5F28E

Crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MEF2C
publication title FAK Forms a Complex with MEF2 to Couple Biomechanical Signaling to Transcription in Cardiomyocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
total genus 50
structure length 128
sequence length 128
chains with identical sequence F, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 5f28E00
1WOLA 2Q00A 3C8GB 3GM1A 3GM3A 1KTMA 1K05A 1WWPA 2YWAA 3BRJA 3GM2A 3L8IA 4EBKA 4XEVA 1V4AA 2JPUA 1WTYA 5F28E 4XEKA 1PV3A 1KNYA 1OW6A 2L6GA 1K04A 1QVXA 1ZZPA 3TULA 3U3FA 3JYYA 3S9OA 1UFBA 2JX0A 4XEFA 3C8GD 3RQFA 4EBJA 1OW7A 2LK4A 3B71A 3JZ0A 3L8JA 4R32A 3O10A 1O3UA 3RQEA 3RQGA 4NQFA 1K40A 2L6HA 2KK1A 3MFNA 2L6FA 3K7DA 2HSBA 3AJMA 2PBEA 1OW8A 3C18A 3C8GA 1JOGA 3U0CA
chains in the Genus database with same CATH superfamily
2HMZA 4U9EA 3C8GB 3KYJA 3C8ZA 2YEVA 1SMYF 3BRJA 4GEHA 5KYXB 3M4BA 3S29A 2EPOA 2IYLD 2NUTB 2VASA 3A9CA 4FWVA 4O79A 4PK4A 1A7DA 3LEOA 1FFHA 1A41A 2Q9AA 1N1CA 1ZW3A 1QVXA 3B0PA 3JTLO 4J30B 3SZRA 3TJ5A 4U5FE 1RKCA 3U9JA 5A6BD 2R7XA 3IQCA 4OD4A 3W8HA 5JLIA 4KI2A 2VH3A 1OR2A 3QTHA 1TR2A 4YJWA 5DQTA 1E83A 3OEOA 1JR8A 1FNTc 4NTAA 1U6HA 4U5DE 1EKYA 2R9RB 4BJTA 4O7GA 3NMKA 1C17M 2G62A 3IHUA 2NG1A 4KBLA 2HSBA 4NTBA 2EPNA 1LIHA 5E3CA 2IXMA 1RJ9A 3V7OA 3GM1A 2ZXPA 4WGYA 4ZLDA 2XLWA 5TJ5E 3L0IA 3U5SA 2AWCA 4PACA 2BL2A 3S28A 2W9YA 1V4AA 3WODF 1WTYA 4Z9HA 5F28E 2IXOA 2WVNA 4XLNF 4MTFA 2V3CC 1SZIA 3ZQVA 2L6GA 3NRHA 5KYYB 2EPLX 1OCOC 1SR2A 2PX0A 1JMWA 3HNJA 4C7OB 2MYSA 1ZHYA 3QVZA 1G8XA 5AC4A 3K1IA 2KQ9A 2XL8A 4XTKA 4DBRA 3IQ6A 3MYFA 5FCLA 3RFYA 4MW8A 2L6HA 3EH1A 3G4XA 3IQTA 3Q6MA 4LERA 3K7DA 3AJMA 3K66A 3ASNC 1FAPB 1LS1A 3EGXB 3OWTA 3SXZA 1ST6A 3DI5A 4WGZA 1U0BB 1TWAA 3H2UA 1WWPA 2P1AA 3FOPA 3L34A 5E2QA 2ZD9A 3UMHA 4PJJA 3ZC4A 4BJ5A 5KYNA 1Z3IX 2QE9A 3MLGA 5A6KA 4DJ9A 1PV3A 3ZIBA 4DVYP 3AG1C 1LE4A 1OW6A 4ULWA 5A6AA 3CAXA 3SNHA 2HJ3A 3H65A 2KNHA 1A7VA 4U5BE 3S9OA 3S84A 2R7VA 3PCVA 3ABMC 3RYLA 4EBJA 2WL8A 2LFFA 4JTAB 2CNWA 2BC5A 2XL4A 3LESA 2M4EA 5BQHA 3IEEA 4MVQA 1V55C 1UG7A 3U8PA 3SXYA 5JRAA 5B3SC 2NSGA 3HKKA 3O55A 2V26A 1L3PA 3ATPA 2R02A 1DOVA 4U5GA 2YL1A 2E87A 4DRIB 1MMGA 3CSKA 4DBQA 4IARA 4WJ0A 4XPXA 3TQOA 2OEXA 4YL1A 2R25A 3TULA 2R03A 4E18A 3DJUB 2M64A 2XS1A 4JJGA 4GQHA 4U5CE 4CS8C 2XSEA 5L0JA 2GAQA 4EWCA 5F5FA 5COFA 3ZTMA 4J7YA 2Y3DA 4DOZA 4CS8A 5JS5A 5F5HA 1B68A 2YZSA 2UUIA 3GODA 4W8KA 3U9MA 4C3DA 5A6JA 2Q4FA 2HKVA 1H9TA 3POVA 3KYIA 2NUPA 3R7CA 4D4NA 1GGQA 3EGDA 2EILC 2GDCA 1K05A 1OCCC 4EBKA 4LLCA 4A4AA 3LLIA 3DM9B 1S05A 3NYMA 3NDBB 4LDQA 1T9KA 4CJOA 4G7HF 1ZHZA 4ONSA 4A2NB 4XPYA 2J46A 2HV6A 3U8VA 3Q7LA 1RKEA 4Z9JA 2DYRC 3KH2A 3B9QA 1FMVA 1EI7A 1K04A 2QLAA 2VCAA 1QQ3A 3EG9A 3GWLA 1Y4CA 3MBGA 3FXHA 4C3EA 1E86A 3I5PA 3X2QC 2D5RB 2ZXWC 3K6BA 1OW7A 3Q7GA 5L0GA 3K1HA 4ZLCA 2XL6A 3QW0A 2P61A 2KYHA 1TWHA 4O6YA 1TWGA 1H6GA 2UUHA 3HNLA 4W8PA 4XPWA 2J0XA 4E0IA 2HV7A 2XRHA 3B29A 3FAPB 4PJLA 4B6IA 2LCHA 5B3IA 3PMRA 3M4CA 2Q00A 1QKRA 1AEPA 3DD7A 4YT4A 5AC5A 3TK0A 3TD7A 4J7TA 4YT8A 1R5ID 3LNRA 4XEVA 3AG3C 3LS0A 4HFFB 3M1CB 3NKEA 4P9FA 3HJCA 3JRMO 1PD1A 2Y3HA 3N2ZB 4JKVA 4MVUA 2CGEA 3E9VA 1A7EA 4OD5A 2WZLA 4LDRA 4E0HA 3EZHA 3U3FA 1SYQA 5L0IA 3DWWA 4IJJA 4YK5A 1AUEA 4OIPF 3VAYA 1LKXA 3AG2C 3DKAA 3UMKA 2AP3A 2LK4A 4G78A 4Z9IA 4ANJA 4CIPA 3QVYA 1LS4A 3RH3A 4PFOA 4DRHB 1C03A 5JVEA 3EHMA 3FMSA 4I3MA 3IPMO 4MTOA 1TKNA 4NQFA 1Z23A 1W2WA 4PJNA 4AL1A 3NYLA 2ZXOA 5DLJA 1HW1A 2ASRA 2LFDA 2G3KA 4MQ9F 3W4YA 3MX3A 2GA0A 4IAOA 1ORYA 2A68F 1M2OA 2EPKX 4E7ZA 1SF8A 1M2VA 2Y69C 3VRCA 2VCBA 2R7RA 2A6EF 3LS1A 1NFNA 3CQZA 5L0FA 2EIKC 2DB4A 2OKUA 1OR3A 1FTSA 4IGGA 2MHRA 4AE4A 5A69A 3LJBA 2HFIA 1QLEC 3TJ6A 1TFKB 3K1IC 1MQVA 3HLZA 2XLMA 1VTMP 3KMIA 5T1DB 2L7AA 1ZYRF 2ZPAA 3S90A 4Q5SF 2H7BA 2XS8A 3FHDA 4CIHA 1FMWA 1T6UA 3RQGA 3ECSA 2D4UA 2X51A 2F22A 2KK1A 3GEHA 3EFOB 3FDQA 5KYWB 4KNVA 3QW1A 1XZQA 4N6HA 2KSFA 3U0CA 1VLSA 1CGNA 1H7IA 1OXKA 4JIOA 4BJ5C 1J8MF 3JSEO 3UR3C 3MYIA 4CDYA 3T9OA 2P0NA 2Y39A 3M15A 4FESA 2XXAB 3FOOA 1PCXA 4MVRA 2B0JA 1OCZC 2J8WA 2XLOA 5JP7A 3V5YA 4CDAA 5CI8A 2BE5F 4MVZA 4DRJB 4JC7A 2W4MA 1KNYA 4G7OF 1GM5A 4ER9A 2H7OA 3I4UA 3OA1A 1HW2A 1O87A 1MMNA 3ZTZA 5L3VA 2PF4E 2XM4A 2Q7RA 5EK0A 2Q9BA 1NFOA 1T01A 2QY9A 4XQ1A 4G0HA 1NZEA 2OEVA 5KYUA 4BG0A 1XWJA 4MNDA 3SEOA 1UFBA 2YL7A 3B71A 1E2XA 3NG1A 3T6GB 4EKWA 3HNKA 5DVWA 1O3UA 2HZ8A 3B0VC 2CDQA 4JW1A 2X0CA 4PR9A 4GYTA 1G5ZA 3ZQYA 3EPVA 3C8GA 1ZW2A 4CS7A 5JSLA 2LIGA 3EZIA 5EHHA 1EQ1A 1LPEA 2W4BA 1WOLA 1JPNA 2OCCC 1OKKA 1ZU5A 2C04A 1IZMA 2VC9A 2YLGA 4IRUA 5KYXA 1KTMA 1YLMA 3GM2A 4JCHA 2NUTA 3W2WA 3L8IA 1A0BA 3EH2A 5DQZA 4FAPB 3UGOA 1I4YA 5COGA 3EHNA 2HSQA 2J9WA 2NSFA 4Q4ZF 4JEAA 4AX2A 4JTDB 4CJGA 4N6CA 3UGPA 4IWBA 5BQIA 2QUPA 2WZGA 2WVQA 3ASOC 4E7SA 4AL0A 1MNEA 3DJNB 1QZXA 4NTFA 5FZTA 1LI7A 2Q9CA 3T6BA 4OIOF 1E84A 4MVSA 2L81A 4K1OA 3V5ZA 1LVKA 1GS9A 4NCQA 2AWYA 2YQYA 2B0HA 1Q0FA 5IY5C 2YVKA 3AOUA 4JCZA 4QI2A 1YVIA 2CYDA 2IXNA 2LSEA 3CEXA 3AG4C 1RJ9B 5E33A 4JVSA 3SP1A 2C03A 1Z7Qc 1RMVA 4K0DA 3NMJA 1NSGB 1V54C 4MW3A 5DS6A 3J06A 4XEKA 3GWNA 2PNOA 1JPJA 2OU6A 2Q3TA 1YYXA 2OOCA 3I5QA 2EINC 4MTGA 5COMA 2EPMX 2CW0F 2OQMA 1ZZPA 2R05A 3C63A 4LDKA 5B1BC 2KGOA 3UMIA 2CNWD 2YLDA 4D4XA 4C7OA 3E70C 1R4TA 2R7SA 3LNMB 3G4ZA 2IXPA 3SYNA 1YYJA 4XEFA 4RDAA 3N0TA 3GEEA 2LD6A 1OKKD 1RXQA 2XLVA 3L8JA 1Q0KA 2A1DD 3O10A 1TQGA 5A6BA 1TWCA 1CGOA 4P6IC 2HUJA 2XLEA 1K40A 2J7PA 4N06A 4BEMJ 3EGXA 4JZAA 4BEJA 1VK5A 2I15A 4JRZA 1JOGA 1WASA 4CX9A 3RF3A 2KJGA 1YZAA 4KC9A 4JTCB 1NG1A 3LEVA 4MVOA 2L9JA 1Q0GA 4Q7CA 2NPUA 2AU5A 4CBEA 4EUKB 1BR2A 5L0DA 2JPUA 2LQGA 3O6XA 2YKZA 3DAGA 1HE9A 1LM3B 3AGTA 4DXWA 2TMVP 4O6NA 4YT2A 256BA 4JURI 1CGME 2ICWG 4CS9C 2DYSC 2HS5A 3DE9A 2YLIA 1M6TA 4HFKB 1L7CA 1T6QA 2A69F 4PJMA 3C7JA 2R7WA 2FAPB 4CS9A 1BDJB 1QPUA 2VCCA 2QNLA 2OJED 1HMDA 4CSAA 3GANA 1I5NA 4OINF 3S27A 3QMKA 1HMOA 2HMQA 2OJQA 4U5HA 2J9BA 2IM8A 4XWJA 3HNIA 2I8BA 3VM6A 1YA9A 1GQAA 3VF0A 1D0XA 1F1MA 4EIYA 1YJGA 4YL3A 3X1OA 2J9UA 3RVYA 1ORSC 3N24A 4AK9A 3SXMA 3F46A 4YN0B 3ZSUA 2J7PD 3VYWA 2H8AA 2XLHA 4EHPA 4LLEA 5JT4A 1O5HA 1OCRC 2R7UA 3JSZA 4U5EE 2YHSA 1D1AA 3JRTA 2ZXRA 3LLKA 2J0WA 2J9VA 3O39A 4H54A 4QI0A 1J8YF 2PP4A 2YL0A 3KKBA 1Q0MA 2PBEA 2VB6A 4O6MA 2OG2A 1LE2A 3IQ5A 1VYKA 4RD9A 2NUPB 4I1MA 2FGYA 3WG7C 4XLPF 1Z63A 3EGDB 1D1CA 3CZ6A 4MVMA 3SXKA 1CPQA 2RD9A 2WZFA 4UDVA 3PDMP 1RCPA 1T5OA 2CCYA 5D92A 3FVYA 4JE9A 2W45A 1YZCA 2XM0A 2O9XA 4RBNA 1RKEB 1T6IA 2A6HF 3KPHA 1ZU4A 1ZVZA 3JYHA 5D91A 1FFTC 1M57C 2EIMC 2YRFA 1VB5A 2R7OA 3EG9B 3V5XA 2A0BA 4J32B 1PD0A 3W2VA 2IBFA 3RQFA 4FX5A 1D0YA 2WB7A 1JRAA 2DGJA 4KNWA 3US6A 3JZ0A 4BPMA 5HV9A 4DVZA 1IW7F 1G4US 4I1OB 4I44A 3U2MA 3BEHA 2R7QA 1OW8A 3C18A 1ORJA 2RSEB 4OIRF 3RW0A 3T4RA 1Z5ZA 4IAQA 3UNGC 1BR1A 3M79A 3DZAA 1ZHWA 3GEIA 4E17A 3PHF2 2WVOA 3EQLF 1APCA 1YARO 3AQBA 3ITFA 2ETSA 1EA8A 3NKDA 4YWQA 2P7VA 2YL3A 1VYIA 5CIVA 3A11A 3GORA 4L6RA 3ZVRA 2Z15A 4K7BA 3NMIA 5JUAA 3G50A 1VMAA 1VOMA 1NU7D 2J45A 3KL4A 1OQCA 4OIQF 4EBBA 2HJMA 1HE1A 3ABKC 1KU2A 1YA7O 4PFPA 1Z6AA 1YAUO 2EIJC 3HTKC 3LUTB 1E85A 4JJFA 4P9TA 1ZHXA 3RQEA 3LAYA 3WAQA 2PFDA 5T3WA 3T6JA 1QSPA 1BR4A 5EGYA 1NBBA 3JCUQ 2QTVA 3RVZA 3TOMA 3ZDLA 4BJ1A 1D1BA 2A0UA 3ABLC 2KW3C 3DE8A 1WN0A 3GM3A 1YDIA 1HY5A 3FAJA 1D0ZA 3TOLA 3QZCA 3C62A 2PX3A 1NU9C 2DI3A 3EJNA 4NY3A 4QDLA 1MNDA 3DM5A 1WGWA 2P6VA 5BQGA 5HSWA 1M2VB 2KC3A 3WHNA 3ZG1A 4YL0A 3JYYA 5E3AA 2JD3A 5DS4A 1OXBA 1Q0DA 1U89A 2LP4A 2XLDA 4AE4B 3C8GD 5L0CA 1MMDA 4R32A 3S0XA 3NYJA 1C02A 3EFOA 4YT5A 1AVOB 5KYWA 1XZPA 1BBHA 5DS5A 3U3BA 3RIPA 2GFHA 1FR0A 4BJ6C 2L6FA 3F47A 3H2VA 4ULVA 1H9GA 4H4KC 3W8IA 5BUOA 3DXJF 3U2LA 3ZWIA 4BJ6A 4X0RA 2IOQA 2XXAA 3B0UX 2R7TA 2FFHA 2YWAA 3JT1A 5KYYA 4NC3A 4CDVA 5AGFA 2G3VA 4HEAJ 5CI9A 4N4WA 3K33A 2H7VC 5L3QA 4C3BA 1BZ4A 2GWWA 1M56C 3AGUA 1CPRA 1ZHTA 1JAFA 1S7ZA 4JEBA 4LACB 1G4WR 3AQCA 3DAFA 4G7ZF 2Y3GA 4MS2A 3Q6NA 4WABA 5T3TA 2Y3BA 5K0IA 3L1MA 1WATA 2JX0A 4M63A 5GPGB 1Y6DA 1I4ZA 3DMDA 4IB4A 5KYUB 4F4BA 4CSAC 1V74B 1MMAA 5L0HA 2AVKA 5B1AC 3MFNA 4HE8D 1NLXA 4U9DA 3R2PA 3RKOF 1DOWA 1TFOB 1VLTA 2MWQA 1LI5A
chains in the Genus database with same CATH topology
1WOLA 2Q00A 3C8GB 3GM1A 3GM3A 1KTMA 1K05A 1WWPA 2YWAA 3BRJA 3GM2A 3L8IA 4EBKA 4XEVA 1V4AA 2JPUA 1WTYA 5F28E 4XEKA 1PV3A 1KNYA 1OW6A 2L6GA 1K04A 1QVXA 1ZZPA 3TULA 3U3FA 3JYYA 3S9OA 1UFBA 2JX0A 4XEFA 3C8GD 3RQFA 4EBJA 1OW7A 2LK4A 3B71A 3JZ0A 3L8JA 4R32A 3O10A 1O3UA 3RQEA 3RQGA 4NQFA 1K40A 2L6HA 2KK1A 3MFNA 2L6FA 3K7DA 2HSBA 3AJMA 2PBEA 1OW8A 3C18A 3C8GA 1JOGA 3U0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOL A;  2Q00 A;  3C8G B;  3GM1 A;  3GM3 A;  1KTM A;  1K05 A;  1WWP A;  2YWA A;  3BRJ A;  3GM2 A;  3L8I A;  4EBK A;  4XEV A;  1V4A A;  2JPU A;  1WTY A;  5F28 E;  4XEK A;  1PV3 A;  1KNY A;  1OW6 A;  2L6G A;  1K04 A;  1QVX A;  1ZZP A;  3TUL A;  3U3F A;  3JYY A;  3S9O A;  1UFB A;  2JX0 A;  4XEF A;  3C8G D;  3RQF A;  4EBJ A;  1OW7 A;  2LK4 A;  3B71 A;  3JZ0 A;  3L8J A;  4R32 A;  3O10 A;  1O3U A;  3RQE A;  3RQG A;  4NQF A;  1K40 A;  2L6H A;  2KK1 A;  3MFN A;  2L6F A;  3K7D A;  2HSB A;  3AJM A;  2PBE A;  1OW8 A;  3C18 A;  3C8G A;  1JOG A;  3U0C A; 
#chains in the Genus database with same CATH topology
 2HMZ A;  4U9E A;  3C8G B;  3KYJ A;  3C8Z A;  2YEV A;  1SMY F;  3BRJ A;  4GEH A;  5KYX B;  3M4B A;  3S29 A;  2EPO A;  2IYL D;  2NUT B;  2VAS A;  3A9C A;  4FWV A;  4O79 A;  4PK4 A;  1A7D A;  3LEO A;  1FFH A;  1A41 A;  2Q9A A;  1N1C A;  1ZW3 A;  1QVX A;  3B0P A;  3JTL O;  4J30 B;  3SZR A;  3TJ5 A;  4U5F E;  1RKC A;  3U9J A;  5A6B D;  2R7X A;  3IQC A;  4OD4 A;  3W8H A;  5JLI A;  4KI2 A;  2VH3 A;  1OR2 A;  3QTH A;  1TR2 A;  4YJW A;  5DQT A;  1E83 A;  3OEO A;  1JR8 A;  1FNT c;  4NTA A;  1U6H A;  4U5D E;  1EKY A;  2R9R B;  4BJT A;  4O7G A;  3NMK A;  1C17 M;  2G62 A;  3IHU A;  2NG1 A;  4KBL A;  2HSB A;  4NTB A;  2EPN A;  1LIH A;  5E3C A;  2IXM A;  1RJ9 A;  3V7O A;  3GM1 A;  2ZXP A;  4WGY A;  4ZLD A;  2XLW A;  5TJ5 E;  3L0I A;  3U5S A;  2AWC A;  4PAC A;  2BL2 A;  3S28 A;  2W9Y A;  1V4A A;  3WOD F;  1WTY A;  4Z9H A;  5F28 E;  2IXO A;  2WVN A;  4XLN F;  4MTF A;  2V3C C;  1SZI A;  3ZQV A;  2L6G A;  3NRH A;  5KYY B;  2EPL X;  1OCO C;  1SR2 A;  2PX0 A;  1JMW A;  3HNJ A;  4C7O B;  2MYS A;  1ZHY A;  3QVZ A;  1G8X A;  5AC4 A;  3K1I A;  2KQ9 A;  2XL8 A;  4XTK A;  4DBR A;  3IQ6 A;  3MYF A;  5FCL A;  3RFY A;  4MW8 A;  2L6H A;  3EH1 A;  3G4X A;  3IQT A;  3Q6M A;  4LER A;  3K7D A;  3AJM A;  3K66 A;  3ASN C;  1FAP B;  1LS1 A;  3EGX B;  3OWT A;  3SXZ A;  1ST6 A;  3DI5 A;  4WGZ A;  1U0B B;  1TWA A;  3H2U A;  1WWP A;  2P1A A;  3FOP A;  3L34 A;  5E2Q A;  2ZD9 A;  3UMH A;  4PJJ A;  3ZC4 A;  4BJ5 A;  5KYN A;  1Z3I X;  2QE9 A;  3MLG A;  5A6K A;  4DJ9 A;  1PV3 A;  3ZIB A;  4DVY P;  3AG1 C;  1LE4 A;  1OW6 A;  4ULW A;  5A6A A;  3CAX A;  3SNH A;  2HJ3 A;  3H65 A;  2KNH A;  1A7V A;  4U5B E;  3S9O A;  3S84 A;  2R7V A;  3PCV A;  3ABM C;  3RYL A;  4EBJ A;  2WL8 A;  2LFF A;  4JTA B;  2CNW A;  2BC5 A;  2XL4 A;  3LES A;  2M4E A;  5BQH A;  3IEE A;  4MVQ A;  1V55 C;  1UG7 A;  3U8P A;  3SXY A;  5JRA A;  5B3S C;  2NSG A;  3HKK A;  3O55 A;  2V26 A;  1L3P A;  3ATP A;  2R02 A;  1DOV A;  4U5G A;  2YL1 A;  2E87 A;  4DRI B;  1MMG A;  3CSK A;  4DBQ A;  4IAR A;  4WJ0 A;  4XPX A;  3TQO A;  2OEX A;  4YL1 A;  2R25 A;  3TUL A;  2R03 A;  4E18 A;  3DJU B;  2M64 A;  2XS1 A;  4JJG A;  4GQH A;  4U5C E;  4CS8 C;  2XSE A;  5L0J A;  2GAQ A;  4EWC A;  5F5F A;  5COF A;  3ZTM A;  4J7Y A;  2Y3D A;  4DOZ A;  4CS8 A;  5JS5 A;  5F5H A;  1B68 A;  2YZS A;  2UUI A;  3GOD A;  4W8K A;  3U9M A;  4C3D A;  5A6J A;  2Q4F A;  2HKV A;  1H9T A;  3POV A;  3KYI A;  2NUP A;  3R7C A;  4D4N A;  1GGQ A;  3EGD A;  2EIL C;  2GDC A;  1K05 A;  1OCC C;  4EBK A;  4LLC A;  4A4A A;  3LLI A;  3DM9 B;  1S05 A;  3NYM A;  3NDB B;  4LDQ A;  1T9K A;  4CJO A;  4G7H F;  1ZHZ A;  4ONS A;  4A2N B;  4XPY A;  2J46 A;  2HV6 A;  3U8V A;  3Q7L A;  1RKE A;  4Z9J A;  2DYR C;  3KH2 A;  3B9Q A;  1FMV A;  1EI7 A;  1K04 A;  2QLA A;  2VCA A;  1QQ3 A;  3EG9 A;  3GWL A;  1Y4C A;  3MBG A;  3FXH A;  4C3E A;  1E86 A;  3I5P A;  3X2Q C;  2D5R B;  2ZXW C;  3K6B A;  1OW7 A;  3Q7G A;  5L0G A;  3K1H A;  4ZLC A;  2XL6 A;  3QW0 A;  2P61 A;  2KYH A;  1TWH A;  4O6Y A;  1TWG A;  1H6G A;  2UUH A;  3HNL A;  4W8P A;  4XPW A;  2J0X A;  4E0I A;  2HV7 A;  2XRH A;  3B29 A;  3FAP B;  4PJL A;  4B6I A;  2LCH A;  5B3I A;  3PMR A;  3M4C A;  2Q00 A;  1QKR A;  1AEP A;  3DD7 A;  4YT4 A;  5AC5 A;  3TK0 A;  3TD7 A;  4J7T A;  4YT8 A;  1R5I D;  3LNR A;  4XEV A;  3AG3 C;  3LS0 A;  4HFF B;  3M1C B;  3NKE A;  4P9F A;  3HJC A;  3JRM O;  1PD1 A;  2Y3H A;  3N2Z B;  4JKV A;  4MVU A;  2CGE A;  3E9V A;  1A7E A;  4OD5 A;  2WZL A;  4LDR A;  4E0H A;  3EZH A;  3U3F A;  1SYQ A;  5L0I A;  3DWW A;  4IJJ A;  4YK5 A;  1AUE A;  4OIP F;  3VAY A;  1LKX A;  3AG2 C;  3DKA A;  3UMK A;  2AP3 A;  2LK4 A;  4G78 A;  4Z9I A;  4ANJ A;  4CIP A;  3QVY A;  1LS4 A;  3RH3 A;  4PFO A;  4DRH B;  1C03 A;  5JVE A;  3EHM A;  3FMS A;  4I3M A;  3IPM O;  4MTO A;  1TKN A;  4NQF A;  1Z23 A;  1W2W A;  4PJN A;  4AL1 A;  3NYL A;  2ZXO A;  5DLJ A;  1HW1 A;  2ASR A;  2LFD A;  2G3K A;  4MQ9 F;  3W4Y A;  3MX3 A;  2GA0 A;  4IAO A;  1ORY A;  2A68 F;  1M2O A;  2EPK X;  4E7Z A;  1SF8 A;  1M2V A;  2Y69 C;  3VRC A;  2VCB A;  2R7R A;  2A6E F;  3LS1 A;  1NFN A;  3CQZ A;  5L0F A;  2EIK C;  2DB4 A;  2OKU A;  1OR3 A;  1FTS A;  4IGG A;  2MHR A;  4AE4 A;  5A69 A;  3LJB A;  2HFI A;  1QLE C;  3TJ6 A;  1TFK B;  3K1I C;  1MQV A;  3HLZ A;  2XLM A;  1VTM P;  3KMI A;  5T1D B;  2L7A A;  1ZYR F;  2ZPA A;  3S90 A;  4Q5S F;  2H7B A;  2XS8 A;  3FHD A;  4CIH A;  1FMW A;  1T6U A;  3RQG A;  3ECS A;  2D4U A;  2X51 A;  2F22 A;  2KK1 A;  3GEH A;  3EFO B;  3FDQ A;  5KYW B;  4KNV A;  3QW1 A;  1XZQ A;  4N6H A;  2KSF A;  3U0C A;  1VLS A;  1CGN A;  1H7I A;  1OXK A;  4JIO A;  4BJ5 C;  1J8M F;  3JSE O;  3UR3 C;  3MYI A;  4CDY A;  3T9O A;  2P0N A;  2Y39 A;  3M15 A;  4FES A;  2XXA B;  3FOO A;  1PCX A;  4MVR A;  2B0J A;  1OCZ C;  2J8W A;  2XLO A;  5JP7 A;  3V5Y A;  4CDA A;  5CI8 A;  2BE5 F;  4MVZ A;  4DRJ B;  4JC7 A;  2W4M A;  1KNY A;  4G7O F;  1GM5 A;  4ER9 A;  2H7O A;  3I4U A;  3OA1 A;  1HW2 A;  1O87 A;  1MMN A;  3ZTZ A;  5L3V A;  2PF4 E;  2XM4 A;  2Q7R A;  5EK0 A;  2Q9B A;  1NFO A;  1T01 A;  2QY9 A;  4XQ1 A;  4G0H A;  1NZE A;  2OEV A;  5KYU A;  4BG0 A;  1XWJ A;  4MND A;  3SEO A;  1UFB A;  2YL7 A;  3B71 A;  1E2X A;  3NG1 A;  3T6G B;  4EKW A;  3HNK A;  5DVW A;  1O3U A;  2HZ8 A;  3B0V C;  2CDQ A;  4JW1 A;  2X0C A;  4PR9 A;  4GYT A;  1G5Z A;  3ZQY A;  3EPV A;  3C8G A;  1ZW2 A;  4CS7 A;  5JSL A;  2LIG A;  3EZI A;  5EHH A;  1EQ1 A;  1LPE A;  2W4B A;  1WOL A;  1JPN A;  2OCC C;  1OKK A;  1ZU5 A;  2C04 A;  1IZM A;  2VC9 A;  2YLG A;  4IRU A;  5KYX A;  1KTM A;  1YLM A;  3GM2 A;  4JCH A;  2NUT A;  3W2W A;  3L8I A;  1A0B A;  3EH2 A;  5DQZ A;  4FAP B;  3UGO A;  1I4Y A;  5COG A;  3EHN A;  2HSQ A;  2J9W A;  2NSF A;  4Q4Z F;  4JEA A;  4AX2 A;  4JTD B;  4CJG A;  4N6C A;  3UGP A;  4IWB A;  5BQI A;  2QUP A;  2WZG A;  2WVQ A;  3ASO C;  4E7S A;  4AL0 A;  1MNE A;  3DJN B;  1QZX A;  4NTF A;  5FZT A;  1LI7 A;  2Q9C A;  3T6B A;  4OIO F;  1E84 A;  4MVS A;  2L81 A;  4K1O A;  3V5Z A;  1LVK A;  1GS9 A;  4NCQ A;  2AWY A;  2YQY A;  2B0H A;  1Q0F A;  5IY5 C;  2YVK A;  3AOU A;  4JCZ A;  4QI2 A;  1YVI A;  2CYD A;  2IXN A;  2LSE A;  3CEX A;  3AG4 C;  1RJ9 B;  5E33 A;  4JVS A;  3SP1 A;  2C03 A;  1Z7Q c;  1RMV A;  4K0D A;  3NMJ A;  1NSG B;  1V54 C;  4MW3 A;  5DS6 A;  3J06 A;  4XEK A;  3GWN A;  2PNO A;  1JPJ A;  2OU6 A;  2Q3T A;  1YYX A;  2OOC A;  3I5Q A;  2EIN C;  4MTG A;  5COM A;  2EPM X;  2CW0 F;  2OQM A;  1ZZP A;  2R05 A;  3C63 A;  4LDK A;  5B1B C;  2KGO A;  3UMI A;  2CNW D;  2YLD A;  4D4X A;  4C7O A;  3E70 C;  1R4T A;  2R7S A;  3LNM B;  3G4Z A;  2IXP A;  3SYN A;  1YYJ A;  4XEF A;  4RDA A;  3N0T A;  3GEE A;  2LD6 A;  1OKK D;  1RXQ A;  2XLV A;  3L8J A;  1Q0K A;  2A1D D;  3O10 A;  1TQG A;  5A6B A;  1TWC A;  1CGO A;  4P6I C;  2HUJ A;  2XLE A;  1K40 A;  2J7P A;  4N06 A;  4BEM J;  3EGX A;  4JZA A;  4BEJ A;  1VK5 A;  2I15 A;  4JRZ A;  1JOG A;  1WAS A;  4CX9 A;  3RF3 A;  2KJG A;  1YZA A;  4KC9 A;  4JTC B;  1NG1 A;  3LEV A;  4MVO A;  2L9J A;  1Q0G A;  4Q7C A;  2NPU A;  2AU5 A;  4CBE A;  4EUK B;  1BR2 A;  5L0D A;  2JPU A;  2LQG A;  3O6X A;  2YKZ A;  3DAG A;  1HE9 A;  1LM3 B;  3AGT A;  4DXW A;  2TMV P;  4O6N A;  4YT2 A;  256B A;  4JUR I;  1CGM E;  2ICW G;  4CS9 C;  2DYS C;  2HS5 A;  3DE9 A;  2YLI A;  1M6T A;  4HFK B;  1L7C A;  1T6Q A;  2A69 F;  4PJM A;  3C7J A;  2R7W A;  2FAP B;  4CS9 A;  1BDJ B;  1QPU A;  2VCC A;  2QNL A;  2OJE D;  1HMD A;  4CSA A;  3GAN A;  1I5N A;  4OIN F;  3S27 A;  3QMK A;  1HMO A;  2HMQ A;  2OJQ A;  4U5H A;  2J9B A;  2IM8 A;  4XWJ A;  3HNI A;  2I8B A;  3VM6 A;  1YA9 A;  1GQA A;  3VF0 A;  1D0X A;  1F1M A;  4EIY A;  1YJG A;  4YL3 A;  3X1O A;  2J9U A;  3RVY A;  1ORS C;  3N24 A;  4AK9 A;  3SXM A;  3F46 A;  4YN0 B;  3ZSU A;  2J7P D;  3VYW A;  2H8A A;  2XLH A;  4EHP A;  4LLE A;  5JT4 A;  1O5H A;  1OCR C;  2R7U A;  3JSZ A;  4U5E E;  2YHS A;  1D1A A;  3JRT A;  2ZXR A;  3LLK A;  2J0W A;  2J9V A;  3O39 A;  4H54 A;  4QI0 A;  1J8Y F;  2PP4 A;  2YL0 A;  3KKB A;  1Q0M A;  2PBE A;  2VB6 A;  4O6M A;  2OG2 A;  1LE2 A;  3IQ5 A;  1VYK A;  4RD9 A;  2NUP B;  4I1M A;  2FGY A;  3WG7 C;  4XLP F;  1Z63 A;  3EGD B;  1D1C A;  3CZ6 A;  4MVM A;  3SXK A;  1CPQ A;  2RD9 A;  2WZF A;  4UDV A;  3PDM P;  1RCP A;  1T5O A;  2CCY A;  5D92 A;  3FVY A;  4JE9 A;  2W45 A;  1YZC A;  2XM0 A;  2O9X A;  4RBN A;  1RKE B;  1T6I A;  2A6H F;  3KPH A;  1ZU4 A;  1ZVZ A;  3JYH A;  5D91 A;  1FFT C;  1M57 C;  2EIM C;  2YRF A;  1VB5 A;  2R7O A;  3EG9 B;  3V5X A;  2A0B A;  4J32 B;  1PD0 A;  3W2V A;  2IBF A;  3RQF A;  4FX5 A;  1D0Y A;  2WB7 A;  1JRA A;  2DGJ A;  4KNW A;  3US6 A;  3JZ0 A;  4BPM A;  5HV9 A;  4DVZ A;  1IW7 F;  1G4U S;  4I1O B;  4I44 A;  3U2M A;  3BEH A;  2R7Q A;  1OW8 A;  3C18 A;  1ORJ A;  2RSE B;  4OIR F;  3RW0 A;  3T4R A;  1Z5Z A;  4IAQ A;  3UNG C;  1BR1 A;  3M79 A;  3DZA A;  1ZHW A;  3GEI A;  4E17 A;  3PHF 2;  2WVO A;  3EQL F;  1APC A;  1YAR O;  3AQB A;  3ITF A;  2ETS A;  1EA8 A;  3NKD A;  4YWQ A;  2P7V A;  2YL3 A;  1VYI A;  5CIV A;  3A11 A;  3GOR A;  4L6R A;  3ZVR A;  2Z15 A;  4K7B A;  3NMI A;  5JUA A;  3G50 A;  1VMA A;  1VOM A;  1NU7 D;  2J45 A;  3KL4 A;  1OQC A;  4OIQ F;  4EBB A;  2HJM A;  1HE1 A;  3ABK C;  1KU2 A;  1YA7 O;  4PFP A;  1Z6A A;  1YAU O;  2EIJ C;  3HTK C;  3LUT B;  1E85 A;  4JJF A;  4P9T A;  1ZHX A;  3RQE A;  3LAY A;  3WAQ A;  2PFD A;  5T3W A;  3T6J A;  1QSP A;  1BR4 A;  5EGY A;  1NBB A;  3JCU Q;  2QTV A;  3RVZ A;  3TOM A;  3ZDL A;  4BJ1 A;  1D1B A;  2A0U A;  3ABL C;  2KW3 C;  3DE8 A;  1WN0 A;  3GM3 A;  1YDI A;  1HY5 A;  3FAJ A;  1D0Z A;  3TOL A;  3QZC A;  3C62 A;  2PX3 A;  1NU9 C;  2DI3 A;  3EJN A;  4NY3 A;  4QDL A;  1MND A;  3DM5 A;  1WGW A;  2P6V A;  5BQG A;  5HSW A;  1M2V B;  2KC3 A;  3WHN A;  3ZG1 A;  4YL0 A;  3JYY A;  5E3A A;  2JD3 A;  5DS4 A;  1OXB A;  1Q0D A;  1U89 A;  2LP4 A;  2XLD A;  4AE4 B;  3C8G D;  5L0C A;  1MMD A;  4R32 A;  3S0X A;  3NYJ A;  1C02 A;  3EFO A;  4YT5 A;  1AVO B;  5KYW A;  1XZP A;  1BBH A;  5DS5 A;  3U3B A;  3RIP A;  2GFH A;  1FR0 A;  4BJ6 C;  2L6F A;  3F47 A;  3H2V A;  4ULV A;  1H9G A;  4H4K C;  3W8I A;  5BUO A;  3DXJ F;  3U2L A;  3ZWI A;  4BJ6 A;  4X0R A;  2IOQ A;  2XXA A;  3B0U X;  2R7T A;  2FFH A;  2YWA A;  3JT1 A;  5KYY A;  4NC3 A;  4CDV A;  5AGF A;  2G3V A;  4HEA J;  5CI9 A;  4N4W A;  3K33 A;  2H7V C;  5L3Q A;  4C3B A;  1BZ4 A;  2GWW A;  1M56 C;  3AGU A;  1CPR A;  1ZHT A;  1JAF A;  1S7Z A;  4JEB A;  4LAC B;  1G4W R;  3AQC A;  3DAF A;  4G7Z F;  2Y3G A;  4MS2 A;  3Q6N A;  4WAB A;  5T3T A;  2Y3B A;  5K0I A;  3L1M A;  1WAT A;  2JX0 A;  4M63 A;  5GPG B;  1Y6D A;  1I4Z A;  3DMD A;  4IB4 A;  5KYU B;  4F4B A;  4CSA C;  1V74 B;  1MMA A;  5L0H A;  2AVK A;  5B1A C;  3MFN A;  4HE8 D;  1NLX A;  4U9D A;  3R2P A;  3RKO F;  1DOW A;  1TFO B;  1VLT A;  2MWQ A;  1LI5 A; 
#chains in the Genus database with same CATH homology
 1WOL A;  2Q00 A;  3C8G B;  3GM1 A;  3GM3 A;  1KTM A;  1K05 A;  1WWP A;  2YWA A;  3BRJ A;  3GM2 A;  3L8I A;  4EBK A;  4XEV A;  1V4A A;  2JPU A;  1WTY A;  5F28 E;  4XEK A;  1PV3 A;  1KNY A;  1OW6 A;  2L6G A;  1K04 A;  1QVX A;  1ZZP A;  3TUL A;  3U3F A;  3JYY A;  3S9O A;  1UFB A;  2JX0 A;  4XEF A;  3C8G D;  3RQF A;  4EBJ A;  1OW7 A;  2LK4 A;  3B71 A;  3JZ0 A;  3L8J A;  4R32 A;  3O10 A;  1O3U A;  3RQE A;  3RQG A;  4NQF A;  1K40 A;  2L6H A;  2KK1 A;  3MFN A;  2L6F A;  3K7D A;  2HSB A;  3AJM A;  2PBE A;  1OW8 A;  3C18 A;  3C8G A;  1JOG A;  3U0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...