3DE9A

Crystal structure of a trimeric cytochrome cb562 assembly induced by nickel coordination
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMHDFRHGFDILVGQIHDALHLANEGKVKEAQAAAEQLKTTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Control of protein oligomerization symmetry by metal coordination: C2 and C3 symmetrical assemblies through Cu(II) and Ni(II) coordination.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 47
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2008-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3de9A00
1QPUA 4CIPA 3IQ5A 1YYJA 3HNKA 3NMKA 3IQ6A 3HNLA 3C62A 3ZWIA 3TOLA 3DE8A 1YZAA 4ER9A 4D4XA 4CDVA 1S05A 1M6TA 1CPRA 2YL7A 2YLDA 3NMIA 4WGYA 5JLIA 1APCA 5JRAA 1EKYA 2XL8A 1QQ3A 1NBBA 2XLVA 5AGFA 3FOPA 3C63A 3M79A 1MQVA 256BA 4CDAA 1E83A 3HNJA 5JVEA 4N6HA 3HNIA 4U9DA 2XLDA 3QW0A 4JEBA 1LM3B 2YL1A 1A7VA 1E84A 4EIYA 4WGZA 3ZQYA 1CPQA 2J8WA 3DE9A 2XLWA 5B3IA 3FOOA 1CGOA 4JEAA 2XL6A 2YKZA 4D4NA 4U9EA 1RCPA 4NC3A 3ZQVA 3ZTZA 3VRCA 5JSLA 2XLOA 1BBHA 1YZCA 4CJOA 2YLGA 3M4BA 2XLEA 3TOMA 1JAFA 2YL3A 4JE9A 2XLHA 5JP7A 5JS5A 3QVZA 3QVYA 1E86A 3ZTMA 3L1MA 2QLAA 3M4CA 4JKVA 3QW1A 2YLIA 4L6RA 4IARA 4ULVA 4CX9A 4IB4A 5JT4A 2J9BA 4IAQA 2YL0A 2CCYA 1YYXA 2BC5A 2XM4A 1CGNA 1E85A 2XM0A 3NMJA 1GQAA 4N4WA 2XLMA 3U8PA 4CJGA 3M15A 5JUAA 4CDYA
chains in the Genus database with same CATH superfamily
2MWQA 2UUHA 1QPUA 1OXKA 3I4UA 3T4RA 3AGUA 4CIPA 2LIGA 3HNKA 3SNHA 3NMKA 3W8IA 4AL0A 2R25A 4PFOA 3SYNA 1I4YA 1TWHA 2IOQA 3HNLA 1D1CA 3U2MA 3ZWIA 1YARO 1MMNA 1OXBA 2YHSA 4ER9A 1HW2A 3ZG1A 1T5OA 4CDVA 1OR2A 2WL8A 1JRAA 3EJNA 2H7VC 4XTKA 3AQCA 2DYRC 4C3DA 1HW1A 1R5ID 3ABMC 4JZAA 4CS7A 1T6UA 2AU5A 3B71A 1VTMP 4PK4A 3OEOA 4RBNA 2CDQA 1ZW3A 1M57C 1LS1A 2XLVA 4XWJA 4OINF 4JW1A 1R4TA 4EBBA 1ZHYA 4G7OF 3M79A 3WODF 4A2NB 1K40A 3U3FA 4E18A 1MQVA 2WZGA 1KU2A 1MNEA 1TFKB 1ORYA 2GAQA 4BG0A 1E83A 4XPWA 3ZDLA 4YN0B 5JVEA 2H7OA 1IW7F 1NFOA 2CNWA 2R7OA 3H2UA 4BPMA 2Y69C 3IQTA 2JD3A 2L6FA 2XLDA 5CI8A 1OR3A 4U5DE 2PP4A 4CS8C 4H4KC 2YL1A 4JIOA 3EPVA 4G78A 3NYMA 1E84A 3DMDA 3EG9B 1JOGA 3R2PA 1QLEC 2J0WA 4EIYA 4LLCA 2A68F 3EGXA 3EH2A 1NU7D 2A0UA 3DE9A 3GWLA 2LFDA 4JJGA 3K7DA 3FOOA 2ASRA 4G7ZF 2KSFA 1CGOA 2QNLA 3DM5A 3AG2C 4DBRA 2ZXWC 2UUIA 4I3MA 2XL6A 3UMIA 5BUOA 3U0CA 1BR2A 2L9JA 3DM9B 1LI7A 4U9EA 4Z9HA 5L3VA 2PNOA 4N06A 3ZQVA 4RDAA 2KW3C 4E7SA 2QUPA 3LS0A 4YT8A 1FNTc 2I8BA 2FAPB 2CGEA 3G50A 3EZIA 1VYIA 2XLOA 3HJCA 2NUTA 4CS9C 1WASA 3LEVA 4JTDB 2VB6A 3F46A 3GANA 1PD1A 1YZCA 2IYLD 1G4WR 3RVZA 4CJOA 5KYNA 2I15A 5B1BC 5KYWB 3S29A 4AK9A 2BL2A 1WN0A 2NPUA 4BJ5C 4DVZA 2D4UA 4U5HA 3JCUQ 5L3QA 2HFIA 2XLHA 4JURI 2NSGA 1MMGA 3SXZA 3B29A 4JJFA 2DI3A 1WGWA 2GA0A 2YWAA 2G3KA 1LI5A 1YAUO 3GORA 2C03A 3O55A 3Q7LA 4JVSA 4XEFA 4YT4A 3ZSUA 4P6IC 2Q7RA 2EINC 3L34A 4A4AA 4DOZA 1VOMA 1Z5ZA 5KYUA 3WG7C 3NKEA 4W8KA 3B0UX 4O6MA 3Q6NA 2ZD9A 3KPHA 1YA9A 4BJ6C 4PR9A 3QW1A 4NTFA 4HEAJ 2YVKA 4IARA 1BDJB 1FFTC 4N6CA 2YZSA 2J9WA 5T1DB 2W45A 2H7BA 2A69F 2AWCA 2Q4FA 2Q00A 2BC5A 5KYYA 5L0GA 1I4ZA 4NTBA 1E85A 1GQAA 3QMKA 2XLMA 3CEXA 3U8PA 5K0IA 5FZTA 4LLEA 3TJ6A 2Y3BA 3SEOA 4LDRA 2OEXA 3IHUA 4EKWA 4MQ9F 2EPMX 1FFHA 2OEVA 3S27A 3SXMA 1YYJA 3C7JA 4I1MA 1M56C 2M64A 3RIPA 1JPNA 3DWWA 4MW8A 3L8JA 2HSBA 3GEEA 3TULA 3PMRA 4EWCA 1HE9A 5A6KA 2Y3DA 3JYYA 4NCQA 4Q5SF 1ZYRF 3DE8A 1YZAA 3RW0A 4FX5A 5B1AC 1FTSA 1QSPA 3VF0A 4B6IA 2R7WA 3T6JA 1Z6AA 1UFBA 3K1IA 2PF4E 3FMSA 2YL7A 3RQEA 1YVIA 2HJMA 4WABA 3AG1C 4EBKA 4G0HA 1O87A 1VYKA 3US6A 3GM3A 4FAPB 5JLIA 4P9TA 1HE1A 1M2VB 4CSAC 4AL1A 3LUTB 5JRAA 3JRMO 4CIHA 1EKYA 1JR8A 1QQ3A 3EH1A 5COGA 3GODA 1TWAA 3ASNC 3L0IA 4BEJA 4O6YA 5D91A 4R32A 1RMVA 3RF3A 2IBFA 1OW6A 1TWCA 3MYIA 2V3CC 5F5HA 4DXWA 4QI2A 4K7BA 4XLPF 3KH2A 1ZHTA 5A6AA 1U89A 2A6HF 1LIHA 5DQTA 2Y3GA 1XWJA 4EBJA 2H8AA 2J46A 3GWNA 4OIQF 2P1AA 4MVUA 4MVMA 4MVQA 1OQCA 2GDCA 3EGDA 3TK0A 4I44A 4J32B 1Y6DA 3NYJA 5A6JA 2NUPB 1ST6A 1G4US 1O3UA 1RKEA 3EQLF 1A0BA 3A9CA 3ZQYA 1Q0DA 1YJGA 3F47A 2J8WA 2LSEA 4DBQA 2L7AA 2XSEA 1LPEA 1EI7A 3V5ZA 5DS4A 3S9OA 1NSGB 4Q7CA 2C04A 3B0PA 1BR4A 1QKRA 1Z7Qc 3FDQA 4BJTA 2LD6A 4KI2A 3A11A 4D4NA 1H9TA 1RCPA 3I5QA 4U5BE 2A0BA 5BQGA 1LVKA 1DOVA 2EPKX 2Q9CA 2WVOA 2DYSC 3VYWA 3W2VA 4NTAA 4U5FE 3J06A 4AE4A 4PJLA 1HMDA 1FMWA 2Z15A 1BBHA 1FAPB 2ICWG 1ORJA 1Z23A 4YL3A 1Q0MA 2A1DD 1A7EA 1C02A 3M4BA 5KYXB 3LNRA 2XLEA 3UMKA 3TOMA 3EZHA 4PACA 3C8GB 1CGME 5T3TA 3U8VA 4QI0A 2ETSA 2FGYA 1VLTA 2CW0F 1O5HA 3QVZA 3X2QC 1E86A 1QZXA 4Z9IA 3L1MA 2KK1A 1A41A 3VAYA 4JKVA 4DRJB 3B9QA 1OW7A 1HY5A 2R03A 3DZAA 3K6BA 4KNVA 4DVYP 1RJ9B 3N24A 1YLMA 4IWBA 4NY3A 4PJJA 1OCCC 2YLIA 4OD5A 5E3CA 2VCAA 1SF8A 1JPJA 3MYFA 2KGOA 2R7UA 4ULVA 1E2XA 3UGOA 2XRHA 3UR3C 1D1BA 3HKKA 2R7SA 1ZHZA 2Q9BA 2XS8A 2Q9AA 4QDLA 5L0HA 3EFOB 5D92A 3FAPB 5DQZA 2R7QA 2CCYA 2LCHA 1YYXA 2HS5A 3GEHA 2ZPAA 1EA8A 2XM4A 3K33A 4JTAB 4XEKA 4Z9JA 2HKVA 3NMJA 4CJGA 1ZHWA 3SZRA 1KNYA 3M15A 3OWTA 3RKOF 3KL4A 4H54A 3H65A 2KC3A 3UMHA 5EHHA 5JUAA 5L0CA 4BJ5A 4CDYA 4OIOF 4MW3A 4EHPA 3UNGC 3NDBB 4C7OB 2P0NA 3GEIA 2VCCA 3ZVRA 3MX3A 4J7TA 5CI9A 2ZXPA 2LP4A 3C62A 2TMVP 2X0CA 1ZHXA 1A7DA 1YDIA 2KYHA 4ULWA 2A6EF 1VB5A 4OIPF 4D4XA 1U6HA 1Y4CA 1T6QA 2MHRA 2QY9A 5GPGB 1OKKD 1XZPA 1M6TA 4OD4A 3JSEO 2R7RA 3Q7GA 3E70C 1GS9A 2EPLX 3JSZA 1APCA 4WGYA 2LK4A 2EIKC 2Q3TA 3EG9A 3O10A 3PDMP 2XL8A 2OJQA 2YEVA 1NBBA 1EQ1A 2OOCA 4I1OB 4DRHB 3C18A 3H2VA 2F22A 1V55C 2QTVA 4JC7A 5AGFA 2OU6A 3FOPA 1NU9C 3C63A 3LEOA 4ONSA 4ANJA 5TJ5E 2IXNA 1M2OA 1GM5A 2XL4A 1K05A 2IXMA 3HNJA 3O39A 1YA7O 3IPMO 3HNIA 5E2QA 1BZ4A 4E0IA 1ZU4A 1SR2A 2HMQA 3JYHA 3LESA 3S0XA 1ZVZA 5B3SC 2PFDA 3JTLO 1H9GA 2OCCC 3TD7A 3CZ6A 2D5RB 3V5XA 1Z3IX 3NYLA 2P7VA 3QW0A 4CS8A 1ZU5A 1LM3B 1NFNA 2E87A 1A7VA 2XS1A 3DD7A 1F1MA 1VLSA 1J8MF 2ZXOA 2X51A 5KYWA 3RVYA 1CPQA 2NSFA 4IAOA 2XLWA 1PCXA 1B68A 3CSKA 4FWVA 5B3IA 1U0BB 3EHMA 4IGGA 3EHNA 2EILC 4ZLDA 1TQGA 1C17M 4HFKB 3U9MA 3HLZA 4CBEA 2YKZA 1D1AA 3U3BA 4YJWA 1BR1A 2R02A 1TFOB 2OQMA 1D0XA 3DJUB 3ATPA 1TWGA 5JSLA 5CIVA 4RD9A 4IJJA 2VASA 4LDKA 3WHNA 3AG4C 5JS5A 1VK5A 3LNMB 3LS1A 3ABKC 1GGQA 3NG1A 1S7ZA 5COFA 3GM2A 3OA1A 2YLGA 3N2ZB 3K1HA 3IQCA 1G5ZA 3EGXB 2EIMC 3ABLC 4GYTA 4ZLCA 4YT5A 4JE9A 4O7GA 1HMOA 1Q0FA 2AP3A 2KNHA 4AX2A 2EPNA 2JPUA 3JT1A 1V4AA 2RSEB 3SXKA 2YRFA 1ORSC 4OIRF 4LDQA 4PJNA 4LERA 2HSQA 2J9UA 2VCBA 3O6XA 2LQGA 4MS2A 4GQHA 5A6BD 3LJBA 2L81A 2L6GA 2IXOA 3FAJA 3PCVA 4HFFB 5DVWA 2NUTB 3FHDA 3FXHA 4K0DA 4XPXA 4BJ6A 4L6RA 2Y39A 2HJ3A 3KMIA 4YK5A 5COMA 4P9FA 1K04A 2DGJA 3B0VC 4W8PA 4IB4A 5JT4A 4JCHA 1TKNA 1XZQA 2O9XA 2WVQA 4PJMA 2JX0A 1I5NA 2J9BA 3AQBA 3JRTA 2XXAA 1Q0KA 1SYQA 1WOLA 4IAQA 2YL0A 4FESA 2HV6A 2XXAB 1ZW2A 2Y3HA 2CYDA 4MTGA 3QZCA 2LFFA 1M2VA 1N1CA 2W4MA 4PFPA 4J7YA 1UG7A 2B0HA 1OW8A 4HE8D 4JCZA 4JTCB 2V26A 4KNWA 5KYUB 2J7PD 4BJ1A 3IQ5A 4F4BA 1VMAA 1JMWA 3KYIA 3MBGA 1KTMA 1WWPA 2L6HA 3NKDA 1H7IA 3IQ6A 4U5CE 3RQFA 3V7OA 3TOLA 4C3BA 1OKKA 2VC9A 2HMZA 1H6GA 4EUKB 1S05A 4U5EE 3K1IC 5L0IA 2EIJC 1LE2A 4XLNF 1CPRA 2YLDA 4MNDA 2QE9A 3RFYA 5KYYB 4G7HF 3GM1A 3ASOC 1WTYA 3NMIA 5HV9A 1OCOC 2NUPA 4CSAA 3DKAA 2B0JA 4O6NA 2EPOA 5IY5C 3TJ5A 5L0JA 1LKXA 1D0ZA 2FFHA 3AGTA 3I5PA 4O79A 1ZZPA 3ITFA 3KKBA 4XEVA 3R7CA 1MMAA 1OCZC 3S28A 2G62A 3T6BA 5FCLA 4IRUA 2KQ9A 4MTFA 3SXYA 2VH3A 1OCRC 256BA 2IXPA 2NG1A 3FVYA 3K66A 4GEHA 4CDAA 1RKCA 4N6HA 4KBLA 2WB7A 2R05A 3BRJA 4U9DA 5DS6A 1Z63A 2R7VA 2CNWD 1AVOB 1NG1A 3DJNB 3MFNA 4DJ9A 4E7ZA 3S90A 4JEBA 1L7CA 1LE4A 4DRIB 3DXJF 3G4XA 1DOWA 3CQZA 3T9OA 3ZC4A 1WATA 1W2WA 1D0YA 1MMDA 3HTKC 4KC9A 2KJGA 1PV3A 2RD9A 5E33A 3POVA 4WGZA 2YQYA 2ZXRA 3TQOA 5KYXA 3C8GA 4MTOA 3DI5A 2R7TA 2IM8A 5L0DA 3VM6A 2HZ8A 2PBEA 3AJMA 3CAXA 1AEPA 4JEAA 2BE5F 3BEHA 3E9VA 3DAFA 1T01A 4YL0A 3LLKA 3U2LA 3W4YA 2OJED 1T9KA 3MLGA 4NC3A 4UDVA 3AG3C 2AWYA 4YL1A 3LLIA 3VRCA 3ZTZA 4XQ1A 2R7XA 5DLJA 3EGDB 1Q0GA 2MYSA 5EK0A 1PD0A 1RJ9A 3SP1A 3DAGA 4JRZA 5A69A 3PHF2 1MNDA 2W4BA 3G4ZA 2P61A 3L8IA 1RKEB 5F5FA 1C03A 5BQIA 1LS4A 1FR0A 3AOUA 5T3WA 5DS5A 3EFOA 3LAYA 4M63A 3T6GB 3W2WA 1RXQA 5HSWA 3UGPA 1JAFA 2WVNA 2YL3A 2OKUA 1NLXA 5JP7A 5AC4A 3KYJA 5L0FA 3RH3A 3QVYA 5BQHA 3IEEA 3ECSA 4X0RA 3ZTMA 1TR2A 2HV7A 2J45A 2PX0A 5E3AA 5AC5A 5A6BA 2DB4A 2J0XA 2QLAA 3C8GD 3M4CA 2GFHA 3NRHA 3V5YA 2P6VA 1G8XA 4E17A 4XPYA 4MVRA 4C7OA 2M4EA 3JZ0A 4MVZA 4E0HA 2J9VA 4AE4B 2R9RB 3RYLA 4U5GA 4WJ0A 1FMVA 3U9JA 4BEMJ 3C8ZA 3QTHA 4Q4ZF 3RQGA 2GWWA 4MVOA 3ZIBA 2W9YA 1IZMA 4NQFA 4CS9A 4CX9A 3M1CB 1SZIA 4K1OA 2PX3A 1NZEA 1V54C 3W8HA 2WZLA 2G3VA 2HUJA 4LACB 4C3EA 1CGNA 3WAQA 1SMYF 3U5SA 1QVXA 2WZFA 1L3PA 2XM0A 4N4WA 3X1OA 4YT2A 4J30B 5EGYA 1T6IA 4MVSA 3N0TA 1J8YF 2J7PA 1AUEA 5F28E 2OG2A 3Q6MA 3S84A 1V74B 4YWQA 2AVKA
chains in the Genus database with same CATH topology
1QPUA 4CIPA 3IQ5A 1YYJA 3HNKA 3NMKA 3IQ6A 3HNLA 3C62A 3ZWIA 3TOLA 3DE8A 1YZAA 4ER9A 4D4XA 4CDVA 1S05A 1M6TA 1CPRA 2YL7A 2YLDA 3NMIA 4WGYA 5JLIA 1APCA 5JRAA 1EKYA 2XL8A 1QQ3A 1NBBA 2XLVA 5AGFA 3FOPA 3C63A 3M79A 1MQVA 256BA 4CDAA 1E83A 3HNJA 5JVEA 4N6HA 3HNIA 4U9DA 2XLDA 3QW0A 4JEBA 1LM3B 2YL1A 1A7VA 1E84A 4EIYA 4WGZA 3ZQYA 1CPQA 2J8WA 3DE9A 2XLWA 5B3IA 3FOOA 1CGOA 4JEAA 2XL6A 2YKZA 4D4NA 4U9EA 1RCPA 4NC3A 3ZQVA 3ZTZA 3VRCA 5JSLA 2XLOA 1BBHA 1YZCA 4CJOA 2YLGA 3M4BA 2XLEA 3TOMA 1JAFA 2YL3A 4JE9A 2XLHA 5JP7A 5JS5A 3QVZA 3QVYA 1E86A 3ZTMA 3L1MA 2QLAA 3M4CA 4JKVA 3QW1A 2YLIA 4L6RA 4IARA 4ULVA 4CX9A 4IB4A 5JT4A 2J9BA 4IAQA 2YL0A 2CCYA 1YYXA 2BC5A 2XM4A 1CGNA 1E85A 2XM0A 3NMJA 1GQAA 4N4WA 2XLMA 3U8PA 4CJGA 3M15A 5JUAA 4CDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPU A;  4CIP A;  3IQ5 A;  1YYJ A;  3HNK A;  3NMK A;  3IQ6 A;  3HNL A;  3C62 A;  3ZWI A;  3TOL A;  3DE8 A;  1YZA A;  4ER9 A;  4D4X A;  4CDV A;  1S05 A;  1M6T A;  1CPR A;  2YL7 A;  2YLD A;  3NMI A;  4WGY A;  5JLI A;  1APC A;  5JRA A;  1EKY A;  2XL8 A;  1QQ3 A;  1NBB A;  2XLV A;  5AGF A;  3FOP A;  3C63 A;  3M79 A;  1MQV A;  256B A;  4CDA A;  1E83 A;  3HNJ A;  5JVE A;  4N6H A;  3HNI A;  4U9D A;  2XLD A;  3QW0 A;  4JEB A;  1LM3 B;  2YL1 A;  1A7V A;  1E84 A;  4EIY A;  4WGZ A;  3ZQY A;  1CPQ A;  2J8W A;  3DE9 A;  2XLW A;  5B3I A;  3FOO A;  1CGO A;  4JEA A;  2XL6 A;  2YKZ A;  4D4N A;  4U9E A;  1RCP A;  4NC3 A;  3ZQV A;  3ZTZ A;  3VRC A;  5JSL A;  2XLO A;  1BBH A;  1YZC A;  4CJO A;  2YLG A;  3M4B A;  2XLE A;  3TOM A;  1JAF A;  2YL3 A;  4JE9 A;  2XLH A;  5JP7 A;  5JS5 A;  3QVZ A;  3QVY A;  1E86 A;  3ZTM A;  3L1M A;  2QLA A;  3M4C A;  4JKV A;  3QW1 A;  2YLI A;  4L6R A;  4IAR A;  4ULV A;  4CX9 A;  4IB4 A;  5JT4 A;  2J9B A;  4IAQ A;  2YL0 A;  2CCY A;  1YYX A;  2BC5 A;  2XM4 A;  1CGN A;  1E85 A;  2XM0 A;  3NMJ A;  1GQA A;  4N4W A;  2XLM A;  3U8P A;  4CJG A;  3M15 A;  5JUA A;  4CDY A; 
#chains in the Genus database with same CATH topology
 2MWQ A;  2UUH A;  1QPU A;  1OXK A;  3I4U A;  3T4R A;  3AGU A;  4CIP A;  2LIG A;  3HNK A;  3SNH A;  3NMK A;  3W8I A;  4AL0 A;  2R25 A;  4PFO A;  3SYN A;  1I4Y A;  1TWH A;  2IOQ A;  3HNL A;  1D1C A;  3U2M A;  3ZWI A;  1YAR O;  1MMN A;  1OXB A;  2YHS A;  4ER9 A;  1HW2 A;  3ZG1 A;  1T5O A;  4CDV A;  1OR2 A;  2WL8 A;  1JRA A;  3EJN A;  2H7V C;  4XTK A;  3AQC A;  2DYR C;  4C3D A;  1HW1 A;  1R5I D;  3ABM C;  4JZA A;  4CS7 A;  1T6U A;  2AU5 A;  3B71 A;  1VTM P;  4PK4 A;  3OEO A;  4RBN A;  2CDQ A;  1ZW3 A;  1M57 C;  1LS1 A;  2XLV A;  4XWJ A;  4OIN F;  4JW1 A;  1R4T A;  4EBB A;  1ZHY A;  4G7O F;  3M79 A;  3WOD F;  4A2N B;  1K40 A;  3U3F A;  4E18 A;  1MQV A;  2WZG A;  1KU2 A;  1MNE A;  1TFK B;  1ORY A;  2GAQ A;  4BG0 A;  1E83 A;  4XPW A;  3ZDL A;  4YN0 B;  5JVE A;  2H7O A;  1IW7 F;  1NFO A;  2CNW A;  2R7O A;  3H2U A;  4BPM A;  2Y69 C;  3IQT A;  2JD3 A;  2L6F A;  2XLD A;  5CI8 A;  1OR3 A;  4U5D E;  2PP4 A;  4CS8 C;  4H4K C;  2YL1 A;  4JIO A;  3EPV A;  4G78 A;  3NYM A;  1E84 A;  3DMD A;  3EG9 B;  1JOG A;  3R2P A;  1QLE C;  2J0W A;  4EIY A;  4LLC A;  2A68 F;  3EGX A;  3EH2 A;  1NU7 D;  2A0U A;  3DE9 A;  3GWL A;  2LFD A;  4JJG A;  3K7D A;  3FOO A;  2ASR A;  4G7Z F;  2KSF A;  1CGO A;  2QNL A;  3DM5 A;  3AG2 C;  4DBR A;  2ZXW C;  2UUI A;  4I3M A;  2XL6 A;  3UMI A;  5BUO A;  3U0C A;  1BR2 A;  2L9J A;  3DM9 B;  1LI7 A;  4U9E A;  4Z9H A;  5L3V A;  2PNO A;  4N06 A;  3ZQV A;  4RDA A;  2KW3 C;  4E7S A;  2QUP A;  3LS0 A;  4YT8 A;  1FNT c;  2I8B A;  2FAP B;  2CGE A;  3G50 A;  3EZI A;  1VYI A;  2XLO A;  3HJC A;  2NUT A;  4CS9 C;  1WAS A;  3LEV A;  4JTD B;  2VB6 A;  3F46 A;  3GAN A;  1PD1 A;  1YZC A;  2IYL D;  1G4W R;  3RVZ A;  4CJO A;  5KYN A;  2I15 A;  5B1B C;  5KYW B;  3S29 A;  4AK9 A;  2BL2 A;  1WN0 A;  2NPU A;  4BJ5 C;  4DVZ A;  2D4U A;  4U5H A;  3JCU Q;  5L3Q A;  2HFI A;  2XLH A;  4JUR I;  2NSG A;  1MMG A;  3SXZ A;  3B29 A;  4JJF A;  2DI3 A;  1WGW A;  2GA0 A;  2YWA A;  2G3K A;  1LI5 A;  1YAU O;  3GOR A;  2C03 A;  3O55 A;  3Q7L A;  4JVS A;  4XEF A;  4YT4 A;  3ZSU A;  4P6I C;  2Q7R A;  2EIN C;  3L34 A;  4A4A A;  4DOZ A;  1VOM A;  1Z5Z A;  5KYU A;  3WG7 C;  3NKE A;  4W8K A;  3B0U X;  4O6M A;  3Q6N A;  2ZD9 A;  3KPH A;  1YA9 A;  4BJ6 C;  4PR9 A;  3QW1 A;  4NTF A;  4HEA J;  2YVK A;  4IAR A;  1BDJ B;  1FFT C;  4N6C A;  2YZS A;  2J9W A;  5T1D B;  2W45 A;  2H7B A;  2A69 F;  2AWC A;  2Q4F A;  2Q00 A;  2BC5 A;  5KYY A;  5L0G A;  1I4Z A;  4NTB A;  1E85 A;  1GQA A;  3QMK A;  2XLM A;  3CEX A;  3U8P A;  5K0I A;  5FZT A;  4LLE A;  3TJ6 A;  2Y3B A;  3SEO A;  4LDR A;  2OEX A;  3IHU A;  4EKW A;  4MQ9 F;  2EPM X;  1FFH A;  2OEV A;  3S27 A;  3SXM A;  1YYJ A;  3C7J A;  4I1M A;  1M56 C;  2M64 A;  3RIP A;  1JPN A;  3DWW A;  4MW8 A;  3L8J A;  2HSB A;  3GEE A;  3TUL A;  3PMR A;  4EWC A;  1HE9 A;  5A6K A;  2Y3D A;  3JYY A;  4NCQ A;  4Q5S F;  1ZYR F;  3DE8 A;  1YZA A;  3RW0 A;  4FX5 A;  5B1A C;  1FTS A;  1QSP A;  3VF0 A;  4B6I A;  2R7W A;  3T6J A;  1Z6A A;  1UFB A;  3K1I A;  2PF4 E;  3FMS A;  2YL7 A;  3RQE A;  1YVI A;  2HJM A;  4WAB A;  3AG1 C;  4EBK A;  4G0H A;  1O87 A;  1VYK A;  3US6 A;  3GM3 A;  4FAP B;  5JLI A;  4P9T A;  1HE1 A;  1M2V B;  4CSA C;  4AL1 A;  3LUT B;  5JRA A;  3JRM O;  4CIH A;  1EKY A;  1JR8 A;  1QQ3 A;  3EH1 A;  5COG A;  3GOD A;  1TWA A;  3ASN C;  3L0I A;  4BEJ A;  4O6Y A;  5D91 A;  4R32 A;  1RMV A;  3RF3 A;  2IBF A;  1OW6 A;  1TWC A;  3MYI A;  2V3C C;  5F5H A;  4DXW A;  4QI2 A;  4K7B A;  4XLP F;  3KH2 A;  1ZHT A;  5A6A A;  1U89 A;  2A6H F;  1LIH A;  5DQT A;  2Y3G A;  1XWJ A;  4EBJ A;  2H8A A;  2J46 A;  3GWN A;  4OIQ F;  2P1A A;  4MVU A;  4MVM A;  4MVQ A;  1OQC A;  2GDC A;  3EGD A;  3TK0 A;  4I44 A;  4J32 B;  1Y6D A;  3NYJ A;  5A6J A;  2NUP B;  1ST6 A;  1G4U S;  1O3U A;  1RKE A;  3EQL F;  1A0B A;  3A9C A;  3ZQY A;  1Q0D A;  1YJG A;  3F47 A;  2J8W A;  2LSE A;  4DBQ A;  2L7A A;  2XSE A;  1LPE A;  1EI7 A;  3V5Z A;  5DS4 A;  3S9O A;  1NSG B;  4Q7C A;  2C04 A;  3B0P A;  1BR4 A;  1QKR A;  1Z7Q c;  3FDQ A;  4BJT A;  2LD6 A;  4KI2 A;  3A11 A;  4D4N A;  1H9T A;  1RCP A;  3I5Q A;  4U5B E;  2A0B A;  5BQG A;  1LVK A;  1DOV A;  2EPK X;  2Q9C A;  2WVO A;  2DYS C;  3VYW A;  3W2V A;  4NTA A;  4U5F E;  3J06 A;  4AE4 A;  4PJL A;  1HMD A;  1FMW A;  2Z15 A;  1BBH A;  1FAP B;  2ICW G;  1ORJ A;  1Z23 A;  4YL3 A;  1Q0M A;  2A1D D;  1A7E A;  1C02 A;  3M4B A;  5KYX B;  3LNR A;  2XLE A;  3UMK A;  3TOM A;  3EZH A;  4PAC A;  3C8G B;  1CGM E;  5T3T A;  3U8V A;  4QI0 A;  2ETS A;  2FGY A;  1VLT A;  2CW0 F;  1O5H A;  3QVZ A;  3X2Q C;  1E86 A;  1QZX A;  4Z9I A;  3L1M A;  2KK1 A;  1A41 A;  3VAY A;  4JKV A;  4DRJ B;  3B9Q A;  1OW7 A;  1HY5 A;  2R03 A;  3DZA A;  3K6B A;  4KNV A;  4DVY P;  1RJ9 B;  3N24 A;  1YLM A;  4IWB A;  4NY3 A;  4PJJ A;  1OCC C;  2YLI A;  4OD5 A;  5E3C A;  2VCA A;  1SF8 A;  1JPJ A;  3MYF A;  2KGO A;  2R7U A;  4ULV A;  1E2X A;  3UGO A;  2XRH A;  3UR3 C;  1D1B A;  3HKK A;  2R7S A;  1ZHZ A;  2Q9B A;  2XS8 A;  2Q9A A;  4QDL A;  5L0H A;  3EFO B;  5D92 A;  3FAP B;  5DQZ A;  2R7Q A;  2CCY A;  2LCH A;  1YYX A;  2HS5 A;  3GEH A;  2ZPA A;  1EA8 A;  2XM4 A;  3K33 A;  4JTA B;  4XEK A;  4Z9J A;  2HKV A;  3NMJ A;  4CJG A;  1ZHW A;  3SZR A;  1KNY A;  3M15 A;  3OWT A;  3RKO F;  3KL4 A;  4H54 A;  3H65 A;  2KC3 A;  3UMH A;  5EHH A;  5JUA A;  5L0C A;  4BJ5 A;  4CDY A;  4OIO F;  4MW3 A;  4EHP A;  3UNG C;  3NDB B;  4C7O B;  2P0N A;  3GEI A;  2VCC A;  3ZVR A;  3MX3 A;  4J7T A;  5CI9 A;  2ZXP A;  2LP4 A;  3C62 A;  2TMV P;  2X0C A;  1ZHX A;  1A7D A;  1YDI A;  2KYH A;  4ULW A;  2A6E F;  1VB5 A;  4OIP F;  4D4X A;  1U6H A;  1Y4C A;  1T6Q A;  2MHR A;  2QY9 A;  5GPG B;  1OKK D;  1XZP A;  1M6T A;  4OD4 A;  3JSE O;  2R7R A;  3Q7G A;  3E70 C;  1GS9 A;  2EPL X;  3JSZ A;  1APC A;  4WGY A;  2LK4 A;  2EIK C;  2Q3T A;  3EG9 A;  3O10 A;  3PDM P;  2XL8 A;  2OJQ A;  2YEV A;  1NBB A;  1EQ1 A;  2OOC A;  4I1O B;  4DRH B;  3C18 A;  3H2V A;  2F22 A;  1V55 C;  2QTV A;  4JC7 A;  5AGF A;  2OU6 A;  3FOP A;  1NU9 C;  3C63 A;  3LEO A;  4ONS A;  4ANJ A;  5TJ5 E;  2IXN A;  1M2O A;  1GM5 A;  2XL4 A;  1K05 A;  2IXM A;  3HNJ A;  3O39 A;  1YA7 O;  3IPM O;  3HNI A;  5E2Q A;  1BZ4 A;  4E0I A;  1ZU4 A;  1SR2 A;  2HMQ A;  3JYH A;  3LES A;  3S0X A;  1ZVZ A;  5B3S C;  2PFD A;  3JTL O;  1H9G A;  2OCC C;  3TD7 A;  3CZ6 A;  2D5R B;  3V5X A;  1Z3I X;  3NYL A;  2P7V A;  3QW0 A;  4CS8 A;  1ZU5 A;  1LM3 B;  1NFN A;  2E87 A;  1A7V A;  2XS1 A;  3DD7 A;  1F1M A;  1VLS A;  1J8M F;  2ZXO A;  2X51 A;  5KYW A;  3RVY A;  1CPQ A;  2NSF A;  4IAO A;  2XLW A;  1PCX A;  1B68 A;  3CSK A;  4FWV A;  5B3I A;  1U0B B;  3EHM A;  4IGG A;  3EHN A;  2EIL C;  4ZLD A;  1TQG A;  1C17 M;  4HFK B;  3U9M A;  3HLZ A;  4CBE A;  2YKZ A;  1D1A A;  3U3B A;  4YJW A;  1BR1 A;  2R02 A;  1TFO B;  2OQM A;  1D0X A;  3DJU B;  3ATP A;  1TWG A;  5JSL A;  5CIV A;  4RD9 A;  4IJJ A;  2VAS A;  4LDK A;  3WHN A;  3AG4 C;  5JS5 A;  1VK5 A;  3LNM B;  3LS1 A;  3ABK C;  1GGQ A;  3NG1 A;  1S7Z A;  5COF A;  3GM2 A;  3OA1 A;  2YLG A;  3N2Z B;  3K1H A;  3IQC A;  1G5Z A;  3EGX B;  2EIM C;  3ABL C;  4GYT A;  4ZLC A;  4YT5 A;  4JE9 A;  4O7G A;  1HMO A;  1Q0F A;  2AP3 A;  2KNH A;  4AX2 A;  2EPN A;  2JPU A;  3JT1 A;  1V4A A;  2RSE B;  3SXK A;  2YRF A;  1ORS C;  4OIR F;  4LDQ A;  4PJN A;  4LER A;  2HSQ A;  2J9U A;  2VCB A;  3O6X A;  2LQG A;  4MS2 A;  4GQH A;  5A6B D;  3LJB A;  2L81 A;  2L6G A;  2IXO A;  3FAJ A;  3PCV A;  4HFF B;  5DVW A;  2NUT B;  3FHD A;  3FXH A;  4K0D A;  4XPX A;  4BJ6 A;  4L6R A;  2Y39 A;  2HJ3 A;  3KMI A;  4YK5 A;  5COM A;  4P9F A;  1K04 A;  2DGJ A;  3B0V C;  4W8P A;  4IB4 A;  5JT4 A;  4JCH A;  1TKN A;  1XZQ A;  2O9X A;  2WVQ A;  4PJM A;  2JX0 A;  1I5N A;  2J9B A;  3AQB A;  3JRT A;  2XXA A;  1Q0K A;  1SYQ A;  1WOL A;  4IAQ A;  2YL0 A;  4FES A;  2HV6 A;  2XXA B;  1ZW2 A;  2Y3H A;  2CYD A;  4MTG A;  3QZC A;  2LFF A;  1M2V A;  1N1C A;  2W4M A;  4PFP A;  4J7Y A;  1UG7 A;  2B0H A;  1OW8 A;  4HE8 D;  4JCZ A;  4JTC B;  2V26 A;  4KNW A;  5KYU B;  2J7P D;  4BJ1 A;  3IQ5 A;  4F4B A;  1VMA A;  1JMW A;  3KYI A;  3MBG A;  1KTM A;  1WWP A;  2L6H A;  3NKD A;  1H7I A;  3IQ6 A;  4U5C E;  3RQF A;  3V7O A;  3TOL A;  4C3B A;  1OKK A;  2VC9 A;  2HMZ A;  1H6G A;  4EUK B;  1S05 A;  4U5E E;  3K1I C;  5L0I A;  2EIJ C;  1LE2 A;  4XLN F;  1CPR A;  2YLD A;  4MND A;  2QE9 A;  3RFY A;  5KYY B;  4G7H F;  3GM1 A;  3ASO C;  1WTY A;  3NMI A;  5HV9 A;  1OCO C;  2NUP A;  4CSA A;  3DKA A;  2B0J A;  4O6N A;  2EPO A;  5IY5 C;  3TJ5 A;  5L0J A;  1LKX A;  1D0Z A;  2FFH A;  3AGT A;  3I5P A;  4O79 A;  1ZZP A;  3ITF A;  3KKB A;  4XEV A;  3R7C A;  1MMA A;  1OCZ C;  3S28 A;  2G62 A;  3T6B A;  5FCL A;  4IRU A;  2KQ9 A;  4MTF A;  3SXY A;  2VH3 A;  1OCR C;  256B A;  2IXP A;  2NG1 A;  3FVY A;  3K66 A;  4GEH A;  4CDA A;  1RKC A;  4N6H A;  4KBL A;  2WB7 A;  2R05 A;  3BRJ A;  4U9D A;  5DS6 A;  1Z63 A;  2R7V A;  2CNW D;  1AVO B;  1NG1 A;  3DJN B;  3MFN A;  4DJ9 A;  4E7Z A;  3S90 A;  4JEB A;  1L7C A;  1LE4 A;  4DRI B;  3DXJ F;  3G4X A;  1DOW A;  3CQZ A;  3T9O A;  3ZC4 A;  1WAT A;  1W2W A;  1D0Y A;  1MMD A;  3HTK C;  4KC9 A;  2KJG A;  1PV3 A;  2RD9 A;  5E33 A;  3POV A;  4WGZ A;  2YQY A;  2ZXR A;  3TQO A;  5KYX A;  3C8G A;  4MTO A;  3DI5 A;  2R7T A;  2IM8 A;  5L0D A;  3VM6 A;  2HZ8 A;  2PBE A;  3AJM A;  3CAX A;  1AEP A;  4JEA A;  2BE5 F;  3BEH A;  3E9V A;  3DAF A;  1T01 A;  4YL0 A;  3LLK A;  3U2L A;  3W4Y A;  2OJE D;  1T9K A;  3MLG A;  4NC3 A;  4UDV A;  3AG3 C;  2AWY A;  4YL1 A;  3LLI A;  3VRC A;  3ZTZ A;  4XQ1 A;  2R7X A;  5DLJ A;  3EGD B;  1Q0G A;  2MYS A;  5EK0 A;  1PD0 A;  1RJ9 A;  3SP1 A;  3DAG A;  4JRZ A;  5A69 A;  3PHF 2;  1MND A;  2W4B A;  3G4Z A;  2P61 A;  3L8I A;  1RKE B;  5F5F A;  1C03 A;  5BQI A;  1LS4 A;  1FR0 A;  3AOU A;  5T3W A;  5DS5 A;  3EFO A;  3LAY A;  4M63 A;  3T6G B;  3W2W A;  1RXQ A;  5HSW A;  3UGP A;  1JAF A;  2WVN A;  2YL3 A;  2OKU A;  1NLX A;  5JP7 A;  5AC4 A;  3KYJ A;  5L0F A;  3RH3 A;  3QVY A;  5BQH A;  3IEE A;  3ECS A;  4X0R A;  3ZTM A;  1TR2 A;  2HV7 A;  2J45 A;  2PX0 A;  5E3A A;  5AC5 A;  5A6B A;  2DB4 A;  2J0X A;  2QLA A;  3C8G D;  3M4C A;  2GFH A;  3NRH A;  3V5Y A;  2P6V A;  1G8X A;  4E17 A;  4XPY A;  4MVR A;  4C7O A;  2M4E A;  3JZ0 A;  4MVZ A;  4E0H A;  2J9V A;  4AE4 B;  2R9R B;  3RYL A;  4U5G A;  4WJ0 A;  1FMV A;  3U9J A;  4BEM J;  3C8Z A;  3QTH A;  4Q4Z F;  3RQG A;  2GWW A;  4MVO A;  3ZIB A;  2W9Y A;  1IZM A;  4NQF A;  4CS9 A;  4CX9 A;  3M1C B;  1SZI A;  4K1O A;  2PX3 A;  1NZE A;  1V54 C;  3W8H A;  2WZL A;  2G3V A;  2HUJ A;  4LAC B;  4C3E A;  1CGN A;  3WAQ A;  1SMY F;  3U5S A;  1QVX A;  2WZF A;  1L3P A;  2XM0 A;  4N4W A;  3X1O A;  4YT2 A;  4J30 B;  5EGY A;  1T6I A;  4MVS A;  3N0T A;  1J8Y F;  2J7P A;  1AUE A;  5F28 E;  2OG2 A;  3Q6M A;  3S84 A;  1V74 B;  4YWQ A;  2AVK A; 
#chains in the Genus database with same CATH homology
 1QPU A;  4CIP A;  3IQ5 A;  1YYJ A;  3HNK A;  3NMK A;  3IQ6 A;  3HNL A;  3C62 A;  3ZWI A;  3TOL A;  3DE8 A;  1YZA A;  4ER9 A;  4D4X A;  4CDV A;  1S05 A;  1M6T A;  1CPR A;  2YL7 A;  2YLD A;  3NMI A;  4WGY A;  5JLI A;  1APC A;  5JRA A;  1EKY A;  2XL8 A;  1QQ3 A;  1NBB A;  2XLV A;  5AGF A;  3FOP A;  3C63 A;  3M79 A;  1MQV A;  256B A;  4CDA A;  1E83 A;  3HNJ A;  5JVE A;  4N6H A;  3HNI A;  4U9D A;  2XLD A;  3QW0 A;  4JEB A;  1LM3 B;  2YL1 A;  1A7V A;  1E84 A;  4EIY A;  4WGZ A;  3ZQY A;  1CPQ A;  2J8W A;  3DE9 A;  2XLW A;  5B3I A;  3FOO A;  1CGO A;  4JEA A;  2XL6 A;  2YKZ A;  4D4N A;  4U9E A;  1RCP A;  4NC3 A;  3ZQV A;  3ZTZ A;  3VRC A;  5JSL A;  2XLO A;  1BBH A;  1YZC A;  4CJO A;  2YLG A;  3M4B A;  2XLE A;  3TOM A;  1JAF A;  2YL3 A;  4JE9 A;  2XLH A;  5JP7 A;  5JS5 A;  3QVZ A;  3QVY A;  1E86 A;  3ZTM A;  3L1M A;  2QLA A;  3M4C A;  4JKV A;  3QW1 A;  2YLI A;  4L6R A;  4IAR A;  4ULV A;  4CX9 A;  4IB4 A;  5JT4 A;  2J9B A;  4IAQ A;  2YL0 A;  2CCY A;  1YYX A;  2BC5 A;  2XM4 A;  1CGN A;  1E85 A;  2XM0 A;  3NMJ A;  1GQA A;  4N4W A;  2XLM A;  3U8P A;  4CJG A;  3M15 A;  5JUA A;  4CDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...