5F28E

Crystal structure of fat domain of focal adhesion kinase (fak) bound to the transcription factor mef2c
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
128
Chain Sequence
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title FAK Forms a Complex with MEF2 to Couple Biomechanical Signaling to Transcription in Cardiomyocytes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription, protein binding
molecule keywords MEF2C
total genus 50
structure length 128
sequence length 128
chains with identical sequence F, G
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 5f28E00
3S9OA 3JZ0A 1KTMA 2YWAA 1OW6A 3B71A 2JX0A 3U3FA 1QVXA 2L6FA 3TULA 3GM2A 1K04A 1K05A 2JPUA 2L6GA 3C8GA 4EBKA 3U0CA 5F28E 3AJMA 1WWPA 3RQEA 3JYYA 1UFBA 2L6HA 3MFNA 3BRJA 4XEKA 3GM1A 2KK1A 3C8GD 3RQGA 4EBJA 3RQFA 1JOGA 1WTYA 3GM3A 1K40A 1PV3A 4R32A 4NQFA 3C18A 1V4AA 1ZZPA 3L8IA 1OW7A 1KNYA 1WOLA 3L8JA 4XEFA 2Q00A 3O10A 4XEVA 3C8GB 3K7DA 2PBEA 1OW8A 2LK4A 2HSBA 1O3UA
chains in the Genus database with same CATH superfamily
4U5FE 3EH2A 3FXHA 3LUTB 3X1OA 4AE4B 3NMJA 3A11A 2YLGA 5JRAA 2R7TA 2QTVA 2EPMX 3AGTA 1ST6A 1BDJB 1T6QA 3V5ZA 1JR8A 1QVXA 1O5HA 4E17A 2KYHA 3EQLF 3KH2A 4DOZA 2XM0A 3DXJF 5COMA 4JCHA 2KC3A 4C7OB 4MNDA 1Q0DA 1VMAA 2DGJA 2OOCA 3CZ6A 3U3BA 2CNWD 3BRJA 3SZRA 4ULWA 3B0VC 2IXPA 4JIOA 4MQ9F 5A6BA 1A7DA 3LESA 3EHNA 2M64A 3H65A 4MVMA 4E7SA 1VYKA 4KI2A 1GS9A 3PMRA 2R03A 2DI3A 4C3EA 4ZLCA 1C02A 3NMIA 1AUEA 2AU5A 1Q0GA 2OCCC 3AQCA 2J45A 4YL1A 2QE9A 3AQBA 5B3IA 1M57C 1O3UA 1EQ1A 4YT5A 2LFFA 1S7ZA 1APCA 5A6KA 2BC5A 4Z9HA 4IB4A 4JTAB 4JC7A 3FOOA 4LDRA 4WGYA 4BJ5A 1NU7D 4JE9A 2KJGA 4N6CA 1BR1A 1ORYA 1FAPB 2PX3A 3O39A 3UR3C 2R7OA 3ABMC 5CIVA 3AJMA 1JPJA 1TFOB 2NUTB 2YL0A 2J0XA 3JYYA 3X2QC 5DQZA 5KYWB 3UGOA 2YEVA 1Z23A 3F47A 1TR2A 3RQFA 5L0DA 3GM3A 3JSEO 2R7RA 5E3CA 1PD0A 4CDYA 1BR2A 3CQZA 1AVOB 1ZW2A 2A1DD 4OD4A 4CJGA 4K7BA 2YQYA 3GWLA 4IAQA 5EGYA 3IQTA 3NKDA 2NUPB 4PFPA 3NYLA 1N1CA 2V3CC 4XWJA 3T4RA 1JRAA 3NRHA 2PX0A 3ZWIA 1OW6A 5EHHA 1E2XA 1SMYF 4W8PA 2EPLX 4EKWA 2VB6A 3HJCA 3N24A 5AC4A 4G7ZF 1OCCC 2EILC 3EZHA 5CI8A 3S27A 1R5ID 2L7AA 3ZSUA 1TWGA 3K1IA 2H8AA 5GPGB 4U5GA 2YL7A 1H9GA 3IPMO 4QI2A 3DAGA 2YL1A 1OCZC 1DOWA 4EBJA 5JUAA 2I8BA 4OIOF 5DVWA 4AE4A 4DRIB 1S05A 4J7TA 2Q9CA 4NQFA 4XPYA 1M6TA 3KMIA 2JD3A 3QVZA 5D92A 3SXMA 4ONSA 4MVSA 2EIJC 4EBBA 2EPKX 5L0GA 3DE9A 5K0IA 3KKBA 2J9BA 3RVYA 1OR2A 2HSBA 3QW1A 2HZ8A 4MTGA 1L7CA 4PFOA 1OCOC 1VLSA 4YL0A 2WZGA 4JURI 3JTLO 3WG7C 3T6GB 1QQ3A 1ZU5A 3LS1A 4OIRF 3TOLA 2A69F 1KU2A 2A0BA 4U5HA 2VH3A 3L0IA 3IQ5A 4Z9JA 1D1AA 4NY3A 3WAQA 2FFHA 4BJ6A 1T6UA 1YA9A 4Q5SF 4NC3A 2GDCA 2NG1A 3ABKC 4J7YA 3H2VA 3CEXA 4JJGA 3T6BA 3E70C 1BBHA 5DS5A 4CJOA 3VAYA 2G3KA 1XZQA 3IHUA 3U2MA 3S0XA 1TWCA 1ZHTA 4PJNA 3V5XA 5DQTA 2HFIA 1NFOA 2NUTA 2A68F 5KYWA 1Z3IX 4OD5A 1RKEB 3TD7A 3VM6A 2WZLA 1NZEA 3PCVA 2VCBA 2XL6A 1GM5A 3K33A 3ZDLA 2XRHA 4YT4A 3AOUA 2XLEA 4HFKB 5F5FA 1VTMP 3GEIA 2J9UA 5T3TA 3KL4A 2P61A 2HKVA 1Z5ZA 3ZG1A 2R05A 3MYFA 3MX3A 3QTHA 4CBEA 3NDBB 1MNDA 4N6HA 4YK5A 1OCRC 5IY5C 3DMDA 3ZQVA 5KYXA 1D0ZA 1SR2A 1Y6DA 4E18A 1T5OA 5DS6A 2IXNA 4MVRA 4JKVA 4A4AA 3RW0A 4E0HA 1E86A 2VCAA 4B6IA 2XLVA 1ZYRF 4XEFA 5JSLA 2BL2A 2LSEA 2OEXA 3G4ZA 1LKXA 1RKCA 4MTFA 5A6JA 2H7OA 2ZXRA 2XLDA 1TKNA 4BEMJ 1HMDA 1CGOA 2Q9BA 4LDKA 5L0IA 4CSAC 2XLWA 3EJNA 1PD1A 2XLHA 1SZIA 2ZXWC 2CNWA 4YJWA 4FAPB 1Q0KA 2XL8A 3OA1A 3QVYA 4F4BA 2LIGA 4M63A 1A41A 1A7EA 4CS8A 5L0CA 2HV7A 1EA8A 4PJMA 2LCHA 2EPNA 3GM1A 4DBQA 2IM8A 1TQGA 4EIYA 3LLKA 2KGOA 4OIQF 3C8ZA 1SYQA 1D1CA 3B0PA 3E9VA 2QNLA 5DS4A 4AL1A 1HY5A 1OW7A 4YL3A 1LE2A 4UDVA 4JW1A 3G4XA 4XQ1A 4NTBA 5E33A 1I4YA 1OXKA 2E87A 2J0WA 5L0HA 4ZLDA 1WGWA 2BE5F 2OEVA 3RIPA 1NBBA 1MMDA 1AEPA 1LVKA 4WJ0A 3B71A 5TJ5E 3SXKA 1HW2A 2XL4A 3S28A 1FFHA 1K04A 2PNOA 4U9DA 4QI0A 3RYLA 3K1IC 4HEAJ 5JP7A 5F5HA 3M15A 3O6XA 2HSQA 2J9VA 1NLXA 3C8GA 4L6RA 2NSGA 3US6A 3O55A 3RQEA 2QY9A 2P7VA 2ZD9A 1LI5A 3ZQYA 4H4KC 3TQOA 3WODF 4P9TA 4KBLA 3OEOA 1BZ4A 1FFTC 1OKKA 2Y3DA 1LM3B 4O6NA 3EGXA 4KC9A 4ULVA 1FTSA 5KYYB 4IWBA 2EIKC 3EFOA 1V74B 2O9XA 3U8VA 3DKAA 1RJ9A 4XTKA 2GAQA 3NG1A 3O10A 1LE4A 3NYMA 1C03A 5COFA 4GQHA 1RXQA 2LK4A 1T01A 2HS5A 5CI9A 3ITFA 2B0HA 4YWQA 4E0IA 3R2PA 2NSFA 4ANJA 4OIPF 1OR3A 3EZIA 4JCZA 4U5CE 1D1BA 2H7VC 4BEJA 5E2QA 3A9CA 1V54C 1CGME 2CGEA 2C03A 3GEEA 4MVOA 4DJ9A 3DZAA 1MNEA 4I1OB 4YT8A 3NKEA 2F22A 4I1MA 3JYHA 3U2LA 1LIHA 1OQCA 3RFYA 3ZIBA 2OG2A 2XLMA 3AG1C 5L0FA 2XS1A 4KNWA 4BJ5C 4E7ZA 2KK1A 2G62A 2QUPA 3GORA 4LLEA 4CSAA 2OJED 3EGDA 2LFDA 3N2ZB 3VYWA 5AGFA 4MVQA 256BA 3ZC4A 1G4WR 4HE8D 1T9KA 3S29A 2RSEB 4LLCA 1OKKD 4NTAA 4X0RA 5AC5A 2XXAA 1OW8A 3I4UA 4JVSA 4U5DE 3EPVA 3JRMO 3WHNA 4QDLA 1E85A 3S9OA 1GQAA 3SEOA 2LP4A 3RF3A 3SXYA 4PJJA 2R7UA 1QSPA 3RVZA 2J7PD 3ABLC 1YAUO 2L6FA 3DWWA 5KYUA 3UMKA 4GYTA 1VB5A 2WVOA 3FMSA 2JPUA 3GANA 3DAFA 1CPRA 5L3QA 1D0XA 2WL8A 3Q6MA 5KYNA 2GFHA 3JRTA 4XEKA 4WABA 2J7PA 3CAXA 3KYIA 1ORJA 4G78A 2P1AA 4AL0A 3LNMB 4RBNA 1JOGA 3KYJA 5JS5A 2FGYA 3JSZA 5JVEA 3LJBA 1Y4CA 1ZU4A 2XS8A 2R7SA 3JT1A 3Q6NA 1IZMA 4G7OF 1H7IA 1D0YA 3EH1A 4DRHB 3C8GB 3M4BA 3R7CA 2CYDA 5COGA 2XLOA 2YKZA 2YVKA 1YYJA 3ZTMA 2W45A 5B1AC 1VYIA 4LACB 2Q4FA 1F1MA 4IJJA 1NU9C 4ER9A 3DJNB 2GA0A 1Z63A 2PP4A 4PR9A 3U9MA 4BJ6C 5KYYA 4CDAA 3EFOB 2I15A 3K66A 3S90A 3QW0A 1PCXA 3UGPA 2WVNA 2X0CA 3BEHA 2DB4A 3MLGA 1YLMA 1DOVA 1G8XA 2AP3A 4N06A 3VF0A 3LNRA 5T3WA 1YJGA 1ZW3A 1UG7A 4O6MA 4RD9A 2C04A 2XM4A 3B29A 3MYIA 1ZZPA 4Z9IA 4XLPF 1IW7F 1YZAA 1Q0MA 4CDVA 1MQVA 4P6IC 4BJTA 1Q0FA 2EINC 2YLDA 2EPOA 2HUJA 2IBFA 2VCCA 2YHSA 4MW3A 3TK0A 3HLZA 2OQMA 4U5EE 1U0BB 1KTMA 1JPNA 4JEBA 2L81A 4JRZA 4AX2A 3LLIA 3FDQA 4CIPA 3EGDB 1R4TA 2J9WA 4FESA 1FMWA 2DYRC 4DRJB 3TULA 2UUHA 5FCLA 3QZCA 2R02A 3IQCA 4G7HF 1K05A 4O7GA 1YVIA 4XPXA 4C3BA 3W8HA 1WASA 1QKRA 3K1HA 4NCQA 1C17M 2NUPA 3FAJA 2Y3HA 2YZSA 2HMZA 3GWNA 1H6GA 4U9EA 1HMOA 3W4YA 4PACA 4DBRA 2XXAB 3EG9B 2P6VA 4IRUA 2ASRA 4O6YA 1J8MF 2A0UA 4FWVA 2AWCA 5E3AA 2IOQA 2ZXOA 1I5NA 1KNYA 3L8JA 3QMKA 1M56C 1HE9A 4IARA 4MW8A 3K7DA 2PBEA 4MS2A 2MHRA 1M2OA 1XWJA 4MTOA 2ZPAA 1ZHYA 3S84A 5L0JA 3DI5A 5L3VA 4PK4A 1TWAA 1QZXA 5HV9A 2Q3TA 2VC9A 2YWAA 1A7VA 1NSGB 1M2VA 2R9RB 1VK5A 4IGGA 2Y3BA 3C63A 1TWHA 3PHF2 1TFKB 2OU6A 4EHPA 2D4UA 3U8PA 5A6BD 1LS4A 4CS7A 4EBKA 4JJFA 5F28E 3U0CA 3C7JA 1Z6AA 3LS0A 1EKYA 4FX5A 3FAPB 1A0BA 5BQGA 1GGQA 2YL3A 3RKOF 4H54A 3FOPA 3UMIA 3IEEA 3HNLA 1YYXA 4DVYP 3NMKA 2A6HF 3AG2C 4CS9A 2A6EF 5DLJA 1YARO 4WGZA 5D91A 2MWQA 3UNGC 1CPQA 2UUIA 2CCYA 3FVYA 3M4CA 5BQHA 3HKKA 2Q00A 1HE1A 1WN0A 3ZVRA 2HJMA 1YA7O 3W2WA 2G3VA 3SP1A 2KNHA 3UMHA 1VLTA 2R7QA 5KYXB 3I5PA 4Q4ZF 4NTFA 3DJUB 3U3FA 1SF8A 3AG3C 1O87A 2ICWG 2Q9AA 2W4MA 4K1OA 2Y3GA 2YRFA 4YT2A 1NG1A 1WWPA 2W9YA 3HTKC 4MVZA 5BUOA 1V55C 4CIHA 4XLNF 3DE8A 1Z7Qc 1MMGA 2YLIA 3DM5A 5B1BC 1RKEA 3G50A 1VOMA 4RDAA 1WTYA 1YDIA 3PDMP 2R7WA 2HMQA 4JTDB 4R32A 1FR0A 3TJ6A 3EHMA 1WOLA 4C3DA 1CGNA 4D4NA 1ZHWA 3C62A 5FZTA 2Z15A 4D4XA 1E83A 4A2NB 2H7BA 2Y69C 3T9OA 5B3SC 1RCPA 2FAPB 2M4EA 4OINF 1ZHZA 3EG9A 1E84A 4BPMA 3AG4C 3JCUQ 3TJ5A 3GM2A 3DM9B 2KQ9A 2WB7A 4GEHA 4IAOA 4JEAA 1U6HA 2X51A 4W8KA 3SNHA 2PFDA 1U89A 2B0JA 2LD6A 3NYJA 4I3MA 4BJ1A 5HSWA 3ECSA 3MFNA 3FHDA 4PJLA 4YN0B 5JT4A 2AWYA 3C8GD 1FMVA 4N4WA 4XPWA 4KNVA 1OXBA 4Q7CA 4HFFB 3B0UX 1LPEA 2EIMC 1G4US 3I5QA 4LDQA 2Q7RA 1M2VB 1T6IA 3VRCA 3AGUA 3DD7A 4C7OA 3GODA 3IQ6A 2KW3C 2XSEA 2LQGA 4U5BE 3SXZA 4DXWA 2ZXPA 3TOMA 2J8WA 5BQIA 1W2WA 1WATA 3U9JA 3J06A 1ORSC 3HNKA 2ETSA 2R7VA 3LEVA 3OWTA 1NFNA 1QLEC 4EWCA 1I4ZA 2W4BA 5JLIA 3U5SA 1HW1A 2MYSA 2WZFA 4G0HA 3T6JA 2DYSC 3HNIA 4LERA 4K0DA 1JMWA 3KPHA 2NPUA 2HV6A 1L3PA 1G5ZA 2OKUA 5A6AA 3B9QA 3CSKA 5A69A 1MMNA 2GWWA 3SYNA 4MVUA 2R7XA 1B68A 3C18A 3LAYA 1V4AA 2CDQA 3L8IA 3POVA 5T1DB 3LEOA 4I44A 3V7OA 1XZPA 2IXMA 3GEHA 3ZTZA 4XEVA 1RMVA 4P9FA 3Q7LA 4JTCB 2Y39A 4AK9A 3W8IA 3M79A 3JZ0A 3V5YA 3ASOC 4CX9A 2IXOA 2R25A 2P0NA 1ZVZA 1BR4A 1LS1A 3RH3A 2PF4E 4J32B 3W2VA 2JX0A 1ZHXA 2V26A 1JAFA 3ATPA 1QPUA 2WVQA 3EGXB 3L1MA 3H2UA 3MBGA 2J46A 2TMVP 2L6GA 2RD9A 1RJ9B 3K6BA 1UFBA 2L6HA 2HJ3A 4CS9C 2AVKA 1YZCA 4EUKB 5EK0A 3L34A 3N0TA 4JZAA 3M1CB 2D5RB 3RQGA 4BG0A 4J30B 1LI7A 1K40A 1J8YF 1MMAA 1PV3A 2L9JA 5KYUB 1H9TA 2KSFA 2OJQA 3Q7GA 3F46A 3ASNC 4CS8C 4O79A 2CW0F 4DVZA 1FNTc 3HNJA 1EI7A 2VASA 2QLAA 2IYLD
chains in the Genus database with same CATH topology
3S9OA 3JZ0A 1KTMA 2YWAA 1OW6A 3B71A 2JX0A 3U3FA 1QVXA 2L6FA 3TULA 3GM2A 1K04A 1K05A 2JPUA 2L6GA 3C8GA 4EBKA 3U0CA 5F28E 3AJMA 1WWPA 3RQEA 3JYYA 1UFBA 2L6HA 3MFNA 3BRJA 4XEKA 3GM1A 2KK1A 3C8GD 3RQGA 4EBJA 3RQFA 1JOGA 1WTYA 3GM3A 1K40A 1PV3A 4R32A 4NQFA 3C18A 1V4AA 1ZZPA 3L8IA 1OW7A 1KNYA 1WOLA 3L8JA 4XEFA 2Q00A 3O10A 4XEVA 3C8GB 3K7DA 2PBEA 1OW8A 2LK4A 2HSBA 1O3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  3JZ0 A;  1KTM A;  2YWA A;  1OW6 A;  3B71 A;  2JX0 A;  3U3F A;  1QVX A;  2L6F A;  3TUL A;  3GM2 A;  1K04 A;  1K05 A;  2JPU A;  2L6G A;  3C8G A;  4EBK A;  3U0C A;  5F28 E;  3AJM A;  1WWP A;  3RQE A;  3JYY A;  1UFB A;  2L6H A;  3MFN A;  3BRJ A;  4XEK A;  3GM1 A;  2KK1 A;  3C8G D;  3RQG A;  4EBJ A;  3RQF A;  1JOG A;  1WTY A;  3GM3 A;  1K40 A;  1PV3 A;  4R32 A;  4NQF A;  3C18 A;  1V4A A;  1ZZP A;  3L8I A;  1OW7 A;  1KNY A;  1WOL A;  3L8J A;  4XEF A;  2Q00 A;  3O10 A;  4XEV A;  3C8G B;  3K7D A;  2PBE A;  1OW8 A;  2LK4 A;  2HSB A;  1O3U A; 
#chains in the Genus database with same CATH topology
 4U5F E;  3EH2 A;  3FXH A;  3LUT B;  3X1O A;  4AE4 B;  3NMJ A;  3A11 A;  2YLG A;  5JRA A;  2R7T A;  2QTV A;  2EPM X;  3AGT A;  1ST6 A;  1BDJ B;  1T6Q A;  3V5Z A;  1JR8 A;  1QVX A;  1O5H A;  4E17 A;  2KYH A;  3EQL F;  3KH2 A;  4DOZ A;  2XM0 A;  3DXJ F;  5COM A;  4JCH A;  2KC3 A;  4C7O B;  4MND A;  1Q0D A;  1VMA A;  2DGJ A;  2OOC A;  3CZ6 A;  3U3B A;  2CNW D;  3BRJ A;  3SZR A;  4ULW A;  3B0V C;  2IXP A;  4JIO A;  4MQ9 F;  5A6B A;  1A7D A;  3LES A;  3EHN A;  2M64 A;  3H65 A;  4MVM A;  4E7S A;  1VYK A;  4KI2 A;  1GS9 A;  3PMR A;  2R03 A;  2DI3 A;  4C3E A;  4ZLC A;  1C02 A;  3NMI A;  1AUE A;  2AU5 A;  1Q0G A;  2OCC C;  3AQC A;  2J45 A;  4YL1 A;  2QE9 A;  3AQB A;  5B3I A;  1M57 C;  1O3U A;  1EQ1 A;  4YT5 A;  2LFF A;  1S7Z A;  1APC A;  5A6K A;  2BC5 A;  4Z9H A;  4IB4 A;  4JTA B;  4JC7 A;  3FOO A;  4LDR A;  4WGY A;  4BJ5 A;  1NU7 D;  4JE9 A;  2KJG A;  4N6C A;  1BR1 A;  1ORY A;  1FAP B;  2PX3 A;  3O39 A;  3UR3 C;  2R7O A;  3ABM C;  5CIV A;  3AJM A;  1JPJ A;  1TFO B;  2NUT B;  2YL0 A;  2J0X A;  3JYY A;  3X2Q C;  5DQZ A;  5KYW B;  3UGO A;  2YEV A;  1Z23 A;  3F47 A;  1TR2 A;  3RQF A;  5L0D A;  3GM3 A;  3JSE O;  2R7R A;  5E3C A;  1PD0 A;  4CDY A;  1BR2 A;  3CQZ A;  1AVO B;  1ZW2 A;  2A1D D;  4OD4 A;  4CJG A;  4K7B A;  2YQY A;  3GWL A;  4IAQ A;  5EGY A;  3IQT A;  3NKD A;  2NUP B;  4PFP A;  3NYL A;  1N1C A;  2V3C C;  4XWJ A;  3T4R A;  1JRA A;  3NRH A;  2PX0 A;  3ZWI A;  1OW6 A;  5EHH A;  1E2X A;  1SMY F;  4W8P A;  2EPL X;  4EKW A;  2VB6 A;  3HJC A;  3N24 A;  5AC4 A;  4G7Z F;  1OCC C;  2EIL C;  3EZH A;  5CI8 A;  3S27 A;  1R5I D;  2L7A A;  3ZSU A;  1TWG A;  3K1I A;  2H8A A;  5GPG B;  4U5G A;  2YL7 A;  1H9G A;  3IPM O;  4QI2 A;  3DAG A;  2YL1 A;  1OCZ C;  1DOW A;  4EBJ A;  5JUA A;  2I8B A;  4OIO F;  5DVW A;  4AE4 A;  4DRI B;  1S05 A;  4J7T A;  2Q9C A;  4NQF A;  4XPY A;  1M6T A;  3KMI A;  2JD3 A;  3QVZ A;  5D92 A;  3SXM A;  4ONS A;  4MVS A;  2EIJ C;  4EBB A;  2EPK X;  5L0G A;  3DE9 A;  5K0I A;  3KKB A;  2J9B A;  3RVY A;  1OR2 A;  2HSB A;  3QW1 A;  2HZ8 A;  4MTG A;  1L7C A;  4PFO A;  1OCO C;  1VLS A;  4YL0 A;  2WZG A;  4JUR I;  3JTL O;  3WG7 C;  3T6G B;  1QQ3 A;  1ZU5 A;  3LS1 A;  4OIR F;  3TOL A;  2A69 F;  1KU2 A;  2A0B A;  4U5H A;  2VH3 A;  3L0I A;  3IQ5 A;  4Z9J A;  1D1A A;  4NY3 A;  3WAQ A;  2FFH A;  4BJ6 A;  1T6U A;  1YA9 A;  4Q5S F;  4NC3 A;  2GDC A;  2NG1 A;  3ABK C;  4J7Y A;  3H2V A;  3CEX A;  4JJG A;  3T6B A;  3E70 C;  1BBH A;  5DS5 A;  4CJO A;  3VAY A;  2G3K A;  1XZQ A;  3IHU A;  3U2M A;  3S0X A;  1TWC A;  1ZHT A;  4PJN A;  3V5X A;  5DQT A;  2HFI A;  1NFO A;  2NUT A;  2A68 F;  5KYW A;  1Z3I X;  4OD5 A;  1RKE B;  3TD7 A;  3VM6 A;  2WZL A;  1NZE A;  3PCV A;  2VCB A;  2XL6 A;  1GM5 A;  3K33 A;  3ZDL A;  2XRH A;  4YT4 A;  3AOU A;  2XLE A;  4HFK B;  5F5F A;  1VTM P;  3GEI A;  2J9U A;  5T3T A;  3KL4 A;  2P61 A;  2HKV A;  1Z5Z A;  3ZG1 A;  2R05 A;  3MYF A;  3MX3 A;  3QTH A;  4CBE A;  3NDB B;  1MND A;  4N6H A;  4YK5 A;  1OCR C;  5IY5 C;  3DMD A;  3ZQV A;  5KYX A;  1D0Z A;  1SR2 A;  1Y6D A;  4E18 A;  1T5O A;  5DS6 A;  2IXN A;  4MVR A;  4JKV A;  4A4A A;  3RW0 A;  4E0H A;  1E86 A;  2VCA A;  4B6I A;  2XLV A;  1ZYR F;  4XEF A;  5JSL A;  2BL2 A;  2LSE A;  2OEX A;  3G4Z A;  1LKX A;  1RKC A;  4MTF A;  5A6J A;  2H7O A;  2ZXR A;  2XLD A;  1TKN A;  4BEM J;  1HMD A;  1CGO A;  2Q9B A;  4LDK A;  5L0I A;  4CSA C;  2XLW A;  3EJN A;  1PD1 A;  2XLH A;  1SZI A;  2ZXW C;  2CNW A;  4YJW A;  4FAP B;  1Q0K A;  2XL8 A;  3OA1 A;  3QVY A;  4F4B A;  2LIG A;  4M63 A;  1A41 A;  1A7E A;  4CS8 A;  5L0C A;  2HV7 A;  1EA8 A;  4PJM A;  2LCH A;  2EPN A;  3GM1 A;  4DBQ A;  2IM8 A;  1TQG A;  4EIY A;  3LLK A;  2KGO A;  4OIQ F;  3C8Z A;  1SYQ A;  1D1C A;  3B0P A;  3E9V A;  2QNL A;  5DS4 A;  4AL1 A;  1HY5 A;  1OW7 A;  4YL3 A;  1LE2 A;  4UDV A;  4JW1 A;  3G4X A;  4XQ1 A;  4NTB A;  5E33 A;  1I4Y A;  1OXK A;  2E87 A;  2J0W A;  5L0H A;  4ZLD A;  1WGW A;  2BE5 F;  2OEV A;  3RIP A;  1NBB A;  1MMD A;  1AEP A;  1LVK A;  4WJ0 A;  3B71 A;  5TJ5 E;  3SXK A;  1HW2 A;  2XL4 A;  3S28 A;  1FFH A;  1K04 A;  2PNO A;  4U9D A;  4QI0 A;  3RYL A;  3K1I C;  4HEA J;  5JP7 A;  5F5H A;  3M15 A;  3O6X A;  2HSQ A;  2J9V A;  1NLX A;  3C8G A;  4L6R A;  2NSG A;  3US6 A;  3O55 A;  3RQE A;  2QY9 A;  2P7V A;  2ZD9 A;  1LI5 A;  3ZQY A;  4H4K C;  3TQO A;  3WOD F;  4P9T A;  4KBL A;  3OEO A;  1BZ4 A;  1FFT C;  1OKK A;  2Y3D A;  1LM3 B;  4O6N A;  3EGX A;  4KC9 A;  4ULV A;  1FTS A;  5KYY B;  4IWB A;  2EIK C;  3EFO A;  1V74 B;  2O9X A;  3U8V A;  3DKA A;  1RJ9 A;  4XTK A;  2GAQ A;  3NG1 A;  3O10 A;  1LE4 A;  3NYM A;  1C03 A;  5COF A;  4GQH A;  1RXQ A;  2LK4 A;  1T01 A;  2HS5 A;  5CI9 A;  3ITF A;  2B0H A;  4YWQ A;  4E0I A;  3R2P A;  2NSF A;  4ANJ A;  4OIP F;  1OR3 A;  3EZI A;  4JCZ A;  4U5C E;  1D1B A;  2H7V C;  4BEJ A;  5E2Q A;  3A9C A;  1V54 C;  1CGM E;  2CGE A;  2C03 A;  3GEE A;  4MVO A;  4DJ9 A;  3DZA A;  1MNE A;  4I1O B;  4YT8 A;  3NKE A;  2F22 A;  4I1M A;  3JYH A;  3U2L A;  1LIH A;  1OQC A;  3RFY A;  3ZIB A;  2OG2 A;  2XLM A;  3AG1 C;  5L0F A;  2XS1 A;  4KNW A;  4BJ5 C;  4E7Z A;  2KK1 A;  2G62 A;  2QUP A;  3GOR A;  4LLE A;  4CSA A;  2OJE D;  3EGD A;  2LFD A;  3N2Z B;  3VYW A;  5AGF A;  4MVQ A;  256B A;  3ZC4 A;  1G4W R;  4HE8 D;  1T9K A;  3S29 A;  2RSE B;  4LLC A;  1OKK D;  4NTA A;  4X0R A;  5AC5 A;  2XXA A;  1OW8 A;  3I4U A;  4JVS A;  4U5D E;  3EPV A;  3JRM O;  3WHN A;  4QDL A;  1E85 A;  3S9O A;  1GQA A;  3SEO A;  2LP4 A;  3RF3 A;  3SXY A;  4PJJ A;  2R7U A;  1QSP A;  3RVZ A;  2J7P D;  3ABL C;  1YAU O;  2L6F A;  3DWW A;  5KYU A;  3UMK A;  4GYT A;  1VB5 A;  2WVO A;  3FMS A;  2JPU A;  3GAN A;  3DAF A;  1CPR A;  5L3Q A;  1D0X A;  2WL8 A;  3Q6M A;  5KYN A;  2GFH A;  3JRT A;  4XEK A;  4WAB A;  2J7P A;  3CAX A;  3KYI A;  1ORJ A;  4G78 A;  2P1A A;  4AL0 A;  3LNM B;  4RBN A;  1JOG A;  3KYJ A;  5JS5 A;  2FGY A;  3JSZ A;  5JVE A;  3LJB A;  1Y4C A;  1ZU4 A;  2XS8 A;  2R7S A;  3JT1 A;  3Q6N A;  1IZM A;  4G7O F;  1H7I A;  1D0Y A;  3EH1 A;  4DRH B;  3C8G B;  3M4B A;  3R7C A;  2CYD A;  5COG A;  2XLO A;  2YKZ A;  2YVK A;  1YYJ A;  3ZTM A;  2W45 A;  5B1A C;  1VYI A;  4LAC B;  2Q4F A;  1F1M A;  4IJJ A;  1NU9 C;  4ER9 A;  3DJN B;  2GA0 A;  1Z63 A;  2PP4 A;  4PR9 A;  3U9M A;  4BJ6 C;  5KYY A;  4CDA A;  3EFO B;  2I15 A;  3K66 A;  3S90 A;  3QW0 A;  1PCX A;  3UGP A;  2WVN A;  2X0C A;  3BEH A;  2DB4 A;  3MLG A;  1YLM A;  1DOV A;  1G8X A;  2AP3 A;  4N06 A;  3VF0 A;  3LNR A;  5T3W A;  1YJG A;  1ZW3 A;  1UG7 A;  4O6M A;  4RD9 A;  2C04 A;  2XM4 A;  3B29 A;  3MYI A;  1ZZP A;  4Z9I A;  4XLP F;  1IW7 F;  1YZA A;  1Q0M A;  4CDV A;  1MQV A;  4P6I C;  4BJT A;  1Q0F A;  2EIN C;  2YLD A;  2EPO A;  2HUJ A;  2IBF A;  2VCC A;  2YHS A;  4MW3 A;  3TK0 A;  3HLZ A;  2OQM A;  4U5E E;  1U0B B;  1KTM A;  1JPN A;  4JEB A;  2L81 A;  4JRZ A;  4AX2 A;  3LLI A;  3FDQ A;  4CIP A;  3EGD B;  1R4T A;  2J9W A;  4FES A;  1FMW A;  2DYR C;  4DRJ B;  3TUL A;  2UUH A;  5FCL A;  3QZC A;  2R02 A;  3IQC A;  4G7H F;  1K05 A;  4O7G A;  1YVI A;  4XPX A;  4C3B A;  3W8H A;  1WAS A;  1QKR A;  3K1H A;  4NCQ A;  1C17 M;  2NUP A;  3FAJ A;  2Y3H A;  2YZS A;  2HMZ A;  3GWN A;  1H6G A;  4U9E A;  1HMO A;  3W4Y A;  4PAC A;  4DBR A;  2XXA B;  3EG9 B;  2P6V A;  4IRU A;  2ASR A;  4O6Y A;  1J8M F;  2A0U A;  4FWV A;  2AWC A;  5E3A A;  2IOQ A;  2ZXO A;  1I5N A;  1KNY A;  3L8J A;  3QMK A;  1M56 C;  1HE9 A;  4IAR A;  4MW8 A;  3K7D A;  2PBE A;  4MS2 A;  2MHR A;  1M2O A;  1XWJ A;  4MTO A;  2ZPA A;  1ZHY A;  3S84 A;  5L0J A;  3DI5 A;  5L3V A;  4PK4 A;  1TWA A;  1QZX A;  5HV9 A;  2Q3T A;  2VC9 A;  2YWA A;  1A7V A;  1NSG B;  1M2V A;  2R9R B;  1VK5 A;  4IGG A;  2Y3B A;  3C63 A;  1TWH A;  3PHF 2;  1TFK B;  2OU6 A;  4EHP A;  2D4U A;  3U8P A;  5A6B D;  1LS4 A;  4CS7 A;  4EBK A;  4JJF A;  5F28 E;  3U0C A;  3C7J A;  1Z6A A;  3LS0 A;  1EKY A;  4FX5 A;  3FAP B;  1A0B A;  5BQG A;  1GGQ A;  2YL3 A;  3RKO F;  4H54 A;  3FOP A;  3UMI A;  3IEE A;  3HNL A;  1YYX A;  4DVY P;  3NMK A;  2A6H F;  3AG2 C;  4CS9 A;  2A6E F;  5DLJ A;  1YAR O;  4WGZ A;  5D91 A;  2MWQ A;  3UNG C;  1CPQ A;  2UUI A;  2CCY A;  3FVY A;  3M4C A;  5BQH A;  3HKK A;  2Q00 A;  1HE1 A;  1WN0 A;  3ZVR A;  2HJM A;  1YA7 O;  3W2W A;  2G3V A;  3SP1 A;  2KNH A;  3UMH A;  1VLT A;  2R7Q A;  5KYX B;  3I5P A;  4Q4Z F;  4NTF A;  3DJU B;  3U3F A;  1SF8 A;  3AG3 C;  1O87 A;  2ICW G;  2Q9A A;  2W4M A;  4K1O A;  2Y3G A;  2YRF A;  4YT2 A;  1NG1 A;  1WWP A;  2W9Y A;  3HTK C;  4MVZ A;  5BUO A;  1V55 C;  4CIH A;  4XLN F;  3DE8 A;  1Z7Q c;  1MMG A;  2YLI A;  3DM5 A;  5B1B C;  1RKE A;  3G50 A;  1VOM A;  4RDA A;  1WTY A;  1YDI A;  3PDM P;  2R7W A;  2HMQ A;  4JTD B;  4R32 A;  1FR0 A;  3TJ6 A;  3EHM A;  1WOL A;  4C3D A;  1CGN A;  4D4N A;  1ZHW A;  3C62 A;  5FZT A;  2Z15 A;  4D4X A;  1E83 A;  4A2N B;  2H7B A;  2Y69 C;  3T9O A;  5B3S C;  1RCP A;  2FAP B;  2M4E A;  4OIN F;  1ZHZ A;  3EG9 A;  1E84 A;  4BPM A;  3AG4 C;  3JCU Q;  3TJ5 A;  3GM2 A;  3DM9 B;  2KQ9 A;  2WB7 A;  4GEH A;  4IAO A;  4JEA A;  1U6H A;  2X51 A;  4W8K A;  3SNH A;  2PFD A;  1U89 A;  2B0J A;  2LD6 A;  3NYJ A;  4I3M A;  4BJ1 A;  5HSW A;  3ECS A;  3MFN A;  3FHD A;  4PJL A;  4YN0 B;  5JT4 A;  2AWY A;  3C8G D;  1FMV A;  4N4W A;  4XPW A;  4KNV A;  1OXB A;  4Q7C A;  4HFF B;  3B0U X;  1LPE A;  2EIM C;  1G4U S;  3I5Q A;  4LDQ A;  2Q7R A;  1M2V B;  1T6I A;  3VRC A;  3AGU A;  3DD7 A;  4C7O A;  3GOD A;  3IQ6 A;  2KW3 C;  2XSE A;  2LQG A;  4U5B E;  3SXZ A;  4DXW A;  2ZXP A;  3TOM A;  2J8W A;  5BQI A;  1W2W A;  1WAT A;  3U9J A;  3J06 A;  1ORS C;  3HNK A;  2ETS A;  2R7V A;  3LEV A;  3OWT A;  1NFN A;  1QLE C;  4EWC A;  1I4Z A;  2W4B A;  5JLI A;  3U5S A;  1HW1 A;  2MYS A;  2WZF A;  4G0H A;  3T6J A;  2DYS C;  3HNI A;  4LER A;  4K0D A;  1JMW A;  3KPH A;  2NPU A;  2HV6 A;  1L3P A;  1G5Z A;  2OKU A;  5A6A A;  3B9Q A;  3CSK A;  5A69 A;  1MMN A;  2GWW A;  3SYN A;  4MVU A;  2R7X A;  1B68 A;  3C18 A;  3LAY A;  1V4A A;  2CDQ A;  3L8I A;  3POV A;  5T1D B;  3LEO A;  4I44 A;  3V7O A;  1XZP A;  2IXM A;  3GEH A;  3ZTZ A;  4XEV A;  1RMV A;  4P9F A;  3Q7L A;  4JTC B;  2Y39 A;  4AK9 A;  3W8I A;  3M79 A;  3JZ0 A;  3V5Y A;  3ASO C;  4CX9 A;  2IXO A;  2R25 A;  2P0N A;  1ZVZ A;  1BR4 A;  1LS1 A;  3RH3 A;  2PF4 E;  4J32 B;  3W2V A;  2JX0 A;  1ZHX A;  2V26 A;  1JAF A;  3ATP A;  1QPU A;  2WVQ A;  3EGX B;  3L1M A;  3H2U A;  3MBG A;  2J46 A;  2TMV P;  2L6G A;  2RD9 A;  1RJ9 B;  3K6B A;  1UFB A;  2L6H A;  2HJ3 A;  4CS9 C;  2AVK A;  1YZC A;  4EUK B;  5EK0 A;  3L34 A;  3N0T A;  4JZA A;  3M1C B;  2D5R B;  3RQG A;  4BG0 A;  4J30 B;  1LI7 A;  1K40 A;  1J8Y F;  1MMA A;  1PV3 A;  2L9J A;  5KYU B;  1H9T A;  2KSF A;  2OJQ A;  3Q7G A;  3F46 A;  3ASN C;  4CS8 C;  4O79 A;  2CW0 F;  4DVZ A;  1FNT c;  3HNJ A;  1EI7 A;  2VAS A;  2QLA A;  2IYL D; 
#chains in the Genus database with same CATH homology
 3S9O A;  3JZ0 A;  1KTM A;  2YWA A;  1OW6 A;  3B71 A;  2JX0 A;  3U3F A;  1QVX A;  2L6F A;  3TUL A;  3GM2 A;  1K04 A;  1K05 A;  2JPU A;  2L6G A;  3C8G A;  4EBK A;  3U0C A;  5F28 E;  3AJM A;  1WWP A;  3RQE A;  3JYY A;  1UFB A;  2L6H A;  3MFN A;  3BRJ A;  4XEK A;  3GM1 A;  2KK1 A;  3C8G D;  3RQG A;  4EBJ A;  3RQF A;  1JOG A;  1WTY A;  3GM3 A;  1K40 A;  1PV3 A;  4R32 A;  4NQF A;  3C18 A;  1V4A A;  1ZZP A;  3L8I A;  1OW7 A;  1KNY A;  1WOL A;  3L8J A;  4XEF A;  2Q00 A;  3O10 A;  4XEV A;  3C8G B;  3K7D A;  2PBE A;  1OW8 A;  2LK4 A;  2HSB A;  1O3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...