5TJ5E

Atomic model for the membrane-embedded motor of a eukaryotic v-atpase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
138
Chain Sequence
APFFGAIGCASAIIFTSLGAAYGTAKSGVLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type proton ATPase subunit a
publication title Atomic model for the membrane-embedded VO motor of a eukaryotic V-ATPase.
pubmed doi rcsb
molecule tags Motor protein
total genus 43
structure length 138
sequence length 150
chains with identical sequence F, G, H, I, J, M, N
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 5tj5E00
5TJ5E 4BEMJ 2BL2A 2DB4A 3AOUA 2CYDA
chains in the Genus database with same CATH superfamily
2XL8A 1D1CA 4Q7CA 2QUPA 2C03A 3EG9A 4JVSA 2Q7RA 3U8VA 1FR0A 1H6GA 2CGEA 2WVQA 3NYMA 4ER9A 3DAGA 4O6MA 4LLCA 4DRJB 4C7OB 3WAQA 4M63A 3GEEA 2DB4A 3FOOA 3OA1A 4CBEA 1YDIA 2KK1A 2J9VA 2Y39A 2ETSA 2YZSA 3SXKA 3T6GB 3U8PA 1YAUO 2L6FA 4I3MA 3FXHA 3R7CA 4BPMA 5A69A 3C8ZA 3B29A 2XL6A 4KNVA 2XSEA 2CNWA 3HNIA 3N0TA 3AQBA 2YLDA 2YRFA 3MYIA 3NMKA 3LNMB 4DJ9A 3H2UA 1RKEA 2PP4A 1A7EA 3QMKA 2Y69C 3QW1A 3RH3A 2B0JA 2QNLA 3EJNA 4BJ5C 4BJTA 1GQAA 4H4KC 2EPOA 1GGQA 3HNLA 2LP4A 4XLPF 4MVSA 5L0IA 4C3EA 4QI0A 3S28A 1BZ4A 1NU9C 3AG4C 4DVZA 3LS1A 1D0YA 1TWAA 5JS5A 5L3QA 1YZAA 2Z15A 1SMYF 2LCHA 2FFHA 2J7PA 4N06A 3MX3A 5T3WA 3R2PA 1Q0FA 2IXPA 2Q3TA 4AE4A 4EBKA 2YL3A 4J32B 1C03A 2NPUA 3EZIA 2EPNA 3QZCA 2V26A 4ONSA 2P1AA 3TD7A 3POVA 2LK4A 5E3CA 3AJMA 5BUOA 2JX0A 2R7VA 1J8YF 2Y3HA 3JSEO 1T9KA 2I8BA 3ZC4A 5COFA 1OCZC 2YHSA 2VASA 1CPRA 1YVIA 3EH1A 3L8JA 5KYXA 2W4MA 5DS4A 5D92A 3DD7A 4JW1A 1W2WA 1NZEA 3MYFA 4YN0B 3HJCA 4DBRA 1U89A 4MW3A 3TOMA 1LIHA 1S7ZA 5L0HA 2LSEA 2ZD9A 3JRMO 3FDQA 4NC3A 1TKNA 4OIOF 2J45A 1Q0MA 4PFOA 1OW8A 4WGYA 2L9JA 3KMIA 1ZU4A 1TWGA 1V4AA 1YJGA 4U9EA 1TWCA 4BEJA 2HFIA 1ZZPA 2QLAA 1NG1A 2EINC 2IBFA 2ZXRA 3GEIA 3KPHA 4IGGA 5JP7A 3U2MA 1D0XA 3S90A 1LPEA 4G7ZF 1HE9A 4DOZA 5GPGB 4BEMJ 4GYTA 2DI3A 1APCA 4CDVA 4XLNF 2OJQA 1G5ZA 2KW3C 1SF8A 1JR8A 2R03A 4XWJA 5DVWA 4DXWA 2VB6A 4OIRF 3T4RA 2AWYA 3GORA 4UDVA 2IXNA 4JEAA 4RBNA 1ZW3A 3HLZA 2C04A 4NTFA 2VCAA 1O3UA 1JPJA 2NSGA 5L0DA 4FESA 4J7TA 3AQCA 1IW7F 2XM0A 4YJWA 3RVZA 5B1AC 2HJMA 2J0WA 1XZPA 2L6GA 1WOLA 2X51A 3CAXA 4J30B 1GS9A 3ZTZA 5BQHA 3F46A 1E86A 1ST6A 4MVOA 256BA 4U5GA 1I5NA 2JD3A 3S84A 5KYUB 2JPUA 2OOCA 3EHNA 1ZU5A 3HTKC 3NDBB 3RVYA 3ZWIA 1FFTC 3C8GA 4U5CE 2P7VA 5AC4A 4IAOA 2WZLA 5A6JA 3FMSA 1QZXA 3US6A 4N6CA 1VYIA 2ZPAA 4BJ5A 1QVXA 1HW2A 2R7RA 5F5FA 1Y4CA 2HZ8A 5BQIA 2XLVA 3EPVA 1OW7A 1I4ZA 1JPNA 2R7UA 3G4XA 1HW1A 2ICWG 5L0GA 4RDAA 5KYWB 3LEOA 2IM8A 3NG1A 4JCHA 2HJ3A 2J9WA 2NUPB 2YL1A 2Y3BA 3DJNB 4FWVA 3B71A 3UMIA 3UGPA 2NUTB 3RFYA 1C02A 4YK5A 3UGOA 3B0PA 2XS1A 3CZ6A 4JEBA 4U5FE 1AEPA 1OR2A 2H7VC 3E70C 4BG0A 4QI2A 1M2VA 2YKZA 3DKAA 5JSLA 1MMGA 2CYDA 2WZGA 1JAFA 2WL8A 3ZVRA 1XWJA 2HMQA 1LE2A 3GWNA 3Q7LA 1FAPB 3SEOA 4OD5A 3W8IA 2QY9A 1VB5A 3LS0A 3QTHA 2XLWA 4G7OF 4XTKA 4CS7A 1D1AA 1YLMA 2AU5A 4JZAA 2YVKA 2W9YA 3SXZA 1ORJA 4OIPF 2EPLX 4JJFA 4MVRA 1VYKA 4XEKA 2DYSC 4HFFB 2KGOA 3K1IA 4XQ1A 4KI2A 4HFKB 1I4YA 1PV3A 3JZ0A 1LE4A 3UMKA 2KYHA 4F4BA 3DAFA 4BJ6C 2OG2A 2J0XA 1A0BA 3LLKA 3EG9B 1FMWA 3HKKA 1BR1A 4N6HA 2A6EF 4XPYA 2R9RB 3FVYA 2A0BA 2HUJA 2WVOA 2CNWD 2XM4A 3EHMA 3MLGA 4G78A 2H7OA 1PD0A 2R02A 1NLXA 1HMDA 2YLIA 4L6RA 4MVUA 1TQGA 2IOQA 2OCCC 3C7JA 1NBBA 3ABLC 4YT5A 2A6HF 3O6XA 1T01A 5CI8A 4CJOA 3M4BA 5KYYA 1JOGA 2M4EA 4IRUA 4JTCB 3DZAA 1TFKB 3JT1A 4JTAB 1K40A 3UR3C 1YARO 1LS4A 4MTGA 4B6IA 3G4ZA 4JTDB 1U0BB 5KYNA 1RKEB 1AVOB 4J7YA 4D4XA 3CSKA 4PJMA 4EHPA 2WVNA 2XLEA 3L34A 3NMJA 3V5YA 5JLIA 2H8AA 2WB7A 2XLOA 3I4UA 2R7XA 1QQ3A 2Y3GA 2E87A 1RJ9B 3PDMP 2J7PD 3L1MA 2W4BA 1ZHWA 4O6NA 5DLJA 3U0CA 2J8WA 5COGA 2FGYA 1J8MF 4ULVA 4IARA 1H9GA 3A11A 4MS2A 2XLHA 1XZQA 1VOMA 1UFBA 4JCZA 3B0UX 2Q4FA 3SZRA 2GA0A 2VCCA 1ZYRF 3SXYA 5T3TA 1E83A 4MTFA 3AG1C 1OW6A 1RKCA 5BQGA 4AE4B 5AC5A 4ZLDA 3O55A 2M64A 1M2OA 1MNEA 5B1BC 4Q5SF 5DQZA 3NKEA 2CDQA 4CSAA 4PJJA 3HNJA 3IQCA 2AWCA 3Q6MA 4W8KA 4A2NB 2L81A 1EKYA 3TJ5A 4CX9A 5KYXB 1Z23A 1LI7A 5B3SC 5TJ5E 1L7CA 2R7TA 5CIVA 1BR2A 3V7OA 3EH2A 1ZHTA 3ZSUA 2AVKA 2DGJA 3S0XA 1OCCC 3LESA 3LNRA 1AUEA 4FX5A 3ZG1A 4XEFA 2GFHA 2FAPB 3K7DA 3MBGA 4R32A 1YYJA 3DI5A 1R5ID 4KC9A 2PBEA 2KC3A 2EILC 3NYJA 4PJLA 1OKKA 3PHF2 2J9UA 4E0IA 2LFFA 3FHDA 3EGDA 3LJBA 4I44A 4LDKA 3G50A 4WABA 4A4AA 1WGWA 4H54A 2R7SA 4E7SA 2Q9CA 3B9QA 1UG7A 3ZQVA 1K04A 1G8XA 1KU2A 3U3BA 1BR4A 3O39A 4BJ6A 2EIJC 3QVZA 3U2LA 1FFHA 3ABKC 1Q0KA 2CCYA 3SYNA 1CGME 1HMOA 3KYIA 1BDJB 2XLDA 1YA7O 1Y6DA 3N2ZB 4MTOA 3TOLA 1Q0DA 4LACB 2I15A 4MVQA 1M56C 4PK4A 2IYLD 3IHUA 2VC9A 4CS9C 1OXBA 2PFDA 4U5BE 4AK9A 4G7HF 3FAJA 1VLSA 5L0FA 3C8GD 1V54C 2YL0A 2ZXPA 1RCPA 1G4US 3U5SA 5D91A 4D4NA 4OIQF 4GQHA 4JE9A 4E0HA 1FMVA 4GEHA 1KNYA 2GDCA 2EPMX 5CI9A 4LDQA 2HSQA 4ZLCA 3DJUB 4ANJA 5A6BD 3W4YA 3DM5A 1OCRC 1B68A 3EFOA 1FTSA 3FAPB 2IXMA 3AGTA 5KYUA 3ZDLA 4CDYA 2HS5A 3EQLF 2KNHA 5JUAA 3KYJA 5IY5C 3PCVA 5F28E 5DS5A 3BEHA 4G0HA 2MYSA 3ASOC 3EGXA 3GODA 1M6TA 2P61A 3JYYA 2P6VA 4OINF 4AL0A 5A6KA 2RSEB 4FAPB 1VK5A 3ZIBA 2J46A 4I1OB 4K7BA 5T1DB 3TQOA 5DQTA 5E2QA 4EBBA 2MHRA 3ITFA 4K0DA 5HV9A 1H9TA 3RIPA 2HV7A 2XXAA 3U9MA 1ZHXA 3T9OA 3VM6A 3DE9A 3DE8A 1WTYA 1LVKA 2D4UA 3IQTA 3KKBA 4P9TA 3TJ6A 4EBJA 1M2VB 3UNGC 3PMRA 2D5RB 4JJGA 4O79A 3QVYA 2G62A 4YL3A 4YT8A 1TWHA 5DS6A 2YWAA 3WG7C 5JT4A 1WN0A 1KTMA 3JCUQ 2KQ9A 3AG2C 2V3CC 2QE9A 1DOWA 1MNDA 2A68F 5FZTA 2IXOA 1V74B 2A69F 4AL1A 1Z63A 2WZFA 3M4CA 4PFPA 1YYXA 1LS1A 3EZHA 2OQMA 5B3IA 3RQGA 4Z9IA 3SXMA 2B0HA 2PF4E 1JRAA 4IB4A 3VRCA 1D0ZA 2RD9A 3V5XA 4YWQA 1G4WR 2HKVA 3RW0A 1E2XA 3Q7GA 1MQVA 1TR2A 3GM1A 4P9FA 2XRHA 3JRTA 3F47A 2VH3A 4C7OA 1E84A 2HMZA 5EHHA 1A7DA 1ZHZA 2ASRA 4CJGA 4CS8C 4CIPA 1C17M 3L8IA 4JC7A 5HSWA 2ZXOA 2R05A 1SYQA 3WODF 2F22A 3CEXA 3RQFA 4ULWA 2J9BA 5KYYB 2UUHA 4PR9A 4DRIB 1VTMP 3TULA 1WWPA 1A41A 4W8PA 2L6HA 4NTAA 1YZCA 2O9XA 2EIKC 2LIGA 3DMDA 4CS9A 3VAYA 3W2WA 3NMIA 3RF3A 2GWWA 2XL4A 5K0IA 2R25A 1EQ1A 3IEEA 3LAYA 3IQ5A 3I5QA 3IQ6A 3Q6NA 1PD1A 4P6IC 1BBHA 2Q00A 1U6HA 3K33A 3JTLO 3X1OA 4U9DA 1RJ9A 4HEAJ 4YT2A 1Z6AA 2YL7A 1ORSC 3CQZA 1JMWA 2YEVA 4MQ9F 4I1MA 5FCLA 1ZW2A 3T6JA 4DRHB 4O7GA 1RXQA 1SR2A 1YA9A 2XS8A 4XPXA 3AOUA 3KH2A 1CGOA 4JRZA 4YT4A 1NFNA 3ECSA 1MMAA 5JVEA 1Q0GA 5A6BA 3S9OA 1E85A 1O87A 4DBQA 4C3BA 4AX2A 1TFOB 3W2VA 4IAQA 3UMHA 1NU7D 2YLGA 1LM3B 5E3AA 2R7OA 1Z3IX 2YQYA 3GANA 2HSBA 4MW8A 4LLEA 2DYRC 3DM9B 1EA8A 4QDLA 3VYWA 2G3VA 2X0CA 1FNTc 2TMVP 2L7AA 3C63A 1OKKD 3LUTB 1O5HA 1VLTA 3OEOA 4NTBA 1QSPA 5E33A 4EKWA 4E7ZA 4IJJA 5AGFA 3NYLA 3GM2A 2KSFA 3K66A 3M79A 2HV6A 3M15A 4X0RA 2ZXWC 2Y3DA 3RKOF 2OU6A 3FOPA 3ZTMA 3J06A 1N1CA 1ZHYA 1DOVA 3L0IA 2NSFA 4Q4ZF 1OR3A 4BJ1A 4PJNA 2PNOA 3N24A 3AG3C 1WATA 3X2QC 3K1IC 4NQFA 1LI5A 2CW0F 2UUIA 4NY3A 3T6BA 3EGDB 4XPWA 3U9JA 3I5PA 3JSZA 1CPQA 4KBLA 1SZIA 1Z5ZA 4U5HA 1OQCA 1S05A 3A9CA 3S27A 4NCQA 1V55C 5EK0A 4WGZA 2KJGA 2MWQA 3NRHA 4U5EE 4MVZA 4EIYA 5F5HA 4JURI 1Z7Qc 2NG1A 3E9VA 2W45A 2VCBA 3GEHA 4O6YA 1CGNA 1F1MA 1K05A 2OKUA 2PX0A 4CS8A 3OWTA 3QW0A 1VMAA 3C62A 4CDAA 2LFDA 1L3PA 5L3VA 1MMNA 3W8HA 2BE5F 2QTVA 3C8GB 3TK0A 3BRJA 4N4WA 4JKVA 4OD4A 3U3FA 5A6AA 3C18A 5L0CA 4WJ0A 3V5ZA 1NFOA 3O10A 3EFOB 3H2VA 5JRAA 1A7VA 2XLMA 1IZMA 4U5DE 3VF0A 2OEXA 5EGYA 4IWBA 4MNDA 2EPKX 1T6IA 4K1OA 4LDRA 4EWCA 3DWWA 3H65A 3GWLA 4KNWA 5KYWA 3B0VC 4MVMA 1H7IA 1OCOC 2NUPA 1PCXA 3EGXB 4YL0A 4Z9HA 1M57C 3SNHA 4E18A 1HY5A 2LQGA 1D1BA 4E17A 5L0JA 2P0NA 4JIOA 1T6UA 1QLEC 2G3KA 3K6BA 3M1CB 4XEVA 2NUTA 4EUKB 2BL2A 3S29A 3ZQYA 4HE8D 4CSAC 2H7BA 2AP3A 3AGUA 3MFNA 2XXAB 2GAQA 2Q9BA 1LKXA 1RMVA 3WHNA 3HNKA 2Q9AA 1ZVZA 1HE1A 1ORYA 1QKRA 3IPMO 1MMDA 4LERA 3NKDA 1NSGB 1T5OA 3RQEA 4DVYP 1GM5A 1EI7A 3GM3A 3DXJF 1QPUA 4CIHA 4Z9JA 2OJED 3ASNC 3LLIA 2OEVA 4RD9A 3SP1A 2PX3A 3LEVA 2R7QA 3ABMC 1OXKA 2LD6A 4PACA 4YL1A 2EIMC 1T6QA 5COMA 3RYLA 1WASA 3JYHA 2A0UA 3ATPA 4C3DA 2BC5A 3K1HA 2R7WA 2A1DD 3KL4A 1R4TA
chains in the Genus database with same CATH topology
5TJ5E 4BEMJ 2BL2A 2DB4A 3AOUA 2CYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TJ5 E;  4BEM J;  2BL2 A;  2DB4 A;  3AOU A;  2CYD A; 
#chains in the Genus database with same CATH topology
 2XL8 A;  1D1C A;  4Q7C A;  2QUP A;  2C03 A;  3EG9 A;  4JVS A;  2Q7R A;  3U8V A;  1FR0 A;  1H6G A;  2CGE A;  2WVQ A;  3NYM A;  4ER9 A;  3DAG A;  4O6M A;  4LLC A;  4DRJ B;  4C7O B;  3WAQ A;  4M63 A;  3GEE A;  2DB4 A;  3FOO A;  3OA1 A;  4CBE A;  1YDI A;  2KK1 A;  2J9V A;  2Y39 A;  2ETS A;  2YZS A;  3SXK A;  3T6G B;  3U8P A;  1YAU O;  2L6F A;  4I3M A;  3FXH A;  3R7C A;  4BPM A;  5A69 A;  3C8Z A;  3B29 A;  2XL6 A;  4KNV A;  2XSE A;  2CNW A;  3HNI A;  3N0T A;  3AQB A;  2YLD A;  2YRF A;  3MYI A;  3NMK A;  3LNM B;  4DJ9 A;  3H2U A;  1RKE A;  2PP4 A;  1A7E A;  3QMK A;  2Y69 C;  3QW1 A;  3RH3 A;  2B0J A;  2QNL A;  3EJN A;  4BJ5 C;  4BJT A;  1GQA A;  4H4K C;  2EPO A;  1GGQ A;  3HNL A;  2LP4 A;  4XLP F;  4MVS A;  5L0I A;  4C3E A;  4QI0 A;  3S28 A;  1BZ4 A;  1NU9 C;  3AG4 C;  4DVZ A;  3LS1 A;  1D0Y A;  1TWA A;  5JS5 A;  5L3Q A;  1YZA A;  2Z15 A;  1SMY F;  2LCH A;  2FFH A;  2J7P A;  4N06 A;  3MX3 A;  5T3W A;  3R2P A;  1Q0F A;  2IXP A;  2Q3T A;  4AE4 A;  4EBK A;  2YL3 A;  4J32 B;  1C03 A;  2NPU A;  3EZI A;  2EPN A;  3QZC A;  2V26 A;  4ONS A;  2P1A A;  3TD7 A;  3POV A;  2LK4 A;  5E3C A;  3AJM A;  5BUO A;  2JX0 A;  2R7V A;  1J8Y F;  2Y3H A;  3JSE O;  1T9K A;  2I8B A;  3ZC4 A;  5COF A;  1OCZ C;  2YHS A;  2VAS A;  1CPR A;  1YVI A;  3EH1 A;  3L8J A;  5KYX A;  2W4M A;  5DS4 A;  5D92 A;  3DD7 A;  4JW1 A;  1W2W A;  1NZE A;  3MYF A;  4YN0 B;  3HJC A;  4DBR A;  1U89 A;  4MW3 A;  3TOM A;  1LIH A;  1S7Z A;  5L0H A;  2LSE A;  2ZD9 A;  3JRM O;  3FDQ A;  4NC3 A;  1TKN A;  4OIO F;  2J45 A;  1Q0M A;  4PFO A;  1OW8 A;  4WGY A;  2L9J A;  3KMI A;  1ZU4 A;  1TWG A;  1V4A A;  1YJG A;  4U9E A;  1TWC A;  4BEJ A;  2HFI A;  1ZZP A;  2QLA A;  1NG1 A;  2EIN C;  2IBF A;  2ZXR A;  3GEI A;  3KPH A;  4IGG A;  5JP7 A;  3U2M A;  1D0X A;  3S90 A;  1LPE A;  4G7Z F;  1HE9 A;  4DOZ A;  5GPG B;  4BEM J;  4GYT A;  2DI3 A;  1APC A;  4CDV A;  4XLN F;  2OJQ A;  1G5Z A;  2KW3 C;  1SF8 A;  1JR8 A;  2R03 A;  4XWJ A;  5DVW A;  4DXW A;  2VB6 A;  4OIR F;  3T4R A;  2AWY A;  3GOR A;  4UDV A;  2IXN A;  4JEA A;  4RBN A;  1ZW3 A;  3HLZ A;  2C04 A;  4NTF A;  2VCA A;  1O3U A;  1JPJ A;  2NSG A;  5L0D A;  4FES A;  4J7T A;  3AQC A;  1IW7 F;  2XM0 A;  4YJW A;  3RVZ A;  5B1A C;  2HJM A;  2J0W A;  1XZP A;  2L6G A;  1WOL A;  2X51 A;  3CAX A;  4J30 B;  1GS9 A;  3ZTZ A;  5BQH A;  3F46 A;  1E86 A;  1ST6 A;  4MVO A;  256B A;  4U5G A;  1I5N A;  2JD3 A;  3S84 A;  5KYU B;  2JPU A;  2OOC A;  3EHN A;  1ZU5 A;  3HTK C;  3NDB B;  3RVY A;  3ZWI A;  1FFT C;  3C8G A;  4U5C E;  2P7V A;  5AC4 A;  4IAO A;  2WZL A;  5A6J A;  3FMS A;  1QZX A;  3US6 A;  4N6C A;  1VYI A;  2ZPA A;  4BJ5 A;  1QVX A;  1HW2 A;  2R7R A;  5F5F A;  1Y4C A;  2HZ8 A;  5BQI A;  2XLV A;  3EPV A;  1OW7 A;  1I4Z A;  1JPN A;  2R7U A;  3G4X A;  1HW1 A;  2ICW G;  5L0G A;  4RDA A;  5KYW B;  3LEO A;  2IM8 A;  3NG1 A;  4JCH A;  2HJ3 A;  2J9W A;  2NUP B;  2YL1 A;  2Y3B A;  3DJN B;  4FWV A;  3B71 A;  3UMI A;  3UGP A;  2NUT B;  3RFY A;  1C02 A;  4YK5 A;  3UGO A;  3B0P A;  2XS1 A;  3CZ6 A;  4JEB A;  4U5F E;  1AEP A;  1OR2 A;  2H7V C;  3E70 C;  4BG0 A;  4QI2 A;  1M2V A;  2YKZ A;  3DKA A;  5JSL A;  1MMG A;  2CYD A;  2WZG A;  1JAF A;  2WL8 A;  3ZVR A;  1XWJ A;  2HMQ A;  1LE2 A;  3GWN A;  3Q7L A;  1FAP B;  3SEO A;  4OD5 A;  3W8I A;  2QY9 A;  1VB5 A;  3LS0 A;  3QTH A;  2XLW A;  4G7O F;  4XTK A;  4CS7 A;  1D1A A;  1YLM A;  2AU5 A;  4JZA A;  2YVK A;  2W9Y A;  3SXZ A;  1ORJ A;  4OIP F;  2EPL X;  4JJF A;  4MVR A;  1VYK A;  4XEK A;  2DYS C;  4HFF B;  2KGO A;  3K1I A;  4XQ1 A;  4KI2 A;  4HFK B;  1I4Y A;  1PV3 A;  3JZ0 A;  1LE4 A;  3UMK A;  2KYH A;  4F4B A;  3DAF A;  4BJ6 C;  2OG2 A;  2J0X A;  1A0B A;  3LLK A;  3EG9 B;  1FMW A;  3HKK A;  1BR1 A;  4N6H A;  2A6E F;  4XPY A;  2R9R B;  3FVY A;  2A0B A;  2HUJ A;  2WVO A;  2CNW D;  2XM4 A;  3EHM A;  3MLG A;  4G78 A;  2H7O A;  1PD0 A;  2R02 A;  1NLX A;  1HMD A;  2YLI A;  4L6R A;  4MVU A;  1TQG A;  2IOQ A;  2OCC C;  3C7J A;  1NBB A;  3ABL C;  4YT5 A;  2A6H F;  3O6X A;  1T01 A;  5CI8 A;  4CJO A;  3M4B A;  5KYY A;  1JOG A;  2M4E A;  4IRU A;  4JTC B;  3DZA A;  1TFK B;  3JT1 A;  4JTA B;  1K40 A;  3UR3 C;  1YAR O;  1LS4 A;  4MTG A;  4B6I A;  3G4Z A;  4JTD B;  1U0B B;  5KYN A;  1RKE B;  1AVO B;  4J7Y A;  4D4X A;  3CSK A;  4PJM A;  4EHP A;  2WVN A;  2XLE A;  3L34 A;  3NMJ A;  3V5Y A;  5JLI A;  2H8A A;  2WB7 A;  2XLO A;  3I4U A;  2R7X A;  1QQ3 A;  2Y3G A;  2E87 A;  1RJ9 B;  3PDM P;  2J7P D;  3L1M A;  2W4B A;  1ZHW A;  4O6N A;  5DLJ A;  3U0C A;  2J8W A;  5COG A;  2FGY A;  1J8M F;  4ULV A;  4IAR A;  1H9G A;  3A11 A;  4MS2 A;  2XLH A;  1XZQ A;  1VOM A;  1UFB A;  4JCZ A;  3B0U X;  2Q4F A;  3SZR A;  2GA0 A;  2VCC A;  1ZYR F;  3SXY A;  5T3T A;  1E83 A;  4MTF A;  3AG1 C;  1OW6 A;  1RKC A;  5BQG A;  4AE4 B;  5AC5 A;  4ZLD A;  3O55 A;  2M64 A;  1M2O A;  1MNE A;  5B1B C;  4Q5S F;  5DQZ A;  3NKE A;  2CDQ A;  4CSA A;  4PJJ A;  3HNJ A;  3IQC A;  2AWC A;  3Q6M A;  4W8K A;  4A2N B;  2L81 A;  1EKY A;  3TJ5 A;  4CX9 A;  5KYX B;  1Z23 A;  1LI7 A;  5B3S C;  5TJ5 E;  1L7C A;  2R7T A;  5CIV A;  1BR2 A;  3V7O A;  3EH2 A;  1ZHT A;  3ZSU A;  2AVK A;  2DGJ A;  3S0X A;  1OCC C;  3LES A;  3LNR A;  1AUE A;  4FX5 A;  3ZG1 A;  4XEF A;  2GFH A;  2FAP B;  3K7D A;  3MBG A;  4R32 A;  1YYJ A;  3DI5 A;  1R5I D;  4KC9 A;  2PBE A;  2KC3 A;  2EIL C;  3NYJ A;  4PJL A;  1OKK A;  3PHF 2;  2J9U A;  4E0I A;  2LFF A;  3FHD A;  3EGD A;  3LJB A;  4I44 A;  4LDK A;  3G50 A;  4WAB A;  4A4A A;  1WGW A;  4H54 A;  2R7S A;  4E7S A;  2Q9C A;  3B9Q A;  1UG7 A;  3ZQV A;  1K04 A;  1G8X A;  1KU2 A;  3U3B A;  1BR4 A;  3O39 A;  4BJ6 A;  2EIJ C;  3QVZ A;  3U2L A;  1FFH A;  3ABK C;  1Q0K A;  2CCY A;  3SYN A;  1CGM E;  1HMO A;  3KYI A;  1BDJ B;  2XLD A;  1YA7 O;  1Y6D A;  3N2Z B;  4MTO A;  3TOL A;  1Q0D A;  4LAC B;  2I15 A;  4MVQ A;  1M56 C;  4PK4 A;  2IYL D;  3IHU A;  2VC9 A;  4CS9 C;  1OXB A;  2PFD A;  4U5B E;  4AK9 A;  4G7H F;  3FAJ A;  1VLS A;  5L0F A;  3C8G D;  1V54 C;  2YL0 A;  2ZXP A;  1RCP A;  1G4U S;  3U5S A;  5D91 A;  4D4N A;  4OIQ F;  4GQH A;  4JE9 A;  4E0H A;  1FMV A;  4GEH A;  1KNY A;  2GDC A;  2EPM X;  5CI9 A;  4LDQ A;  2HSQ A;  4ZLC A;  3DJU B;  4ANJ A;  5A6B D;  3W4Y A;  3DM5 A;  1OCR C;  1B68 A;  3EFO A;  1FTS A;  3FAP B;  2IXM A;  3AGT A;  5KYU A;  3ZDL A;  4CDY A;  2HS5 A;  3EQL F;  2KNH A;  5JUA A;  3KYJ A;  5IY5 C;  3PCV A;  5F28 E;  5DS5 A;  3BEH A;  4G0H A;  2MYS A;  3ASO C;  3EGX A;  3GOD A;  1M6T A;  2P61 A;  3JYY A;  2P6V A;  4OIN F;  4AL0 A;  5A6K A;  2RSE B;  4FAP B;  1VK5 A;  3ZIB A;  2J46 A;  4I1O B;  4K7B A;  5T1D B;  3TQO A;  5DQT A;  5E2Q A;  4EBB A;  2MHR A;  3ITF A;  4K0D A;  5HV9 A;  1H9T A;  3RIP A;  2HV7 A;  2XXA A;  3U9M A;  1ZHX A;  3T9O A;  3VM6 A;  3DE9 A;  3DE8 A;  1WTY A;  1LVK A;  2D4U A;  3IQT A;  3KKB A;  4P9T A;  3TJ6 A;  4EBJ A;  1M2V B;  3UNG C;  3PMR A;  2D5R B;  4JJG A;  4O79 A;  3QVY A;  2G62 A;  4YL3 A;  4YT8 A;  1TWH A;  5DS6 A;  2YWA A;  3WG7 C;  5JT4 A;  1WN0 A;  1KTM A;  3JCU Q;  2KQ9 A;  3AG2 C;  2V3C C;  2QE9 A;  1DOW A;  1MND A;  2A68 F;  5FZT A;  2IXO A;  1V74 B;  2A69 F;  4AL1 A;  1Z63 A;  2WZF A;  3M4C A;  4PFP A;  1YYX A;  1LS1 A;  3EZH A;  2OQM A;  5B3I A;  3RQG A;  4Z9I A;  3SXM A;  2B0H A;  2PF4 E;  1JRA A;  4IB4 A;  3VRC A;  1D0Z A;  2RD9 A;  3V5X A;  4YWQ A;  1G4W R;  2HKV A;  3RW0 A;  1E2X A;  3Q7G A;  1MQV A;  1TR2 A;  3GM1 A;  4P9F A;  2XRH A;  3JRT A;  3F47 A;  2VH3 A;  4C7O A;  1E84 A;  2HMZ A;  5EHH A;  1A7D A;  1ZHZ A;  2ASR A;  4CJG A;  4CS8 C;  4CIP A;  1C17 M;  3L8I A;  4JC7 A;  5HSW A;  2ZXO A;  2R05 A;  1SYQ A;  3WOD F;  2F22 A;  3CEX A;  3RQF A;  4ULW A;  2J9B A;  5KYY B;  2UUH A;  4PR9 A;  4DRI B;  1VTM P;  3TUL A;  1WWP A;  1A41 A;  4W8P A;  2L6H A;  4NTA A;  1YZC A;  2O9X A;  2EIK C;  2LIG A;  3DMD A;  4CS9 A;  3VAY A;  3W2W A;  3NMI A;  3RF3 A;  2GWW A;  2XL4 A;  5K0I A;  2R25 A;  1EQ1 A;  3IEE A;  3LAY A;  3IQ5 A;  3I5Q A;  3IQ6 A;  3Q6N A;  1PD1 A;  4P6I C;  1BBH A;  2Q00 A;  1U6H A;  3K33 A;  3JTL O;  3X1O A;  4U9D A;  1RJ9 A;  4HEA J;  4YT2 A;  1Z6A A;  2YL7 A;  1ORS C;  3CQZ A;  1JMW A;  2YEV A;  4MQ9 F;  4I1M A;  5FCL A;  1ZW2 A;  3T6J A;  4DRH B;  4O7G A;  1RXQ A;  1SR2 A;  1YA9 A;  2XS8 A;  4XPX A;  3AOU A;  3KH2 A;  1CGO A;  4JRZ A;  4YT4 A;  1NFN A;  3ECS A;  1MMA A;  5JVE A;  1Q0G A;  5A6B A;  3S9O A;  1E85 A;  1O87 A;  4DBQ A;  4C3B A;  4AX2 A;  1TFO B;  3W2V A;  4IAQ A;  3UMH A;  1NU7 D;  2YLG A;  1LM3 B;  5E3A A;  2R7O A;  1Z3I X;  2YQY A;  3GAN A;  2HSB A;  4MW8 A;  4LLE A;  2DYR C;  3DM9 B;  1EA8 A;  4QDL A;  3VYW A;  2G3V A;  2X0C A;  1FNT c;  2TMV P;  2L7A A;  3C63 A;  1OKK D;  3LUT B;  1O5H A;  1VLT A;  3OEO A;  4NTB A;  1QSP A;  5E33 A;  4EKW A;  4E7Z A;  4IJJ A;  5AGF A;  3NYL A;  3GM2 A;  2KSF A;  3K66 A;  3M79 A;  2HV6 A;  3M15 A;  4X0R A;  2ZXW C;  2Y3D A;  3RKO F;  2OU6 A;  3FOP A;  3ZTM A;  3J06 A;  1N1C A;  1ZHY A;  1DOV A;  3L0I A;  2NSF A;  4Q4Z F;  1OR3 A;  4BJ1 A;  4PJN A;  2PNO A;  3N24 A;  3AG3 C;  1WAT A;  3X2Q C;  3K1I C;  4NQF A;  1LI5 A;  2CW0 F;  2UUI A;  4NY3 A;  3T6B A;  3EGD B;  4XPW A;  3U9J A;  3I5P A;  3JSZ A;  1CPQ A;  4KBL A;  1SZI A;  1Z5Z A;  4U5H A;  1OQC A;  1S05 A;  3A9C A;  3S27 A;  4NCQ A;  1V55 C;  5EK0 A;  4WGZ A;  2KJG A;  2MWQ A;  3NRH A;  4U5E E;  4MVZ A;  4EIY A;  5F5H A;  4JUR I;  1Z7Q c;  2NG1 A;  3E9V A;  2W45 A;  2VCB A;  3GEH A;  4O6Y A;  1CGN A;  1F1M A;  1K05 A;  2OKU A;  2PX0 A;  4CS8 A;  3OWT A;  3QW0 A;  1VMA A;  3C62 A;  4CDA A;  2LFD A;  1L3P A;  5L3V A;  1MMN A;  3W8H A;  2BE5 F;  2QTV A;  3C8G B;  3TK0 A;  3BRJ A;  4N4W A;  4JKV A;  4OD4 A;  3U3F A;  5A6A A;  3C18 A;  5L0C A;  4WJ0 A;  3V5Z A;  1NFO A;  3O10 A;  3EFO B;  3H2V A;  5JRA A;  1A7V A;  2XLM A;  1IZM A;  4U5D E;  3VF0 A;  2OEX A;  5EGY A;  4IWB A;  4MND A;  2EPK X;  1T6I A;  4K1O A;  4LDR A;  4EWC A;  3DWW A;  3H65 A;  3GWL A;  4KNW A;  5KYW A;  3B0V C;  4MVM A;  1H7I A;  1OCO C;  2NUP A;  1PCX A;  3EGX B;  4YL0 A;  4Z9H A;  1M57 C;  3SNH A;  4E18 A;  1HY5 A;  2LQG A;  1D1B A;  4E17 A;  5L0J A;  2P0N A;  4JIO A;  1T6U A;  1QLE C;  2G3K A;  3K6B A;  3M1C B;  4XEV A;  2NUT A;  4EUK B;  2BL2 A;  3S29 A;  3ZQY A;  4HE8 D;  4CSA C;  2H7B A;  2AP3 A;  3AGU A;  3MFN A;  2XXA B;  2GAQ A;  2Q9B A;  1LKX A;  1RMV A;  3WHN A;  3HNK A;  2Q9A A;  1ZVZ A;  1HE1 A;  1ORY A;  1QKR A;  3IPM O;  1MMD A;  4LER A;  3NKD A;  1NSG B;  1T5O A;  3RQE A;  4DVY P;  1GM5 A;  1EI7 A;  3GM3 A;  3DXJ F;  1QPU A;  4CIH A;  4Z9J A;  2OJE D;  3ASN C;  3LLI A;  2OEV A;  4RD9 A;  3SP1 A;  2PX3 A;  3LEV A;  2R7Q A;  3ABM C;  1OXK A;  2LD6 A;  4PAC A;  4YL1 A;  2EIM C;  1T6Q A;  5COM A;  3RYL A;  1WAS A;  3JYH A;  2A0U A;  3ATP A;  4C3D A;  2BC5 A;  3K1H A;  2R7W A;  2A1D D;  3KL4 A;  1R4T A; 
#chains in the Genus database with same CATH homology
 5TJ5 E;  4BEM J;  2BL2 A;  2DB4 A;  3AOU A;  2CYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...