4QI2A

X-ray structure of the roq domain from murine roquin-1 in complex with a 23-mer tnf-cde rna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
153
Chain Sequence
HQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
molecule keywords Roquin-1
total genus 59
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4qi2A00
4ZLDA 4ZLCA 4QI0A 4YWQA 3X1OA 4ULWA 5F5FA 4QI2A 5F5HA
chains in the Genus database with same CATH superfamily
1DOVA 2Q9CA 3EQLF 5E3CA 4E7ZA 2I8BA 2R03A 1OXKA 2WZFA 1QPUA 3NMKA 5L0JA 3AQBA 2PX0A 4XTKA 1M57C 4U5DE 1GS9A 2HV6A 3EG9A 4MTGA 2L9JA 4G0HA 2IXPA 2GAQA 1QSPA 2ZXOA 3EZIA 5F5HA 4F4BA 2EIJC 3PHF2 3M15A 3UMIA 5CI8A 3DAFA 3IQ6A 3U3FA 3MYFA 1WGWA 2XL4A 1Z3IX 4P6IC 3UGOA 1YARO 4J32B 4J7TA 2HSBA 3K1HA 3L0IA 2J46A 3B0PA 3FHDA 2Q00A 3AJMA 4IGGA 4PK4A 4W8PA 5FZTA 2VB6A 2YEVA 4XWJA 4FAPB 3KYIA 1JR8A 3FVYA 3ZDLA 2EINC 1H6GA 1M2VA 2CDQA 2G3VA 2XM4A 2B0JA 3HLZA 3AG1C 3T6GB 3TJ6A 3UMHA 3W2VA 3EHMA 1TFOB 3O10A 2ZXWC 3HNKA 1LS4A 4K1OA 4CIHA 5D91A 1YYXA 5DQZA 5HV9A 2HUJA 3CSKA 3VF0A 3S27A 4CX9A 1JOGA 3EGXA 5TJ5E 1Z63A 4PR9A 3K33A 3IEEA 4RBNA 5L0IA 2M4EA 3JYYA 3HTKC 5KYNA 3WHNA 1D0XA 3RQFA 2TMVP 1T5OA 2X51A 3A11A 2C03A 3ATPA 2A0UA 3DE8A 1RKEB 1OKKD 1YZCA 2J8WA 4JTDB 1LIHA 3VRCA 1KNYA 2HJMA 4RD9A 5DS4A 3O55A 3RIPA 3WODF 3AG4C 2LIGA 2J0WA 1VB5A 3C8GD 3OA1A 1HY5A 1VYKA 2PNOA 1G4US 2JPUA 4U5FE 3H65A 4NY3A 4NTAA 4YT5A 5E3AA 2J7PD 1CPRA 4CDVA 1OR3A 4JW1A 3SYNA 1XZPA 3K66A 2QE9A 4EWCA 1HE9A 2BE5F 1Z7Qc 5JS5A 5L3QA 3Q6NA 1VTMP 1FNTc 1Z5ZA 1ORJA 2EPMX 1CGOA 2P7VA 3S28A 5JLIA 3GODA 4N4WA 3W4YA 3QW1A 1V4AA 2NPUA 4NTFA 1EI7A 2HSQA 2Y3GA 4MVZA 4P9TA 1D1CA 4EHPA 1A7DA 3ITFA 4WGZA 4BPMA 4EIYA 1M2OA 2QLAA 4I3MA 2IXOA 3I4UA 4I1OB 3C8GB 3GEIA 5KYXA 3SP1A 3KL4A 2Q9BA 4KC9A 3FAPB 1MNDA 4PFOA 4A4AA 4CIPA 4W8KA 5JSLA 3DAGA 3IQTA 5B1AC 5COFA 2NUTA 2P61A 2KSFA 3JTLO 2XS1A 2Y39A 1V54C 3DXJF 3DM5A 3CQZA 4NC3A 1J8MF 4LLEA 3POVA 3DMDA 3L34A 4AE4A 1ZYRF 4LDKA 1KTMA 1EA8A 2G62A 3SXZA 1A7EA 3IQ5A 3PDMP 1T9KA 1O3UA 4U9DA 2VCCA 1U6HA 1AUEA 1YVIA 3LLIA 4JC7A 3SXKA 4FWVA 2Z15A 3UNGC 3Q6MA 3V5ZA 4WJ0A 4DRJB 2IBFA 4R32A 4HFKB 1SR2A 3B71A 3OEOA 2LK4A 4CBEA 3DKAA 2Y69C 3L1MA 1NSGB 4NTBA 3B9QA 3UMKA 2P6VA 4E0IA 1E83A 4Q4ZF 3LEVA 1VYIA 1TR2A 2KGOA 4YT4A 2RSEB 2YHSA 3EFOB 2QNLA 4OIOF 4IAQA 2ZPAA 4MW8A 3AQCA 1D1BA 3T9OA 3RQEA 4CSAC 2R7QA 2PFDA 1YA9A 3ZTMA 3MBGA 2W45A 5KYYA 2DGJA 1SYQA 3CEXA 3M1CB 1EQ1A 1JMWA 2NUPB 1O5HA 3GM1A 2ICWG 1QQ3A 1TFKB 4NCQA 4KBLA 1WASA 5HSWA 4GYTA 4RDAA 3G4XA 4OINF 3S90A 1VK5A 3ZSUA 1IW7F 1HW1A 2C04A 4ULWA 1S7ZA 1O87A 3M4CA 3U5SA 4Z9HA 5L0FA 5JP7A 3EG9B 4BJ6C 3C63A 2XLOA 3TD7A 1L3PA 1TWHA 1JPJA 3DM9B 3K7DA 4XPYA 3ASOC 2ZXPA 3SEOA 1R5ID 1Y6DA 1YA7O 1MMNA 2AU5A 4N06A 1D0ZA 5COGA 2OQMA 3U0CA 3RVZA 5COMA 2BC5A 2EPLX 4D4XA 3W8IA 3F47A 1BBHA 2LD6A 4E18A 4ANJA 3DD7A 3GEHA 4XQ1A 2DYSC 2XLVA 5T3TA 1G4WR 2CGEA 2J7PA 2J45A 4XPWA 1FAPB 2IYLD 3N24A 3KMIA 1OCZC 1HE1A 3EGDA 5BQIA 4Z9IA 4O7GA 5E33A 4U5BE 4CDAA 3TJ5A 2LFFA 2DB4A 2LQGA 1TWGA 5K0IA 4DVZA 5F5FA 3R2PA 3TOMA 2PP4A 4Q5SF 1YJGA 1A7VA 4O6NA 3ZIBA 3AG2C 4EUKB 1S05A 2FGYA 2XL6A 3GM3A 1K40A 5JVEA 3TOLA 2EPKX 1NU7D 3W8HA 2D4UA 2YKZA 4JTAB 5A69A 3L8JA 3KPHA 1PCXA 4A2NB 1MQVA 2A6HF 2FFHA 1BR1A 1C17M 3E9VA 3C18A 5CI9A 4D4NA 1SMYF 1Y4CA 5DS6A 1ZHZA 2R7SA 4ZLDA 1XZQA 3N2ZB 1RJ9A 5IY5C 3Q7LA 4LDRA 2YLGA 4MTOA 2IOQA 2Y3BA 4EBBA 3C62A 2HV7A 3ZQVA 3I5QA 2W9YA 2GDCA 1D1AA 1ZHXA 1WWPA 3HNIA 4MVOA 2OEVA 3QMKA 3B0VC 1VMAA 3NMJA 2OJQA 1I4YA 2CW0F 4C7OA 2PX3A 4MW3A 1J8YF 4OIPF 4XEFA 2Q4FA 3X1OA 4LDQA 4PJLA 3SNHA 3U8PA 2JX0A 2YL3A 4XPXA 1WN0A 2V26A 3GORA 1T6IA 2R7OA 1SF8A 4YJWA 5KYWA 4WGYA 2XXAA 1UFBA 2J9UA 1T6UA 3VM6A 2WVNA 4M63A 2YZSA 5EK0A 1Q0FA 1HMOA 3EPVA 2L6FA 3F46A 1FFTC 1Q0GA 3QVZA 4U9EA 2VC9A 4BJ1A 1ZZPA 5AC5A 1KU2A 2R7XA 2EIKC 1OCRC 2W4BA 2YVKA 1LPEA 5JRAA 2XSEA 2XLDA 2XS8A 2WB7A 1IZMA 3C8ZA 4JEAA 3NYLA 4MNDA 1WTYA 1Q0DA 4JURI 1NG1A 2XRHA 3RF3A 2R7VA 1XWJA 3ABMC 2HMZA 2XM0A 3C7JA 5KYXB 5DQTA 3EGXB 3JSZA 4BJ6A 3BRJA 2AVKA 3L8IA 4PFPA 3RW0A 4JRZA 1MMDA 1UG7A 5DVWA 1E84A 3U8VA 2I15A 3V5XA 4K0DA 1RCPA 3IHUA 2OCCC 1FMVA 3RFYA 2XLEA 2VCAA 1PD1A 1NZEA 1OW6A 2H7OA 3EJNA 3MLGA 2AWYA 3MX3A 4O6YA 4MQ9F 4P9FA 1BZ4A 4HEAJ 4JIOA 3ZQYA 2YRFA 1GGQA 3US6A 1OQCA 5KYUB 1SZIA 4UDVA 4E7SA 1LI5A 3DJNB 4U5HA 2O9XA 1OKKA 2YL7A 2EPNA 3LNMB 1FTSA 1CGME 5FCLA 2EIMC 4CDYA 2Q9AA 2CCYA 1I4ZA 2KQ9A 2L7AA 3AGUA 4G7ZF 2JD3A 1N1CA 4QI2A 2G3KA 2QUPA 1ZHTA 1M6TA 2QTVA 1BR4A 1GQAA 1LKXA 1OCCC 1Z6AA 2MHRA 2YL1A 3LESA 2CYDA 3BEHA 1YZAA 3JT1A 3U9JA 3HNLA 3PMRA 3PCVA 5A6JA 5E2QA 1LE4A 1RMVA 1ORSC 3B29A 1C03A 3QW0A 2KJGA 2XL8A 2A6EF 3GEEA 4AL0A 1ZHWA 2VASA 3N0TA 2OU6A 2YLIA 1ZW2A 3EHNA 5BQGA 1VLSA 1YYJA 2L6HA 3A9CA 2CNWA 2NG1A 2ZD9A 4PJMA 1R4TA 1TKNA 2WVQA 1LVKA 2M64A 4YWQA 2NUTB 2LSEA 1H9GA 3JCUQ 3K1IA 1YLMA 2R05A 4JZAA 1A0BA 3EH2A 2Y3HA 4PACA 2ETSA 4JVSA 5B3SC 2P0NA 3V7OA 4KNWA 4EBKA 2HMQA 2J9BA 2R7TA 3HJCA 5EGYA 3S9OA 2PBEA 4JJFA 3X2QC 1D0YA 5BQHA 1FR0A 1LS1A 2LP4A 3U2MA 4ER9A 4QDLA 2OKUA 4G78A 4O6MA 4U5GA 1DOWA 2KK1A 5L0CA 3DE9A 1PD0A 4YL1A 3AOUA 4NQFA 3GM2A 1G8XA 3NG1A 2WZGA 4HFFB 3RH3A 3JRTA 1YAUO 4MVRA 3RYLA 1NBBA 1OR2A 3EGDB 4QI0A 1I5NA 5F28E 2J9WA 1LM3B 1ZW3A 3EFOA 2KYHA 1VLTA 1OXBA 2R02A 3JSEO 5T1DB 3H2UA 1RXQA 3LS0A 4YT8A 3CZ6A 4N6HA 4O79A 3DI5A 2XLWA 1F1MA 3NKDA 4YL3A 3TK0A 4BJTA 3JYHA 1M2VB 1HW2A 2NUPA 4JJGA 1ZVZA 2HZ8A 4CS9A 4MVQA 3U2LA 4ZLCA 1EKYA 1CPQA 4X0RA 3GANA 3E70C 3RVYA 3EZHA 4WABA 5JT4A 4BJ5A 3T6JA 3FAJA 3ZVRA 4G7HF 1NFOA 2E87A 1AVOB 2F22A 2H8AA 1BDJB 1TWCA 2DYRC 2PF4E 2Y3DA 3G4ZA 3K1IC 3O6XA 1RJ9B 3HKKA 3Q7GA 3RQGA 3AG3C 3LNRA 1G5ZA 3NRHA 4EBJA 4K7BA 1LI7A 4E0HA 4EKWA 3ZG1A 3TULA 3NYJA 2P1AA 1T6QA 4LACB 2IM8A 4U5EE 4C7OB 3S29A 3ZC4A 3ASNC 1WOLA 3VAYA 1H9TA 4JTCB 2BL2A 1V55C 2AP3A 2UUHA 4GEHA 256BA 3H2VA 4BG0A 2R7WA 3JZ0A 1MNEA 4ULVA 4J7YA 3U3BA 4C3DA 1OCOC 1ORYA 3FMSA 2XXAB 2XLHA 3LLKA 3KKBA 4MS2A 4XEVA 3U9MA 1A41A 2XLMA 3O39A 4DRIB 4I44A 4U5CE 4CJOA 1W2WA 1T01A 1RKCA 1U89A 4CS8C 3QVYA 1JPNA 4XEKA 1OW8A 1E86A 2H7VC 2HS5A 2WZLA 4IARA 3FDQA 3NYMA 3R7CA 2ASRA 1Z23A 3UGPA 1B68A 2R9RB 2WL8A 4Z9JA 4BEJA 3DZAA 5AC4A 4OD4A 5CIVA 3LAYA 3G50A 3C8GA 2Q3TA 3T4RA 5L0HA 2UUIA 5DLJA 4XLPF 3NDBB 1LE2A 5D92A 4ONSA 3W2WA 2MYSA 4DJ9A 5A6BA 5DS5A 3FOOA 2V3CC 3VYWA 5B3IA 2RD9A 2HFIA 1ZHYA 5B1BC 4YN0B 4IWBA 2HJ3A 2QY9A 5KYUA 3SXYA 4DVYP 2OJED 4BJ5C 2A68F 1RKEA 1E2XA 3GWNA 2MWQA 1L7CA 3LUTB 4AX2A 4MVSA 4Q7CA 5EHHA 4G7OF 4OIRF 2KNHA 3CAXA 5BUOA 2LCHA 2IXNA 2YQYA 1JRAA 3KYJA 3GWLA 3K6BA 4YT2A 4CS8A 1VOMA 1V74B 5KYWB 5A6BD 4DBRA 1OW7A 1YDIA 4PJNA 3ECSA 4I1MA 2VCBA 2WVOA 3EH1A 2A69F 3FXHA 4L6RA 5L0GA 1ZU4A 4JCHA 2R7RA 3MYIA 1K05A 4KNVA 2EPOA 3TQOA 5L3VA 2VH3A 2LFDA 2HKVA 1MMGA 3ABLC 4DRHB 1QVXA 4YL0A 4IAOA 5GPGB 1WATA 2OOCA 4IJJA 4IRUA 2W4MA 3I5PA 3QZCA 2X0CA 3UR3C 2AWCA 1Q0MA 3T6BA 3IPMO 2YL0A 5KYYB 3J06A 2R7UA 3MFNA 3SXMA 3M79A 2DI3A 4C3EA 1GM5A 1NFNA 2Q7RA 1QZXA 4OD5A 1ST6A 3LJBA 1FFHA 3B0UX 2R25A 1HMDA 2NSGA 4H4KC 3OWTA 5T3WA 4DOZA 4OIQF 3DJUB 1NLXA 3IQCA 3RKOF 3AGTA 4CJGA 4LERA 4YK5A 2OEXA 1AEPA 4MTFA 4E17A 2ZXRA 1C02A 4PJJA 3WG7C 4AE4B 1QLEC 1APCA 3ABKC 3NMIA 2D5RB 4DXWA 3JRMO 4JKVA 1BR2A 3V5YA 4CS9C 4J30B 1CGNA 1H7IA 2CNWD 3DWWA 3QTHA 4JEBA 1JAFA 1NU9C 4AK9A 3FOPA 4AL1A 2B0HA 1ZU5A 2J9VA 4LLCA 4CSAA 2L6GA 2H7BA 5L0DA 1TWAA 4N6CA 4FESA 3LS1A 4MVMA 2GA0A 5AGFA 4IB4A 3KH2A 3SZRA 4BEMJ 5A6KA 3S0XA 2KC3A 1PV3A 2L81A 2FAPB 2J0XA 5JUAA 4C3BA 2GWWA 3S84A 1U0BB 2KW3C 4HE8D 4H54A 5A6AA 1TQGA 4KI2A 1FMWA 3WAQA 3ZTZA 1QKRA 4JE9A 2A1DD 2YWAA 4XLNF 3M4BA 2GFHA 4CS7A 2NSFA 4MVUA 2EILC 3ZWIA 4B6IA 1E85A 1M56C 2IXMA 3LEOA 4JCZA 1K04A 2A0BA 1Q0KA 1MMAA 4FX5A 4GQHA 4DBQA 2YLDA 3HNJA 2OG2A 3NKEA
chains in the Genus database with same CATH topology
2Q9CA 3EQLF 5E3CA 4E7ZA 2I8BA 2WZFA 3AQBA 2PX0A 4XTKA 1M57C 4U5DE 2HV6A 3EG9A 2L9JA 4G0HA 2IXPA 2ZXOA 3EZIA 5F5HA 4F4BA 2EIJC 3PHF2 3UMIA 5CI8A 3DAFA 1WGWA 2XL4A 1Z3IX 4P6IC 3UGOA 4J32B 3K1HA 3L0IA 2J46A 3B0PA 3FHDA 4PK4A 2VB6A 2YEVA 4XWJA 3FVYA 2EINC 1M2VA 2CDQA 2G3VA 2B0JA 3HLZA 3AG1C 3W2VA 3UMHA 3EHMA 2ZXWC 4CIHA 5D91A 5DQZA 3CSKA 3S27A 3EGXA 1Z63A 3K33A 3IEEA 4RBNA 2M4EA 3HTKC 5KYNA 1D0XA 2X51A 2C03A 1OKKD 4RD9A 5DS4A 3RIPA 3WODF 3AG4C 2J0WA 3OA1A 1VYKA 4U5FE 3H65A 4NY3A 4YT5A 5E3AA 2J7PD 3SYNA 4JW1A 3K66A 4EWCA 2BE5F 5L3QA 3Q6NA 1Z5ZA 2P7VA 3S28A 3GODA 2Y3GA 1D1CA 3ITFA 1M2OA 4I3MA 2IXOA 3I4UA 4I1OB 5KYXA 3SP1A 3KL4A 2Q9BA 4KC9A 4PFOA 1MNDA 4W8KA 3DAGA 5B1AC 2NUTA 2Y39A 3CQZA 3DXJF 1V54C 3DM5A 3POVA 1J8MF 4LLEA 3DMDA 3L34A 4AE4A 1ZYRF 2G62A 3LLIA 4FWVA 2Z15A 3UNGC 3Q6MA 4WJ0A 4HFKB 3OEOA 4CBEA 2Y69C 3UMKA 3B9QA 2P6VA 4Q4ZF 3LEVA 1VYIA 1TR2A 2KGOA 4YT4A 4OIOF 2YHSA 3EFOB 2ZPAA 3AQCA 1D1BA 4CSAC 2R7QA 2PFDA 5KYYA 2W45A 2DGJA 3M1CB 2NUPB 1O5HA 4KBLA 4GYTA 4RDAA 4OINF 1VK5A 3ZSUA 1IW7F 2C04A 4ULWA 1S7ZA 1O87A 3EG9B 4BJ6C 3TD7A 3K7DA 1JPJA 1TWHA 3DM9B 3ASOC 2ZXPA 3SEOA 1MMNA 4N06A 1D0ZA 3W8IA 3F47A 4ANJA 3DD7A 2DYSC 5T3TA 2CGEA 2J7PA 2J45A 2IYLD 3N24A 3KMIA 1OCZC 3EGDA 5E33A 4O7GA 4U5BE 1TWGA 4DVZA 5F5FA 2PP4A 4Q5SF 4O6NA 3ZIBA 3AG2C 2FGYA 1NU7D 3W8HA 1PCXA 4A2NB 2A6HF 2FFHA 1BR1A 3E9VA 5CI9A 1SMYF 2R7SA 5DS6A 1ZHZA 4ZLDA 3N2ZB 1RJ9A 5IY5C 3Q7LA 2IOQA 2Y3BA 4EBBA 2HV7A 3I5QA 2W9YA 1D1AA 1ZHXA 3QMKA 3B0VC 1VMAA 2CW0F 4C7OA 2PX3A 4OIPF 1J8YF 3X1OA 4PJLA 3SNHA 2V26A 2R7OA 1SF8A 4YJWA 5KYWA 2XXAA 2J9UA 2WVNA 4M63A 2YZSA 3EPVA 4BJ1A 3F46A 1FFTC 1KU2A 2R7XA 2EIKC 1OCRC 2W4BA 2XSEA 4QDLA 4MNDA 2WB7A 1IZMA 5HSWA 3NYLA 4JURI 2R7VA 1NG1A 2XRHA 3ABMC 5KYXB 5DQTA 3EGXB 3JSZA 4BJ6A 4PFPA 1MMDA 5DVWA 4K0DA 2OCCC 1FMVA 3RFYA 3MX3A 1PD1A 1NZEA 2H7OA 3EJNA 3MLGA 4O6YA 5DLJA 3S0XA 4MQ9F 4HEAJ 5KYUB 1SZIA 4E7SA 4U5HA 3DJNB 2O9XA 1OKKA 1FTSA 5FCLA 2EIMC 2Q9AA 2KQ9A 4G7ZF 2JD3A 1N1CA 4QI2A 2G3KA 1ZHTA 2QTVA 1BR4A 1Z6AA 1LKXA 1OCCC 3LESA 3JT1A 3PMRA 5E2QA 2KJGA 2A6EF 1ZHWA 2VASA 3N0TA 3EHNA 2CNWA 2NG1A 4PJMA 1TKNA 2WVQA 1LVKA 4YWQA 2NUTB 2LSEA 3JCUQ 4JZAA 3EH2A 2Y3HA 4JVSA 5B3SC 3V7OA 4KNWA 2R7TA 3HJCA 5EGYA 4JJFA 3X2QC 1D0YA 1LS1A 4O6MA 4U5GA 1PD0A 1G8XA 3NG1A 2WZGA 4HFFB 3RH3A 3JRTA 3RYLA 3EGDB 4QI0A 2J9WA 5T1DB 3EFOA 3UGPA 4YT8A 3LS0A 3CZ6A 4O79A 4BJTA 3NKDA 3JYHA 1M2VB 2NUPA 4JJGA 4CS9A 4ZLCA 4X0RA 3GANA 3E70C 3EZHA 4BJ5A 3T6JA 3FAJA 3ZVRA 4G7HF 2E87A 2Y3DA 3K1IC 3ZC4A 1TWCA 2DYRC 2PF4E 3O6XA 1RJ9B 3Q7GA 3AG3C 3LNRA 3NRHA 4K7BA 3ZG1A 3NYJA 4LACB 4U5EE 4C7OB 3S29A 3ASNC 3VAYA 1V55C 4GEHA 2R7WA 4BG0A 1MNEA 4C3DA 1OCOC 2XXAB 3LLKA 3KKBA 3O39A 4I44A 4U5CE 1W2WA 4CS8C 1JPNA 2H7VC 2WZLA 3FDQA 3NYMA 1Z23A 2WL8A 4BEJA 3DZAA 4OD4A 3LAYA 2Q3TA 3T4RA 4XLPF 3NDBB 5D92A 3W2WA 2MYSA 5DS5A 2V3CC 3VYWA 1ZHYA 5B1BC 4YN0B 4IWBA 2QY9A 5KYUA 4DVYP 4BJ5C 2A68F 2MWQA 4AX2A 4Q7CA 5EHHA 4G7OF 4OIRF 2KNHA 5BUOA 2IXNA 3K6BA 4YT2A 4CS8A 1VOMA 5KYWB 4DBRA 4PJNA 3ECSA 4I1MA 2WVOA 3EH1A 2A69F 1ZU4A 4JCHA 2R7RA 5L3VA 4KNVA 2VH3A 3ABLC 1MMGA 4IAOA 4IJJA 4IRUA 2W4MA 3I5PA 3QZCA 3UR3C 3T6BA 5KYYB 2R7UA 4C3EA 1QZXA 4OD5A 1ST6A 3LJBA 1FFHA 3B0UX 5T3WA 4H4KC 3OWTA 4DOZA 4OIQF 3DJUB 3RKOF 4LERA 2ZXRA 4PJJA 3WG7C 4AE4B 1QLEC 3ABKC 2D5RB 1BR2A 4CS9C 4J30B 2CNWD 1NU9C 4AK9A 1ZU5A 2J9VA 4LLCA 4CSAA 2H7BA 1TWAA 4FESA 3LS1A 3KH2A 3SZRA 2L81A 2J0XA 4C3BA 2KW3C 4HE8D 4KI2A 1FMWA 2A1DD 4XLNF 2GFHA 4CS7A 2EILC 4B6IA 1M56C 2IXMA 4DBQA 1MMAA 4FX5A 2OG2A 3NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZLD A;  4ZLC A;  4QI0 A;  4YWQ A;  3X1O A;  4ULW A;  5F5F A;  4QI2 A;  5F5H A; 
#chains in the Genus database with same CATH topology
 1DOV A;  2Q9C A;  3EQL F;  5E3C A;  4E7Z A;  2I8B A;  2R03 A;  1OXK A;  2WZF A;  1QPU A;  3NMK A;  5L0J A;  3AQB A;  2PX0 A;  4XTK A;  1M57 C;  4U5D E;  1GS9 A;  2HV6 A;  3EG9 A;  4MTG A;  2L9J A;  4G0H A;  2IXP A;  2GAQ A;  1QSP A;  2ZXO A;  3EZI A;  5F5H A;  4F4B A;  2EIJ C;  3PHF 2;  3M15 A;  3UMI A;  5CI8 A;  3DAF A;  3IQ6 A;  3U3F A;  3MYF A;  1WGW A;  2XL4 A;  1Z3I X;  4P6I C;  3UGO A;  1YAR O;  4J32 B;  4J7T A;  2HSB A;  3K1H A;  3L0I A;  2J46 A;  3B0P A;  3FHD A;  2Q00 A;  3AJM A;  4IGG A;  4PK4 A;  4W8P A;  5FZT A;  2VB6 A;  2YEV A;  4XWJ A;  4FAP B;  3KYI A;  1JR8 A;  3FVY A;  3ZDL A;  2EIN C;  1H6G A;  1M2V A;  2CDQ A;  2G3V A;  2XM4 A;  2B0J A;  3HLZ A;  3AG1 C;  3T6G B;  3TJ6 A;  3UMH A;  3W2V A;  3EHM A;  1TFO B;  3O10 A;  2ZXW C;  3HNK A;  1LS4 A;  4K1O A;  4CIH A;  5D91 A;  1YYX A;  5DQZ A;  5HV9 A;  2HUJ A;  3CSK A;  3VF0 A;  3S27 A;  4CX9 A;  1JOG A;  3EGX A;  5TJ5 E;  1Z63 A;  4PR9 A;  3K33 A;  3IEE A;  4RBN A;  5L0I A;  2M4E A;  3JYY A;  3HTK C;  5KYN A;  3WHN A;  1D0X A;  3RQF A;  2TMV P;  1T5O A;  2X51 A;  3A11 A;  2C03 A;  3ATP A;  2A0U A;  3DE8 A;  1RKE B;  1OKK D;  1YZC A;  2J8W A;  4JTD B;  1LIH A;  3VRC A;  1KNY A;  2HJM A;  4RD9 A;  5DS4 A;  3O55 A;  3RIP A;  3WOD F;  3AG4 C;  2LIG A;  2J0W A;  1VB5 A;  3C8G D;  3OA1 A;  1HY5 A;  1VYK A;  2PNO A;  1G4U S;  2JPU A;  4U5F E;  3H65 A;  4NY3 A;  4NTA A;  4YT5 A;  5E3A A;  2J7P D;  1CPR A;  4CDV A;  1OR3 A;  4JW1 A;  3SYN A;  1XZP A;  3K66 A;  2QE9 A;  4EWC A;  1HE9 A;  2BE5 F;  1Z7Q c;  5JS5 A;  5L3Q A;  3Q6N A;  1VTM P;  1FNT c;  1Z5Z A;  1ORJ A;  2EPM X;  1CGO A;  2P7V A;  3S28 A;  5JLI A;  3GOD A;  4N4W A;  3W4Y A;  3QW1 A;  1V4A A;  2NPU A;  4NTF A;  1EI7 A;  2HSQ A;  2Y3G A;  4MVZ A;  4P9T A;  1D1C A;  4EHP A;  1A7D A;  3ITF A;  4WGZ A;  4BPM A;  4EIY A;  1M2O A;  2QLA A;  4I3M A;  2IXO A;  3I4U A;  4I1O B;  3C8G B;  3GEI A;  5KYX A;  3SP1 A;  3KL4 A;  2Q9B A;  4KC9 A;  3FAP B;  1MND A;  4PFO A;  4A4A A;  4CIP A;  4W8K A;  5JSL A;  3DAG A;  3IQT A;  5B1A C;  5COF A;  2NUT A;  2P61 A;  2KSF A;  3JTL O;  2XS1 A;  2Y39 A;  1V54 C;  3DXJ F;  3DM5 A;  3CQZ A;  4NC3 A;  1J8M F;  4LLE A;  3POV A;  3DMD A;  3L34 A;  4AE4 A;  1ZYR F;  4LDK A;  1KTM A;  1EA8 A;  2G62 A;  3SXZ A;  1A7E A;  3IQ5 A;  3PDM P;  1T9K A;  1O3U A;  4U9D A;  2VCC A;  1U6H A;  1AUE A;  1YVI A;  3LLI A;  4JC7 A;  3SXK A;  4FWV A;  2Z15 A;  3UNG C;  3Q6M A;  3V5Z A;  4WJ0 A;  4DRJ B;  2IBF A;  4R32 A;  4HFK B;  1SR2 A;  3B71 A;  3OEO A;  2LK4 A;  4CBE A;  3DKA A;  2Y69 C;  3L1M A;  1NSG B;  4NTB A;  3B9Q A;  3UMK A;  2P6V A;  4E0I A;  1E83 A;  4Q4Z F;  3LEV A;  1VYI A;  1TR2 A;  2KGO A;  4YT4 A;  2RSE B;  2YHS A;  3EFO B;  2QNL A;  4OIO F;  4IAQ A;  2ZPA A;  4MW8 A;  3AQC A;  1D1B A;  3T9O A;  3RQE A;  4CSA C;  2R7Q A;  2PFD A;  1YA9 A;  3ZTM A;  3MBG A;  2W45 A;  5KYY A;  2DGJ A;  1SYQ A;  3CEX A;  3M1C B;  1EQ1 A;  1JMW A;  2NUP B;  1O5H A;  3GM1 A;  2ICW G;  1QQ3 A;  1TFK B;  4NCQ A;  4KBL A;  1WAS A;  5HSW A;  4GYT A;  4RDA A;  3G4X A;  4OIN F;  3S90 A;  1VK5 A;  3ZSU A;  1IW7 F;  1HW1 A;  2C04 A;  4ULW A;  1S7Z A;  1O87 A;  3M4C A;  3U5S A;  4Z9H A;  5L0F A;  5JP7 A;  3EG9 B;  4BJ6 C;  3C63 A;  2XLO A;  3TD7 A;  1L3P A;  1TWH A;  1JPJ A;  3DM9 B;  3K7D A;  4XPY A;  3ASO C;  2ZXP A;  3SEO A;  1R5I D;  1Y6D A;  1YA7 O;  1MMN A;  2AU5 A;  4N06 A;  1D0Z A;  5COG A;  2OQM A;  3U0C A;  3RVZ A;  5COM A;  2BC5 A;  2EPL X;  4D4X A;  3W8I A;  3F47 A;  1BBH A;  2LD6 A;  4E18 A;  4ANJ A;  3DD7 A;  3GEH A;  4XQ1 A;  2DYS C;  2XLV A;  5T3T A;  1G4W R;  2CGE A;  2J7P A;  2J45 A;  4XPW A;  1FAP B;  2IYL D;  3N24 A;  3KMI A;  1OCZ C;  1HE1 A;  3EGD A;  5BQI A;  4Z9I A;  4O7G A;  5E33 A;  4U5B E;  4CDA A;  3TJ5 A;  2LFF A;  2DB4 A;  2LQG A;  1TWG A;  5K0I A;  4DVZ A;  5F5F A;  3R2P A;  3TOM A;  2PP4 A;  4Q5S F;  1YJG A;  1A7V A;  4O6N A;  3ZIB A;  3AG2 C;  4EUK B;  1S05 A;  2FGY A;  2XL6 A;  3GM3 A;  1K40 A;  5JVE A;  3TOL A;  2EPK X;  1NU7 D;  3W8H A;  2D4U A;  2YKZ A;  4JTA B;  5A69 A;  3L8J A;  3KPH A;  1PCX A;  4A2N B;  1MQV A;  2A6H F;  2FFH A;  1BR1 A;  1C17 M;  3E9V A;  3C18 A;  5CI9 A;  4D4N A;  1SMY F;  1Y4C A;  5DS6 A;  1ZHZ A;  2R7S A;  4ZLD A;  1XZQ A;  3N2Z B;  1RJ9 A;  5IY5 C;  3Q7L A;  4LDR A;  2YLG A;  4MTO A;  2IOQ A;  2Y3B A;  4EBB A;  3C62 A;  2HV7 A;  3ZQV A;  3I5Q A;  2W9Y A;  2GDC A;  1D1A A;  1ZHX A;  1WWP A;  3HNI A;  4MVO A;  2OEV A;  3QMK A;  3B0V C;  1VMA A;  3NMJ A;  2OJQ A;  1I4Y A;  2CW0 F;  4C7O A;  2PX3 A;  4MW3 A;  1J8Y F;  4OIP F;  4XEF A;  2Q4F A;  3X1O A;  4LDQ A;  4PJL A;  3SNH A;  3U8P A;  2JX0 A;  2YL3 A;  4XPX A;  1WN0 A;  2V26 A;  3GOR A;  1T6I A;  2R7O A;  1SF8 A;  4YJW A;  5KYW A;  4WGY A;  2XXA A;  1UFB A;  2J9U A;  1T6U A;  3VM6 A;  2WVN A;  4M63 A;  2YZS A;  5EK0 A;  1Q0F A;  1HMO A;  3EPV A;  2L6F A;  3F46 A;  1FFT C;  1Q0G A;  3QVZ A;  4U9E A;  2VC9 A;  4BJ1 A;  1ZZP A;  5AC5 A;  1KU2 A;  2R7X A;  2EIK C;  1OCR C;  2W4B A;  2YVK A;  1LPE A;  5JRA A;  2XSE A;  2XLD A;  2XS8 A;  2WB7 A;  1IZM A;  3C8Z A;  4JEA A;  3NYL A;  4MND A;  1WTY A;  1Q0D A;  4JUR I;  1NG1 A;  2XRH A;  3RF3 A;  2R7V A;  1XWJ A;  3ABM C;  2HMZ A;  2XM0 A;  3C7J A;  5KYX B;  5DQT A;  3EGX B;  3JSZ A;  4BJ6 A;  3BRJ A;  2AVK A;  3L8I A;  4PFP A;  3RW0 A;  4JRZ A;  1MMD A;  1UG7 A;  5DVW A;  1E84 A;  3U8V A;  2I15 A;  3V5X A;  4K0D A;  1RCP A;  3IHU A;  2OCC C;  1FMV A;  3RFY A;  2XLE A;  2VCA A;  1PD1 A;  1NZE A;  1OW6 A;  2H7O A;  3EJN A;  3MLG A;  2AWY A;  3MX3 A;  4O6Y A;  4MQ9 F;  4P9F A;  1BZ4 A;  4HEA J;  4JIO A;  3ZQY A;  2YRF A;  1GGQ A;  3US6 A;  1OQC A;  5KYU B;  1SZI A;  4UDV A;  4E7S A;  1LI5 A;  3DJN B;  4U5H A;  2O9X A;  1OKK A;  2YL7 A;  2EPN A;  3LNM B;  1FTS A;  1CGM E;  5FCL A;  2EIM C;  4CDY A;  2Q9A A;  2CCY A;  1I4Z A;  2KQ9 A;  2L7A A;  3AGU A;  4G7Z F;  2JD3 A;  1N1C A;  4QI2 A;  2G3K A;  2QUP A;  1ZHT A;  1M6T A;  2QTV A;  1BR4 A;  1GQA A;  1LKX A;  1OCC C;  1Z6A A;  2MHR A;  2YL1 A;  3LES A;  2CYD A;  3BEH A;  1YZA A;  3JT1 A;  3U9J A;  3HNL A;  3PMR A;  3PCV A;  5A6J A;  5E2Q A;  1LE4 A;  1RMV A;  1ORS C;  3B29 A;  1C03 A;  3QW0 A;  2KJG A;  2XL8 A;  2A6E F;  3GEE A;  4AL0 A;  1ZHW A;  2VAS A;  3N0T A;  2OU6 A;  2YLI A;  1ZW2 A;  3EHN A;  5BQG A;  1VLS A;  1YYJ A;  2L6H A;  3A9C A;  2CNW A;  2NG1 A;  2ZD9 A;  4PJM A;  1R4T A;  1TKN A;  2WVQ A;  1LVK A;  2M64 A;  4YWQ A;  2NUT B;  2LSE A;  1H9G A;  3JCU Q;  3K1I A;  1YLM A;  2R05 A;  4JZA A;  1A0B A;  3EH2 A;  2Y3H A;  4PAC A;  2ETS A;  4JVS A;  5B3S C;  2P0N A;  3V7O A;  4KNW A;  4EBK A;  2HMQ A;  2J9B A;  2R7T A;  3HJC A;  5EGY A;  3S9O A;  2PBE A;  4JJF A;  3X2Q C;  1D0Y A;  5BQH A;  1FR0 A;  1LS1 A;  2LP4 A;  3U2M A;  4ER9 A;  4QDL A;  2OKU A;  4G78 A;  4O6M A;  4U5G A;  1DOW A;  2KK1 A;  5L0C A;  3DE9 A;  1PD0 A;  4YL1 A;  3AOU A;  4NQF A;  3GM2 A;  1G8X A;  3NG1 A;  2WZG A;  4HFF B;  3RH3 A;  3JRT A;  1YAU O;  4MVR A;  3RYL A;  1NBB A;  1OR2 A;  3EGD B;  4QI0 A;  1I5N A;  5F28 E;  2J9W A;  1LM3 B;  1ZW3 A;  3EFO A;  2KYH A;  1VLT A;  1OXB A;  2R02 A;  3JSE O;  5T1D B;  3H2U A;  1RXQ A;  3LS0 A;  4YT8 A;  3CZ6 A;  4N6H A;  4O79 A;  3DI5 A;  2XLW A;  1F1M A;  3NKD A;  4YL3 A;  3TK0 A;  4BJT A;  3JYH A;  1M2V B;  1HW2 A;  2NUP A;  4JJG A;  1ZVZ A;  2HZ8 A;  4CS9 A;  4MVQ A;  3U2L A;  4ZLC A;  1EKY A;  1CPQ A;  4X0R A;  3GAN A;  3E70 C;  3RVY A;  3EZH A;  4WAB A;  5JT4 A;  4BJ5 A;  3T6J A;  3FAJ A;  3ZVR A;  4G7H F;  1NFO A;  2E87 A;  1AVO B;  2F22 A;  2H8A A;  1BDJ B;  1TWC A;  2DYR C;  2PF4 E;  2Y3D A;  3G4Z A;  3K1I C;  3O6X A;  1RJ9 B;  3HKK A;  3Q7G A;  3RQG A;  3AG3 C;  3LNR A;  1G5Z A;  3NRH A;  4EBJ A;  4K7B A;  1LI7 A;  4E0H A;  4EKW A;  3ZG1 A;  3TUL A;  3NYJ A;  2P1A A;  1T6Q A;  4LAC B;  2IM8 A;  4U5E E;  4C7O B;  3S29 A;  3ZC4 A;  3ASN C;  1WOL A;  3VAY A;  1H9T A;  4JTC B;  2BL2 A;  1V55 C;  2AP3 A;  2UUH A;  4GEH A;  256B A;  3H2V A;  4BG0 A;  2R7W A;  3JZ0 A;  1MNE A;  4ULV A;  4J7Y A;  3U3B A;  4C3D A;  1OCO C;  1ORY A;  3FMS A;  2XXA B;  2XLH A;  3LLK A;  3KKB A;  4MS2 A;  4XEV A;  3U9M A;  1A41 A;  2XLM A;  3O39 A;  4DRI B;  4I44 A;  4U5C E;  4CJO A;  1W2W A;  1T01 A;  1RKC A;  1U89 A;  4CS8 C;  3QVY A;  1JPN A;  4XEK A;  1OW8 A;  1E86 A;  2H7V C;  2HS5 A;  2WZL A;  4IAR A;  3FDQ A;  3NYM A;  3R7C A;  2ASR A;  1Z23 A;  3UGP A;  1B68 A;  2R9R B;  2WL8 A;  4Z9J A;  4BEJ A;  3DZA A;  5AC4 A;  4OD4 A;  5CIV A;  3LAY A;  3G50 A;  3C8G A;  2Q3T A;  3T4R A;  5L0H A;  2UUI A;  5DLJ A;  4XLP F;  3NDB B;  1LE2 A;  5D92 A;  4ONS A;  3W2W A;  2MYS A;  4DJ9 A;  5A6B A;  5DS5 A;  3FOO A;  2V3C C;  3VYW A;  5B3I A;  2RD9 A;  2HFI A;  1ZHY A;  5B1B C;  4YN0 B;  4IWB A;  2HJ3 A;  2QY9 A;  5KYU A;  3SXY A;  4DVY P;  2OJE D;  4BJ5 C;  2A68 F;  1RKE A;  1E2X A;  3GWN A;  2MWQ A;  1L7C A;  3LUT B;  4AX2 A;  4MVS A;  4Q7C A;  5EHH A;  4G7O F;  4OIR F;  2KNH A;  3CAX A;  5BUO A;  2LCH A;  2IXN A;  2YQY A;  1JRA A;  3KYJ A;  3GWL A;  3K6B A;  4YT2 A;  4CS8 A;  1VOM A;  1V74 B;  5KYW B;  5A6B D;  4DBR A;  1OW7 A;  1YDI A;  4PJN A;  3ECS A;  4I1M A;  2VCB A;  2WVO A;  3EH1 A;  2A69 F;  3FXH A;  4L6R A;  5L0G A;  1ZU4 A;  4JCH A;  2R7R A;  3MYI A;  1K05 A;  4KNV A;  2EPO A;  3TQO A;  5L3V A;  2VH3 A;  2LFD A;  2HKV A;  1MMG A;  3ABL C;  4DRH B;  1QVX A;  4YL0 A;  4IAO A;  5GPG B;  1WAT A;  2OOC A;  4IJJ A;  4IRU A;  2W4M A;  3I5P A;  3QZC A;  2X0C A;  3UR3 C;  2AWC A;  1Q0M A;  3T6B A;  3IPM O;  2YL0 A;  5KYY B;  3J06 A;  2R7U A;  3MFN A;  3SXM A;  3M79 A;  2DI3 A;  4C3E A;  1GM5 A;  1NFN A;  2Q7R A;  1QZX A;  4OD5 A;  1ST6 A;  3LJB A;  1FFH A;  3B0U X;  2R25 A;  1HMD A;  2NSG A;  4H4K C;  3OWT A;  5T3W A;  4DOZ A;  4OIQ F;  3DJU B;  1NLX A;  3IQC A;  3RKO F;  3AGT A;  4CJG A;  4LER A;  4YK5 A;  2OEX A;  1AEP A;  4MTF A;  4E17 A;  2ZXR A;  1C02 A;  4PJJ A;  3WG7 C;  4AE4 B;  1QLE C;  1APC A;  3ABK C;  3NMI A;  2D5R B;  4DXW A;  3JRM O;  4JKV A;  1BR2 A;  3V5Y A;  4CS9 C;  4J30 B;  1CGN A;  1H7I A;  2CNW D;  3DWW A;  3QTH A;  4JEB A;  1JAF A;  1NU9 C;  4AK9 A;  3FOP A;  4AL1 A;  2B0H A;  1ZU5 A;  2J9V A;  4LLC A;  4CSA A;  2L6G A;  2H7B A;  5L0D A;  1TWA A;  4N6C A;  4FES A;  3LS1 A;  4MVM A;  2GA0 A;  5AGF A;  4IB4 A;  3KH2 A;  3SZR A;  4BEM J;  5A6K A;  3S0X A;  2KC3 A;  1PV3 A;  2L81 A;  2FAP B;  2J0X A;  5JUA A;  4C3B A;  2GWW A;  3S84 A;  1U0B B;  2KW3 C;  4HE8 D;  4H54 A;  5A6A A;  1TQG A;  4KI2 A;  1FMW A;  3WAQ A;  3ZTZ A;  1QKR A;  4JE9 A;  2A1D D;  2YWA A;  4XLN F;  3M4B A;  2GFH A;  4CS7 A;  2NSF A;  4MVU A;  2EIL C;  3ZWI A;  4B6I A;  1E85 A;  1M56 C;  2IXM A;  3LEO A;  4JCZ A;  1K04 A;  2A0B A;  1Q0K A;  1MMA A;  4FX5 A;  4GQH A;  4DBQ A;  2YLD A;  3HNJ A;  2OG2 A;  3NKE A; 
#chains in the Genus database with same CATH homology
 2Q9C A;  3EQL F;  5E3C A;  4E7Z A;  2I8B A;  2WZF A;  3AQB A;  2PX0 A;  4XTK A;  1M57 C;  4U5D E;  2HV6 A;  3EG9 A;  2L9J A;  4G0H A;  2IXP A;  2ZXO A;  3EZI A;  5F5H A;  4F4B A;  2EIJ C;  3PHF 2;  3UMI A;  5CI8 A;  3DAF A;  1WGW A;  2XL4 A;  1Z3I X;  4P6I C;  3UGO A;  4J32 B;  3K1H A;  3L0I A;  2J46 A;  3B0P A;  3FHD A;  4PK4 A;  2VB6 A;  2YEV A;  4XWJ A;  3FVY A;  2EIN C;  1M2V A;  2CDQ A;  2G3V A;  2B0J A;  3HLZ A;  3AG1 C;  3W2V A;  3UMH A;  3EHM A;  2ZXW C;  4CIH A;  5D91 A;  5DQZ A;  3CSK A;  3S27 A;  3EGX A;  1Z63 A;  3K33 A;  3IEE A;  4RBN A;  2M4E A;  3HTK C;  5KYN A;  1D0X A;  2X51 A;  2C03 A;  1OKK D;  4RD9 A;  5DS4 A;  3RIP A;  3WOD F;  3AG4 C;  2J0W A;  3OA1 A;  1VYK A;  4U5F E;  3H65 A;  4NY3 A;  4YT5 A;  5E3A A;  2J7P D;  3SYN A;  4JW1 A;  3K66 A;  4EWC A;  2BE5 F;  5L3Q A;  3Q6N A;  1Z5Z A;  2P7V A;  3S28 A;  3GOD A;  2Y3G A;  1D1C A;  3ITF A;  1M2O A;  4I3M A;  2IXO A;  3I4U A;  4I1O B;  5KYX A;  3SP1 A;  3KL4 A;  2Q9B A;  4KC9 A;  4PFO A;  1MND A;  4W8K A;  3DAG A;  5B1A C;  2NUT A;  2Y39 A;  3CQZ A;  3DXJ F;  1V54 C;  3DM5 A;  3POV A;  1J8M F;  4LLE A;  3DMD A;  3L34 A;  4AE4 A;  1ZYR F;  2G62 A;  3LLI A;  4FWV A;  2Z15 A;  3UNG C;  3Q6M A;  4WJ0 A;  4HFK B;  3OEO A;  4CBE A;  2Y69 C;  3UMK A;  3B9Q A;  2P6V A;  4Q4Z F;  3LEV A;  1VYI A;  1TR2 A;  2KGO A;  4YT4 A;  4OIO F;  2YHS A;  3EFO B;  2ZPA A;  3AQC A;  1D1B A;  4CSA C;  2R7Q A;  2PFD A;  5KYY A;  2W45 A;  2DGJ A;  3M1C B;  2NUP B;  1O5H A;  4KBL A;  4GYT A;  4RDA A;  4OIN F;  1VK5 A;  3ZSU A;  1IW7 F;  2C04 A;  4ULW A;  1S7Z A;  1O87 A;  3EG9 B;  4BJ6 C;  3TD7 A;  3K7D A;  1JPJ A;  1TWH A;  3DM9 B;  3ASO C;  2ZXP A;  3SEO A;  1MMN A;  4N06 A;  1D0Z A;  3W8I A;  3F47 A;  4ANJ A;  3DD7 A;  2DYS C;  5T3T A;  2CGE A;  2J7P A;  2J45 A;  2IYL D;  3N24 A;  3KMI A;  1OCZ C;  3EGD A;  5E33 A;  4O7G A;  4U5B E;  1TWG A;  4DVZ A;  5F5F A;  2PP4 A;  4Q5S F;  4O6N A;  3ZIB A;  3AG2 C;  2FGY A;  1NU7 D;  3W8H A;  1PCX A;  4A2N B;  2A6H F;  2FFH A;  1BR1 A;  3E9V A;  5CI9 A;  1SMY F;  2R7S A;  5DS6 A;  1ZHZ A;  4ZLD A;  3N2Z B;  1RJ9 A;  5IY5 C;  3Q7L A;  2IOQ A;  2Y3B A;  4EBB A;  2HV7 A;  3I5Q A;  2W9Y A;  1D1A A;  1ZHX A;  3QMK A;  3B0V C;  1VMA A;  2CW0 F;  4C7O A;  2PX3 A;  4OIP F;  1J8Y F;  3X1O A;  4PJL A;  3SNH A;  2V26 A;  2R7O A;  1SF8 A;  4YJW A;  5KYW A;  2XXA A;  2J9U A;  2WVN A;  4M63 A;  2YZS A;  3EPV A;  4BJ1 A;  3F46 A;  1FFT C;  1KU2 A;  2R7X A;  2EIK C;  1OCR C;  2W4B A;  2XSE A;  4QDL A;  4MND A;  2WB7 A;  1IZM A;  5HSW A;  3NYL A;  4JUR I;  2R7V A;  1NG1 A;  2XRH A;  3ABM C;  5KYX B;  5DQT A;  3EGX B;  3JSZ A;  4BJ6 A;  4PFP A;  1MMD A;  5DVW A;  4K0D A;  2OCC C;  1FMV A;  3RFY A;  3MX3 A;  1PD1 A;  1NZE A;  2H7O A;  3EJN A;  3MLG A;  4O6Y A;  5DLJ A;  3S0X A;  4MQ9 F;  4HEA J;  5KYU B;  1SZI A;  4E7S A;  4U5H A;  3DJN B;  2O9X A;  1OKK A;  1FTS A;  5FCL A;  2EIM C;  2Q9A A;  2KQ9 A;  4G7Z F;  2JD3 A;  1N1C A;  4QI2 A;  2G3K A;  1ZHT A;  2QTV A;  1BR4 A;  1Z6A A;  1LKX A;  1OCC C;  3LES A;  3JT1 A;  3PMR A;  5E2Q A;  2KJG A;  2A6E F;  1ZHW A;  2VAS A;  3N0T A;  3EHN A;  2CNW A;  2NG1 A;  4PJM A;  1TKN A;  2WVQ A;  1LVK A;  4YWQ A;  2NUT B;  2LSE A;  3JCU Q;  4JZA A;  3EH2 A;  2Y3H A;  4JVS A;  5B3S C;  3V7O A;  4KNW A;  2R7T A;  3HJC A;  5EGY A;  4JJF A;  3X2Q C;  1D0Y A;  1LS1 A;  4O6M A;  4U5G A;  1PD0 A;  1G8X A;  3NG1 A;  2WZG A;  4HFF B;  3RH3 A;  3JRT A;  3RYL A;  3EGD B;  4QI0 A;  2J9W A;  5T1D B;  3EFO A;  3UGP A;  4YT8 A;  3LS0 A;  3CZ6 A;  4O79 A;  4BJT A;  3NKD A;  3JYH A;  1M2V B;  2NUP A;  4JJG A;  4CS9 A;  4ZLC A;  4X0R A;  3GAN A;  3E70 C;  3EZH A;  4BJ5 A;  3T6J A;  3FAJ A;  3ZVR A;  4G7H F;  2E87 A;  2Y3D A;  3K1I C;  3ZC4 A;  1TWC A;  2DYR C;  2PF4 E;  3O6X A;  1RJ9 B;  3Q7G A;  3AG3 C;  3LNR A;  3NRH A;  4K7B A;  3ZG1 A;  3NYJ A;  4LAC B;  4U5E E;  4C7O B;  3S29 A;  3ASN C;  3VAY A;  1V55 C;  4GEH A;  2R7W A;  4BG0 A;  1MNE A;  4C3D A;  1OCO C;  2XXA B;  3LLK A;  3KKB A;  3O39 A;  4I44 A;  4U5C E;  1W2W A;  4CS8 C;  1JPN A;  2H7V C;  2WZL A;  3FDQ A;  3NYM A;  1Z23 A;  2WL8 A;  4BEJ A;  3DZA A;  4OD4 A;  3LAY A;  2Q3T A;  3T4R A;  4XLP F;  3NDB B;  5D92 A;  3W2W A;  2MYS A;  5DS5 A;  2V3C C;  3VYW A;  1ZHY A;  5B1B C;  4YN0 B;  4IWB A;  2QY9 A;  5KYU A;  4DVY P;  4BJ5 C;  2A68 F;  2MWQ A;  4AX2 A;  4Q7C A;  5EHH A;  4G7O F;  4OIR F;  2KNH A;  5BUO A;  2IXN A;  3K6B A;  4YT2 A;  4CS8 A;  1VOM A;  5KYW B;  4DBR A;  4PJN A;  3ECS A;  4I1M A;  2WVO A;  3EH1 A;  2A69 F;  1ZU4 A;  4JCH A;  2R7R A;  5L3V A;  4KNV A;  2VH3 A;  3ABL C;  1MMG A;  4IAO A;  4IJJ A;  4IRU A;  2W4M A;  3I5P A;  3QZC A;  3UR3 C;  3T6B A;  5KYY B;  2R7U A;  4C3E A;  1QZX A;  4OD5 A;  1ST6 A;  3LJB A;  1FFH A;  3B0U X;  5T3W A;  4H4K C;  3OWT A;  4DOZ A;  4OIQ F;  3DJU B;  3RKO F;  4LER A;  2ZXR A;  4PJJ A;  3WG7 C;  4AE4 B;  1QLE C;  3ABK C;  2D5R B;  1BR2 A;  4CS9 C;  4J30 B;  2CNW D;  1NU9 C;  4AK9 A;  1ZU5 A;  2J9V A;  4LLC A;  4CSA A;  2H7B A;  1TWA A;  4FES A;  3LS1 A;  3KH2 A;  3SZR A;  2L81 A;  2J0X A;  4C3B A;  2KW3 C;  4HE8 D;  4KI2 A;  1FMW A;  2A1D D;  4XLN F;  2GFH A;  4CS7 A;  2EIL C;  4B6I A;  1M56 C;  2IXM A;  4DBQ A;  1MMA A;  4FX5 A;  2OG2 A;  3NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...