4QI2A

X-ray structure of the roq domain from murine roquin-1 in complex with a 23-mer tnf-cde rna
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
153
structure length
153
Chain Sequence
HQNPQQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Structural basis for RNA recognition in roquin-mediated post-transcriptional gene regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 59
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4qi2A00
4ULWA 4QI2A 5F5FA 4QI0A 4ZLCA 3X1OA 4YWQA 4ZLDA 5F5HA
chains in the Genus database with same CATH superfamily
4OIOF 3MLGA 1WN0A 5D92A 3EG9A 5T3WA 1YAUO 3NMIA 4E0HA 1TFKB 2A0BA 2LSEA 3TOMA 3KYIA 4IB4A 1K05A 1D1BA 2D5RB 1LKXA 1W2WA 2KQ9A 4GYTA 4J30B 5HV9A 2UUIA 3U8VA 4OD4A 5KYXB 4CSAC 4CS9A 1T6QA 4XPWA 2TMVP 2DB4A 3LLIA 3NMJA 3DJUB 1JMWA 5CI9A 1Q0MA 2IM8A 4PJNA 1WTYA 2F22A 4P6IC 3ZG1A 4N6HA 1ZHXA 4EBBA 1EKYA 3ZC4A 4G7HF 2JPUA 3JZ0A 3MFNA 1HMDA 3L34A 5F5HA 5E3AA 4PR9A 3T6JA 4U5DE 1ORYA 4B6IA 3Q6MA 2ZXOA 3KH2A 3EG9B 4YN0B 1E85A 1VOMA 2WVQA 2XL8A 3O39A 4M63A 4K1OA 1YYJA 4ULVA 4MVOA 2GDCA 3HKKA 4I3MA 4O79A 2G3VA 3RW0A 3U8PA 4G7OF 1C03A 2H7BA 3IPMO 4HFFB 4KC9A 1CPQA 1TKNA 1XWJA 3KMIA 1GS9A 2A1DD 2B0JA 2H7OA 3I4UA 1ZVZA 2LP4A 3L1MA 3B0UX 3LJBA 1EA8A 3MYIA 3UR3C 3H65A 3EQLF 5L0DA 4CS8A 2AU5A 1R4TA 3M4BA 5A6BD 3J06A 2ZD9A 4WJ0A 5L0CA 3TD7A 2KYHA 4PJMA 3O6XA 1T9KA 5DLJA 1CGME 1HE9A 4PJLA 4C3EA 3QMKA 1FNTc 1ZYRF 2LK4A 3GWNA 2V26A 4LDKA 5L3VA 2J7PD 4YL0A 5A69A 2YLIA 2MYSA 3JYYA 3M1CB 3RVZA 4FAPB 2AWCA 4MQ9F 4J7YA 3K66A 3NDBB 1MMGA 2LFDA 3JSZA 4LDRA 2HSQA 3B0PA 3ASNC 1Q0FA 3S84A 1T6UA 2CNWA 5E33A 3VM6A 3ZWIA 4W8PA 3LESA 1PV3A 5D91A 1JR8A 5JSLA 2VCBA 1YLMA 2A0UA 1VB5A 3B29A 4IRUA 4JTCB 4JW1A 4JKVA 5BQIA 4C7OA 1M2VA 4JE9A 5JUAA 3GEHA 3HNLA 3U3FA 3IQ5A 2R02A 1B68A 3U5SA 2EPNA 1H7IA 2OOCA 2QE9A 4XWJA 2VH3A 4YT4A 3C7JA 5B3IA 3CQZA 2J45A 1MNDA 3A11A 4U9EA 3ZTZA 4XEFA 2VASA 3DM5A 4Z9JA 1GM5A 1AUEA 3V5XA 4XLPF 2BL2A 3LEOA 1H9GA 5JP7A 5JS5A 4DOZA 1J8MF 1O3UA 2ASRA 3K1IC 3K6BA 2IOQA 2IYLD 1TR2A 4K0DA 4DVYP 2XRHA 5JRAA 3GM2A 1J8YF 4MNDA 2CCYA 1BR1A 1FAPB 2W4BA 1AEPA 1LM3B 1E83A 2Y3GA 2P1AA 1OCRC 2L6HA 4JURI 1XZPA 3G4XA 2Z15A 2CYDA 4KNVA 2WL8A 4DXWA 4C7OB 2HFIA 3ZSUA 4EBJA 1M2VB 2X51A 2YL7A 3B71A 3JTLO 3OWTA 5CI8A 3U9MA 3UMKA 2HV7A 2GA0A 2NUPA 4MW3A 1QLEC 3E9VA 1K40A 1NBBA 3M15A 1OCZC 2P61A 3RKOF 4JEAA 2XSEA 1YJGA 3ABLC 4J32B 1JOGA 3B0VC 3N24A 3H2UA 5JLIA 1VTMP 5A6AA 4FX5A 4XPYA 3G50A 2GFHA 4JCZA 4OIQF 5EGYA 1YZCA 4YT8A 3AJMA 1M2OA 3Q6NA 3TULA 2J0WA 3RQFA 2KSFA 1BBHA 1LI5A 2EPOA 2R7OA 4LDQA 4XEVA 4ONSA 1OW8A 3MX3A 3UNGC 4Z9HA 1BR4A 1G5ZA 2R03A 5KYWA 4C3BA 1H9TA 3BRJA 1G4US 3K7DA 4RDAA 1M57C 1TFOB 3JRMO 1UFBA 2ZPAA 1NFOA 1L7CA 1OR3A 2YL3A 3KKBA 4CS9C 4JIOA 1LPEA 2L6FA 4ULWA 1UG7A 3O10A 3GANA 3QTHA 4C3DA 2R7TA 2NUPB 4YT5A 2KW3C 4PK4A 4BPMA 2G3KA 4PJJA 2OKUA 3JYHA 3EZHA 2MWQA 3C8GD 5AC4A 2H7VC 3GODA 2Q9BA 4W8KA 4YK5A 1FFHA 2P6VA 4U5FE 3FHDA 1QKRA 2AVKA 1I4YA 5EK0A 1PCXA 4U9DA 3W2VA 3W8HA 1D1AA 3T4RA 4BJ5C 1RMVA 3EGDA 2YQYA 4BJ1A 1E86A 1JAFA 4IAQA 3ABMC 3DE8A 2R7VA 1O87A 4HE8D 4AL1A 1S05A 2XM0A 3GEIA 3CAXA 2A69F 2OG2A 5KYWB 1OW7A 2BE5F 2VCAA 2HV6A 2WZFA 5KYUA 1LS1A 1Z7Qc 3R7CA 3SXMA 3V5YA 5AC5A 4Q4ZF 1FR0A 2PX0A 4CJOA 1LE2A 4XPXA 3DD7A 1ZHZA 1TWHA 1MNEA 1AVOB 1WWPA 3AQCA 5DQTA 3LEVA 4AL0A 1E84A 1U0BB 1YVIA 1S7ZA 3NYMA 2XS1A 1YYXA 4BJ6A 1U6HA 3NYLA 1Z5ZA 1OQCA 1RKCA 2EPKX 3AGTA 1IZMA 2HZ8A 3IQTA 1A0BA 4K7BA 3A9CA 3VF0A 4XQ1A 1CGOA 1YDIA 3JRTA 1BZ4A 2HMQA 2YZSA 2YLDA 1T01A 3QZCA 2PBEA 4CDYA 1YZAA 3EGDB 3UMHA 1G8XA 1M6TA 4E18A 3POVA 5AGFA 2ZXRA 3VAYA 1LI7A 3AQBA 1HW1A 3LS1A 4D4NA 4EKWA 2NSFA 3EJNA 3AGUA 1NZEA 2J9WA 3EFOA 5KYUB 2OEVA 1LIHA 2KNHA 1V54C 1PD0A 4JCHA 4I1OB 2R7UA 2R05A 3AG4C 2NUTA 2PF4E 5B3SC 5KYNA 2XLHA 2R7QA 2LD6A 3DMDA 4CIPA 5A6JA 3NG1A 1OXBA 4YT2A 1GGQA 1ORSC 3HNIA 5FCLA 2GAQA 2CDQA 4AX2A 1FTSA 3U3BA 3US6A 1VLTA 4DRJB 1ZU4A 3RFYA 5A6KA 5L0IA 3UGOA 3U2MA 1VYIA 1FFTC 2HMZA 1NFNA 2XS8A 4J7TA 256BA 2JD3A 2PX3A 1ZHTA 1MMDA 2Q3TA 4BEJA 1IW7F 1G4WR 3V7OA 3DI5A 2XLOA 3FOOA 1EQ1A 1NLXA 3PCVA 3TJ5A 3U2LA 1OR2A 1ZHYA 2GWWA 2H8AA 4O6YA 5T3TA 3EFOB 2CW0F 5GPGB 1ZW3A 3DAGA 5COMA 1MQVA 3EGXA 3HNKA 3SEOA 3ECSA 5FZTA 3SXZA 4CX9A 1NSGB 4EIYA 2OU6A 4N4WA 3RF3A 2VCCA 1XZQA 3EZIA 4MW8A 4ANJA 1QSPA 3QW1A 4EWCA 3LLKA 4OIRF 5DS6A 2OQMA 4Q5SF 5L0JA 3PMRA 1ORJA 3UGPA 2WZGA 4MVRA 4GEHA 4H4KC 2AP3A 1JRAA 4FWVA 1TWAA 1Z63A 2ETSA 1OKKD 2RSEB 3FVYA 1TQGA 3WHNA 2EPMX 3K33A 3C8GA 1APCA 2EPLX 2Y3HA 3NRHA 4CDAA 3HTKC 4AE4A 3SNHA 4E0IA 4KNWA 1BR2A 4P9FA 2FFHA 2V3CC 3NKEA 4LLEA 4F4BA 1D0ZA 3ABKC 2J9UA 3M4CA 3W8IA 2QNLA 1CPRA 3FXHA 3K1HA 1HW2A 3I5QA 3T6GB 1OCOC 2P0NA 2C03A 2Y39A 4LERA 2NSGA 3SYNA 1Q0GA 1VK5A 3CEXA 1DOWA 3DE9A 4PFOA 3FAPB 4MS2A 2XLMA 3HNJA 4MTFA 2PP4A 3MYFA 4CIHA 1L3PA 3S27A 4BEMJ 4H54A 3F46A 3RYLA 2B0HA 1M56C 3C18A 1V4AA 3EHMA 4DBRA 2R7XA 5DS4A 2YL0A 2IBFA 3OEOA 4JJGA 4LACB 3SXYA 3AG3C 4IARA 4E17A 2VC9A 3EHNA 4G7ZF 2EIMC 1BDJB 2QY9A 2HUJA 2W9YA 2YHSA 3C8GB 5L0GA 4IWBA 1MMNA 2M64A 3IQCA 5COGA 1HY5A 4AE4B 4O6MA 3SP1A 2WVOA 5E3CA 1Q0KA 2J0XA 4JC7A 3K1IA 2ZXPA 4MVZA 5E2QA 3ZQYA 4E7SA 2DGJA 1WASA 4MVMA 3NKDA 1SYQA 2OEXA 3T6BA 3N0TA 1RJ9A 4MTGA 4JZAA 2HKVA 3PHF2 3DM9B 2J8WA 1QQ3A 2YKZA 5A6BA 1KTMA 1F1MA 4LLCA 3VRCA 3GM3A 5KYXA 2L9JA 2L81A 1N1CA 2QTVA 4BJ6C 1O5HA 1SF8A 1A41A 5IY5C 3R2PA 3X2QC 1WOLA 2PNOA 2P7VA 1NG1A 2ZXWC 3CZ6A 1KNYA 2J7PA 4XLNF 3MBGA 2LQGA 3AG1C 2WVNA 3BEHA 3E70C 3LUTB 3QVYA 4ZLCA 5BQHA 1K04A 3U0CA 3L0IA 2WZLA 1C17M 4RBNA 1D0XA 3ZQVA 4DVZA 3DAFA 4YJWA 1LE4A 3HLZA 2KC3A 2Y69C 4U5BE 4HFKB 4QI0A 3ZVRA 4IJJA 1ZHWA 2HJ3A 3NYJA 4IGGA 5KYYA 1FMVA 3ATPA 3TK0A 3GM1A 4X0RA 3TQOA 5K0IA 4WABA 3F47A 4CS8C 5EHHA 4JVSA 5COFA 2ICWG 4CDVA 1RJ9B 3Q7GA 3M79A 3GEEA 1I4ZA 3ZDLA 2R7RA 2A68F 2YEVA 1U89A 3CSKA 5L0HA 1C02A 4O7GA 3S29A 2HJMA 2J46A 1Z6AA 3FAJA 2A6HF 5CIVA 2Y3BA 1QPUA 3KYJA 1Q0DA 1WGWA 2L7AA 4U5EE 4NTFA 2XXAA 2YRFA 3DJNB 4U5HA 1Z3IX 2KJGA 4NTAA 2R9RB 3JSEO 3ZTMA 5BUOA 1QVXA 1Z23A 1OKKA 5L3QA 3ASOC 5F5FA 4OD5A 2VB6A 2PFDA 4YL1A 1OCCC 4IAOA 3SZRA 2D4UA 2HSBA 2J9BA 3U9JA 4BJ5A 5KYYB 1D1CA 4KI2A 2W4MA 4O6NA 3G4ZA 3X1OA 3ZIBA 5BQGA 4EHPA 4CSAA 1V74B 3ITFA 2WB7A 3DKAA 3LNMB 2J9VA 2AWYA 2OJED 1R5ID 3FMSA 2MHRA 3QW0A 4MVQA 4WGYA 2EILC 3IQ6A 2IXNA 4I44A 4NC3A 2Q7RA 1VYKA 4I1MA 2CGEA 4JTDB 2M4EA 2UUHA 5JVEA 1GQAA 1HE1A 4JEBA 3SXKA 2XLEA 3S90A 2QLAA 2DI3A 3H2VA 3Q7LA 5DVWA 1EI7A 1ZZPA 1H6GA 3WODF 2EINC 4DRIB 4OIPF 2XXAB 2XLDA 2KGOA 5F28E 2XL6A 4JJFA 3C62A 1KU2A 1RKEA 2Q4FA 3RQGA 3GORA 4YWQA 2LIGA 2YWAA 3AG2C 2EIJC 1HMOA 2NUTB 1YARO 5B1BC 1ZW2A 1LS4A 1VMAA 1I5NA 2L6GA 4N06A 4EUKB 1D0YA 4YL3A 3JT1A 3RH3A 3C8ZA 4E7ZA 3O55A 4QI2A 3AOUA 3IEEA 2KK1A 2C04A 2LFFA 2RD9A 3DWWA 3GWLA 1QZXA 3LNRA 4P9TA 3T9OA 3UMIA 1SMYF 4CS7A 2XL4A 3LS0A 1YA9A 3C63A 3JCUQ 3LAYA 4XTKA 4U5CE 3RQEA 2O9XA 1A7EA 2I15A 4EBKA 1LVKA 2OJQA 3TOLA 2A6EF 4NQFA 4Q7CA 3KPHA 4DRHB 3PDMP 4NY3A 1DOVA 2EIKC 4NCQA 2E87A 4PFPA 4DBQA 3EH2A 4BJTA 2X0CA 3N2ZB 2I8BA 1MMAA 1RKEB 2XM4A 3DXJF 3I5PA 3KL4A 4MTOA 4OINF 3EGXB 2XLVA 3W2WA 2XLWA 4Z9IA 3FDQA 2FGYA 1YA7O 5TJ5E 2R7WA 1ZU5A 4CBEA 1SR2A 1T5OA 5T1DB 2IXPA 3S9OA 1Y4CA 1JPJA 4D4XA 2NPUA 2R7SA 1NU7D 4FESA 4JTAB 3WAQA 2OCCC 2LCHA 4JRZA 1OW6A 2IXMA 1OXKA 2DYRC 4N6CA 4NTBA 4KBLA 2R25A 1V55C 2Y3DA 4U5GA 3TJ6A 4DJ9A 4ZLDA 4PACA 4UDVA 4WGZA 4MVSA 2W45A 4HEAJ 2YL1A 5JT4A 4AK9A 2BC5A 4A2NB 4G78A 1VLSA 4A4AA 2Q9AA 2CNWD 1ST6A 2QUPA 1RCPA 4ER9A 3QVZA 3S0XA 3EPVA 5HSWA 1JPNA 3S28A 3FOPA 4GQHA 3IHUA 1RXQA 1PD1A 3L8JA 4XEKA 5DQZA 3EH1A 2HS5A 4CJGA 2G62A 1T6IA 2DYSC 2IXOA 1Y6DA 2FAPB 4MVUA 4R32A 2YVKA 3B9QA 1A7VA 5DS5A 3HJCA 1SZIA 4RD9A 3RIPA 5L0FA 1TWCA 2NG1A 2Q00A 1NU9C 1TWGA 3W4YA 3NMKA 1A7DA 1E2XA 3DZAA 3RVYA 4QDLA 4BG0A 2JX0A 3OA1A 5B1AC 4G0HA 1WATA 3L8IA 4L6RA 1FMWA 1CGNA 3WG7C 2Q9CA 2YLGA 3V5ZA 3VYWA
chains in the Genus database with same CATH topology
4OIOF 3MLGA 5D92A 5T3WA 3EG9A 2LSEA 1D1BA 2D5RB 1LKXA 1W2WA 2KQ9A 4GYTA 4J30B 5KYXB 4OD4A 4CSAC 4CS9A 3LLIA 3DJUB 5CI9A 4PJNA 4P6IC 3ZG1A 1ZHXA 4EBBA 3ZC4A 4G7HF 3L34A 5F5HA 5E3AA 3T6JA 4U5DE 4B6IA 3Q6MA 2ZXOA 3KH2A 3EG9B 4YN0B 1VOMA 2WVQA 3O39A 4M63A 4O79A 4I3MA 4G7OF 2G3VA 2H7BA 4HFFB 4KC9A 1TKNA 3KMIA 2A1DD 2B0JA 2H7OA 3I4UA 3B0UX 3LJBA 3UR3C 3H65A 3EQLF 4CS8A 4WJ0A 3TD7A 4PJMA 3O6XA 5DLJA 4PJLA 4C3EA 3QMKA 1ZYRF 2V26A 5L3VA 2J7PD 2MYSA 3M1CB 4MQ9F 3K66A 3NDBB 1MMGA 3JSZA 3B0PA 3ASNC 2CNWA 5E33A 3LESA 5D91A 4IRUA 4C7OA 4JW1A 1M2VA 4XWJA 2VH3A 4YT4A 3CQZA 2J45A 1MNDA 2VASA 3DM5A 4XLPF 4DOZA 1J8MF 3K6BA 3K1IC 4K0DA 2IOQA 2IYLD 1TR2A 4DVYP 2XRHA 1J8YF 4MNDA 1BR1A 2W4BA 2Y3GA 1OCRC 4JURI 2Z15A 4KNVA 2WL8A 4C7OB 3ZSUA 1M2VB 2X51A 5CI8A 3OWTA 3UMKA 2HV7A 2NUPA 1QLEC 3E9VA 1OCZC 3RKOF 2XSEA 3ABLC 4J32B 3B0VC 3N24A 4FX5A 2GFHA 4OIQF 5EGYA 4YT8A 1M2OA 3Q6NA 2J0WA 2R7OA 3MX3A 3UNGC 1BR4A 5KYWA 4C3BA 3K7DA 4RDAA 1M57C 2ZPAA 3KKBA 4CS9C 4ULWA 4C3DA 3GANA 2R7TA 2NUPB 4YT5A 2KW3C 4PK4A 2G3KA 4PJJA 3JYHA 3EZHA 2MWQA 2H7VC 3GODA 2Q9BA 4W8KA 1FFHA 2P6VA 4U5FE 3FHDA 1PCXA 3W2VA 3W8HA 1D1AA 3T4RA 4BJ5C 3EGDA 4BJ1A 2R7VA 3ABMC 1O87A 4HE8D 5KYWB 2A69F 2OG2A 2R7XA 2BE5F 5KYUA 2HV6A 2WZFA 1LS1A 4Q4ZF 2PX0A 3DD7A 1ZHZA 1TWHA 1MNEA 3AQCA 5DQTA 3LEVA 1S7ZA 3NYMA 4BJ6A 3NYLA 1Z5ZA 4K7BA 1IZMA 3JRTA 2YZSA 3QZCA 3EGDB 3UMHA 1G8XA 3POVA 2ZXRA 3VAYA 3AQBA 3LS1A 3EJNA 3EFOA 1NZEA 2J9WA 5KYUB 2KNHA 1V54C 1PD0A 4JCHA 4I1OB 2R7UA 3AG4C 5B3SC 2NUTA 2PF4E 5KYNA 2R7QA 3DMDA 3NG1A 4YT2A 5FCLA 2CDQA 4AX2A 1FTSA 1ZU4A 3RFYA 3UGOA 1VYIA 1FFTC 2Q3TA 2JD3A 2PX3A 1ZHTA 1MMDA 4BEJA 1IW7F 3V7OA 1ZHYA 4O6YA 5T3TA 3EFOB 2CW0F 3DAGA 3EGXA 3SEOA 3ECSA 4ANJA 3EZIA 4EWCA 3LLKA 4OIRF 5DS6A 4Q5SF 3PMRA 3UGPA 2WZGA 4GEHA 4H4KC 4FWVA 1TWAA 1Z63A 1OKKD 3FVYA 3K33A 2Y3HA 3NRHA 3HTKC 4AE4A 3SNHA 2V3CC 4KNWA 1BR2A 2FFHA 3NKEA 4LLEA 4F4BA 1D0ZA 3ABKC 2J9UA 3W8IA 3K1HA 3I5QA 1OCOC 2Y39A 2C03A 4LERA 3SYNA 1VK5A 4PFOA 2PP4A 4CIHA 3S27A 3F46A 3RYLA 1M56C 4DBRA 3EHMA 5DS4A 3OEOA 4JJGA 4LACB 3AG3C 4G7ZF 3EHNA 2EIMC 2QY9A 2W9YA 2YHSA 4IWBA 1MMNA 4AE4B 4O6MA 3SP1A 2WVOA 5E3CA 2J0XA 5E2QA 2ZXPA 4E7SA 2DGJA 3NKDA 3T6BA 3N0TA 1RJ9A 4JZAA 3PHF2 3DM9B 4LLCA 5KYXA 2L9JA 2L81A 1N1CA 2QTVA 4BJ6C 1O5HA 1SF8A 5IY5C 3X2QC 2P7VA 1NG1A 2ZXWC 3CZ6A 2J7PA 4XLNF 3AG1C 2WVNA 3E70C 4ZLCA 3L0IA 2WZLA 4RBNA 1D0XA 4DVZA 3DAFA 4YJWA 3HLZA 2Y69C 4U5BE 4HFKB 4QI0A 3ZVRA 4IJJA 1ZHWA 3NYJA 5KYYA 1FMVA 4X0RA 3F47A 4CS8C 5EHHA 4JVSA 1RJ9B 3Q7GA 2R7RA 2A68F 2YEVA 3CSKA 4O7GA 3S29A 2J46A 1Z6AA 3FAJA 2A6HF 2Y3BA 4U5EE 1WGWA 2XXAA 3DJNB 4U5HA 1Z3IX 2KJGA 5BUOA 1Z23A 1OKKA 5L3QA 3ASOC 5F5FA 4OD5A 2VB6A 2PFDA 1OCCC 4IAOA 3SZRA 4BJ5A 4KI2A 5KYYB 1D1CA 2W4MA 4O6NA 3X1OA 3ZIBA 4CSAA 3ITFA 2WB7A 2J9VA 2EILC 2IXNA 4I44A 1VYKA 4I1MA 2CGEA 2M4EA 3Q7LA 5DVWA 4OIPF 3WODF 2EINC 2XXAB 2KGOA 4JJFA 1KU2A 4YWQA 3AG2C 2EIJC 2NUTB 5B1BC 1VMAA 4N06A 1D0YA 3JT1A 3RH3A 4E7ZA 4QI2A 3IEEA 3LNRA 2C04A 1QZXA 3UMIA 4CS7A 1SMYF 2XL4A 3LS0A 3LAYA 3JCUQ 4XTKA 4U5CE 2O9XA 1LVKA 2A6EF 4Q7CA 4NY3A 2EIKC 2E87A 4PFPA 4DBQA 3EH2A 4BJTA 3N2ZB 2I8BA 1MMAA 3DXJF 3KL4A 3I5PA 4OINF 3EGXB 3W2WA 3FDQA 2FGYA 2R7WA 1ZU5A 4CBEA 5T1DB 2IXPA 1JPJA 2R7SA 1NU7D 4FESA 2OCCC 2IXMA 2DYRC 4KBLA 1V55C 2Y3DA 4U5GA 4ZLDA 2W45A 4HEAJ 4AK9A 4A2NB 2Q9AA 2CNWD 1ST6A 3S0XA 3EPVA 5HSWA 1JPNA 3S28A 1PD1A 5DQZA 3EH1A 2G62A 2IXOA 2DYSC 3B9QA 5DS5A 3HJCA 1SZIA 4RD9A 3RIPA 1TWCA 2NG1A 1NU9C 1TWGA 3DZAA 4QDLA 4BG0A 3OA1A 5B1AC 4G0HA 1FMWA 3WG7C 2Q9CA 3VYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ULW A;  4QI2 A;  5F5F A;  4QI0 A;  4ZLC A;  3X1O A;  4YWQ A;  4ZLD A;  5F5H A; 
#chains in the Genus database with same CATH topology
 4OIO F;  3MLG A;  1WN0 A;  5D92 A;  3EG9 A;  5T3W A;  1YAU O;  3NMI A;  4E0H A;  1TFK B;  2A0B A;  2LSE A;  3TOM A;  3KYI A;  4IB4 A;  1K05 A;  1D1B A;  2D5R B;  1LKX A;  1W2W A;  2KQ9 A;  4GYT A;  4J30 B;  5HV9 A;  2UUI A;  3U8V A;  4OD4 A;  5KYX B;  4CSA C;  4CS9 A;  1T6Q A;  4XPW A;  2TMV P;  2DB4 A;  3LLI A;  3NMJ A;  3DJU B;  1JMW A;  5CI9 A;  1Q0M A;  2IM8 A;  4PJN A;  1WTY A;  2F22 A;  4P6I C;  3ZG1 A;  4N6H A;  1ZHX A;  4EBB A;  1EKY A;  3ZC4 A;  4G7H F;  2JPU A;  3JZ0 A;  3MFN A;  1HMD A;  3L34 A;  5F5H A;  5E3A A;  4PR9 A;  3T6J A;  4U5D E;  1ORY A;  4B6I A;  3Q6M A;  2ZXO A;  3KH2 A;  3EG9 B;  4YN0 B;  1E85 A;  1VOM A;  2WVQ A;  2XL8 A;  3O39 A;  4M63 A;  4K1O A;  1YYJ A;  4ULV A;  4MVO A;  2GDC A;  3HKK A;  4I3M A;  4O79 A;  2G3V A;  3RW0 A;  3U8P A;  4G7O F;  1C03 A;  2H7B A;  3IPM O;  4HFF B;  4KC9 A;  1CPQ A;  1TKN A;  1XWJ A;  3KMI A;  1GS9 A;  2A1D D;  2B0J A;  2H7O A;  3I4U A;  1ZVZ A;  2LP4 A;  3L1M A;  3B0U X;  3LJB A;  1EA8 A;  3MYI A;  3UR3 C;  3H65 A;  3EQL F;  5L0D A;  4CS8 A;  2AU5 A;  1R4T A;  3M4B A;  5A6B D;  3J06 A;  2ZD9 A;  4WJ0 A;  5L0C A;  3TD7 A;  2KYH A;  4PJM A;  3O6X A;  1T9K A;  5DLJ A;  1CGM E;  1HE9 A;  4PJL A;  4C3E A;  3QMK A;  1FNT c;  1ZYR F;  2LK4 A;  3GWN A;  2V26 A;  4LDK A;  5L3V A;  2J7P D;  4YL0 A;  5A69 A;  2YLI A;  2MYS A;  3JYY A;  3M1C B;  3RVZ A;  4FAP B;  2AWC A;  4MQ9 F;  4J7Y A;  3K66 A;  3NDB B;  1MMG A;  2LFD A;  3JSZ A;  4LDR A;  2HSQ A;  3B0P A;  3ASN C;  1Q0F A;  3S84 A;  1T6U A;  2CNW A;  5E33 A;  3VM6 A;  3ZWI A;  4W8P A;  3LES A;  1PV3 A;  5D91 A;  1JR8 A;  5JSL A;  2VCB A;  1YLM A;  2A0U A;  1VB5 A;  3B29 A;  4IRU A;  4JTC B;  4JW1 A;  4JKV A;  5BQI A;  4C7O A;  1M2V A;  4JE9 A;  5JUA A;  3GEH A;  3HNL A;  3U3F A;  3IQ5 A;  2R02 A;  1B68 A;  3U5S A;  2EPN A;  1H7I A;  2OOC A;  2QE9 A;  4XWJ A;  2VH3 A;  4YT4 A;  3C7J A;  5B3I A;  3CQZ A;  2J45 A;  1MND A;  3A11 A;  4U9E A;  3ZTZ A;  4XEF A;  2VAS A;  3DM5 A;  4Z9J A;  1GM5 A;  1AUE A;  3V5X A;  4XLP F;  2BL2 A;  3LEO A;  1H9G A;  5JP7 A;  5JS5 A;  4DOZ A;  1J8M F;  1O3U A;  2ASR A;  3K1I C;  3K6B A;  2IOQ A;  2IYL D;  1TR2 A;  4K0D A;  4DVY P;  2XRH A;  5JRA A;  3GM2 A;  1J8Y F;  4MND A;  2CCY A;  1BR1 A;  1FAP B;  2W4B A;  1AEP A;  1LM3 B;  1E83 A;  2Y3G A;  2P1A A;  1OCR C;  2L6H A;  4JUR I;  1XZP A;  3G4X A;  2Z15 A;  2CYD A;  4KNV A;  2WL8 A;  4DXW A;  4C7O B;  2HFI A;  3ZSU A;  4EBJ A;  1M2V B;  2X51 A;  2YL7 A;  3B71 A;  3JTL O;  3OWT A;  5CI8 A;  3U9M A;  3UMK A;  2HV7 A;  2GA0 A;  2NUP A;  4MW3 A;  1QLE C;  3E9V A;  1K40 A;  1NBB A;  3M15 A;  1OCZ C;  2P61 A;  3RKO F;  4JEA A;  2XSE A;  1YJG A;  3ABL C;  4J32 B;  1JOG A;  3B0V C;  3N24 A;  3H2U A;  5JLI A;  1VTM P;  5A6A A;  4FX5 A;  4XPY A;  3G50 A;  2GFH A;  4JCZ A;  4OIQ F;  5EGY A;  1YZC A;  4YT8 A;  3AJM A;  1M2O A;  3Q6N A;  3TUL A;  2J0W A;  3RQF A;  2KSF A;  1BBH A;  1LI5 A;  2EPO A;  2R7O A;  4LDQ A;  4XEV A;  4ONS A;  1OW8 A;  3MX3 A;  3UNG C;  4Z9H A;  1BR4 A;  1G5Z A;  2R03 A;  5KYW A;  4C3B A;  1H9T A;  3BRJ A;  1G4U S;  3K7D A;  4RDA A;  1M57 C;  1TFO B;  3JRM O;  1UFB A;  2ZPA A;  1NFO A;  1L7C A;  1OR3 A;  2YL3 A;  3KKB A;  4CS9 C;  4JIO A;  1LPE A;  2L6F A;  4ULW A;  1UG7 A;  3O10 A;  3GAN A;  3QTH A;  4C3D A;  2R7T A;  2NUP B;  4YT5 A;  2KW3 C;  4PK4 A;  4BPM A;  2G3K A;  4PJJ A;  2OKU A;  3JYH A;  3EZH A;  2MWQ A;  3C8G D;  5AC4 A;  2H7V C;  3GOD A;  2Q9B A;  4W8K A;  4YK5 A;  1FFH A;  2P6V A;  4U5F E;  3FHD A;  1QKR A;  2AVK A;  1I4Y A;  5EK0 A;  1PCX A;  4U9D A;  3W2V A;  3W8H A;  1D1A A;  3T4R A;  4BJ5 C;  1RMV A;  3EGD A;  2YQY A;  4BJ1 A;  1E86 A;  1JAF A;  4IAQ A;  3ABM C;  3DE8 A;  2R7V A;  1O87 A;  4HE8 D;  4AL1 A;  1S05 A;  2XM0 A;  3GEI A;  3CAX A;  2A69 F;  2OG2 A;  5KYW B;  1OW7 A;  2BE5 F;  2VCA A;  2HV6 A;  2WZF A;  5KYU A;  1LS1 A;  1Z7Q c;  3R7C A;  3SXM A;  3V5Y A;  5AC5 A;  4Q4Z F;  1FR0 A;  2PX0 A;  4CJO A;  1LE2 A;  4XPX A;  3DD7 A;  1ZHZ A;  1TWH A;  1MNE A;  1AVO B;  1WWP A;  3AQC A;  5DQT A;  3LEV A;  4AL0 A;  1E84 A;  1U0B B;  1YVI A;  1S7Z A;  3NYM A;  2XS1 A;  1YYX A;  4BJ6 A;  1U6H A;  3NYL A;  1Z5Z A;  1OQC A;  1RKC A;  2EPK X;  3AGT A;  1IZM A;  2HZ8 A;  3IQT A;  1A0B A;  4K7B A;  3A9C A;  3VF0 A;  4XQ1 A;  1CGO A;  1YDI A;  3JRT A;  1BZ4 A;  2HMQ A;  2YZS A;  2YLD A;  1T01 A;  3QZC A;  2PBE A;  4CDY A;  1YZA A;  3EGD B;  3UMH A;  1G8X A;  1M6T A;  4E18 A;  3POV A;  5AGF A;  2ZXR A;  3VAY A;  1LI7 A;  3AQB A;  1HW1 A;  3LS1 A;  4D4N A;  4EKW A;  2NSF A;  3EJN A;  3AGU A;  1NZE A;  2J9W A;  3EFO A;  5KYU B;  2OEV A;  1LIH A;  2KNH A;  1V54 C;  1PD0 A;  4JCH A;  4I1O B;  2R7U A;  2R05 A;  3AG4 C;  2NUT A;  2PF4 E;  5B3S C;  5KYN A;  2XLH A;  2R7Q A;  2LD6 A;  3DMD A;  4CIP A;  5A6J A;  3NG1 A;  1OXB A;  4YT2 A;  1GGQ A;  1ORS C;  3HNI A;  5FCL A;  2GAQ A;  2CDQ A;  4AX2 A;  1FTS A;  3U3B A;  3US6 A;  1VLT A;  4DRJ B;  1ZU4 A;  3RFY A;  5A6K A;  5L0I A;  3UGO A;  3U2M A;  1VYI A;  1FFT C;  2HMZ A;  1NFN A;  2XS8 A;  4J7T A;  256B A;  2JD3 A;  2PX3 A;  1ZHT A;  1MMD A;  2Q3T A;  4BEJ A;  1IW7 F;  1G4W R;  3V7O A;  3DI5 A;  2XLO A;  3FOO A;  1EQ1 A;  1NLX A;  3PCV A;  3TJ5 A;  3U2L A;  1OR2 A;  1ZHY A;  2GWW A;  2H8A A;  4O6Y A;  5T3T A;  3EFO B;  2CW0 F;  5GPG B;  1ZW3 A;  3DAG A;  5COM A;  1MQV A;  3EGX A;  3HNK A;  3SEO A;  3ECS A;  5FZT A;  3SXZ A;  4CX9 A;  1NSG B;  4EIY A;  2OU6 A;  4N4W A;  3RF3 A;  2VCC A;  1XZQ A;  3EZI A;  4MW8 A;  4ANJ A;  1QSP A;  3QW1 A;  4EWC A;  3LLK A;  4OIR F;  5DS6 A;  2OQM A;  4Q5S F;  5L0J A;  3PMR A;  1ORJ A;  3UGP A;  2WZG A;  4MVR A;  4GEH A;  4H4K C;  2AP3 A;  1JRA A;  4FWV A;  1TWA A;  1Z63 A;  2ETS A;  1OKK D;  2RSE B;  3FVY A;  1TQG A;  3WHN A;  2EPM X;  3K33 A;  3C8G A;  1APC A;  2EPL X;  2Y3H A;  3NRH A;  4CDA A;  3HTK C;  4AE4 A;  3SNH A;  4E0I A;  4KNW A;  1BR2 A;  4P9F A;  2FFH A;  2V3C C;  3NKE A;  4LLE A;  4F4B A;  1D0Z A;  3ABK C;  2J9U A;  3M4C A;  3W8I A;  2QNL A;  1CPR A;  3FXH A;  3K1H A;  1HW2 A;  3I5Q A;  3T6G B;  1OCO C;  2P0N A;  2C03 A;  2Y39 A;  4LER A;  2NSG A;  3SYN A;  1Q0G A;  1VK5 A;  3CEX A;  1DOW A;  3DE9 A;  4PFO A;  3FAP B;  4MS2 A;  2XLM A;  3HNJ A;  4MTF A;  2PP4 A;  3MYF A;  4CIH A;  1L3P A;  3S27 A;  4BEM J;  4H54 A;  3F46 A;  3RYL A;  2B0H A;  1M56 C;  3C18 A;  1V4A A;  3EHM A;  4DBR A;  2R7X A;  5DS4 A;  2YL0 A;  2IBF A;  3OEO A;  4JJG A;  4LAC B;  3SXY A;  3AG3 C;  4IAR A;  4E17 A;  2VC9 A;  3EHN A;  4G7Z F;  2EIM C;  1BDJ B;  2QY9 A;  2HUJ A;  2W9Y A;  2YHS A;  3C8G B;  5L0G A;  4IWB A;  1MMN A;  2M64 A;  3IQC A;  5COG A;  1HY5 A;  4AE4 B;  4O6M A;  3SP1 A;  2WVO A;  5E3C A;  1Q0K A;  2J0X A;  4JC7 A;  3K1I A;  2ZXP A;  4MVZ A;  5E2Q A;  3ZQY A;  4E7S A;  2DGJ A;  1WAS A;  4MVM A;  3NKD A;  1SYQ A;  2OEX A;  3T6B A;  3N0T A;  1RJ9 A;  4MTG A;  4JZA A;  2HKV A;  3PHF 2;  3DM9 B;  2J8W A;  1QQ3 A;  2YKZ A;  5A6B A;  1KTM A;  1F1M A;  4LLC A;  3VRC A;  3GM3 A;  5KYX A;  2L9J A;  2L81 A;  1N1C A;  2QTV A;  4BJ6 C;  1O5H A;  1SF8 A;  1A41 A;  5IY5 C;  3R2P A;  3X2Q C;  1WOL A;  2PNO A;  2P7V A;  1NG1 A;  2ZXW C;  3CZ6 A;  1KNY A;  2J7P A;  4XLN F;  3MBG A;  2LQG A;  3AG1 C;  2WVN A;  3BEH A;  3E70 C;  3LUT B;  3QVY A;  4ZLC A;  5BQH A;  1K04 A;  3U0C A;  3L0I A;  2WZL A;  1C17 M;  4RBN A;  1D0X A;  3ZQV A;  4DVZ A;  3DAF A;  4YJW A;  1LE4 A;  3HLZ A;  2KC3 A;  2Y69 C;  4U5B E;  4HFK B;  4QI0 A;  3ZVR A;  4IJJ A;  1ZHW A;  2HJ3 A;  3NYJ A;  4IGG A;  5KYY A;  1FMV A;  3ATP A;  3TK0 A;  3GM1 A;  4X0R A;  3TQO A;  5K0I A;  4WAB A;  3F47 A;  4CS8 C;  5EHH A;  4JVS A;  5COF A;  2ICW G;  4CDV A;  1RJ9 B;  3Q7G A;  3M79 A;  3GEE A;  1I4Z A;  3ZDL A;  2R7R A;  2A68 F;  2YEV A;  1U89 A;  3CSK A;  5L0H A;  1C02 A;  4O7G A;  3S29 A;  2HJM A;  2J46 A;  1Z6A A;  3FAJ A;  2A6H F;  5CIV A;  2Y3B A;  1QPU A;  3KYJ A;  1Q0D A;  1WGW A;  2L7A A;  4U5E E;  4NTF A;  2XXA A;  2YRF A;  3DJN B;  4U5H A;  1Z3I X;  2KJG A;  4NTA A;  2R9R B;  3JSE O;  3ZTM A;  5BUO A;  1QVX A;  1Z23 A;  1OKK A;  5L3Q A;  3ASO C;  5F5F A;  4OD5 A;  2VB6 A;  2PFD A;  4YL1 A;  1OCC C;  4IAO A;  3SZR A;  2D4U A;  2HSB A;  2J9B A;  3U9J A;  4BJ5 A;  5KYY B;  1D1C A;  4KI2 A;  2W4M A;  4O6N A;  3G4Z A;  3X1O A;  3ZIB A;  5BQG A;  4EHP A;  4CSA A;  1V74 B;  3ITF A;  2WB7 A;  3DKA A;  3LNM B;  2J9V A;  2AWY A;  2OJE D;  1R5I D;  3FMS A;  2MHR A;  3QW0 A;  4MVQ A;  4WGY A;  2EIL C;  3IQ6 A;  2IXN A;  4I44 A;  4NC3 A;  2Q7R A;  1VYK A;  4I1M A;  2CGE A;  4JTD B;  2M4E A;  2UUH A;  5JVE A;  1GQA A;  1HE1 A;  4JEB A;  3SXK A;  2XLE A;  3S90 A;  2QLA A;  2DI3 A;  3H2V A;  3Q7L A;  5DVW A;  1EI7 A;  1ZZP A;  1H6G A;  3WOD F;  2EIN C;  4DRI B;  4OIP F;  2XXA B;  2XLD A;  2KGO A;  5F28 E;  2XL6 A;  4JJF A;  3C62 A;  1KU2 A;  1RKE A;  2Q4F A;  3RQG A;  3GOR A;  4YWQ A;  2LIG A;  2YWA A;  3AG2 C;  2EIJ C;  1HMO A;  2NUT B;  1YAR O;  5B1B C;  1ZW2 A;  1LS4 A;  1VMA A;  1I5N A;  2L6G A;  4N06 A;  4EUK B;  1D0Y A;  4YL3 A;  3JT1 A;  3RH3 A;  3C8Z A;  4E7Z A;  3O55 A;  4QI2 A;  3AOU A;  3IEE A;  2KK1 A;  2C04 A;  2LFF A;  2RD9 A;  3DWW A;  3GWL A;  1QZX A;  3LNR A;  4P9T A;  3T9O A;  3UMI A;  1SMY F;  4CS7 A;  2XL4 A;  3LS0 A;  1YA9 A;  3C63 A;  3JCU Q;  3LAY A;  4XTK A;  4U5C E;  3RQE A;  2O9X A;  1A7E A;  2I15 A;  4EBK A;  1LVK A;  2OJQ A;  3TOL A;  2A6E F;  4NQF A;  4Q7C A;  3KPH A;  4DRH B;  3PDM P;  4NY3 A;  1DOV A;  2EIK C;  4NCQ A;  2E87 A;  4PFP A;  4DBQ A;  3EH2 A;  4BJT A;  2X0C A;  3N2Z B;  2I8B A;  1MMA A;  1RKE B;  2XM4 A;  3DXJ F;  3I5P A;  3KL4 A;  4MTO A;  4OIN F;  3EGX B;  2XLV A;  3W2W A;  2XLW A;  4Z9I A;  3FDQ A;  2FGY A;  1YA7 O;  5TJ5 E;  2R7W A;  1ZU5 A;  4CBE A;  1SR2 A;  1T5O A;  5T1D B;  2IXP A;  3S9O A;  1Y4C A;  1JPJ A;  4D4X A;  2NPU A;  2R7S A;  1NU7 D;  4FES A;  4JTA B;  3WAQ A;  2OCC C;  2LCH A;  4JRZ A;  1OW6 A;  2IXM A;  1OXK A;  2DYR C;  4N6C A;  4NTB A;  4KBL A;  2R25 A;  1V55 C;  2Y3D A;  4U5G A;  3TJ6 A;  4DJ9 A;  4ZLD A;  4PAC A;  4UDV A;  4WGZ A;  4MVS A;  2W45 A;  4HEA J;  2YL1 A;  5JT4 A;  4AK9 A;  2BC5 A;  4A2N B;  4G78 A;  1VLS A;  4A4A A;  2Q9A A;  2CNW D;  1ST6 A;  2QUP A;  1RCP A;  4ER9 A;  3QVZ A;  3S0X A;  3EPV A;  5HSW A;  1JPN A;  3S28 A;  3FOP A;  4GQH A;  3IHU A;  1RXQ A;  1PD1 A;  3L8J A;  4XEK A;  5DQZ A;  3EH1 A;  2HS5 A;  4CJG A;  2G62 A;  1T6I A;  2DYS C;  2IXO A;  1Y6D A;  2FAP B;  4MVU A;  4R32 A;  2YVK A;  3B9Q A;  1A7V A;  5DS5 A;  3HJC A;  1SZI A;  4RD9 A;  3RIP A;  5L0F A;  1TWC A;  2NG1 A;  2Q00 A;  1NU9 C;  1TWG A;  3W4Y A;  3NMK A;  1A7D A;  1E2X A;  3DZA A;  3RVY A;  4QDL A;  4BG0 A;  2JX0 A;  3OA1 A;  5B1A C;  4G0H A;  1WAT A;  3L8I A;  4L6R A;  1FMW A;  1CGN A;  3WG7 C;  2Q9C A;  2YLG A;  3V5Z A;  3VYW A; 
#chains in the Genus database with same CATH homology
 4OIO F;  3MLG A;  5D92 A;  5T3W A;  3EG9 A;  2LSE A;  1D1B A;  2D5R B;  1LKX A;  1W2W A;  2KQ9 A;  4GYT A;  4J30 B;  5KYX B;  4OD4 A;  4CSA C;  4CS9 A;  3LLI A;  3DJU B;  5CI9 A;  4PJN A;  4P6I C;  3ZG1 A;  1ZHX A;  4EBB A;  3ZC4 A;  4G7H F;  3L34 A;  5F5H A;  5E3A A;  3T6J A;  4U5D E;  4B6I A;  3Q6M A;  2ZXO A;  3KH2 A;  3EG9 B;  4YN0 B;  1VOM A;  2WVQ A;  3O39 A;  4M63 A;  4O79 A;  4I3M A;  4G7O F;  2G3V A;  2H7B A;  4HFF B;  4KC9 A;  1TKN A;  3KMI A;  2A1D D;  2B0J A;  2H7O A;  3I4U A;  3B0U X;  3LJB A;  3UR3 C;  3H65 A;  3EQL F;  4CS8 A;  4WJ0 A;  3TD7 A;  4PJM A;  3O6X A;  5DLJ A;  4PJL A;  4C3E A;  3QMK A;  1ZYR F;  2V26 A;  5L3V A;  2J7P D;  2MYS A;  3M1C B;  4MQ9 F;  3K66 A;  3NDB B;  1MMG A;  3JSZ A;  3B0P A;  3ASN C;  2CNW A;  5E33 A;  3LES A;  5D91 A;  4IRU A;  4C7O A;  4JW1 A;  1M2V A;  4XWJ A;  2VH3 A;  4YT4 A;  3CQZ A;  2J45 A;  1MND A;  2VAS A;  3DM5 A;  4XLP F;  4DOZ A;  1J8M F;  3K6B A;  3K1I C;  4K0D A;  2IOQ A;  2IYL D;  1TR2 A;  4DVY P;  2XRH A;  1J8Y F;  4MND A;  1BR1 A;  2W4B A;  2Y3G A;  1OCR C;  4JUR I;  2Z15 A;  4KNV A;  2WL8 A;  4C7O B;  3ZSU A;  1M2V B;  2X51 A;  5CI8 A;  3OWT A;  3UMK A;  2HV7 A;  2NUP A;  1QLE C;  3E9V A;  1OCZ C;  3RKO F;  2XSE A;  3ABL C;  4J32 B;  3B0V C;  3N24 A;  4FX5 A;  2GFH A;  4OIQ F;  5EGY A;  4YT8 A;  1M2O A;  3Q6N A;  2J0W A;  2R7O A;  3MX3 A;  3UNG C;  1BR4 A;  5KYW A;  4C3B A;  3K7D A;  4RDA A;  1M57 C;  2ZPA A;  3KKB A;  4CS9 C;  4ULW A;  4C3D A;  3GAN A;  2R7T A;  2NUP B;  4YT5 A;  2KW3 C;  4PK4 A;  2G3K A;  4PJJ A;  3JYH A;  3EZH A;  2MWQ A;  2H7V C;  3GOD A;  2Q9B A;  4W8K A;  1FFH A;  2P6V A;  4U5F E;  3FHD A;  1PCX A;  3W2V A;  3W8H A;  1D1A A;  3T4R A;  4BJ5 C;  3EGD A;  4BJ1 A;  2R7V A;  3ABM C;  1O87 A;  4HE8 D;  5KYW B;  2A69 F;  2OG2 A;  2R7X A;  2BE5 F;  5KYU A;  2HV6 A;  2WZF A;  1LS1 A;  4Q4Z F;  2PX0 A;  3DD7 A;  1ZHZ A;  1TWH A;  1MNE A;  3AQC A;  5DQT A;  3LEV A;  1S7Z A;  3NYM A;  4BJ6 A;  3NYL A;  1Z5Z A;  4K7B A;  1IZM A;  3JRT A;  2YZS A;  3QZC A;  3EGD B;  3UMH A;  1G8X A;  3POV A;  2ZXR A;  3VAY A;  3AQB A;  3LS1 A;  3EJN A;  3EFO A;  1NZE A;  2J9W A;  5KYU B;  2KNH A;  1V54 C;  1PD0 A;  4JCH A;  4I1O B;  2R7U A;  3AG4 C;  5B3S C;  2NUT A;  2PF4 E;  5KYN A;  2R7Q A;  3DMD A;  3NG1 A;  4YT2 A;  5FCL A;  2CDQ A;  4AX2 A;  1FTS A;  1ZU4 A;  3RFY A;  3UGO A;  1VYI A;  1FFT C;  2Q3T A;  2JD3 A;  2PX3 A;  1ZHT A;  1MMD A;  4BEJ A;  1IW7 F;  3V7O A;  1ZHY A;  4O6Y A;  5T3T A;  3EFO B;  2CW0 F;  3DAG A;  3EGX A;  3SEO A;  3ECS A;  4ANJ A;  3EZI A;  4EWC A;  3LLK A;  4OIR F;  5DS6 A;  4Q5S F;  3PMR A;  3UGP A;  2WZG A;  4GEH A;  4H4K C;  4FWV A;  1TWA A;  1Z63 A;  1OKK D;  3FVY A;  3K33 A;  2Y3H A;  3NRH A;  3HTK C;  4AE4 A;  3SNH A;  2V3C C;  4KNW A;  1BR2 A;  2FFH A;  3NKE A;  4LLE A;  4F4B A;  1D0Z A;  3ABK C;  2J9U A;  3W8I A;  3K1H A;  3I5Q A;  1OCO C;  2Y39 A;  2C03 A;  4LER A;  3SYN A;  1VK5 A;  4PFO A;  2PP4 A;  4CIH A;  3S27 A;  3F46 A;  3RYL A;  1M56 C;  4DBR A;  3EHM A;  5DS4 A;  3OEO A;  4JJG A;  4LAC B;  3AG3 C;  4G7Z F;  3EHN A;  2EIM C;  2QY9 A;  2W9Y A;  2YHS A;  4IWB A;  1MMN A;  4AE4 B;  4O6M A;  3SP1 A;  2WVO A;  5E3C A;  2J0X A;  5E2Q A;  2ZXP A;  4E7S A;  2DGJ A;  3NKD A;  3T6B A;  3N0T A;  1RJ9 A;  4JZA A;  3PHF 2;  3DM9 B;  4LLC A;  5KYX A;  2L9J A;  2L81 A;  1N1C A;  2QTV A;  4BJ6 C;  1O5H A;  1SF8 A;  5IY5 C;  3X2Q C;  2P7V A;  1NG1 A;  2ZXW C;  3CZ6 A;  2J7P A;  4XLN F;  3AG1 C;  2WVN A;  3E70 C;  4ZLC A;  3L0I A;  2WZL A;  4RBN A;  1D0X A;  4DVZ A;  3DAF A;  4YJW A;  3HLZ A;  2Y69 C;  4U5B E;  4HFK B;  4QI0 A;  3ZVR A;  4IJJ A;  1ZHW A;  3NYJ A;  5KYY A;  1FMV A;  4X0R A;  3F47 A;  4CS8 C;  5EHH A;  4JVS A;  1RJ9 B;  3Q7G A;  2R7R A;  2A68 F;  2YEV A;  3CSK A;  4O7G A;  3S29 A;  2J46 A;  1Z6A A;  3FAJ A;  2A6H F;  2Y3B A;  4U5E E;  1WGW A;  2XXA A;  3DJN B;  4U5H A;  1Z3I X;  2KJG A;  5BUO A;  1Z23 A;  1OKK A;  5L3Q A;  3ASO C;  5F5F A;  4OD5 A;  2VB6 A;  2PFD A;  1OCC C;  4IAO A;  3SZR A;  4BJ5 A;  4KI2 A;  5KYY B;  1D1C A;  2W4M A;  4O6N A;  3X1O A;  3ZIB A;  4CSA A;  3ITF A;  2WB7 A;  2J9V A;  2EIL C;  2IXN A;  4I44 A;  1VYK A;  4I1M A;  2CGE A;  2M4E A;  3Q7L A;  5DVW A;  4OIP F;  3WOD F;  2EIN C;  2XXA B;  2KGO A;  4JJF A;  1KU2 A;  4YWQ A;  3AG2 C;  2EIJ C;  2NUT B;  5B1B C;  1VMA A;  4N06 A;  1D0Y A;  3JT1 A;  3RH3 A;  4E7Z A;  4QI2 A;  3IEE A;  3LNR A;  2C04 A;  1QZX A;  3UMI A;  4CS7 A;  1SMY F;  2XL4 A;  3LS0 A;  3LAY A;  3JCU Q;  4XTK A;  4U5C E;  2O9X A;  1LVK A;  2A6E F;  4Q7C A;  4NY3 A;  2EIK C;  2E87 A;  4PFP A;  4DBQ A;  3EH2 A;  4BJT A;  3N2Z B;  2I8B A;  1MMA A;  3DXJ F;  3KL4 A;  3I5P A;  4OIN F;  3EGX B;  3W2W A;  3FDQ A;  2FGY A;  2R7W A;  1ZU5 A;  4CBE A;  5T1D B;  2IXP A;  1JPJ A;  2R7S A;  1NU7 D;  4FES A;  2OCC C;  2IXM A;  2DYR C;  4KBL A;  1V55 C;  2Y3D A;  4U5G A;  4ZLD A;  2W45 A;  4HEA J;  4AK9 A;  4A2N B;  2Q9A A;  2CNW D;  1ST6 A;  3S0X A;  3EPV A;  5HSW A;  1JPN A;  3S28 A;  1PD1 A;  5DQZ A;  3EH1 A;  2G62 A;  2IXO A;  2DYS C;  3B9Q A;  5DS5 A;  3HJC A;  1SZI A;  4RD9 A;  3RIP A;  1TWC A;  2NG1 A;  1NU9 C;  1TWG A;  3DZA A;  4QDL A;  4BG0 A;  3OA1 A;  5B1A C;  4G0H A;  1FMW A;  3WG7 C;  2Q9C A;  3VYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...