5TJ5E

Atomic model for the membrane-embedded motor of a eukaryotic v-atpase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
138
Chain Sequence
APFFGAIGCASAIIFTSLGAAYGTAKSGVLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Motor protein
molecule keywords V-type proton ATPase subunit a
publication title Atomic model for the membrane-embedded VO motor of a eukaryotic V-ATPase.
pubmed doi rcsb
total genus 43
structure length 138
sequence length 150
chains with identical sequence F, G, H, I, J, M, N
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00137 ATP-synt_C ATP synthase subunit C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.610 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) lithium bound rotor ring of v- atpase 5tj5E00
2CYDA 2DB4A 4BEMJ 2BL2A 5TJ5E 3AOUA
chains in the Genus database with same CATH superfamily
2X51A 1IZMA 5JUAA 1FNTc 2R25A 3L34A 1U89A 1JR8A 1H9GA 2OKUA 4YT5A 2V26A 3RVZA 3UMKA 4CJGA 2LIGA 4CIPA 4A2NB 5A6BD 2VCCA 2OJQA 1ZHWA 4MVUA 3K1IC 5B3IA 1QSPA 3FHDA 4NY3A 4CSAC 2AWCA 4YT8A 3EPVA 3O39A 1VLSA 4AL0A 3JRMO 4XEKA 1C17M 4MW8A 3FAJA 1JMWA 1RKCA 1TWAA 4OIOF 1M2VA 4HFFB 4IB4A 4WABA 3S9OA 1AEPA 1T6IA 4J7TA 1D0ZA 2QUPA 3DJUB 3RFYA 3ZVRA 2KNHA 5BQGA 2W4BA 4AX2A 2O9XA 2WVOA 5KYUB 2YKZA 3PMRA 3HNLA 5CI8A 3DJNB 2OJED 3MFNA 5DQTA 2YZSA 1I5NA 3EG9A 1OXKA 2YLGA 5JT4A 2XL8A 5B3SC 1YDIA 4EKWA 1Q0GA 1ZHZA 3UGOA 1ZZPA 2GDCA 1FFHA 3DXJF 5A6JA 1HW2A 2NPUA 5L0DA 5BQHA 1BBHA 2KC3A 3NKEA 3NDBB 2VC9A 2Q4FA 1H9TA 3JZ0A 4H54A 3LEOA 1UFBA 1OKKA 4BEMJ 2EPLX 3JT1A 4BG0A 1FR0A 4N06A 2DGJA 3N0TA 1WWPA 5KYWB 1A7VA 3I4UA 4DRHB 2LFDA 3BEHA 4DVZA 2E87A 3EFOA 3NMJA 1YA7O 2CCYA 4CBEA 3W8HA 1L3PA 4MS2A 1NG1A 4N6HA 2AWYA 3LAYA 3H65A 4U5HA 5CI9A 3S0XA 1NLXA 2NSGA 1YLMA 3K6BA 3CSKA 5AC4A 3CAXA 2OEVA 2RD9A 2B0HA 2ZXRA 4XLPF 4Q4ZF 4KI2A 2XLEA 4LLEA 4BJ6C 5KYYB 5GPGB 5L0IA 3M4BA 3U2MA 5EGYA 1JRAA 2JD3A 4U5FE 5L0GA 4W8PA 2NUPB 1BR4A 4EWCA 2R02A 2WL8A 4MTOA 3LUTB 1XZQA 1LS4A 3ZSUA 4JW1A 4DBRA 1S7ZA 2EPOA 3HLZA 3M15A 2Y39A 3DKAA 4CSAA 2CW0F 1N1CA 2P1AA 4YL1A 4R32A 5L0FA 3SEOA 3C8ZA 3U9MA 3U0CA 2ZXWC 2L6GA 3JSZA 2LK4A 3CQZA 3KPHA 2D5RB 2C04A 5B1AC 1YYJA 1YZAA 2ZD9A 1LIHA 2Y69C 3ABKC 2YLIA 1RJ9B 3JCUQ 3JYYA 3LLKA 4IRUA 4U9DA 5KYUA 3V5ZA 1YARO 1OQCA 3CZ6A 2JX0A 2BE5F 3S27A 2P7VA 1MMNA 3WHNA 3ZC4A 2OEXA 3BRJA 5F5FA 3KKBA 3UGPA 2YVKA 3TJ6A 2G3KA 3B0PA 3F46A 5JP7A 5FCLA 3X1OA 4ZLCA 4DJ9A 1RCPA 4MVRA 3AQCA 4H4KC 2IXOA 4QDLA 2KJGA 3ZG1A 1TWHA 1U6HA 2GA0A 3EHNA 1ORSC 1A41A 4G0HA 4CS8C 3LS0A 2MYSA 4E7ZA 3S90A 2IOQA 2J45A 5F28E 2Q9CA 1V4AA 5E2QA 1QZXA 2ZXOA 1FTSA 4Z9IA 3IQ5A 5KYWA 2J9VA 1QKRA 4J7YA 2XRHA 5FZTA 1SR2A 3HKKA 4U5GA 3I5QA 3ZDLA 5KYXB 4XLNF 2QLAA 1O87A 1NFNA 3EHMA 1Q0MA 1FFTC 3Q7LA 4YN0B 3ZIBA 2YL7A 1OCOC 2R7UA 2R7WA 5COFA 1JOGA 1KU2A 1TR2A 1VMAA 5L3QA 1G4US 1ZHXA 2HSQA 3AGUA 4CDAA 2XSEA 1AUEA 3C63A 1T6QA 1NU9C 1MMAA 1OCCC 1EQ1A 2Q7RA 4XPXA 3U3FA 1M56C 5KYYA 5L0CA 2X0CA 2J7PA 2GFHA 4CJOA 2QE9A 5D91A 1JPJA 4CDVA 1M57C 1OR2A 3QZCA 2NUPA 1XWJA 3B0UX 1YYXA 1ZYRF 5JVEA 3UMIA 3AGTA 3K66A 3VAYA 1SZIA 4O7GA 2EINC 3EH2A 1PD0A 3FOOA 3IQTA 4O79A 4YWQA 2ASRA 2I8BA 3QVYA 3EJNA 2OU6A 3WODF 3AJMA 2B0JA 3HJCA 3VRCA 4I1MA 3WAQA 2PFDA 4ANJA 5JS5A 4WGZA 4WJ0A 3QW0A 3Q7GA 1RXQA 1HE9A 2PF4E 4JURI 1G8XA 1RJ9A 3V5XA 5AC5A 3N2ZB 3MYFA 4K1OA 2PBEA 4MQ9F 1HMDA 5E3AA 3RH3A 3TULA 1C03A 2KSFA 2LCHA 3EGDB 3US6A 1ORYA 5DQZA 1ZU5A 3C7JA 4LDQA 4O6NA 3FDQA 4BEJA 2GWWA 4EIYA 1Q0DA 3GWNA 4Z9HA 4MVQA 4DRJB 1JAFA 4LLCA 4P6IC 3U5SA 4CIHA 4C3BA 1Y4CA 4XPYA 3EZHA 1VTMP 3F47A 1NZEA 1LKXA 3AQBA 5A6BA 4IARA 1M6TA 1LM3B 2J46A 5HSWA 3KL4A 2J9WA 2PNOA 4ZLDA 4MW3A 3S84A 4EBJA 5L3VA 4G7ZF 5CIVA 5JRAA 4AE4B 2M64A 3FAPB 1D1CA 3RKOF 2VH3A 2R7RA 1Y6DA 5KYXA 2XM4A 2Q9BA 4G78A 5D92A 1T6UA 2IBFA 2A68F 1LE2A 3ECSA 1T9KA 4MVSA 1HE1A 5T3WA 3W8IA 2WVQA 5F5HA 3VYWA 1EKYA 5IY5C 2A6HF 4OINF 4PJJA 5A69A 3PDMP 2OG2A 4Q7CA 3IEEA 1A0BA 2WVNA 2FAPB 2RSEB 4IAOA 2WZGA 4IJJA 1KNYA 4P9TA 4JC7A 1C02A 1R4TA 3U3BA 1QPUA 1LVKA 4EBKA 3JRTA 3MYIA 3AG4C 4C7OB 1U0BB 1NSGB 2A0UA 4NTAA 1OKKD 3NG1A 2R7QA 3RQEA 2BC5A 4HE8D 3GM2A 1CGOA 1LS1A 4PK4A 3HNKA 4YL0A 2DYRC 3K1HA 1HMOA 3E70C 1QVXA 3PCVA 4QI0A 4GYTA 2HV7A 1WGWA 2Y3BA 3ITFA 3M79A 3R2PA 2VCAA 3QW1A 1DOWA 1JPNA 2ETSA 3IHUA 1APCA 1CPQA 1LI5A 2J9BA 2EPNA 2CNWA 3DE9A 2XS8A 1VYKA 3EGDA 1OR3A 4CS9C 1ORJA 4FX5A 4KNWA 3H2UA 1I4ZA 3RVYA 5COGA 4BJ5C 1H6GA 2EPKX 1WOLA 3S29A 4E18A 4IWBA 3K33A 4MTFA 3K1IA 1AVOB 2NG1A 2QY9A 2Q00A 3U8PA 4WGYA 1O5HA 2DYSC 2QTVA 3MBGA 2L7AA 1G5ZA 2HMZA 3C18A 3L8JA 1CGNA 4MNDA 3FVYA 4U5EE 1ZHYA 1PD1A 2OCCC 1YZCA 1QLEC 4D4NA 5L0HA 1VLTA 1QQ3A 4K7BA 4AE4A 3H2VA 4MTGA 3E9VA 4G7HF 1TQGA 4O6YA 3C8GD 1DOVA 4CDYA 4U5BE 2R7OA 2Y3GA 3W4YA 5BUOA 3UMHA 4JIOA 2J9UA 4I3MA 4M63A 2PX3A 4EHPA 3GODA 2CYDA 2XLOA 4F4BA 1TKNA 2A0BA 1ZU4A 3SZRA 5B1BC 1OCZC 1VB5A 2P0NA 3NMIA 1BDJB 4XEFA 3L8IA 3ZTZA 3G4XA 3O55A 3N24A 2VB6A 3DZAA 4IAQA 3UNGC 1E85A 3DD7A 4L6RA 1IW7F 3U9JA 4DBQA 2TMVP 5EK0A 1MNDA 3NYLA 1E86A 3C62A 3HTKC 1K05A 1GM5A 4EBBA 4C7OA 1Z23A 2A6EF 2HJMA 4KNVA 2H7VC 2V3CC 3ZWIA 4GEHA 2L6HA 3FMSA 5DS6A 3SXKA 2FFHA 5T1DB 1Q0FA 1OCRC 4LERA 5E33A 4MVMA 3DM5A 4X0RA 2W9YA 2L6FA 4YJWA 1BZ4A 4O6MA 1WTYA 4FAPB 4XQ1A 2AVKA 1MQVA 4GQHA 2OOCA 3K7DA 4J32B 4BJ6A 5AGFA 5DS4A 1FMVA 4HEAJ 1V74B 4XTKA 3DI5A 5E3CA 2EIJC 4KC9A 4DOZA 4OD5A 1Z7Qc 3UR3C 1J8YF 3M4CA 4LDKA 2Q9AA 1Z63A 1E84A 2W4MA 3O10A 3B0VC 2KGOA 3NYMA 2YL1A 1WASA 4A4AA 4U5DE 2L9JA 4JE9A 1K04A 1O3UA 2DB4A 1SF8A 3PHF2 2J7PD 2HKVA 3T6JA 2C03A 2ICWG 1SYQA 2AP3A 4BJ1A 1MNEA 1Z3IX 2WZLA 1E83A 1VOMA 2KYHA 5JSLA 3RF3A 4JCZA 1OW8A 3GM1A 4J30B 2NUTA 4BPMA 1FAPB 1A7EA 4JZAA 3T6BA 4DXWA 1D1AA 2J8WA 4ER9A 5DVWA 3QTHA 4PFPA 2R7TA 1MMGA 2IXPA 3IPMO 3OEOA 3ASNC 4N4WA 4YL3A 4JTAB 3DMDA 3LJBA 3Q6NA 2IM8A 5COMA 1BR2A 1I4YA 4CS8A 2H8AA 5JLIA 3DE8A 2YRFA 3QVZA 1ST6A 3O6XA 3TOLA 2G3VA 3LS1A 1ZW2A 1NFOA 2HS5A 2R03A 3TD7A 3SXYA 1YJGA 4NTBA 3W2VA 1HW1A 1CPRA 4ULWA 4ULVA 1TFOB 2F22A 3GANA 3R7CA 3B9QA 1MMDA 2D4UA 4XWJA 3JSEO 2XXAB 2HZ8A 5K0IA 2A69F 1D0YA 1EA8A 3EH1A 4JJGA 1VYIA 1D0XA 2YQYA 4PR9A 3C8GB 4JJFA 2EIKC 2NSFA 4RBNA 2EPMX 1J8MF 1R5ID 4PJMA 4AL1A 4G7OF 1GQAA 4U5CE 1B68A 2PX0A 3TJ5A 2KK1A 1S05A 2LD6A 3AG2C 4YK5A 3U8VA 3OWTA 2R7XA 2KQ9A 1TFKB 2MHRA 4N6CA 1SMYF 3ABMC 3JTLO 1H7IA 3X2QC 4DVYP 4PJLA 1LPEA 2YL0A 2HMQA 2WB7A 3OA1A 3T4RA 3ABLC 3NMKA 4CS7A 2L81A 1L7CA 1YA9A 1RKEB 1TWCA 3FOPA 3LESA 2A1DD 2R9RB 2Z15A 3GORA 3HNJA 4UDVA 3EQLF 3QMKA 2ZXPA 2Y3DA 3DM9B 2XM0A 3KYIA 2I15A 1KTMA 1PV3A 3L0IA 3LLIA 1V54C 3FXHA 2UUHA 3AOUA 2ZPAA 3A11A 3I5PA 4E0HA 2R7VA 4PFOA 4JCHA 4EUKB 4PJNA 5DLJA 2EIMC 2HV6A 2M4EA 4AK9A 4P9FA 3L1MA 1A7DA 1Q0KA 3TOMA 2CNWD 1WN0A 1YVIA 4OIRF 2LSEA 2OQMA 4RD9A 2XLHA 4C3EA 3DAGA 2Q3TA 4I44A 4YT2A 3KYJA 3V5YA 4JVSA 3ZQVA 1ZHTA 2EILC 1TWGA 2NUTB 1NU7D 3EZIA 2J0WA 5KYNA 4I1OB 3DAFA 2CGEA 4PACA 3RQFA 2PP4A 5TJ5E 4JEBA 2KW3C 4OIPF 4XPWA 3EGXB 3LNMB 3SYNA 5EHHA 4E0IA 1F1MA 3SP1A 4C3DA 3RYLA 2XXAA 2HJ3A 3GEHA 1UG7A 2HSBA 2YLDA 3G4ZA 3NKDA 2P61A 3RQGA 3RW0A 5L0JA 4QI2A 3DWWA 3G50A 3AG1C 3CEXA 1GS9A 3SNHA 4CX9A 3C8GA 4XEVA 3RIPA 2MWQA 3GM3A 3M1CB 1G4WR 5A6KA 2YWAA 1ZW3A 4DRIB 4RDAA 4BJTA 256BA 2DI3A 3WG7C 3NRHA 4E17A 1EI7A 2XLDA 1OXBA 5DS5A 3J06A 2XLWA 1CGME 1E2XA 4NCQA 2QNLA 4JTCB 4JTDB 5HV9A 3IQCA 4D4XA 3T6GB 5BQIA 1XZPA 3HNIA 3ZQYA 4OD4A 1VK5A 3TQOA 1RKEA 1T01A 2GAQA 3KMIA 2W45A 1HY5A 1Z5ZA 4IGGA 4U9EA 4YT4A 3A9CA 3VF0A 5T3TA 1V55C 2G62A 1M2VB 2XS1A 3MX3A 2CDQA 4JEAA 3Q6MA 3ASOC 4CS9A 2XLMA 4LACB 4KBLA 3B29A 3GEEA 1WATA 2LP4A 2HUJA 4Q5SF 3POVA 2LQGA 4NQFA 4BJ5A 3MLGA 2YEVA 3B71A 4JRZA 2XLVA 2IYLD 3SXMA 1YAUO 2JPUA 3EG9B 1NBBA 2AU5A 1ZVZA 3GWLA 4LDRA 2YL3A 2HFIA 1GGQA 1K40A 2Y3HA 1OW6A 2YHSA 1BR1A 3AG3C 4JKVA 4MVZA 4NTFA 1LE4A 1W2WA 1RMVA 4OIQF 1D1BA 2R05A 1PCXA 2P6VA 2XL4A 4HFKB 4MVOA 1T5OA 2VCBA 1LI7A 1OW7A 1M2OA 2J0XA 4FESA 3GEIA 2IXMA 2R7SA 2H7BA 3JYHA 3NYJA 3ATPA 3LEVA 2VASA 3EGXA 2BL2A 3IQ6A 4B6IA 3S28A 3EFOB 5A6AA 4FWVA 3ZTMA 4Z9JA 2WZFA 4ONSA 2XL6A 4NC3A 4E7SA 3W2WA 2H7OA 3T9OA 3U2LA 3V7OA 4W8KA 2UUIA 3TK0A 3VM6A 2FGYA 2IXNA 3KH2A 3SXZA 2LFFA 4K0DA 3LNRA 1Z6AA 1FMWA
chains in the Genus database with same CATH topology
2CYDA 2DB4A 4BEMJ 2BL2A 5TJ5E 3AOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYD A;  2DB4 A;  4BEM J;  2BL2 A;  5TJ5 E;  3AOU A; 
#chains in the Genus database with same CATH topology
 2X51 A;  1IZM A;  5JUA A;  1FNT c;  2R25 A;  3L34 A;  1U89 A;  1JR8 A;  1H9G A;  2OKU A;  4YT5 A;  2V26 A;  3RVZ A;  3UMK A;  4CJG A;  2LIG A;  4CIP A;  4A2N B;  5A6B D;  2VCC A;  2OJQ A;  1ZHW A;  4MVU A;  3K1I C;  5B3I A;  1QSP A;  3FHD A;  4NY3 A;  4CSA C;  2AWC A;  4YT8 A;  3EPV A;  3O39 A;  1VLS A;  4AL0 A;  3JRM O;  4XEK A;  1C17 M;  4MW8 A;  3FAJ A;  1JMW A;  1RKC A;  1TWA A;  4OIO F;  1M2V A;  4HFF B;  4IB4 A;  4WAB A;  3S9O A;  1AEP A;  1T6I A;  4J7T A;  1D0Z A;  2QUP A;  3DJU B;  3RFY A;  3ZVR A;  2KNH A;  5BQG A;  2W4B A;  4AX2 A;  2O9X A;  2WVO A;  5KYU B;  2YKZ A;  3PMR A;  3HNL A;  5CI8 A;  3DJN B;  2OJE D;  3MFN A;  5DQT A;  2YZS A;  1I5N A;  3EG9 A;  1OXK A;  2YLG A;  5JT4 A;  2XL8 A;  5B3S C;  1YDI A;  4EKW A;  1Q0G A;  1ZHZ A;  3UGO A;  1ZZP A;  2GDC A;  1FFH A;  3DXJ F;  5A6J A;  1HW2 A;  2NPU A;  5L0D A;  5BQH A;  1BBH A;  2KC3 A;  3NKE A;  3NDB B;  2VC9 A;  2Q4F A;  1H9T A;  3JZ0 A;  4H54 A;  3LEO A;  1UFB A;  1OKK A;  4BEM J;  2EPL X;  3JT1 A;  4BG0 A;  1FR0 A;  4N06 A;  2DGJ A;  3N0T A;  1WWP A;  5KYW B;  1A7V A;  3I4U A;  4DRH B;  2LFD A;  3BEH A;  4DVZ A;  2E87 A;  3EFO A;  3NMJ A;  1YA7 O;  2CCY A;  4CBE A;  3W8H A;  1L3P A;  4MS2 A;  1NG1 A;  4N6H A;  2AWY A;  3LAY A;  3H65 A;  4U5H A;  5CI9 A;  3S0X A;  1NLX A;  2NSG A;  1YLM A;  3K6B A;  3CSK A;  5AC4 A;  3CAX A;  2OEV A;  2RD9 A;  2B0H A;  2ZXR A;  4XLP F;  4Q4Z F;  4KI2 A;  2XLE A;  4LLE A;  4BJ6 C;  5KYY B;  5GPG B;  5L0I A;  3M4B A;  3U2M A;  5EGY A;  1JRA A;  2JD3 A;  4U5F E;  5L0G A;  4W8P A;  2NUP B;  1BR4 A;  4EWC A;  2R02 A;  2WL8 A;  4MTO A;  3LUT B;  1XZQ A;  1LS4 A;  3ZSU A;  4JW1 A;  4DBR A;  1S7Z A;  2EPO A;  3HLZ A;  3M15 A;  2Y39 A;  3DKA A;  4CSA A;  2CW0 F;  1N1C A;  2P1A A;  4YL1 A;  4R32 A;  5L0F A;  3SEO A;  3C8Z A;  3U9M A;  3U0C A;  2ZXW C;  2L6G A;  3JSZ A;  2LK4 A;  3CQZ A;  3KPH A;  2D5R B;  2C04 A;  5B1A C;  1YYJ A;  1YZA A;  2ZD9 A;  1LIH A;  2Y69 C;  3ABK C;  2YLI A;  1RJ9 B;  3JCU Q;  3JYY A;  3LLK A;  4IRU A;  4U9D A;  5KYU A;  3V5Z A;  1YAR O;  1OQC A;  3CZ6 A;  2JX0 A;  2BE5 F;  3S27 A;  2P7V A;  1MMN A;  3WHN A;  3ZC4 A;  2OEX A;  3BRJ A;  5F5F A;  3KKB A;  3UGP A;  2YVK A;  3TJ6 A;  2G3K A;  3B0P A;  3F46 A;  5JP7 A;  5FCL A;  3X1O A;  4ZLC A;  4DJ9 A;  1RCP A;  4MVR A;  3AQC A;  4H4K C;  2IXO A;  4QDL A;  2KJG A;  3ZG1 A;  1TWH A;  1U6H A;  2GA0 A;  3EHN A;  1ORS C;  1A41 A;  4G0H A;  4CS8 C;  3LS0 A;  2MYS A;  4E7Z A;  3S90 A;  2IOQ A;  2J45 A;  5F28 E;  2Q9C A;  1V4A A;  5E2Q A;  1QZX A;  2ZXO A;  1FTS A;  4Z9I A;  3IQ5 A;  5KYW A;  2J9V A;  1QKR A;  4J7Y A;  2XRH A;  5FZT A;  1SR2 A;  3HKK A;  4U5G A;  3I5Q A;  3ZDL A;  5KYX B;  4XLN F;  2QLA A;  1O87 A;  1NFN A;  3EHM A;  1Q0M A;  1FFT C;  3Q7L A;  4YN0 B;  3ZIB A;  2YL7 A;  1OCO C;  2R7U A;  2R7W A;  5COF A;  1JOG A;  1KU2 A;  1TR2 A;  1VMA A;  5L3Q A;  1G4U S;  1ZHX A;  2HSQ A;  3AGU A;  4CDA A;  2XSE A;  1AUE A;  3C63 A;  1T6Q A;  1NU9 C;  1MMA A;  1OCC C;  1EQ1 A;  2Q7R A;  4XPX A;  3U3F A;  1M56 C;  5KYY A;  5L0C A;  2X0C A;  2J7P A;  2GFH A;  4CJO A;  2QE9 A;  5D91 A;  1JPJ A;  4CDV A;  1M57 C;  1OR2 A;  3QZC A;  2NUP A;  1XWJ A;  3B0U X;  1YYX A;  1ZYR F;  5JVE A;  3UMI A;  3AGT A;  3K66 A;  3VAY A;  1SZI A;  4O7G A;  2EIN C;  3EH2 A;  1PD0 A;  3FOO A;  3IQT A;  4O79 A;  4YWQ A;  2ASR A;  2I8B A;  3QVY A;  3EJN A;  2OU6 A;  3WOD F;  3AJM A;  2B0J A;  3HJC A;  3VRC A;  4I1M A;  3WAQ A;  2PFD A;  4ANJ A;  5JS5 A;  4WGZ A;  4WJ0 A;  3QW0 A;  3Q7G A;  1RXQ A;  1HE9 A;  2PF4 E;  4JUR I;  1G8X A;  1RJ9 A;  3V5X A;  5AC5 A;  3N2Z B;  3MYF A;  4K1O A;  2PBE A;  4MQ9 F;  1HMD A;  5E3A A;  3RH3 A;  3TUL A;  1C03 A;  2KSF A;  2LCH A;  3EGD B;  3US6 A;  1ORY A;  5DQZ A;  1ZU5 A;  3C7J A;  4LDQ A;  4O6N A;  3FDQ A;  4BEJ A;  2GWW A;  4EIY A;  1Q0D A;  3GWN A;  4Z9H A;  4MVQ A;  4DRJ B;  1JAF A;  4LLC A;  4P6I C;  3U5S A;  4CIH A;  4C3B A;  1Y4C A;  4XPY A;  3EZH A;  1VTM P;  3F47 A;  1NZE A;  1LKX A;  3AQB A;  5A6B A;  4IAR A;  1M6T A;  1LM3 B;  2J46 A;  5HSW A;  3KL4 A;  2J9W A;  2PNO A;  4ZLD A;  4MW3 A;  3S84 A;  4EBJ A;  5L3V A;  4G7Z F;  5CIV A;  5JRA A;  4AE4 B;  2M64 A;  3FAP B;  1D1C A;  3RKO F;  2VH3 A;  2R7R A;  1Y6D A;  5KYX A;  2XM4 A;  2Q9B A;  4G78 A;  5D92 A;  1T6U A;  2IBF A;  2A68 F;  1LE2 A;  3ECS A;  1T9K A;  4MVS A;  1HE1 A;  5T3W A;  3W8I A;  2WVQ A;  5F5H A;  3VYW A;  1EKY A;  5IY5 C;  2A6H F;  4OIN F;  4PJJ A;  5A69 A;  3PDM P;  2OG2 A;  4Q7C A;  3IEE A;  1A0B A;  2WVN A;  2FAP B;  2RSE B;  4IAO A;  2WZG A;  4IJJ A;  1KNY A;  4P9T A;  4JC7 A;  1C02 A;  1R4T A;  3U3B A;  1QPU A;  1LVK A;  4EBK A;  3JRT A;  3MYI A;  3AG4 C;  4C7O B;  1U0B B;  1NSG B;  2A0U A;  4NTA A;  1OKK D;  3NG1 A;  2R7Q A;  3RQE A;  2BC5 A;  4HE8 D;  3GM2 A;  1CGO A;  1LS1 A;  4PK4 A;  3HNK A;  4YL0 A;  2DYR C;  3K1H A;  1HMO A;  3E70 C;  1QVX A;  3PCV A;  4QI0 A;  4GYT A;  2HV7 A;  1WGW A;  2Y3B A;  3ITF A;  3M79 A;  3R2P A;  2VCA A;  3QW1 A;  1DOW A;  1JPN A;  2ETS A;  3IHU A;  1APC A;  1CPQ A;  1LI5 A;  2J9B A;  2EPN A;  2CNW A;  3DE9 A;  2XS8 A;  1VYK A;  3EGD A;  1OR3 A;  4CS9 C;  1ORJ A;  4FX5 A;  4KNW A;  3H2U A;  1I4Z A;  3RVY A;  5COG A;  4BJ5 C;  1H6G A;  2EPK X;  1WOL A;  3S29 A;  4E18 A;  4IWB A;  3K33 A;  4MTF A;  3K1I A;  1AVO B;  2NG1 A;  2QY9 A;  2Q00 A;  3U8P A;  4WGY A;  1O5H A;  2DYS C;  2QTV A;  3MBG A;  2L7A A;  1G5Z A;  2HMZ A;  3C18 A;  3L8J A;  1CGN A;  4MND A;  3FVY A;  4U5E E;  1ZHY A;  1PD1 A;  2OCC C;  1YZC A;  1QLE C;  4D4N A;  5L0H A;  1VLT A;  1QQ3 A;  4K7B A;  4AE4 A;  3H2V A;  4MTG A;  3E9V A;  4G7H F;  1TQG A;  4O6Y A;  3C8G D;  1DOV A;  4CDY A;  4U5B E;  2R7O A;  2Y3G A;  3W4Y A;  5BUO A;  3UMH A;  4JIO A;  2J9U A;  4I3M A;  4M63 A;  2PX3 A;  4EHP A;  3GOD A;  2CYD A;  2XLO A;  4F4B A;  1TKN A;  2A0B A;  1ZU4 A;  3SZR A;  5B1B C;  1OCZ C;  1VB5 A;  2P0N A;  3NMI A;  1BDJ B;  4XEF A;  3L8I A;  3ZTZ A;  3G4X A;  3O55 A;  3N24 A;  2VB6 A;  3DZA A;  4IAQ A;  3UNG C;  1E85 A;  3DD7 A;  4L6R A;  1IW7 F;  3U9J A;  4DBQ A;  2TMV P;  5EK0 A;  1MND A;  3NYL A;  1E86 A;  3C62 A;  3HTK C;  1K05 A;  1GM5 A;  4EBB A;  4C7O A;  1Z23 A;  2A6E F;  2HJM A;  4KNV A;  2H7V C;  2V3C C;  3ZWI A;  4GEH A;  2L6H A;  3FMS A;  5DS6 A;  3SXK A;  2FFH A;  5T1D B;  1Q0F A;  1OCR C;  4LER A;  5E33 A;  4MVM A;  3DM5 A;  4X0R A;  2W9Y A;  2L6F A;  4YJW A;  1BZ4 A;  4O6M A;  1WTY A;  4FAP B;  4XQ1 A;  2AVK A;  1MQV A;  4GQH A;  2OOC A;  3K7D A;  4J32 B;  4BJ6 A;  5AGF A;  5DS4 A;  1FMV A;  4HEA J;  1V74 B;  4XTK A;  3DI5 A;  5E3C A;  2EIJ C;  4KC9 A;  4DOZ A;  4OD5 A;  1Z7Q c;  3UR3 C;  1J8Y F;  3M4C A;  4LDK A;  2Q9A A;  1Z63 A;  1E84 A;  2W4M A;  3O10 A;  3B0V C;  2KGO A;  3NYM A;  2YL1 A;  1WAS A;  4A4A A;  4U5D E;  2L9J A;  4JE9 A;  1K04 A;  1O3U A;  2DB4 A;  1SF8 A;  3PHF 2;  2J7P D;  2HKV A;  3T6J A;  2C03 A;  2ICW G;  1SYQ A;  2AP3 A;  4BJ1 A;  1MNE A;  1Z3I X;  2WZL A;  1E83 A;  1VOM A;  2KYH A;  5JSL A;  3RF3 A;  4JCZ A;  1OW8 A;  3GM1 A;  4J30 B;  2NUT A;  4BPM A;  1FAP B;  1A7E A;  4JZA A;  3T6B A;  4DXW A;  1D1A A;  2J8W A;  4ER9 A;  5DVW A;  3QTH A;  4PFP A;  2R7T A;  1MMG A;  2IXP A;  3IPM O;  3OEO A;  3ASN C;  4N4W A;  4YL3 A;  4JTA B;  3DMD A;  3LJB A;  3Q6N A;  2IM8 A;  5COM A;  1BR2 A;  1I4Y A;  4CS8 A;  2H8A A;  5JLI A;  3DE8 A;  2YRF A;  3QVZ A;  1ST6 A;  3O6X A;  3TOL A;  2G3V A;  3LS1 A;  1ZW2 A;  1NFO A;  2HS5 A;  2R03 A;  3TD7 A;  3SXY A;  1YJG A;  4NTB A;  3W2V A;  1HW1 A;  1CPR A;  4ULW A;  4ULV A;  1TFO B;  2F22 A;  3GAN A;  3R7C A;  3B9Q A;  1MMD A;  2D4U A;  4XWJ A;  3JSE O;  2XXA B;  2HZ8 A;  5K0I A;  2A69 F;  1D0Y A;  1EA8 A;  3EH1 A;  4JJG A;  1VYI A;  1D0X A;  2YQY A;  4PR9 A;  3C8G B;  4JJF A;  2EIK C;  2NSF A;  4RBN A;  2EPM X;  1J8M F;  1R5I D;  4PJM A;  4AL1 A;  4G7O F;  1GQA A;  4U5C E;  1B68 A;  2PX0 A;  3TJ5 A;  2KK1 A;  1S05 A;  2LD6 A;  3AG2 C;  4YK5 A;  3U8V A;  3OWT A;  2R7X A;  2KQ9 A;  1TFK B;  2MHR A;  4N6C A;  1SMY F;  3ABM C;  3JTL O;  1H7I A;  3X2Q C;  4DVY P;  4PJL A;  1LPE A;  2YL0 A;  2HMQ A;  2WB7 A;  3OA1 A;  3T4R A;  3ABL C;  3NMK A;  4CS7 A;  2L81 A;  1L7C A;  1YA9 A;  1RKE B;  1TWC A;  3FOP A;  3LES A;  2A1D D;  2R9R B;  2Z15 A;  3GOR A;  3HNJ A;  4UDV A;  3EQL F;  3QMK A;  2ZXP A;  2Y3D A;  3DM9 B;  2XM0 A;  3KYI A;  2I15 A;  1KTM A;  1PV3 A;  3L0I A;  3LLI A;  1V54 C;  3FXH A;  2UUH A;  3AOU A;  2ZPA A;  3A11 A;  3I5P A;  4E0H A;  2R7V A;  4PFO A;  4JCH A;  4EUK B;  4PJN A;  5DLJ A;  2EIM C;  2HV6 A;  2M4E A;  4AK9 A;  4P9F A;  3L1M A;  1A7D A;  1Q0K A;  3TOM A;  2CNW D;  1WN0 A;  1YVI A;  4OIR F;  2LSE A;  2OQM A;  4RD9 A;  2XLH A;  4C3E A;  3DAG A;  2Q3T A;  4I44 A;  4YT2 A;  3KYJ A;  3V5Y A;  4JVS A;  3ZQV A;  1ZHT A;  2EIL C;  1TWG A;  2NUT B;  1NU7 D;  3EZI A;  2J0W A;  5KYN A;  4I1O B;  3DAF A;  2CGE A;  4PAC A;  3RQF A;  2PP4 A;  5TJ5 E;  4JEB A;  2KW3 C;  4OIP F;  4XPW A;  3EGX B;  3LNM B;  3SYN A;  5EHH A;  4E0I A;  1F1M A;  3SP1 A;  4C3D A;  3RYL A;  2XXA A;  2HJ3 A;  3GEH A;  1UG7 A;  2HSB A;  2YLD A;  3G4Z A;  3NKD A;  2P61 A;  3RQG A;  3RW0 A;  5L0J A;  4QI2 A;  3DWW A;  3G50 A;  3AG1 C;  3CEX A;  1GS9 A;  3SNH A;  4CX9 A;  3C8G A;  4XEV A;  3RIP A;  2MWQ A;  3GM3 A;  3M1C B;  1G4W R;  5A6K A;  2YWA A;  1ZW3 A;  4DRI B;  4RDA A;  4BJT A;  256B A;  2DI3 A;  3WG7 C;  3NRH A;  4E17 A;  1EI7 A;  2XLD A;  1OXB A;  5DS5 A;  3J06 A;  2XLW A;  1CGM E;  1E2X A;  4NCQ A;  2QNL A;  4JTC B;  4JTD B;  5HV9 A;  3IQC A;  4D4X A;  3T6G B;  5BQI A;  1XZP A;  3HNI A;  3ZQY A;  4OD4 A;  1VK5 A;  3TQO A;  1RKE A;  1T01 A;  2GAQ A;  3KMI A;  2W45 A;  1HY5 A;  1Z5Z A;  4IGG A;  4U9E A;  4YT4 A;  3A9C A;  3VF0 A;  5T3T A;  1V55 C;  2G62 A;  1M2V B;  2XS1 A;  3MX3 A;  2CDQ A;  4JEA A;  3Q6M A;  3ASO C;  4CS9 A;  2XLM A;  4LAC B;  4KBL A;  3B29 A;  3GEE A;  1WAT A;  2LP4 A;  2HUJ A;  4Q5S F;  3POV A;  2LQG A;  4NQF A;  4BJ5 A;  3MLG A;  2YEV A;  3B71 A;  4JRZ A;  2XLV A;  2IYL D;  3SXM A;  1YAU O;  2JPU A;  3EG9 B;  1NBB A;  2AU5 A;  1ZVZ A;  3GWL A;  4LDR A;  2YL3 A;  2HFI A;  1GGQ A;  1K40 A;  2Y3H A;  1OW6 A;  2YHS A;  1BR1 A;  3AG3 C;  4JKV A;  4MVZ A;  4NTF A;  1LE4 A;  1W2W A;  1RMV A;  4OIQ F;  1D1B A;  2R05 A;  1PCX A;  2P6V A;  2XL4 A;  4HFK B;  4MVO A;  1T5O A;  2VCB A;  1LI7 A;  1OW7 A;  1M2O A;  2J0X A;  4FES A;  3GEI A;  2IXM A;  2R7S A;  2H7B A;  3JYH A;  3NYJ A;  3ATP A;  3LEV A;  2VAS A;  3EGX A;  2BL2 A;  3IQ6 A;  4B6I A;  3S28 A;  3EFO B;  5A6A A;  4FWV A;  3ZTM A;  4Z9J A;  2WZF A;  4ONS A;  2XL6 A;  4NC3 A;  4E7S A;  3W2W A;  2H7O A;  3T9O A;  3U2L A;  3V7O A;  4W8K A;  2UUI A;  3TK0 A;  3VM6 A;  2FGY A;  2IXN A;  3KH2 A;  3SXZ A;  2LFF A;  4K0D A;  3LNR A;  1Z6A A;  1FMW A; 
#chains in the Genus database with same CATH homology
 2CYD A;  2DB4 A;  4BEM J;  2BL2 A;  5TJ5 E;  3AOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...