5TJ5E

Atomic model for the membrane-embedded motor of a eukaryotic v-atpase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
138
Chain Sequence
APFFGAIGCASAIIFTSLGAAYGTAKSGVLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic model for the membrane-embedded VO motor of a eukaryotic V-ATPase.
pubmed doi rcsb
molecule tags Motor protein
molecule keywords V-type proton ATPase subunit a
total genus 43
structure length 138
sequence length 150
chains with identical sequence F, G, H, I, J, M, N
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 5tj5E00
4BEMJ 2CYDA 5TJ5E 3AOUA 2DB4A 2BL2A
chains in the Genus database with same CATH superfamily
1A0BA 3RIPA 3O55A 3WAQA 1A7VA 3C8GA 3FOPA 2C04A 1G5ZA 3GANA 4BJ1A 3F47A 3EGXA 3LS0A 1APCA 4W8PA 3NYMA 1LKXA 4FX5A 4AK9A 3K1IA 4JRZA 2Q3TA 1V4AA 3EZIA 3WODF 2KSFA 2CNWA 2YHSA 2KQ9A 3U5SA 1G8XA 4BG0A 4H54A 3SYNA 3FVYA 3CQZA 2HFIA 1I5NA 5D92A 1TWHA 3OEOA 5E33A 3J06A 5K0IA 3AG2C 2YLIA 4I3MA 4DJ9A 4KNWA 1AVOB 3V5ZA 4CDVA 4IAOA 1IW7F 1E83A 1H7IA 2R7XA 4YL3A 1RJ9A 4HEAJ 3QVYA 2QUPA 1WWPA 3W8IA 2NUPA 1NFNA 3EPVA 2XLVA 3B0VC 4EKWA 1ZU4A 4PJJA 3RQFA 1K04A 5BQHA 2OOCA 4N6HA 3SZRA 3SXKA 3JZ0A 2AP3A 4DBQA 2WZLA 4G0HA 1XWJA 3FAJA 4CBEA 4G7ZF 4YT4A 2WZFA 3JRMO 5FCLA 1ORSC 2IOQA 2XXAA 2NUTA 1BDJB 2PF4E 2PBEA 1RKCA 2CGEA 2J9UA 3SEOA 5KYNA 1Z63A 1L3PA 4OIPF 4UDVA 3VM6A 1PD1A 2YWAA 3B29A 4BJTA 4CDYA 5IY5C 2YL1A 4O6YA 3K1IC 3PDMP 2QY9A 2Y69C 2YQYA 4XPWA 5EK0A 4IARA 4EUKB 3DAFA 3RW0A 2A69F 2OEXA 3UR3C 2PX0A 2L9JA 2Q9AA 1JPNA 1RCPA 2Q4FA 4WJ0A 2R7UA 4AX2A 1E84A 4XEVA 1MMNA 3T6BA 5T3TA 3UGOA 4JEBA 2H7OA 3NRHA 4Q4ZF 4N06A 4CS8A 4OIRF 4BPMA 4U5FE 1VLSA 4IAQA 1CPQA 1D0YA 4ZLDA 1LIHA 2B0HA 2CCYA 2PX3A 1AEPA 4DOZA 5A69A 5JLIA 3K66A 2XLMA 4YT8A 3DD7A 4QI0A 2XL4A 3LNRA 4AL0A 4C3BA 4MNDA 1I4YA 1OKKA 2KC3A 1D1CA 4N4WA 3VYWA 3QW1A 1NZEA 1A41A 1BZ4A 2XS8A 4LERA 5COMA 4EWCA 4M63A 1LVKA 3IQ6A 4O6NA 4W8KA 3PMRA 3BRJA 3B0UX 1GGQA 3JSEO 2IYLD 4ZLCA 4CIPA 2EIJC 5DLJA 4PFPA 2XXAB 2AVKA 2J8WA 5L0IA 3LLKA 3S27A 3NKDA 3PCVA 1L7CA 2J9WA 1C17M 2LP4A 4ER9A 2QTVA 3AG4C 3DM5A 1OCRC 1LPEA 4MS2A 1W2WA 3H2UA 2XLWA 1NBBA 2LFFA 2EILC 3C8ZA 3TD7A 3RQEA 2Y3GA 2NUPB 2D4UA 2XS1A 2OJED 4IRUA 3RF3A 4WABA 2DYRC 2P0NA 4G78A 4Q7CA 1V55C 3K6BA 3DZAA 4E18A 3SNHA 1T6IA 5BQGA 4WGZA 1V74B 4I44A 3AOUA 5TJ5E 3AGUA 3DXJF 3NMJA 1YYJA 3T6GB 1ORYA 3I4UA 1ZU5A 3IHUA 1MMAA 1Z5ZA 2G3VA 2GWWA 1OXBA 2ZPAA 4P9FA 4CJOA 4QDLA 4CS9A 4IJJA 1YA7O 4JCZA 4JTDB 4U5EE 3ZWIA 4NCQA 3O39A 3VAYA 3GEIA 3GORA 5D91A 3EH2A 3QZCA 5F5HA 3ASOC 3POVA 2XLOA 3TJ6A 4D4XA 3TQOA 2A0UA 4FWVA 4FAPB 2Q00A 1SR2A 2LFDA 4J30B 1JMWA 3E70C 2OQMA 4PACA 3WHNA 2ZXRA 1JOGA 5COFA 3GM2A 1MNEA 2IBFA 3CZ6A 1GM5A 4XEKA 3K7DA 1TR2A 2AU5A 2KYHA 1NFOA 1FFHA 1M56C 2IXMA 1HW1A 3ABMC 3NYLA 3O6XA 2ICWG 4XPYA 1RJ9B 4CIHA 4K1OA 4CS8C 1Z6AA 2HV6A 2MWQA 2EPKX 5DQTA 5AGFA 3HNLA 4J7YA 4NTBA 5JUAA 2UUHA 5L0GA 2XM4A 2B0JA 3QVZA 5F5FA 1QKRA 3K33A 4JE9A 3VRCA 3HNIA 5KYXA 3M4BA 3IEEA 4ULVA 4OIOF 2GDCA 2GFHA 3R2PA 4DXWA 3CSKA 3NDBB 5A6JA 2H8AA 4CS9C 4DRIB 1HMDA 2YKZA 4C3DA 4H4KC 3GM1A 5DQZA 2J45A 2HJ3A 4EBJA 5L0HA 3H65A 1U0BB 2ASRA 2F22A 1B68A 3RH3A 4MW3A 2H7BA 2L6GA 4DBRA 3AJMA 4XLPF 1LI7A 2FAPB 1TKNA 1H9TA 1J8YF 2YVKA 1JPJA 4NTFA 3NMIA 3U9JA 5B3IA 3PHF2 1NLXA 2FFHA 4CSAC 1BR4A 2KK1A 3RFYA 3JYYA 4E7SA 1EKYA 1NU9C 2E87A 2FGYA 4MW8A 2VH3A 3EQLF 3TOLA 3JRTA 3TJ5A 1T5OA 2AWYA 3IQTA 3ZG1A 2A68F 1MQVA 2WVQA 4JEAA 3FDQA 1JR8A 1RKEA 4LLCA 4A4AA 5A6BA 4HFKB 1C02A 4JVSA 1MMDA 4PJLA 1NG1A 1TWGA 1E2XA 1G4WR 1RXQA 3KYJA 3MYFA 1MMGA 3MYIA 2HS5A 1CGME 3OA1A 1BR2A 2W4MA 3N0TA 3S28A 4EIYA 2KNHA 3L8JA 5T3WA 1BBHA 5GPGB 2Y39A 4JC7A 1Q0KA 4U9EA 2QLAA 4R32A 1OXKA 3E9VA 4RD9A 4PR9A 1SMYF 2J7PD 2LCHA 1LE2A 1Z3IX 1FAPB 4YT2A 2TMVP 3FXHA 1QVXA 4BJ5A 1HE9A 4XTKA 3G4ZA 2JPUA 4X0RA 2L81A 1OW6A 3LEOA 4IGGA 1EQ1A 5A6BD 2R9RB 4HFFB 1YARO 1ZHXA 3KH2A 2NG1A 4JZAA 3JT1A 5CIVA 1K40A 1Q0FA 3HNKA 3V5YA 2WL8A 4DRJB 1HW2A 1FFTC 1ZZPA 3ZSUA 5BQIA 2YLDA 5DS4A 1BR1A 4Z9JA 3UNGC 1YLMA 2NPUA 3R7CA 1QSPA 3ECSA 1Q0DA 5KYYA 2DI3A 3QTHA 2P61A 4MVMA 2R7OA 2PFDA 5E2QA 4DRHB 3RVYA 2O9XA 1J8MF 2Y3HA 3IPMO 2EPLX 2DB4A 5JSLA 5JRAA 3S84A 2J0XA 2LSEA 4YN0B 4MVUA 5EGYA 3CEXA 3DE9A 4C7OA 1D0XA 4PJMA 3HJCA 4KC9A 3U3FA 3LS1A 3EGXB 2VCCA 2XM0A 3M79A 4U5GA 2D5RB 3X1OA 1RKEB 3NKEA 4NQFA 3UMHA 1EI7A 1GQAA 1OW7A 1ZHYA 1PCXA 5AC5A 4CSAA 2ETSA 1S05A 1OR3A 2CYDA 2DYSC 3M1CB 4K7BA 3Q7LA 2BL2A 4AL1A 3UGPA 3ZC4A 1T9KA 1VMAA 1Q0GA 2Y3DA 2A6EF 1ST6A 1V54C 4U5DE 5HSWA 1Y6DA 1VK5A 3KMIA 5A6KA 1JRAA 3LJBA 3JCUQ 3GWNA 1T6QA 2OKUA 1M2VA 2KW3C 3OWTA 5JT4A 5KYWA 2IXOA 1FNTc 4JCHA 3Q6NA 1OCCC 2XRHA 2GAQA 2YZSA 4Z9HA 5B1AC 1XZQA 2BE5F 3S29A 3W2VA 3QW0A 3S90A 1R4TA 2J7PA 2Z15A 2Q9CA 4ONSA 4BJ6A 3LUTB 2R7VA 1FMWA 1CGNA 3ITFA 3L0IA 4MQ9F 4MTFA 1PD0A 2OEVA 3ZVRA 3GWLA 5FZTA 3VF0A 3EHMA 3M4CA 2OG2A 2W9YA 3AGTA 2A0BA 4C7OB 5CI9A 5L0FA 1XZPA 5B3SC 3NYJA 2KGOA 3U9MA 2PNOA 3KKBA 2P1AA 3N2ZB 4K0DA 1O87A 1TFKB 1QQ3A 2XLDA 3N24A 2JX0A 1TFOB 2GA0A 3CAXA 4JW1A 1CGOA 3UMIA 4Q5SF 1ZYRF 4NY3A 2YL7A 1YJGA 3MX3A 1C03A 3Q6MA 1ZHZA 5E3CA 5CI8A 3T9OA 1ZHWA 2VC9A 2I8BA 3EG9B 2EPNA 3MFNA 3U3BA 3UMKA 5E3AA 4YL0A 4YT5A 1LS1A 4QI2A 2HSQA 3GODA 1A7DA 3TK0A 1D1AA 2LD6A 3EZHA 3V7OA 5EHHA 3DJNB 1QLEC 4EBKA 3FMSA 4DVZA 1YAUO 4LDRA 3TOMA 4N6CA 3AQBA 2A6HF 2ZD9A 4BJ6C 1CPRA 2EPMX 1D0ZA 3C63A 1T6UA 3I5PA 1ORJA 1YYXA 2JD3A 2XLEA 4PFOA 4I1MA 3SXYA 4D4NA 2X51A 3ABLC 4F4BA 4I1OB 4OINF 4A2NB 2J9BA 4NTAA 5DS5A 2KJGA 3US6A 3AQCA 3B9QA 1OQCA 3BEHA 2Q9BA 4YJWA 4P6IC 4BJ5C 1U6HA 5B1BC 3B71A 1SZIA 4XLNF 4E17A 5A6AA 3L8IA 2XL6A 3ABKC 1KU2A 2G62A 2PP4A 4AE4B 3G4XA 1UG7A 1FR0A 1WASA 2XLHA 2QNLA 1YDIA 3C18A 1YZAA 5KYUA 3C7JA 1ZW2A 2R02A 2CNWD 4PJNA 5T1DB 2L6HA 4OD5A 2IXNA 4ULWA 2Q7RA 3U0CA 3C62A 2R7QA 4KNVA 1YVIA 2RSEB 1HMOA 2R7SA 1A7EA 3T6JA 3W4YA 2NSGA 1M2OA 3IQCA 2M4EA 1I4ZA 1VLTA 2OU6A 1M2VB 3RQGA 2VCBA 3WG7C 3W8HA 1K05A 2QE9A 1O5HA 4XWJA 4B6IA 1MNDA 4E7ZA 2NSFA 2XL8A 3JTLO 4FESA 1KNYA 4C3EA 4GEHA 5L3VA 2W45A 1ZW3A 4OD4A 2HJMA 1Q0MA 1SF8A 1EA8A 3DJUB 3ASNC 1TWAA 4O6MA 3ZTMA 5HV9A 3EHNA 1ZHTA 2CW0F 4P9TA 2UUIA 1LM3B 2EINC 1O3UA 1Y4CA 3EJNA 3V5XA 3EFOA 2LQGA 4CS7A 5JS5A 256BA 3FHDA 3HNJA 1E85A 3RVZA 2W4BA 1D1BA 1Z23A 4CDAA 5DS6A 2AWCA 1YA9A 2HSBA 1OCZC 3HLZA 3KYIA 3B0PA 2J0WA 2IM8A 4BEJA 4LLEA 5L0JA 1H6GA 3DWWA 2WZGA 3FOOA 5JP7A 1NSGB 3EGDA 4HE8D 3MBGA 1OCOC 3AG1C 3L1MA 4E0IA 4LACB 2Y3BA 4DVYP 2EPOA 1TQGA 5KYYB 1QZXA 3DI5A 4O7GA 3JYHA 1Z7Qc 2EIKC 2G3KA 5F28E 3W2WA 3EG9A 4XQ1A 2P7VA 2XSEA 4IWBA 1LS4A 2R25A 1RMVA 3G50A 3I5QA 1R5ID 2A1DD 2HZ8A 2NUTB 1DOVA 3DKAA 2HV7A 4MVSA 3AG3C 2L6FA 3O10A 4U9DA 3T4RA 4EHPA 3C8GB 3SXZA 2R7WA 4KI2A 3KPHA 2YEVA 1OW8A 2H7VC 4MVRA 3ZDLA 1VOMA 3LNMB 1YZCA 1JAFA 1OKKD 3ZQVA 4E0HA 2J46A 2VB6A 3ATPA 3A9CA 1DOWA 3FAPB 3U8VA 2HKVA 3NG1A 4JIOA 4KBLA 3X2QC 3EH1A 2ZXPA 1LI5A 4BEMJ 3SP1A 4NC3A 3GM3A 4JJFA 4O79A 2R7RA 1WATA 5L0CA 4Z9IA 3ZTZA 2EIMC 3DAGA 3GEHA 2VCAA 2YRFA 3LEVA 2HUJA 5AC4A 2OCCC 3TULA 3U2MA 1T01A 4ANJA 4MVQA 2RD9A 4LDQA 4JTCB 4XPXA 4RBNA 4EBBA 1S7ZA 3DM9B 4YK5A 2R7TA 2I15A 2LK4A 3MLGA 3JSZA 1WTYA 3EGDB 2WB7A 4MTGA 1HY5A 2R05A 5JVEA 3NMKA 4OIQF 3DMDA 3L34A 1GS9A 1G4US 5KYXB 1KTMA 3U2LA 1WN0A 4XEFA 2IXPA 2M64A 1FMVA 3A11A 3C8GD 2YL3A 1WGWA 3EFOB 4JKVA 3F46A 1VYIA 1OR2A 2J9VA 4G7HF 1HE1A 1ZVZA 3QMKA 2MYSA 5DVWA 4PK4A 3ZQYA 2V26A 4IB4A 1VB5A 4U5HA 2X0CA 3HTKC 2WVOA 3SXMA 4YWQA 2HMZA 2ZXOA 4MTOA 4RDAA 1PV3A 1M6TA 4CX9A 2R03A 4U5CE 1VYKA 3ZIBA 1UFBA 2YL0A 1WOLA 2LIGA 4GYTA 2HMQA 2VASA 5L0DA 3H2VA 4L6RA 3S9OA 2OJQA 1FTSA 4J32B 4U5BE 5L3QA 1IZMA 1AUEA 4JURI 4JJGA 1TWCA 4MVOA 5KYUB 3S0XA 2L7AA 2CDQA 2WVNA 1F1MA 3M15A 3GEEA 3LESA 2MHRA 3IQ5A 3LLIA 4WGYA 1H9GA 4LDKA 1NU7D 5COGA 5BUOA 2V3CC 4JTAB 4AE4A 2C03A 1QPUA 1N1CA 2YLGA 2ZXWC 3DE8A 4MVZA 5KYWB 3HKKA 3U8PA 4J7TA 1VTMP 3K1HA 1E86A 4YL1A 1M57C 1SYQA 1U89A 2P6VA 4GQHA 3RKOF 4G7OF 3Q7GA 1LE4A 3RYLA 4CJGA 3KL4A 2DGJA 2BC5A 3LAYA
chains in the Genus database with same CATH topology
4BEMJ 2CYDA 5TJ5E 3AOUA 2DB4A 2BL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BEM J;  2CYD A;  5TJ5 E;  3AOU A;  2DB4 A;  2BL2 A; 
#chains in the Genus database with same CATH topology
 1A0B A;  3RIP A;  3O55 A;  3WAQ A;  1A7V A;  3C8G A;  3FOP A;  2C04 A;  1G5Z A;  3GAN A;  4BJ1 A;  3F47 A;  3EGX A;  3LS0 A;  1APC A;  4W8P A;  3NYM A;  1LKX A;  4FX5 A;  4AK9 A;  3K1I A;  4JRZ A;  2Q3T A;  1V4A A;  3EZI A;  3WOD F;  2KSF A;  2CNW A;  2YHS A;  2KQ9 A;  3U5S A;  1G8X A;  4BG0 A;  4H54 A;  3SYN A;  3FVY A;  3CQZ A;  2HFI A;  1I5N A;  5D92 A;  1TWH A;  3OEO A;  5E33 A;  3J06 A;  5K0I A;  3AG2 C;  2YLI A;  4I3M A;  4DJ9 A;  4KNW A;  1AVO B;  3V5Z A;  4CDV A;  4IAO A;  1IW7 F;  1E83 A;  1H7I A;  2R7X A;  4YL3 A;  1RJ9 A;  4HEA J;  3QVY A;  2QUP A;  1WWP A;  3W8I A;  2NUP A;  1NFN A;  3EPV A;  2XLV A;  3B0V C;  4EKW A;  1ZU4 A;  4PJJ A;  3RQF A;  1K04 A;  5BQH A;  2OOC A;  4N6H A;  3SZR A;  3SXK A;  3JZ0 A;  2AP3 A;  4DBQ A;  2WZL A;  4G0H A;  1XWJ A;  3FAJ A;  4CBE A;  4G7Z F;  4YT4 A;  2WZF A;  3JRM O;  5FCL A;  1ORS C;  2IOQ A;  2XXA A;  2NUT A;  1BDJ B;  2PF4 E;  2PBE A;  1RKC A;  2CGE A;  2J9U A;  3SEO A;  5KYN A;  1Z63 A;  1L3P A;  4OIP F;  4UDV A;  3VM6 A;  1PD1 A;  2YWA A;  3B29 A;  4BJT A;  4CDY A;  5IY5 C;  2YL1 A;  4O6Y A;  3K1I C;  3PDM P;  2QY9 A;  2Y69 C;  2YQY A;  4XPW A;  5EK0 A;  4IAR A;  4EUK B;  3DAF A;  3RW0 A;  2A69 F;  2OEX A;  3UR3 C;  2PX0 A;  2L9J A;  2Q9A A;  1JPN A;  1RCP A;  2Q4F A;  4WJ0 A;  2R7U A;  4AX2 A;  1E84 A;  4XEV A;  1MMN A;  3T6B A;  5T3T A;  3UGO A;  4JEB A;  2H7O A;  3NRH A;  4Q4Z F;  4N06 A;  4CS8 A;  4OIR F;  4BPM A;  4U5F E;  1VLS A;  4IAQ A;  1CPQ A;  1D0Y A;  4ZLD A;  1LIH A;  2B0H A;  2CCY A;  2PX3 A;  1AEP A;  4DOZ A;  5A69 A;  5JLI A;  3K66 A;  2XLM A;  4YT8 A;  3DD7 A;  4QI0 A;  2XL4 A;  3LNR A;  4AL0 A;  4C3B A;  4MND A;  1I4Y A;  1OKK A;  2KC3 A;  1D1C A;  4N4W A;  3VYW A;  3QW1 A;  1NZE A;  1A41 A;  1BZ4 A;  2XS8 A;  4LER A;  5COM A;  4EWC A;  4M63 A;  1LVK A;  3IQ6 A;  4O6N A;  4W8K A;  3PMR A;  3BRJ A;  3B0U X;  1GGQ A;  3JSE O;  2IYL D;  4ZLC A;  4CIP A;  2EIJ C;  5DLJ A;  4PFP A;  2XXA B;  2AVK A;  2J8W A;  5L0I A;  3LLK A;  3S27 A;  3NKD A;  3PCV A;  1L7C A;  2J9W A;  1C17 M;  2LP4 A;  4ER9 A;  2QTV A;  3AG4 C;  3DM5 A;  1OCR C;  1LPE A;  4MS2 A;  1W2W A;  3H2U A;  2XLW A;  1NBB A;  2LFF A;  2EIL C;  3C8Z A;  3TD7 A;  3RQE A;  2Y3G A;  2NUP B;  2D4U A;  2XS1 A;  2OJE D;  4IRU A;  3RF3 A;  4WAB A;  2DYR C;  2P0N A;  4G78 A;  4Q7C A;  1V55 C;  3K6B A;  3DZA A;  4E18 A;  3SNH A;  1T6I A;  5BQG A;  4WGZ A;  1V74 B;  4I44 A;  3AOU A;  5TJ5 E;  3AGU A;  3DXJ F;  3NMJ A;  1YYJ A;  3T6G B;  1ORY A;  3I4U A;  1ZU5 A;  3IHU A;  1MMA A;  1Z5Z A;  2G3V A;  2GWW A;  1OXB A;  2ZPA A;  4P9F A;  4CJO A;  4QDL A;  4CS9 A;  4IJJ A;  1YA7 O;  4JCZ A;  4JTD B;  4U5E E;  3ZWI A;  4NCQ A;  3O39 A;  3VAY A;  3GEI A;  3GOR A;  5D91 A;  3EH2 A;  3QZC A;  5F5H A;  3ASO C;  3POV A;  2XLO A;  3TJ6 A;  4D4X A;  3TQO A;  2A0U A;  4FWV A;  4FAP B;  2Q00 A;  1SR2 A;  2LFD A;  4J30 B;  1JMW A;  3E70 C;  2OQM A;  4PAC A;  3WHN A;  2ZXR A;  1JOG A;  5COF A;  3GM2 A;  1MNE A;  2IBF A;  3CZ6 A;  1GM5 A;  4XEK A;  3K7D A;  1TR2 A;  2AU5 A;  2KYH A;  1NFO A;  1FFH A;  1M56 C;  2IXM A;  1HW1 A;  3ABM C;  3NYL A;  3O6X A;  2ICW G;  4XPY A;  1RJ9 B;  4CIH A;  4K1O A;  4CS8 C;  1Z6A A;  2HV6 A;  2MWQ A;  2EPK X;  5DQT A;  5AGF A;  3HNL A;  4J7Y A;  4NTB A;  5JUA A;  2UUH A;  5L0G A;  2XM4 A;  2B0J A;  3QVZ A;  5F5F A;  1QKR A;  3K33 A;  4JE9 A;  3VRC A;  3HNI A;  5KYX A;  3M4B A;  3IEE A;  4ULV A;  4OIO F;  2GDC A;  2GFH A;  3R2P A;  4DXW A;  3CSK A;  3NDB B;  5A6J A;  2H8A A;  4CS9 C;  4DRI B;  1HMD A;  2YKZ A;  4C3D A;  4H4K C;  3GM1 A;  5DQZ A;  2J45 A;  2HJ3 A;  4EBJ A;  5L0H A;  3H65 A;  1U0B B;  2ASR A;  2F22 A;  1B68 A;  3RH3 A;  4MW3 A;  2H7B A;  2L6G A;  4DBR A;  3AJM A;  4XLP F;  1LI7 A;  2FAP B;  1TKN A;  1H9T A;  1J8Y F;  2YVK A;  1JPJ A;  4NTF A;  3NMI A;  3U9J A;  5B3I A;  3PHF 2;  1NLX A;  2FFH A;  4CSA C;  1BR4 A;  2KK1 A;  3RFY A;  3JYY A;  4E7S A;  1EKY A;  1NU9 C;  2E87 A;  2FGY A;  4MW8 A;  2VH3 A;  3EQL F;  3TOL A;  3JRT A;  3TJ5 A;  1T5O A;  2AWY A;  3IQT A;  3ZG1 A;  2A68 F;  1MQV A;  2WVQ A;  4JEA A;  3FDQ A;  1JR8 A;  1RKE A;  4LLC A;  4A4A A;  5A6B A;  4HFK B;  1C02 A;  4JVS A;  1MMD A;  4PJL A;  1NG1 A;  1TWG A;  1E2X A;  1G4W R;  1RXQ A;  3KYJ A;  3MYF A;  1MMG A;  3MYI A;  2HS5 A;  1CGM E;  3OA1 A;  1BR2 A;  2W4M A;  3N0T A;  3S28 A;  4EIY A;  2KNH A;  3L8J A;  5T3W A;  1BBH A;  5GPG B;  2Y39 A;  4JC7 A;  1Q0K A;  4U9E A;  2QLA A;  4R32 A;  1OXK A;  3E9V A;  4RD9 A;  4PR9 A;  1SMY F;  2J7P D;  2LCH A;  1LE2 A;  1Z3I X;  1FAP B;  4YT2 A;  2TMV P;  3FXH A;  1QVX A;  4BJ5 A;  1HE9 A;  4XTK A;  3G4Z A;  2JPU A;  4X0R A;  2L81 A;  1OW6 A;  3LEO A;  4IGG A;  1EQ1 A;  5A6B D;  2R9R B;  4HFF B;  1YAR O;  1ZHX A;  3KH2 A;  2NG1 A;  4JZA A;  3JT1 A;  5CIV A;  1K40 A;  1Q0F A;  3HNK A;  3V5Y A;  2WL8 A;  4DRJ B;  1HW2 A;  1FFT C;  1ZZP A;  3ZSU A;  5BQI A;  2YLD A;  5DS4 A;  1BR1 A;  4Z9J A;  3UNG C;  1YLM A;  2NPU A;  3R7C A;  1QSP A;  3ECS A;  1Q0D A;  5KYY A;  2DI3 A;  3QTH A;  2P61 A;  4MVM A;  2R7O A;  2PFD A;  5E2Q A;  4DRH B;  3RVY A;  2O9X A;  1J8M F;  2Y3H A;  3IPM O;  2EPL X;  2DB4 A;  5JSL A;  5JRA A;  3S84 A;  2J0X A;  2LSE A;  4YN0 B;  4MVU A;  5EGY A;  3CEX A;  3DE9 A;  4C7O A;  1D0X A;  4PJM A;  3HJC A;  4KC9 A;  3U3F A;  3LS1 A;  3EGX B;  2VCC A;  2XM0 A;  3M79 A;  4U5G A;  2D5R B;  3X1O A;  1RKE B;  3NKE A;  4NQF A;  3UMH A;  1EI7 A;  1GQA A;  1OW7 A;  1ZHY A;  1PCX A;  5AC5 A;  4CSA A;  2ETS A;  1S05 A;  1OR3 A;  2CYD A;  2DYS C;  3M1C B;  4K7B A;  3Q7L A;  2BL2 A;  4AL1 A;  3UGP A;  3ZC4 A;  1T9K A;  1VMA A;  1Q0G A;  2Y3D A;  2A6E F;  1ST6 A;  1V54 C;  4U5D E;  5HSW A;  1Y6D A;  1VK5 A;  3KMI A;  5A6K A;  1JRA A;  3LJB A;  3JCU Q;  3GWN A;  1T6Q A;  2OKU A;  1M2V A;  2KW3 C;  3OWT A;  5JT4 A;  5KYW A;  2IXO A;  1FNT c;  4JCH A;  3Q6N A;  1OCC C;  2XRH A;  2GAQ A;  2YZS A;  4Z9H A;  5B1A C;  1XZQ A;  2BE5 F;  3S29 A;  3W2V A;  3QW0 A;  3S90 A;  1R4T A;  2J7P A;  2Z15 A;  2Q9C A;  4ONS A;  4BJ6 A;  3LUT B;  2R7V A;  1FMW A;  1CGN A;  3ITF A;  3L0I A;  4MQ9 F;  4MTF A;  1PD0 A;  2OEV A;  3ZVR A;  3GWL A;  5FZT A;  3VF0 A;  3EHM A;  3M4C A;  2OG2 A;  2W9Y A;  3AGT A;  2A0B A;  4C7O B;  5CI9 A;  5L0F A;  1XZP A;  5B3S C;  3NYJ A;  2KGO A;  3U9M A;  2PNO A;  3KKB A;  2P1A A;  3N2Z B;  4K0D A;  1O87 A;  1TFK B;  1QQ3 A;  2XLD A;  3N24 A;  2JX0 A;  1TFO B;  2GA0 A;  3CAX A;  4JW1 A;  1CGO A;  3UMI A;  4Q5S F;  1ZYR F;  4NY3 A;  2YL7 A;  1YJG A;  3MX3 A;  1C03 A;  3Q6M A;  1ZHZ A;  5E3C A;  5CI8 A;  3T9O A;  1ZHW A;  2VC9 A;  2I8B A;  3EG9 B;  2EPN A;  3MFN A;  3U3B A;  3UMK A;  5E3A A;  4YL0 A;  4YT5 A;  1LS1 A;  4QI2 A;  2HSQ A;  3GOD A;  1A7D A;  3TK0 A;  1D1A A;  2LD6 A;  3EZH A;  3V7O A;  5EHH A;  3DJN B;  1QLE C;  4EBK A;  3FMS A;  4DVZ A;  1YAU O;  4LDR A;  3TOM A;  4N6C A;  3AQB A;  2A6H F;  2ZD9 A;  4BJ6 C;  1CPR A;  2EPM X;  1D0Z A;  3C63 A;  1T6U A;  3I5P A;  1ORJ A;  1YYX A;  2JD3 A;  2XLE A;  4PFO A;  4I1M A;  3SXY A;  4D4N A;  2X51 A;  3ABL C;  4F4B A;  4I1O B;  4OIN F;  4A2N B;  2J9B A;  4NTA A;  5DS5 A;  2KJG A;  3US6 A;  3AQC A;  3B9Q A;  1OQC A;  3BEH A;  2Q9B A;  4YJW A;  4P6I C;  4BJ5 C;  1U6H A;  5B1B C;  3B71 A;  1SZI A;  4XLN F;  4E17 A;  5A6A A;  3L8I A;  2XL6 A;  3ABK C;  1KU2 A;  2G62 A;  2PP4 A;  4AE4 B;  3G4X A;  1UG7 A;  1FR0 A;  1WAS A;  2XLH A;  2QNL A;  1YDI A;  3C18 A;  1YZA A;  5KYU A;  3C7J A;  1ZW2 A;  2R02 A;  2CNW D;  4PJN A;  5T1D B;  2L6H A;  4OD5 A;  2IXN A;  4ULW A;  2Q7R A;  3U0C A;  3C62 A;  2R7Q A;  4KNV A;  1YVI A;  2RSE B;  1HMO A;  2R7S A;  1A7E A;  3T6J A;  3W4Y A;  2NSG A;  1M2O A;  3IQC A;  2M4E A;  1I4Z A;  1VLT A;  2OU6 A;  1M2V B;  3RQG A;  2VCB A;  3WG7 C;  3W8H A;  1K05 A;  2QE9 A;  1O5H A;  4XWJ A;  4B6I A;  1MND A;  4E7Z A;  2NSF A;  2XL8 A;  3JTL O;  4FES A;  1KNY A;  4C3E A;  4GEH A;  5L3V A;  2W45 A;  1ZW3 A;  4OD4 A;  2HJM A;  1Q0M A;  1SF8 A;  1EA8 A;  3DJU B;  3ASN C;  1TWA A;  4O6M A;  3ZTM A;  5HV9 A;  3EHN A;  1ZHT A;  2CW0 F;  4P9T A;  2UUI A;  1LM3 B;  2EIN C;  1O3U A;  1Y4C A;  3EJN A;  3V5X A;  3EFO A;  2LQG A;  4CS7 A;  5JS5 A;  256B A;  3FHD A;  3HNJ A;  1E85 A;  3RVZ A;  2W4B A;  1D1B A;  1Z23 A;  4CDA A;  5DS6 A;  2AWC A;  1YA9 A;  2HSB A;  1OCZ C;  3HLZ A;  3KYI A;  3B0P A;  2J0W A;  2IM8 A;  4BEJ A;  4LLE A;  5L0J A;  1H6G A;  3DWW A;  2WZG A;  3FOO A;  5JP7 A;  1NSG B;  3EGD A;  4HE8 D;  3MBG A;  1OCO C;  3AG1 C;  3L1M A;  4E0I A;  4LAC B;  2Y3B A;  4DVY P;  2EPO A;  1TQG A;  5KYY B;  1QZX A;  3DI5 A;  4O7G A;  3JYH A;  1Z7Q c;  2EIK C;  2G3K A;  5F28 E;  3W2W A;  3EG9 A;  4XQ1 A;  2P7V A;  2XSE A;  4IWB A;  1LS4 A;  2R25 A;  1RMV A;  3G50 A;  3I5Q A;  1R5I D;  2A1D D;  2HZ8 A;  2NUT B;  1DOV A;  3DKA A;  2HV7 A;  4MVS A;  3AG3 C;  2L6F A;  3O10 A;  4U9D A;  3T4R A;  4EHP A;  3C8G B;  3SXZ A;  2R7W A;  4KI2 A;  3KPH A;  2YEV A;  1OW8 A;  2H7V C;  4MVR A;  3ZDL A;  1VOM A;  3LNM B;  1YZC A;  1JAF A;  1OKK D;  3ZQV A;  4E0H A;  2J46 A;  2VB6 A;  3ATP A;  3A9C A;  1DOW A;  3FAP B;  3U8V A;  2HKV A;  3NG1 A;  4JIO A;  4KBL A;  3X2Q C;  3EH1 A;  2ZXP A;  1LI5 A;  4BEM J;  3SP1 A;  4NC3 A;  3GM3 A;  4JJF A;  4O79 A;  2R7R A;  1WAT A;  5L0C A;  4Z9I A;  3ZTZ A;  2EIM C;  3DAG A;  3GEH A;  2VCA A;  2YRF A;  3LEV A;  2HUJ A;  5AC4 A;  2OCC C;  3TUL A;  3U2M A;  1T01 A;  4ANJ A;  4MVQ A;  2RD9 A;  4LDQ A;  4JTC B;  4XPX A;  4RBN A;  4EBB A;  1S7Z A;  3DM9 B;  4YK5 A;  2R7T A;  2I15 A;  2LK4 A;  3MLG A;  3JSZ A;  1WTY A;  3EGD B;  2WB7 A;  4MTG A;  1HY5 A;  2R05 A;  5JVE A;  3NMK A;  4OIQ F;  3DMD A;  3L34 A;  1GS9 A;  1G4U S;  5KYX B;  1KTM A;  3U2L A;  1WN0 A;  4XEF A;  2IXP A;  2M64 A;  1FMV A;  3A11 A;  3C8G D;  2YL3 A;  1WGW A;  3EFO B;  4JKV A;  3F46 A;  1VYI A;  1OR2 A;  2J9V A;  4G7H F;  1HE1 A;  1ZVZ A;  3QMK A;  2MYS A;  5DVW A;  4PK4 A;  3ZQY A;  2V26 A;  4IB4 A;  1VB5 A;  4U5H A;  2X0C A;  3HTK C;  2WVO A;  3SXM A;  4YWQ A;  2HMZ A;  2ZXO A;  4MTO A;  4RDA A;  1PV3 A;  1M6T A;  4CX9 A;  2R03 A;  4U5C E;  1VYK A;  3ZIB A;  1UFB A;  2YL0 A;  1WOL A;  2LIG A;  4GYT A;  2HMQ A;  2VAS A;  5L0D A;  3H2V A;  4L6R A;  3S9O A;  2OJQ A;  1FTS A;  4J32 B;  4U5B E;  5L3Q A;  1IZM A;  1AUE A;  4JUR I;  4JJG A;  1TWC A;  4MVO A;  5KYU B;  3S0X A;  2L7A A;  2CDQ A;  2WVN A;  1F1M A;  3M15 A;  3GEE A;  3LES A;  2MHR A;  3IQ5 A;  3LLI A;  4WGY A;  1H9G A;  4LDK A;  1NU7 D;  5COG A;  5BUO A;  2V3C C;  4JTA B;  4AE4 A;  2C03 A;  1QPU A;  1N1C A;  2YLG A;  2ZXW C;  3DE8 A;  4MVZ A;  5KYW B;  3HKK A;  3U8P A;  4J7T A;  1VTM P;  3K1H A;  1E86 A;  4YL1 A;  1M57 C;  1SYQ A;  1U89 A;  2P6V A;  4GQH A;  3RKO F;  4G7O F;  3Q7G A;  1LE4 A;  3RYL A;  4CJG A;  3KL4 A;  2DGJ A;  2BC5 A;  3LAY A; 
#chains in the Genus database with same CATH homology
 4BEM J;  2CYD A;  5TJ5 E;  3AOU A;  2DB4 A;  2BL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...