5F28E

Crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MEF2C
publication title FAK Forms a Complex with MEF2 to Couple Biomechanical Signaling to Transcription in Cardiomyocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
total genus 50
structure length 128
sequence length 128
chains with identical sequence F, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 5f28E00
3GM2A 3JYYA 4XEVA 1PV3A 2YWAA 3RQEA 2JX0A 2Q00A 2JPUA 2L6HA 5F28E 3GM1A 1WTYA 3U3FA 4NQFA 1KNYA 3O10A 4XEKA 1K40A 3GM3A 1QVXA 4R32A 1OW6A 1V4AA 2L6FA 2PBEA 3C18A 1KTMA 2HSBA 3RQGA 3MFNA 1K04A 2L6GA 3U0CA 1WWPA 3TULA 1JOGA 1OW8A 2KK1A 4EBKA 1OW7A 3L8IA 3L8JA 1K05A 1O3UA 3C8GB 3K7DA 2LK4A 3S9OA 4XEFA 4EBJA 3B71A 1UFBA 1ZZPA 3C8GA 3C8GD 3BRJA 1WOLA 3JZ0A 3RQFA 3AJMA
chains in the Genus database with same CATH superfamily
4EIYA 3GM2A 3U5SA 3NYMA 4EWCA 5B3IA 4U5BE 1Z63A 3C7JA 1WN0A 1LS4A 4A2NB 3ZVRA 5L0GA 2ZXRA 3K1IC 4LDKA 2HSQA 2PX3A 2YVKA 4U9DA 4CS9A 1GM5A 3AQBA 1I5NA 1H9TA 2AWCA 5EGYA 1T6IA 2ZXOA 5COFA 4I1MA 3S90A 1Q0KA 3QW0A 3QZCA 4GQHA 1E86A 2HJMA 3DI5A 3N0TA 4PJMA 4W8KA 5KYUA 2LCHA 1WASA 4CSAC 2OKUA 2PX0A 5KYYB 3M1CB 3PDMP 2OQMA 2IM8A 3L0IA 1B68A 1T5OA 3MLGA 2ETSA 2V3CC 1E2XA 2J8WA 2KC3A 2NSFA 3BRJA 4G0HA 4MVRA 3FDQA 3DMDA 4I44A 4JRZA 4LDRA 4RDAA 1ZHXA 2F22A 2R7OA 4JTAB 3UMKA 3IEEA 4XQ1A 5FZTA 1D0YA 3RF3A 4DJ9A 1OXKA 2YRFA 1D0ZA 3QTHA 4XEKA 2DGJA 4WABA 1Y4CA 1J8MF 1OW6A 3HKKA 3ZDLA 1FMWA 3C18A 4AL1A 5A69A 1CPQA 3S29A 2P6VA 1XWJA 4M63A 1ZU4A 5BQHA 1JR8A 1JOGA 3G50A 5L0HA 3LS1A 1OKKA 2R25A 2ZD9A 2R7UA 2W9YA 3JRTA 2CNWA 4X0RA 4FWVA 5JT4A 4G7ZF 4I3MA 1HMDA 2XLDA 5DQZA 5BUOA 2PF4E 2WZFA 3PCVA 4JKVA 4AL0A 4CS8C 4O7GA 4IAQA 2GAQA 4JIOA 3T6BA 3I4UA 1FNTc 1F1MA 2R7XA 4NTFA 3CQZA 3T9OA 1HY5A 2WZGA 4JJGA 4PK4A 1JAFA 2Q4FA 2IOQA 2XLWA 3EH2A 1L3PA 4DVYP 1C03A 1MMAA 1QLEC 1M2OA 2MYSA 4NCQA 5K0IA 4JEAA 3OEOA 1ORSC 1SZIA 5JP7A 4PACA 3T6GB 1MNDA 3FAPB 3S9OA 5DS5A 3LJBA 2XLOA 5L0DA 4QDLA 3FOOA 1HW1A 3ZQYA 2YLDA 4EHPA 1VTMP 3DM9B 3LNRA 3FHDA 2FAPB 3IQTA 4U5CE 5A6BA 2FFHA 4JW1A 4JURI 3TJ5A 4Z9HA 1QSPA 4FAPB 2LQGA 1QQ3A 3U3BA 1MMNA 1TFKB 2VC9A 4EKWA 1A0BA 2WVQA 3K6BA 4DBQA 1JPNA 3WODF 4CJOA 1LKXA 3ZWIA 1TR2A 4MTFA 3Q6NA 2MWQA 3S0XA 3B0UX 4MQ9F 3ABLC 4LERA 2BC5A 3B0PA 1VMAA 5E33A 2OU6A 5E3CA 3DXJF 2EINC 2LFFA 3DJUB 5COGA 5E2QA 2KNHA 2X0CA 3U9MA 2J9WA 1V55C 3RFYA 4U5FE 3RYLA 2A1DD 5B3SC 3S28A 3C8GA 1OCRC 4ER9A 3IHUA 2DB4A 1SR2A 5CIVA 4GYTA 4HFKB 1FFTC 4XPWA 2HMQA 3U2LA 1GGQA 3IPMO 1Z23A 1YVIA 3C8ZA 1OR2A 4JC7A 3US6A 4MVZA 1T6QA 3TJ6A 4YT4A 1R5ID 1SF8A 4CJGA 2EIMC 1BDJB 1J8YF 1HE1A 1VYIA 2P61A 2G3KA 2Y3HA 3DZAA 1W2WA 4IARA 1VK5A 3MFNA 4AX2A 2E87A 1OXBA 3ZC4A 2LSEA 3O39A 2MHRA 1PD0A 3DAGA 3KYIA 4N6CA 2R7TA 2ICWG 1O3UA 2C03A 1C02A 3GWLA 3ZQVA 3C8GB 4U9EA 1N1CA 1YARO 3K7DA 1BR2A 3V5YA 2IYLD 3AGTA 4IRUA 1U0BB 1VOMA 2VCAA 3F47A 3WG7C 3H2VA 4ANJA 4OIPF 2GWWA 2Q9BA 2Y69C 4F4BA 5HSWA 1BR4A 1TWAA 4MVMA 3JSEO 3O55A 1R4TA 2Z15A 3G4ZA 3M4CA 1PD1A 4NQFA 1E84A 1G8XA 3EG9B 2G62A 3K1IA 2P0NA 256BA 1QVXA 3GM3A 2GA0A 4FX5A 2XS8A 2LP4A 3AOUA 5D92A 4E0IA 4G78A 3N2ZB 3NKEA 2YL0A 4IB4A 3DE8A 4KNVA 2RD9A 2M64A 4CDYA 3W8HA 3PHF2 4QI2A 3B9QA 1Q0FA 5B1BC 2EIJC 1K05A 1LI7A 1YAUO 2WVOA 5L0JA 4CSAA 1OQCA 3SEOA 1L7CA 4CIHA 3LAYA 3SZRA 3QMKA 2TMVP 4Q4ZF 2R7SA 4QI0A 4MW3A 1GS9A 3DKAA 2YZSA 3RIPA 2J9VA 3UMIA 1WATA 1ZW3A 5HV9A 2HZ8A 5DVWA 3C62A 5A6BD 2I15A 3RQEA 1ZVZA 1NFOA 2IXPA 1I4YA 1EKYA 3N24A 3G4XA 1NSGB 5F5HA 5L0IA 2EPMX 2Y3GA 2L6FA 4EUKB 4O6NA 1NLXA 4E0HA 2NUPA 3RQGA 3A11A 2XSEA 3FOPA 4C3EA 4K1OA 5KYUB 2YL3A 3FMSA 2J0WA 5DLJA 4EBKA 2QTVA 3CZ6A 3ZTZA 1AEPA 2OJED 4C3BA 3GEIA 2O9XA 4JTDB 5JLIA 4B6IA 4UDVA 4O6YA 4G7OF 1M2VA 1OR3A 2LFDA 3NYJA 4NC3A 1UFBA 4WGYA 2OJQA 3CEXA 1XZPA 3VYWA 1G5ZA 1U89A 1YLMA 3C8GD 3ITFA 2CDQA 4OD4A 3JSZA 4EBBA 5B1AC 1VB5A 5JSLA 4CS8A 2ASRA 4JCZA 3HTKC 1C17M 1SMYF 2A0UA 2OEXA 2YEVA 2XL4A 3K33A 3Q7GA 4JEBA 3S27A 4MNDA 1FMVA 4YL0A 2Q7RA 4BJ5C 4PJLA 3SXYA 5FCLA 3J06A 4CS7A 1BBHA 1CGOA 3K66A 1BR1A 4BJ1A 4BEMJ 5DQTA 4D4XA 2I8BA 5AC4A 1TWHA 2BE5F 4J7TA 1FR0A 4MW8A 3MYIA 5AGFA 2DYSC 3W2WA 1LE2A 1M2VB 1TKNA 2KK1A 1OW7A 3GORA 5TJ5E 1GQAA 1S7ZA 2AU5A 3RH3A 1VLTA 3TOMA 1YYXA 2LK4A 4JE9A 4LDQA 5KYXA 1JMWA 3B71A 4L6RA 2EPNA 3EZIA 2KSFA 4O6MA 3HLZA 3UGPA 4AE4A 4BEJA 1Q0GA 2YHSA 2Y3DA 2YL7A 2W4BA 4KBLA 4MVOA 3O6XA 4YL3A 2KQ9A 4U5HA 1U6HA 1Z5ZA 3MX3A 1NZEA 3ASOC 1LIHA 3NMIA 4YT5A 3A9CA 3NRHA 3S84A 5F28E 5T3WA 1FFHA 3T6JA 1WTYA 2L81A 2XL6A 1CPRA 2IBFA 1WGWA 1YYJA 2M4EA 3Q6MA 4XLNF 3U9JA 4C3DA 3M4BA 2DYRC 2Q9AA 2YL1A 2J9UA 1H6GA 1RJ9A 3M79A 2VASA 4DVZA 1G4WR 4K7BA 2XLEA 2L7AA 3AG3C 3QVZA 4IJJA 3ATPA 1QZXA 4OINF 3B29A 4H54A 3V7OA 3DD7A 4OIQF 1DOWA 3DWWA 4XPYA 4NTAA 2YQYA 2UUIA 4DRHB 4E17A 1D1CA 2XM0A 4WJ0A 2EPOA 3JYYA 1E85A 1Q0DA 1RKEA 2OOCA 2OG2A 3L1MA 2Q00A 1AUEA 2OCCC 3QVYA 2W4MA 3IQ6A 5CI9A 4BG0A 3GEEA 1ORJA 3GM1A 4D4NA 1S05A 2FGYA 3KYJA 1VYKA 3SXZA 4IAOA 5A6KA 3SXKA 3Q7LA 5KYNA 1KTMA 2R03A 1NU9C 4Z9IA 3AG2C 3EHMA 2NUTA 4FESA 1LVKA 4KNWA 1ZHZA 2XL8A 1RXQA 4HE8D 5A6JA 1V54C 3OWTA 3RVZA 3H65A 3U8PA 3DAFA 3L8JA 1Y6DA 1YJGA 1ZHWA 2WZLA 5T1DB 5COMA 1MNEA 1ZW2A 4XLPF 2L9JA 2BL2A 3EGDA 3SNHA 1H7IA 4CBEA 5AC5A 4YWQA 2R7RA 2NPUA 2C04A 2WVNA 1LS1A 1RKEB 2HKVA 3LS0A 4DRIB 3JZ0A 2AVKA 3K1HA 4CIPA 3RQFA 4CDVA 5L3VA 2J7PA 1T01A 3HNKA 4JZAA 4CX9A 2YWAA 2QUPA 3CSKA 4HEAJ 3W2VA 2EPKX 1T6UA 3FAJA 3CAXA 2P7VA 3GEHA 3OA1A 3U3FA 4DRJB 2NUTB 2OEVA 3O10A 3NMJA 1FAPB 1K40A 1D1AA 4O79A 5BQIA 3JYHA 3LUTB 2R05A 1SYQA 4N6HA 4IGGA 2L6GA 5EK0A 3U8VA 3KL4A 3U0CA 4G7HF 2ZXPA 1LPEA 2H8AA 1OCZC 3EGDB 1A7VA 4E18A 1M57C 3TULA 1TFOB 4MVQA 5JS5A 1OCOC 4J30B 3IQCA 3HNIA 1RMVA 5DS6A 1RCPA 4Q7CA 2KJGA 1NFNA 2B0JA 3NG1A 4BJ6C 1T9KA 2PFDA 3V5ZA 5KYYA 3NMKA 1VLSA 2A6EF 4NY3A 4CDAA 3E70C 5T3TA 1RKCA 4ONSA 1Z6AA 4I1OB 1HE9A 3VM6A 4P9FA 4PJJA 2X51A 3IQ5A 1A7DA 5E3AA 2JPUA 2G3VA 4J7YA 3VRCA 3H2UA 1ORYA 2CYDA 3F46A 4YN0B 3VF0A 3TOLA 3ZTMA 3PMRA 2KW3C 5KYWB 1ZYRF 1NBBA 2PBEA 4CS9C 3AQCA 2HFIA 3KH2A 2HUJA 3LLKA 1BZ4A 1QKRA 4U5EE 3ABMC 5A6AA 4N06A 3ZSUA 1E83A 1LM3B 1JPJA 1EQ1A 1AVOB 2XS1A 4LLEA 3HNJA 3SYNA 3ZG1A 2IXOA 2XM4A 2R7VA 4GEHA 4ZLDA 2CCYA 5JVEA 2ZXWC 3FXHA 4W8PA 3KKBA 3MBGA 2R7QA 2YKZA 4XEFA 4YJWA 2VCBA 2R7WA 4N4WA 2HV7A 2NG1A 1WOLA 2J45A 4HFFB 2Q9CA 2H7VC 3QW1A 1A7EA 1M6TA 3KMIA 4MTOA 2A6HF 4P9TA 4ZLCA 2H7OA 3L34A 3RVYA 2JX0A 1KU2A 3EHNA 5CI8A 2Y39A 4ULVA 2NSGA 5KYWA 5JRAA 2CW0F 2H7BA 3SXMA 3V5XA 2CGEA 3HNLA 2NUPB 1PCXA 2QY9A 2QLAA 1A41A 3E9VA 2Y3BA 3WHNA 2HS5A 3ZIBA 3LLIA 2HSBA 3I5QA 2RSEB 3C63A 2J0XA 4OD5A 4OIOF 4MVUA 3KPHA 4KI2A 5JUAA 1NG1A 3UMHA 1I4ZA 4BJTA 3EH1A 1IZMA 1D1BA 3JT1A 1MQVA 4PJNA 3UNGC 2HV6A 3EPVA 3UR3C 3B0VC 1LE4A 3BEHA 2IXNA 2R02A 1LI5A 3RKOF 2A69F 1ZZPA 2HMZA 4MVSA 1EA8A 1FTSA 3JRMO 2LD6A 3AG4C 3AG1C 3EQLF 2WL8A 3MYFA 4H4KC 2PP4A 3T4RA 4JJFA 1DOVA 2J7PD 3TD7A 4YT8A 2YLGA 3GODA 1UG7A 3NDBB 4Z9JA 3NYLA 3X2QC 3R7CA 2GDCA 5GPGB 1ZU5A 5L0FA 3EGXA 3U2MA 1CGME 4WGZA 2D4UA 2VB6A 2VH3A 5BQGA 2XLVA 1ZHYA 1HMOA 4RD9A 4A4AA 3EFOA 4E7ZA 4Q5SF 1WWPA 5D91A 1YA7O 3R2PA 4C7OA 1D0XA 4JCHA 4U5DE 3I5PA 2V26A 4XWJA 2D5RB 4KC9A 5KYXB 2IXMA 3FVYA 3JCUQ 2GFHA 3RW0A 4OIRF 4DOZA 4AE4B 2VCCA 2R9RB 1G4US 4EBJA 3LEVA 4ULWA 3NKDA 3M15A 1MMDA 2A68F 3LESA 1O5HA 5F5FA 3DJNB 4NTBA 1YDIA 3AJMA 3HJCA 4J32B 2JD3A 3EGXB 4LACB 5DS4A 4MTGA 1ZHTA 4BJ5A 2KGOA 4K0DA 3EZHA 2XLMA 3W8IA 2QNLA 1KNYA 1O87A 1RJ9B 3ASNC 2EPLX 3EFOB 3ABKC 3GANA 4AK9A 4C7OB 3W4YA 1K04A 5L0CA 3LNMB 1H9GA 4LLCA 4MS2A 2Q3TA 1OW8A 1Q0MA 3ECSA 4PFOA 4JTCB 4E7SA 1TWGA 2ZPAA 4BPMA 1TQGA 1TWCA 2XLHA 2EIKC 5EHHA 3DM5A 3VAYA 4JVSA 4DBRA 4XPXA 3JTLO 3L8IA 1MMGA 4YT2A 1CGNA 3EJNA 3GWNA 4PR9A 3POVA 4XEVA 5IY5C 2XXAA 5L3QA 1PV3A 1M56C 1QPUA 2YLIA 1V74B 2L6HA 3DE9A 4XTKA 3X1OA 4PFPA 4U5GA 4YL1A 2EILC 2HJ3A 2XRHA 1JRAA 4R32A 4RBNA 1V4AA 1IW7F 2DI3A 3EG9A 2KYHA 1Z7Qc 1YZCA 1YZAA 3TQOA 3SP1A 1YA9A 3AGUA 1XZQA 3UGOA 1OKKD 1NU7D 2AWYA 1ST6A 2A0BA 3LEOA 1Z3IX 2QE9A 2W45A 4YK5A 1HW2A 2B0HA 1OCCC 2CNWD 2WB7A 4IWBA 4BJ6A 2AP3A 4DXWA 4P6IC 2J46A 2XXAB 3WAQA 2UUHA 1EI7A 3TK0A 1APCA 2LIGA 2P1AA 2PNOA 2J9BA
chains in the Genus database with same CATH topology
3GM2A 3JYYA 4XEVA 1PV3A 2YWAA 3RQEA 2JX0A 2Q00A 2JPUA 2L6HA 5F28E 3GM1A 1WTYA 3U3FA 4NQFA 1KNYA 3O10A 4XEKA 1K40A 3GM3A 1QVXA 4R32A 1OW6A 1V4AA 2L6FA 2PBEA 3C18A 1KTMA 2HSBA 3RQGA 3MFNA 1K04A 2L6GA 3U0CA 1WWPA 3TULA 1JOGA 1OW8A 2KK1A 4EBKA 1OW7A 3L8IA 3L8JA 1K05A 1O3UA 3C8GB 3K7DA 2LK4A 3S9OA 4XEFA 4EBJA 3B71A 1UFBA 1ZZPA 3C8GA 3C8GD 3BRJA 1WOLA 3JZ0A 3RQFA 3AJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GM2 A;  3JYY A;  4XEV A;  1PV3 A;  2YWA A;  3RQE A;  2JX0 A;  2Q00 A;  2JPU A;  2L6H A;  5F28 E;  3GM1 A;  1WTY A;  3U3F A;  4NQF A;  1KNY A;  3O10 A;  4XEK A;  1K40 A;  3GM3 A;  1QVX A;  4R32 A;  1OW6 A;  1V4A A;  2L6F A;  2PBE A;  3C18 A;  1KTM A;  2HSB A;  3RQG A;  3MFN A;  1K04 A;  2L6G A;  3U0C A;  1WWP A;  3TUL A;  1JOG A;  1OW8 A;  2KK1 A;  4EBK A;  1OW7 A;  3L8I A;  3L8J A;  1K05 A;  1O3U A;  3C8G B;  3K7D A;  2LK4 A;  3S9O A;  4XEF A;  4EBJ A;  3B71 A;  1UFB A;  1ZZP A;  3C8G A;  3C8G D;  3BRJ A;  1WOL A;  3JZ0 A;  3RQF A;  3AJM A; 
#chains in the Genus database with same CATH topology
 4EIY A;  3GM2 A;  3U5S A;  3NYM A;  4EWC A;  5B3I A;  4U5B E;  1Z63 A;  3C7J A;  1WN0 A;  1LS4 A;  4A2N B;  3ZVR A;  5L0G A;  2ZXR A;  3K1I C;  4LDK A;  2HSQ A;  2PX3 A;  2YVK A;  4U9D A;  4CS9 A;  1GM5 A;  3AQB A;  1I5N A;  1H9T A;  2AWC A;  5EGY A;  1T6I A;  2ZXO A;  5COF A;  4I1M A;  3S90 A;  1Q0K A;  3QW0 A;  3QZC A;  4GQH A;  1E86 A;  2HJM A;  3DI5 A;  3N0T A;  4PJM A;  4W8K A;  5KYU A;  2LCH A;  1WAS A;  4CSA C;  2OKU A;  2PX0 A;  5KYY B;  3M1C B;  3PDM P;  2OQM A;  2IM8 A;  3L0I A;  1B68 A;  1T5O A;  3MLG A;  2ETS A;  2V3C C;  1E2X A;  2J8W A;  2KC3 A;  2NSF A;  3BRJ A;  4G0H A;  4MVR A;  3FDQ A;  3DMD A;  4I44 A;  4JRZ A;  4LDR A;  4RDA A;  1ZHX A;  2F22 A;  2R7O A;  4JTA B;  3UMK A;  3IEE A;  4XQ1 A;  5FZT A;  1D0Y A;  3RF3 A;  4DJ9 A;  1OXK A;  2YRF A;  1D0Z A;  3QTH A;  4XEK A;  2DGJ A;  4WAB A;  1Y4C A;  1J8M F;  1OW6 A;  3HKK A;  3ZDL A;  1FMW A;  3C18 A;  4AL1 A;  5A69 A;  1CPQ A;  3S29 A;  2P6V A;  1XWJ A;  4M63 A;  1ZU4 A;  5BQH A;  1JR8 A;  1JOG A;  3G50 A;  5L0H A;  3LS1 A;  1OKK A;  2R25 A;  2ZD9 A;  2R7U A;  2W9Y A;  3JRT A;  2CNW A;  4X0R A;  4FWV A;  5JT4 A;  4G7Z F;  4I3M A;  1HMD A;  2XLD A;  5DQZ A;  5BUO A;  2PF4 E;  2WZF A;  3PCV A;  4JKV A;  4AL0 A;  4CS8 C;  4O7G A;  4IAQ A;  2GAQ A;  4JIO A;  3T6B A;  3I4U A;  1FNT c;  1F1M A;  2R7X A;  4NTF A;  3CQZ A;  3T9O A;  1HY5 A;  2WZG A;  4JJG A;  4PK4 A;  1JAF A;  2Q4F A;  2IOQ A;  2XLW A;  3EH2 A;  1L3P A;  4DVY P;  1C03 A;  1MMA A;  1QLE C;  1M2O A;  2MYS A;  4NCQ A;  5K0I A;  4JEA A;  3OEO A;  1ORS C;  1SZI A;  5JP7 A;  4PAC A;  3T6G B;  1MND A;  3FAP B;  3S9O A;  5DS5 A;  3LJB A;  2XLO A;  5L0D A;  4QDL A;  3FOO A;  1HW1 A;  3ZQY A;  2YLD A;  4EHP A;  1VTM P;  3DM9 B;  3LNR A;  3FHD A;  2FAP B;  3IQT A;  4U5C E;  5A6B A;  2FFH A;  4JW1 A;  4JUR I;  3TJ5 A;  4Z9H A;  1QSP A;  4FAP B;  2LQG A;  1QQ3 A;  3U3B A;  1MMN A;  1TFK B;  2VC9 A;  4EKW A;  1A0B A;  2WVQ A;  3K6B A;  4DBQ A;  1JPN A;  3WOD F;  4CJO A;  1LKX A;  3ZWI A;  1TR2 A;  4MTF A;  3Q6N A;  2MWQ A;  3S0X A;  3B0U X;  4MQ9 F;  3ABL C;  4LER A;  2BC5 A;  3B0P A;  1VMA A;  5E33 A;  2OU6 A;  5E3C A;  3DXJ F;  2EIN C;  2LFF A;  3DJU B;  5COG A;  5E2Q A;  2KNH A;  2X0C A;  3U9M A;  2J9W A;  1V55 C;  3RFY A;  4U5F E;  3RYL A;  2A1D D;  5B3S C;  3S28 A;  3C8G A;  1OCR C;  4ER9 A;  3IHU A;  2DB4 A;  1SR2 A;  5CIV A;  4GYT A;  4HFK B;  1FFT C;  4XPW A;  2HMQ A;  3U2L A;  1GGQ A;  3IPM O;  1Z23 A;  1YVI A;  3C8Z A;  1OR2 A;  4JC7 A;  3US6 A;  4MVZ A;  1T6Q A;  3TJ6 A;  4YT4 A;  1R5I D;  1SF8 A;  4CJG A;  2EIM C;  1BDJ B;  1J8Y F;  1HE1 A;  1VYI A;  2P61 A;  2G3K A;  2Y3H A;  3DZA A;  1W2W A;  4IAR A;  1VK5 A;  3MFN A;  4AX2 A;  2E87 A;  1OXB A;  3ZC4 A;  2LSE A;  3O39 A;  2MHR A;  1PD0 A;  3DAG A;  3KYI A;  4N6C A;  2R7T A;  2ICW G;  1O3U A;  2C03 A;  1C02 A;  3GWL A;  3ZQV A;  3C8G B;  4U9E A;  1N1C A;  1YAR O;  3K7D A;  1BR2 A;  3V5Y A;  2IYL D;  3AGT A;  4IRU A;  1U0B B;  1VOM A;  2VCA A;  3F47 A;  3WG7 C;  3H2V A;  4ANJ A;  4OIP F;  2GWW A;  2Q9B A;  2Y69 C;  4F4B A;  5HSW A;  1BR4 A;  1TWA A;  4MVM A;  3JSE O;  3O55 A;  1R4T A;  2Z15 A;  3G4Z A;  3M4C A;  1PD1 A;  4NQF A;  1E84 A;  1G8X A;  3EG9 B;  2G62 A;  3K1I A;  2P0N A;  256B A;  1QVX A;  3GM3 A;  2GA0 A;  4FX5 A;  2XS8 A;  2LP4 A;  3AOU A;  5D92 A;  4E0I A;  4G78 A;  3N2Z B;  3NKE A;  2YL0 A;  4IB4 A;  3DE8 A;  4KNV A;  2RD9 A;  2M64 A;  4CDY A;  3W8H A;  3PHF 2;  4QI2 A;  3B9Q A;  1Q0F A;  5B1B C;  2EIJ C;  1K05 A;  1LI7 A;  1YAU O;  2WVO A;  5L0J A;  4CSA A;  1OQC A;  3SEO A;  1L7C A;  4CIH A;  3LAY A;  3SZR A;  3QMK A;  2TMV P;  4Q4Z F;  2R7S A;  4QI0 A;  4MW3 A;  1GS9 A;  3DKA A;  2YZS A;  3RIP A;  2J9V A;  3UMI A;  1WAT A;  1ZW3 A;  5HV9 A;  2HZ8 A;  5DVW A;  3C62 A;  5A6B D;  2I15 A;  3RQE A;  1ZVZ A;  1NFO A;  2IXP A;  1I4Y A;  1EKY A;  3N24 A;  3G4X A;  1NSG B;  5F5H A;  5L0I A;  2EPM X;  2Y3G A;  2L6F A;  4EUK B;  4O6N A;  1NLX A;  4E0H A;  2NUP A;  3RQG A;  3A11 A;  2XSE A;  3FOP A;  4C3E A;  4K1O A;  5KYU B;  2YL3 A;  3FMS A;  2J0W A;  5DLJ A;  4EBK A;  2QTV A;  3CZ6 A;  3ZTZ A;  1AEP A;  2OJE D;  4C3B A;  3GEI A;  2O9X A;  4JTD B;  5JLI A;  4B6I A;  4UDV A;  4O6Y A;  4G7O F;  1M2V A;  1OR3 A;  2LFD A;  3NYJ A;  4NC3 A;  1UFB A;  4WGY A;  2OJQ A;  3CEX A;  1XZP A;  3VYW A;  1G5Z A;  1U89 A;  1YLM A;  3C8G D;  3ITF A;  2CDQ A;  4OD4 A;  3JSZ A;  4EBB A;  5B1A C;  1VB5 A;  5JSL A;  4CS8 A;  2ASR A;  4JCZ A;  3HTK C;  1C17 M;  1SMY F;  2A0U A;  2OEX A;  2YEV A;  2XL4 A;  3K33 A;  3Q7G A;  4JEB A;  3S27 A;  4MND A;  1FMV A;  4YL0 A;  2Q7R A;  4BJ5 C;  4PJL A;  3SXY A;  5FCL A;  3J06 A;  4CS7 A;  1BBH A;  1CGO A;  3K66 A;  1BR1 A;  4BJ1 A;  4BEM J;  5DQT A;  4D4X A;  2I8B A;  5AC4 A;  1TWH A;  2BE5 F;  4J7T A;  1FR0 A;  4MW8 A;  3MYI A;  5AGF A;  2DYS C;  3W2W A;  1LE2 A;  1M2V B;  1TKN A;  2KK1 A;  1OW7 A;  3GOR A;  5TJ5 E;  1GQA A;  1S7Z A;  2AU5 A;  3RH3 A;  1VLT A;  3TOM A;  1YYX A;  2LK4 A;  4JE9 A;  4LDQ A;  5KYX A;  1JMW A;  3B71 A;  4L6R A;  2EPN A;  3EZI A;  2KSF A;  4O6M A;  3HLZ A;  3UGP A;  4AE4 A;  4BEJ A;  1Q0G A;  2YHS A;  2Y3D A;  2YL7 A;  2W4B A;  4KBL A;  4MVO A;  3O6X A;  4YL3 A;  2KQ9 A;  4U5H A;  1U6H A;  1Z5Z A;  3MX3 A;  1NZE A;  3ASO C;  1LIH A;  3NMI A;  4YT5 A;  3A9C A;  3NRH A;  3S84 A;  5F28 E;  5T3W A;  1FFH A;  3T6J A;  1WTY A;  2L81 A;  2XL6 A;  1CPR A;  2IBF A;  1WGW A;  1YYJ A;  2M4E A;  3Q6M A;  4XLN F;  3U9J A;  4C3D A;  3M4B A;  2DYR C;  2Q9A A;  2YL1 A;  2J9U A;  1H6G A;  1RJ9 A;  3M79 A;  2VAS A;  4DVZ A;  1G4W R;  4K7B A;  2XLE A;  2L7A A;  3AG3 C;  3QVZ A;  4IJJ A;  3ATP A;  1QZX A;  4OIN F;  3B29 A;  4H54 A;  3V7O A;  3DD7 A;  4OIQ F;  1DOW A;  3DWW A;  4XPY A;  4NTA A;  2YQY A;  2UUI A;  4DRH B;  4E17 A;  1D1C A;  2XM0 A;  4WJ0 A;  2EPO A;  3JYY A;  1E85 A;  1Q0D A;  1RKE A;  2OOC A;  2OG2 A;  3L1M A;  2Q00 A;  1AUE A;  2OCC C;  3QVY A;  2W4M A;  3IQ6 A;  5CI9 A;  4BG0 A;  3GEE A;  1ORJ A;  3GM1 A;  4D4N A;  1S05 A;  2FGY A;  3KYJ A;  1VYK A;  3SXZ A;  4IAO A;  5A6K A;  3SXK A;  3Q7L A;  5KYN A;  1KTM A;  2R03 A;  1NU9 C;  4Z9I A;  3AG2 C;  3EHM A;  2NUT A;  4FES A;  1LVK A;  4KNW A;  1ZHZ A;  2XL8 A;  1RXQ A;  4HE8 D;  5A6J A;  1V54 C;  3OWT A;  3RVZ A;  3H65 A;  3U8P A;  3DAF A;  3L8J A;  1Y6D A;  1YJG A;  1ZHW A;  2WZL A;  5T1D B;  5COM A;  1MNE A;  1ZW2 A;  4XLP F;  2L9J A;  2BL2 A;  3EGD A;  3SNH A;  1H7I A;  4CBE A;  5AC5 A;  4YWQ A;  2R7R A;  2NPU A;  2C04 A;  2WVN A;  1LS1 A;  1RKE B;  2HKV A;  3LS0 A;  4DRI B;  3JZ0 A;  2AVK A;  3K1H A;  4CIP A;  3RQF A;  4CDV A;  5L3V A;  2J7P A;  1T01 A;  3HNK A;  4JZA A;  4CX9 A;  2YWA A;  2QUP A;  3CSK A;  4HEA J;  3W2V A;  2EPK X;  1T6U A;  3FAJ A;  3CAX A;  2P7V A;  3GEH A;  3OA1 A;  3U3F A;  4DRJ B;  2NUT B;  2OEV A;  3O10 A;  3NMJ A;  1FAP B;  1K40 A;  1D1A A;  4O79 A;  5BQI A;  3JYH A;  3LUT B;  2R05 A;  1SYQ A;  4N6H A;  4IGG A;  2L6G A;  5EK0 A;  3U8V A;  3KL4 A;  3U0C A;  4G7H F;  2ZXP A;  1LPE A;  2H8A A;  1OCZ C;  3EGD B;  1A7V A;  4E18 A;  1M57 C;  3TUL A;  1TFO B;  4MVQ A;  5JS5 A;  1OCO C;  4J30 B;  3IQC A;  3HNI A;  1RMV A;  5DS6 A;  1RCP A;  4Q7C A;  2KJG A;  1NFN A;  2B0J A;  3NG1 A;  4BJ6 C;  1T9K A;  2PFD A;  3V5Z A;  5KYY A;  3NMK A;  1VLS A;  2A6E F;  4NY3 A;  4CDA A;  3E70 C;  5T3T A;  1RKC A;  4ONS A;  1Z6A A;  4I1O B;  1HE9 A;  3VM6 A;  4P9F A;  4PJJ A;  2X51 A;  3IQ5 A;  1A7D A;  5E3A A;  2JPU A;  2G3V A;  4J7Y A;  3VRC A;  3H2U A;  1ORY A;  2CYD A;  3F46 A;  4YN0 B;  3VF0 A;  3TOL A;  3ZTM A;  3PMR A;  2KW3 C;  5KYW B;  1ZYR F;  1NBB A;  2PBE A;  4CS9 C;  3AQC A;  2HFI A;  3KH2 A;  2HUJ A;  3LLK A;  1BZ4 A;  1QKR A;  4U5E E;  3ABM C;  5A6A A;  4N06 A;  3ZSU A;  1E83 A;  1LM3 B;  1JPJ A;  1EQ1 A;  1AVO B;  2XS1 A;  4LLE A;  3HNJ A;  3SYN A;  3ZG1 A;  2IXO A;  2XM4 A;  2R7V A;  4GEH A;  4ZLD A;  2CCY A;  5JVE A;  2ZXW C;  3FXH A;  4W8P A;  3KKB A;  3MBG A;  2R7Q A;  2YKZ A;  4XEF A;  4YJW A;  2VCB A;  2R7W A;  4N4W A;  2HV7 A;  2NG1 A;  1WOL A;  2J45 A;  4HFF B;  2Q9C A;  2H7V C;  3QW1 A;  1A7E A;  1M6T A;  3KMI A;  4MTO A;  2A6H F;  4P9T A;  4ZLC A;  2H7O A;  3L34 A;  3RVY A;  2JX0 A;  1KU2 A;  3EHN A;  5CI8 A;  2Y39 A;  4ULV A;  2NSG A;  5KYW A;  5JRA A;  2CW0 F;  2H7B A;  3SXM A;  3V5X A;  2CGE A;  3HNL A;  2NUP B;  1PCX A;  2QY9 A;  2QLA A;  1A41 A;  3E9V A;  2Y3B A;  3WHN A;  2HS5 A;  3ZIB A;  3LLI A;  2HSB A;  3I5Q A;  2RSE B;  3C63 A;  2J0X A;  4OD5 A;  4OIO F;  4MVU A;  3KPH A;  4KI2 A;  5JUA A;  1NG1 A;  3UMH A;  1I4Z A;  4BJT A;  3EH1 A;  1IZM A;  1D1B A;  3JT1 A;  1MQV A;  4PJN A;  3UNG C;  2HV6 A;  3EPV A;  3UR3 C;  3B0V C;  1LE4 A;  3BEH A;  2IXN A;  2R02 A;  1LI5 A;  3RKO F;  2A69 F;  1ZZP A;  2HMZ A;  4MVS A;  1EA8 A;  1FTS A;  3JRM O;  2LD6 A;  3AG4 C;  3AG1 C;  3EQL F;  2WL8 A;  3MYF A;  4H4K C;  2PP4 A;  3T4R A;  4JJF A;  1DOV A;  2J7P D;  3TD7 A;  4YT8 A;  2YLG A;  3GOD A;  1UG7 A;  3NDB B;  4Z9J A;  3NYL A;  3X2Q C;  3R7C A;  2GDC A;  5GPG B;  1ZU5 A;  5L0F A;  3EGX A;  3U2M A;  1CGM E;  4WGZ A;  2D4U A;  2VB6 A;  2VH3 A;  5BQG A;  2XLV A;  1ZHY A;  1HMO A;  4RD9 A;  4A4A A;  3EFO A;  4E7Z A;  4Q5S F;  1WWP A;  5D91 A;  1YA7 O;  3R2P A;  4C7O A;  1D0X A;  4JCH A;  4U5D E;  3I5P A;  2V26 A;  4XWJ A;  2D5R B;  4KC9 A;  5KYX B;  2IXM A;  3FVY A;  3JCU Q;  2GFH A;  3RW0 A;  4OIR F;  4DOZ A;  4AE4 B;  2VCC A;  2R9R B;  1G4U S;  4EBJ A;  3LEV A;  4ULW A;  3NKD A;  3M15 A;  1MMD A;  2A68 F;  3LES A;  1O5H A;  5F5F A;  3DJN B;  4NTB A;  1YDI A;  3AJM A;  3HJC A;  4J32 B;  2JD3 A;  3EGX B;  4LAC B;  5DS4 A;  4MTG A;  1ZHT A;  4BJ5 A;  2KGO A;  4K0D A;  3EZH A;  2XLM A;  3W8I A;  2QNL A;  1KNY A;  1O87 A;  1RJ9 B;  3ASN C;  2EPL X;  3EFO B;  3ABK C;  3GAN A;  4AK9 A;  4C7O B;  3W4Y A;  1K04 A;  5L0C A;  3LNM B;  1H9G A;  4LLC A;  4MS2 A;  2Q3T A;  1OW8 A;  1Q0M A;  3ECS A;  4PFO A;  4JTC B;  4E7S A;  1TWG A;  2ZPA A;  4BPM A;  1TQG A;  1TWC A;  2XLH A;  2EIK C;  5EHH A;  3DM5 A;  3VAY A;  4JVS A;  4DBR A;  4XPX A;  3JTL O;  3L8I A;  1MMG A;  4YT2 A;  1CGN A;  3EJN A;  3GWN A;  4PR9 A;  3POV A;  4XEV A;  5IY5 C;  2XXA A;  5L3Q A;  1PV3 A;  1M56 C;  1QPU A;  2YLI A;  1V74 B;  2L6H A;  3DE9 A;  4XTK A;  3X1O A;  4PFP A;  4U5G A;  4YL1 A;  2EIL C;  2HJ3 A;  2XRH A;  1JRA A;  4R32 A;  4RBN A;  1V4A A;  1IW7 F;  2DI3 A;  3EG9 A;  2KYH A;  1Z7Q c;  1YZC A;  1YZA A;  3TQO A;  3SP1 A;  1YA9 A;  3AGU A;  1XZQ A;  3UGO A;  1OKK D;  1NU7 D;  2AWY A;  1ST6 A;  2A0B A;  3LEO A;  1Z3I X;  2QE9 A;  2W45 A;  4YK5 A;  1HW2 A;  2B0H A;  1OCC C;  2CNW D;  2WB7 A;  4IWB A;  4BJ6 A;  2AP3 A;  4DXW A;  4P6I C;  2J46 A;  2XXA B;  3WAQ A;  2UUH A;  1EI7 A;  3TK0 A;  1APC A;  2LIG A;  2P1A A;  2PNO A;  2J9B A; 
#chains in the Genus database with same CATH homology
 3GM2 A;  3JYY A;  4XEV A;  1PV3 A;  2YWA A;  3RQE A;  2JX0 A;  2Q00 A;  2JPU A;  2L6H A;  5F28 E;  3GM1 A;  1WTY A;  3U3F A;  4NQF A;  1KNY A;  3O10 A;  4XEK A;  1K40 A;  3GM3 A;  1QVX A;  4R32 A;  1OW6 A;  1V4A A;  2L6F A;  2PBE A;  3C18 A;  1KTM A;  2HSB A;  3RQG A;  3MFN A;  1K04 A;  2L6G A;  3U0C A;  1WWP A;  3TUL A;  1JOG A;  1OW8 A;  2KK1 A;  4EBK A;  1OW7 A;  3L8I A;  3L8J A;  1K05 A;  1O3U A;  3C8G B;  3K7D A;  2LK4 A;  3S9O A;  4XEF A;  4EBJ A;  3B71 A;  1UFB A;  1ZZP A;  3C8G A;  3C8G D;  3BRJ A;  1WOL A;  3JZ0 A;  3RQF A;  3AJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...