 A;  3RVY A;  1C03 A;  1EQ1 A;  3M4B A;  3MX3 A;  2E87 A;  2YLI A;  5E2Q A;  1ZVZ A;  2XM4 A;  1HE1 A;  2WZL A;  4W8K A;  2QUP A;  4AL0 A;  1TKN A;  4BJT A;  3ZQY A;  1OCO C;  4OIO F;  5BUO A;  1PCX A;  3B0V C;  2XS1 A;  3A9C A;  2ICW G;  3FOO A;  3FXH A;  4DJ9 A;  4YL1 A;  3NG1 A;  4RBN A;  4YT4 A;  2FFH A;  4G7H F;  4J7Y A;  4XPX A;  1T9K A;  3JYY A;  3QMK A;  3C18 A;  2LFD A;  3PCV A;  4PFO A;  4CSA A;  2L9J A;  1YJG A;  4Z9H A;  1OXB A;  4IAO A;  4EHP A;  1E83 A;  2PFD A;  4XPW A;  2HUJ A;  4A2N B;  1QLE C;  3N24 A;  2BE5 F;  1GS9 A;  2J7P A;  2Y3D A;  3ABM C;  3B0P A;  1JRA A;  1OW7 A;  4DRH B;  4DXW A;  4D4X A;  5EHH A;  3S28 A;  1C17 M;  2J46 A;  3EH2 A;  1KTM A;  2OJE D;  3GWL A;  3V5Y A;  5KYX A;  1G5Z A;  4CS8 A;  4JTD B;  3FDQ A;  4EKW A;  2HSB A;  2Q3T A;  2EIN C;  2R7X A;  1M2V B;  1ZHT A;  3ECS A; 
#chains in the Genus database with same CATH homology
 1QPU A;  1MQV A;  3DE8 A;  4CIP A;  1CPR A;  3TOL A;  4WGY A;  4N6H A;  3FOP A;  4IAQ A;  3NMI A;  3TOM A;  5JVE A;  2XL8 A;  5JT4 A;  1E86 A;  3HNL A;  5JLI A;  1BBH A;  3HNJ A;  4JEB A;  3VRC A;  1A7V A;  1YYJ A;  3NMK A;  1EKY A;  5JSL A;  2QLA A;  3IQ6 A;  3NMJ A;  4IB4 A;  1YZA A;  2YLD A;  3M79 A;  2YLG A;  2XL6 A;  4U9E A;  3HNI A;  3C62 A;  2YL0 A;  1APC A;  5B3I A;  4CDY A;  1E84 A;  4CJG A;  4ER9 A;  3ZTM A;  2XLH A;  3IQ5 A;  3ZWI A;  4NC3 A;  5JP7 A;  3QW0 A;  1M6T A;  4CDV A;  4CX9 A;  4JEA A;  5JRA A;  1GQA A;  2XLW A;  3QVZ A;  1CGO A;  3HNK A;  3QW1 A;  1QQ3 A;  3QVY A;  2XLD A;  2BC5 A;  5JS5 A;  2XLV A;  3DE9 A;  2XLE A;  2XM0 A;  4N4W A;  1JAF A;  1CPQ A;  4IAR A;  3ZTZ A;  3M4C A;  2J8W A;  2CCY A;  2XLM A;  2YL7 A;  4U9D A;  1LM3 B;  2YL3 A;  2YL1 A;  2YKZ A;  4L6R A;  3M15 A;  1YZC A;  3M4B A;  2YLI A;  3U8P A;  2XM4 A;  1NBB A;  3ZQY A;  4WGZ A;  1YYX A;  3FOO A;  4CDA A;  3C63 A;  2J9B A;  1CGN A;  4ULV A;  4EIY A;  1E83 A;  256B A;  4CJO A;  3L1M A;  2XLO A;  4JKV A;  4D4X A;  4D4N A;  1E85 A;  5JUA A;  1RCP A;  3ZQV A;  5AGF A;  1S05 A;  4JE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...