4CJGA

Spectroscopically validated structure of the 5 coordinate proximal no adduct of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjgA00
5B3IA 1S05A 4IB4A 5JT4A 2J9BA 3FOOA 4CDYA 1M6TA 2QLAA 4ULVA 2YL3A 4ER9A 4CDVA 4D4XA 3ZTZA 1QQ3A 4NC3A 3DE9A 4U9EA 2XLWA 5AGFA 1BBHA 1YYXA 1CPRA 4CX9A 2BC5A 2XL6A 3M4BA 1E86A 3M15A 2XM4A 4JE9A 4N4WA 3ZWIA 4WGYA 5JSLA 3ZTMA 2XLMA 2CCYA 2YKZA 1E85A 2YL7A 3M79A 3FOPA 1E84A 1EKYA 2J8WA 1APCA 3NMJA 1NBBA 4CJOA 3U8PA 3QW0A 2XLVA 4WGZA 3TOLA 2YLIA 3IQ6A 4D4NA 4IAQA 3QW1A 1YYJA 1JAFA 3HNIA 2XLDA 5JS5A 3HNLA 3VRCA 1GQAA 3HNKA 2YLGA 5JP7A 3ZQVA 256BA 2YL0A 4CDAA 2XLOA 2YLDA 5JRAA 4CJGA 5JLIA 3QVZA 4N6HA 3L1MA 1A7VA 1RCPA 3C63A 2XLHA 2XL8A 1QPUA 1E83A 3DE8A 4JEBA 1CPQA 1LM3B 3M4CA 2XM0A 3ZQYA 3C62A 3HNJA 1CGOA 4IARA 2XLEA 1YZCA 4U9DA 2YL1A 4JKVA 3NMKA 1MQVA 4EIYA 4JEAA 4CIPA 3QVYA 5JUAA 3NMIA 1CGNA 3TOMA 1YZAA 5JVEA 4L6RA 3IQ5A
chains in the Genus database with same CATH superfamily
1Q0GA 3IHUA 2F22A 3LLKA 4I1OB 1TWAA 5EK0A 3RVYA 4N06A 4G7HF 4DJ9A 2XXAA 1JPNA 3KYIA 5CI8A 2VH3A 4OIPF 3FOOA 2LP4A 3PCVA 4J7YA 1M6TA 1OCOC 1OKKA 3VF0A 2XXAB 2XL4A 2KNHA 2ZXPA 1OCRC 2HS5A 1A41A 2WVNA 3JRMO 1MNDA 1HE1A 1OCZC 2AP3A 4CDVA 3GM3A 2VC9A 4D4XA 3UGPA 3LNRA 1V55C 2AU5A 4IWBA 5T1DB 1VB5A 2XLWA 4MQ9F 1BBHA 3U0CA 2CW0F 1VYKA 1W2WA 2C03A 2W4MA 2Q9AA 2G62A 1CPRA 4CX9A 2CGEA 3Q7LA 3X2QC 1TQGA 3BEHA 2XSEA 3M4BA 3OWTA 5L0CA 1E86A 3M15A 2FAPB 4ZLDA 2AWCA 1VYIA 1MMAA 4A2NB 3IQTA 4WGYA 5KYXA 3T9OA 2P1AA 3KKBA 3T6JA 5JSLA 1DOVA 2R7TA 3AG3C 1GM5A 4PJJA 3ZC4A 2CCYA 2YKZA 3ITFA 4MS2A 4CS8C 4CIHA 1T6QA 1AUEA 2A68F 3K1IC 1HE9A 2IXNA 1ST6A 2WZLA 2Q3TA 5FZTA 2VCCA 2NG1A 3DWWA 3GEIA 3EJNA 5DLJA 1HMOA 4DOZA 3NMJA 2D4UA 3JYHA 1NBBA 3OEOA 4CJOA 3U8PA 2YEVA 4CS8A 2I8BA 2P6VA 4GEHA 3K1IA 3QZCA 4HEAJ 5DS6A 2YLIA 3TJ6A 4IAQA 4DBRA 3QW1A 4RDAA 3L8IA 1YYJA 2W45A 3ABLC 2B0HA 3HNIA 3O39A 3U3BA 3H2UA 5KYUB 4Q7CA 3HNLA 3MFNA 3MBGA 1WTYA 4WABA 3SXZA 4I44A 4O79A 3N24A 4Z9HA 3WAQA 256BA 1BR4A 3DD7A 4BJ1A 4CDAA 3DKAA 2PFDA 1NLXA 4MNDA 2DI3A 2XLOA 5TJ5E 1ZVZA 3S27A 3TQOA 3L8JA 4FAPB 2R7UA 1A7EA 3LS0A 3RQGA 3AQCA 1NFOA 2HV7A 3HLZA 5B1AC 1TFOB 1D0ZA 1EI7A 2YVKA 5L0FA 2R05A 1LPEA 2PX0A 1TR2A 2BE5F 4LLCA 5D92A 2WVOA 1A7VA 1NU9C 4B6IA 2LIGA 3NG1A 3O55A 2L6FA 3W2VA 3WHNA 3POVA 3S0XA 2HMZA 5F28E 2DYRC 1FTSA 3EHNA 3FAPB 4MTOA 1TWGA 1U0BB 1V54C 2Q4FA 3W4YA 1V4AA 4A4AA 3U2LA 4EBBA 3ZQYA 5BUOA 2LSEA 3K1HA 1CGOA 2D5RB 2H7OA 2WZFA 2LD6A 5HSWA 3EHMA 3ZVRA 3VAYA 4HFKB 4YL1A 5L0GA 1RJ9A 2J7PD 1RKEA 2H7VC 1OW6A 5F5HA 3A9CA 1D1AA 3K33A 1T01A 4JTDB 4MVMA 5E33A 1MQVA 1HY5A 4BJTA 3A11A 5HV9A 1YAUO 3DI5A 3SXYA 1H7IA 4E7SA 4X0RA 3UMKA 3LEVA 1OCCC 1FMVA 3EGXA 2Y3BA 2R7OA 3QVYA 1OXKA 1VLTA 2A6HF 4YJWA 3T6BA 1LIHA 2QUPA 3US6A 2P0NA 4P6IC 3EGXB 1K40A 2HSBA 2VCAA 1S7ZA 3GM1A 3MYFA 1JPJA 1RXQA 1M56C 2KC3A 4AK9A 5B3IA 2R7WA 4QI2A 2YWAA 4XLNF 1G4US 5A6AA 5L0JA 2R7XA 3GANA 3WODF 4CDYA 2FGYA 4O6NA 4Z9JA 5E2QA 4IRUA 2QLAA 1A0BA 2Y39A 5GPGB 2YL3A 1QKRA 2AWYA 3L0IA 3JRTA 2KQ9A 2IOQA 3F47A 3MLGA 5AC4A 3H65A 3ZTZA 1QQ3A 1M2VA 1YARO 4E18A 2YQYA 4JJFA 5FCLA 3G4XA 1EA8A 2J0XA 4YT4A 1V74B 3UMIA 3AGTA 2L6HA 1C02A 2HKVA 1Z63A 1ORYA 3S28A 1DOWA 1Q0FA 4MTFA 3AG1C 3C7JA 3LNMB 4PFOA 1ZW3A 3ZWIA 3RIPA 2G3VA 1YDIA 3K66A 3NDBB 3ZTMA 1E2XA 1G5ZA 3F46A 3JSEO 1K04A 1SZIA 4DVZA 1E85A 4BPMA 1BR1A 1OR3A 4DVYP 2YL7A 3M79A 3UMHA 3PHF2 4IJJA 1CGME 3B9QA 3FOPA 3TD7A 3WG7C 4AE4A 2J9UA 2JPUA 2J8WA 3ECSA 4XEKA 1EKYA 1APCA 1HMDA 2TMVP 1OKKD 2R7VA 2LFFA 2XS8A 1A7DA 3QW0A 2GWWA 4AE4B 1I5NA 2XLVA 4WGZA 1G4WR 1SYQA 3DAGA 3S90A 1WGWA 2GFHA 1M2OA 1J8YF 3IQ6A 4BJ6C 1Z3IX 3NYLA 2R7QA 1L3PA 1JAFA 2ZXOA 1H9GA 2PX3A 1QSPA 4I1MA 2MHRA 3AQBA 2L81A 3HNKA 4IGGA 1NG1A 2H7BA 3OA1A 4JIOA 1Y6DA 3ATPA 4LERA 4BJ6A 1T6UA 1H6GA 2MYSA 3U8VA 1FMWA 2A6EF 4ONSA 3W8HA 2LQGA 1H9TA 2L6GA 2RSEB 1GS9A 1ZW2A 1ZHXA 1JRAA 3NKEA 2LK4A 3U2MA 3EH1A 1O3UA 1VTMP 4IAOA 4FWVA 1U6HA 3AGUA 3SP1A 2BL2A 5JLIA 2PF4E 2OEXA 1Q0DA 5BQHA 3ABMC 4N6HA 3L1MA 2ZXWC 1Z7Qc 3I5QA 2P61A 1RCPA 3Q6NA 5KYUA 3SEOA 2JD3A 4M63A 4QI0A 1Q0MA 2A69F 3K7DA 5A6JA 4AL1A 4EUKB 1E83A 3NKDA 5T3TA 5L3QA 3M4CA 2AVKA 2DB4A 2FFHA 2XM0A 4PR9A 1T5OA 4OD4A 4G0HA 1YJGA 1PD1A 3C62A 3V5YA 4BEMJ 3H2VA 5A6BA 3M1CB 4ANJA 4JW1A 4IARA 4MW3A 1AVOB 4RBNA 2IBFA 3Q6MA 4MVUA 2GA0A 5A6BD 1LE4A 2OEVA 3W2WA 2HFIA 3C8ZA 4QDLA 1YA7O 4JKVA 1OW8A 1FFHA 1FNTc 2X0CA 4JC7A 4Q4ZF 1RKCA 2EPNA 1QZXA 1JR8A 1Q0KA 1SMYF 4KI2A 4YT8A 3GORA 4NTAA 4RD9A 2ZD9A 1HW2A 1I4YA 4CS9C 1BDJB 1WATA 2A1DD 3LJBA 1OW7A 1YZAA 2HUJA 3FAJA 4L6RA 4U5HA 5KYYB 4G7ZF 3RH3A 4JCZA 3EGDB 3JZ0A 4EBKA 1LI5A 1ZHTA 1S05A 1TFKB 3E70C 2RD9A 4IB4A 5JT4A 3B71A 1D0XA 2GAQA 3K6BA 2J9BA 4J32B 4O7GA 3RQFA 2EPOA 4CBEA 3DAFA 3EZHA 2QY9A 1U89A 3HJCA 5CIVA 3DXJF 2DGJA 2PNOA 2EIMC 3AG2C 2ETSA 4C7OA 3U9MA 3V7OA 5D91A 4ER9A 2EIKC 2ZXRA 1AEPA 1C17M 2VASA 3NRHA 4JVSA 4C3DA 3O10A 1Z23A 2Z15A 1J8MF 4CSAC 4C7OB 1TWCA 4NC3A 1BR2A 3DE9A 4NY3A 4HFFB 1NFNA 1D1CA 2EPKX 3C8GB 5B1BC 1ZU4A 5AGFA 1YYXA 3SXKA 4MVOA 4H54A 1T6IA 3DJUB 4EKWA 2V3CC 2WB7A 3CAXA 2Q9BA 4JTCB 2IM8A 4XEVA 4DXWA 4CSAA 1ZZPA 2BC5A 3ASOC 3IEEA 5AC5A 5DQTA 4HE8D 4YL3A 3CSKA 5BQGA 3S29A 4N4WA 3T6GB 5DVWA 4YL0A 3EFOA 1O5HA 4PK4A 3R2PA 1GGQA 4O6YA 4Q5SF 2J9WA 1RMVA 5L0HA 3GEHA 3DMDA 3MX3A 4FESA 4FX5A 4W8KA 2CNWA 2NPUA 2KK1A 4YT5A 5EGYA 1ORSC 4LLEA 5KYNA 1OQCA 1NZEA 1ZU5A 4W8PA 2M64A 2Y3GA 3EG9B 2NUPB 4GYTA 4MVQA 1IZMA 4DRJB 2I15A 2IXOA 3S84A 4MVRA 3V5XA 4D4NA 4UDVA 4ZLCA 5E3AA 3ABKC 4E0IA 3JTLO 3MYIA 2L9JA 3LEOA 4MTGA 2HSQA 1Z6AA 1HW1A 2XLDA 4U5CE 4WJ0A 3EPVA 2A0BA 3JCUQ 3VRCA 3DM5A 4LACB 3ZDLA 2O9XA 3R7CA 2YLGA 4YN0B 2CYDA 5JP7A 1M57C 2CDQA 3ZQVA 3NYMA 5T3WA 2J9VA 2Q9CA 3DJNB 3FVYA 1LE2A 1LI7A 3ZIBA 3FHDA 3LESA 4PFPA 2ASRA 2KYHA 5DQZA 2KW3C 4F4BA 1D1BA 2OJQA 3E9VA 3DZAA 4U5GA 2YLDA 5BQIA 5JRAA 2KGOA 2HMQA 3HKKA 1OXBA 4PJLA 4XPYA 2LCHA 4CJGA 3BRJA 2OKUA 3QVZA 3RW0A 4OIQF 3N0TA 2R02A 2J46A 3C63A 2A0UA 4JCHA 1VMAA 3I5PA 3B0VC 4KNVA 3L34A 3DE8A 4G78A 2R7SA 1FR0A 4XWJA 1CPQA 4C3BA 1LM3B 4U5BE 1L7CA 4ULWA 3EFOB 3UGOA 3EH2A 1B68A 2ZPAA 3GM2A 1ORJA 3HNJA 4JTAB 4XEFA 2Q7RA 3UNGC 5A6KA 1JMWA 4I3MA 1XZQA 3GODA 1VOMA 1R5ID 3DM9B 2W9YA 4YT2A 1JOGA 4PJMA 4GQHA 2YHSA 5L0DA 5F5FA 2EINC 1QLEC 3GEEA 3VYWA 1SF8A 5B3SC 3KMIA 2GDCA 3KH2A 3SXMA 4U9DA 4KNWA 1PV3A 1WWPA 3IPMO 2R7RA 4DRHB 2Y3HA 2P7VA 4JURI 4PACA 1OR2A 3FXHA 4U5FE 2IYLD 4CS7A 4CIPA 3VM6A 4XPWA 3G50A 2JX0A 4JZAA 5JUAA 2G3KA 3KPHA 4KBLA 3LUTB 4JJGA 1FFTC 1VK5A 1ZYRF 4KC9A 5JVEA 2J45A 3IQ5A 4DBQA 1Z5ZA 4XQ1A 1WOLA 4BEJA 3PMRA 4MW8A 4P9FA 2WL8A 1O87A 1YVIA 5KYXB 1VLSA 3X1OA 2QNLA 3JT1A 4JRZA 4YWQA 5EHHA 3AOUA 1XWJA 4ULVA 2E87A 3CQZA 1YLMA 4LDRA 3RQEA 1Y4CA 1BZ4A 2M4EA 2KSFA 1MMGA 1EQ1A 4U9EA 3V5ZA 4J30B 4H4KC 5A69A 3JSZA 2H8AA 4XPXA 4G7OF 5KYYA 2C04A 3B29A 3I4UA 1ZHYA 4NTBA 3TJ5A 4BJ5C 1G8XA 3EGDA 2XRHA 2XL6A 4E17A 4AX2A 2IXPA 5DS4A 2XM4A 1SR2A 1FAPB 3QTHA 2OQMA 4JE9A 2EPMX 2HJMA 1LKXA 2ICWG 3G4ZA 4R32A 4K0DA 2YRFA 4LDQA 4OIOF 2NUTA 1LS4A 3U9JA 4BJ5A 2Q00A 2XLMA 4CS9A 2J0WA 3LLIA 2PBEA 3O6XA 2NUTB 3ZSUA 2WZGA 3ASNC 4EWCA 5L0IA 3JYYA 2YZSA 1IW7F 1E84A 3TK0A 3C8GA 1QVXA 4LDKA 1T9KA 1ZHZA 4N6CA 3TULA 4NQFA 1XZPA 1LS1A 3T4RA 3U5SA 3UR3C 3TOLA 3C8GD 1MNEA 3KL4A 1LVKA 2IXMA 2WVQA 4OD5A 2Y3DA 5DS5A 1PD0A 2HJ3A 3FMSA 5E3CA 5COFA 4E0HA 5JS5A 2NSFA 1MMNA 4K1OA 3GWNA 4U5DE 1GQAA 1TKNA 2OCCC 3CEXA 3AJMA 4U5EE 2J7PA 3Q7GA 1F1MA 5L3VA 4NTFA 3RKOF 2R03A 2V26A 3GWLA 4OINF 4XLPF 4PJNA 2YL0A 3FDQA 3RVZA 2EIJC 2MWQA 3SZRA 2VCBA 2QTVA 2OJED 4Z9IA 4OIRF 3RF3A 3SYNA 3RFYA 4J7TA 3J06A 3EG9A 2OOCA 3KYJA 2NUPA 1RJ9B 1K05A 2OU6A 1NSGB 3U3FA 1RKEB 2B0JA 3EZIA 1WN0A 3C18A 2R25A 4K7BA 4XTKA 4O6MA 5COGA 3QMKA 1R4TA 2CNWD 3S9OA 3N2ZB 3LAYA 1TWHA 4AL0A 4MVSA 1KNYA 2XLHA 4C3EA 3LS1A 2XL8A 3RYLA 1QPUA 1D0YA 1UFBA 4MVZA 2EPLX 5IY5C 3B0UX 4JEBA 3SNHA 1PCXA 2DYSC 2VB6A 4BG0A 4E7ZA 3NYJA 2LFDA 3AG4C 1NU7D 5KYWA 3PDMP 1UG7A 2EILC 1C03A 2W4BA 4NCQA 2L7AA 1MMDA 3HTKC 5KYWB 4EHPA 2XLEA 1I4ZA 1YZCA 2UUIA 2HV6A 2NSGA 2OG2A 2YL1A 1KTMA 3NMKA 1ZHWA 5K0IA 2KJGA 4JEAA 4EIYA 1N1CA 1WASA 3ZG1A 4P9TA 1M2VB 2R9RB 3IQCA 3NMIA 4YK5A 1CGNA 2Y69C 2XS1A 3CZ6A 2QE9A 3TOMA 3W8IA 2HZ8A 2PP4A 2X51A 4DRIB 4EBJA 1KU2A 3EQLF 3B0PA 5COMA 2UUHA 5CI9A 1YA9A
chains in the Genus database with same CATH topology
5B3IA 1S05A 4IB4A 5JT4A 2J9BA 3FOOA 4CDYA 1M6TA 2QLAA 4ULVA 2YL3A 4ER9A 4CDVA 4D4XA 3ZTZA 1QQ3A 4NC3A 3DE9A 4U9EA 2XLWA 5AGFA 1BBHA 1YYXA 1CPRA 4CX9A 2BC5A 2XL6A 3M4BA 1E86A 3M15A 2XM4A 4JE9A 4N4WA 3ZWIA 4WGYA 5JSLA 3ZTMA 2XLMA 2CCYA 2YKZA 1E85A 2YL7A 3M79A 3FOPA 1E84A 1EKYA 2J8WA 1APCA 3NMJA 1NBBA 4CJOA 3U8PA 3QW0A 2XLVA 4WGZA 3TOLA 2YLIA 3IQ6A 4D4NA 4IAQA 3QW1A 1YYJA 1JAFA 3HNIA 2XLDA 5JS5A 3HNLA 3VRCA 1GQAA 3HNKA 2YLGA 5JP7A 3ZQVA 256BA 2YL0A 4CDAA 2XLOA 2YLDA 5JRAA 4CJGA 5JLIA 3QVZA 4N6HA 3L1MA 1A7VA 1RCPA 3C63A 2XLHA 2XL8A 1QPUA 1E83A 3DE8A 4JEBA 1CPQA 1LM3B 3M4CA 2XM0A 3ZQYA 3C62A 3HNJA 1CGOA 4IARA 2XLEA 1YZCA 4U9DA 2YL1A 4JKVA 3NMKA 1MQVA 4EIYA 4JEAA 4CIPA 3QVYA 5JUAA 3NMIA 1CGNA 3TOMA 1YZAA 5JVEA 4L6RA 3IQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  1S05 A;  4IB4 A;  5JT4 A;  2J9B A;  3FOO A;  4CDY A;  1M6T A;  2QLA A;  4ULV A;  2YL3 A;  4ER9 A;  4CDV A;  4D4X A;  3ZTZ A;  1QQ3 A;  4NC3 A;  3DE9 A;  4U9E A;  2XLW A;  5AGF A;  1BBH A;  1YYX A;  1CPR A;  4CX9 A;  2BC5 A;  2XL6 A;  3M4B A;  1E86 A;  3M15 A;  2XM4 A;  4JE9 A;  4N4W A;  3ZWI A;  4WGY A;  5JSL A;  3ZTM A;  2XLM A;  2CCY A;  2YKZ A;  1E85 A;  2YL7 A;  3M79 A;  3FOP A;  1E84 A;  1EKY A;  2J8W A;  1APC A;  3NMJ A;  1NBB A;  4CJO A;  3U8P A;  3QW0 A;  2XLV A;  4WGZ A;  3TOL A;  2YLI A;  3IQ6 A;  4D4N A;  4IAQ A;  3QW1 A;  1YYJ A;  1JAF A;  3HNI A;  2XLD A;  5JS5 A;  3HNL A;  3VRC A;  1GQA A;  3HNK A;  2YLG A;  5JP7 A;  3ZQV A;  256B A;  2YL0 A;  4CDA A;  2XLO A;  2YLD A;  5JRA A;  4CJG A;  5JLI A;  3QVZ A;  4N6H A;  3L1M A;  1A7V A;  1RCP A;  3C63 A;  2XLH A;  2XL8 A;  1QPU A;  1E83 A;  3DE8 A;  4JEB A;  1CPQ A;  1LM3 B;  3M4C A;  2XM0 A;  3ZQY A;  3C62 A;  3HNJ A;  1CGO A;  4IAR A;  2XLE A;  1YZC A;  4U9D A;  2YL1 A;  4JKV A;  3NMK A;  1MQV A;  4EIY A;  4JEA A;  4CIP A;  3QVY A;  5JUA A;  3NMI A;  1CGN A;  3TOM A;  1YZA A;  5JVE A;  4L6R A;  3IQ5 A; 
#chains in the Genus database with same CATH topology
 1Q0G A;  3IHU A;  2F22 A;  3LLK A;  4I1O B;  1TWA A;  5EK0 A;  3RVY A;  4N06 A;  4G7H F;  4DJ9 A;  2XXA A;  1JPN A;  3KYI A;  5CI8 A;  2VH3 A;  4OIP F;  3FOO A;  2LP4 A;  3PCV A;  4J7Y A;  1M6T A;  1OCO C;  1OKK A;  3VF0 A;  2XXA B;  2XL4 A;  2KNH A;  2ZXP A;  1OCR C;  2HS5 A;  1A41 A;  2WVN A;  3JRM O;  1MND A;  1HE1 A;  1OCZ C;  2AP3 A;  4CDV A;  3GM3 A;  2VC9 A;  4D4X A;  3UGP A;  3LNR A;  1V55 C;  2AU5 A;  4IWB A;  5T1D B;  1VB5 A;  2XLW A;  4MQ9 F;  1BBH A;  3U0C A;  2CW0 F;  1VYK A;  1W2W A;  2C03 A;  2W4M A;  2Q9A A;  2G62 A;  1CPR A;  4CX9 A;  2CGE A;  3Q7L A;  3X2Q C;  1TQG A;  3BEH A;  2XSE A;  3M4B A;  3OWT A;  5L0C A;  1E86 A;  3M15 A;  2FAP B;  4ZLD A;  2AWC A;  1VYI A;  1MMA A;  4A2N B;  3IQT A;  4WGY A;  5KYX A;  3T9O A;  2P1A A;  3KKB A;  3T6J A;  5JSL A;  1DOV A;  2R7T A;  3AG3 C;  1GM5 A;  4PJJ A;  3ZC4 A;  2CCY A;  2YKZ A;  3ITF A;  4MS2 A;  4CS8 C;  4CIH A;  1T6Q A;  1AUE A;  2A68 F;  3K1I C;  1HE9 A;  2IXN A;  1ST6 A;  2WZL A;  2Q3T A;  5FZT A;  2VCC A;  2NG1 A;  3DWW A;  3GEI A;  3EJN A;  5DLJ A;  1HMO A;  4DOZ A;  3NMJ A;  2D4U A;  3JYH A;  1NBB A;  3OEO A;  4CJO A;  3U8P A;  2YEV A;  4CS8 A;  2I8B A;  2P6V A;  4GEH A;  3K1I A;  3QZC A;  4HEA J;  5DS6 A;  2YLI A;  3TJ6 A;  4IAQ A;  4DBR A;  3QW1 A;  4RDA A;  3L8I A;  1YYJ A;  2W45 A;  3ABL C;  2B0H A;  3HNI A;  3O39 A;  3U3B A;  3H2U A;  5KYU B;  4Q7C A;  3HNL A;  3MFN A;  3MBG A;  1WTY A;  4WAB A;  3SXZ A;  4I44 A;  4O79 A;  3N24 A;  4Z9H A;  3WAQ A;  256B A;  1BR4 A;  3DD7 A;  4BJ1 A;  4CDA A;  3DKA A;  2PFD A;  1NLX A;  4MND A;  2DI3 A;  2XLO A;  5TJ5 E;  1ZVZ A;  3S27 A;  3TQO A;  3L8J A;  4FAP B;  2R7U A;  1A7E A;  3LS0 A;  3RQG A;  3AQC A;  1NFO A;  2HV7 A;  3HLZ A;  5B1A C;  1TFO B;  1D0Z A;  1EI7 A;  2YVK A;  5L0F A;  2R05 A;  1LPE A;  2PX0 A;  1TR2 A;  2BE5 F;  4LLC A;  5D92 A;  2WVO A;  1A7V A;  1NU9 C;  4B6I A;  2LIG A;  3NG1 A;  3O55 A;  2L6F A;  3W2V A;  3WHN A;  3POV A;  3S0X A;  2HMZ A;  5F28 E;  2DYR C;  1FTS A;  3EHN A;  3FAP B;  4MTO A;  1TWG A;  1U0B B;  1V54 C;  2Q4F A;  3W4Y A;  1V4A A;  4A4A A;  3U2L A;  4EBB A;  3ZQY A;  5BUO A;  2LSE A;  3K1H A;  1CGO A;  2D5R B;  2H7O A;  2WZF A;  2LD6 A;  5HSW A;  3EHM A;  3ZVR A;  3VAY A;  4HFK B;  4YL1 A;  5L0G A;  1RJ9 A;  2J7P D;  1RKE A;  2H7V C;  1OW6 A;  5F5H A;  3A9C A;  1D1A A;  3K33 A;  1T01 A;  4JTD B;  4MVM A;  5E33 A;  1MQV A;  1HY5 A;  4BJT A;  3A11 A;  5HV9 A;  1YAU O;  3DI5 A;  3SXY A;  1H7I A;  4E7S A;  4X0R A;  3UMK A;  3LEV A;  1OCC C;  1FMV A;  3EGX A;  2Y3B A;  2R7O A;  3QVY A;  1OXK A;  1VLT A;  2A6H F;  4YJW A;  3T6B A;  1LIH A;  2QUP A;  3US6 A;  2P0N A;  4P6I C;  3EGX B;  1K40 A;  2HSB A;  2VCA A;  1S7Z A;  3GM1 A;  3MYF A;  1JPJ A;  1RXQ A;  1M56 C;  2KC3 A;  4AK9 A;  5B3I A;  2R7W A;  4QI2 A;  2YWA A;  4XLN F;  1G4U S;  5A6A A;  5L0J A;  2R7X A;  3GAN A;  3WOD F;  4CDY A;  2FGY A;  4O6N A;  4Z9J A;  5E2Q A;  4IRU A;  2QLA A;  1A0B A;  2Y39 A;  5GPG B;  2YL3 A;  1QKR A;  2AWY A;  3L0I A;  3JRT A;  2KQ9 A;  2IOQ A;  3F47 A;  3MLG A;  5AC4 A;  3H65 A;  3ZTZ A;  1QQ3 A;  1M2V A;  1YAR O;  4E18 A;  2YQY A;  4JJF A;  5FCL A;  3G4X A;  1EA8 A;  2J0X A;  4YT4 A;  1V74 B;  3UMI A;  3AGT A;  2L6H A;  1C02 A;  2HKV A;  1Z63 A;  1ORY A;  3S28 A;  1DOW A;  1Q0F A;  4MTF A;  3AG1 C;  3C7J A;  3LNM B;  4PFO A;  1ZW3 A;  3ZWI A;  3RIP A;  2G3V A;  1YDI A;  3K66 A;  3NDB B;  3ZTM A;  1E2X A;  1G5Z A;  3F46 A;  3JSE O;  1K04 A;  1SZI A;  4DVZ A;  1E85 A;  4BPM A;  1BR1 A;  1OR3 A;  4DVY P;  2YL7 A;  3M79 A;  3UMH A;  3PHF 2;  4IJJ A;  1CGM E;  3B9Q A;  3FOP A;  3TD7 A;  3WG7 C;  4AE4 A;  2J9U A;  2JPU A;  2J8W A;  3ECS A;  4XEK A;  1EKY A;  1APC A;  1HMD A;  2TMV P;  1OKK D;  2R7V A;  2LFF A;  2XS8 A;  1A7D A;  3QW0 A;  2GWW A;  4AE4 B;  1I5N A;  2XLV A;  4WGZ A;  1G4W R;  1SYQ A;  3DAG A;  3S90 A;  1WGW A;  2GFH A;  1M2O A;  1J8Y F;  3IQ6 A;  4BJ6 C;  1Z3I X;  3NYL A;  2R7Q A;  1L3P A;  1JAF A;  2ZXO A;  1H9G A;  2PX3 A;  1QSP A;  4I1M A;  2MHR A;  3AQB A;  2L81 A;  3HNK A;  4IGG A;  1NG1 A;  2H7B A;  3OA1 A;  4JIO A;  1Y6D A;  3ATP A;  4LER A;  4BJ6 A;  1T6U A;  1H6G A;  2MYS A;  3U8V A;  1FMW A;  2A6E F;  4ONS A;  3W8H A;  2LQG A;  1H9T A;  2L6G A;  2RSE B;  1GS9 A;  1ZW2 A;  1ZHX A;  1JRA A;  3NKE A;  2LK4 A;  3U2M A;  3EH1 A;  1O3U A;  1VTM P;  4IAO A;  4FWV A;  1U6H A;  3AGU A;  3SP1 A;  2BL2 A;  5JLI A;  2PF4 E;  2OEX A;  1Q0D A;  5BQH A;  3ABM C;  4N6H A;  3L1M A;  2ZXW C;  1Z7Q c;  3I5Q A;  2P61 A;  1RCP A;  3Q6N A;  5KYU A;  3SEO A;  2JD3 A;  4M63 A;  4QI0 A;  1Q0M A;  2A69 F;  3K7D A;  5A6J A;  4AL1 A;  4EUK B;  1E83 A;  3NKD A;  5T3T A;  5L3Q A;  3M4C A;  2AVK A;  2DB4 A;  2FFH A;  2XM0 A;  4PR9 A;  1T5O A;  4OD4 A;  4G0H A;  1YJG A;  1PD1 A;  3C62 A;  3V5Y A;  4BEM J;  3H2V A;  5A6B A;  3M1C B;  4ANJ A;  4JW1 A;  4IAR A;  4MW3 A;  1AVO B;  4RBN A;  2IBF A;  3Q6M A;  4MVU A;  2GA0 A;  5A6B D;  1LE4 A;  2OEV A;  3W2W A;  2HFI A;  3C8Z A;  4QDL A;  1YA7 O;  4JKV A;  1OW8 A;  1FFH A;  1FNT c;  2X0C A;  4JC7 A;  4Q4Z F;  1RKC A;  2EPN A;  1QZX A;  1JR8 A;  1Q0K A;  1SMY F;  4KI2 A;  4YT8 A;  3GOR A;  4NTA A;  4RD9 A;  2ZD9 A;  1HW2 A;  1I4Y A;  4CS9 C;  1BDJ B;  1WAT A;  2A1D D;  3LJB A;  1OW7 A;  1YZA A;  2HUJ A;  3FAJ A;  4L6R A;  4U5H A;  5KYY B;  4G7Z F;  3RH3 A;  4JCZ A;  3EGD B;  3JZ0 A;  4EBK A;  1LI5 A;  1ZHT A;  1S05 A;  1TFK B;  3E70 C;  2RD9 A;  4IB4 A;  5JT4 A;  3B71 A;  1D0X A;  2GAQ A;  3K6B A;  2J9B A;  4J32 B;  4O7G A;  3RQF A;  2EPO A;  4CBE A;  3DAF A;  3EZH A;  2QY9 A;  1U89 A;  3HJC A;  5CIV A;  3DXJ F;  2DGJ A;  2PNO A;  2EIM C;  3AG2 C;  2ETS A;  4C7O A;  3U9M A;  3V7O A;  5D91 A;  4ER9 A;  2EIK C;  2ZXR A;  1AEP A;  1C17 M;  2VAS A;  3NRH A;  4JVS A;  4C3D A;  3O10 A;  1Z23 A;  2Z15 A;  1J8M F;  4CSA C;  4C7O B;  1TWC A;  4NC3 A;  1BR2 A;  3DE9 A;  4NY3 A;  4HFF B;  1NFN A;  1D1C A;  2EPK X;  3C8G B;  5B1B C;  1ZU4 A;  5AGF A;  1YYX A;  3SXK A;  4MVO A;  4H54 A;  1T6I A;  3DJU B;  4EKW A;  2V3C C;  2WB7 A;  3CAX A;  2Q9B A;  4JTC B;  2IM8 A;  4XEV A;  4DXW A;  4CSA A;  1ZZP A;  2BC5 A;  3ASO C;  3IEE A;  5AC5 A;  5DQT A;  4HE8 D;  4YL3 A;  3CSK A;  5BQG A;  3S29 A;  4N4W A;  3T6G B;  5DVW A;  4YL0 A;  3EFO A;  1O5H A;  4PK4 A;  3R2P A;  1GGQ A;  4O6Y A;  4Q5S F;  2J9W A;  1RMV A;  5L0H A;  3GEH A;  3DMD A;  3MX3 A;  4FES A;  4FX5 A;  4W8K A;  2CNW A;  2NPU A;  2KK1 A;  4YT5 A;  5EGY A;  1ORS C;  4LLE A;  5KYN A;  1OQC A;  1NZE A;  1ZU5 A;  4W8P A;  2M64 A;  2Y3G A;  3EG9 B;  2NUP B;  4GYT A;  4MVQ A;  1IZM A;  4DRJ B;  2I15 A;  2IXO A;  3S84 A;  4MVR A;  3V5X A;  4D4N A;  4UDV A;  4ZLC A;  5E3A A;  3ABK C;  4E0I A;  3JTL O;  3MYI A;  2L9J A;  3LEO A;  4MTG A;  2HSQ A;  1Z6A A;  1HW1 A;  2XLD A;  4U5C E;  4WJ0 A;  3EPV A;  2A0B A;  3JCU Q;  3VRC A;  3DM5 A;  4LAC B;  3ZDL A;  2O9X A;  3R7C A;  2YLG A;  4YN0 B;  2CYD A;  5JP7 A;  1M57 C;  2CDQ A;  3ZQV A;  3NYM A;  5T3W A;  2J9V A;  2Q9C A;  3DJN B;  3FVY A;  1LE2 A;  1LI7 A;  3ZIB A;  3FHD A;  3LES A;  4PFP A;  2ASR A;  2KYH A;  5DQZ A;  2KW3 C;  4F4B A;  1D1B A;  2OJQ A;  3E9V A;  3DZA A;  4U5G A;  2YLD A;  5BQI A;  5JRA A;  2KGO A;  2HMQ A;  3HKK A;  1OXB A;  4PJL A;  4XPY A;  2LCH A;  4CJG A;  3BRJ A;  2OKU A;  3QVZ A;  3RW0 A;  4OIQ F;  3N0T A;  2R02 A;  2J46 A;  3C63 A;  2A0U A;  4JCH A;  1VMA A;  3I5P A;  3B0V C;  4KNV A;  3L34 A;  3DE8 A;  4G78 A;  2R7S A;  1FR0 A;  4XWJ A;  1CPQ A;  4C3B A;  1LM3 B;  4U5B E;  1L7C A;  4ULW A;  3EFO B;  3UGO A;  3EH2 A;  1B68 A;  2ZPA A;  3GM2 A;  1ORJ A;  3HNJ A;  4JTA B;  4XEF A;  2Q7R A;  3UNG C;  5A6K A;  1JMW A;  4I3M A;  1XZQ A;  3GOD A;  1VOM A;  1R5I D;  3DM9 B;  2W9Y A;  4YT2 A;  1JOG A;  4PJM A;  4GQH A;  2YHS A;  5L0D A;  5F5F A;  2EIN C;  1QLE C;  3GEE A;  3VYW A;  1SF8 A;  5B3S C;  3KMI A;  2GDC A;  3KH2 A;  3SXM A;  4U9D A;  4KNW A;  1PV3 A;  1WWP A;  3IPM O;  2R7R A;  4DRH B;  2Y3H A;  2P7V A;  4JUR I;  4PAC A;  1OR2 A;  3FXH A;  4U5F E;  2IYL D;  4CS7 A;  4CIP A;  3VM6 A;  4XPW A;  3G50 A;  2JX0 A;  4JZA A;  5JUA A;  2G3K A;  3KPH A;  4KBL A;  3LUT B;  4JJG A;  1FFT C;  1VK5 A;  1ZYR F;  4KC9 A;  5JVE A;  2J45 A;  3IQ5 A;  4DBQ A;  1Z5Z A;  4XQ1 A;  1WOL A;  4BEJ A;  3PMR A;  4MW8 A;  4P9F A;  2WL8 A;  1O87 A;  1YVI A;  5KYX B;  1VLS A;  3X1O A;  2QNL A;  3JT1 A;  4JRZ A;  4YWQ A;  5EHH A;  3AOU A;  1XWJ A;  4ULV A;  2E87 A;  3CQZ A;  1YLM A;  4LDR A;  3RQE A;  1Y4C A;  1BZ4 A;  2M4E A;  2KSF A;  1MMG A;  1EQ1 A;  4U9E A;  3V5Z A;  4J30 B;  4H4K C;  5A69 A;  3JSZ A;  2H8A A;  4XPX A;  4G7O F;  5KYY A;  2C04 A;  3B29 A;  3I4U A;  1ZHY A;  4NTB A;  3TJ5 A;  4BJ5 C;  1G8X A;  3EGD A;  2XRH A;  2XL6 A;  4E17 A;  4AX2 A;  2IXP A;  5DS4 A;  2XM4 A;  1SR2 A;  1FAP B;  3QTH A;  2OQM A;  4JE9 A;  2EPM X;  2HJM A;  1LKX A;  2ICW G;  3G4Z A;  4R32 A;  4K0D A;  2YRF A;  4LDQ A;  4OIO F;  2NUT A;  1LS4 A;  3U9J A;  4BJ5 A;  2Q00 A;  2XLM A;  4CS9 A;  2J0W A;  3LLI A;  2PBE A;  3O6X A;  2NUT B;  3ZSU A;  2WZG A;  3ASN C;  4EWC A;  5L0I A;  3JYY A;  2YZS A;  1IW7 F;  1E84 A;  3TK0 A;  3C8G A;  1QVX A;  4LDK A;  1T9K A;  1ZHZ A;  4N6C A;  3TUL A;  4NQF A;  1XZP A;  1LS1 A;  3T4R A;  3U5S A;  3UR3 C;  3TOL A;  3C8G D;  1MNE A;  3KL4 A;  1LVK A;  2IXM A;  2WVQ A;  4OD5 A;  2Y3D A;  5DS5 A;  1PD0 A;  2HJ3 A;  3FMS A;  5E3C A;  5COF A;  4E0H A;  5JS5 A;  2NSF A;  1MMN A;  4K1O A;  3GWN A;  4U5D E;  1GQA A;  1TKN A;  2OCC C;  3CEX A;  3AJM A;  4U5E E;  2J7P A;  3Q7G A;  1F1M A;  5L3V A;  4NTF A;  3RKO F;  2R03 A;  2V26 A;  3GWL A;  4OIN F;  4XLP F;  4PJN A;  2YL0 A;  3FDQ A;  3RVZ A;  2EIJ C;  2MWQ A;  3SZR A;  2VCB A;  2QTV A;  2OJE D;  4Z9I A;  4OIR F;  3RF3 A;  3SYN A;  3RFY A;  4J7T A;  3J06 A;  3EG9 A;  2OOC A;  3KYJ A;  2NUP A;  1RJ9 B;  1K05 A;  2OU6 A;  1NSG B;  3U3F A;  1RKE B;  2B0J A;  3EZI A;  1WN0 A;  3C18 A;  2R25 A;  4K7B A;  4XTK A;  4O6M A;  5COG A;  3QMK A;  1R4T A;  2CNW D;  3S9O A;  3N2Z B;  3LAY A;  1TWH A;  4AL0 A;  4MVS A;  1KNY A;  2XLH A;  4C3E A;  3LS1 A;  2XL8 A;  3RYL A;  1QPU A;  1D0Y A;  1UFB A;  4MVZ A;  2EPL X;  5IY5 C;  3B0U X;  4JEB A;  3SNH A;  1PCX A;  2DYS C;  2VB6 A;  4BG0 A;  4E7Z A;  3NYJ A;  2LFD A;  3AG4 C;  1NU7 D;  5KYW A;  3PDM P;  1UG7 A;  2EIL C;  1C03 A;  2W4B A;  4NCQ A;  2L7A A;  1MMD A;  3HTK C;  5KYW B;  4EHP A;  2XLE A;  1I4Z A;  1YZC A;  2UUI A;  2HV6 A;  2NSG A;  2OG2 A;  2YL1 A;  1KTM A;  3NMK A;  1ZHW A;  5K0I A;  2KJG A;  4JEA A;  4EIY A;  1N1C A;  1WAS A;  3ZG1 A;  4P9T A;  1M2V B;  2R9R B;  3IQC A;  3NMI A;  4YK5 A;  1CGN A;  2Y69 C;  2XS1 A;  3CZ6 A;  2QE9 A;  3TOM A;  3W8I A;  2HZ8 A;  2PP4 A;  2X51 A;  4DRI B;  4EBJ A;  1KU2 A;  3EQL F;  3B0P A;  5COM A;  2UUH A;  5CI9 A;  1YA9 A; 
#chains in the Genus database with same CATH homology
 5B3I A;  1S05 A;  4IB4 A;  5JT4 A;  2J9B A;  3FOO A;  4CDY A;  1M6T A;  2QLA A;  4ULV A;  2YL3 A;  4ER9 A;  4CDV A;  4D4X A;  3ZTZ A;  1QQ3 A;  4NC3 A;  3DE9 A;  4U9E A;  2XLW A;  5AGF A;  1BBH A;  1YYX A;  1CPR A;  4CX9 A;  2BC5 A;  2XL6 A;  3M4B A;  1E86 A;  3M15 A;  2XM4 A;  4JE9 A;  4N4W A;  3ZWI A;  4WGY A;  5JSL A;  3ZTM A;  2XLM A;  2CCY A;  2YKZ A;  1E85 A;  2YL7 A;  3M79 A;  3FOP A;  1E84 A;  1EKY A;  2J8W A;  1APC A;  3NMJ A;  1NBB A;  4CJO A;  3U8P A;  3QW0 A;  2XLV A;  4WGZ A;  3TOL A;  2YLI A;  3IQ6 A;  4D4N A;  4IAQ A;  3QW1 A;  1YYJ A;  1JAF A;  3HNI A;  2XLD A;  5JS5 A;  3HNL A;  3VRC A;  1GQA A;  3HNK A;  2YLG A;  5JP7 A;  3ZQV A;  256B A;  2YL0 A;  4CDA A;  2XLO A;  2YLD A;  5JRA A;  4CJG A;  5JLI A;  3QVZ A;  4N6H A;  3L1M A;  1A7V A;  1RCP A;  3C63 A;  2XLH A;  2XL8 A;  1QPU A;  1E83 A;  3DE8 A;  4JEB A;  1CPQ A;  1LM3 B;  3M4C A;  2XM0 A;  3ZQY A;  3C62 A;  3HNJ A;  1CGO A;  4IAR A;  2XLE A;  1YZC A;  4U9D A;  2YL1 A;  4JKV A;  3NMK A;  1MQV A;  4EIY A;  4JEA A;  4CIP A;  3QVY A;  5JUA A;  3NMI A;  1CGN A;  3TOM A;  1YZA A;  5JVE A;  4L6R A;  3IQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...