5F28E

Crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
b'LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MEF2C
publication title FAK Forms a Complex with MEF2 to Couple Biomechanical Signaling to Transcription in Cardiomyocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
total genus 50
structure length 128
sequence length 128
chains with identical sequence F, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 5f28E00
1UFBA 2HSBA 3K7DA 3C18A 3GM2A 3JZ0A 1KNYA 2JX0A 1KTMA 1OW8A 3GM3A 3TULA 3O10A 3AJMA 1OW6A 1PV3A 1K05A 1O3UA 2LK4A 3B71A 4R32A 1QVXA 3U3FA 1K04A 2KK1A 3C8GD 3L8IA 3BRJA 1ZZPA 1WOLA 3L8JA 4XEKA 3MFNA 3C8GA 2L6HA 3U0CA 3S9OA 4EBJA 1V4AA 2L6FA 3RQFA 1OW7A 3GM1A 2L6GA 2Q00A 1WTYA 3RQGA 1WWPA 1K40A 4XEFA 3JYYA 5F28E 4EBKA 4XEVA 2YWAA 2JPUA 3C8GB 3RQEA 4NQFA 2PBEA 1JOGA
chains in the Genus database with same CATH superfamily
5JS5A 2HSBA 4PFOA 1FTSA 3V5ZA 4H54A 1TWGA 1OXKA 4W8PA 3GWLA 1IW7F 3H2VA 3RVYA 3SNHA 3TULA 3L34A 4K1OA 3AJMA 3EHMA 2GWWA 4MVMA 2KK1A 2L7AA 3ZDLA 1YVIA 4E0IA 2C03A 1NSGB 3R2PA 2YZSA 3HNIA 3K1IA 1M56C 3QZCA 3ZQYA 3ZSUA 1S7ZA 3B9QA 1RCPA 3LEOA 4QDLA 5DVWA 3RW0A 2XLVA 3EJNA 3PHF2 2W45A 2AU5A 1K40A 2I8BA 3DJUB 5E3CA 4XPXA 2CCYA 4MVZA 3V7OA 2IBFA 2WZLA 3DM9B 1AUEA 4XPWA 1FFTC 1M57C 3S27A 5KYWA 1VMAA 2FFHA 2HKVA 2XS8A 3QMKA 3X1OA 3DAFA 1H6GA 1Q0GA 1YYXA 1Z5ZA 2LP4A 2LIGA 4JEAA 4OIOF 3QW1A 2X0CA 2PX3A 3G4XA 4B6IA 2YVKA 3DZAA 5CI8A 3DAGA 4EKWA 4DBQA 2Y3DA 2YL3A 3S0XA 3UMHA 4CDYA 1YA7O 5HV9A 1O3UA 2EPLX 3TD7A 5A6KA 3JRTA 3K66A 4QI2A 2OKUA 2R03A 1ZHTA 1V74B 4MQ9F 3IHUA 3LESA 5A6BD 1A7VA 3LUTB 1APCA 2HSQA 3W2WA 1QLEC 4G7HF 4G78A 4CSAC 1XWJA 1HE1A 2PP4A 4IAQA 2CGEA 3TJ6A 5L3VA 1WWPA 3JYYA 2BC5A 2NUPB 4E18A 3ZWIA 3S29A 4HEAJ 3U2LA 2Y3HA 4XEVA 3C8GB 4OINF 3AQCA 3RQEA 2CYDA 4BEJA 2D5RB 2QNLA 2XLHA 5B3SC 2VCAA 1JRAA 1ORYA 4MNDA 3ZIBA 4G0HA 4I1OB 3QVYA 1T6QA 4U5DE 2O9XA 3FXHA 2QLAA 3M4CA 5D91A 3RH3A 3WODF 1LS1A 1LVKA 2Q3TA 2RD9A 4N06A 4X0RA 2KGOA 2Y3GA 1T6UA 2Q9BA 4U5HA 4CX9A 3UR3C 4E7SA 1QZXA 1Z6AA 1ZYRF 2HFIA 1QSPA 1IZMA 2YL7A 3EPVA 2R7UA 1M2VA 2TMVP 4JC7A 4DBRA 3OA1A 3DWWA 2J0WA 2UUHA 3T6GB 3FOPA 2OEXA 5CI9A 4BJ6A 3K6BA 4MVSA 4ANJA 1U0BB 1TWAA 2ICWG 1LS4A 2YEVA 4P9FA 1FMVA 3W4YA 1V55C 2XL6A 3C7JA 1NU7D 4XWJA 1GS9A 4YT2A 1CGME 1RJ9A 4J30B 4JZAA 4GEHA 5F5HA 3V5YA 3HNJA 1NLXA 3SP1A 3WAQA 4XLPF 3I5PA 4CDVA 2QUPA 2YRFA 3GM3A 1RKCA 5KYUB 1OCCC 3U8PA 1YZCA 1LIHA 1SF8A 3O39A 4D4NA 1I4YA 1TQGA 4PJMA 4C7OB 4AL0A 3BRJA 3LLKA 1R5ID 4ONSA 4N4WA 2YL0A 1E86A 3JSEO 5AGFA 4MVUA 2G3VA 2IYLD 1D0YA 2X51A 3EGDA 3FVYA 4MTGA 1OR3A 1Q0KA 2XM0A 4WABA 2JD3A 3DXJF 5JVEA 1I5NA 1E83A 2OOCA 1BDJB 1HMDA 1OCOC 1E2XA 4DJ9A 3JCUQ 5L0FA 1VYKA 3MLGA 1D1CA 2EPNA 3Q7LA 4W8KA 2A6HF 2EIMC 4CJGA 2HS5A 2W4MA 3AG3C 2B0HA 4NY3A 2HUJA 2R05A 3UMIA 2RSEB 2HV6A 1JAFA 4FAPB 4YWQA 3M4BA 4WGYA 2NSGA 1J8MF 3JT1A 2A6EF 4P9TA 5KYWB 2M4EA 4YN0B 2LK4A 2PNOA 2V3CC 2YQYA 1EQ1A 3C8GD 2CNWD 4GQHA 2A1DD 4DRIB 2HMZA 4PACA 3ZVRA 3E9VA 1XZQA 4JJGA 3WG7C 3KYIA 1W2WA 2XXAA 4JCHA 1AEPA 3NYMA 2HMQA 4EBJA 5L0CA 2L6FA 1OW7A 3IQTA 2WL8A 1ST6A 2Y3BA 3RQGA 3IQ5A 1WN0A 3NKDA 4BPMA 2WVOA 3S84A 5BQHA 1FR0A 4F4BA 2H7BA 1ZU5A 4C3DA 3CAXA 2HJ3A 3LJBA 1L7CA 2VCCA 2IOQA 2AWCA 4J7YA 3OWTA 3C8ZA 3EQLF 2R25A 3FOOA 1U6HA 3LAYA 4IARA 3MYIA 4JTAB 2I15A 4KBLA 3QW0A 1PV3A 3N0TA 3NMIA 1QQ3A 2R7XA 1SYQA 3R7CA 3U3BA 1VB5A 3RIPA 2A69F 1A7DA 2ETSA 3CEXA 3EH1A 4N6HA 4Q7CA 1U89A 3T4RA 3IEEA 4LLCA 3MX3A 4YT4A 5AC5A 5JLIA 5KYYA 2VCBA 2FGYA 3GEEA 3VM6A 2XL4A 1YJGA 2MHRA 1KU2A 3IPMO 3KL4A 3L1MA 3FHDA 3U5SA 4U5GA 2LSEA 4KC9A 1M2VB 4JRZA 3K1HA 2GFHA 3TOMA 2J7PA 2R9RB 1CGOA 2XRHA 3B29A 4RDAA 3NMJA 2Q9AA 2EPMX 3NKEA 4JJFA 4XTKA 3W8HA 4EIYA 2A0UA 2A68F 3JSZA 1G4US 2OJED 3ZTZA 4CS9C 1RMVA 1QPUA 2P1AA 5L3QA 2LFFA 4IRUA 5L0DA 4J7TA 4CS7A 3KMIA 1RJ9B 1I4ZA 2WVQA 3B71A 1JMWA 1MNEA 2EPOA 3ECSA 5T3TA 2CDQA 3SXYA 1SMYF 3VRCA 1OXBA 2IXMA 3CZ6A 4PFPA 1WOLA 3MFNA 3MYFA 3DJNB 1B68A 1S05A 2H7OA 4A2NB 2PFDA 3GM1A 5E33A 1WTYA 256BA 4QI0A 4DRHB 5DQTA 2WZFA 4JEBA 2OCCC 4PK4A 4Z9JA 1ZHXA 3GORA 1QKRA 3Q7GA 3EG9A 3EGDB 4CS9A 3PMRA 4FESA 1WATA 4I44A 1DOWA 1CPRA 5KYXA 1NG1A 2AWYA 3GM2A 4YT8A 3JZ0A 5T1DB 1KTMA 4FWVA 2NUTA 3VYWA 4WGZA 1ZHWA 1O5HA 2DI3A 1OW6A 1TWHA 1TFKB 3AOUA 2J9VA 3DKAA 2PF4E 3HLZA 3IQ6A 2A0BA 4LDQA 4CSAA 4NTFA 3ZC4A 4BJ5C 5A6JA 3RYLA 1WASA 1TKNA 4KI2A 4Z9IA 4KNVA 3ZQVA 5KYNA 1YARO 3HJCA 3JRMO 3HTKC 4E17A 2Q00A 3HKKA 1A41A 3ABKC 4MVQA 3SYNA 3F46A 2IXPA 1HY5A 2KW3C 2YWAA 3NMKA 4O7GA 2JPUA 2R7TA 1OKKA 3T9OA 1N1CA 3U9JA 3POVA 2R7RA 3SEOA 1NU9C 1Z23A 2ZXPA 3A9CA 2KNHA 4FX5A 3Q6MA 4IJJA 4NCQA 4Z9HA 3U9MA 1LKXA 2HJMA 4YJWA 2DB4A 3AG1C 3LS0A 4AL1A 3ABMC 2ZXRA 4UDVA 1MMDA 3GEHA 2QY9A 4ZLCA 4PJNA 3ITFA 1ORSC 1G4WR 1K04A 1Y6DA 3LS1A 2EIKC 1FMWA 1AVOB 5L0HA 3GODA 4CIPA 2XS1A 1D1AA 4J32B 1EKYA 4U5BE 4EBBA 2W4BA 5JSLA 2MYSA 5AC4A 1RXQA 4ULWA 1JR8A 4IWBA 1Z63A 3AQBA 3EGXA 5DS6A 4BJTA 2F22A 4D4XA 1TWCA 1YYJA 3M15A 2DYSC 3KPHA 5KYYB 2H8AA 4O79A 3HNKA 5JP7A 1VLSA 2YHSA 2EPKX 3C18A 1LI5A 3U2MA 5EK0A 3ZTMA 2LCHA 1BR4A 2YL1A 1MMGA 3WHNA 4DOZA 3FAPB 4PJLA 4LDKA 2LFDA 4KNWA 2G3KA 2GA0A 3EFOA 4U5FE 3UMKA 1XZPA 3EHNA 5A69A 1GGQA 1PD1A 1TFOB 3CQZA 3TJ5A 2IM8A 4MW8A 4XEKA 4K7BA 4GYTA 5CIVA 4JTCB 3S90A 4OD5A 2M64A 3IQCA 4AK9A 4XQ1A 2WVNA 3F47A 3DMDA 3AGTA 4MVOA 2P7VA 3UGPA 1DOVA 3LNRA 4LLEA 5COGA 2Y69C 3I4UA 1FNTc 3GANA 3X2QC 3DM5A 2EIJC 5GPGB 3W2VA 1EA8A 1BR2A 1J8YF 3K33A 4U5CE 4MVRA 3N24A 1M6TA 5BUOA 3AG2C 3C63A 4CJOA 1KNYA 3I5QA 1NFNA 4P6IC 4DVZA 3O10A 4JCZA 2DYRC 3EG9B 4EUKB 3UNGC 1K05A 3B0PA 3U3FA 5EHHA 1ORJA 2HZ8A 2Q4FA 3NG1A 3DI5A 4JE9A 2HV7A 4U9EA 5KYXB 1A0BA 3BEHA 4NTBA 1O87A 2KJGA 2NUTB 3KH2A 1H7IA 4AE4A 3N2ZB 3RQFA 1YAUO 2J9BA 2KQ9A 1Q0MA 2L6GA 2XLOA 1OQCA 3H2UA 1T5OA 2XSEA 2PX0A 3K1IC 1LE4A 4JIOA 5F28E 4E0HA 1HE9A 4N6CA 1Q0FA 2VH3A 3ASOC 3EZIA 2ZPAA 4O6MA 1MQVA 4LDRA 3SZRA 3U8VA 2Q7RA 4HE8D 2PBEA 5B3IA 1JPNA 4MTFA 4U5EE 2LD6A 1VLTA 3Q6NA 5B1BC 5IY5C 3US6A 1OW8A 3W8IA 1Y4CA 1ZHYA 1MMNA 4XPYA 1T01A 2D4UA 3HNLA 1L3PA 3KKBA 2R7QA 2J45A 2WZGA 1NFOA 3LNMB 1ZZPA 2DGJA 5FZTA 1RKEA 3DE9A 2R02A 3S28A 4XLNF 4OIPF 2R7SA 2OEVA 3S9OA 4I3MA 1CPQA 1LPEA 4YL1A 4ER9A 1FFHA 1EI7A 1LE2A 5A6BA 1UG7A 2BL2A 2KC3A 3MBGA 2WB7A 4YL0A 3RFYA 3TK0A 4Q5SF 2J7PD 3TOLA 1FAPB 4ULVA 3LLIA 4ZLDA 1C02A 1ZHZA 3JTLO 4LACB 1WGWA 3RKOF 5L0JA 3GEIA 3RVZA 4IGGA 1H9GA 1VYIA 2AVKA 2KSFA 3ASNC 3NYLA 5B1AC 4OIRF 2XLEA 2P0NA 4G7ZF 3EGXB 2EILC 4DVYP 4YL3A 2L81A 1R4TA 1Z3IX 2QTVA 5DQZA 5DS5A 1BZ4A 3QVZA 4AX2A 2P61A 2J8WA 4MW3A 4R32A 1QVXA 4EHPA 2G62A 3ABLC 3G50A 5BQGA 2GAQA 4MTOA 3L8JA 1LM3B 2NG1A 5L0IA 3B0UX 2EINC 1V4AA 4O6NA 4DRJB 3EFOB 4YK5A 1C03A 1YZAA 3AGUA 4XEFA 2AP3A 4RBNA 1GM5A 1D0ZA 4BJ6C 1ZVZA 3EZHA 1LI7A 3JYHA 1YA9A 3AG4C 3FAJA 3O6XA 4L6RA 1G8XA 3V5XA 4IB4A 4PR9A 4H4KC 2IXNA 4IAOA 3UGOA 2XXAB 3FDQA 1T6IA 2YLGA 3T6BA 1JOGA 1VOMA 3C62A 4JURI 3B0VC 3SXMA 3E70C 5JUAA 4PJJA 1MNDA 1TR2A 3CSKA 2R7WA 1C17M 4CBEA 3O55A 4BJ5A 2UUIA 2ZXOA 4BG0A 3LEVA 4C3BA 2V26A 5COMA 4MS2A 2NPUA 3SXKA 1HW2A 1A7EA 2YLIA 1MMAA 3NYJA 2NSFA 2R7VA 2R7OA 3QTHA 4CIHA 2VASA 2XLMA 1OKKD 4C3EA 5FCLA 1VTMP 4K0DA 3ZG1A 2OJQA 2XLWA 1HW1A 4I1MA 4RD9A 4WJ0A 4CDAA 4AE4B 2BE5F 2XLDA 2YLDA 1OCRC 1SR2A 2J46A 1YDIA 3NRHA 5COFA 1D0XA 2IXOA 1T9KA 3G4ZA 4O6YA 5DS4A 3DE8A 5HSWA 4Q4ZF 3K7DA 4JKVA 5E2QA 4CS8C 1H9TA 5F5FA 1NZEA 2JX0A 3A11A 5BQIA 2ZXWC 1E85A 4OD4A 2GDCA 4YT5A 4M63A 4HFFB 5JRAA 4A4AA 1JPJA 5K0IA 2FAPB 3PCVA 4JTDB 2Z15A 4NC3A 3L8IA 2KYHA 1BBHA 2NUPA 2VC9A 1V54C 1YLMA 1ZW2A 3T6JA 4OIQF 3C8GA 2CNWA 2L9JA 4JW1A 3VAYA 2L6HA 3U0CA 2P6VA 4E7ZA 3ATPA 1HMOA 3M1CB 4BJ1A 4U9DA 2B0JA 4DXWA 5A6AA 1ZU4A 3DD7A 1Z7Qc 4BEMJ 1GQAA 3J06A 2C04A 2J9WA 2YKZA 1RKEB 2XM4A 5DLJA 4CS8A 1F1MA 3M79A 3EH2A 1D1BA 2ZD9A 4EWCA 1UFBA 1CGNA 1E84A 2H7VC 3RF3A 4LERA 3SXZA 2E87A 2OG2A 3PDMP 1OCZC 1G5ZA 3VF0A 5JT4A 4JVSA 1OR2A 4NTAA 5T3WA 2Y39A 3L0IA 2OU6A 2CW0F 2MWQA 5D92A 4G7OF 3OEOA 2W9YA 3FMSA 3H65A 5E3AA 2XL8A 5TJ5E 3GWNA 5EGYA 2LQGA 2VB6A 1BR1A 2OQMA 5L0GA 1PCXA 4HFKB 3KYJA 2QE9A 1SZIA 2Q9CA 1VK5A 2ASRA 4EBKA 1NBBA 1PD0A 2J0XA 1ZW3A 1Q0DA 4NQFA 5KYUA 2J9UA 3TQOA 3NDBB 1M2OA 4C7OA
chains in the Genus database with same CATH topology
1UFBA 2HSBA 3K7DA 3C18A 3GM2A 3JZ0A 1KNYA 2JX0A 1KTMA 1OW8A 3GM3A 3TULA 3O10A 3AJMA 1OW6A 1PV3A 1K05A 1O3UA 2LK4A 3B71A 4R32A 1QVXA 3U3FA 1K04A 2KK1A 3C8GD 3L8IA 3BRJA 1ZZPA 1WOLA 3L8JA 4XEKA 3MFNA 3C8GA 2L6HA 3U0CA 3S9OA 4EBJA 1V4AA 2L6FA 3RQFA 1OW7A 3GM1A 2L6GA 2Q00A 1WTYA 3RQGA 1WWPA 1K40A 4XEFA 3JYYA 5F28E 4EBKA 4XEVA 2YWAA 2JPUA 3C8GB 3RQEA 4NQFA 2PBEA 1JOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  2HSB A;  3K7D A;  3C18 A;  3GM2 A;  3JZ0 A;  1KNY A;  2JX0 A;  1KTM A;  1OW8 A;  3GM3 A;  3TUL A;  3O10 A;  3AJM A;  1OW6 A;  1PV3 A;  1K05 A;  1O3U A;  2LK4 A;  3B71 A;  4R32 A;  1QVX A;  3U3F A;  1K04 A;  2KK1 A;  3C8G D;  3L8I A;  3BRJ A;  1ZZP A;  1WOL A;  3L8J A;  4XEK A;  3MFN A;  3C8G A;  2L6H A;  3U0C A;  3S9O A;  4EBJ A;  1V4A A;  2L6F A;  3RQF A;  1OW7 A;  3GM1 A;  2L6G A;  2Q00 A;  1WTY A;  3RQG A;  1WWP A;  1K40 A;  4XEF A;  3JYY A;  5F28 E;  4EBK A;  4XEV A;  2YWA A;  2JPU A;  3C8G B;  3RQE A;  4NQF A;  2PBE A;  1JOG A; 
#chains in the Genus database with same CATH topology
 5JS5 A;  2HSB A;  4PFO A;  1FTS A;  3V5Z A;  4H54 A;  1TWG A;  1OXK A;  4W8P A;  3GWL A;  1IW7 F;  3H2V A;  3RVY A;  3SNH A;  3TUL A;  3L34 A;  4K1O A;  3AJM A;  3EHM A;  2GWW A;  4MVM A;  2KK1 A;  2L7A A;  3ZDL A;  1YVI A;  4E0I A;  2C03 A;  1NSG B;  3R2P A;  2YZS A;  3HNI A;  3K1I A;  1M56 C;  3QZC A;  3ZQY A;  3ZSU A;  1S7Z A;  3B9Q A;  1RCP A;  3LEO A;  4QDL A;  5DVW A;  3RW0 A;  2XLV A;  3EJN A;  3PHF 2;  2W45 A;  2AU5 A;  1K40 A;  2I8B A;  3DJU B;  5E3C A;  4XPX A;  2CCY A;  4MVZ A;  3V7O A;  2IBF A;  2WZL A;  3DM9 B;  1AUE A;  4XPW A;  1FFT C;  1M57 C;  3S27 A;  5KYW A;  1VMA A;  2FFH A;  2HKV A;  2XS8 A;  3QMK A;  3X1O A;  3DAF A;  1H6G A;  1Q0G A;  1YYX A;  1Z5Z A;  2LP4 A;  2LIG A;  4JEA A;  4OIO F;  3QW1 A;  2X0C A;  2PX3 A;  3G4X A;  4B6I A;  2YVK A;  3DZA A;  5CI8 A;  3DAG A;  4EKW A;  4DBQ A;  2Y3D A;  2YL3 A;  3S0X A;  3UMH A;  4CDY A;  1YA7 O;  5HV9 A;  1O3U A;  2EPL X;  3TD7 A;  5A6K A;  3JRT A;  3K66 A;  4QI2 A;  2OKU A;  2R03 A;  1ZHT A;  1V74 B;  4MQ9 F;  3IHU A;  3LES A;  5A6B D;  1A7V A;  3LUT B;  1APC A;  2HSQ A;  3W2W A;  1QLE C;  4G7H F;  4G78 A;  4CSA C;  1XWJ A;  1HE1 A;  2PP4 A;  4IAQ A;  2CGE A;  3TJ6 A;  5L3V A;  1WWP A;  3JYY A;  2BC5 A;  2NUP B;  4E18 A;  3ZWI A;  3S29 A;  4HEA J;  3U2L A;  2Y3H A;  4XEV A;  3C8G B;  4OIN F;  3AQC A;  3RQE A;  2CYD A;  4BEJ A;  2D5R B;  2QNL A;  2XLH A;  5B3S C;  2VCA A;  1JRA A;  1ORY A;  4MND A;  3ZIB A;  4G0H A;  4I1O B;  3QVY A;  1T6Q A;  4U5D E;  2O9X A;  3FXH A;  2QLA A;  3M4C A;  5D91 A;  3RH3 A;  3WOD F;  1LS1 A;  1LVK A;  2Q3T A;  2RD9 A;  4N06 A;  4X0R A;  2KGO A;  2Y3G A;  1T6U A;  2Q9B A;  4U5H A;  4CX9 A;  3UR3 C;  4E7S A;  1QZX A;  1Z6A A;  1ZYR F;  2HFI A;  1QSP A;  1IZM A;  2YL7 A;  3EPV A;  2R7U A;  1M2V A;  2TMV P;  4JC7 A;  4DBR A;  3OA1 A;  3DWW A;  2J0W A;  2UUH A;  3T6G B;  3FOP A;  2OEX A;  5CI9 A;  4BJ6 A;  3K6B A;  4MVS A;  4ANJ A;  1U0B B;  1TWA A;  2ICW G;  1LS4 A;  2YEV A;  4P9F A;  1FMV A;  3W4Y A;  1V55 C;  2XL6 A;  3C7J A;  1NU7 D;  4XWJ A;  1GS9 A;  4YT2 A;  1CGM E;  1RJ9 A;  4J30 B;  4JZA A;  4GEH A;  5F5H A;  3V5Y A;  3HNJ A;  1NLX A;  3SP1 A;  3WAQ A;  4XLP F;  3I5P A;  4CDV A;  2QUP A;  2YRF A;  3GM3 A;  1RKC A;  5KYU B;  1OCC C;  3U8P A;  1YZC A;  1LIH A;  1SF8 A;  3O39 A;  4D4N A;  1I4Y A;  1TQG A;  4PJM A;  4C7O B;  4AL0 A;  3BRJ A;  3LLK A;  1R5I D;  4ONS A;  4N4W A;  2YL0 A;  1E86 A;  3JSE O;  5AGF A;  4MVU A;  2G3V A;  2IYL D;  1D0Y A;  2X51 A;  3EGD A;  3FVY A;  4MTG A;  1OR3 A;  1Q0K A;  2XM0 A;  4WAB A;  2JD3 A;  3DXJ F;  5JVE A;  1I5N A;  1E83 A;  2OOC A;  1BDJ B;  1HMD A;  1OCO C;  1E2X A;  4DJ9 A;  3JCU Q;  5L0F A;  1VYK A;  3MLG A;  1D1C A;  2EPN A;  3Q7L A;  4W8K A;  2A6H F;  2EIM C;  4CJG A;  2HS5 A;  2W4M A;  3AG3 C;  2B0H A;  4NY3 A;  2HUJ A;  2R05 A;  3UMI A;  2RSE B;  2HV6 A;  1JAF A;  4FAP B;  4YWQ A;  3M4B A;  4WGY A;  2NSG A;  1J8M F;  3JT1 A;  2A6E F;  4P9T A;  5KYW B;  2M4E A;  4YN0 B;  2LK4 A;  2PNO A;  2V3C C;  2YQY A;  1EQ1 A;  3C8G D;  2CNW D;  4GQH A;  2A1D D;  4DRI B;  2HMZ A;  4PAC A;  3ZVR A;  3E9V A;  1XZQ A;  4JJG A;  3WG7 C;  3KYI A;  1W2W A;  2XXA A;  4JCH A;  1AEP A;  3NYM A;  2HMQ A;  4EBJ A;  5L0C A;  2L6F A;  1OW7 A;  3IQT A;  2WL8 A;  1ST6 A;  2Y3B A;  3RQG A;  3IQ5 A;  1WN0 A;  3NKD A;  4BPM A;  2WVO A;  3S84 A;  5BQH A;  1FR0 A;  4F4B A;  2H7B A;  1ZU5 A;  4C3D A;  3CAX A;  2HJ3 A;  3LJB A;  1L7C A;  2VCC A;  2IOQ A;  2AWC A;  4J7Y A;  3OWT A;  3C8Z A;  3EQL F;  2R25 A;  3FOO A;  1U6H A;  3LAY A;  4IAR A;  3MYI A;  4JTA B;  2I15 A;  4KBL A;  3QW0 A;  1PV3 A;  3N0T A;  3NMI A;  1QQ3 A;  2R7X A;  1SYQ A;  3R7C A;  3U3B A;  1VB5 A;  3RIP A;  2A69 F;  1A7D A;  2ETS A;  3CEX A;  3EH1 A;  4N6H A;  4Q7C A;  1U89 A;  3T4R A;  3IEE A;  4LLC A;  3MX3 A;  4YT4 A;  5AC5 A;  5JLI A;  5KYY A;  2VCB A;  2FGY A;  3GEE A;  3VM6 A;  2XL4 A;  1YJG A;  2MHR A;  1KU2 A;  3IPM O;  3KL4 A;  3L1M A;  3FHD A;  3U5S A;  4U5G A;  2LSE A;  4KC9 A;  1M2V B;  4JRZ A;  3K1H A;  2GFH A;  3TOM A;  2J7P A;  2R9R B;  1CGO A;  2XRH A;  3B29 A;  4RDA A;  3NMJ A;  2Q9A A;  2EPM X;  3NKE A;  4JJF A;  4XTK A;  3W8H A;  4EIY A;  2A0U A;  2A68 F;  3JSZ A;  1G4U S;  2OJE D;  3ZTZ A;  4CS9 C;  1RMV A;  1QPU A;  2P1A A;  5L3Q A;  2LFF A;  4IRU A;  5L0D A;  4J7T A;  4CS7 A;  3KMI A;  1RJ9 B;  1I4Z A;  2WVQ A;  3B71 A;  1JMW A;  1MNE A;  2EPO A;  3ECS A;  5T3T A;  2CDQ A;  3SXY A;  1SMY F;  3VRC A;  1OXB A;  2IXM A;  3CZ6 A;  4PFP A;  1WOL A;  3MFN A;  3MYF A;  3DJN B;  1B68 A;  1S05 A;  2H7O A;  4A2N B;  2PFD A;  3GM1 A;  5E33 A;  1WTY A;  256B A;  4QI0 A;  4DRH B;  5DQT A;  2WZF A;  4JEB A;  2OCC C;  4PK4 A;  4Z9J A;  1ZHX A;  3GOR A;  1QKR A;  3Q7G A;  3EG9 A;  3EGD B;  4CS9 A;  3PMR A;  4FES A;  1WAT A;  4I44 A;  1DOW A;  1CPR A;  5KYX A;  1NG1 A;  2AWY A;  3GM2 A;  4YT8 A;  3JZ0 A;  5T1D B;  1KTM A;  4FWV A;  2NUT A;  3VYW A;  4WGZ A;  1ZHW A;  1O5H A;  2DI3 A;  1OW6 A;  1TWH A;  1TFK B;  3AOU A;  2J9V A;  3DKA A;  2PF4 E;  3HLZ A;  3IQ6 A;  2A0B A;  4LDQ A;  4CSA A;  4NTF A;  3ZC4 A;  4BJ5 C;  5A6J A;  3RYL A;  1WAS A;  1TKN A;  4KI2 A;  4Z9I A;  4KNV A;  3ZQV A;  5KYN A;  1YAR O;  3HJC A;  3JRM O;  3HTK C;  4E17 A;  2Q00 A;  3HKK A;  1A41 A;  3ABK C;  4MVQ A;  3SYN A;  3F46 A;  2IXP A;  1HY5 A;  2KW3 C;  2YWA A;  3NMK A;  4O7G A;  2JPU A;  2R7T A;  1OKK A;  3T9O A;  1N1C A;  3U9J A;  3POV A;  2R7R A;  3SEO A;  1NU9 C;  1Z23 A;  2ZXP A;  3A9C A;  2KNH A;  4FX5 A;  3Q6M A;  4IJJ A;  4NCQ A;  4Z9H A;  3U9M A;  1LKX A;  2HJM A;  4YJW A;  2DB4 A;  3AG1 C;  3LS0 A;  4AL1 A;  3ABM C;  2ZXR A;  4UDV A;  1MMD A;  3GEH A;  2QY9 A;  4ZLC A;  4PJN A;  3ITF A;  1ORS C;  1G4W R;  1K04 A;  1Y6D A;  3LS1 A;  2EIK C;  1FMW A;  1AVO B;  5L0H A;  3GOD A;  4CIP A;  2XS1 A;  1D1A A;  4J32 B;  1EKY A;  4U5B E;  4EBB A;  2W4B A;  5JSL A;  2MYS A;  5AC4 A;  1RXQ A;  4ULW A;  1JR8 A;  4IWB A;  1Z63 A;  3AQB A;  3EGX A;  5DS6 A;  4BJT A;  2F22 A;  4D4X A;  1TWC A;  1YYJ A;  3M15 A;  2DYS C;  3KPH A;  5KYY B;  2H8A A;  4O79 A;  3HNK A;  5JP7 A;  1VLS A;  2YHS A;  2EPK X;  3C18 A;  1LI5 A;  3U2M A;  5EK0 A;  3ZTM A;  2LCH A;  1BR4 A;  2YL1 A;  1MMG A;  3WHN A;  4DOZ A;  3FAP B;  4PJL A;  4LDK A;  2LFD A;  4KNW A;  2G3K A;  2GA0 A;  3EFO A;  4U5F E;  3UMK A;  1XZP A;  3EHN A;  5A69 A;  1GGQ A;  1PD1 A;  1TFO B;  3CQZ A;  3TJ5 A;  2IM8 A;  4MW8 A;  4XEK A;  4K7B A;  4GYT A;  5CIV A;  4JTC B;  3S90 A;  4OD5 A;  2M64 A;  3IQC A;  4AK9 A;  4XQ1 A;  2WVN A;  3F47 A;  3DMD A;  3AGT A;  4MVO A;  2P7V A;  3UGP A;  1DOV A;  3LNR A;  4LLE A;  5COG A;  2Y69 C;  3I4U A;  1FNT c;  3GAN A;  3X2Q C;  3DM5 A;  2EIJ C;  5GPG B;  3W2V A;  1EA8 A;  1BR2 A;  1J8Y F;  3K33 A;  4U5C E;  4MVR A;  3N24 A;  1M6T A;  5BUO A;  3AG2 C;  3C63 A;  4CJO A;  1KNY A;  3I5Q A;  1NFN A;  4P6I C;  4DVZ A;  3O10 A;  4JCZ A;  2DYR C;  3EG9 B;  4EUK B;  3UNG C;  1K05 A;  3B0P A;  3U3F A;  5EHH A;  1ORJ A;  2HZ8 A;  2Q4F A;  3NG1 A;  3DI5 A;  4JE9 A;  2HV7 A;  4U9E A;  5KYX B;  1A0B A;  3BEH A;  4NTB A;  1O87 A;  2KJG A;  2NUT B;  3KH2 A;  1H7I A;  4AE4 A;  3N2Z B;  3RQF A;  1YAU O;  2J9B A;  2KQ9 A;  1Q0M A;  2L6G A;  2XLO A;  1OQC A;  3H2U A;  1T5O A;  2XSE A;  2PX0 A;  3K1I C;  1LE4 A;  4JIO A;  5F28 E;  4E0H A;  1HE9 A;  4N6C A;  1Q0F A;  2VH3 A;  3ASO C;  3EZI A;  2ZPA A;  4O6M A;  1MQV A;  4LDR A;  3SZR A;  3U8V A;  2Q7R A;  4HE8 D;  2PBE A;  5B3I A;  1JPN A;  4MTF A;  4U5E E;  2LD6 A;  1VLT A;  3Q6N A;  5B1B C;  5IY5 C;  3US6 A;  1OW8 A;  3W8I A;  1Y4C A;  1ZHY A;  1MMN A;  4XPY A;  1T01 A;  2D4U A;  3HNL A;  1L3P A;  3KKB A;  2R7Q A;  2J45 A;  2WZG A;  1NFO A;  3LNM B;  1ZZP A;  2DGJ A;  5FZT A;  1RKE A;  3DE9 A;  2R02 A;  3S28 A;  4XLN F;  4OIP F;  2R7S A;  2OEV A;  3S9O A;  4I3M A;  1CPQ A;  1LPE A;  4YL1 A;  4ER9 A;  1FFH A;  1EI7 A;  1LE2 A;  5A6B A;  1UG7 A;  2BL2 A;  2KC3 A;  3MBG A;  2WB7 A;  4YL0 A;  3RFY A;  3TK0 A;  4Q5S F;  2J7P D;  3TOL A;  1FAP B;  4ULV A;  3LLI A;  4ZLD A;  1C02 A;  1ZHZ A;  3JTL O;  4LAC B;  1WGW A;  3RKO F;  5L0J A;  3GEI A;  3RVZ A;  4IGG A;  1H9G A;  1VYI A;  2AVK A;  2KSF A;  3ASN C;  3NYL A;  5B1A C;  4OIR F;  2XLE A;  2P0N A;  4G7Z F;  3EGX B;  2EIL C;  4DVY P;  4YL3 A;  2L81 A;  1R4T A;  1Z3I X;  2QTV A;  5DQZ A;  5DS5 A;  1BZ4 A;  3QVZ A;  4AX2 A;  2P61 A;  2J8W A;  4MW3 A;  4R32 A;  1QVX A;  4EHP A;  2G62 A;  3ABL C;  3G50 A;  5BQG A;  2GAQ A;  4MTO A;  3L8J A;  1LM3 B;  2NG1 A;  5L0I A;  3B0U X;  2EIN C;  1V4A A;  4O6N A;  4DRJ B;  3EFO B;  4YK5 A;  1C03 A;  1YZA A;  3AGU A;  4XEF A;  2AP3 A;  4RBN A;  1GM5 A;  1D0Z A;  4BJ6 C;  1ZVZ A;  3EZH A;  1LI7 A;  3JYH A;  1YA9 A;  3AG4 C;  3FAJ A;  3O6X A;  4L6R A;  1G8X A;  3V5X A;  4IB4 A;  4PR9 A;  4H4K C;  2IXN A;  4IAO A;  3UGO A;  2XXA B;  3FDQ A;  1T6I A;  2YLG A;  3T6B A;  1JOG A;  1VOM A;  3C62 A;  4JUR I;  3B0V C;  3SXM A;  3E70 C;  5JUA A;  4PJJ A;  1MND A;  1TR2 A;  3CSK A;  2R7W A;  1C17 M;  4CBE A;  3O55 A;  4BJ5 A;  2UUI A;  2ZXO A;  4BG0 A;  3LEV A;  4C3B A;  2V26 A;  5COM A;  4MS2 A;  2NPU A;  3SXK A;  1HW2 A;  1A7E A;  2YLI A;  1MMA A;  3NYJ A;  2NSF A;  2R7V A;  2R7O A;  3QTH A;  4CIH A;  2VAS A;  2XLM A;  1OKK D;  4C3E A;  5FCL A;  1VTM P;  4K0D A;  3ZG1 A;  2OJQ A;  2XLW A;  1HW1 A;  4I1M A;  4RD9 A;  4WJ0 A;  4CDA A;  4AE4 B;  2BE5 F;  2XLD A;  2YLD A;  1OCR C;  1SR2 A;  2J46 A;  1YDI A;  3NRH A;  5COF A;  1D0X A;  2IXO A;  1T9K A;  3G4Z A;  4O6Y A;  5DS4 A;  3DE8 A;  5HSW A;  4Q4Z F;  3K7D A;  4JKV A;  5E2Q A;  4CS8 C;  1H9T A;  5F5F A;  1NZE A;  2JX0 A;  3A11 A;  5BQI A;  2ZXW C;  1E85 A;  4OD4 A;  2GDC A;  4YT5 A;  4M63 A;  4HFF B;  5JRA A;  4A4A A;  1JPJ A;  5K0I A;  2FAP B;  3PCV A;  4JTD B;  2Z15 A;  4NC3 A;  3L8I A;  2KYH A;  1BBH A;  2NUP A;  2VC9 A;  1V54 C;  1YLM A;  1ZW2 A;  3T6J A;  4OIQ F;  3C8G A;  2CNW A;  2L9J A;  4JW1 A;  3VAY A;  2L6H A;  3U0C A;  2P6V A;  4E7Z A;  3ATP A;  1HMO A;  3M1C B;  4BJ1 A;  4U9D A;  2B0J A;  4DXW A;  5A6A A;  1ZU4 A;  3DD7 A;  1Z7Q c;  4BEM J;  1GQA A;  3J06 A;  2C04 A;  2J9W A;  2YKZ A;  1RKE B;  2XM4 A;  5DLJ A;  4CS8 A;  1F1M A;  3M79 A;  3EH2 A;  1D1B A;  2ZD9 A;  4EWC A;  1UFB A;  1CGN A;  1E84 A;  2H7V C;  3RF3 A;  4LER A;  3SXZ A;  2E87 A;  2OG2 A;  3PDM P;  1OCZ C;  1G5Z A;  3VF0 A;  5JT4 A;  4JVS A;  1OR2 A;  4NTA A;  5T3W A;  2Y39 A;  3L0I A;  2OU6 A;  2CW0 F;  2MWQ A;  5D92 A;  4G7O F;  3OEO A;  2W9Y A;  3FMS A;  3H65 A;  5E3A A;  2XL8 A;  5TJ5 E;  3GWN A;  5EGY A;  2LQG A;  2VB6 A;  1BR1 A;  2OQM A;  5L0G A;  1PCX A;  4HFK B;  3KYJ A;  2QE9 A;  1SZI A;  2Q9C A;  1VK5 A;  2ASR A;  4EBK A;  1NBB A;  1PD0 A;  2J0X A;  1ZW3 A;  1Q0D A;  4NQF A;  5KYU A;  2J9U A;  3TQO A;  3NDB B;  1M2O A;  4C7O A; 
#chains in the Genus database with same CATH homology
 1UFB A;  2HSB A;  3K7D A;  3C18 A;  3GM2 A;  3JZ0 A;  1KNY A;  2JX0 A;  1KTM A;  1OW8 A;  3GM3 A;  3TUL A;  3O10 A;  3AJM A;  1OW6 A;  1PV3 A;  1K05 A;  1O3U A;  2LK4 A;  3B71 A;  4R32 A;  1QVX A;  3U3F A;  1K04 A;  2KK1 A;  3C8G D;  3L8I A;  3BRJ A;  1ZZP A;  1WOL A;  3L8J A;  4XEK A;  3MFN A;  3C8G A;  2L6H A;  3U0C A;  3S9O A;  4EBJ A;  1V4A A;  2L6F A;  3RQF A;  1OW7 A;  3GM1 A;  2L6G A;  2Q00 A;  1WTY A;  3RQG A;  1WWP A;  1K40 A;  4XEF A;  3JYY A;  5F28 E;  4EBK A;  4XEV A;  2YWA A;  2JPU A;  3C8G B;  3RQE A;  4NQF A;  2PBE A;  1JOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...