5F28E

Crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription, protein binding
molecule keywords MEF2C
publication title FAK Forms a Complex with MEF2 to Couple Biomechanical Signaling to Transcription in Cardiomyocytes.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 128
sequence length 128
chains with identical sequence F, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 5f28E00
1UFBA 2Q00A 4XEKA 1PV3A 2YWAA 3RQEA 3AJMA 1WOLA 2L6GA 1O3UA 4XEVA 3O10A 3RQFA 3C18A 3C8GB 4NQFA 4EBJA 3MFNA 3L8IA 3GM1A 2L6HA 1V4AA 1KTMA 2L6FA 3GM2A 1WTYA 3S9OA 3U3FA 1OW6A 3C8GA 2PBEA 3B71A 1KNYA 1K05A 1OW8A 1WWPA 2HSBA 1K40A 5F28E 1OW7A 3RQGA 3C8GD 3GM3A 2KK1A 2LK4A 1K04A 3U0CA 1QVXA 1ZZPA 4XEFA 3L8JA 1JOGA 4R32A 3BRJA 4EBKA 3K7DA 3JYYA 3TULA 2JX0A 2JPUA 3JZ0A
chains in the Genus database with same CATH superfamily
1A0BA 2J9WA 1OCRC 3NMJA 2EIKC 3AGTA 3KL4A 1Z63A 1MMGA 2QLAA 2Y69C 5AGFA 2AU5A 2J45A 3JSEO 3DAFA 3C8GB 3HTKC 4U9EA 5EGYA 3FOPA 1ZW3A 4H4KC 1OQCA 1H7IA 2OU6A 3KYJA 4I1OB 4YT2A 1OXKA 1NU9C 2HJ3A 1MMNA 1SR2A 1G8XA 2NSGA 2Z15A 2R9RB 1RMVA 4MQ9F 4N6CA 4PR9A 5JSLA 2QY9A 2AP3A 3VAYA 4AL1A 1WASA 3M15A 3V5ZA 2IOQA 2WB7A 2NPUA 4YL1A 3JRMO 1APCA 1HMOA 1K04A 1ZW2A 2XL4A 1T6QA 5E3AA 3L8JA 2D4UA 2XL8A 3Q7LA 4ULVA 2HJMA 2A0BA 1VLTA 4NC3A 2YQYA 1FTSA 4JTCB 1YARO 1BR2A 1LS4A 1GGQA 1UFBA 3AGUA 4OIOF 4O6YA 2HKVA 3CQZA 2L6GA 4NTAA 3TD7A 3O10A 1NFNA 2CNWD 2PX0A 5KYXB 2ICWG 3B9QA 5KYYB 3MBGA 3L8IA 2VB6A 4DXWA 4IRUA 4BPMA 5KYUB 3FOOA 3NYLA 3DKAA 4LERA 4ANJA 4EUKB 2A68F 2I8BA 3U3FA 5L3QA 3ZSUA 1QQ3A 2NUPA 1IW7F 1L7CA 1OW8A 1T5OA 1VYIA 4A2NB 1FR0A 3B29A 4KNWA 4C7OB 4HFFB 1AUEA 3DM9B 1RKCA 2ZXPA 3RYLA 4CSAC 3UGOA 1JRAA 1A41A 4EKWA 3SZRA 1S7ZA 1VMAA 3JRTA 4M63A 2KQ9A 3U0CA 2WL8A 3RKOF 2MHRA 1HMDA 2MYSA 2HV7A 1TWGA 2IBFA 2P6VA 2PF4E 3FAJA 4W8PA 3TOMA 2D5RB 1D0XA 2EPKX 4JEAA 4P9TA 1ZYRF 2OJED 1QKRA 3JSZA 4X0RA 3LLKA 4C3BA 3GM1A 3U9MA 3VYWA 5EHHA 3F47A 1VYKA 2CW0F 1SMYF 3IQCA 3JCUQ 5JRAA 2QTVA 1VTMP 2NUTB 1E84A 1I4YA 3NKDA 1AEPA 4G78A 3T9OA 2XRHA 2Q9BA 1LM3B 3RW0A 3S84A 2WZFA 1FNTc 3E70C 3GWLA 4N6HA 3BRJA 3HNLA 3UMIA 1ORYA 1PD1A 2EIMC 1QPUA 5A69A 1NG1A 2XLOA 3C8ZA 1G4US 3I4UA 4B6IA 1LI5A 1NBBA 2FGYA 2Q9CA 2XLWA 1WOLA 2ZXRA 3AJMA 3AQCA 4JE9A 4DOZA 3C18A 2R03A 1KU2A 1SYQA 2GFHA 4J7YA 4XPXA 5DVWA 4BJ6A 4MVRA 4D4XA 3ASOC 1OR3A 1ZHTA 3ABKC 3C62A 4LLEA 3RF3A 2HZ8A 3NKEA 3IQ6A 3OA1A 1U0BB 3EZIA 3ZDLA 4CDVA 1FMWA 5DLJA 5E2QA 2XXAA 1KNYA 1TWAA 2XS8A 4U5HA 3RVZA 3EG9A 4BEJA 4IB4A 3LEOA 2RSEB 2XM4A 2KJGA 5HSWA 3GM3A 4YK5A 2XM0A 2ASRA 2H7BA 3EGXA 1ZU5A 3S90A 3G4ZA 3I5QA 4E7SA 1QZXA 4XQ1A 2IYLD 3T6JA 4PK4A 3EH1A 3V7OA 1QSPA 2W9YA 2Y3DA 1TFKB 4I44A 4PJMA 3LS0A 1YZCA 3RQEA 4XEVA 4JTDB 1O3UA 2EPOA 3V5YA 3DZAA 4CS9A 2Q3TA 3U8PA 4OD5A 4NQFA 4EBJA 2HUJA 2NUPB 2G3KA 2HV6A 4GEHA 4CS8A 1E86A 2OQMA 1T01A 3PHF2 3MLGA 1YLMA 2WVOA 3MYFA 1T6UA 1WTYA 4AK9A 5BQIA 2P61A 2PBEA 2R02A 2CCYA 4XPWA 4OIRF 1CPQA 2I15A 5AC4A 3LJBA 3NRHA 3N0TA 1RKEA 3EZHA 4CIHA 3PCVA 1ORJA 3GEIA 1EA8A 3H2UA 3NG1A 2L81A 2V26A 2VCBA 4YJWA 2OOCA 2PNOA 3C63A 3AOUA 5COGA 4U5FE 3Q6NA 4EBKA 5JT4A 3X1OA 2J0XA 3G4XA 1NLXA 2A6HF 3EH2A 3JZ0A 3LLIA 5COFA 4CX9A 3LUTB 4N06A 5L0GA 2YWAA 4P6IC 3J06A 3SXKA 5DS4A 1Z6AA 2WVQA 1M57C 3T6GB 1MNEA 3I5PA 4FWVA 3RFYA 3POVA 3CZ6A 2J9UA 5DS5A 3IHUA 3BEHA 4IAOA 4J30B 1E2XA 1BBHA 4JVSA 1D0YA 2OG2A 2A6EF 3HNKA 1M6TA 1Q0GA 1K05A 1ZVZA 2J0WA 2VC9A 3L1MA 3QMKA 5BQHA 2E87A 2QNLA 2CDQA 2JD3A 3C8GD 4WGYA 4U5BE 4JJFA 2Q4FA 2UUIA 5E3CA 1D0ZA 1DOVA 1I4ZA 3DAGA 2C04A 3JYYA 2OCCC 3Q7GA 1C02A 4LDKA 4XPYA 3SYNA 3U3BA 1T9KA 3JYHA 4DRJB 3ZC4A 2GAQA 4CS7A 1C03A 2H7VC 1FAPB 5DQZA 5JP7A 1YAUO 2OEVA 5JLIA 2XXAB 1C17M 2QUPA 3EG9B 2YVKA 5L0IA 3U8VA 2LIGA 1HW2A 3EGXB 1TWCA 1B68A 2A69F 2H8AA 3Q6MA 4ONSA 1Z23A 4HFKB 2P7VA 5F5FA 4U5EE 4Z9HA 3HJCA 1T6IA 2XS1A 2DYRC 3ITFA 4O6MA 2FAPB 5T1DB 3CAXA 1ZHZA 1XZQA 2J7PA 1YYXA 1JPNA 3FMSA 4K0DA 4NCQA 2PP4A 1CGME 2HMQA 4BJTA 5E33A 2R7WA 2JX0A 5F5HA 4ZLCA 2R05A 4LDQA 2VCAA 3EJNA 1QLEC 1J8YF 3GEHA 4IARA 4FX5A 1DOWA 2OJQA 1RCPA 1YA7O 3DXJF 4JJGA 1H9GA 3EGDA 1CPRA 5FCLA 1O87A 4U5GA 4E17A 3S29A 5EK0A 1RKEB 2KW3C 3ABLC 2YL0A 4CDYA 1NU7D 3DMDA 4W8KA 2R7TA 1WGWA 1OW6A 4YN0B 2IM8A 2M64A 1MNDA 2MWQA 3O55A 4NTFA 4YT4A 4Q4ZF 2B0HA 4YT5A 1FFTC 1M56C 4JRZA 1M2VA 1R4TA 1S05A 2KK1A 1NZEA 4F4BA 2YL1A 1HW1A 4YL0A 1JR8A 3R7CA 1JOGA 4R32A 3ZTZA 3K6BA 4I3MA 1GM5A 1OXBA 5DQTA 2HSQA 3GODA 1XWJA 3H65A 4N4WA 1D1AA 3N2ZB 2KGOA 2R7XA 1U89A 3F46A 4CIPA 4MTOA 1LVKA 3IEEA 2YKZA 5B1BC 3SXMA 4MVMA 1NFOA 1CGNA 2CGEA 2EPMX 3M4CA 3FAPB 4OD4A 4L6RA 3ZQYA 5L0HA 2B0JA 3JTLO 5BQGA 4JCHA 1O5HA 2TMVP 4C7OA 5CI8A 1HY5A 4AX2A 2YL7A 1H6GA 1WWPA 3FVYA 1TKNA 3RQGA 2L9JA 5CIVA 2GA0A 3U2LA 1LIHA 3O6XA 1RXQA 3VF0A 4DVYP 5DS6A 1SZIA 1MQVA 1E85A 1JAFA 3FXHA 4XEFA 2Y3GA 3DJNB 1CGOA 2LFDA 1V55C 2CNWA 4JKVA 2Y3HA 5A6BD 1TR2A 4MS2A 4P9FA 1F1MA 4AE4A 3KMIA 3M4BA 1LE4A 2R7OA 4PFOA 3U5SA 4BG0A 1ST6A 2DI3A 1LE2A 4O7GA 4PFPA 3EHMA 3UR3C 2R7UA 5D91A 2ZPAA 3GEEA 4CJOA 3KKBA 1V74B 5L0JA 5IY5C 4DRIB 1KTMA 3HKKA 4NY3A 2NG1A 3QW0A 2XLEA 3UNGC 4E7ZA 4G0HA 4LDRA 2GDCA 1HE1A 5A6AA 3VM6A 2LP4A 3L0IA 2W4MA 2EILC 2W4BA 2R7QA 3CEXA 3RVYA 4BJ1A 3S0XA 3KH2A 3WODF 1TFOB 1YZAA 2FFHA 2HMZA 2KNHA 3DM5A 4QDLA 1A7EA 2YZSA 3ZVRA 4JEBA 4Z9IA 4YWQA 1BDJB 4XLPF 3T6BA 2LD6A 3S27A 3TULA 3EGDB 3W2WA 1AVOB 3K1HA 3W8IA 3LNRA 4JC7A 4ULWA 4IJJA 4GQHA 4PACA 1YA9A 4J7TA 3DJUB 3O39A 4IGGA 3PDMP 3L34A 1WATA 3W4YA 3GM2A 1JPJA 1RJ9A 4PJLA 3WHNA 1M2VB 4E0HA 5JS5A 2ZD9A 4EWCA 2WZGA 1ZHWA 4WGZA 1ORSC 4XLNF 4CS9C 3K1IC 5B3IA 2QE9A 4KI2A 3W8HA 2PX3A 1Q0MA 4MTFA 4BJ5C 1YYJA 4CS8C 3HNJA 4MVOA 3FDQA 1LPEA 1ZHYA 4A4AA 3DE8A 3DD7A 4G7ZF 4H54A 1MMAA 2VASA 1OCOC 1Y4CA 3SNHA 2L7AA 3IQTA 4MVSA 3AG2C 2YL3A 2X0CA 3U2MA 1V54C 2WZLA 5HV9A 1OCCC 1Q0KA 2EPNA 2YEVA 4EHPA 4LLCA 4ER9A 2BC5A 4UDVA 3UGPA 2J46A 2LQGA 3OWTA 3RIPA 3OEOA 4Q7CA 5L3VA 4G7HF 3NDBB 4G7OF 1IZMA 5A6JA 4CSAA 1R5ID 1A7VA 4WABA 3T4RA 5FZTA 4JW1A 3C7JA 5T3WA 2P1AA 256BA 3LS1A 1WN0A 1Y6DA 3HLZA 3SEOA 1OW7A 2XLMA 4K7BA 5A6BA 4PJJA 4AE4B 3EFOA 3EPVA 3JT1A 4IWBA 1YVIA 4KC9A 3WAQA 1EKYA 3M79A 3AQBA 1UG7A 3TOLA 3NYMA 4J32B 3KYIA 4XTKA 3ZG1A 4E0IA 4Q5SF 1VK5A 2H7OA 2Q9AA 4HEAJ 1EI7A 2KC3A 3EHNA 4U5CE 2XL6A 3ASNC 4I1MA 5T3TA 1JMWA 1YDIA 3KPHA 2AVKA 4C3DA 3TK0A 1Q0DA 3RQFA 2Y3BA 1NSGB 2DYSC 3E9VA 4WJ0A 5KYWA 4RDAA 3QW1A 4QI0A 3V5XA 2EIJC 2R7SA 4RD9A 1G5ZA 1V4AA 2LCHA 2L6FA 3LESA 2F22A 1Z5ZA 3X2QC 4OIPF 1FFHA 5B1AC 4FAPB 2Y39A 3IQ5A 3PMRA 3CSKA 4BEMJ 2O9XA 2HSBA 3B0UX 3U9JA 4XWJA 2IXOA 4O6NA 2WVNA 4NTBA 1GS9A 4YL3A 5AC5A 2XLDA 3LNMB 1PCXA 3SXYA 5JVEA 3AG1C 2OKUA 2IXMA 2UUHA 2IXNA 2JPUA 1OKKD 2M4EA 3SP1A 2YLGA 4O79A 5A6KA 3QZCA 5JUAA 3IPMO 2G62A 5B3SC 2P0NA 4MVZA 1D1BA 4ZLDA 1RJ9B 1FMVA 2G3VA 3QVYA 4OIQF 2EPLX 2PFDA 3ZIBA 2ZXOA 5BUOA 3MFNA 5L0CA 1TQGA 4YT8A 4D4NA 5TJ5E 1XZPA 2A1DD 4MNDA 2GWWA 2YLIA 4MTGA 1E83A 3QVZA 3K66A 3C8GA 3LAYA 1M2OA 4QI2A 2XLHA 1K40A 4IAQA 4JURI 4MVUA 1Z3IX 1PD0A 5CI9A 2V3CC 1BR4A 2LFFA 1J8MF 3DE9A 2YLDA 4CDAA 2ZXWC 3ZTMA 4C3EA 1TWHA 1QVXA 2Q7RA 3ZWIA 1W2WA 3UMHA 4DBQA 5L0DA 2ETSA 3GANA 3A11A 2YHSA 4RBNA 2VCCA 5K0IA 1BZ4A 3B0PA 4MW3A 1D1CA 2AWYA 2Q00A 3EQLF 1U6HA 1LI7A 1PV3A 2EINC 4AL0A 4DJ9A 2R25A 1G4WR 3FHDA 2KYHA 3MYIA 4FESA 3W2VA 3K33A 1HE9A 4U5DE 4JZAA 1A7DA 4GYTA 3AG3C 2AWCA 4LACB 3N24A 4U9DA 4MW8A 3QTHA 4Z9JA 3S9OA 5KYXA 3SXZA 3EFOB 3ZQVA 2OEXA 3TJ6A 5KYYA 2C03A 3B71A 2J9BA 4K1OA 3ABMC 5KYNA 3UMKA 1ZHXA 4MVQA 1L3PA 5KYUA 3TJ5A 4BJ6C 4DRHB 3VRCA 3M1CB 2BL2A 2J8WA 2X51A 3MX3A 2XLVA 1OR2A 3A9CA 1MMDA 3GWNA 3HNIA 3K7DA 3DI5A 1I5NA 2NSFA 5KYWB 1ZU4A 2J7PD 1LKXA 3B0VC 3RH3A 3R2PA 5L0FA 2J9VA 4XEKA 2IXPA 3NMKA 3K1IA 1Z7Qc 4DVZA 2R7RA 1SF8A 2CYDA 3LEVA 3GORA 1LS1A 2KSFA 4KBLA 4BJ5A 4EBBA 3NYJA 4EIYA 4CJGA 3S28A 2L6HA 1OCZC 2W45A 4DBRA 5D92A 2HS5A 3DWWA 4E18A 1VLSA 5COMA 3TQOA 3ECSA 2R7VA 1VOMA 2LSEA 2YRFA 3AG4C 3US6A 1Q0FA 1BR1A 4CBEA 3H2VA 1GQAA 2VH3A 4KNVA 4JCZA 3NMIA 4PJNA 3G50A 5F28E 3WG7C 2XSEA 2DGJA 4JIOA 1OKKA 1VB5A 2LK4A 4JTAB 1H9TA 4HE8D 1ZZPA 2A0UA 1EQ1A 2RD9A 2BE5F 2DB4A 2HFIA 2NUTA 4OINF 1N1CA 1YJGA 3ATPA 5GPGB
chains in the Genus database with same CATH topology
1UFBA 2Q00A 4XEKA 1PV3A 2YWAA 3RQEA 3AJMA 1WOLA 2L6GA 1O3UA 4XEVA 3O10A 3RQFA 3C18A 3C8GB 4NQFA 4EBJA 3MFNA 3L8IA 3GM1A 2L6HA 1V4AA 1KTMA 2L6FA 3GM2A 1WTYA 3S9OA 3U3FA 1OW6A 3C8GA 2PBEA 3B71A 1KNYA 1K05A 1OW8A 1WWPA 2HSBA 1K40A 5F28E 1OW7A 3RQGA 3C8GD 3GM3A 2KK1A 2LK4A 1K04A 3U0CA 1QVXA 1ZZPA 4XEFA 3L8JA 1JOGA 4R32A 3BRJA 4EBKA 3K7DA 3JYYA 3TULA 2JX0A 2JPUA 3JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  2Q00 A;  4XEK A;  1PV3 A;  2YWA A;  3RQE A;  3AJM A;  1WOL A;  2L6G A;  1O3U A;  4XEV A;  3O10 A;  3RQF A;  3C18 A;  3C8G B;  4NQF A;  4EBJ A;  3MFN A;  3L8I A;  3GM1 A;  2L6H A;  1V4A A;  1KTM A;  2L6F A;  3GM2 A;  1WTY A;  3S9O A;  3U3F A;  1OW6 A;  3C8G A;  2PBE A;  3B71 A;  1KNY A;  1K05 A;  1OW8 A;  1WWP A;  2HSB A;  1K40 A;  5F28 E;  1OW7 A;  3RQG A;  3C8G D;  3GM3 A;  2KK1 A;  2LK4 A;  1K04 A;  3U0C A;  1QVX A;  1ZZP A;  4XEF A;  3L8J A;  1JOG A;  4R32 A;  3BRJ A;  4EBK A;  3K7D A;  3JYY A;  3TUL A;  2JX0 A;  2JPU A;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 1A0B A;  2J9W A;  1OCR C;  3NMJ A;  2EIK C;  3AGT A;  3KL4 A;  1Z63 A;  1MMG A;  2QLA A;  2Y69 C;  5AGF A;  2AU5 A;  2J45 A;  3JSE O;  3DAF A;  3C8G B;  3HTK C;  4U9E A;  5EGY A;  3FOP A;  1ZW3 A;  4H4K C;  1OQC A;  1H7I A;  2OU6 A;  3KYJ A;  4I1O B;  4YT2 A;  1OXK A;  1NU9 C;  2HJ3 A;  1MMN A;  1SR2 A;  1G8X A;  2NSG A;  2Z15 A;  2R9R B;  1RMV A;  4MQ9 F;  4N6C A;  4PR9 A;  5JSL A;  2QY9 A;  2AP3 A;  3VAY A;  4AL1 A;  1WAS A;  3M15 A;  3V5Z A;  2IOQ A;  2WB7 A;  2NPU A;  4YL1 A;  3JRM O;  1APC A;  1HMO A;  1K04 A;  1ZW2 A;  2XL4 A;  1T6Q A;  5E3A A;  3L8J A;  2D4U A;  2XL8 A;  3Q7L A;  4ULV A;  2HJM A;  2A0B A;  1VLT A;  4NC3 A;  2YQY A;  1FTS A;  4JTC B;  1YAR O;  1BR2 A;  1LS4 A;  1GGQ A;  1UFB A;  3AGU A;  4OIO F;  4O6Y A;  2HKV A;  3CQZ A;  2L6G A;  4NTA A;  3TD7 A;  3O10 A;  1NFN A;  2CNW D;  2PX0 A;  5KYX B;  2ICW G;  3B9Q A;  5KYY B;  3MBG A;  3L8I A;  2VB6 A;  4DXW A;  4IRU A;  4BPM A;  5KYU B;  3FOO A;  3NYL A;  3DKA A;  4LER A;  4ANJ A;  4EUK B;  2A68 F;  2I8B A;  3U3F A;  5L3Q A;  3ZSU A;  1QQ3 A;  2NUP A;  1IW7 F;  1L7C A;  1OW8 A;  1T5O A;  1VYI A;  4A2N B;  1FR0 A;  3B29 A;  4KNW A;  4C7O B;  4HFF B;  1AUE A;  3DM9 B;  1RKC A;  2ZXP A;  3RYL A;  4CSA C;  3UGO A;  1JRA A;  1A41 A;  4EKW A;  3SZR A;  1S7Z A;  1VMA A;  3JRT A;  4M63 A;  2KQ9 A;  3U0C A;  2WL8 A;  3RKO F;  2MHR A;  1HMD A;  2MYS A;  2HV7 A;  1TWG A;  2IBF A;  2P6V A;  2PF4 E;  3FAJ A;  4W8P A;  3TOM A;  2D5R B;  1D0X A;  2EPK X;  4JEA A;  4P9T A;  1ZYR F;  2OJE D;  1QKR A;  3JSZ A;  4X0R A;  3LLK A;  4C3B A;  3GM1 A;  3U9M A;  3VYW A;  5EHH A;  3F47 A;  1VYK A;  2CW0 F;  1SMY F;  3IQC A;  3JCU Q;  5JRA A;  2QTV A;  1VTM P;  2NUT B;  1E84 A;  1I4Y A;  3NKD A;  1AEP A;  4G78 A;  3T9O A;  2XRH A;  2Q9B A;  1LM3 B;  3RW0 A;  3S84 A;  2WZF A;  1FNT c;  3E70 C;  3GWL A;  4N6H A;  3BRJ A;  3HNL A;  3UMI A;  1ORY A;  1PD1 A;  2EIM C;  1QPU A;  5A69 A;  1NG1 A;  2XLO A;  3C8Z A;  1G4U S;  3I4U A;  4B6I A;  1LI5 A;  1NBB A;  2FGY A;  2Q9C A;  2XLW A;  1WOL A;  2ZXR A;  3AJM A;  3AQC A;  4JE9 A;  4DOZ A;  3C18 A;  2R03 A;  1KU2 A;  1SYQ A;  2GFH A;  4J7Y A;  4XPX A;  5DVW A;  4BJ6 A;  4MVR A;  4D4X A;  3ASO C;  1OR3 A;  1ZHT A;  3ABK C;  3C62 A;  4LLE A;  3RF3 A;  2HZ8 A;  3NKE A;  3IQ6 A;  3OA1 A;  1U0B B;  3EZI A;  3ZDL A;  4CDV A;  1FMW A;  5DLJ A;  5E2Q A;  2XXA A;  1KNY A;  1TWA A;  2XS8 A;  4U5H A;  3RVZ A;  3EG9 A;  4BEJ A;  4IB4 A;  3LEO A;  2RSE B;  2XM4 A;  2KJG A;  5HSW A;  3GM3 A;  4YK5 A;  2XM0 A;  2ASR A;  2H7B A;  3EGX A;  1ZU5 A;  3S90 A;  3G4Z A;  3I5Q A;  4E7S A;  1QZX A;  4XQ1 A;  2IYL D;  3T6J A;  4PK4 A;  3EH1 A;  3V7O A;  1QSP A;  2W9Y A;  2Y3D A;  1TFK B;  4I44 A;  4PJM A;  3LS0 A;  1YZC A;  3RQE A;  4XEV A;  4JTD B;  1O3U A;  2EPO A;  3V5Y A;  3DZA A;  4CS9 A;  2Q3T A;  3U8P A;  4OD5 A;  4NQF A;  4EBJ A;  2HUJ A;  2NUP B;  2G3K A;  2HV6 A;  4GEH A;  4CS8 A;  1E86 A;  2OQM A;  1T01 A;  3PHF 2;  3MLG A;  1YLM A;  2WVO A;  3MYF A;  1T6U A;  1WTY A;  4AK9 A;  5BQI A;  2P61 A;  2PBE A;  2R02 A;  2CCY A;  4XPW A;  4OIR F;  1CPQ A;  2I15 A;  5AC4 A;  3LJB A;  3NRH A;  3N0T A;  1RKE A;  3EZH A;  4CIH A;  3PCV A;  1ORJ A;  3GEI A;  1EA8 A;  3H2U A;  3NG1 A;  2L81 A;  2V26 A;  2VCB A;  4YJW A;  2OOC A;  2PNO A;  3C63 A;  3AOU A;  5COG A;  4U5F E;  3Q6N A;  4EBK A;  5JT4 A;  3X1O A;  2J0X A;  3G4X A;  1NLX A;  2A6H F;  3EH2 A;  3JZ0 A;  3LLI A;  5COF A;  4CX9 A;  3LUT B;  4N06 A;  5L0G A;  2YWA A;  4P6I C;  3J06 A;  3SXK A;  5DS4 A;  1Z6A A;  2WVQ A;  1M57 C;  3T6G B;  1MNE A;  3I5P A;  4FWV A;  3RFY A;  3POV A;  3CZ6 A;  2J9U A;  5DS5 A;  3IHU A;  3BEH A;  4IAO A;  4J30 B;  1E2X A;  1BBH A;  4JVS A;  1D0Y A;  2OG2 A;  2A6E F;  3HNK A;  1M6T A;  1Q0G A;  1K05 A;  1ZVZ A;  2J0W A;  2VC9 A;  3L1M A;  3QMK A;  5BQH A;  2E87 A;  2QNL A;  2CDQ A;  2JD3 A;  3C8G D;  4WGY A;  4U5B E;  4JJF A;  2Q4F A;  2UUI A;  5E3C A;  1D0Z A;  1DOV A;  1I4Z A;  3DAG A;  2C04 A;  3JYY A;  2OCC C;  3Q7G A;  1C02 A;  4LDK A;  4XPY A;  3SYN A;  3U3B A;  1T9K A;  3JYH A;  4DRJ B;  3ZC4 A;  2GAQ A;  4CS7 A;  1C03 A;  2H7V C;  1FAP B;  5DQZ A;  5JP7 A;  1YAU O;  2OEV A;  5JLI A;  2XXA B;  1C17 M;  2QUP A;  3EG9 B;  2YVK A;  5L0I A;  3U8V A;  2LIG A;  1HW2 A;  3EGX B;  1TWC A;  1B68 A;  2A69 F;  2H8A A;  3Q6M A;  4ONS A;  1Z23 A;  4HFK B;  2P7V A;  5F5F A;  4U5E E;  4Z9H A;  3HJC A;  1T6I A;  2XS1 A;  2DYR C;  3ITF A;  4O6M A;  2FAP B;  5T1D B;  3CAX A;  1ZHZ A;  1XZQ A;  2J7P A;  1YYX A;  1JPN A;  3FMS A;  4K0D A;  4NCQ A;  2PP4 A;  1CGM E;  2HMQ A;  4BJT A;  5E33 A;  2R7W A;  2JX0 A;  5F5H A;  4ZLC A;  2R05 A;  4LDQ A;  2VCA A;  3EJN A;  1QLE C;  1J8Y F;  3GEH A;  4IAR A;  4FX5 A;  1DOW A;  2OJQ A;  1RCP A;  1YA7 O;  3DXJ F;  4JJG A;  1H9G A;  3EGD A;  1CPR A;  5FCL A;  1O87 A;  4U5G A;  4E17 A;  3S29 A;  5EK0 A;  1RKE B;  2KW3 C;  3ABL C;  2YL0 A;  4CDY A;  1NU7 D;  3DMD A;  4W8K A;  2R7T A;  1WGW A;  1OW6 A;  4YN0 B;  2IM8 A;  2M64 A;  1MND A;  2MWQ A;  3O55 A;  4NTF A;  4YT4 A;  4Q4Z F;  2B0H A;  4YT5 A;  1FFT C;  1M56 C;  4JRZ A;  1M2V A;  1R4T A;  1S05 A;  2KK1 A;  1NZE A;  4F4B A;  2YL1 A;  1HW1 A;  4YL0 A;  1JR8 A;  3R7C A;  1JOG A;  4R32 A;  3ZTZ A;  3K6B A;  4I3M A;  1GM5 A;  1OXB A;  5DQT A;  2HSQ A;  3GOD A;  1XWJ A;  3H65 A;  4N4W A;  1D1A A;  3N2Z B;  2KGO A;  2R7X A;  1U89 A;  3F46 A;  4CIP A;  4MTO A;  1LVK A;  3IEE A;  2YKZ A;  5B1B C;  3SXM A;  4MVM A;  1NFO A;  1CGN A;  2CGE A;  2EPM X;  3M4C A;  3FAP B;  4OD4 A;  4L6R A;  3ZQY A;  5L0H A;  2B0J A;  3JTL O;  5BQG A;  4JCH A;  1O5H A;  2TMV P;  4C7O A;  5CI8 A;  1HY5 A;  4AX2 A;  2YL7 A;  1H6G A;  1WWP A;  3FVY A;  1TKN A;  3RQG A;  2L9J A;  5CIV A;  2GA0 A;  3U2L A;  1LIH A;  3O6X A;  1RXQ A;  3VF0 A;  4DVY P;  5DS6 A;  1SZI A;  1MQV A;  1E85 A;  1JAF A;  3FXH A;  4XEF A;  2Y3G A;  3DJN B;  1CGO A;  2LFD A;  1V55 C;  2CNW A;  4JKV A;  2Y3H A;  5A6B D;  1TR2 A;  4MS2 A;  4P9F A;  1F1M A;  4AE4 A;  3KMI A;  3M4B A;  1LE4 A;  2R7O A;  4PFO A;  3U5S A;  4BG0 A;  1ST6 A;  2DI3 A;  1LE2 A;  4O7G A;  4PFP A;  3EHM A;  3UR3 C;  2R7U A;  5D91 A;  2ZPA A;  3GEE A;  4CJO A;  3KKB A;  1V74 B;  5L0J A;  5IY5 C;  4DRI B;  1KTM A;  3HKK A;  4NY3 A;  2NG1 A;  3QW0 A;  2XLE A;  3UNG C;  4E7Z A;  4G0H A;  4LDR A;  2GDC A;  1HE1 A;  5A6A A;  3VM6 A;  2LP4 A;  3L0I A;  2W4M A;  2EIL C;  2W4B A;  2R7Q A;  3CEX A;  3RVY A;  4BJ1 A;  3S0X A;  3KH2 A;  3WOD F;  1TFO B;  1YZA A;  2FFH A;  2HMZ A;  2KNH A;  3DM5 A;  4QDL A;  1A7E A;  2YZS A;  3ZVR A;  4JEB A;  4Z9I A;  4YWQ A;  1BDJ B;  4XLP F;  3T6B A;  2LD6 A;  3S27 A;  3TUL A;  3EGD B;  3W2W A;  1AVO B;  3K1H A;  3W8I A;  3LNR A;  4JC7 A;  4ULW A;  4IJJ A;  4GQH A;  4PAC A;  1YA9 A;  4J7T A;  3DJU B;  3O39 A;  4IGG A;  3PDM P;  3L34 A;  1WAT A;  3W4Y A;  3GM2 A;  1JPJ A;  1RJ9 A;  4PJL A;  3WHN A;  1M2V B;  4E0H A;  5JS5 A;  2ZD9 A;  4EWC A;  2WZG A;  1ZHW A;  4WGZ A;  1ORS C;  4XLN F;  4CS9 C;  3K1I C;  5B3I A;  2QE9 A;  4KI2 A;  3W8H A;  2PX3 A;  1Q0M A;  4MTF A;  4BJ5 C;  1YYJ A;  4CS8 C;  3HNJ A;  4MVO A;  3FDQ A;  1LPE A;  1ZHY A;  4A4A A;  3DE8 A;  3DD7 A;  4G7Z F;  4H54 A;  1MMA A;  2VAS A;  1OCO C;  1Y4C A;  3SNH A;  2L7A A;  3IQT A;  4MVS A;  3AG2 C;  2YL3 A;  2X0C A;  3U2M A;  1V54 C;  2WZL A;  5HV9 A;  1OCC C;  1Q0K A;  2EPN A;  2YEV A;  4EHP A;  4LLC A;  4ER9 A;  2BC5 A;  4UDV A;  3UGP A;  2J46 A;  2LQG A;  3OWT A;  3RIP A;  3OEO A;  4Q7C A;  5L3V A;  4G7H F;  3NDB B;  4G7O F;  1IZM A;  5A6J A;  4CSA A;  1R5I D;  1A7V A;  4WAB A;  3T4R A;  5FZT A;  4JW1 A;  3C7J A;  5T3W A;  2P1A A;  256B A;  3LS1 A;  1WN0 A;  1Y6D A;  3HLZ A;  3SEO A;  1OW7 A;  2XLM A;  4K7B A;  5A6B A;  4PJJ A;  4AE4 B;  3EFO A;  3EPV A;  3JT1 A;  4IWB A;  1YVI A;  4KC9 A;  3WAQ A;  1EKY A;  3M79 A;  3AQB A;  1UG7 A;  3TOL A;  3NYM A;  4J32 B;  3KYI A;  4XTK A;  3ZG1 A;  4E0I A;  4Q5S F;  1VK5 A;  2H7O A;  2Q9A A;  4HEA J;  1EI7 A;  2KC3 A;  3EHN A;  4U5C E;  2XL6 A;  3ASN C;  4I1M A;  5T3T A;  1JMW A;  1YDI A;  3KPH A;  2AVK A;  4C3D A;  3TK0 A;  1Q0D A;  3RQF A;  2Y3B A;  1NSG B;  2DYS C;  3E9V A;  4WJ0 A;  5KYW A;  4RDA A;  3QW1 A;  4QI0 A;  3V5X A;  2EIJ C;  2R7S A;  4RD9 A;  1G5Z A;  1V4A A;  2LCH A;  2L6F A;  3LES A;  2F22 A;  1Z5Z A;  3X2Q C;  4OIP F;  1FFH A;  5B1A C;  4FAP B;  2Y39 A;  3IQ5 A;  3PMR A;  3CSK A;  4BEM J;  2O9X A;  2HSB A;  3B0U X;  3U9J A;  4XWJ A;  2IXO A;  4O6N A;  2WVN A;  4NTB A;  1GS9 A;  4YL3 A;  5AC5 A;  2XLD A;  3LNM B;  1PCX A;  3SXY A;  5JVE A;  3AG1 C;  2OKU A;  2IXM A;  2UUH A;  2IXN A;  2JPU A;  1OKK D;  2M4E A;  3SP1 A;  2YLG A;  4O79 A;  5A6K A;  3QZC A;  5JUA A;  3IPM O;  2G62 A;  5B3S C;  2P0N A;  4MVZ A;  1D1B A;  4ZLD A;  1RJ9 B;  1FMV A;  2G3V A;  3QVY A;  4OIQ F;  2EPL X;  2PFD A;  3ZIB A;  2ZXO A;  5BUO A;  3MFN A;  5L0C A;  1TQG A;  4YT8 A;  4D4N A;  5TJ5 E;  1XZP A;  2A1D D;  4MND A;  2GWW A;  2YLI A;  4MTG A;  1E83 A;  3QVZ A;  3K66 A;  3C8G A;  3LAY A;  1M2O A;  4QI2 A;  2XLH A;  1K40 A;  4IAQ A;  4JUR I;  4MVU A;  1Z3I X;  1PD0 A;  5CI9 A;  2V3C C;  1BR4 A;  2LFF A;  1J8M F;  3DE9 A;  2YLD A;  4CDA A;  2ZXW C;  3ZTM A;  4C3E A;  1TWH A;  1QVX A;  2Q7R A;  3ZWI A;  1W2W A;  3UMH A;  4DBQ A;  5L0D A;  2ETS A;  3GAN A;  3A11 A;  2YHS A;  4RBN A;  2VCC A;  5K0I A;  1BZ4 A;  3B0P A;  4MW3 A;  1D1C A;  2AWY A;  2Q00 A;  3EQL F;  1U6H A;  1LI7 A;  1PV3 A;  2EIN C;  4AL0 A;  4DJ9 A;  2R25 A;  1G4W R;  3FHD A;  2KYH A;  3MYI A;  4FES A;  3W2V A;  3K33 A;  1HE9 A;  4U5D E;  4JZA A;  1A7D A;  4GYT A;  3AG3 C;  2AWC A;  4LAC B;  3N24 A;  4U9D A;  4MW8 A;  3QTH A;  4Z9J A;  3S9O A;  5KYX A;  3SXZ A;  3EFO B;  3ZQV A;  2OEX A;  3TJ6 A;  5KYY A;  2C03 A;  3B71 A;  2J9B A;  4K1O A;  3ABM C;  5KYN A;  3UMK A;  1ZHX A;  4MVQ A;  1L3P A;  5KYU A;  3TJ5 A;  4BJ6 C;  4DRH B;  3VRC A;  3M1C B;  2BL2 A;  2J8W A;  2X51 A;  3MX3 A;  2XLV A;  1OR2 A;  3A9C A;  1MMD A;  3GWN A;  3HNI A;  3K7D A;  3DI5 A;  1I5N A;  2NSF A;  5KYW B;  1ZU4 A;  2J7P D;  1LKX A;  3B0V C;  3RH3 A;  3R2P A;  5L0F A;  2J9V A;  4XEK A;  2IXP A;  3NMK A;  3K1I A;  1Z7Q c;  4DVZ A;  2R7R A;  1SF8 A;  2CYD A;  3LEV A;  3GOR A;  1LS1 A;  2KSF A;  4KBL A;  4BJ5 A;  4EBB A;  3NYJ A;  4EIY A;  4CJG A;  3S28 A;  2L6H A;  1OCZ C;  2W45 A;  4DBR A;  5D92 A;  2HS5 A;  3DWW A;  4E18 A;  1VLS A;  5COM A;  3TQO A;  3ECS A;  2R7V A;  1VOM A;  2LSE A;  2YRF A;  3AG4 C;  3US6 A;  1Q0F A;  1BR1 A;  4CBE A;  3H2V A;  1GQA A;  2VH3 A;  4KNV A;  4JCZ A;  3NMI A;  4PJN A;  3G50 A;  5F28 E;  3WG7 C;  2XSE A;  2DGJ A;  4JIO A;  1OKK A;  1VB5 A;  2LK4 A;  4JTA B;  1H9T A;  4HE8 D;  1ZZP A;  2A0U A;  1EQ1 A;  2RD9 A;  2BE5 F;  2DB4 A;  2HFI A;  2NUT A;  4OIN F;  1N1C A;  1YJG A;  3ATP A;  5GPG B; 
#chains in the Genus database with same CATH homology
 1UFB A;  2Q00 A;  4XEK A;  1PV3 A;  2YWA A;  3RQE A;  3AJM A;  1WOL A;  2L6G A;  1O3U A;  4XEV A;  3O10 A;  3RQF A;  3C18 A;  3C8G B;  4NQF A;  4EBJ A;  3MFN A;  3L8I A;  3GM1 A;  2L6H A;  1V4A A;  1KTM A;  2L6F A;  3GM2 A;  1WTY A;  3S9O A;  3U3F A;  1OW6 A;  3C8G A;  2PBE A;  3B71 A;  1KNY A;  1K05 A;  1OW8 A;  1WWP A;  2HSB A;  1K40 A;  5F28 E;  1OW7 A;  3RQG A;  3C8G D;  3GM3 A;  2KK1 A;  2LK4 A;  1K04 A;  3U0C A;  1QVX A;  1ZZP A;  4XEF A;  3L8J A;  1JOG A;  4R32 A;  3BRJ A;  4EBK A;  3K7D A;  3JYY A;  3TUL A;  2JX0 A;  2JPU A;  3JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...