4QI2A

X-ray structure of the roq domain from murine roquin-1 in complex with a 23-mer tnf-cde rna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
153
Chain Sequence
HQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords Roquin-1
publication title Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4qi2A00
4YWQA 4ULWA 4QI0A 3X1OA 4QI2A 5F5HA 4ZLCA 5F5FA 4ZLDA
chains in the Genus database with same CATH superfamily
1Q0FA 1YAUO 2X51A 3HNJA 3K1IA 2J7PA 3EFOB 1WASA 1O87A 4CJOA 3CQZA 1Q0MA 4PACA 4E7ZA 3GORA 2HZ8A 4E0HA 2TMVP 3RQFA 1YARO 3V5XA 3FAPB 1OKKD 1NU7D 3V7OA 2HSBA 2E87A 4ULVA 5DVWA 4AL1A 1ZHYA 2XLVA 3VAYA 5A6JA 1V54C 3C7JA 3DKAA 3R2PA 4A4AA 3U2LA 5JT4A 3T4RA 4EUKB 1SR2A 1ZHTA 1MNEA 1APCA 2LP4A 3DXJF 4E7SA 1JPJA 4LLCA 5KYUB 2YL3A 256BA 2EPLX 2GA0A 1JPNA 1MQVA 4BEJA 2XSEA 1T6IA 4HE8D 3TOMA 4FX5A 2J0WA 4XEFA 3WODF 1K40A 4YT8A 3DD7A 3G4XA 4NTFA 1AUEA 1MNDA 4AE4B 1RCPA 3C8GA 4MTGA 4PJJA 3JYYA 2J8WA 4Z9HA 1FFHA 1HW2A 2Y39A 2UUIA 4Q7CA 3AGUA 1ZVZA 3IPMO 1WTYA 2WZLA 4BG0A 3T6BA 4U5CE 4DBQA 2Q9CA 1CGME 3L8IA 1D0ZA 4CS7A 2L7AA 2OQMA 5DQTA 1NU9C 4JVSA 3LUTB 1V55C 4XTKA 5JVEA 2R7QA 2L6GA 3ZDLA 2KSFA 2EINC 2KNHA 5DLJA 2G3VA 3NKDA 4U9EA 3W8HA 1U0BB 1G4US 3EQLF 2R02A 3GODA 1PD0A 3ZTZA 1ORSC 4NTAA 3S28A 3O39A 3O55A 2CNWA 4NTBA 3GM2A 4C7OA 3O6XA 3ATPA 1R4TA 5DQZA 3MLGA 1RJ9A 3X2QC 1LKXA 5D92A 1TFOB 4JEAA 4JC7A 4G7HF 1B68A 1OR3A 5L0GA 1XWJA 2LQGA 4CS8A 2V3CC 1E85A 4QI2A 1NLXA 2R9RB 4IWBA 3EGXB 4K7BA 4UDVA 4FESA 4H4KC 1OKKA 1OW8A 1ZU4A 2L9JA 2MWQA 5KYXB 3F47A 1ST6A 3NKEA 4H54A 1MMAA 1M2VA 1TWHA 1NBBA 2XLDA 3DJUB 4HFFB 4IARA 4LDQA 3LJBA 5E3CA 1Z63A 4MVOA 1H9TA 4QI0A 3FOPA 3DAFA 1OQCA 2OG2A 1YYJA 1MMNA 5COGA 4BJ5A 2A68F 4YT5A 2XS1A 3AG4C 2L81A 2KYHA 3EHMA 2A0BA 3JT1A 3MYFA 3KKBA 4CS9A 2OKUA 3B9QA 5K0IA 2LK4A 2LSEA 2R7RA 2YL1A 1JRAA 3IQ5A 2DI3A 1A7EA 2ZXRA 3MX3A 5JP7A 4P9TA 3BRJA 4O6YA 4LDKA 3EH1A 2R7WA 1VOMA 4C3DA 1C02A 3L1MA 1T9KA 2VH3A 4P9FA 2CCYA 2HKVA 4PK4A 4EHPA 3U8PA 1YA9A 4MVUA 3SYNA 4JIOA 3JTLO 4IAOA 4YL3A 1N1CA 1OCOC 2EPNA 3M4BA 2OJED 3C62A 3GEHA 3NYMA 3ITFA 3RVZA 3J06A 1CPRA 5T1DB 2O9XA 3SXMA 3U5SA 1TKNA 4CX9A 1RKEA 3GEIA 5FZTA 1Z6AA 1XZQA 2NPUA 2P0NA 3S0XA 3U0CA 1HMDA 4JW1A 4PFPA 4G7ZF 1CGOA 3FVYA 3QVZA 3RFYA 1LM3B 2OOCA 3CSKA 1ZW3A 4JCHA 3DAGA 4Z9IA 4NC3A 3RW0A 4OIPF 4JZAA 4EKWA 4GEHA 1QLEC 1W2WA 4MVMA 3NMJA 4Z9JA 1GQAA 3JSEO 4D4XA 1OXBA 3K33A 5CI8A 4WGYA 3DI5A 1AEPA 1JMWA 4D4NA 2GFHA 3C18A 4OIOF 1HMOA 2XLEA 5KYWA 4I3MA 1F1MA 1G5ZA 4BPMA 3AG1C 1OR2A 1BBHA 1QVXA 1Y4CA 3DE8A 3IHUA 3RQGA 4CDVA 3FDQA 1LI5A 5CIVA 1ZZPA 2P6VA 3EGDA 1TWGA 4NY3A 3OA1A 3I4UA 1QKRA 4FWVA 3ASOC 3VRCA 4MTOA 4WGZA 3TD7A 1ZYRF 4HEAJ 3U3BA 1FAPB 2FFHA 2YVKA 4O79A 3LEOA 5T3TA 5A6KA 3FHDA 3RH3A 2OU6A 2RSEB 1FNTc 3N0TA 4YN0B 2LFDA 4U5BE 1L3PA 1FMWA 2XLHA 3UNGC 2Z15A 1WN0A 4PJLA 1D1CA 1EI7A 3DJNB 2JX0A 2YKZA 2HFIA 2ZD9A 3C63A 3N2ZB 1BZ4A 4BEMJ 5AC4A 2ZXPA 4XPXA 1JR8A 4G7OF 3HTKC 2V26A 2WVQA 4JEBA 3ABMC 2G3KA 3QMKA 4IAQA 4I44A 2Q00A 1YDIA 3NYJA 1ZW2A 3LNMB 3HNLA 4L6RA 2WVNA 3CZ6A 4XQ1A 1K05A 1ZU5A 3ZIBA 1I5NA 4JJGA 5AGFA 3C8ZA 5KYYA 4E18A 3NYLA 1YZCA 3SXZA 1S05A 2PFDA 1BR4A 4YL0A 1PCXA 2YWAA 1TQGA 3ZQVA 2YLDA 3PMRA 4WABA 1MMDA 5BQIA 1SYQA 1VTMP 1KU2A 1RJ9B 1BR2A 4YT2A 2ICWG 1EA8A 4X0RA 3AJMA 5JS5A 1YYXA 3AQBA 2KW3C 4LDRA 2QUPA 4XLPF 2H7OA 1S7ZA 2J9WA 1NZEA 3G4ZA 4JTDB 4QDLA 2NUTA 3HJCA 2EPKX 2NUPA 1UFBA 1WGWA 1O5HA 2OEXA 3EPVA 2XL6A 4O6MA 1TWAA 3RKOF 3LAYA 3UR3C 4YWQA 1M2OA 4XEVA 3DZAA 3EZIA 2MYSA 4JRZA 2PNOA 3SXYA 1TR2A 2KGOA 2R25A 2J46A 1K04A 3WG7C 4DRJB 2Y3HA 2NSFA 2J9UA 3MBGA 4OD4A 2Q9BA 2YQYA 3U8VA 4DOZA 3SXKA 1EKYA 3ABKC 1YVIA 1U89A 1T01A 4OINF 1ORJA 1VYIA 2W45A 5KYUA 2XLMA 3SZRA 1FMVA 3QW0A 4AK9A 2P1AA 2WL8A 1VLSA 2VCAA 4MNDA 2OCCC 3K7DA 3VF0A 3W4YA 1FFTC 4WJ0A 1DOWA 2J0XA 1AVOB 4U5GA 4KI2A 3AG2C 4MW3A 2L6FA 1J8YF 1LE2A 3IQCA 2G62A 3GEEA 3JSZA 3LNRA 3M79A 3O10A 4LACB 4A2NB 2B0HA 3SEOA 3EG9B 4J32B 3JRTA 1KNYA 2ZXOA 3UGOA 3W2WA 3IQTA 1SZIA 3N24A 4JKVA 2AWYA 3TQOA 2J9BA 1RKEB 4NCQA 5BQGA 2Q9AA 2IOQA 3AGTA 2J9VA 2IYLD 4F4BA 1J8MF 1C03A 5B3SC 3WHNA 2R05A 3IEEA 2W4MA 1E84A 3HNKA 3HNIA 4JTAB 3M4CA 4DBRA 3T6JA 5AC5A 1Q0DA 2D4UA 2EILC 3CEXA 5L3QA 3TJ6A 1DOVA 1OCZC 3QVYA 5L0IA 4DRIB 4FAPB 3PDMP 2KC3A 5L0FA 3EHNA 1BDJB 1G4WR 5E33A 4IGGA 1C17M 2IXOA 4OD5A 4BJ6A 1UG7A 1E2XA 2R7OA 4EWCA 5L0HA 3S84A 2HV7A 3IQ6A 4OIRF 3UMIA 3NDBB 4IRUA 3EGDB 4J30B 3T9OA 3U9JA 1VLTA 1JOGA 4XPYA 1A7VA 3BEHA 2AP3A 4LERA 3PHF2 5A6AA 2H7VC 2XM0A 1VB5A 1SF8A 4E17A 3EGXA 2A6EF 2A6HF 2L6HA 2VASA 2Y69C 4RBNA 3SNHA 2R7VA 5L0CA 2J45A 4JTCB 2F22A 2CYDA 3H65A 4EBBA 3FOOA 2XLWA 1ZHXA 1CPQA 1PD1A 2JPUA 4MS2A 4XWJA 4XPWA 4BJ5C 2GWWA 4EIYA 3ZSUA 2EPMX 1FTSA 2R7UA 1T6UA 3B29A 2MHRA 1D1BA 4U5DE 1SMYF 2EIKC 3S27A 3DE9A 3KH2A 2B0JA 2A0UA 1RXQA 2XL4A 3AG3C 5HV9A 1D0XA 3JZ0A 3U2MA 3NRHA 4CSAC 4DVYP 1M6TA 3LESA 3NMIA 2YLGA 3B0VC 1KTMA 3TULA 2YZSA 3V5YA 2XS8A 4EBKA 5DS6A 2PP4A 5B1BC 5JLIA 1HY5A 1VYKA 3HKKA 3A11A 4JE9A 5KYYB 2QLAA 1LPEA 1QSPA 4Q4ZF 2A69F 2XLOA 1CGNA 1YJGA 3C8GB 3RQEA 2R7XA 2XXAA 1EQ1A 4MW8A 1ZHWA 4PJMA 3T6GB 1RMVA 2Y3DA 2HJ3A 3ASNC 3QW1A 1LS4A 2DYSC 2BC5A 2GDCA 4JJFA 3S9OA 1BR1A 1O3UA 1A7DA 2XRHA 3ZQYA 1T6QA 2AVKA 4CDYA 5JUAA 4AX2A 3M15A 5FCLA 2HUJA 1Q0KA 1TWCA 2CGEA 4KC9A 4MTFA 4AL0A 4BJTA 5L3VA 5GPGB 4HFKB 3RIPA 3GWNA 5F28E 3LEVA 5JSLA 2Y3GA 3JYHA 2ASRA 4ONSA 2AWCA 4N6HA 1L7CA 5BUOA 5JRAA 2KQ9A 2LD6A 3Q7LA 4PJNA 2CDQA 2WVOA 4YL1A 4B6IA 3W2VA 4ZLDA 3PCVA 2QNLA 2OJQA 1LE4A 2EPOA 1VMAA 3G50A 1LI7A 3LLKA 3KYIA 3Q7GA 4C7OB 4U5FE 5EGYA 2DB4A 3GM3A 2ZPAA 3RYLA 3KMIA 3KPHA 2VB6A 3Q6MA 2LIGA 2WZGA 3DM5A 4N6CA 2NG1A 3JCUQ 3TK0A 1QZXA 3OWTA 1H6GA 3U3FA 2YEVA 2IXPA 1MMGA 4DVZA 3K1IC 5CI9A 2P61A 1HE9A 2IXNA 4N06A 1IZMA 4U5HA 1XZPA 5IY5C 3AQCA 2Y3BA 4ULWA 1I4ZA 2PX0A 3X1OA 1PV3A 1E86A 2C03A 1G8XA 2RD9A 1LIHA 1M2VB 1YZAA 3EFOA 1V74B 5DS5A 5F5FA 3EZHA 3GANA 3R7CA 2HS5A 5EK0A 3S29A 1HW1A 4YJWA 3US6A 2IXMA 4RDAA 2FGYA 1Q0GA 3FXHA 4ER9A 4I1MA 3B71A 2DYRC 3CAXA 1WOLA 3JRMO 5TJ5E 3RVYA 2YRFA 4J7YA 3NMKA 2YHSA 4U5EE 4K1OA 2VCBA 5A6BD 2Q4FA 3ZTMA 3ZC4A 5HSWA 3A9CA 4CIHA 4G0HA 4IB4A 1OXKA 3LLIA 2HV6A 2YL7A 5B1AC 1D1AA 1LS1A 2YLIA 4MQ9F 3RF3A 3LS0A 4XEKA 3UMKA 3W8IA 1OW6A 2D5RB 4AE4A 3F46A 1Z3IX 4PFOA 5D91A 1H7IA 1ZHZA 4JCZA 4JURI 1RKCA 2M64A 5T3WA 1A41A 1WATA 1IW7F 3B0PA 4YK5A 3S90A 5B3IA 5KYNA 1M56C 2VCCA 2H8AA 5COMA 5E2QA 3E9VA 4J7TA 3Q6NA 1GM5A 3VM6A 1JAFA 2BL2A 1YA7O 3GWLA 1A0BA 1NFNA 1Y6DA 4YT4A 1H9GA 2BE5F 3GM1A 2HSQA 3E70C 4CDAA 2ETSA 2PBEA 1Z23A 3I5PA 2M4EA 2OEVA 4MVQA 1U6HA 1V4AA 3L0IA 1D0YA 3UMHA 1ORYA 3QTHA 1Z5ZA 5KYWB 3FAJA 4P6IC 2QE9A 2W4BA 4BJ1A 2I8BA 4KNVA 3U9MA 2J7PD 2AU5A 2HMZA 3L8JA 3TJ5A 4CS8C 2C04A 3KL4A 1YLMA 3ZG1A 3M1CB 4DXWA 5BQHA 4ANJA 1HE1A 4MVZA 3I5QA 4IJJA 2JD3A 4MVSA 2DGJA 1OCCC 3OEOA 4N4WA 4U9DA 3NG1A 2KK1A 4NQFA 4CJGA 2HMQA 4CSAA 3H2UA 3MFNA 4R32A 3L34A 4DRHB 2R7SA 2ZXWC 1WWPA 3EJNA 1M57C 2A1DD 2WB7A 2H7BA 2QTVA 3ABLC 3K66A 4DJ9A 5KYXA 4O6NA 2XXAB 2EIMC 5A6BA 3DWWA 3AOUA 1NFOA 3EG9A 3HLZA 4I1OB 4CS9C 5A69A 1QPUA 2PF4E 2LCHA 3V5ZA 4MVRA 4KBLA 3ZWIA 3K6BA 4C3EA 1FR0A 4CBEA 1VK5A 2CW0F 4XLNF 1OW7A 3C8GD 2GAQA 3ZVRA 4K0DA 1NG1A 4GQHA 1T5OA 4CIPA 4Q5SF 2EIJC 3H2VA 3POVA 1I4YA 2R03A 2Q3TA 5EHHA 1QQ3A 2XL8A 1TFKB 2R7TA 2IM8A 2NSGA 4O7GA 1E83A 3DM9B 4EBJA 3FMSA 3ECSA 5COFA 3K1HA 2IBFA 4BJ6C 2P7VA 4E0IA 1R5ID 2UUHA 4G78A 1Z7Qc 4W8KA 4OIQF 3LS1A 4KNWA 2YL0A 3UGPA 3VYWA 3WAQA 2QY9A 1OCRC 5E3AA 3SP1A 2FAPB 3MYIA 4LLEA 3TOLA 4RD9A 4C3BA 2LFFA 2VC9A 5DS4A 2HJMA 2WZFA 1GGQA 2CNWD 3KYJA 5L0DA 3B0UX 2NUTB 2I15A 1GS9A 3EH2A 4M63A 3DMDA 4GYTA 2X0CA 2PX3A 2NUPB 3QZCA 2W9YA 4W8PA 2Q7RA 5F5HA 4ZLCA 5L0JA 4PR9A 2KJGA 2XM4A 1LVKA 1NSGB
chains in the Genus database with same CATH topology
2X51A 2J7PA 3EFOB 1O87A 3CQZA 4E7ZA 1OKKD 1NU7D 3V7OA 2E87A 5DVWA 5KYUB 1ZHYA 3VAYA 1V54C 3T4RA 1ZHTA 1MNEA 4E7SA 3DXJF 1JPJA 4LLCA 4BEJA 1JPNA 2XSEA 4HE8D 4FX5A 2J0WA 3WODF 4YT8A 3DD7A 1MNDA 4AE4B 4PJJA 1FFHA 2Y39A 4Q7CA 2WZLA 4BG0A 3T6BA 4U5CE 4DBQA 2Q9CA 1D0ZA 4CS7A 5DQTA 1NU9C 4JVSA 1V55C 4XTKA 2R7QA 2EINC 2KNHA 5DLJA 2G3VA 3NKDA 3W8HA 3EQLF 3GODA 1PD0A 3S28A 3O39A 2CNWA 4C7OA 3O6XA 5DQZA 3MLGA 1RJ9A 3X2QC 1LKXA 5D92A 4CS8A 2V3CC 4QI2A 4IWBA 3EGXB 4K7BA 4FESA 4H4KC 1OKKA 2L9JA 1ZU4A 5KYXB 2MWQA 3F47A 3NKEA 1ST6A 1MMAA 1TWHA 1M2VA 4HFFB 3DJUB 5E3CA 1Z63A 3LJBA 4QI0A 3DAFA 2OG2A 1MMNA 4BJ5A 2A68F 4YT5A 3AG4C 2L81A 3EHMA 3JT1A 4CS9A 3KKBA 3B9QA 2R7RA 2LSEA 2ZXRA 3MX3A 4O6YA 3EH1A 2R7WA 1VOMA 4C3DA 2VH3A 4PK4A 3SYNA 4IAOA 1N1CA 1OCOC 3NYMA 3ITFA 5T1DB 2O9XA 1TKNA 1Z6AA 3S0XA 4JW1A 4PFPA 4G7ZF 3RFYA 3FVYA 4JCHA 3CSKA 4OIPF 3DAGA 4JZAA 4GEHA 1QLEC 1W2WA 3K33A 5CI8A 4OIOF 2GFHA 5KYWA 4I3MA 3AG1C 3FDQA 2P6VA 3EGDA 1TWGA 4NY3A 3OA1A 3I4UA 4FWVA 3ASOC 3TD7A 1ZYRF 4HEAJ 2FFHA 4O79A 5T3TA 3FHDA 3RH3A 3N0TA 4YN0B 4U5BE 1FMWA 3UNGC 2Z15A 4PJLA 1D1CA 3DJNB 3UGOA 3N2ZB 2ZXPA 4G7OF 3HTKC 2V26A 2WVQA 3ABMC 2G3KA 3QMKA 4I44A 3NYJA 2WVNA 3CZ6A 1ZU5A 3ZIBA 4JJGA 5KYYA 3NYLA 2PFDA 1BR4A 1PCXA 3PMRA 1MMDA 1KU2A 1RJ9B 1BR2A 4YT2A 4X0RA 3AQBA 2KW3C 4XLPF 2H7OA 1S7ZA 2J9WA 1NZEA 4QDLA 2NUTA 3HJCA 2NUPA 4O6MA 3EPVA 1WGWA 1O5HA 1TWAA 3RKOF 3LAYA 2KJGA 3UR3C 1M2OA 4YWQA 3DZAA 3EZIA 2MYSA 1TR2A 2KGOA 2J46A 3WG7C 2Y3HA 4DOZA 2J9UA 4OD4A 2Q9BA 3ABKC 4OINF 1VYIA 2W45A 5KYUA 3SZRA 1FMVA 4AK9A 2WL8A 4MNDA 2OCCC 3K7DA 1FFTC 4WJ0A 2J0XA 4U5GA 4KI2A 3AG2C 1J8YF 3LNRA 4ZLDA 2G62A 3JSZA 4LACB 4A2NB 3SEOA 3EG9B 4J32B 3JRTA 2ZXOA 3W2WA 1SZIA 3N24A 2Q9AA 2IOQA 2J9VA 2IYLD 4F4BA 1J8MF 5B3SC 2W4MA 4DBRA 3T6JA 2EILC 5L3QA 1OCZC 3EHNA 5E33A 2IXOA 4OD5A 4BJ6A 2R7OA 4EWCA 2HV7A 4OIRF 3UMIA 3NDBB 4IRUA 3EGDB 4J30B 4LERA 3PHF2 2H7VC 1SF8A 3EGXA 2A6EF 2A6HF 2VASA 2Y69C 4RBNA 3SNHA 2R7VA 2J45A 3H65A 4EBBA 1ZHXA 1PD1A 4XWJA 4BJ5C 3ZSUA 1FTSA 2R7UA 1D1BA 4U5DE 1SMYF 2EIKC 3S27A 3KH2A 2B0JA 3AG3C 2XL4A 1D0XA 3NRHA 4CSAC 4DVYP 3LESA 3B0VC 2YZSA 5DS6A 2PP4A 5B1BC 1VYKA 5KYYB 4Q4ZF 2A69F 2R7XA 2XXAA 1ZHWA 4PJMA 2Y3DA 3ASNC 4JJFA 2DYSC 1BR1A 2XRHA 4AX2A 5FCLA 4KC9A 4BJTA 1TWCA 2CGEA 5L3VA 4HFKB 3RIPA 3LEVA 2Y3GA 3JYHA 5BUOA 2KQ9A 4PJNA 3Q7LA 4B6IA 2CDQA 2WVOA 3W2VA 3Q7GA 1VMAA 3LLKA 4C7OB 4U5FE 5EGYA 2ZPAA 3RYLA 3KMIA 2VB6A 3Q6MA 2WZGA 3DM5A 2NG1A 3JCUQ 1QZXA 3OWTA 2YEVA 2IXPA 1MMGA 4DVZA 3K1IC 5CI9A 2IXNA 4N06A 1IZMA 4U5HA 5IY5C 3AQCA 2Y3BA 4ULWA 2PX0A 3X1OA 2C03A 1G8XA 5DS5A 3EFOA 1M2VB 5F5FA 3EZHA 3GANA 3S29A 4YJWA 2IXMA 4RDAA 2FGYA 4I1MA 2DYRC 2YHSA 4U5EE 3ZC4A 5HSWA 4CIHA 4G0HA 3LLIA 2HV6A 5B1AC 1D1AA 1LS1A 4MQ9F 3UMKA 3LS0A 3W8IA 2D5RB 4AE4A 3F46A 1Z3IX 4PFOA 5D91A 1ZHZA 4JURI 5T3WA 1IW7F 3B0PA 5KYNA 1M56C 5E2QA 3E9VA 3Q6NA 4YT4A 2BE5F 3E70C 3I5PA 1Z23A 2M4EA 3L0IA 1D0YA 3UMHA 1Z5ZA 5KYWB 3FAJA 4P6IC 2W4BA 4BJ1A 2I8BA 4KNVA 2J7PD 4CS8C 2C04A 3KL4A 3ZG1A 3M1CB 4ANJA 3I5QA 4IJJA 2JD3A 2DGJA 1OCCC 3OEOA 3NG1A 2R7SA 4CSAA 3L34A 2ZXWC 3K66A 3EJNA 1M57C 2A1DD 2WB7A 2H7BA 2QTVA 3ABLC 5KYXA 2XXAB 4O6NA 2EIMC 3HLZA 3EG9A 4CS9C 4I1OB 2PF4E 4KBLA 3K6BA 4C3EA 4CBEA 1VK5A 2CW0F 4XLNF 3ZVRA 4K0DA 1NG1A 4Q5SF 2EIJC 3POVA 2Q3TA 5EHHA 2R7TA 4O7GA 3DM9B 3ECSA 4BJ6C 3K1HA 2P7VA 4OIQF 4W8KA 3LS1A 4KNWA 3UGPA 3VYWA 2QY9A 1OCRC 5E3AA 3SP1A 4LLEA 4RD9A 4C3BA 5DS4A 2WZFA 2CNWD 3B0UX 2NUTB 3EH2A 4M63A 3DMDA 4GYTA 5F5HA 2PX3A 2NUPB 3QZCA 2W9YA 4ZLCA 4G7HF 3IEEA 1LVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWQ A;  4ULW A;  4QI0 A;  3X1O A;  4QI2 A;  5F5H A;  4ZLC A;  5F5F A;  4ZLD A; 
#chains in the Genus database with same CATH topology
 1Q0F A;  1YAU O;  2X51 A;  3HNJ A;  3K1I A;  2J7P A;  3EFO B;  1WAS A;  1O87 A;  4CJO A;  3CQZ A;  1Q0M A;  4PAC A;  4E7Z A;  3GOR A;  2HZ8 A;  4E0H A;  2TMV P;  3RQF A;  1YAR O;  3V5X A;  3FAP B;  1OKK D;  1NU7 D;  3V7O A;  2HSB A;  2E87 A;  4ULV A;  5DVW A;  4AL1 A;  1ZHY A;  2XLV A;  3VAY A;  5A6J A;  1V54 C;  3C7J A;  3DKA A;  3R2P A;  4A4A A;  3U2L A;  5JT4 A;  3T4R A;  4EUK B;  1SR2 A;  1ZHT A;  1MNE A;  1APC A;  2LP4 A;  3DXJ F;  4E7S A;  1JPJ A;  4LLC A;  5KYU B;  2YL3 A;  256B A;  2EPL X;  2GA0 A;  1JPN A;  1MQV A;  4BEJ A;  2XSE A;  1T6I A;  4HE8 D;  3TOM A;  4FX5 A;  2J0W A;  4XEF A;  3WOD F;  1K40 A;  4YT8 A;  3DD7 A;  3G4X A;  4NTF A;  1AUE A;  1MND A;  4AE4 B;  1RCP A;  3C8G A;  4MTG A;  4PJJ A;  3JYY A;  2J8W A;  4Z9H A;  1FFH A;  1HW2 A;  2Y39 A;  2UUI A;  4Q7C A;  3AGU A;  1ZVZ A;  3IPM O;  1WTY A;  2WZL A;  4BG0 A;  3T6B A;  4U5C E;  4DBQ A;  2Q9C A;  1CGM E;  3L8I A;  1D0Z A;  4CS7 A;  2L7A A;  2OQM A;  5DQT A;  1NU9 C;  4JVS A;  3LUT B;  1V55 C;  4XTK A;  5JVE A;  2R7Q A;  2L6G A;  3ZDL A;  2KSF A;  2EIN C;  2KNH A;  5DLJ A;  2G3V A;  3NKD A;  4U9E A;  3W8H A;  1U0B B;  1G4U S;  3EQL F;  2R02 A;  3GOD A;  1PD0 A;  3ZTZ A;  1ORS C;  4NTA A;  3S28 A;  3O39 A;  3O55 A;  2CNW A;  4NTB A;  3GM2 A;  4C7O A;  3O6X A;  3ATP A;  1R4T A;  5DQZ A;  3MLG A;  1RJ9 A;  3X2Q C;  1LKX A;  5D92 A;  1TFO B;  4JEA A;  4JC7 A;  4G7H F;  1B68 A;  1OR3 A;  5L0G A;  1XWJ A;  2LQG A;  4CS8 A;  2V3C C;  1E85 A;  4QI2 A;  1NLX A;  2R9R B;  4IWB A;  3EGX B;  4K7B A;  4UDV A;  4FES A;  4H4K C;  1OKK A;  1OW8 A;  1ZU4 A;  2L9J A;  2MWQ A;  5KYX B;  3F47 A;  1ST6 A;  3NKE A;  4H54 A;  1MMA A;  1M2V A;  1TWH A;  1NBB A;  2XLD A;  3DJU B;  4HFF B;  4IAR A;  4LDQ A;  3LJB A;  5E3C A;  1Z63 A;  4MVO A;  1H9T A;  4QI0 A;  3FOP A;  3DAF A;  1OQC A;  2OG2 A;  1YYJ A;  1MMN A;  5COG A;  4BJ5 A;  2A68 F;  4YT5 A;  2XS1 A;  3AG4 C;  2L81 A;  2KYH A;  3EHM A;  2A0B A;  3JT1 A;  3MYF A;  3KKB A;  4CS9 A;  2OKU A;  3B9Q A;  5K0I A;  2LK4 A;  2LSE A;  2R7R A;  2YL1 A;  1JRA A;  3IQ5 A;  2DI3 A;  1A7E A;  2ZXR A;  3MX3 A;  5JP7 A;  4P9T A;  3BRJ A;  4O6Y A;  4LDK A;  3EH1 A;  2R7W A;  1VOM A;  4C3D A;  1C02 A;  3L1M A;  1T9K A;  2VH3 A;  4P9F A;  2CCY A;  2HKV A;  4PK4 A;  4EHP A;  3U8P A;  1YA9 A;  4MVU A;  3SYN A;  4JIO A;  3JTL O;  4IAO A;  4YL3 A;  1N1C A;  1OCO C;  2EPN A;  3M4B A;  2OJE D;  3C62 A;  3GEH A;  3NYM A;  3ITF A;  3RVZ A;  3J06 A;  1CPR A;  5T1D B;  2O9X A;  3SXM A;  3U5S A;  1TKN A;  4CX9 A;  1RKE A;  3GEI A;  5FZT A;  1Z6A A;  1XZQ A;  2NPU A;  2P0N A;  3S0X A;  3U0C A;  1HMD A;  4JW1 A;  4PFP A;  4G7Z F;  1CGO A;  3FVY A;  3QVZ A;  3RFY A;  1LM3 B;  2OOC A;  3CSK A;  1ZW3 A;  4JCH A;  3DAG A;  4Z9I A;  4NC3 A;  3RW0 A;  4OIP F;  4JZA A;  4EKW A;  4GEH A;  1QLE C;  1W2W A;  4MVM A;  3NMJ A;  4Z9J A;  1GQA A;  3JSE O;  4D4X A;  1OXB A;  3K33 A;  5CI8 A;  4WGY A;  3DI5 A;  1AEP A;  1JMW A;  4D4N A;  2GFH A;  3C18 A;  4OIO F;  1HMO A;  2XLE A;  5KYW A;  4I3M A;  1F1M A;  1G5Z A;  4BPM A;  3AG1 C;  1OR2 A;  1BBH A;  1QVX A;  1Y4C A;  3DE8 A;  3IHU A;  3RQG A;  4CDV A;  3FDQ A;  1LI5 A;  5CIV A;  1ZZP A;  2P6V A;  3EGD A;  1TWG A;  4NY3 A;  3OA1 A;  3I4U A;  1QKR A;  4FWV A;  3ASO C;  3VRC A;  4MTO A;  4WGZ A;  3TD7 A;  1ZYR F;  4HEA J;  3U3B A;  1FAP B;  2FFH A;  2YVK A;  4O79 A;  3LEO A;  5T3T A;  5A6K A;  3FHD A;  3RH3 A;  2OU6 A;  2RSE B;  1FNT c;  3N0T A;  4YN0 B;  2LFD A;  4U5B E;  1L3P A;  1FMW A;  2XLH A;  3UNG C;  2Z15 A;  1WN0 A;  4PJL A;  1D1C A;  1EI7 A;  3DJN B;  2JX0 A;  2YKZ A;  2HFI A;  2ZD9 A;  3C63 A;  3N2Z B;  1BZ4 A;  4BEM J;  5AC4 A;  2ZXP A;  4XPX A;  1JR8 A;  4G7O F;  3HTK C;  2V26 A;  2WVQ A;  4JEB A;  3ABM C;  2G3K A;  3QMK A;  4IAQ A;  4I44 A;  2Q00 A;  1YDI A;  3NYJ A;  1ZW2 A;  3LNM B;  3HNL A;  4L6R A;  2WVN A;  3CZ6 A;  4XQ1 A;  1K05 A;  1ZU5 A;  3ZIB A;  1I5N A;  4JJG A;  5AGF A;  3C8Z A;  5KYY A;  4E18 A;  3NYL A;  1YZC A;  3SXZ A;  1S05 A;  2PFD A;  1BR4 A;  4YL0 A;  1PCX A;  2YWA A;  1TQG A;  3ZQV A;  2YLD A;  3PMR A;  4WAB A;  1MMD A;  5BQI A;  1SYQ A;  1VTM P;  1KU2 A;  1RJ9 B;  1BR2 A;  4YT2 A;  2ICW G;  1EA8 A;  4X0R A;  3AJM A;  5JS5 A;  1YYX A;  3AQB A;  2KW3 C;  4LDR A;  2QUP A;  4XLP F;  2H7O A;  1S7Z A;  2J9W A;  1NZE A;  3G4Z A;  4JTD B;  4QDL A;  2NUT A;  3HJC A;  2EPK X;  2NUP A;  1UFB A;  1WGW A;  1O5H A;  2OEX A;  3EPV A;  2XL6 A;  4O6M A;  1TWA A;  3RKO F;  3LAY A;  3UR3 C;  4YWQ A;  1M2O A;  4XEV A;  3DZA A;  3EZI A;  2MYS A;  4JRZ A;  2PNO A;  3SXY A;  1TR2 A;  2KGO A;  2R25 A;  2J46 A;  1K04 A;  3WG7 C;  4DRJ B;  2Y3H A;  2NSF A;  2J9U A;  3MBG A;  4OD4 A;  2Q9B A;  2YQY A;  3U8V A;  4DOZ A;  3SXK A;  1EKY A;  3ABK C;  1YVI A;  1U89 A;  1T01 A;  4OIN F;  1ORJ A;  1VYI A;  2W45 A;  5KYU A;  2XLM A;  3SZR A;  1FMV A;  3QW0 A;  4AK9 A;  2P1A A;  2WL8 A;  1VLS A;  2VCA A;  4MND A;  2OCC C;  3K7D A;  3VF0 A;  3W4Y A;  1FFT C;  4WJ0 A;  1DOW A;  2J0X A;  1AVO B;  4U5G A;  4KI2 A;  3AG2 C;  4MW3 A;  2L6F A;  1J8Y F;  1LE2 A;  3IQC A;  2G62 A;  3GEE A;  3JSZ A;  3LNR A;  3M79 A;  3O10 A;  4LAC B;  4A2N B;  2B0H A;  3SEO A;  3EG9 B;  4J32 B;  3JRT A;  1KNY A;  2ZXO A;  3UGO A;  3W2W A;  3IQT A;  1SZI A;  3N24 A;  4JKV A;  2AWY A;  3TQO A;  2J9B A;  1RKE B;  4NCQ A;  5BQG A;  2Q9A A;  2IOQ A;  3AGT A;  2J9V A;  2IYL D;  4F4B A;  1J8M F;  1C03 A;  5B3S C;  3WHN A;  2R05 A;  3IEE A;  2W4M A;  1E84 A;  3HNK A;  3HNI A;  4JTA B;  3M4C A;  4DBR A;  3T6J A;  5AC5 A;  1Q0D A;  2D4U A;  2EIL C;  3CEX A;  5L3Q A;  3TJ6 A;  1DOV A;  1OCZ C;  3QVY A;  5L0I A;  4DRI B;  4FAP B;  3PDM P;  2KC3 A;  5L0F A;  3EHN A;  1BDJ B;  1G4W R;  5E33 A;  4IGG A;  1C17 M;  2IXO A;  4OD5 A;  4BJ6 A;  1UG7 A;  1E2X A;  2R7O A;  4EWC A;  5L0H A;  3S84 A;  2HV7 A;  3IQ6 A;  4OIR F;  3UMI A;  3NDB B;  4IRU A;  3EGD B;  4J30 B;  3T9O A;  3U9J A;  1VLT A;  1JOG A;  4XPY A;  1A7V A;  3BEH A;  2AP3 A;  4LER A;  3PHF 2;  5A6A A;  2H7V C;  2XM0 A;  1VB5 A;  1SF8 A;  4E17 A;  3EGX A;  2A6E F;  2A6H F;  2L6H A;  2VAS A;  2Y69 C;  4RBN A;  3SNH A;  2R7V A;  5L0C A;  2J45 A;  4JTC B;  2F22 A;  2CYD A;  3H65 A;  4EBB A;  3FOO A;  2XLW A;  1ZHX A;  1CPQ A;  1PD1 A;  2JPU A;  4MS2 A;  4XWJ A;  4XPW A;  4BJ5 C;  2GWW A;  4EIY A;  3ZSU A;  2EPM X;  1FTS A;  2R7U A;  1T6U A;  3B29 A;  2MHR A;  1D1B A;  4U5D E;  1SMY F;  2EIK C;  3S27 A;  3DE9 A;  3KH2 A;  2B0J A;  2A0U A;  1RXQ A;  2XL4 A;  3AG3 C;  5HV9 A;  1D0X A;  3JZ0 A;  3U2M A;  3NRH A;  4CSA C;  4DVY P;  1M6T A;  3LES A;  3NMI A;  2YLG A;  3B0V C;  1KTM A;  3TUL A;  2YZS A;  3V5Y A;  2XS8 A;  4EBK A;  5DS6 A;  2PP4 A;  5B1B C;  5JLI A;  1HY5 A;  1VYK A;  3HKK A;  3A11 A;  4JE9 A;  5KYY B;  2QLA A;  1LPE A;  1QSP A;  4Q4Z F;  2A69 F;  2XLO A;  1CGN A;  1YJG A;  3C8G B;  3RQE A;  2R7X A;  2XXA A;  1EQ1 A;  4MW8 A;  1ZHW A;  4PJM A;  3T6G B;  1RMV A;  2Y3D A;  2HJ3 A;  3ASN C;  3QW1 A;  1LS4 A;  2DYS C;  2BC5 A;  2GDC A;  4JJF A;  3S9O A;  1BR1 A;  1O3U A;  1A7D A;  2XRH A;  3ZQY A;  1T6Q A;  2AVK A;  4CDY A;  5JUA A;  4AX2 A;  3M15 A;  5FCL A;  2HUJ A;  1Q0K A;  1TWC A;  2CGE A;  4KC9 A;  4MTF A;  4AL0 A;  4BJT A;  5L3V A;  5GPG B;  4HFK B;  3RIP A;  3GWN A;  5F28 E;  3LEV A;  5JSL A;  2Y3G A;  3JYH A;  2ASR A;  4ONS A;  2AWC A;  4N6H A;  1L7C A;  5BUO A;  5JRA A;  2KQ9 A;  2LD6 A;  3Q7L A;  4PJN A;  2CDQ A;  2WVO A;  4YL1 A;  4B6I A;  3W2V A;  4ZLD A;  3PCV A;  2QNL A;  2OJQ A;  1LE4 A;  2EPO A;  1VMA A;  3G50 A;  1LI7 A;  3LLK A;  3KYI A;  3Q7G A;  4C7O B;  4U5F E;  5EGY A;  2DB4 A;  3GM3 A;  2ZPA A;  3RYL A;  3KMI A;  3KPH A;  2VB6 A;  3Q6M A;  2LIG A;  2WZG A;  3DM5 A;  4N6C A;  2NG1 A;  3JCU Q;  3TK0 A;  1QZX A;  3OWT A;  1H6G A;  3U3F A;  2YEV A;  2IXP A;  1MMG A;  4DVZ A;  3K1I C;  5CI9 A;  2P61 A;  1HE9 A;  2IXN A;  4N06 A;  1IZM A;  4U5H A;  1XZP A;  5IY5 C;  3AQC A;  2Y3B A;  4ULW A;  1I4Z A;  2PX0 A;  3X1O A;  1PV3 A;  1E86 A;  2C03 A;  1G8X A;  2RD9 A;  1LIH A;  1M2V B;  1YZA A;  3EFO A;  1V74 B;  5DS5 A;  5F5F A;  3EZH A;  3GAN A;  3R7C A;  2HS5 A;  5EK0 A;  3S29 A;  1HW1 A;  4YJW A;  3US6 A;  2IXM A;  4RDA A;  2FGY A;  1Q0G A;  3FXH A;  4ER9 A;  4I1M A;  3B71 A;  2DYR C;  3CAX A;  1WOL A;  3JRM O;  5TJ5 E;  3RVY A;  2YRF A;  4J7Y A;  3NMK A;  2YHS A;  4U5E E;  4K1O A;  2VCB A;  5A6B D;  2Q4F A;  3ZTM A;  3ZC4 A;  5HSW A;  3A9C A;  4CIH A;  4G0H A;  4IB4 A;  1OXK A;  3LLI A;  2HV6 A;  2YL7 A;  5B1A C;  1D1A A;  1LS1 A;  2YLI A;  4MQ9 F;  3RF3 A;  3LS0 A;  4XEK A;  3UMK A;  3W8I A;  1OW6 A;  2D5R B;  4AE4 A;  3F46 A;  1Z3I X;  4PFO A;  5D91 A;  1H7I A;  1ZHZ A;  4JCZ A;  4JUR I;  1RKC A;  2M64 A;  5T3W A;  1A41 A;  1WAT A;  1IW7 F;  3B0P A;  4YK5 A;  3S90 A;  5B3I A;  5KYN A;  1M56 C;  2VCC A;  2H8A A;  5COM A;  5E2Q A;  3E9V A;  4J7T A;  3Q6N A;  1GM5 A;  3VM6 A;  1JAF A;  2BL2 A;  1YA7 O;  3GWL A;  1A0B A;  1NFN A;  1Y6D A;  4YT4 A;  1H9G A;  2BE5 F;  3GM1 A;  2HSQ A;  3E70 C;  4CDA A;  2ETS A;  2PBE A;  1Z23 A;  3I5P A;  2M4E A;  2OEV A;  4MVQ A;  1U6H A;  1V4A A;  3L0I A;  1D0Y A;  3UMH A;  1ORY A;  3QTH A;  1Z5Z A;  5KYW B;  3FAJ A;  4P6I C;  2QE9 A;  2W4B A;  4BJ1 A;  2I8B A;  4KNV A;  3U9M A;  2J7P D;  2AU5 A;  2HMZ A;  3L8J A;  3TJ5 A;  4CS8 C;  2C04 A;  3KL4 A;  1YLM A;  3ZG1 A;  3M1C B;  4DXW A;  5BQH A;  4ANJ A;  1HE1 A;  4MVZ A;  3I5Q A;  4IJJ A;  2JD3 A;  4MVS A;  2DGJ A;  1OCC C;  3OEO A;  4N4W A;  4U9D A;  3NG1 A;  2KK1 A;  4NQF A;  4CJG A;  2HMQ A;  4CSA A;  3H2U A;  3MFN A;  4R32 A;  3L34 A;  4DRH B;  2R7S A;  2ZXW C;  1WWP A;  3EJN A;  1M57 C;  2A1D D;  2WB7 A;  2H7B A;  2QTV A;  3ABL C;  3K66 A;  4DJ9 A;  5KYX A;  4O6N A;  2XXA B;  2EIM C;  5A6B A;  3DWW A;  3AOU A;  1NFO A;  3EG9 A;  3HLZ A;  4I1O B;  4CS9 C;  5A69 A;  1QPU A;  2PF4 E;  2LCH A;  3V5Z A;  4MVR A;  4KBL A;  3ZWI A;  3K6B A;  4C3E A;  1FR0 A;  4CBE A;  1VK5 A;  2CW0 F;  4XLN F;  1OW7 A;  3C8G D;  2GAQ A;  3ZVR A;  4K0D A;  1NG1 A;  4GQH A;  1T5O A;  4CIP A;  4Q5S F;  2EIJ C;  3H2V A;  3POV A;  1I4Y A;  2R03 A;  2Q3T A;  5EHH A;  1QQ3 A;  2XL8 A;  1TFK B;  2R7T A;  2IM8 A;  2NSG A;  4O7G A;  1E83 A;  3DM9 B;  4EBJ A;  3FMS A;  3ECS A;  5COF A;  3K1H A;  2IBF A;  4BJ6 C;  2P7V A;  4E0I A;  1R5I D;  2UUH A;  4G78 A;  1Z7Q c;  4W8K A;  4OIQ F;  3LS1 A;  4KNW A;  2YL0 A;  3UGP A;  3VYW A;  3WAQ A;  2QY9 A;  1OCR C;  5E3A A;  3SP1 A;  2FAP B;  3MYI A;  4LLE A;  3TOL A;  4RD9 A;  4C3B A;  2LFF A;  2VC9 A;  5DS4 A;  2HJM A;  2WZF A;  1GGQ A;  2CNW D;  3KYJ A;  5L0D A;  3B0U X;  2NUT B;  2I15 A;  1GS9 A;  3EH2 A;  4M63 A;  3DMD A;  4GYT A;  2X0C A;  2PX3 A;  2NUP B;  3QZC A;  2W9Y A;  4W8P A;  2Q7R A;  5F5H A;  4ZLC A;  5L0J A;  4PR9 A;  2KJG A;  2XM4 A;  1LVK A;  1NSG B; 
#chains in the Genus database with same CATH homology
 2X51 A;  2J7P A;  3EFO B;  1O87 A;  3CQZ A;  4E7Z A;  1OKK D;  1NU7 D;  3V7O A;  2E87 A;  5DVW A;  5KYU B;  1ZHY A;  3VAY A;  1V54 C;  3T4R A;  1ZHT A;  1MNE A;  4E7S A;  3DXJ F;  1JPJ A;  4LLC A;  4BEJ A;  1JPN A;  2XSE A;  4HE8 D;  4FX5 A;  2J0W A;  3WOD F;  4YT8 A;  3DD7 A;  1MND A;  4AE4 B;  4PJJ A;  1FFH A;  2Y39 A;  4Q7C A;  2WZL A;  4BG0 A;  3T6B A;  4U5C E;  4DBQ A;  2Q9C A;  1D0Z A;  4CS7 A;  5DQT A;  1NU9 C;  4JVS A;  1V55 C;  4XTK A;  2R7Q A;  2EIN C;  2KNH A;  5DLJ A;  2G3V A;  3NKD A;  3W8H A;  3EQL F;  3GOD A;  1PD0 A;  3S28 A;  3O39 A;  2CNW A;  4C7O A;  3O6X A;  5DQZ A;  3MLG A;  1RJ9 A;  3X2Q C;  1LKX A;  5D92 A;  4CS8 A;  2V3C C;  4QI2 A;  4IWB A;  3EGX B;  4K7B A;  4FES A;  4H4K C;  1OKK A;  2L9J A;  1ZU4 A;  5KYX B;  2MWQ A;  3F47 A;  3NKE A;  1ST6 A;  1MMA A;  1TWH A;  1M2V A;  4HFF B;  3DJU B;  5E3C A;  1Z63 A;  3LJB A;  4QI0 A;  3DAF A;  2OG2 A;  1MMN A;  4BJ5 A;  2A68 F;  4YT5 A;  3AG4 C;  2L81 A;  3EHM A;  3JT1 A;  4CS9 A;  3KKB A;  3B9Q A;  2R7R A;  2LSE A;  2ZXR A;  3MX3 A;  4O6Y A;  3EH1 A;  2R7W A;  1VOM A;  4C3D A;  2VH3 A;  4PK4 A;  3SYN A;  4IAO A;  1N1C A;  1OCO C;  3NYM A;  3ITF A;  5T1D B;  2O9X A;  1TKN A;  1Z6A A;  3S0X A;  4JW1 A;  4PFP A;  4G7Z F;  3RFY A;  3FVY A;  4JCH A;  3CSK A;  4OIP F;  3DAG A;  4JZA A;  4GEH A;  1QLE C;  1W2W A;  3K33 A;  5CI8 A;  4OIO F;  2GFH A;  5KYW A;  4I3M A;  3AG1 C;  3FDQ A;  2P6V A;  3EGD A;  1TWG A;  4NY3 A;  3OA1 A;  3I4U A;  4FWV A;  3ASO C;  3TD7 A;  1ZYR F;  4HEA J;  2FFH A;  4O79 A;  5T3T A;  3FHD A;  3RH3 A;  3N0T A;  4YN0 B;  4U5B E;  1FMW A;  3UNG C;  2Z15 A;  4PJL A;  1D1C A;  3DJN B;  3UGO A;  3N2Z B;  2ZXP A;  4G7O F;  3HTK C;  2V26 A;  2WVQ A;  3ABM C;  2G3K A;  3QMK A;  4I44 A;  3NYJ A;  2WVN A;  3CZ6 A;  1ZU5 A;  3ZIB A;  4JJG A;  5KYY A;  3NYL A;  2PFD A;  1BR4 A;  1PCX A;  3PMR A;  1MMD A;  1KU2 A;  1RJ9 B;  1BR2 A;  4YT2 A;  4X0R A;  3AQB A;  2KW3 C;  4XLP F;  2H7O A;  1S7Z A;  2J9W A;  1NZE A;  4QDL A;  2NUT A;  3HJC A;  2NUP A;  4O6M A;  3EPV A;  1WGW A;  1O5H A;  1TWA A;  3RKO F;  3LAY A;  2KJG A;  3UR3 C;  1M2O A;  4YWQ A;  3DZA A;  3EZI A;  2MYS A;  1TR2 A;  2KGO A;  2J46 A;  3WG7 C;  2Y3H A;  4DOZ A;  2J9U A;  4OD4 A;  2Q9B A;  3ABK C;  4OIN F;  1VYI A;  2W45 A;  5KYU A;  3SZR A;  1FMV A;  4AK9 A;  2WL8 A;  4MND A;  2OCC C;  3K7D A;  1FFT C;  4WJ0 A;  2J0X A;  4U5G A;  4KI2 A;  3AG2 C;  1J8Y F;  3LNR A;  4ZLD A;  2G62 A;  3JSZ A;  4LAC B;  4A2N B;  3SEO A;  3EG9 B;  4J32 B;  3JRT A;  2ZXO A;  3W2W A;  1SZI A;  3N24 A;  2Q9A A;  2IOQ A;  2J9V A;  2IYL D;  4F4B A;  1J8M F;  5B3S C;  2W4M A;  4DBR A;  3T6J A;  2EIL C;  5L3Q A;  1OCZ C;  3EHN A;  5E33 A;  2IXO A;  4OD5 A;  4BJ6 A;  2R7O A;  4EWC A;  2HV7 A;  4OIR F;  3UMI A;  3NDB B;  4IRU A;  3EGD B;  4J30 B;  4LER A;  3PHF 2;  2H7V C;  1SF8 A;  3EGX A;  2A6E F;  2A6H F;  2VAS A;  2Y69 C;  4RBN A;  3SNH A;  2R7V A;  2J45 A;  3H65 A;  4EBB A;  1ZHX A;  1PD1 A;  4XWJ A;  4BJ5 C;  3ZSU A;  1FTS A;  2R7U A;  1D1B A;  4U5D E;  1SMY F;  2EIK C;  3S27 A;  3KH2 A;  2B0J A;  3AG3 C;  2XL4 A;  1D0X A;  3NRH A;  4CSA C;  4DVY P;  3LES A;  3B0V C;  2YZS A;  5DS6 A;  2PP4 A;  5B1B C;  1VYK A;  5KYY B;  4Q4Z F;  2A69 F;  2R7X A;  2XXA A;  1ZHW A;  4PJM A;  2Y3D A;  3ASN C;  4JJF A;  2DYS C;  1BR1 A;  2XRH A;  4AX2 A;  5FCL A;  4KC9 A;  4BJT A;  1TWC A;  2CGE A;  5L3V A;  4HFK B;  3RIP A;  3LEV A;  2Y3G A;  3JYH A;  5BUO A;  2KQ9 A;  4PJN A;  3Q7L A;  4B6I A;  2CDQ A;  2WVO A;  3W2V A;  3Q7G A;  1VMA A;  3LLK A;  4C7O B;  4U5F E;  5EGY A;  2ZPA A;  3RYL A;  3KMI A;  2VB6 A;  3Q6M A;  2WZG A;  3DM5 A;  2NG1 A;  3JCU Q;  1QZX A;  3OWT A;  2YEV A;  2IXP A;  1MMG A;  4DVZ A;  3K1I C;  5CI9 A;  2IXN A;  4N06 A;  1IZM A;  4U5H A;  5IY5 C;  3AQC A;  2Y3B A;  4ULW A;  2PX0 A;  3X1O A;  2C03 A;  1G8X A;  5DS5 A;  3EFO A;  1M2V B;  5F5F A;  3EZH A;  3GAN A;  3S29 A;  4YJW A;  2IXM A;  4RDA A;  2FGY A;  4I1M A;  2DYR C;  2YHS A;  4U5E E;  3ZC4 A;  5HSW A;  4CIH A;  4G0H A;  3LLI A;  2HV6 A;  5B1A C;  1D1A A;  1LS1 A;  4MQ9 F;  3UMK A;  3LS0 A;  3W8I A;  2D5R B;  4AE4 A;  3F46 A;  1Z3I X;  4PFO A;  5D91 A;  1ZHZ A;  4JUR I;  5T3W A;  1IW7 F;  3B0P A;  5KYN A;  1M56 C;  5E2Q A;  3E9V A;  3Q6N A;  4YT4 A;  2BE5 F;  3E70 C;  3I5P A;  1Z23 A;  2M4E A;  3L0I A;  1D0Y A;  3UMH A;  1Z5Z A;  5KYW B;  3FAJ A;  4P6I C;  2W4B A;  4BJ1 A;  2I8B A;  4KNV A;  2J7P D;  4CS8 C;  2C04 A;  3KL4 A;  3ZG1 A;  3M1C B;  4ANJ A;  3I5Q A;  4IJJ A;  2JD3 A;  2DGJ A;  1OCC C;  3OEO A;  3NG1 A;  2R7S A;  4CSA A;  3L34 A;  2ZXW C;  3K66 A;  3EJN A;  1M57 C;  2A1D D;  2WB7 A;  2H7B A;  2QTV A;  3ABL C;  5KYX A;  2XXA B;  4O6N A;  2EIM C;  3HLZ A;  3EG9 A;  4CS9 C;  4I1O B;  2PF4 E;  4KBL A;  3K6B A;  4C3E A;  4CBE A;  1VK5 A;  2CW0 F;  4XLN F;  3ZVR A;  4K0D A;  1NG1 A;  4Q5S F;  2EIJ C;  3POV A;  2Q3T A;  5EHH A;  2R7T A;  4O7G A;  3DM9 B;  3ECS A;  4BJ6 C;  3K1H A;  2P7V A;  4OIQ F;  4W8K A;  3LS1 A;  4KNW A;  3UGP A;  3VYW A;  2QY9 A;  1OCR C;  5E3A A;  3SP1 A;  4LLE A;  4RD9 A;  4C3B A;  5DS4 A;  2WZF A;  2CNW D;  3B0U X;  2NUT B;  3EH2 A;  4M63 A;  3DMD A;  4GYT A;  5F5H A;  2PX3 A;  2NUP B;  3QZC A;  2W9Y A;  4ZLC A;  4G7H F;  3IEE A;  1LVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...