4CJGA

Spectroscopically validated structure of the 5 coordinate proximal no adduct of cytochrome c prime from alcaligenes xylosoxidans
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Fingerprinting Redox and Ligand States in Haemprotein Crystal Structures Using Resonance Raman Spectroscopy.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4cjgA00
5JLIA 2YL1A 3HNLA 4JEAA 2XLHA 3DE8A 4CDAA 2XLDA 3C62A 3ZWIA 2YL3A 4IARA 3NMIA 2QLAA 4NC3A 1YYXA 4WGYA 2XLEA 5JRAA 3HNIA 3FOOA 4IB4A 4CJGA 3IQ5A 1E84A 3M4CA 1RCPA 2YLIA 3QVZA 2BC5A 5JVEA 4CIPA 3ZTZA 4CJOA 4CDYA 1M6TA 2J9BA 1EKYA 3U8PA 1YZAA 5B3IA 1E86A 4WGZA 4JKVA 4JEBA 1JAFA 1LM3B 3M79A 1QPUA 1APCA 2J8WA 4EIYA 2YL0A 3M15A 2XM4A 3FOPA 1A7VA 3TOLA 1QQ3A 4CDVA 1YYJA 5JUAA 4CX9A 1NBBA 3VRCA 2YL7A 4ER9A 2XL8A 1CGNA 1E83A 4IAQA 5JS5A 2XM0A 3ZTMA 2YLGA 3QVYA 2YKZA 1CGOA 1MQVA 3ZQYA 3QW1A 4N4WA 4ULVA 1E85A 1CPQA 3DE9A 2XLOA 3NMKA 4D4NA 3M4BA 5JP7A 3C63A 2XL6A 2CCYA 4N6HA 1CPRA 4L6RA 3HNJA 4U9EA 3ZQVA 2XLWA 1YZCA 256BA 2XLMA 3NMJA 3IQ6A 5JT4A 5JSLA 3QW0A 1BBHA 1GQAA 3HNKA 4D4XA 3L1MA 4U9DA 2XLVA 5AGFA 1S05A 2YLDA 3TOMA 4JE9A
chains in the Genus database with same CATH superfamily
1BDJB 1L7CA 4GEHA 3EG9B 2YL1A 3NYJA 4JEAA 4MTFA 2GWWA 3ECSA 3JYYA 3KL4A 1HMDA 1Z3IX 1JMWA 3HKKA 5IY5C 1T6QA 4K7BA 4QI0A 4EWCA 4C7OA 2ETSA 1T6UA 4OIPF 5E33A 3S28A 2XLDA 2ZXRA 4MS2A 1FR0A 2AWCA 5CI9A 3SXKA 4MQ9F 2A69F 2NUTB 3U3FA 3MYIA 4EUKB 1A7EA 1JPNA 4CSAA 1ZZPA 2GFHA 4XTKA 2I8BA 2XLEA 1F1MA 2J45A 5JRAA 4NTAA 4ANJA 3B9QA 4MVQA 2Q4FA 3KPHA 4ULWA 1BR2A 1FFHA 3L8IA 4PFPA 1XZPA 1OXKA 3DJNB 3E9VA 3IQ5A 4KI2A 1TWCA 1HE1A 2UUHA 2W9YA 4K0DA 1ST6A 5DS5A 2D4UA 1R4TA 2YLIA 2OKUA 3MBGA 3RVZA 1K05A 4OD4A 3T6JA 4DVYP 3U2LA 5KYXB 1XWJA 2Q9CA 4G7HF 4M63A 2VASA 1Q0MA 2EPLX 1YZAA 2YQYA 1WTYA 3KYIA 4KBLA 2R7XA 1HY5A 4HEAJ 2Y3HA 4CS9C 5AC5A 3FAJA 5L3QA 4XLPF 1K40A 4XQ1A 4G0HA 1J8MF 3H2VA 4ONSA 3DWWA 1LM3B 3M79A 1QPUA 2JPUA 1VK5A 4Z9HA 3M1CB 5DLJA 2J8WA 3M15A 3B29A 4U5HA 3UNGC 1TKNA 1N1CA 2C03A 1QZXA 3JCUQ 2LK4A 1SR2A 1YA7O 4KNVA 1TWAA 5BQIA 1QQ3A 2KK1A 2XL4A 3W2VA 1YYJA 2PBEA 4YT4A 1OCZC 1UFBA 4P9TA 1S7ZA 4BPMA 2L81A 1LI7A 1NBBA 1BR1A 3VRCA 4PJMA 4U5DE 5CI8A 3O39A 3HJCA 1OQCA 3JT1A 4JC7A 1G5ZA 2WZGA 2DB4A 2EIKC 2IM8A 1TWGA 2NUPB 3JRTA 5KYYB 1CGOA 2C04A 2EIJC 2A68F 1WGWA 3JZ0A 2YZSA 4LACB 2B0JA 2WVOA 2X0CA 1OKKD 1CPQA 1NFNA 1Q0FA 3K1IC 1HW2A 1TWHA 1GS9A 3DD7A 3NMKA 1J8YF 2OJQA 2OQMA 3AGTA 1PD0A 3S90A 3C7JA 3GEEA 5BQHA 3EFOA 2P7VA 3QZCA 1V74B 4N6CA 2CCYA 2HS5A 1OCOC 2B0HA 4LLEA 4YT5A 4CS7A 1MNEA 1ZHWA 4LDRA 2GAQA 2Q9AA 4K1OA 4JURI 2A0BA 5A69A 1CPRA 1U0BB 3HNJA 2EPNA 1KNYA 3LJBA 3RF3A 3ZQVA 2XLWA 1OKKA 2R7SA 2XLMA 2AU5A 1GM5A 1VYKA 3IEEA 2A0UA 1NSGB 2EPMX 3L8JA 5JSLA 1OW8A 1Z5ZA 2WZLA 2Y39A 3ABLC 1GQAA 2KYHA 1JOGA 4I1OB 4U5CE 2LFFA 2R02A 1XZQA 2R7UA 5GPGB 2R7RA 2HMQA 5E2QA 4U9DA 4E18A 4DOZA 4EKWA 1HMOA 3MYFA 3MX3A 4NCQA 4Q4ZF 5KYXA 2WVQA 2YWAA 2VCCA 1ORYA 5DQZA 4JE9A 2XSEA 3ITFA 4EBKA 5EHHA 1I4YA 1T9KA 3IPMO 3K1IA 4O6NA 2XS8A 3WHNA 3RQGA 4OIRF 4DRHB 4JRZA 3RKOF 2AP3A 4IRUA 3SZRA 4CS8C 3SXMA 1DOWA 2D5RB 4H4KC 3ZSUA 1G4US 1D0XA 3C8GB 2YL3A 5F28E 2OU6A 3UMKA 3E70C 3R2PA 2PF4E 3POVA 5E3CA 2F22A 2X51A 4HE8D 2RSEB 1TQGA 1YYXA 4J32B 4G78A 4KNWA 3EGXB 1AEPA 3ZVRA 4E17A 2V26A 5A6BD 1U89A 2MYSA 3LNMB 1PV3A 1WWPA 2R7QA 1K04A 2XRHA 4PFOA 4NTBA 3ASNC 3U8VA 1T6IA 1RKCA 4HFKB 3RW0A 3I4UA 3AG1C 2NUPA 1OCCC 3V5XA 4MW8A 2MWQA 3QVZA 5KYYA 2DYRC 3SXYA 2H8AA 1Q0DA 1RKEB 2EPOA 4CIPA 3ZTZA 4C3EA 1M6TA 1ZHTA 3WODF 1FMVA 5CIVA 3GORA 4ZLCA 3GWLA 3MLGA 1OXBA 3U8PA 2Q3TA 5A6BA 3A9CA 5DS4A 4E0HA 4GYTA 4G7OF 2VCBA 3K6BA 1QVXA 2L7AA 1C17M 4XEVA 4JEBA 4LLCA 3RH3A 2R7TA 4E0IA 3O55A 4LERA 4Q7CA 4J7YA 4CS8A 2M4EA 4XPXA 1APCA 2KNHA 1Y4CA 4O7GA 1A0BA 4A4AA 5DS6A 1ZU4A 2IYLD 3EGDB 3FOPA 3R7CA 2CYDA 2Q9BA 1RMVA 1SMYF 2A6HF 3LEVA 3VF0A 4CDVA 1TR2A 2VB6A 4CX9A 5KYUB 2OEVA 3AQCA 2R7WA 2VH3A 3MFNA 4JW1A 4J30B 2FAPB 4ER9A 2OOCA 1CGNA 3ZDLA 4IAQA 4BG0A 3ZTMA 4PJJA 5FCLA 5JS5A 3ABKC 3C8GD 1UG7A 3UGPA 3AG4C 4YT2A 4G7ZF 1ZU5A 2YHSA 4I44A 2CGEA 1G4WR 3FHDA 4O6YA 4FAPB 4DRJB 3S0XA 2Y3BA 2HFIA 3PCVA 4W8KA 3DM9B 4ULVA 3ZC4A 1NU7D 2NG1A 3Q6MA 3DE9A 3H2UA 2XLOA 5COMA 5EGYA 1WATA 1ORJA 1SZIA 2LD6A 4D4NA 1M2OA 2BL2A 4JVSA 1Z63A 2VCAA 3PMRA 3TJ5A 4E7SA 3AGUA 3C63A 3RYLA 3V5YA 3C8GA 2KC3A 2J9VA 2GA0A 2QY9A 5L0CA 2R03A 1C03A 2R25A 4JCZA 4YL0A 2Y3GA 1QLEC 2ASRA 3EGXA 3NYMA 4XPWA 5F5FA 3EZIA 2CNWA 4U9EA 1TFOB 2IXMA 2UUIA 2J7PD 3LLIA 5B1BC 1NZEA 4JJFA 3RFYA 5L0HA 4XPYA 3QW0A 3IQTA 2XXAB 2EINC 1MMDA 3AJMA 3PHF2 3GM1A 2H7OA 1WN0A 4BEMJ 1OW7A 4PACA 3B0PA 3T6BA 3EG9A 2W45A 3L1MA 4DRIB 4CS9A 1RKEA 5BUOA 3T6GB 2J9WA 4BJ5C 1YAUO 2XLVA 3U9MA 3SP1A 3LUTB 3TOMA 3EHNA 2HJ3A 1YA9A 3T9OA 2KSFA 2HKVA 3JTLO 4R32A 2LP4A 3JSEO 4H54A 2J7PA 4CBEA 1LVKA 1MMGA 4X0RA 2LCHA 4C3DA 3N24A 2I15A 2QUPA 1D1BA 1HW1A 2NUTA 5HV9A 2R9RB 4AE4B 2KJGA 2ICWG 1E83A 1AUEA 2W4MA 3O6XA 3A11A 4IWBA 3UMHA 3LESA 2Q00A 4FWVA 1TFKB 1JRAA 5F5HA 5T3TA 3U0CA 2J9UA 4NC3A 1IZMA 1FAPB 3O10A 1M2VB 1B68A 1NFOA 1G8XA 1I5NA 1V4AA 1D0ZA 4JTAB 2MHRA 4N06A 4DVZA 5KYUA 2NSFA 3US6A 2Y3DA 4Z9JA 2OG2A 1WOLA 3FOOA 2G3VA 4AL1A 4CJGA 4NY3A 1CGME 5EK0A 2BE5F 4U5EE 1LIHA 3GEIA 3M4CA 1ZW2A 4A2NB 1E84A 3K7DA 3LNRA 4W8PA 3RQFA 3NRHA 1NG1A 1SF8A 4NQFA 3U3BA 4BJ5A 4WABA 4DBQA 5BQGA 4BJ6A 1PCXA 4U5BE 2PX0A 3N0TA 1I4ZA 4AL0A 3K1HA 2IXOA 3FVYA 3EHMA 1E86A 4U5GA 3NG1A 2PNOA 3CSKA 3FAPB 3TJ6A 3U9JA 2ZXOA 3AQBA 4J7TA 3V7OA 2YL0A 3TULA 2H7BA 3S27A 2JX0A 4LDQA 1FFTC 1Y6DA 3JSZA 1A7VA 3KH2A 4PK4A 3TQOA 4EHPA 2YRFA 3B0UX 4WJ0A 2RD9A 3DAGA 5COGA 3OEOA 3J06A 1O3UA 2PP4A 2XXAA 3WAQA 2ZD9A 2QE9A 3DXJF 1DOVA 4RDAA 4BJ6C 1Z6AA 3FMSA 1JPJA 2LSEA 2YL7A 4OIQF 3B0VC 1C02A 4CSAC 5KYNA 5L0DA 1ZHYA 3C18A 2L6FA 2XM0A 1VLTA 2CDQA 4P6IC 3RQEA 5KYWB 4EBJA 1YDIA 3EH1A 3FDQA 2DGJA 2YKZA 3S9OA 1MNDA 2A1DD 4BJ1A 4JZAA 3W8HA 3QMKA 3EH2A 1MQVA 4QDLA 4YL3A 3WG7C 4N4WA 3ZQYA 2NPUA 2ZXPA 4KC9A 1E85A 3AG2C 1H7IA 3NYLA 4MVZA 1NU9C 3G4XA 3HTKC 3GANA 1ORSC 1D1AA 2R05A 1GGQA 1VOMA 4U5FE 3S29A 4AE4A 4MTGA 4YT8A 3VAYA 3JYHA 3KMIA 5JP7A 1D1CA 1FTSA 1T01A 2J46A 3UGOA 3CQZA 4ZLDA 1VYIA 4QI2A 4N6HA 3L34A 4O79A 5DQTA 2ZXWC 1M2VA 1LS1A 1VMAA 4OD5A 3VYWA 1Q0KA 5A6AA 1JR8A 4Q5SF 1Z7Qc 3EFOB 3K66A 3IQ6A 4JIOA 3X2QC 5JT4A 2PFDA 2IOQA 2O9XA 3EJNA 2G62A 2WVNA 1PD1A 2KW3C 4PJLA 4YL1A 4YWQA 4OINF 4MW3A 4Z9IA 4IAOA 3DZAA 2IXPA 2EILC 3TK0A 4D4XA 3U5SA 2FGYA 2CNWD 3LS0A 1ZYRF 4I3MA 1R5ID 2Y69C 3EPVA 3Q6NA 5AGFA 1S05A 3KYJA 2KQ9A 5D91A 4MNDA 3GM2A 1EKYA 5JLIA 4MTOA 2W4BA 3NKDA 3HNLA 3W4YA 4OIOF 4YN0B 3JRMO 1AVOB 1Z23A 2E87A 1MMNA 5A6JA 4B6IA 3BEHA 1MMAA 3SNHA 2L6HA 3DAFA 2XLHA 4DXWA 1KTMA 3DE8A 3DI5A 3G4ZA 3HLZA 3CEXA 1ZW3A 4CDAA 3CZ6A 3T4RA 5AC4A 3C62A 3ZWIA 2HV7A 4GQHA 4IARA 3NMIA 1M56C 4O6MA 1RJ9B 1OR2A 2IBFA 4MVUA 3AG3C 3W8IA 2QLAA 2QNLA 5COFA 4BEJA 1V55C 1D0YA 1A41A 3ZIBA 3GODA 4MVSA 3W2WA 2KGOA 4WGYA 4RBNA 2P0NA 4C3BA 5D92A 2P6VA 3HNIA 1YJGA 3ABMC 4IB4A 4DBRA 3B71A 2J0WA 4IGGA 4RD9A 4JTDB 2Q7RA 1T5OA 3I5QA 5KYWA 2JD3A 1RCPA 3H65A 2ZPAA 3GWNA 1FMWA 4F4BA 2P61A 1BR4A 5L3VA 2BC5A 2Z15A 5JVEA 2PX3A 3CAXA 1H9GA 3ZG1A 4YJWA 3QTHA 3TD7A 4CJOA 4CDYA 1QKRA 3RIPA 3GM3A 2J9BA 4AK9A 2HJMA 1ZHXA 1EI7A 3DKAA 2J0XA 5L0FA 5B3IA 5B1AC 3V5ZA 2FFHA 4FESA 2R7VA 4LDKA 3NDBB 2OEXA 3FXHA 3Q7GA 3BRJA 4WGZA 3EGDA 3OWTA 4JKVA 2XS1A 4XEFA 4C7OB 5A6KA 1LE2A 1H9TA 1JAFA 2A6EF 2HSQA 1V54C 2EIMC 4EIYA 3EZHA 3U2MA 2WL8A 2XM4A 2VC9A 3OA1A 3IQCA 4XWJA 3LS1A 4MVRA 1YLMA 1LI5A 2L9JA 2M64A 2OCCC 4JCHA 1LPEA 3TOLA 3UR3C 1VB5A 1IW7F 5T3WA 3UMIA 5T1DB 3N2ZB 1U6HA 2HSBA 2LIGA 3SYNA 5JUAA 1OW6A 1LS4A 1SYQA 4P9FA 1Q0GA 5TJ5E 2LFDA 5L0IA 2HMZA 4MVMA 2XL8A 3DM5A 3G50A 3K33A 3LEOA 3LAYA 4XLNF 5DVWA 4EBBA 4UDVA 4MVOA 3AOUA 1EA8A 1YARO 2YLGA 4PR9A 3QVYA 4PJNA 5HSWA 4BJTA 2YVKA 4YK5A 5L0GA 2LQGA 3ASOC 3SXZA 2HV6A 2G3KA 3VM6A 4FX5A 3QW1A 1BZ4A 2WB7A 2WZFA 1OCRC 1LE4A 3ATPA 3L0IA 4JJGA 1M57C 5B3SC 1KU2A 1QSPA 3KKBA 4I1MA 2GDCA 1L3PA 2HZ8A 1H6GA 3M4BA 5L0JA 2TMVP 2R7OA 1FNTc 2EPKX 1O5HA 3NKEA 2DI3A 2DYSC 4HFFB 1OR3A 3DMDA 2XL6A 1WASA 4AX2A 4E7ZA 1RJ9A 2AVKA 1ZVZA 2QTVA 1HE9A 3F47A 3SEOA 2NSGA 4XEKA 4DJ9A 1ZHZA 3C8ZA 3S84A 2H7VC 4L6RA 2AWYA 2HUJA 2YEVA 2L6GA 1YZCA 256BA 3NMJA 4CIHA 3DJUB 2OJED 1LKXA 3EQLF 3I5PA 4JTCB 4NTFA 5E3AA 1BBHA 1VTMP 2P1AA 1NLXA 1VLSA 3HNKA 1YVIA 2IXNA 1E2XA 3F46A 4IJJA 3Q7LA 3X1OA 3LLKA 3RVYA 5K0IA 1RXQA 1W2WA 1EQ1A 3IHUA 5FZTA 2V3CC 2CW0F 3PDMP 1A7DA 2YLDA 1O87A 3GEHA
chains in the Genus database with same CATH topology
5JLIA 2YL1A 3HNLA 4JEAA 2XLHA 3DE8A 4CDAA 2XLDA 3C62A 3ZWIA 2YL3A 4IARA 3NMIA 2QLAA 4NC3A 1YYXA 4WGYA 2XLEA 5JRAA 3HNIA 3FOOA 4IB4A 4CJGA 3IQ5A 1E84A 3M4CA 1RCPA 2YLIA 3QVZA 2BC5A 5JVEA 4CIPA 3ZTZA 4CJOA 4CDYA 1M6TA 2J9BA 1EKYA 3U8PA 1YZAA 5B3IA 1E86A 4WGZA 4JKVA 4JEBA 1JAFA 1LM3B 3M79A 1QPUA 1APCA 2J8WA 4EIYA 2YL0A 3M15A 2XM4A 3FOPA 1A7VA 3TOLA 1QQ3A 4CDVA 1YYJA 5JUAA 4CX9A 1NBBA 3VRCA 2YL7A 4ER9A 2XL8A 1CGNA 1E83A 4IAQA 5JS5A 2XM0A 3ZTMA 2YLGA 3QVYA 2YKZA 1CGOA 1MQVA 3ZQYA 3QW1A 4N4WA 4ULVA 1E85A 1CPQA 3DE9A 2XLOA 3NMKA 4D4NA 3M4BA 5JP7A 3C63A 2XL6A 2CCYA 4N6HA 1CPRA 4L6RA 3HNJA 4U9EA 3ZQVA 2XLWA 1YZCA 256BA 2XLMA 3NMJA 3IQ6A 5JT4A 5JSLA 3QW0A 1BBHA 1GQAA 3HNKA 4D4XA 3L1MA 4U9DA 2XLVA 5AGFA 1S05A 2YLDA 3TOMA 4JE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JLI A;  2YL1 A;  3HNL A;  4JEA A;  2XLH A;  3DE8 A;  4CDA A;  2XLD A;  3C62 A;  3ZWI A;  2YL3 A;  4IAR A;  3NMI A;  2QLA A;  4NC3 A;  1YYX A;  4WGY A;  2XLE A;  5JRA A;  3HNI A;  3FOO A;  4IB4 A;  4CJG A;  3IQ5 A;  1E84 A;  3M4C A;  1RCP A;  2YLI A;  3QVZ A;  2BC5 A;  5JVE A;  4CIP A;  3ZTZ A;  4CJO A;  4CDY A;  1M6T A;  2J9B A;  1EKY A;  3U8P A;  1YZA A;  5B3I A;  1E86 A;  4WGZ A;  4JKV A;  4JEB A;  1JAF A;  1LM3 B;  3M79 A;  1QPU A;  1APC A;  2J8W A;  4EIY A;  2YL0 A;  3M15 A;  2XM4 A;  3FOP A;  1A7V A;  3TOL A;  1QQ3 A;  4CDV A;  1YYJ A;  5JUA A;  4CX9 A;  1NBB A;  3VRC A;  2YL7 A;  4ER9 A;  2XL8 A;  1CGN A;  1E83 A;  4IAQ A;  5JS5 A;  2XM0 A;  3ZTM A;  2YLG A;  3QVY A;  2YKZ A;  1CGO A;  1MQV A;  3ZQY A;  3QW1 A;  4N4W A;  4ULV A;  1E85 A;  1CPQ A;  3DE9 A;  2XLO A;  3NMK A;  4D4N A;  3M4B A;  5JP7 A;  3C63 A;  2XL6 A;  2CCY A;  4N6H A;  1CPR A;  4L6R A;  3HNJ A;  4U9E A;  3ZQV A;  2XLW A;  1YZC A;  256B A;  2XLM A;  3NMJ A;  3IQ6 A;  5JT4 A;  5JSL A;  3QW0 A;  1BBH A;  1GQA A;  3HNK A;  4D4X A;  3L1M A;  4U9D A;  2XLV A;  5AGF A;  1S05 A;  2YLD A;  3TOM A;  4JE9 A; 
#chains in the Genus database with same CATH topology
 1BDJ B;  1L7C A;  4GEH A;  3EG9 B;  2YL1 A;  3NYJ A;  4JEA A;  4MTF A;  2GWW A;  3ECS A;  3JYY A;  3KL4 A;  1HMD A;  1Z3I X;  1JMW A;  3HKK A;  5IY5 C;  1T6Q A;  4K7B A;  4QI0 A;  4EWC A;  4C7O A;  2ETS A;  1T6U A;  4OIP F;  5E33 A;  3S28 A;  2XLD A;  2ZXR A;  4MS2 A;  1FR0 A;  2AWC A;  5CI9 A;  3SXK A;  4MQ9 F;  2A69 F;  2NUT B;  3U3F A;  3MYI A;  4EUK B;  1A7E A;  1JPN A;  4CSA A;  1ZZP A;  2GFH A;  4XTK A;  2I8B A;  2XLE A;  1F1M A;  2J45 A;  5JRA A;  4NTA A;  4ANJ A;  3B9Q A;  4MVQ A;  2Q4F A;  3KPH A;  4ULW A;  1BR2 A;  1FFH A;  3L8I A;  4PFP A;  1XZP A;  1OXK A;  3DJN B;  3E9V A;  3IQ5 A;  4KI2 A;  1TWC A;  1HE1 A;  2UUH A;  2W9Y A;  4K0D A;  1ST6 A;  5DS5 A;  2D4U A;  1R4T A;  2YLI A;  2OKU A;  3MBG A;  3RVZ A;  1K05 A;  4OD4 A;  3T6J A;  4DVY P;  3U2L A;  5KYX B;  1XWJ A;  2Q9C A;  4G7H F;  4M63 A;  2VAS A;  1Q0M A;  2EPL X;  1YZA A;  2YQY A;  1WTY A;  3KYI A;  4KBL A;  2R7X A;  1HY5 A;  4HEA J;  2Y3H A;  4CS9 C;  5AC5 A;  3FAJ A;  5L3Q A;  4XLP F;  1K40 A;  4XQ1 A;  4G0H A;  1J8M F;  3H2V A;  4ONS A;  3DWW A;  1LM3 B;  3M79 A;  1QPU A;  2JPU A;  1VK5 A;  4Z9H A;  3M1C B;  5DLJ A;  2J8W A;  3M15 A;  3B29 A;  4U5H A;  3UNG C;  1TKN A;  1N1C A;  2C03 A;  1QZX A;  3JCU Q;  2LK4 A;  1SR2 A;  1YA7 O;  4KNV A;  1TWA A;  5BQI A;  1QQ3 A;  2KK1 A;  2XL4 A;  3W2V A;  1YYJ A;  2PBE A;  4YT4 A;  1OCZ C;  1UFB A;  4P9T A;  1S7Z A;  4BPM A;  2L81 A;  1LI7 A;  1NBB A;  1BR1 A;  3VRC A;  4PJM A;  4U5D E;  5CI8 A;  3O39 A;  3HJC A;  1OQC A;  3JT1 A;  4JC7 A;  1G5Z A;  2WZG A;  2DB4 A;  2EIK C;  2IM8 A;  1TWG A;  2NUP B;  3JRT A;  5KYY B;  1CGO A;  2C04 A;  2EIJ C;  2A68 F;  1WGW A;  3JZ0 A;  2YZS A;  4LAC B;  2B0J A;  2WVO A;  2X0C A;  1OKK D;  1CPQ A;  1NFN A;  1Q0F A;  3K1I C;  1HW2 A;  1TWH A;  1GS9 A;  3DD7 A;  3NMK A;  1J8Y F;  2OJQ A;  2OQM A;  3AGT A;  1PD0 A;  3S90 A;  3C7J A;  3GEE A;  5BQH A;  3EFO A;  2P7V A;  3QZC A;  1V74 B;  4N6C A;  2CCY A;  2HS5 A;  1OCO C;  2B0H A;  4LLE A;  4YT5 A;  4CS7 A;  1MNE A;  1ZHW A;  4LDR A;  2GAQ A;  2Q9A A;  4K1O A;  4JUR I;  2A0B A;  5A69 A;  1CPR A;  1U0B B;  3HNJ A;  2EPN A;  1KNY A;  3LJB A;  3RF3 A;  3ZQV A;  2XLW A;  1OKK A;  2R7S A;  2XLM A;  2AU5 A;  1GM5 A;  1VYK A;  3IEE A;  2A0U A;  1NSG B;  2EPM X;  3L8J A;  5JSL A;  1OW8 A;  1Z5Z A;  2WZL A;  2Y39 A;  3ABL C;  1GQA A;  2KYH A;  1JOG A;  4I1O B;  4U5C E;  2LFF A;  2R02 A;  1XZQ A;  2R7U A;  5GPG B;  2R7R A;  2HMQ A;  5E2Q A;  4U9D A;  4E18 A;  4DOZ A;  4EKW A;  1HMO A;  3MYF A;  3MX3 A;  4NCQ A;  4Q4Z F;  5KYX A;  2WVQ A;  2YWA A;  2VCC A;  1ORY A;  5DQZ A;  4JE9 A;  2XSE A;  3ITF A;  4EBK A;  5EHH A;  1I4Y A;  1T9K A;  3IPM O;  3K1I A;  4O6N A;  2XS8 A;  3WHN A;  3RQG A;  4OIR F;  4DRH B;  4JRZ A;  3RKO F;  2AP3 A;  4IRU A;  3SZR A;  4CS8 C;  3SXM A;  1DOW A;  2D5R B;  4H4K C;  3ZSU A;  1G4U S;  1D0X A;  3C8G B;  2YL3 A;  5F28 E;  2OU6 A;  3UMK A;  3E70 C;  3R2P A;  2PF4 E;  3POV A;  5E3C A;  2F22 A;  2X51 A;  4HE8 D;  2RSE B;  1TQG A;  1YYX A;  4J32 B;  4G78 A;  4KNW A;  3EGX B;  1AEP A;  3ZVR A;  4E17 A;  2V26 A;  5A6B D;  1U89 A;  2MYS A;  3LNM B;  1PV3 A;  1WWP A;  2R7Q A;  1K04 A;  2XRH A;  4PFO A;  4NTB A;  3ASN C;  3U8V A;  1T6I A;  1RKC A;  4HFK B;  3RW0 A;  3I4U A;  3AG1 C;  2NUP A;  1OCC C;  3V5X A;  4MW8 A;  2MWQ A;  3QVZ A;  5KYY A;  2DYR C;  3SXY A;  2H8A A;  1Q0D A;  1RKE B;  2EPO A;  4CIP A;  3ZTZ A;  4C3E A;  1M6T A;  1ZHT A;  3WOD F;  1FMV A;  5CIV A;  3GOR A;  4ZLC A;  3GWL A;  3MLG A;  1OXB A;  3U8P A;  2Q3T A;  5A6B A;  3A9C A;  5DS4 A;  4E0H A;  4GYT A;  4G7O F;  2VCB A;  3K6B A;  1QVX A;  2L7A A;  1C17 M;  4XEV A;  4JEB A;  4LLC A;  3RH3 A;  2R7T A;  4E0I A;  3O55 A;  4LER A;  4Q7C A;  4J7Y A;  4CS8 A;  2M4E A;  4XPX A;  1APC A;  2KNH A;  1Y4C A;  4O7G A;  1A0B A;  4A4A A;  5DS6 A;  1ZU4 A;  2IYL D;  3EGD B;  3FOP A;  3R7C A;  2CYD A;  2Q9B A;  1RMV A;  1SMY F;  2A6H F;  3LEV A;  3VF0 A;  4CDV A;  1TR2 A;  2VB6 A;  4CX9 A;  5KYU B;  2OEV A;  3AQC A;  2R7W A;  2VH3 A;  3MFN A;  4JW1 A;  4J30 B;  2FAP B;  4ER9 A;  2OOC A;  1CGN A;  3ZDL A;  4IAQ A;  4BG0 A;  3ZTM A;  4PJJ A;  5FCL A;  5JS5 A;  3ABK C;  3C8G D;  1UG7 A;  3UGP A;  3AG4 C;  4YT2 A;  4G7Z F;  1ZU5 A;  2YHS A;  4I44 A;  2CGE A;  1G4W R;  3FHD A;  4O6Y A;  4FAP B;  4DRJ B;  3S0X A;  2Y3B A;  2HFI A;  3PCV A;  4W8K A;  3DM9 B;  4ULV A;  3ZC4 A;  1NU7 D;  2NG1 A;  3Q6M A;  3DE9 A;  3H2U A;  2XLO A;  5COM A;  5EGY A;  1WAT A;  1ORJ A;  1SZI A;  2LD6 A;  4D4N A;  1M2O A;  2BL2 A;  4JVS A;  1Z63 A;  2VCA A;  3PMR A;  3TJ5 A;  4E7S A;  3AGU A;  3C63 A;  3RYL A;  3V5Y A;  3C8G A;  2KC3 A;  2J9V A;  2GA0 A;  2QY9 A;  5L0C A;  2R03 A;  1C03 A;  2R25 A;  4JCZ A;  4YL0 A;  2Y3G A;  1QLE C;  2ASR A;  3EGX A;  3NYM A;  4XPW A;  5F5F A;  3EZI A;  2CNW A;  4U9E A;  1TFO B;  2IXM A;  2UUI A;  2J7P D;  3LLI A;  5B1B C;  1NZE A;  4JJF A;  3RFY A;  5L0H A;  4XPY A;  3QW0 A;  3IQT A;  2XXA B;  2EIN C;  1MMD A;  3AJM A;  3PHF 2;  3GM1 A;  2H7O A;  1WN0 A;  4BEM J;  1OW7 A;  4PAC A;  3B0P A;  3T6B A;  3EG9 A;  2W45 A;  3L1M A;  4DRI B;  4CS9 A;  1RKE A;  5BUO A;  3T6G B;  2J9W A;  4BJ5 C;  1YAU O;  2XLV A;  3U9M A;  3SP1 A;  3LUT B;  3TOM A;  3EHN A;  2HJ3 A;  1YA9 A;  3T9O A;  2KSF A;  2HKV A;  3JTL O;  4R32 A;  2LP4 A;  3JSE O;  4H54 A;  2J7P A;  4CBE A;  1LVK A;  1MMG A;  4X0R A;  2LCH A;  4C3D A;  3N24 A;  2I15 A;  2QUP A;  1D1B A;  1HW1 A;  2NUT A;  5HV9 A;  2R9R B;  4AE4 B;  2KJG A;  2ICW G;  1E83 A;  1AUE A;  2W4M A;  3O6X A;  3A11 A;  4IWB A;  3UMH A;  3LES A;  2Q00 A;  4FWV A;  1TFK B;  1JRA A;  5F5H A;  5T3T A;  3U0C A;  2J9U A;  4NC3 A;  1IZM A;  1FAP B;  3O10 A;  1M2V B;  1B68 A;  1NFO A;  1G8X A;  1I5N A;  1V4A A;  1D0Z A;  4JTA B;  2MHR A;  4N06 A;  4DVZ A;  5KYU A;  2NSF A;  3US6 A;  2Y3D A;  4Z9J A;  2OG2 A;  1WOL A;  3FOO A;  2G3V A;  4AL1 A;  4CJG A;  4NY3 A;  1CGM E;  5EK0 A;  2BE5 F;  4U5E E;  1LIH A;  3GEI A;  3M4C A;  1ZW2 A;  4A2N B;  1E84 A;  3K7D A;  3LNR A;  4W8P A;  3RQF A;  3NRH A;  1NG1 A;  1SF8 A;  4NQF A;  3U3B A;  4BJ5 A;  4WAB A;  4DBQ A;  5BQG A;  4BJ6 A;  1PCX A;  4U5B E;  2PX0 A;  3N0T A;  1I4Z A;  4AL0 A;  3K1H A;  2IXO A;  3FVY A;  3EHM A;  1E86 A;  4U5G A;  3NG1 A;  2PNO A;  3CSK A;  3FAP B;  3TJ6 A;  3U9J A;  2ZXO A;  3AQB A;  4J7T A;  3V7O A;  2YL0 A;  3TUL A;  2H7B A;  3S27 A;  2JX0 A;  4LDQ A;  1FFT C;  1Y6D A;  3JSZ A;  1A7V A;  3KH2 A;  4PK4 A;  3TQO A;  4EHP A;  2YRF A;  3B0U X;  4WJ0 A;  2RD9 A;  3DAG A;  5COG A;  3OEO A;  3J06 A;  1O3U A;  2PP4 A;  2XXA A;  3WAQ A;  2ZD9 A;  2QE9 A;  3DXJ F;  1DOV A;  4RDA A;  4BJ6 C;  1Z6A A;  3FMS A;  1JPJ A;  2LSE A;  2YL7 A;  4OIQ F;  3B0V C;  1C02 A;  4CSA C;  5KYN A;  5L0D A;  1ZHY A;  3C18 A;  2L6F A;  2XM0 A;  1VLT A;  2CDQ A;  4P6I C;  3RQE A;  5KYW B;  4EBJ A;  1YDI A;  3EH1 A;  3FDQ A;  2DGJ A;  2YKZ A;  3S9O A;  1MND A;  2A1D D;  4BJ1 A;  4JZA A;  3W8H A;  3QMK A;  3EH2 A;  1MQV A;  4QDL A;  4YL3 A;  3WG7 C;  4N4W A;  3ZQY A;  2NPU A;  2ZXP A;  4KC9 A;  1E85 A;  3AG2 C;  1H7I A;  3NYL A;  4MVZ A;  1NU9 C;  3G4X A;  3HTK C;  3GAN A;  1ORS C;  1D1A A;  2R05 A;  1GGQ A;  1VOM A;  4U5F E;  3S29 A;  4AE4 A;  4MTG A;  4YT8 A;  3VAY A;  3JYH A;  3KMI A;  5JP7 A;  1D1C A;  1FTS A;  1T01 A;  2J46 A;  3UGO A;  3CQZ A;  4ZLD A;  1VYI A;  4QI2 A;  4N6H A;  3L34 A;  4O79 A;  5DQT A;  2ZXW C;  1M2V A;  1LS1 A;  1VMA A;  4OD5 A;  3VYW A;  1Q0K A;  5A6A A;  1JR8 A;  4Q5S F;  1Z7Q c;  3EFO B;  3K66 A;  3IQ6 A;  4JIO A;  3X2Q C;  5JT4 A;  2PFD A;  2IOQ A;  2O9X A;  3EJN A;  2G62 A;  2WVN A;  1PD1 A;  2KW3 C;  4PJL A;  4YL1 A;  4YWQ A;  4OIN F;  4MW3 A;  4Z9I A;  4IAO A;  3DZA A;  2IXP A;  2EIL C;  3TK0 A;  4D4X A;  3U5S A;  2FGY A;  2CNW D;  3LS0 A;  1ZYR F;  4I3M A;  1R5I D;  2Y69 C;  3EPV A;  3Q6N A;  5AGF A;  1S05 A;  3KYJ A;  2KQ9 A;  5D91 A;  4MND A;  3GM2 A;  1EKY A;  5JLI A;  4MTO A;  2W4B A;  3NKD A;  3HNL A;  3W4Y A;  4OIO F;  4YN0 B;  3JRM O;  1AVO B;  1Z23 A;  2E87 A;  1MMN A;  5A6J A;  4B6I A;  3BEH A;  1MMA A;  3SNH A;  2L6H A;  3DAF A;  2XLH A;  4DXW A;  1KTM A;  3DE8 A;  3DI5 A;  3G4Z A;  3HLZ A;  3CEX A;  1ZW3 A;  4CDA A;  3CZ6 A;  3T4R A;  5AC4 A;  3C62 A;  3ZWI A;  2HV7 A;  4GQH A;  4IAR A;  3NMI A;  1M56 C;  4O6M A;  1RJ9 B;  1OR2 A;  2IBF A;  4MVU A;  3AG3 C;  3W8I A;  2QLA A;  2QNL A;  5COF A;  4BEJ A;  1V55 C;  1D0Y A;  1A41 A;  3ZIB A;  3GOD A;  4MVS A;  3W2W A;  2KGO A;  4WGY A;  4RBN A;  2P0N A;  4C3B A;  5D92 A;  2P6V A;  3HNI A;  1YJG A;  3ABM C;  4IB4 A;  4DBR A;  3B71 A;  2J0W A;  4IGG A;  4RD9 A;  4JTD B;  2Q7R A;  1T5O A;  3I5Q A;  5KYW A;  2JD3 A;  1RCP A;  3H65 A;  2ZPA A;  3GWN A;  1FMW A;  4F4B A;  2P61 A;  1BR4 A;  5L3V A;  2BC5 A;  2Z15 A;  5JVE A;  2PX3 A;  3CAX A;  1H9G A;  3ZG1 A;  4YJW A;  3QTH A;  3TD7 A;  4CJO A;  4CDY A;  1QKR A;  3RIP A;  3GM3 A;  2J9B A;  4AK9 A;  2HJM A;  1ZHX A;  1EI7 A;  3DKA A;  2J0X A;  5L0F A;  5B3I A;  5B1A C;  3V5Z A;  2FFH A;  4FES A;  2R7V A;  4LDK A;  3NDB B;  2OEX A;  3FXH A;  3Q7G A;  3BRJ A;  4WGZ A;  3EGD A;  3OWT A;  4JKV A;  2XS1 A;  4XEF A;  4C7O B;  5A6K A;  1LE2 A;  1H9T A;  1JAF A;  2A6E F;  2HSQ A;  1V54 C;  2EIM C;  4EIY A;  3EZH A;  3U2M A;  2WL8 A;  2XM4 A;  2VC9 A;  3OA1 A;  3IQC A;  4XWJ A;  3LS1 A;  4MVR A;  1YLM A;  1LI5 A;  2L9J A;  2M64 A;  2OCC C;  4JCH A;  1LPE A;  3TOL A;  3UR3 C;  1VB5 A;  1IW7 F;  5T3W A;  3UMI A;  5T1D B;  3N2Z B;  1U6H A;  2HSB A;  2LIG A;  3SYN A;  5JUA A;  1OW6 A;  1LS4 A;  1SYQ A;  4P9F A;  1Q0G A;  5TJ5 E;  2LFD A;  5L0I A;  2HMZ A;  4MVM A;  2XL8 A;  3DM5 A;  3G50 A;  3K33 A;  3LEO A;  3LAY A;  4XLN F;  5DVW A;  4EBB A;  4UDV A;  4MVO A;  3AOU A;  1EA8 A;  1YAR O;  2YLG A;  4PR9 A;  3QVY A;  4PJN A;  5HSW A;  4BJT A;  2YVK A;  4YK5 A;  5L0G A;  2LQG A;  3ASO C;  3SXZ A;  2HV6 A;  2G3K A;  3VM6 A;  4FX5 A;  3QW1 A;  1BZ4 A;  2WB7 A;  2WZF A;  1OCR C;  1LE4 A;  3ATP A;  3L0I A;  4JJG A;  1M57 C;  5B3S C;  1KU2 A;  1QSP A;  3KKB A;  4I1M A;  2GDC A;  1L3P A;  2HZ8 A;  1H6G A;  3M4B A;  5L0J A;  2TMV P;  2R7O A;  1FNT c;  2EPK X;  1O5H A;  3NKE A;  2DI3 A;  2DYS C;  4HFF B;  1OR3 A;  3DMD A;  2XL6 A;  1WAS A;  4AX2 A;  4E7Z A;  1RJ9 A;  2AVK A;  1ZVZ A;  2QTV A;  1HE9 A;  3F47 A;  3SEO A;  2NSG A;  4XEK A;  4DJ9 A;  1ZHZ A;  3C8Z A;  3S84 A;  2H7V C;  4L6R A;  2AWY A;  2HUJ A;  2YEV A;  2L6G A;  1YZC A;  256B A;  3NMJ A;  4CIH A;  3DJU B;  2OJE D;  1LKX A;  3EQL F;  3I5P A;  4JTC B;  4NTF A;  5E3A A;  1BBH A;  1VTM P;  2P1A A;  1NLX A;  1VLS A;  3HNK A;  1YVI A;  2IXN A;  1E2X A;  3F46 A;  4IJJ A;  3Q7L A;  3X1O A;  3LLK A;  3RVY A;  5K0I A;  1RXQ A;  1W2W A;  1EQ1 A;  3IHU A;  5FZT A;  2V3C C;  2CW0 F;  3PDM P;  1A7D A;  2YLD A;  1O87 A;  3GEH A; 
#chains in the Genus database with same CATH homology
 5JLI A;  2YL1 A;  3HNL A;  4JEA A;  2XLH A;  3DE8 A;  4CDA A;  2XLD A;  3C62 A;  3ZWI A;  2YL3 A;  4IAR A;  3NMI A;  2QLA A;  4NC3 A;  1YYX A;  4WGY A;  2XLE A;  5JRA A;  3HNI A;  3FOO A;  4IB4 A;  4CJG A;  3IQ5 A;  1E84 A;  3M4C A;  1RCP A;  2YLI A;  3QVZ A;  2BC5 A;  5JVE A;  4CIP A;  3ZTZ A;  4CJO A;  4CDY A;  1M6T A;  2J9B A;  1EKY A;  3U8P A;  1YZA A;  5B3I A;  1E86 A;  4WGZ A;  4JKV A;  4JEB A;  1JAF A;  1LM3 B;  3M79 A;  1QPU A;  1APC A;  2J8W A;  4EIY A;  2YL0 A;  3M15 A;  2XM4 A;  3FOP A;  1A7V A;  3TOL A;  1QQ3 A;  4CDV A;  1YYJ A;  5JUA A;  4CX9 A;  1NBB A;  3VRC A;  2YL7 A;  4ER9 A;  2XL8 A;  1CGN A;  1E83 A;  4IAQ A;  5JS5 A;  2XM0 A;  3ZTM A;  2YLG A;  3QVY A;  2YKZ A;  1CGO A;  1MQV A;  3ZQY A;  3QW1 A;  4N4W A;  4ULV A;  1E85 A;  1CPQ A;  3DE9 A;  2XLO A;  3NMK A;  4D4N A;  3M4B A;  5JP7 A;  3C63 A;  2XL6 A;  2CCY A;  4N6H A;  1CPR A;  4L6R A;  3HNJ A;  4U9E A;  3ZQV A;  2XLW A;  1YZC A;  256B A;  2XLM A;  3NMJ A;  3IQ6 A;  5JT4 A;  5JSL A;  3QW0 A;  1BBH A;  1GQA A;  3HNK A;  4D4X A;  3L1M A;  4U9D A;  2XLV A;  5AGF A;  1S05 A;  2YLD A;  3TOM A;  4JE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...