4CJGA

Spectroscopically validated structure of the 5 coordinate proximal no adduct of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjgA00
3HNJA 4CDVA 4JKVA 4U9DA 3ZQYA 4L6RA 2XLVA 3ZTMA 5JP7A 1YYXA 4CJGA 5JSLA 2XM4A 2XLDA 2YLGA 3HNLA 1APCA 4WGZA 2CCYA 1GQAA 4JE9A 3QW1A 5JT4A 1JAFA 5JVEA 4CJOA 1CPRA 3M4CA 4CDAA 3NMKA 4ER9A 5JUAA 1YZCA 3DE8A 4CX9A 5B3IA 4CIPA 3IQ6A 2J9BA 3QW0A 1YZAA 2XLHA 1QPUA 1RCPA 3ZWIA 4JEBA 3VRCA 2XL8A 3FOPA 1BBHA 4N4WA 4JEAA 2XLOA 2YL0A 4WGYA 3DE9A 3ZQVA 4IARA 1S05A 256BA 3L1MA 4ULVA 2YLIA 1E85A 1A7VA 2XM0A 3TOMA 5JRAA 4IAQA 3TOLA 2YKZA 1NBBA 1CPQA 1E86A 3NMIA 3HNIA 3M4BA 1E83A 3QVYA 3M15A 3NMJA 3C62A 2QLAA 1E84A 5AGFA 1YYJA 2J8WA 4N6HA 5JS5A 4U9EA 4D4NA 2YL7A 3IQ5A 3QVZA 4CDYA 1CGNA 2XLMA 1MQVA 3U8PA 3ZTZA 5JLIA 2XLEA 1EKYA 2XLWA 2XL6A 3FOOA 2BC5A 1QQ3A 4EIYA 1LM3B 3M79A 2YL3A 3C63A 4IB4A 4NC3A 1CGOA 1M6TA 2YL1A 4D4XA 3HNKA 2YLDA
chains in the Genus database with same CATH superfamily
3HNJA 4Z9IA 1SR2A 2E87A 4JKVA 4MVSA 4PFPA 4YL0A 3ZQYA 3ZTMA 2R7RA 1JR8A 1YYXA 2M4EA 5JSLA 3DAFA 1Z7Qc 3JSEO 1LPEA 4DXWA 5KYWB 4ANJA 2XS1A 1VYIA 3KPHA 4JIOA 4DBQA 2Q3TA 4CSAA 3A11A 3L8JA 4YT2A 2HKVA 1Z3IX 2J45A 4J7YA 3DJNB 5BUOA 1G4WR 1MNDA 4IRUA 4G78A 2I15A 5CI9A 1XZQA 2LD6A 2Q9CA 5JT4A 4U5HA 2CNWA 2VCBA 2Q9AA 1JAFA 5JVEA 2J9UA 2P61A 3LEVA 3VF0A 2P6VA 2Y3GA 3ASOC 1LVKA 3O6XA 3M4CA 4FESA 3GWNA 2LCHA 4J7TA 4PR9A 4CDAA 4ONSA 2OEVA 2W4MA 2HJ3A 1D0XA 1YZCA 4CS9C 4CX9A 1EI7A 4XPYA 2H7BA 2J9VA 3Q6NA 2EIMC 3C8ZA 2QE9A 5L0HA 2KK1A 3U2LA 4BJ6A 1VK5A 2HFIA 4BEMJ 4EBKA 2XLHA 2Q00A 5IY5C 1JOGA 1M56C 2Q4FA 1Q0MA 3RKOF 4EUKB 4CS8A 3LJBA 1FMVA 1HY5A 1M2VB 3OWTA 3RIPA 5L0DA 2WZLA 3QZCA 4AE4B 1QZXA 4MW8A 1WOLA 4G7ZF 2L9JA 3MBGA 2QNLA 3T6JA 1LIHA 4N6CA 4DRHB 3PDMP 1MMGA 1OR2A 2H7OA 2PP4A 4N4WA 3LS0A 2XLOA 2KYHA 4JEAA 3VYWA 3W2WA 2UUIA 3X2QC 1LE2A 1O5HA 1WWPA 2NUTB 3IQTA 5BQIA 1DOWA 1ST6A 1FTSA 2LFFA 1NU9C 4U5DE 3ZVRA 2L6HA 2ETSA 5D91A 1AVOB 3SNHA 1Z63A 4PACA 2IXPA 4C3DA 3ZG1A 5JRAA 2X0CA 2KC3A 3KYIA 4MTGA 2YKZA 2R7OA 2NUPA 4YK5A 4BJ1A 3SZRA 3US6A 1OCOC 3EG9A 4OINF 3OEOA 3QMKA 3WODF 4I1OB 2XL4A 2XRHA 3SXZA 4IJJA 3M15A 2OOCA 2AWCA 2GFHA 4Q5SF 4IAOA 1ZU5A 3C62A 1UG7A 2M64A 3JCUQ 4NTFA 1Q0KA 3T4RA 3KYJA 5F28E 2CYDA 3B71A 3K1IC 2HMZA 2RSEB 3FHDA 4E0HA 1ORSC 3HTKC 2KQ9A 1OXBA 1W2WA 2MWQA 3DZAA 3IQ5A 1L7CA 3Q6MA 3RW0A 1FR0A 3TQOA 5DVWA 2OJED 3X1OA 1U6HA 1MQVA 5KYNA 3B0UX 1BR2A 4I1MA 1OW7A 2R7QA 2XLEA 3NRHA 3QTHA 4KNVA 4MW3A 3ZDLA 4B6IA 1HMOA 2XLWA 3R7CA 3S28A 4BJ5C 2MHRA 1SMYF 1J8YF 1WATA 5L0CA 2PNOA 1LM3B 1RKEB 3B9QA 1IW7F 1LS4A 3M79A 2Q7RA 3U9JA 5EGYA 5F5HA 2A6HF 1Q0DA 2WVQA 3C63A 4O79A 4CBEA 1H9TA 3SP1A 3LESA 4YT5A 4NC3A 3U9MA 1Z5ZA 1NU7D 4I3MA 4EKWA 2YWAA 4XEVA 1OQCA 4Q4ZF 3EZHA 3NKDA 2YLDA 5KYUB 1NZEA 1J8MF 4WABA 3U2MA 2Y69C 4PJMA 2XLVA 4CJGA 1C02A 1HE9A 3W8HA 1V74B 3HNLA 2R7WA 4JTCB 1APCA 4IWBA 5L3VA 3LLIA 1Z23A 4J30B 5DQTA 5E33A 1HMDA 2O9XA 2I8BA 2WVNA 4WJ0A 2CCYA 3EFOB 4JC7A 4JE9A 1MNEA 1R5ID 3ABKC 4JRZA 4PJJA 4JTDB 1NFNA 3QW1A 4C7OB 2YVKA 3IPMO 4GEHA 2IXNA 1N1CA 2FAPB 2OKUA 3L0IA 4CJOA 5B1BC 4W8KA 4PFOA 1PD0A 3NG1A 2NPUA 4DJ9A 3AGUA 4CSAC 3N24A 3E9VA 2Y3DA 4ER9A 3GEIA 3DE8A 5K0IA 3NYJA 5B3IA 2IOQA 4LDRA 3VAYA 1HW1A 1V54C 1LI7A 3GORA 1T6IA 1EQ1A 3ZSUA 4DOZA 2HSQA 4ZLDA 3KH2A 3IQ6A 2J9BA 1OCCC 3ITFA 1GS9A 5F5FA 1WN0A 2HSBA 1ZHWA 1ZW3A 4NTBA 3H2UA 3TULA 2R7UA 4XQ1A 4UDVA 1RJ9B 2QTVA 3EGDA 2A69F 3R2PA 2WZGA 2C03A 4XWJA 5HSWA 5GPGB 3AG4C 1NG1A 2CW0F 3O39A 4HEAJ 2HJMA 2F22A 4PJNA 2WL8A 1XWJA 3L8IA 4BJ6C 4C3EA 4QI2A 1SF8A 2ASRA 2HUJA 3AOUA 3I4UA 5E3CA 4CS8C 1YVIA 2WZFA 4WGYA 3M1CB 1TWHA 2L7AA 4QI0A 3K6BA 3B0PA 3MFNA 3GM2A 1OCZC 1ZHXA 2D5RB 1S05A 4ULVA 2YLIA 1A7VA 4IGGA 1G8XA 2XM0A 4FWVA 2YHSA 3FAJA 2DGJA 3AQBA 1JPJA 2YQYA 3PMRA 3TOMA 4A2NB 4ZLCA 1FFHA 1FAPB 2W4BA 2PFDA 3RH3A 4E18A 3TOLA 4DRIB 3SXMA 1RKEA 2A0BA 2J0XA 3S90A 2OEXA 3O55A 4OIRF 4JCHA 1U0BB 1CPQA 3ASNC 4FAPB 1AUEA 3EPVA 3HKKA 1E86A 3CAXA 2R7TA 2IBFA 4MQ9F 5A6KA 3UMIA 1I5NA 3QVYA 3DAGA 4QDLA 3RQGA 2DI3A 3AJMA 2B0JA 4N06A 1FFTC 4U5GA 2H7VC 4YJWA 3FVYA 2G3KA 5EK0A 3ATPA 1R4TA 1LKXA 2QY9A 4MVUA 5L0FA 3ZIBA 5L3QA 4MVOA 1B68A 1OCRC 3S29A 4R32A 4D4NA 4AL0A 2YL7A 3MYFA 4MVMA 5FCLA 2AVKA 4LDQA 4CDYA 3H65A 2FFHA 1VOMA 2J0WA 4P6IC 4XEKA 2XLMA 4CS7A 1RMVA 3U8PA 3EGXB 5JLIA 1GM5A 1EKYA 3E70C 1BR1A 3JRTA 1NSGB 4XTKA 2XL6A 3T6GB 3FOOA 1WGWA 5KYXA 3POVA 2EPOA 2BC5A 2VH3A 1QQ3A 3SYNA 2R7VA 4JJGA 4EIYA 2L6FA 1H9GA 3RQFA 4YWQA 3DKAA 1TQGA 1JPNA 4BEJA 4OD4A 1WTYA 3VM6A 5KYYA 3CEXA 4JURI 1ZZPA 4YL3A 3RF3A 3FMSA 1CGOA 1D1AA 1LS1A 4D4XA 4OIQF 3HNKA 1NFOA 3B0VC 5COMA 1MMDA 3C8GB 3UNGC 4BG0A 1DOVA 2DYSC 4CDVA 4X0RA 4U9DA 1YA9A 3V5ZA 5KYWA 3WHNA 2OU6A 5JP7A 1SZIA 1ZHTA 2L81A 3LUTB 4NY3A 1ZU4A 1YARO 2GWWA 3RVZA 3S0XA 1ORJA 4OIPF 4LERA 3Q7LA 4WGZA 1H6GA 4JTAB 3MX3A 2ZPAA 4K1OA 5B3SC 2R25A 2LQGA 2R02A 3BRJA 3G50A 3MYIA 5L0GA 5A6AA 1HW2A 4O6NA 1MMNA 4E7ZA 2LFDA 1Y4CA 2IXOA 1T01A 2BE5F 3LAYA 4KBLA 5TJ5E 1RKCA 2NSGA 3GM1A 4XPXA 3EQLF 3NMKA 1E83A 1K05A 5JUAA 5FZTA 3TJ5A 4CIPA 3JZ0A 1QSPA 4XEFA 1L3PA 2EIJC 2LIGA 3GM3A 3OA1A 4XPWA 2AP3A 4W8PA 3PHF2 4OD5A 3RFYA 1M2VA 1I4YA 1TWGA 2WVOA 1YZAA 1TFKB 3DWWA 4AE4A 4MVZA 3H2VA 2XSEA 3I5PA 1V4AA 3SEOA 3LNMB 2IXMA 1VB5A 4HFKB 1EA8A 2ZXPA 2ICWG 4Z9JA 3B29A 4G0HA 1BZ4A 1QPUA 2OCCC 2YEVA 4XLNF 3SXYA 4U5CE 2P1AA 3TD7A 3ZWIA 2A1DD 2Y39A 3AQCA 3DMDA 4EBJA 4E7SA 3MLGA 3FOPA 1LI5A 2RD9A 2KW3C 2NUTA 3U5SA 1WASA 1BBHA 5L0IA 1A7DA 1ORYA 1OW8A 4HE8D 4YN0B 2HZ8A 4MTOA 1GGQA 1K40A 3L34A 4KC9A 2J7PD 3DXJF 1JRAA 2EPNA 3JYYA 5E2QA 2X51A 1VLTA 3EHNA 5B1AC 4BPMA 4IARA 3UR3C 4EWCA 2V3CC 4OIOF 1KTMA 5L0JA 1YJGA 1Q0FA 2EPKX 2MYSA 4NTAA 1Y6DA 2Y3BA 4U5FE 3W8IA 1ZYRF 2PX0A 5EHHA 2OG2A 4P9FA 3FAPB 1ZW2A 1D0YA 3RYLA 3N0TA 4RD9A 4DVYP 2NG1A 2XXAB 2IM8A 3JTLO 4LLCA 4JVSA 5HV9A 1VLSA 5T3WA 3NYMA 3Q7GA 3V7OA 1OKKA 2LK4A 2NSFA 1PCXA 2NUPB 2VCAA 2VB6A 3W4YA 3F46A 2H8AA 1C17M 3M4BA 2W9YA 3EG9B 3JSZA 3PCVA 2KNHA 4F4BA 3LLKA 4K7BA 5A6BD 2GA0A 4CIHA 4ULWA 3NMJA 4G7OF 5A6JA 2JD3A 2QLAA 1KU2A 4KI2A 3S84A 2J8WA 4HFFB 2B0HA 4PK4A 1TR2A 1XZPA 4N6HA 1QVXA 1OW6A 5JS5A 1YDIA 3UMHA 1SYQA 4U9EA 1YLMA 1AEPA 5T1DB 4MNDA 2JPUA 1TWAA 1V55C 3QVZA 1Z6AA 2A68F 4LACB 1TWCA 1ZVZA 4K0DA 1BR4A 4RDAA 3G4XA 4H4KC 1G5ZA 1FMWA 2YRFA 3V5YA 1OXKA 1PD1A 3RVYA 4A4AA 3ECSA 2P7VA 5AC5A 1D0ZA 4JJFA 4MVRA 3GEEA 3U0CA 3KMIA 5BQHA 3FXHA 5KYUA 3KKBA 3FDQA 2D4UA 1M6TA 2Q9BA 2W45A 4O7GA 3ZC4A 4EBBA 5COGA 1JMWA 2ZXRA 3HJCA 3TJ6A 1F1MA 3JRMO 4LLEA 4L6RA 1BDJB 1TFOB 1ZHYA 2HS5A 3ABLC 3DI5A 3G4ZA 2XM4A 1PV3A 3LEOA 2XLDA 2LSEA 4RBNA 2EPLX 2YLGA 4O6YA 3EFOA 3C18A 3U3BA 1HE1A 3U8VA 1KNYA 2VC9A 1CGME 4DRJB 4O6MA 2JX0A 4C7OA 3LS1A 5DQZA 2R7XA 3A9CA 3CZ6A 4YT8A 1GQAA 4CS9A 1S7ZA 1A7EA 1OKKD 4I44A 3SXKA 3GANA 2R05A 1G4US 3IQCA 1YAUO 2PX3A 1QKRA 2R7SA 2G3VA 4Z9HA 1CPRA 2J46A 3C8GD 1UFBA 3K1HA 3O10A 3GEHA 3WG7C 5DS6A 4MVQA 4NCQA 4NQFA 3EJNA 1I4ZA 2HV7A 4DVZA 5E3AA 2ZD9A 2R9RB 2J7PA 4FX5A 2DB4A 3LNRA 1T9KA 1RJ9A 2R03A 3KL4A 1D1CA 3AG1C 3QW0A 1C03A 4U5BE 2XXAA 2CGEA 2KJGA 4BJTA 4AL1A 2A6EF 2C04A 2QUPA 4XLPF 3S27A 2HMQA 3BEHA 3RQEA 5COFA 1K04A 2UUHA 3I5QA 4P9TA 1RCPA 4H54A 1IZMA 4J32B 2CNWD 4YT4A 3EGDB 2EINC 2Y3HA 4JW1A 3UMKA 4JEBA 3UGPA 3VRCA 2XL8A 4E0IA 1MMAA 3K7DA 3K66A 4LDKA 2YL0A 2G62A 5A6BA 1TKNA 3F47A 1RXQA 3DE9A 5T3TA 3ZQVA 2HV6A 2P0NA 4AK9A 1FNTc 4G7HF 1A41A 4GQHA 256BA 3L1MA 1YA7O 1E85A 2OJQA 3CQZA 3WAQA 2EILC 4M63A 3T6BA 3IHUA 1VMAA 3EH1A 3HLZA 4MS2A 4YL1A 2V26A 4GYTA 3S9OA 3NDBB 4U5EE 1T6QA 1VYKA 3DM9B 4IAQA 3EHMA 2EPMX 3DD7A 5D92A 2PF4E 1D1BA 2CDQA 1NBBA 2VASA 1VTMP 5CI8A 2KGOA 1M2OA 3C7JA 1OR3A 5AC4A 2LP4A 3TK0A 4C3BA 3K1IA 3NMIA 3V5XA 2PBEA 3AGTA 3U3FA 3HNIA 5BQGA 4EHPA 5CIVA 2AU5A 2A0UA 3N2ZB 2OQMA 1H7IA 2ZXOA 3IEEA 4MTFA 4AX2A 4KNWA 2BL2A 2Z15A 2ZXWC 3DJUB 5DS5A 3K33A 2GDCA 1E84A 5AGFA 1YYJA 1NLXA 4BJ5A 3EZIA 3AG2C 2J9WA 3UGOA 2GAQA 3DM5A 3NKEA 1T5OA 3CSKA 4DBRA 5DS4A 3EGXA 3GWLA 1ZHZA 2DYRC 4Q7CA 3W2VA 1CGNA 4E17A 5A69A 4JCZA 1O87A 1U89A 2XS8A 2FGYA 3JYHA 3T9OA 2YZSA 2AWYA 2KSFA 3GODA 1Q0GA 1M57C 2VCCA 3EH2A 3ABMC 5KYXB 2IYLD 1QLEC 1A0BA 1E2XA 2EIKC 2WB7A 2YL3A 1T6UA 3NYLA 4IB4A 5DLJA 2TMVP 3JT1A 3C8GA 4PJLA 2YL1A 3J06A 3AG3C 5KYYB 1O3UA 2L6GA 1LE4A 4JZAA 3ZTZA
chains in the Genus database with same CATH topology
3HNJA 4CDVA 4JKVA 4U9DA 3ZQYA 4L6RA 2XLVA 3ZTMA 5JP7A 1YYXA 4CJGA 5JSLA 2XM4A 2XLDA 2YLGA 3HNLA 1APCA 4WGZA 2CCYA 1GQAA 4JE9A 3QW1A 5JT4A 1JAFA 5JVEA 4CJOA 1CPRA 3M4CA 4CDAA 3NMKA 4ER9A 5JUAA 1YZCA 3DE8A 4CX9A 5B3IA 4CIPA 3IQ6A 2J9BA 3QW0A 1YZAA 2XLHA 1QPUA 1RCPA 3ZWIA 4JEBA 3VRCA 2XL8A 3FOPA 1BBHA 4N4WA 4JEAA 2XLOA 2YL0A 4WGYA 3DE9A 3ZQVA 4IARA 1S05A 256BA 3L1MA 4ULVA 2YLIA 1E85A 1A7VA 2XM0A 3TOMA 5JRAA 4IAQA 3TOLA 2YKZA 1NBBA 1CPQA 1E86A 3NMIA 3HNIA 3M4BA 1E83A 3QVYA 3M15A 3NMJA 3C62A 2QLAA 1E84A 5AGFA 1YYJA 2J8WA 4N6HA 5JS5A 4U9EA 4D4NA 2YL7A 3IQ5A 3QVZA 4CDYA 1CGNA 2XLMA 1MQVA 3U8PA 3ZTZA 5JLIA 2XLEA 1EKYA 2XLWA 2XL6A 3FOOA 2BC5A 1QQ3A 4EIYA 1LM3B 3M79A 2YL3A 3C63A 4IB4A 4NC3A 1CGOA 1M6TA 2YL1A 4D4XA 3HNKA 2YLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNJ A;  4CDV A;  4JKV A;  4U9D A;  3ZQY A;  4L6R A;  2XLV A;  3ZTM A;  5JP7 A;  1YYX A;  4CJG A;  5JSL A;  2XM4 A;  2XLD A;  2YLG A;  3HNL A;  1APC A;  4WGZ A;  2CCY A;  1GQA A;  4JE9 A;  3QW1 A;  5JT4 A;  1JAF A;  5JVE A;  4CJO A;  1CPR A;  3M4C A;  4CDA A;  3NMK A;  4ER9 A;  5JUA A;  1YZC A;  3DE8 A;  4CX9 A;  5B3I A;  4CIP A;  3IQ6 A;  2J9B A;  3QW0 A;  1YZA A;  2XLH A;  1QPU A;  1RCP A;  3ZWI A;  4JEB A;  3VRC A;  2XL8 A;  3FOP A;  1BBH A;  4N4W A;  4JEA A;  2XLO A;  2YL0 A;  4WGY A;  3DE9 A;  3ZQV A;  4IAR A;  1S05 A;  256B A;  3L1M A;  4ULV A;  2YLI A;  1E85 A;  1A7V A;  2XM0 A;  3TOM A;  5JRA A;  4IAQ A;  3TOL A;  2YKZ A;  1NBB A;  1CPQ A;  1E86 A;  3NMI A;  3HNI A;  3M4B A;  1E83 A;  3QVY A;  3M15 A;  3NMJ A;  3C62 A;  2QLA A;  1E84 A;  5AGF A;  1YYJ A;  2J8W A;  4N6H A;  5JS5 A;  4U9E A;  4D4N A;  2YL7 A;  3IQ5 A;  3QVZ A;  4CDY A;  1CGN A;  2XLM A;  1MQV A;  3U8P A;  3ZTZ A;  5JLI A;  2XLE A;  1EKY A;  2XLW A;  2XL6 A;  3FOO A;  2BC5 A;  1QQ3 A;  4EIY A;  1LM3 B;  3M79 A;  2YL3 A;  3C63 A;  4IB4 A;  4NC3 A;  1CGO A;  1M6T A;  2YL1 A;  4D4X A;  3HNK A;  2YLD A; 
#chains in the Genus database with same CATH topology
 3HNJ A;  4Z9I A;  1SR2 A;  2E87 A;  4JKV A;  4MVS A;  4PFP A;  4YL0 A;  3ZQY A;  3ZTM A;  2R7R A;  1JR8 A;  1YYX A;  2M4E A;  5JSL A;  3DAF A;  1Z7Q c;  3JSE O;  1LPE A;  4DXW A;  5KYW B;  4ANJ A;  2XS1 A;  1VYI A;  3KPH A;  4JIO A;  4DBQ A;  2Q3T A;  4CSA A;  3A11 A;  3L8J A;  4YT2 A;  2HKV A;  1Z3I X;  2J45 A;  4J7Y A;  3DJN B;  5BUO A;  1G4W R;  1MND A;  4IRU A;  4G78 A;  2I15 A;  5CI9 A;  1XZQ A;  2LD6 A;  2Q9C A;  5JT4 A;  4U5H A;  2CNW A;  2VCB A;  2Q9A A;  1JAF A;  5JVE A;  2J9U A;  2P61 A;  3LEV A;  3VF0 A;  2P6V A;  2Y3G A;  3ASO C;  1LVK A;  3O6X A;  3M4C A;  4FES A;  3GWN A;  2LCH A;  4J7T A;  4PR9 A;  4CDA A;  4ONS A;  2OEV A;  2W4M A;  2HJ3 A;  1D0X A;  1YZC A;  4CS9 C;  4CX9 A;  1EI7 A;  4XPY A;  2H7B A;  2J9V A;  3Q6N A;  2EIM C;  3C8Z A;  2QE9 A;  5L0H A;  2KK1 A;  3U2L A;  4BJ6 A;  1VK5 A;  2HFI A;  4BEM J;  4EBK A;  2XLH A;  2Q00 A;  5IY5 C;  1JOG A;  1M56 C;  2Q4F A;  1Q0M A;  3RKO F;  4EUK B;  4CS8 A;  3LJB A;  1FMV A;  1HY5 A;  1M2V B;  3OWT A;  3RIP A;  5L0D A;  2WZL A;  3QZC A;  4AE4 B;  1QZX A;  4MW8 A;  1WOL A;  4G7Z F;  2L9J A;  3MBG A;  2QNL A;  3T6J A;  1LIH A;  4N6C A;  4DRH B;  3PDM P;  1MMG A;  1OR2 A;  2H7O A;  2PP4 A;  4N4W A;  3LS0 A;  2XLO A;  2KYH A;  4JEA A;  3VYW A;  3W2W A;  2UUI A;  3X2Q C;  1LE2 A;  1O5H A;  1WWP A;  2NUT B;  3IQT A;  5BQI A;  1DOW A;  1ST6 A;  1FTS A;  2LFF A;  1NU9 C;  4U5D E;  3ZVR A;  2L6H A;  2ETS A;  5D91 A;  1AVO B;  3SNH A;  1Z63 A;  4PAC A;  2IXP A;  4C3D A;  3ZG1 A;  5JRA A;  2X0C A;  2KC3 A;  3KYI A;  4MTG A;  2YKZ A;  2R7O A;  2NUP A;  4YK5 A;  4BJ1 A;  3SZR A;  3US6 A;  1OCO C;  3EG9 A;  4OIN F;  3OEO A;  3QMK A;  3WOD F;  4I1O B;  2XL4 A;  2XRH A;  3SXZ A;  4IJJ A;  3M15 A;  2OOC A;  2AWC A;  2GFH A;  4Q5S F;  4IAO A;  1ZU5 A;  3C62 A;  1UG7 A;  2M64 A;  3JCU Q;  4NTF A;  1Q0K A;  3T4R A;  3KYJ A;  5F28 E;  2CYD A;  3B71 A;  3K1I C;  2HMZ A;  2RSE B;  3FHD A;  4E0H A;  1ORS C;  3HTK C;  2KQ9 A;  1OXB A;  1W2W A;  2MWQ A;  3DZA A;  3IQ5 A;  1L7C A;  3Q6M A;  3RW0 A;  1FR0 A;  3TQO A;  5DVW A;  2OJE D;  3X1O A;  1U6H A;  1MQV A;  5KYN A;  3B0U X;  1BR2 A;  4I1M A;  1OW7 A;  2R7Q A;  2XLE A;  3NRH A;  3QTH A;  4KNV A;  4MW3 A;  3ZDL A;  4B6I A;  1HMO A;  2XLW A;  3R7C A;  3S28 A;  4BJ5 C;  2MHR A;  1SMY F;  1J8Y F;  1WAT A;  5L0C A;  2PNO A;  1LM3 B;  1RKE B;  3B9Q A;  1IW7 F;  1LS4 A;  3M79 A;  2Q7R A;  3U9J A;  5EGY A;  5F5H A;  2A6H F;  1Q0D A;  2WVQ A;  3C63 A;  4O79 A;  4CBE A;  1H9T A;  3SP1 A;  3LES A;  4YT5 A;  4NC3 A;  3U9M A;  1Z5Z A;  1NU7 D;  4I3M A;  4EKW A;  2YWA A;  4XEV A;  1OQC A;  4Q4Z F;  3EZH A;  3NKD A;  2YLD A;  5KYU B;  1NZE A;  1J8M F;  4WAB A;  3U2M A;  2Y69 C;  4PJM A;  2XLV A;  4CJG A;  1C02 A;  1HE9 A;  3W8H A;  1V74 B;  3HNL A;  2R7W A;  4JTC B;  1APC A;  4IWB A;  5L3V A;  3LLI A;  1Z23 A;  4J30 B;  5DQT A;  5E33 A;  1HMD A;  2O9X A;  2I8B A;  2WVN A;  4WJ0 A;  2CCY A;  3EFO B;  4JC7 A;  4JE9 A;  1MNE A;  1R5I D;  3ABK C;  4JRZ A;  4PJJ A;  4JTD B;  1NFN A;  3QW1 A;  4C7O B;  2YVK A;  3IPM O;  4GEH A;  2IXN A;  1N1C A;  2FAP B;  2OKU A;  3L0I A;  4CJO A;  5B1B C;  4W8K A;  4PFO A;  1PD0 A;  3NG1 A;  2NPU A;  4DJ9 A;  3AGU A;  4CSA C;  3N24 A;  3E9V A;  2Y3D A;  4ER9 A;  3GEI A;  3DE8 A;  5K0I A;  3NYJ A;  5B3I A;  2IOQ A;  4LDR A;  3VAY A;  1HW1 A;  1V54 C;  1LI7 A;  3GOR A;  1T6I A;  1EQ1 A;  3ZSU A;  4DOZ A;  2HSQ A;  4ZLD A;  3KH2 A;  3IQ6 A;  2J9B A;  1OCC C;  3ITF A;  1GS9 A;  5F5F A;  1WN0 A;  2HSB A;  1ZHW A;  1ZW3 A;  4NTB A;  3H2U A;  3TUL A;  2R7U A;  4XQ1 A;  4UDV A;  1RJ9 B;  2QTV A;  3EGD A;  2A69 F;  3R2P A;  2WZG A;  2C03 A;  4XWJ A;  5HSW A;  5GPG B;  3AG4 C;  1NG1 A;  2CW0 F;  3O39 A;  4HEA J;  2HJM A;  2F22 A;  4PJN A;  2WL8 A;  1XWJ A;  3L8I A;  4BJ6 C;  4C3E A;  4QI2 A;  1SF8 A;  2ASR A;  2HUJ A;  3AOU A;  3I4U A;  5E3C A;  4CS8 C;  1YVI A;  2WZF A;  4WGY A;  3M1C B;  1TWH A;  2L7A A;  4QI0 A;  3K6B A;  3B0P A;  3MFN A;  3GM2 A;  1OCZ C;  1ZHX A;  2D5R B;  1S05 A;  4ULV A;  2YLI A;  1A7V A;  4IGG A;  1G8X A;  2XM0 A;  4FWV A;  2YHS A;  3FAJ A;  2DGJ A;  3AQB A;  1JPJ A;  2YQY A;  3PMR A;  3TOM A;  4A2N B;  4ZLC A;  1FFH A;  1FAP B;  2W4B A;  2PFD A;  3RH3 A;  4E18 A;  3TOL A;  4DRI B;  3SXM A;  1RKE A;  2A0B A;  2J0X A;  3S90 A;  2OEX A;  3O55 A;  4OIR F;  4JCH A;  1U0B B;  1CPQ A;  3ASN C;  4FAP B;  1AUE A;  3EPV A;  3HKK A;  1E86 A;  3CAX A;  2R7T A;  2IBF A;  4MQ9 F;  5A6K A;  3UMI A;  1I5N A;  3QVY A;  3DAG A;  4QDL A;  3RQG A;  2DI3 A;  3AJM A;  2B0J A;  4N06 A;  1FFT C;  4U5G A;  2H7V C;  4YJW A;  3FVY A;  2G3K A;  5EK0 A;  3ATP A;  1R4T A;  1LKX A;  2QY9 A;  4MVU A;  5L0F A;  3ZIB A;  5L3Q A;  4MVO A;  1B68 A;  1OCR C;  3S29 A;  4R32 A;  4D4N A;  4AL0 A;  2YL7 A;  3MYF A;  4MVM A;  5FCL A;  2AVK A;  4LDQ A;  4CDY A;  3H65 A;  2FFH A;  1VOM A;  2J0W A;  4P6I C;  4XEK A;  2XLM A;  4CS7 A;  1RMV A;  3U8P A;  3EGX B;  5JLI A;  1GM5 A;  1EKY A;  3E70 C;  1BR1 A;  3JRT A;  1NSG B;  4XTK A;  2XL6 A;  3T6G B;  3FOO A;  1WGW A;  5KYX A;  3POV A;  2EPO A;  2BC5 A;  2VH3 A;  1QQ3 A;  3SYN A;  2R7V A;  4JJG A;  4EIY A;  2L6F A;  1H9G A;  3RQF A;  4YWQ A;  3DKA A;  1TQG A;  1JPN A;  4BEJ A;  4OD4 A;  1WTY A;  3VM6 A;  5KYY A;  3CEX A;  4JUR I;  1ZZP A;  4YL3 A;  3RF3 A;  3FMS A;  1CGO A;  1D1A A;  1LS1 A;  4D4X A;  4OIQ F;  3HNK A;  1NFO A;  3B0V C;  5COM A;  1MMD A;  3C8G B;  3UNG C;  4BG0 A;  1DOV A;  2DYS C;  4CDV A;  4X0R A;  4U9D A;  1YA9 A;  3V5Z A;  5KYW A;  3WHN A;  2OU6 A;  5JP7 A;  1SZI A;  1ZHT A;  2L81 A;  3LUT B;  4NY3 A;  1ZU4 A;  1YAR O;  2GWW A;  3RVZ A;  3S0X A;  1ORJ A;  4OIP F;  4LER A;  3Q7L A;  4WGZ A;  1H6G A;  4JTA B;  3MX3 A;  2ZPA A;  4K1O A;  5B3S C;  2R25 A;  2LQG A;  2R02 A;  3BRJ A;  3G50 A;  3MYI A;  5L0G A;  5A6A A;  1HW2 A;  4O6N A;  1MMN A;  4E7Z A;  2LFD A;  1Y4C A;  2IXO A;  1T01 A;  2BE5 F;  3LAY A;  4KBL A;  5TJ5 E;  1RKC A;  2NSG A;  3GM1 A;  4XPX A;  3EQL F;  3NMK A;  1E83 A;  1K05 A;  5JUA A;  5FZT A;  3TJ5 A;  4CIP A;  3JZ0 A;  1QSP A;  4XEF A;  1L3P A;  2EIJ C;  2LIG A;  3GM3 A;  3OA1 A;  4XPW A;  2AP3 A;  4W8P A;  3PHF 2;  4OD5 A;  3RFY A;  1M2V A;  1I4Y A;  1TWG A;  2WVO A;  1YZA A;  1TFK B;  3DWW A;  4AE4 A;  4MVZ A;  3H2V A;  2XSE A;  3I5P A;  1V4A A;  3SEO A;  3LNM B;  2IXM A;  1VB5 A;  4HFK B;  1EA8 A;  2ZXP A;  2ICW G;  4Z9J A;  3B29 A;  4G0H A;  1BZ4 A;  1QPU A;  2OCC C;  2YEV A;  4XLN F;  3SXY A;  4U5C E;  2P1A A;  3TD7 A;  3ZWI A;  2A1D D;  2Y39 A;  3AQC A;  3DMD A;  4EBJ A;  4E7S A;  3MLG A;  3FOP A;  1LI5 A;  2RD9 A;  2KW3 C;  2NUT A;  3U5S A;  1WAS A;  1BBH A;  5L0I A;  1A7D A;  1ORY A;  1OW8 A;  4HE8 D;  4YN0 B;  2HZ8 A;  4MTO A;  1GGQ A;  1K40 A;  3L34 A;  4KC9 A;  2J7P D;  3DXJ F;  1JRA A;  2EPN A;  3JYY A;  5E2Q A;  2X51 A;  1VLT A;  3EHN A;  5B1A C;  4BPM A;  4IAR A;  3UR3 C;  4EWC A;  2V3C C;  4OIO F;  1KTM A;  5L0J A;  1YJG A;  1Q0F A;  2EPK X;  2MYS A;  4NTA A;  1Y6D A;  2Y3B A;  4U5F E;  3W8I A;  1ZYR F;  2PX0 A;  5EHH A;  2OG2 A;  4P9F A;  3FAP B;  1ZW2 A;  1D0Y A;  3RYL A;  3N0T A;  4RD9 A;  4DVY P;  2NG1 A;  2XXA B;  2IM8 A;  3JTL O;  4LLC A;  4JVS A;  5HV9 A;  1VLS A;  5T3W A;  3NYM A;  3Q7G A;  3V7O A;  1OKK A;  2LK4 A;  2NSF A;  1PCX A;  2NUP B;  2VCA A;  2VB6 A;  3W4Y A;  3F46 A;  2H8A A;  1C17 M;  3M4B A;  2W9Y A;  3EG9 B;  3JSZ A;  3PCV A;  2KNH A;  4F4B A;  3LLK A;  4K7B A;  5A6B D;  2GA0 A;  4CIH A;  4ULW A;  3NMJ A;  4G7O F;  5A6J A;  2JD3 A;  2QLA A;  1KU2 A;  4KI2 A;  3S84 A;  2J8W A;  4HFF B;  2B0H A;  4PK4 A;  1TR2 A;  1XZP A;  4N6H A;  1QVX A;  1OW6 A;  5JS5 A;  1YDI A;  3UMH A;  1SYQ A;  4U9E A;  1YLM A;  1AEP A;  5T1D B;  4MND A;  2JPU A;  1TWA A;  1V55 C;  3QVZ A;  1Z6A A;  2A68 F;  4LAC B;  1TWC A;  1ZVZ A;  4K0D A;  1BR4 A;  4RDA A;  3G4X A;  4H4K C;  1G5Z A;  1FMW A;  2YRF A;  3V5Y A;  1OXK A;  1PD1 A;  3RVY A;  4A4A A;  3ECS A;  2P7V A;  5AC5 A;  1D0Z A;  4JJF A;  4MVR A;  3GEE A;  3U0C A;  3KMI A;  5BQH A;  3FXH A;  5KYU A;  3KKB A;  3FDQ A;  2D4U A;  1M6T A;  2Q9B A;  2W45 A;  4O7G A;  3ZC4 A;  4EBB A;  5COG A;  1JMW A;  2ZXR A;  3HJC A;  3TJ6 A;  1F1M A;  3JRM O;  4LLE A;  4L6R A;  1BDJ B;  1TFO B;  1ZHY A;  2HS5 A;  3ABL C;  3DI5 A;  3G4Z A;  2XM4 A;  1PV3 A;  3LEO A;  2XLD A;  2LSE A;  4RBN A;  2EPL X;  2YLG A;  4O6Y A;  3EFO A;  3C18 A;  3U3B A;  1HE1 A;  3U8V A;  1KNY A;  2VC9 A;  1CGM E;  4DRJ B;  4O6M A;  2JX0 A;  4C7O A;  3LS1 A;  5DQZ A;  2R7X A;  3A9C A;  3CZ6 A;  4YT8 A;  1GQA A;  4CS9 A;  1S7Z A;  1A7E A;  1OKK D;  4I44 A;  3SXK A;  3GAN A;  2R05 A;  1G4U S;  3IQC A;  1YAU O;  2PX3 A;  1QKR A;  2R7S A;  2G3V A;  4Z9H A;  1CPR A;  2J46 A;  3C8G D;  1UFB A;  3K1H A;  3O10 A;  3GEH A;  3WG7 C;  5DS6 A;  4MVQ A;  4NCQ A;  4NQF A;  3EJN A;  1I4Z A;  2HV7 A;  4DVZ A;  5E3A A;  2ZD9 A;  2R9R B;  2J7P A;  4FX5 A;  2DB4 A;  3LNR A;  1T9K A;  1RJ9 A;  2R03 A;  3KL4 A;  1D1C A;  3AG1 C;  3QW0 A;  1C03 A;  4U5B E;  2XXA A;  2CGE A;  2KJG A;  4BJT A;  4AL1 A;  2A6E F;  2C04 A;  2QUP A;  4XLP F;  3S27 A;  2HMQ A;  3BEH A;  3RQE A;  5COF A;  1K04 A;  2UUH A;  3I5Q A;  4P9T A;  1RCP A;  4H54 A;  1IZM A;  4J32 B;  2CNW D;  4YT4 A;  3EGD B;  2EIN C;  2Y3H A;  4JW1 A;  3UMK A;  4JEB A;  3UGP A;  3VRC A;  2XL8 A;  4E0I A;  1MMA A;  3K7D A;  3K66 A;  4LDK A;  2YL0 A;  2G62 A;  5A6B A;  1TKN A;  3F47 A;  1RXQ A;  3DE9 A;  5T3T A;  3ZQV A;  2HV6 A;  2P0N A;  4AK9 A;  1FNT c;  4G7H F;  1A41 A;  4GQH A;  256B A;  3L1M A;  1YA7 O;  1E85 A;  2OJQ A;  3CQZ A;  3WAQ A;  2EIL C;  4M63 A;  3T6B A;  3IHU A;  1VMA A;  3EH1 A;  3HLZ A;  4MS2 A;  4YL1 A;  2V26 A;  4GYT A;  3S9O A;  3NDB B;  4U5E E;  1T6Q A;  1VYK A;  3DM9 B;  4IAQ A;  3EHM A;  2EPM X;  3DD7 A;  5D92 A;  2PF4 E;  1D1B A;  2CDQ A;  1NBB A;  2VAS A;  1VTM P;  5CI8 A;  2KGO A;  1M2O A;  3C7J A;  1OR3 A;  5AC4 A;  2LP4 A;  3TK0 A;  4C3B A;  3K1I A;  3NMI A;  3V5X A;  2PBE A;  3AGT A;  3U3F A;  3HNI A;  5BQG A;  4EHP A;  5CIV A;  2AU5 A;  2A0U A;  3N2Z B;  2OQM A;  1H7I A;  2ZXO A;  3IEE A;  4MTF A;  4AX2 A;  4KNW A;  2BL2 A;  2Z15 A;  2ZXW C;  3DJU B;  5DS5 A;  3K33 A;  2GDC A;  1E84 A;  5AGF A;  1YYJ A;  1NLX A;  4BJ5 A;  3EZI A;  3AG2 C;  2J9W A;  3UGO A;  2GAQ A;  3DM5 A;  3NKE A;  1T5O A;  3CSK A;  4DBR A;  5DS4 A;  3EGX A;  3GWL A;  1ZHZ A;  2DYR C;  4Q7C A;  3W2V A;  1CGN A;  4E17 A;  5A69 A;  4JCZ A;  1O87 A;  1U89 A;  2XS8 A;  2FGY A;  3JYH A;  3T9O A;  2YZS A;  2AWY A;  2KSF A;  3GOD A;  1Q0G A;  1M57 C;  2VCC A;  3EH2 A;  3ABM C;  5KYX B;  2IYL D;  1QLE C;  1A0B A;  1E2X A;  2EIK C;  2WB7 A;  2YL3 A;  1T6U A;  3NYL A;  4IB4 A;  5DLJ A;  2TMV P;  3JT1 A;  3C8G A;  4PJL A;  2YL1 A;  3J06 A;  3AG3 C;  5KYY B;  1O3U A;  2L6G A;  1LE4 A;  4JZA A;  3ZTZ A; 
#chains in the Genus database with same CATH homology
 3HNJ A;  4CDV A;  4JKV A;  4U9D A;  3ZQY A;  4L6R A;  2XLV A;  3ZTM A;  5JP7 A;  1YYX A;  4CJG A;  5JSL A;  2XM4 A;  2XLD A;  2YLG A;  3HNL A;  1APC A;  4WGZ A;  2CCY A;  1GQA A;  4JE9 A;  3QW1 A;  5JT4 A;  1JAF A;  5JVE A;  4CJO A;  1CPR A;  3M4C A;  4CDA A;  3NMK A;  4ER9 A;  5JUA A;  1YZC A;  3DE8 A;  4CX9 A;  5B3I A;  4CIP A;  3IQ6 A;  2J9B A;  3QW0 A;  1YZA A;  2XLH A;  1QPU A;  1RCP A;  3ZWI A;  4JEB A;  3VRC A;  2XL8 A;  3FOP A;  1BBH A;  4N4W A;  4JEA A;  2XLO A;  2YL0 A;  4WGY A;  3DE9 A;  3ZQV A;  4IAR A;  1S05 A;  256B A;  3L1M A;  4ULV A;  2YLI A;  1E85 A;  1A7V A;  2XM0 A;  3TOM A;  5JRA A;  4IAQ A;  3TOL A;  2YKZ A;  1NBB A;  1CPQ A;  1E86 A;  3NMI A;  3HNI A;  3M4B A;  1E83 A;  3QVY A;  3M15 A;  3NMJ A;  3C62 A;  2QLA A;  1E84 A;  5AGF A;  1YYJ A;  2J8W A;  4N6H A;  5JS5 A;  4U9E A;  4D4N A;  2YL7 A;  3IQ5 A;  3QVZ A;  4CDY A;  1CGN A;  2XLM A;  1MQV A;  3U8P A;  3ZTZ A;  5JLI A;  2XLE A;  1EKY A;  2XLW A;  2XL6 A;  3FOO A;  2BC5 A;  1QQ3 A;  4EIY A;  1LM3 B;  3M79 A;  2YL3 A;  3C63 A;  4IB4 A;  4NC3 A;  1CGO A;  1M6T A;  2YL1 A;  4D4X A;  3HNK A;  2YLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...