5TJ5E

Atomic model for the membrane-embedded motor of a eukaryotic v-atpase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
138
Chain Sequence
b'APFFGAIGCASAIIFTSLGAAYGTAKSGVLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type proton ATPase subunit a
publication title Atomic model for the membrane-embedded VO motor of a eukaryotic V-ATPase.
pubmed doi rcsb
molecule tags Motor protein
total genus 43
structure length 138
sequence length 150
chains with identical sequence F, G, H, I, J, M, N
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 5tj5E00
2DB4A 4BEMJ 3AOUA 5TJ5E 2BL2A 2CYDA
chains in the Genus database with same CATH superfamily
4JCHA 1TQGA 3EJNA 3ZIBA 2FFHA 3N0TA 4EIYA 2Y69C 5DQZA 4ULWA 4WABA 2KSFA 1B68A 5E33A 3U9MA 2Q3TA 3UR3C 3IQ5A 3EGXB 5EHHA 3N24A 2GFHA 1OW6A 3IQ6A 4JKVA 1QVXA 1A7VA 1R5ID 3DZAA 1IW7F 1KNYA 3NYLA 3GEIA 2WZLA 2XXAA 3QW1A 1WOLA 1QQ3A 1FAPB 4DRIB 2RSEB 1Z3IX 3TULA 3U8VA 2LIGA 2XLOA 4XQ1A 3RQFA 2NPUA 2HJ3A 3EH2A 5B3IA 3AOUA 3AQCA 2NUPB 3RW0A 1M2VA 2CDQA 2P1AA 5B1AC 5KYWB 2EPMX 4O6NA 1HMOA 4NTFA 4EUKB 4BEMJ 4CJOA 3O39A 3NMIA 3NG1A 4O6YA 2R05A 4P9TA 3W2WA 2W4MA 5BQIA 3EH1A 3UGPA 3US6A 1S7ZA 3POVA 3T9OA 2IXNA 2OKUA 1VYKA 1O3UA 2VCAA 1H7IA 2Y3GA 3LLKA 4AL0A 5L0JA 5KYYB 4BJTA 1YZAA 1KU2A 2ZPAA 2CCYA 1A41A 1LM3B 4LACB 3J06A 2KC3A 3G4ZA 5HV9A 3VYWA 2EIMC 5BQGA 3B9QA 2J0WA 3DJUB 1YVIA 1NBBA 1M56C 2JD3A 2HV6A 5KYUB 4I1OB 1NSGB 1Q0DA 1RMVA 1M6TA 1BZ4A 2OEVA 1D1CA 2XM0A 3CQZA 3MYIA 3VRCA 1E84A 3GEEA 1BDJB 3EZHA 2OG2A 3HNKA 4JC7A 1DOVA 4JW1A 3T6GB 2R25A 3AGTA 3RFYA 5KYXA 3GWLA 4QI0A 4U5CE 1T6UA 1OW8A 1YA7O 2XLVA 1R4TA 3EG9A 3FDQA 3FHDA 1T01A 1T5OA 1T6QA 2RD9A 3EFOB 2YLDA 5DS6A 1YYXA 4CS7A 1OKKA 1T6IA 1ZYRF 1FMVA 2VCCA 4JEAA 5A69A 2NUPA 5JUAA 3ZTZA 3HJCA 1HW2A 3RQGA 2YQYA 2Q4FA 4K1OA 2H7VC 3RVYA 1YZCA 1D0ZA 4MVSA 3OEOA 2WZFA 5JSLA 4KNWA 4PK4A 4XPXA 5A6KA 3RVZA 3UGOA 2R03A 3KKBA 3WAQA 4XWJA 1QKRA 2H7BA 4GQHA 1SMYF 2OJQA 3EQLF 4PFPA 4Z9IA 5KYYA 4NTBA 3CZ6A 1LVKA 3S84A 2DGJA 5GPGB 2WZGA 5AC4A 3G50A 4BG0A 5L0GA 1LS1A 2M64A 5D91A 4AK9A 2GA0A 2OEXA 2WL8A 2PNOA 5COGA 1PD1A 2HMZA 3S28A 3Q7GA 2R7UA 4YT2A 3H2UA 3MYFA 1APCA 3RYLA 3AQBA 2J9BA 5KYUA 3GM2A 3RF3A 1WTYA 4XEKA 2Y3BA 5K0IA 1GGQA 2ZXOA 256BA 1XZPA 4MVMA 3V5ZA 3N2ZB 3QTHA 3FMSA 3DAFA 1J8YF 1OKKD 3HNJA 2J9VA 3QZCA 2A6HF 2V3CC 1EI7A 2H7OA 1HY5A 2ZXRA 3C62A 1T9KA 3DWWA 4MTGA 3LNRA 1UG7A 4NQFA 3ZSUA 2AWYA 2WVOA 2C03A 4U5BE 2XXAB 3RH3A 4KI2A 4IARA 3IEEA 1CGNA 1RKCA 1TKNA 2Z15A 4DRJB 1H9GA 1QZXA 1ORJA 1WN0A 3DJNB 1JMWA 3K7DA 4JIOA 2CGEA 1VYIA 2VASA 2YRFA 3G4XA 2X0CA 4DXWA 5EGYA 4YK5A 2I15A 3KYJA 2P7VA 1M2VB 5DS5A 2YVKA 2I8BA 1I4ZA 2CNWD 3NKDA 1RJ9A 3LAYA 3FAPB 4PJLA 3QW0A 2MWQA 3GORA 4PJJA 3TJ6A 2LCHA 2J9UA 4D4XA 1LPEA 2QTVA 4JZAA 4O6MA 4DBQA 4EWCA 4K0DA 3SP1A 2PP4A 3JSZA 5T3TA 2LK4A 3QVZA 1CPQA 3FVYA 4MVUA 2OOCA 4IAOA 1TFOB 3AJMA 3Q6NA 4JTDB 1V55C 2R9RB 4G7ZF 3SXMA 3R7CA 4CS9A 2Q9CA 1K05A 1TWHA 2HFIA 1D1BA 2R7QA 4LDRA 4U9EA 4RDAA 4Z9JA 4MVQA 2EPOA 4EHPA 1G4WR 2W4BA 2NSFA 3DXJF 3LESA 2YLGA 3WODF 1U6HA 1ZZPA 1LI7A 2J7PD 4I1MA 2R7WA 4NC3A 2TMVP 3RKOF 4BPMA 2XRHA 2BC5A 2IYLD 4U5GA 4IJJA 5L0FA 1EQ1A 4EBBA 2EIKC 2KQ9A 4JEBA 1KTMA 3EG9B 3AG3C 4AX2A 2HSQA 2L9JA 2WVNA 2L6FA 3U3BA 3M1CB 3DM9B 2W9YA 1D0YA 2AVKA 3X1OA 2WVQA 3K66A 1FMWA 2KJGA 5DS4A 3GM3A 1GM5A 1OXBA 1HE1A 2OQMA 5A6BD 2CYDA 1MNDA 1NLXA 3KH2A 3O55A 1RKEA 2NUTA 5JRAA 1K40A 4BJ5C 2WB7A 3PDMP 2G62A 4DBRA 4MW8A 2H8AA 3L1MA 4U9DA 3EZIA 4YL0A 3U5SA 3UNGC 3B0PA 3DE9A 3RIPA 3U2MA 1OCCC 1BR4A 3MBGA 1PD0A 1QLEC 1FNTc 1TWAA 2HKVA 3C8GA 3U9JA 1MMNA 1F1MA 2XLHA 3CEXA 3SNHA 2IXMA 3HNIA 3OA1A 4ULVA 1Z7Qc 3T6BA 3M4CA 3S90A 1VTMP 4JE9A 2ZXWC 4AL1A 1C02A 4EKWA 1BR1A 3TJ5A 4I44A 3MX3A 4DRHB 2XSEA 3GEHA 1D0XA 4OIPF 1TFKB 1Z23A 4E7ZA 1UFBA 2E87A 3L8IA 5T3WA 5BUOA 4WGZA 4R32A 4U5EE 4IRUA 1Q0FA 4WJ0A 1OCZC 3AG1C 4C3BA 2QNLA 2LFDA 4BEJA 2A1DD 3ZDLA 1JR8A 3B29A 5E3CA 1LE4A 4XLNF 2YEVA 3E70C 4OIQF 2L81A 4OD5A 4Q7CA 1O87A 1OCRC 4CSAC 2L6GA 2J8WA 5F5HA 1A7EA 1CGME 2OJED 2VCBA 4OIOF 1WWPA 3C7JA 3EGDB 3NMKA 2OCCC 4LDQA 2G3VA 3R2PA 1U0BB 2A0UA 1CPRA 2DYSC 3B71A 1LS4A 1RXQA 3C8GD 3M79A 2XM4A 3EHMA 5KYNA 4P6IC 4XLPF 3T4RA 2BE5F 2VH3A 2YZSA 4EBJA 1RJ9B 1YA9A 4FWVA 1ZW2A 4J7YA 4LLEA 4IGGA 2KYHA 4JTAB 5COFA 4DVYP 2IM8A 2CW0F 3DMDA 3VM6A 2M4EA 4PACA 3LS1A 1VMAA 3UMKA 4D4NA 1OQCA 1WATA 3ZG1A 4YT4A 4YL1A 5EK0A 2NG1A 3MLGA 3ZVRA 2EPKX 4AE4B 4MTOA 1I5NA 3PCVA 4J7TA 5B1BC 3DKAA 3GWNA 3EHNA 5JP7A 2YL3A 4B6IA 4P9FA 5AGFA 1WGWA 2LFFA 2LSEA 4U5FE 1C03A 1LIHA 1NU9C 1A0BA 1E2XA 1JPNA 2LD6A 3U3FA 1GS9A 4BJ6A 1XWJA 2EIJC 1YYJA 4CJGA 2F22A 4J30B 4KNVA 2FGYA 2MHRA 3WHNA 2ICWG 3NRHA 2UUHA 4CS9C 1E86A 4A2NB 1BBHA 1Q0GA 3LEVA 2PX3A 3Q7LA 2JPUA 2XLMA 3EGDA 3ZQYA 3KYIA 1AUEA 3JRTA 5L0IA 4M63A 3W8IA 2Y3HA 4HEAJ 1YJGA 4IWBA 4JJFA 1W2WA 5CI8A 5KYXB 1L3PA 1RKEB 1ZVZA 2GWWA 2KK1A 1U89A 1NU7D 2KNHA 2NUTB 1FTSA 4IB4A 3L8JA 3T6JA 3V5XA 4FESA 2R7TA 1NG1A 3JYHA 1E85A 4E7SA 2ETSA 3M4BA 3HNLA 1G4US 1LKXA 1S05A 2L6HA 2ZXPA 3JRMO 3OWTA 2P0NA 3RQEA 3C8ZA 2DB4A 4C7OA 4N6HA 2DYRC 2YL0A 3C8GB 3A11A 3UMIA 3V7OA 4DOZA 1VK5A 1ZHZA 2EILC 1Z5ZA 5IY5C 2AU5A 3BRJA 3E9VA 4MS2A 1JAFA 1YDIA 2QY9A 4LDKA 4XEFA 3VF0A 4AE4A 3FOOA 4CS8A 4JCZA 2J0XA 2Q00A 3W8HA 2LQGA 5A6JA 5COMA 3PMRA 1O5HA 1ZU4A 4FX5A 2ASRA 2R7XA 4CIHA 4ANJA 2XLDA 3O10A 4JTCB 4HFKB 1H6GA 5F28E 2J9WA 1FFTC 3M15A 3K1IA 5L0DA 2EINC 3IHUA 4PJNA 1L7CA 3ZTMA 4XTKA 1ZU5A 4N4WA 4PR9A 1ORYA 3FAJA 3K33A 2ZD9A 4OIRF 3U0CA 1YAUO 3AG4C 2B0JA 2HV7A 1GQAA 3U8PA 4NY3A 1ZHXA 4L6RA 4J32B 1OR2A 4PJMA 2A69F 1VLSA 2Y39A 4IAQA 5TJ5E 4UDVA 3WG7C 3ZC4A 4EBKA 3SZRA 1MMGA 3F47A 4W8KA 1G5ZA 1M57C 3ASNC 4MQ9F 3ECSA 3JYYA 5E3AA 1QSPA 2GAQA 3QMKA 4MVZA 2IOQA 4G78A 4BJ1A 3ITFA 1ORSC 1ZHWA 2QE9A 5L3QA 3V5YA 2J46A 3ABMC 1IZMA 3AG2C 3LNMB 2HS5A 1V74B 1D1AA 1NFNA 2DI3A 3NMJA 4Q5SF 2XS1A 3F46A 1H9TA 1MMAA 3TOLA 2P61A 2PFDA 1HMDA 1OXKA 1V4AA 1G8XA 1HE9A 2UUIA 3JT1A 4OD4A 1J8MF 2JX0A 5BQHA 5L0HA 4YWQA 3I5PA 5E2QA 4MVOA 2YWAA 4JRZA 4N06A 5CI9A 2Q9AA 2KW3C 2GDCA 2VB6A 3L0IA 3LS0A 4U5HA 3SXKA 2R7RA 1JRAA 2A0BA 2MYSA 4LLCA 2YL7A 2OU6A 1FR0A 4MTFA 4JJGA 2YLIA 3LEOA 1LE2A 4H4KC 5DQTA 3H2VA 1DOWA 3C63A 4K7BA 4YT5A 4CDVA 4W8PA 2QUPA 2L7AA 3DD7A 2P6VA 3IQCA 3SYNA 1XZQA 4E18A 4RBNA 2PBEA 4HE8D 4KC9A 2IXOA 4WGYA 4F4BA 2IXPA 3K6BA 3MFNA 3I4UA 1EA8A 4CIPA 5DLJA 3DE8A 1Z6AA 4N6CA 1Q0MA 3NYMA 1BR2A 4CDAA 2YKZA 3CAXA 2EPNA 5JLIA 1A7DA 1TWGA 3CSKA 4CBEA 4NCQA 4CX9A 1TWCA 5F5FA 2EPLX 3KMIA 3VAYA 4JVSA 4BJ6C 2R7SA 2HMQA 4BJ5A 5A6AA 1MNEA 2HUJA 2HJMA 2O9XA 3EGXA 2D4UA 4MVRA 2YHSA 3W4YA 1VOMA 3X2QC 4YT8A 2FAPB 2AP3A 3PHF2 1YLMA 2NSGA 1VB5A 1ZHYA 3S0XA 3B0UX 1MMDA 5D92A 5B3SC 3GANA 1I4YA 2C04A 2QLAA 2V26A 3O6XA 4C7OB 3JTLO 2Y3DA 3HKKA 1Q0KA 3GM1A 3I5QA 3LJBA 3DAGA 3S29A 4C3EA 4XPWA 2XL4A 4RD9A 1VLTA 2XL8A 1JOGA 1ZHTA 3K1HA 2Q7RA 3ASOC 3QVYA 2IBFA 1CGOA 3HTKC 5KYWA 1Y4CA 2R7VA 1Y6DA 2A68F 1EKYA 3KL4A 4H54A 1OW7A 2XL6A 4KBLA 5FZTA 4G7HF 4O79A 5AC5A 5HSWA 1WASA 2VC9A 1SYQA 4I3MA 4A4AA 3C18A 1PCXA 5L3VA 4LERA 4MNDA 1LI5A 2XS8A 4Q4ZF 3TK0A 4QI2A 2PX0A 2CNWA 1AVOB 3NDBB 2PF4E 3S27A 3SXZA 1SF8A 1QPUA 4CS8C 5FCLA 1JPJA 3TOMA 3TD7A 3ABLC 4YN0B 4XPYA 4OINF 4E17A 4ZLDA 3AGUA 2R7OA 4C3DA 4CSAA 5JT4A 3NYJA 3SXYA 3TQOA 1C17M 4E0HA 4PFOA 3K1IC 1NFOA 3HLZA 4U5DE 1N1CA 3FOPA 4G7OF 1ST6A 1RCPA 2YL1A 3ATPA 3EFOA 4O7GA 2J45A 3Q6MA 2AWCA 3ZWIA 1SR2A 2XLWA 5JVEA 5T1DB 3ZQVA 3KPHA 2J7PA 2G3KA 3FXHA 3IQTA 5DVWA 4DJ9A 1MQVA 1AEPA 1OCOC 2BL2A 2D5RB 2XLEA 2LP4A 4JURI 3DM5A 3H65A 4YJWA 1HW1A 3LLIA 2R02A 3UMHA 2B0HA 4QDLA 4X0RA 4FAPB 3IPMO 4ZLCA 4Z9HA 4DVZA 1ZW3A 1M2OA 5JS5A 4XEVA 3JZ0A 2X51A 3L34A 4MW3A 4ONSA 3S9OA 1FFHA 3ABKC 4GEHA 5A6BA 5L0CA 3W2VA 1TR2A 4ER9A 3JCUQ 1NZEA 1E83A 2W45A 3DI5A 4G0HA 1YARO 1OR3A 3LUTB 4CDYA 3A9CA 5CIVA 3B0VC 1K04A 3SEOA 2Q9BA 3BEHA 4YL3A 4E0IA 3JSEO 4NTAA 2KGOA 1V54C 1PV3A 2HZ8A 2HSBA 1Z63A 3U2LA 4HFFB 4GYTA 3NKEA 1SZIA 3EPVA 3GODA 2A6EF
chains in the Genus database with same CATH topology
2DB4A 4BEMJ 3AOUA 5TJ5E 2BL2A 2CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DB4 A;  4BEM J;  3AOU A;  5TJ5 E;  2BL2 A;  2CYD A; 
#chains in the Genus database with same CATH topology
 4JCH A;  1TQG A;  3EJN A;  3ZIB A;  2FFH A;  3N0T A;  4EIY A;  2Y69 C;  5DQZ A;  4ULW A;  4WAB A;  2KSF A;  1B68 A;  5E33 A;  3U9M A;  2Q3T A;  3UR3 C;  3IQ5 A;  3EGX B;  5EHH A;  3N24 A;  2GFH A;  1OW6 A;  3IQ6 A;  4JKV A;  1QVX A;  1A7V A;  1R5I D;  3DZA A;  1IW7 F;  1KNY A;  3NYL A;  3GEI A;  2WZL A;  2XXA A;  3QW1 A;  1WOL A;  1QQ3 A;  1FAP B;  4DRI B;  2RSE B;  1Z3I X;  3TUL A;  3U8V A;  2LIG A;  2XLO A;  4XQ1 A;  3RQF A;  2NPU A;  2HJ3 A;  3EH2 A;  5B3I A;  3AOU A;  3AQC A;  2NUP B;  3RW0 A;  1M2V A;  2CDQ A;  2P1A A;  5B1A C;  5KYW B;  2EPM X;  4O6N A;  1HMO A;  4NTF A;  4EUK B;  4BEM J;  4CJO A;  3O39 A;  3NMI A;  3NG1 A;  4O6Y A;  2R05 A;  4P9T A;  3W2W A;  2W4M A;  5BQI A;  3EH1 A;  3UGP A;  3US6 A;  1S7Z A;  3POV A;  3T9O A;  2IXN A;  2OKU A;  1VYK A;  1O3U A;  2VCA A;  1H7I A;  2Y3G A;  3LLK A;  4AL0 A;  5L0J A;  5KYY B;  4BJT A;  1YZA A;  1KU2 A;  2ZPA A;  2CCY A;  1A41 A;  1LM3 B;  4LAC B;  3J06 A;  2KC3 A;  3G4Z A;  5HV9 A;  3VYW A;  2EIM C;  5BQG A;  3B9Q A;  2J0W A;  3DJU B;  1YVI A;  1NBB A;  1M56 C;  2JD3 A;  2HV6 A;  5KYU B;  4I1O B;  1NSG B;  1Q0D A;  1RMV A;  1M6T A;  1BZ4 A;  2OEV A;  1D1C A;  2XM0 A;  3CQZ A;  3MYI A;  3VRC A;  1E84 A;  3GEE A;  1BDJ B;  3EZH A;  2OG2 A;  3HNK A;  4JC7 A;  1DOV A;  4JW1 A;  3T6G B;  2R25 A;  3AGT A;  3RFY A;  5KYX A;  3GWL A;  4QI0 A;  4U5C E;  1T6U A;  1OW8 A;  1YA7 O;  2XLV A;  1R4T A;  3EG9 A;  3FDQ A;  3FHD A;  1T01 A;  1T5O A;  1T6Q A;  2RD9 A;  3EFO B;  2YLD A;  5DS6 A;  1YYX A;  4CS7 A;  1OKK A;  1T6I A;  1ZYR F;  1FMV A;  2VCC A;  4JEA A;  5A69 A;  2NUP A;  5JUA A;  3ZTZ A;  3HJC A;  1HW2 A;  3RQG A;  2YQY A;  2Q4F A;  4K1O A;  2H7V C;  3RVY A;  1YZC A;  1D0Z A;  4MVS A;  3OEO A;  2WZF A;  5JSL A;  4KNW A;  4PK4 A;  4XPX A;  5A6K A;  3RVZ A;  3UGO A;  2R03 A;  3KKB A;  3WAQ A;  4XWJ A;  1QKR A;  2H7B A;  4GQH A;  1SMY F;  2OJQ A;  3EQL F;  4PFP A;  4Z9I A;  5KYY A;  4NTB A;  3CZ6 A;  1LVK A;  3S84 A;  2DGJ A;  5GPG B;  2WZG A;  5AC4 A;  3G50 A;  4BG0 A;  5L0G A;  1LS1 A;  2M64 A;  5D91 A;  4AK9 A;  2GA0 A;  2OEX A;  2WL8 A;  2PNO A;  5COG A;  1PD1 A;  2HMZ A;  3S28 A;  3Q7G A;  2R7U A;  4YT2 A;  3H2U A;  3MYF A;  1APC A;  3RYL A;  3AQB A;  2J9B A;  5KYU A;  3GM2 A;  3RF3 A;  1WTY A;  4XEK A;  2Y3B A;  5K0I A;  1GGQ A;  2ZXO A;  256B A;  1XZP A;  4MVM A;  3V5Z A;  3N2Z B;  3QTH A;  3FMS A;  3DAF A;  1J8Y F;  1OKK D;  3HNJ A;  2J9V A;  3QZC A;  2A6H F;  2V3C C;  1EI7 A;  2H7O A;  1HY5 A;  2ZXR A;  3C62 A;  1T9K A;  3DWW A;  4MTG A;  3LNR A;  1UG7 A;  4NQF A;  3ZSU A;  2AWY A;  2WVO A;  2C03 A;  4U5B E;  2XXA B;  3RH3 A;  4KI2 A;  4IAR A;  3IEE A;  1CGN A;  1RKC A;  1TKN A;  2Z15 A;  4DRJ B;  1H9G A;  1QZX A;  1ORJ A;  1WN0 A;  3DJN B;  1JMW A;  3K7D A;  4JIO A;  2CGE A;  1VYI A;  2VAS A;  2YRF A;  3G4X A;  2X0C A;  4DXW A;  5EGY A;  4YK5 A;  2I15 A;  3KYJ A;  2P7V A;  1M2V B;  5DS5 A;  2YVK A;  2I8B A;  1I4Z A;  2CNW D;  3NKD A;  1RJ9 A;  3LAY A;  3FAP B;  4PJL A;  3QW0 A;  2MWQ A;  3GOR A;  4PJJ A;  3TJ6 A;  2LCH A;  2J9U A;  4D4X A;  1LPE A;  2QTV A;  4JZA A;  4O6M A;  4DBQ A;  4EWC A;  4K0D A;  3SP1 A;  2PP4 A;  3JSZ A;  5T3T A;  2LK4 A;  3QVZ A;  1CPQ A;  3FVY A;  4MVU A;  2OOC A;  4IAO A;  1TFO B;  3AJM A;  3Q6N A;  4JTD B;  1V55 C;  2R9R B;  4G7Z F;  3SXM A;  3R7C A;  4CS9 A;  2Q9C A;  1K05 A;  1TWH A;  2HFI A;  1D1B A;  2R7Q A;  4LDR A;  4U9E A;  4RDA A;  4Z9J A;  4MVQ A;  2EPO A;  4EHP A;  1G4W R;  2W4B A;  2NSF A;  3DXJ F;  3LES A;  2YLG A;  3WOD F;  1U6H A;  1ZZP A;  1LI7 A;  2J7P D;  4I1M A;  2R7W A;  4NC3 A;  2TMV P;  3RKO F;  4BPM A;  2XRH A;  2BC5 A;  2IYL D;  4U5G A;  4IJJ A;  5L0F A;  1EQ1 A;  4EBB A;  2EIK C;  2KQ9 A;  4JEB A;  1KTM A;  3EG9 B;  3AG3 C;  4AX2 A;  2HSQ A;  2L9J A;  2WVN A;  2L6F A;  3U3B A;  3M1C B;  3DM9 B;  2W9Y A;  1D0Y A;  2AVK A;  3X1O A;  2WVQ A;  3K66 A;  1FMW A;  2KJG A;  5DS4 A;  3GM3 A;  1GM5 A;  1OXB A;  1HE1 A;  2OQM A;  5A6B D;  2CYD A;  1MND A;  1NLX A;  3KH2 A;  3O55 A;  1RKE A;  2NUT A;  5JRA A;  1K40 A;  4BJ5 C;  2WB7 A;  3PDM P;  2G62 A;  4DBR A;  4MW8 A;  2H8A A;  3L1M A;  4U9D A;  3EZI A;  4YL0 A;  3U5S A;  3UNG C;  3B0P A;  3DE9 A;  3RIP A;  3U2M A;  1OCC C;  1BR4 A;  3MBG A;  1PD0 A;  1QLE C;  1FNT c;  1TWA A;  2HKV A;  3C8G A;  3U9J A;  1MMN A;  1F1M A;  2XLH A;  3CEX A;  3SNH A;  2IXM A;  3HNI A;  3OA1 A;  4ULV A;  1Z7Q c;  3T6B A;  3M4C A;  3S90 A;  1VTM P;  4JE9 A;  2ZXW C;  4AL1 A;  1C02 A;  4EKW A;  1BR1 A;  3TJ5 A;  4I44 A;  3MX3 A;  4DRH B;  2XSE A;  3GEH A;  1D0X A;  4OIP F;  1TFK B;  1Z23 A;  4E7Z A;  1UFB A;  2E87 A;  3L8I A;  5T3W A;  5BUO A;  4WGZ A;  4R32 A;  4U5E E;  4IRU A;  1Q0F A;  4WJ0 A;  1OCZ C;  3AG1 C;  4C3B A;  2QNL A;  2LFD A;  4BEJ A;  2A1D D;  3ZDL A;  1JR8 A;  3B29 A;  5E3C A;  1LE4 A;  4XLN F;  2YEV A;  3E70 C;  4OIQ F;  2L81 A;  4OD5 A;  4Q7C A;  1O87 A;  1OCR C;  4CSA C;  2L6G A;  2J8W A;  5F5H A;  1A7E A;  1CGM E;  2OJE D;  2VCB A;  4OIO F;  1WWP A;  3C7J A;  3EGD B;  3NMK A;  2OCC C;  4LDQ A;  2G3V A;  3R2P A;  1U0B B;  2A0U A;  1CPR A;  2DYS C;  3B71 A;  1LS4 A;  1RXQ A;  3C8G D;  3M79 A;  2XM4 A;  3EHM A;  5KYN A;  4P6I C;  4XLP F;  3T4R A;  2BE5 F;  2VH3 A;  2YZS A;  4EBJ A;  1RJ9 B;  1YA9 A;  4FWV A;  1ZW2 A;  4J7Y A;  4LLE A;  4IGG A;  2KYH A;  4JTA B;  5COF A;  4DVY P;  2IM8 A;  2CW0 F;  3DMD A;  3VM6 A;  2M4E A;  4PAC A;  3LS1 A;  1VMA A;  3UMK A;  4D4N A;  1OQC A;  1WAT A;  3ZG1 A;  4YT4 A;  4YL1 A;  5EK0 A;  2NG1 A;  3MLG A;  3ZVR A;  2EPK X;  4AE4 B;  4MTO A;  1I5N A;  3PCV A;  4J7T A;  5B1B C;  3DKA A;  3GWN A;  3EHN A;  5JP7 A;  2YL3 A;  4B6I A;  4P9F A;  5AGF A;  1WGW A;  2LFF A;  2LSE A;  4U5F E;  1C03 A;  1LIH A;  1NU9 C;  1A0B A;  1E2X A;  1JPN A;  2LD6 A;  3U3F A;  1GS9 A;  4BJ6 A;  1XWJ A;  2EIJ C;  1YYJ A;  4CJG A;  2F22 A;  4J30 B;  4KNV A;  2FGY A;  2MHR A;  3WHN A;  2ICW G;  3NRH A;  2UUH A;  4CS9 C;  1E86 A;  4A2N B;  1BBH A;  1Q0G A;  3LEV A;  2PX3 A;  3Q7L A;  2JPU A;  2XLM A;  3EGD A;  3ZQY A;  3KYI A;  1AUE A;  3JRT A;  5L0I A;  4M63 A;  3W8I A;  2Y3H A;  4HEA J;  1YJG A;  4IWB A;  4JJF A;  1W2W A;  5CI8 A;  5KYX B;  1L3P A;  1RKE B;  1ZVZ A;  2GWW A;  2KK1 A;  1U89 A;  1NU7 D;  2KNH A;  2NUT B;  1FTS A;  4IB4 A;  3L8J A;  3T6J A;  3V5X A;  4FES A;  2R7T A;  1NG1 A;  3JYH A;  1E85 A;  4E7S A;  2ETS A;  3M4B A;  3HNL A;  1G4U S;  1LKX A;  1S05 A;  2L6H A;  2ZXP A;  3JRM O;  3OWT A;  2P0N A;  3RQE A;  3C8Z A;  2DB4 A;  4C7O A;  4N6H A;  2DYR C;  2YL0 A;  3C8G B;  3A11 A;  3UMI A;  3V7O A;  4DOZ A;  1VK5 A;  1ZHZ A;  2EIL C;  1Z5Z A;  5IY5 C;  2AU5 A;  3BRJ A;  3E9V A;  4MS2 A;  1JAF A;  1YDI A;  2QY9 A;  4LDK A;  4XEF A;  3VF0 A;  4AE4 A;  3FOO A;  4CS8 A;  4JCZ A;  2J0X A;  2Q00 A;  3W8H A;  2LQG A;  5A6J A;  5COM A;  3PMR A;  1O5H A;  1ZU4 A;  4FX5 A;  2ASR A;  2R7X A;  4CIH A;  4ANJ A;  2XLD A;  3O10 A;  4JTC B;  4HFK B;  1H6G A;  5F28 E;  2J9W A;  1FFT C;  3M15 A;  3K1I A;  5L0D A;  2EIN C;  3IHU A;  4PJN A;  1L7C A;  3ZTM A;  4XTK A;  1ZU5 A;  4N4W A;  4PR9 A;  1ORY A;  3FAJ A;  3K33 A;  2ZD9 A;  4OIR F;  3U0C A;  1YAU O;  3AG4 C;  2B0J A;  2HV7 A;  1GQA A;  3U8P A;  4NY3 A;  1ZHX A;  4L6R A;  4J32 B;  1OR2 A;  4PJM A;  2A69 F;  1VLS A;  2Y39 A;  4IAQ A;  5TJ5 E;  4UDV A;  3WG7 C;  3ZC4 A;  4EBK A;  3SZR A;  1MMG A;  3F47 A;  4W8K A;  1G5Z A;  1M57 C;  3ASN C;  4MQ9 F;  3ECS A;  3JYY A;  5E3A A;  1QSP A;  2GAQ A;  3QMK A;  4MVZ A;  2IOQ A;  4G78 A;  4BJ1 A;  3ITF A;  1ORS C;  1ZHW A;  2QE9 A;  5L3Q A;  3V5Y A;  2J46 A;  3ABM C;  1IZM A;  3AG2 C;  3LNM B;  2HS5 A;  1V74 B;  1D1A A;  1NFN A;  2DI3 A;  3NMJ A;  4Q5S F;  2XS1 A;  3F46 A;  1H9T A;  1MMA A;  3TOL A;  2P61 A;  2PFD A;  1HMD A;  1OXK A;  1V4A A;  1G8X A;  1HE9 A;  2UUI A;  3JT1 A;  4OD4 A;  1J8M F;  2JX0 A;  5BQH A;  5L0H A;  4YWQ A;  3I5P A;  5E2Q A;  4MVO A;  2YWA A;  4JRZ A;  4N06 A;  5CI9 A;  2Q9A A;  2KW3 C;  2GDC A;  2VB6 A;  3L0I A;  3LS0 A;  4U5H A;  3SXK A;  2R7R A;  1JRA A;  2A0B A;  2MYS A;  4LLC A;  2YL7 A;  2OU6 A;  1FR0 A;  4MTF A;  4JJG A;  2YLI A;  3LEO A;  1LE2 A;  4H4K C;  5DQT A;  3H2V A;  1DOW A;  3C63 A;  4K7B A;  4YT5 A;  4CDV A;  4W8P A;  2QUP A;  2L7A A;  3DD7 A;  2P6V A;  3IQC A;  3SYN A;  1XZQ A;  4E18 A;  4RBN A;  2PBE A;  4HE8 D;  4KC9 A;  2IXO A;  4WGY A;  4F4B A;  2IXP A;  3K6B A;  3MFN A;  3I4U A;  1EA8 A;  4CIP A;  5DLJ A;  3DE8 A;  1Z6A A;  4N6C A;  1Q0M A;  3NYM A;  1BR2 A;  4CDA A;  2YKZ A;  3CAX A;  2EPN A;  5JLI A;  1A7D A;  1TWG A;  3CSK A;  4CBE A;  4NCQ A;  4CX9 A;  1TWC A;  5F5F A;  2EPL X;  3KMI A;  3VAY A;  4JVS A;  4BJ6 C;  2R7S A;  2HMQ A;  4BJ5 A;  5A6A A;  1MNE A;  2HUJ A;  2HJM A;  2O9X A;  3EGX A;  2D4U A;  4MVR A;  2YHS A;  3W4Y A;  1VOM A;  3X2Q C;  4YT8 A;  2FAP B;  2AP3 A;  3PHF 2;  1YLM A;  2NSG A;  1VB5 A;  1ZHY A;  3S0X A;  3B0U X;  1MMD A;  5D92 A;  5B3S C;  3GAN A;  1I4Y A;  2C04 A;  2QLA A;  2V26 A;  3O6X A;  4C7O B;  3JTL O;  2Y3D A;  3HKK A;  1Q0K A;  3GM1 A;  3I5Q A;  3LJB A;  3DAG A;  3S29 A;  4C3E A;  4XPW A;  2XL4 A;  4RD9 A;  1VLT A;  2XL8 A;  1JOG A;  1ZHT A;  3K1H A;  2Q7R A;  3ASO C;  3QVY A;  2IBF A;  1CGO A;  3HTK C;  5KYW A;  1Y4C A;  2R7V A;  1Y6D A;  2A68 F;  1EKY A;  3KL4 A;  4H54 A;  1OW7 A;  2XL6 A;  4KBL A;  5FZT A;  4G7H F;  4O79 A;  5AC5 A;  5HSW A;  1WAS A;  2VC9 A;  1SYQ A;  4I3M A;  4A4A A;  3C18 A;  1PCX A;  5L3V A;  4LER A;  4MND A;  1LI5 A;  2XS8 A;  4Q4Z F;  3TK0 A;  4QI2 A;  2PX0 A;  2CNW A;  1AVO B;  3NDB B;  2PF4 E;  3S27 A;  3SXZ A;  1SF8 A;  1QPU A;  4CS8 C;  5FCL A;  1JPJ A;  3TOM A;  3TD7 A;  3ABL C;  4YN0 B;  4XPY A;  4OIN F;  4E17 A;  4ZLD A;  3AGU A;  2R7O A;  4C3D A;  4CSA A;  5JT4 A;  3NYJ A;  3SXY A;  3TQO A;  1C17 M;  4E0H A;  4PFO A;  3K1I C;  1NFO A;  3HLZ A;  4U5D E;  1N1C A;  3FOP A;  4G7O F;  1ST6 A;  1RCP A;  2YL1 A;  3ATP A;  3EFO A;  4O7G A;  2J45 A;  3Q6M A;  2AWC A;  3ZWI A;  1SR2 A;  2XLW A;  5JVE A;  5T1D B;  3ZQV A;  3KPH A;  2J7P A;  2G3K A;  3FXH A;  3IQT A;  5DVW A;  4DJ9 A;  1MQV A;  1AEP A;  1OCO C;  2BL2 A;  2D5R B;  2XLE A;  2LP4 A;  4JUR I;  3DM5 A;  3H65 A;  4YJW A;  1HW1 A;  3LLI A;  2R02 A;  3UMH A;  2B0H A;  4QDL A;  4X0R A;  4FAP B;  3IPM O;  4ZLC A;  4Z9H A;  4DVZ A;  1ZW3 A;  1M2O A;  5JS5 A;  4XEV A;  3JZ0 A;  2X51 A;  3L34 A;  4MW3 A;  4ONS A;  3S9O A;  1FFH A;  3ABK C;  4GEH A;  5A6B A;  5L0C A;  3W2V A;  1TR2 A;  4ER9 A;  3JCU Q;  1NZE A;  1E83 A;  2W45 A;  3DI5 A;  4G0H A;  1YAR O;  1OR3 A;  3LUT B;  4CDY A;  3A9C A;  5CIV A;  3B0V C;  1K04 A;  3SEO A;  2Q9B A;  3BEH A;  4YL3 A;  4E0I A;  3JSE O;  4NTA A;  2KGO A;  1V54 C;  1PV3 A;  2HZ8 A;  2HSB A;  1Z63 A;  3U2L A;  4HFF B;  4GYT A;  3NKE A;  1SZI A;  3EPV A;  3GOD A;  2A6E F; 
#chains in the Genus database with same CATH homology
 2DB4 A;  4BEM J;  3AOU A;  5TJ5 E;  2BL2 A;  2CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...