3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
2A0UA 2YRFA 1T9KA 3A9CA 5DBOA 4ZEOA 3ECSA 1T5OA 4LDQA 4LDRA 2YVKA 3VM6A 4ZEMA 1W2WB 1VB5A 3A11A
chains in the Genus database with same CATH superfamily
1NFRA 3FCSB 4NMHA 2X9GA 4ARZA 1Y1KE 2BY4A 4B3SB 1JLRA 1G8PA 1R5JA 2REQA 3RTCA 4XRRA 2G5CA 3KSZO 1E9DA 1RP1A 3CRRA 1I7LA 3WDLA 4K6MA 4LTNA 1Q0DA 2VG8A 4DQXA 5HW0A 2O0JA 3B1YA 1DUVG 1DKLA 1VC2A 1PFKA 4BJ6A 1PCXA 4TV8B 1NM5A 5HE8A 1FSGA 1I6MA 1PTKA 4NAVA 2XE7A 2VNAA 2FSPA 4JSRA 3FSRA 1L7VC 1KI3A 1Q83A 3QVVA 1KI8A 1B26A 3ICVA 2NU7B 2NSGA 3OEED 3CSSA 2I2DA 3HBMA 4UVDA 3BD7A 4M7WA 4ZPXA 3QMPA 2B8JA 3HSKA 5IBPA 2PKWA 2BCEA 4OLAA 4DUYB 2YINC 3A0RB 2VNJA 2P6OA 1E4VA 1WE2A 5BQ3A 3LT2A 3W5UA 3CZ5A 4MULA 3TIXB 1TTTA 3OZTA 2QSUA 5I7SA 3SQWA 3RIXA 3D7SA 4EITA 1QO9A 1QHFA 3KJZA 1UKEA 1BYIA 1SNYA 2I4MA 4FX2A 2WWFA 5C8YA 1KRXA 1E5VA 2A6EF 1IN4A 3EOBI 4AWBA 4KUGA 4U7TB 1TA0A 1U0GA 1JJBA 4BN0A 2VYVA 2VZ0A 1MGOA 4RWZA 3X2FA 4CI0B 4H3SA 1I4DD 1YBMA 4INAA 3F4BA 4QRIA 3VDNB 1IMOA 2DJ5A 1TE2A 1J90A 1GGQA 2L69A 4F6RB 4TUYA 2AOVA 3K70B 1UMDA 3ZJVA 3RGGA 3FHCB 5A3JA 3U8PA 1FFSA 3I32A 2PH1A 3HHEA 3Q2IA 2H1WA 3VRCA 5K0IA 4YJ3A 4L76A 4KFUA 1RSZA 4YRLA 4HFMA 4L5CA 1DEKA 3V4OA 2ESRA 2VZ8A 4H31A 4Y7DA 5EJGA 1W5TA 3MWLA 2ZUUA 1ZSYA 1WOLA 2WYIA 2R1VB 2Y77A 3ER6A 1BR2A 3MGAA 3PC8A 3VZQA 2EC5A 3AI3A 4OXQA 3OPQA 1BKDR 3I6ZA 1RCFA 2E5FA 5HZGA 3QTTA 3OOWA 4LYGA 2ZCJA 4K7BA 1I0ZA 2WP8J 3EDYA 4EGAA 1N6LA 3LCUA 2O2EA 2WZCA 5GZ1A 3CN7A 5DEIA 5E4FA 3DS8A 1N78A 4K6KA 4IEFB 2GOYA 3SXJA 4V0ME 4LA4A 3V4VB 1YZQA 2JCGA 3C8GA 5B1DA 4BLQA 2GNOA 2P3LA 1WXEA 1PV1A 2PZ8A 3SE0A 4A27A 5AXDA 1Q0PA 3GLUA 4AJEA 3BDAA 4RIIA 1YZLA 5A5DA 4WGYA 4GUDA 1HEYA 1FQJA 4FILA 3D4NA 2XX3A 3UF0A 2Q5EA 5JNSA 3UJ3X 1FLDA 3NDPA 3LV8A 3BCSA 3QBEA 1DJQA 1P73A 1D4ZA 5K8JB 1ZM7A 3KSAC 1H8HA 4ARIA 4KZPA 3ANTA 2IH2A 1AEPA 4AT1A 3BJRA 2XQVA 3T12A 3L3BA 1O6BA 1D7AA 1JV2B 3RSFA 4IUYA 1BSVA 1UBJS 2Q1XA 3JZIA 1HI9A 1PSZA 5CH3A 3UZUA 1RIFA 4KXLA 1GRNA 1Y3IA 2KBFA 1FX0A 1O6GA 1SK9A 2JVJA 3RIGA 3WX0A 3O0DA 4MO2A 1SOVA 3U3BA 2NO6A 4MKFA 1ZJ6A 3TTVA 3OX4A 3UMRA 4C5AA 4BZXA 1CHNA 3OZIA 3IQCA 3B70A 3CNNA 4CQLA 1C3OB 3AVTA 3RYHA 1ENZA 3N2EA 3TDNA 3GEPA 3G2OA 3RFFA 1XLTA 2XUZA 3TJZA 3M9LA 4G56A 3TZCA 1U81A 3IILA 1YR6A 2HCJB 1UMKA 4RTLA 1FS6A 5CFMA 3QJ5A 4FDMA 5EYPB 5GJBA 1Q1QA 2OCXA 4R83A 1LM3B 3KMIA 1R6XA 4R2XA 5F5LA 1EYZA 1H85A 1POXA 3GU3A 1WO8A 2J7PD 1A72A 3Q3EA 4GM0A 4YJHA 3R3JA 1R18A 1NI4B 3FPGA 1Z17A 3ZY3A 2JIPA 4F1JA 2XE8A 2ZXOA 4TZKA 3EULA 1L4LA 3KE8A 3K94A 1P0CA 1OQCA 3KBBA 3PJDA 4B6GA 4WIAA 3DHNA 2XMDA 4PHGA 5TR9A 1W4CA 4DB4A 3NBXX 3JT1A 2HRDA 2PANA 3MTJA 4W5RA 1OXSC 5JSFA 2Q6KA 2G4CA 5JC8A 2XADA 4M3NA 3GEEA 7REQB 1EGAA 3RK0A 4HO1X 3AEQB 2F48A 3LBFA 3CRZA 1CEYA 2D6FA 3IGFA 3TLYA 3A1EA 4AFNA 3PHIA 3TTSA 3AR6A 1PT5A 4ZI7A 1YZ3A 1MV5A 2FK8A 2WAOA 3PC7A 4I4IA 4MCJA 5G3ZA 3SICE 4O5OA 1DQSA 3ZJTA 2IW3A 4MV0A 5ABPA 4KWTA 2JIMA 4R71A 1DXHA 1TCCA 4EFLA 3HWRA 1VE5A 2IV2X 3A6JA 1RPTA 3IA7A 1MFPA 3D0KA 4YJ2F 1KAQA 2V54A 4Z0NA 1NVMB 4D9EA 1C7EA 5BRAA 3CWZA 2FRXA 4EQ6B 2DB3A 4QAJA 3HKDA 2P7HA 8ADHA 4IOKA 1SKBA 2DPYA 4YQZA 3QTLA 3P4XA 2I71A 3LYAA 5DU2A 3CW2A 1Z75A 4A6DA 2QR2A 2LBPA 1OR2A 4Q18A 1T6QA 1PHPA 1ZD4A 4MUYA 3AB3A 3GQVA 1KY2A 1P8JA 3BFJA 3K1TA 4ASUA 4RVOA 5L0GA 1NDHA 2O2DA 3B85A 1AKEA 3ENZA 2QL7A 3JTEA 3LQ4A 1VJ1A 3NVDA 4HXGA 4URZR 4IQGA 3AY7A 1G2PA 3B36A 1AB6A 2VRNA 2BGKA 4PYMA 4TMYA 4Q4AB 4M49A 1A88A 2JRLA 1LPNA 5A1TA 3CUSA 4R1OA 2COUA 5KTYA 5G02A 2VRWA 2C2MA 4FEGA 4NHOA 3UTCA 5I47A 1IHDA 1WZIA 2Y71A 4OLHA 3EGWA 2HIGA 3T99A 4TKMA 4HL6A 1IW7F 3GMTA 4BKPA 2FFHA 3AJEA 3RT1A 2BM9A 2QUPA 1XDDA 3OTHA 4LDNA 4ENVA 3M0EA 4CEHA 4NBNA 5KYTA 2X86A 4HTFA 4YIKA 3IE0A 5IM5A 1RZUA 2OVFA 2R5FA 4Z9YA 1V6SA 1FFHA 4YS6A 4DMUB 3C3BA 1FUEA 5JO0A 3FUVA 1SVWA 4ENUA 4HPXB 5AKKA 3HKBB 4F5DA 2Q49A 1AHHA 4M8KA 1XXLA 1JBQA 1DINA 4FZJA 4TV9F 1F5NA 3TB6A 1K7SN 3CNOA 4RLQA 3CVWA 3KFVA 4I1IA 4KQFA 2YZGA 3C24A 1CQIB 3RK4A 3FTCA 4PPNA 1FR0A 4C0LA 1RHUA 1V1JA 2NP7A 2XUKA 2J3LA 4BGIA 2BEVA 2Y99A 5T8KC 1UMBB 1XTRA 3PHLA 4RVGA 1Z83A 3FKSD 4IIUA 1Z0AA 2X0EA 5K8UA 1B0UA 2DFNA 5C1BA 1HYQA 4AP5A 3F7OA 3WGUA 3OO1A 4MKHA 5EQJB 4JI6B 2IRWA 4M9QA 3USES 1RWWA 2JK0A 1E3WB 1W0JA 2OCPA 2H0RA 1R8XA 1GGJA 1IN7A 1FUYB 3KL4A 2R6ZA 2FDRA 3ORHA 2ZB2A 2K5UA 5JBQA 1YONA 4CM5A 2LIPA 4PAGA 3PRKE 3GOQA 1ZM4A 1WPRA 4FD2A 2NUPB 1YR2A 4IWBA 1TYDE 1LFDB 5JFGA 1P9RA 1RXUA 4HVTA 4RF3A 3QHAA 1U0RA 4Q6WA 1YBHA 1DIOB 3IIIA 1QFJA 2XJ4A 1JQKA 4KUEA 3U26A 1BOFA 1KDOA 3ZCXA 4IS2A 2CE2X 1E94E 1HNNA 5DSXA 1CY0A 4NI5A 3X1WA 2L82A 3MLBA 4OOEA 1E2XA 3EZ6A 3N8HA 2YMPA 5JALA 4V38A 1P0QA 1ZVMA 1AZWA 5GONB 4BE7B 1SUCA 4HDSB 2BGIA 2HXYA 2VAPA 1D2EA 3H8VA 1HDGO 1NLFA 4PSCA 5EKXA 3KZOA 2O7SA 2QLTA 5EKTA 3QWAA 1GKYA 4PEVA 5CT9A 5FIUA 3E15A 1GPLA 4XW2A 3U4QB 3WRYC 1QMGA 1M6VB 4RTOA 2FUKA 2K6GA 1EJ6A 3GEGA 4UTZA 4KK3A 4ZYWA 4M0EA 4MEBA 3I4UA 4AN4A 3EUAA 3PHBE 3VNUA 4IWNA 3WOVA 3KOMA 3W2HA 3UJ8A 4JI5B 1MKYA 1ZINA 5CB4B 4O4HB 1DTWA 3IXQA 1OE0A 1BU5A 2F62A 3RC1A 4S1PA 4LJ6A 2H17A 3N8IA 3C6YA 2TS1A 3BFPA 3ILHA 3N58A 4JYMA 2OCDA 2OEVA 3ERCA 4L15A 4YHBA 1F8XA 3VPAA 2ABWA 4Y6RA 2VZEA 3E48A 5AI4A 4EMSA 2X76A 4LSWA 1KZ4A 3DR5A 2DTXA 1X7HA 2A94A 2MSWA 2O2CA 1ZHWA 1UT6A 5A4DA 4R1QA 1HDRA 1TD9A 1VCHA 2JLCA 1NGSA 3MERA 1QC5B 4WABA 3V7OA 5HQ3B 2Q6LA 3K7EA 2QI9F 4PW0A 1GKUB 1B41A 2PTHA 1YB6A 4FHFA 1FJHA 3ABZA 1QV6A 1AQYA 1MJ5A 4OK6A 2CDAA 3NHZA 5AQ1A 1E5QA 4NCKA 5EXDA 2YQZA 1T6UA 2J87A 4L8FA 1Y4CA 3O93A 4DLUA 1Z23A 3P26A 1WD7A 3KHTA 5TC4A 1ZH0A 1JEAA 4E0IA 2VZ9A 5C9ZA 1P5RA 2JHGA 4Q9HA 2ETSA 1MN6A 2FZ5A 1NYRA 4OEHA 5LKAA 2J9FB 2XQIA 2OVBA 1ST2A 1KKMA 4QFMA 4O63O 2R02A 4F2WA 2Q5FA 3G0GA 5AW7A 5EJ4A 4ZQIA 3FWZA 3TRFA 4ZT5A 5F51A 4ZEWA 4DQ0A 5B2FA 1MH9A 3UG6A 4N76A 1WR8A 4GX1A 1FFBA 2R7MA 4UFPA 4QOHA 3TLZA 1ULHA 5JNRA 2ADOA 2OY0A 1QH8A 2AR0A 4TKVA 4LMBA 4EKIA 2Y1GA 2VNIA 3H7IA 3J81k 1GXSA 3WRVA 1KE2A 4WESB 4RCVA 2PX5A 1ZM2A 1WHTB 2J0XA 3GHYA 3CEMA 2ZROA 1JSCA 3MK31 1CU1A 2OUKA 1U8CB 1Z6XA 3HR4A 4G09A 4EY8A 3B9QA 4DDWA 4HPWA 1SXPA 3ONDA 5JVEA 3B8EA 3EXHB 3FH0A 3U7QB 1RAAA 2SCUB 2BKUA 2YMQA 1OC4A 2R7LA 1ZICA 4RESA 2EFEB 2R11A 2N0SA 3LAWA 4NNOA 5KNCH 4KQ2A 3DLAA 3ETJA 5DP1A 3GJ0A 1WX1A 1DRKA 2J0VA 4N8DA 1MC1A 3U3RA 4KCGA 4F72A 2B2XA 4BMCA 4Z1OA 5JW6A 2Z08A 3K0HA 2IS2A 4CKYA 4IDHA 4R2MA 3SXZA 5KOJA 1ZOOA 5E0OA 3CRNA 3TLAA 3JZAA 3UGKA 4LJRA 4HEA6 1UIRA 2PX4A 4E12A 1YZCA 1LE4A 5JRZA 4MWZA 2GFIA 4B2IA 4PZAA 4XB1A 4XEHA 3JYLA 3HNKA 5DHRA 3ZPXA 1X7YB 4NC9A 1AVTA 5KYXA 1DC6A 2QRKA 3DLTA 3DW1X 1MEOA 3UK0A 4YV1A 2YDYA 4D79A 4CL2A 3L6BA 5LL6P 4U2KA 4RHTA 3KV1A 3B12A 3WLSA 2XUIA 4O2BA 4I2VA 1KIAA 5JAIA 4DG8A 4YJFA 1SD2A 5KVAA 4XTRA 3ZOZA 3DYIA 5BWOA 5FX2A 4TTRA 1Y5NA 1UC9A 2BFFB 2KM1A 3WQHA 4BG0A 3HPRA 4CL3A 1TQDA 1JQ3A 1QM5A 4JI4B 1CTQA 5HWSA 3OY2A 3HZHA 2BMAA 3F49S 3AVWA 1D0YA 1XQ9A 1CPRA 4MS4A 3KPJA 5HKKD 3FJOA 1TYEB 2HY7A 1WULS 4OHVA 2PQMA 4AG3A 4B3IA 4Y6OA 2EERA 1U02A 2DH6A 3D6MA 3WNCA 3R23A 4LYFA 1SCNE 3OFJA 1C30A 1FSZA 4ZIRB 1PT8A 1KAEA 4IRXA 3ANMA 2KB0A 2YZMA 4GIBA 1ZG3A 1RLTA 3NU1A 3CXUA 1CUAA 5IZCA 4DRIB 3BSWA 4AICA 4R2KA 4ZI3A 4DN6A 2GHIA 3HUTA 3FFBA 2VPTA 4YREA 4YB8A 1BE1A 1PWZA 2R7RA 1SKQA 1UJCA 2D1YA 1WATA 4NOJA 3HFJA 3VFDA 1ORSC 1TD1A 1Z9BA 1B6SA 1H1LA 1NF2A 2VTDA 3UT5B 1C14A 4OB8A 1VG1A 3HM9A 3OWXA 2HO4A 5DN6A 1A9PA 2Q8QA 1CRWG 2BJHA 4BAUA 3RJTA 4Q03A 5E0KB 1SCQA 3SXUA 4H3KB 1X86B 3HV0A 4BYMA 1KFCB 1DZ3A 2FMIA 3FTNA 3H1GA 3VR5A 1HUQA 3X1KA 5BQOA 2R4QA 4TXNA 1WKCA 4ZHQB 3CPSA 4IF6A 4AROA 1M8JA 2VDJA 4CS9A 4K9RA 4FGJA 2DHCA 4WNCA 1UKYA 4UASA 3GD5A 2H2DA 5KQLA 4PNHA 3H19A 3O03A 2X9LA 4PIVA 1DO2A 3WG9A 2QE6A 4LY9A 1G60A 2LCHA 2IP2A 4CDNA 2O07A 1GUAA 3RHFA 2X2PA 2AHOA 4XVUA 1QWSA 4GNKA 1WMAA 3PVSA 1D5CA 4KRYA 2NVUB 3K31A 4DRJB 1G5RA 1ZIPA 3H0KA 1NPDA 4ZVKA 1CBUA 1P9LA 5LD2C 2C9YA 2GCEA 2X1LA 2NUTB 3N0TA 1GGEA 2VAWA 5IY5C 3KYBA 1YZYA 3EZ2A 4DFDA 1U2SA 3IAEA 4CUZA 3P2EA 2QLFA 2Q00A 3U1BA 3QMMA 1DO0A 1J39A 2P4UA 4DR2B 3T95A 3COZA 4XPIB 4EG7A 4C0SA 1HSZA 1VG8A 1GDHA 5FR1A 2AW3A 4UM7A 3VR4A 5F5FA 2VSFA 3LCCA 2GZHA 4CM1A 5KSWB 2GN9A 3AIIA 2JDID 3DF9A 1RJ9A 5DCWA 2O8DB 1SVIA 3V5ZA 4L5YA 2VQDA 2JFYA 2XWBF 4P83A 4QHTA 1BWRA 1W34A 3Q8MA 4QEDA 5DK4A 3WQQA 3M3DA 2WHQA 2JFZA 5FORA 2QRPA 3SLGA 2A0FA 2HNAA 1TZCA 3SZLA 4YCJA 3GRAA 4D9HA 2I2BA 3FYUA 2G80A 1NUPA 5EHHA 3GIWA 3U5SA 3TCKA 1WABA 3GBSA 4HMPA 5FPHA 3FMPB 2Y3BA 2H4ZA 4BMDA 1M8FA 2BGGA 2PL3A 3CIOA 2G8LA 1XMXA 3RVQA 3SYNA 1GAWA 3DE0X 4OYLA 1RI4A 3UWMA 3P5SA 4BLSA 1FIUA 4CV1A 4DBLC 3GM2A 5ALHA 3OWHA 5F23A 3QEMA 3UJHA 1YJQA 1NLZA 1T8WA 2ZB4A 2ZBEA 2IEZA 3PXUA 2OA0A 3HNRA 3DC7A 3FDZA 4B3CA 4NZMA 4JP5A 4E1AA 3JVDA 4N6CA 2FR8C 1UDXA 2LPMA 1Z8NA 2PXHA 2AT1A 1L5OA 2XLWA 2YN2A 3LCRA 1P9WA 1DDGA 4HFJA 4QXPA 1I5RA 2ZKIA 1GUFA 3B1JA 4B45A 4BEWA 4TLEA 1DBRA 2AZTA 1QWOA 1PZEA 1U0EA 1UDBA 5JDIA 2V1XA 2LDXA 2Q6OA 3AL2A 1OQAA 3GUYA 3ZV4A 2DLCX 5TS2A 1JH8A 1U80A 3EVBA 4DILA 5B4TA 2Z5GA 1UPCA 4Q4ZF 5DTEA 2CL5A 3Q9SA 1LEHA 3JX9A 2YXLA 2O8VA 4E08A 4URFA 1DOVA 3GCZA 5DBHX 8ABPA 3C6QA 1DBVO 1A4XA 3A9TA 3EDRA 3REOA 2FW7A 4TUYF 2EKZA 4MW2A 3WWZA 4EG0A 4Z4EA 2VPWA 3KM0A 4MLDA 4ONSA 1E5LA 3BTSA 4YJ3F 2GPJA 4PLPA 1X7DA 5BP7A 2JFGA 3HJUA 1L2TA 3D6JA 1IU9A 4TRJA 4EEXA 1T5DX 1XKQA 1SU7A 2BFDA 4NU0A 4XLLA 1VE1A 1K08A 1I10A 1QAMA 2ZB7A 2AKEA 1U3FA 4WBNB 2HJVA 2OR3A 1FDRA 4GYKA 3C6BA 2AOUA 3S1AA 2VL7A 1TIKA 3L6OO 4K1OA 1HA3A 2YX1A 3F0TA 5LU8A 4M9XA 4XGRA 1ZX1A 2WWHA 5TEWA 3GJSA 2DSNA 4UMDA 1KBOA 3KLPX 4V1CB 4FCWA 1EWTA 2P6PA 1ARZA 2J7KA 1N3YA 1PZNA 4QQNA 3VNQA 1H0KA 2WZGA 4ESHA 4AWAA 3R2JA 4JYPA 3KTAA 5B64A 1W36D 2HCBA 2BBWA 2EPMX 3IRUA 4K0RA 5IDQA 3ES9A 4GR4A 2XE4A 5FOXA 3OHPA 4LW8A 2BDEA 4MVQA 4OLBA 3TEMA 1E66A 2H7YA 1W36C 1T0PA 3IAXA 4KN9S 2BM0A 3M4YA 3N59A 2G7ZA 4GI1A 4MMXB 3IBTA 2A6HF 1Y3HA 3MWKA 4JITA 5FLKA 4DLRA 3RQFA 4QD3A 1MTZA 2OXTA 4URUR 3VC1A 1MO4A 3GLFB 1BS1A 3N2KA 1KI2A 3OTOB 1P0FA 1Z34A 3T7KA 5T3YA 1TWHA 4XI9A 3FDQA 1WCWA 1XDBA 1LK7A 3GRYA 2NZYA 1Q5PA 3T0IA 4I8XA 3F8WA 1X7ZA 3GGCA 3D2CA 4B3HA 1LCIA 3IDOA 3BAFA 5EIBD 3ZWMA 1U5BB 1T10A 3Q87B 1EUCA 2JA2A 2DKFA 3CJQA 4TQ9A 5GZ6A 4Y9UA 4DR1B 2JZNA 3GFGA 3HXTA 2YWFA 1RHMA 3N1UA 4JOBA 3OQMA 4OMFG 4AIIA 1FDIA 1HV8A 3RABA 1ELOA 2DQKA 2X5OA 3LRTA 2SKEA 1ZHHA 2F3PA 1EUDA 5IT4A 3ASVA 2M6SA 3F2VA 5ICGA 1GCAA 4O25A 4TL7A 2GF9A 4HLUC 2O54A 1UL1X 2DR3A 3BHMA 1VIDA 1Q2UA 4NAHA 2BFBA 3AVXA 2GR9A 1H7IA 3ONEA 2GHTA 4I9UA 4J4TA 3NKDA 4DMKA 1EA7A 2DFTA 2EDAA 1VLMA 2MWQA 4KE6A 2ZITA 1ZSNA 3DMPA 1XTQA 4PO3X 3C5CA 1TJNA 3WMEA 1TUIA 3M3HA 2ZUWA 1XCBA 1RWKA 5TJHA 4C3EA 2J4FA 4GSLA 1ZJJA 1XZHA 3HDHA 1EK1A 4I55A 5DI3A 5KQRA 3I09A 1TA4A 5I9BA 3W5VA 2QENA 4EENA 3U09A 3DKVA 4JMPA 1EBBA 1XP8A 4RULA 4GDMA 3OEWA 1MA3A 3S4YA 4QDZA 4HZGA 4E6PA 3TX6A 1ZP6A 4LFBB 1RVDA 2PGDA 4PRZA 3CUKA 4OM7A 3TGLA 4XUCA 4KVFA 3ZDYB 1LIHA 2I66A 3CAXA 1BX1A 1N57A 3ELWA 3WLMA 5E3JA 1JZQA 3RVRA 4HUTA 4NV1A 3O10A 1X1TA 4ZI7F 2ID4A 4UUBA 3N86A 2Y0CA 5TJ5E 3OMWA 2EIXA 3U31A 1RBMA 3FPLA 3H11A 1TM3E 3DMDA 5SICE 4CXMA 3DL0A 2AN4A 4EGJA 4C01A 4TWIA 4DJ9A 1RMYA 1AO3A 1ZBQA 4IMJB 1OZAA 2A68F 3IEVA 3FTPA 5KC8A 1LI4A 1MX1A 3QEAZ 3K9QO 2FMTA 3FPFA 1M0EA 3TULA 3K0AB 1BEZA 4FI3F 4MW5A 1G21B 3ISVA 2QD4A 2VATA 3FOEC 1NJ1A 2R7SA 3FLEA 2CLKB 4M53A 1H2BA 2D2VA 3MSCA 3UUFA 4JKIA 4HUQA 2P1AA 1QCCA 5DYYA 2EGHA 4HQLA 1KYIA 1EFVB 3ETLA 4R98A 2DUUA 3NEYA 4Q4JA 5EGNA 4CV0A 2D59A 1H0RA 2MYTA 4X63A 2X0KA 1D8AA 5CI9A 1G20A 3GRUA 2CWDA 3ZVNA 5B7PA 1PZHA 2O14A 1HSOA 1R4AA 4C2AA 4PLYA 3VR6A 1N7IA 1Y6RA 1PP4A 1GARA 2JB9A 3DLCA 3OIWA 5ESXA 2Q4DA 2AYYA 2IZ1A 4Q1BA 3H5AA 1H9BA 4NY1A 3COYA 4ZYZA 3EARA 5EQDA 3BDIA 3R6TA 4PLZA 4AUNA 2XMQA 4F2GA 4EAAA 2YJZA 4BNJA 3FE2A 1AS0A 4X8LA 1OX4A 3AEXA 3R44A 5FWNA 1XDZA 3CVXA 1Z38A 2HJHA 2G62A 4UM9D 2AOWA 1L5RA 1QE0A 4V0RA 4L4ZA 4MAFA 5B57C 1JFFB 2LP4A 1IYZA 4F1WA 1BCRA 5TARA 1PWYE 1ABEA 5AJYA 5JZVA 5GOTA 2ZXEA 5GOZA 9ATCA 2H2WA 1TAQA 4TMXA 1NW9B 1UODA 3QFSA 4DMLA 5EJ5A 2GH1A 2GRUA 2Z6VA 3DI5A 1ZMOA 4DCCA 3P4YA 3ACDA 1TT5B 1PL6A 2GA9A 2ARKA 1TL7C 3P2MA 3GCGA 3IL2A 4NCBA 1XVIA 5I7RA 2H7BA 1XUOA 2HCRA 3SCZA 2CNLA 5G0UA 4UAUA 2XUGA 4L28A 3H05A 4C30A 4PQFA 4MVJG 2VJMB 2CK3A 3TQIA 4YXFA 3AESA 3RVKA 1E61A 3OCWA 2C84A 1LKZA 2HLDA 1WB4A 3TQSA 2WSYB 3W8HA 3RVYA 1LLDA 1V55C 2PN1A 1W1WA 1LD3A 3DGEC 3HY4A 1KU6A 2W2MA 3WB0A 4WKGA 2YOHA 3ZCSA 2Q5HA 4BAGA 2NTVA 2OAQ1 3RSQA 1L8AA 2L6HA 5CG2A 1UMCA 3HSSA 4YR9A 2JI7A 3OEHA 3AHGA 2NVOA 3PUKA 3U6BA 3M4ZA 1TC2A 3T6JA 1DE0A 4KMMA 4BGEA 4P36A 3C7DB 1P17A 4FSHA 1GILA 4I50F 4XFDA 4YQYA 2Q4EA 4WERA 1XZFA 5IAOA 3WNDA 5IULC 1SVKA 1ORYA 1R4NA 2F1HA 1WDTA 4CT5A 1KPHA 1AKMA 5C37A 4UHCA 2SNIE 1HT2E 4V3BA 2VAXA 1VYUA 3L43A 2EG5A 2QZSA 4PZUA 3C41J 2RB5A 3R7LA 4HN9A 1U63A 3HP4A 1WHSB 3FPJA 3MBIA 3NHAA 3FVYA 2ZYVX 1Q0HA 2DE0X 3IVMA 2AC2A 3SHTA 2VPZA 1ZU5A 3KALA 4RZQA 1F06A 3R7WB 1RQ2A 2B69A 2VIIA 4RY2A 1F8UA 3PWKA 3JWGA 4JI7B 3F6RA 3O8OA 1A7JA 4WUTA 1ZXLA 3MELA 5TGTA 2V6GA 3UGTA 1NM5C 2CVZA 1PJCA 1WCXA 2HSEA 1T2FA 2IIVA 3S27A 4YMLA 5KJ1A 2HYDA 4LK2A 4M7PA 3ROGA 4CKBA 4L1KA 1U04A 2WJGA 4DLLA 4QNMA 3NR2A 3UTDA 1CT9A 2C20A 5FTMA 1PEYA 1WMDA 3D0RA 3M3PA 4RPHA 5G0WA 1E2KA 3NUQA 4MV6A 1LPAB 1FTSA 2YHIB 3WIBA 1CY4A 1FBNA 4MUNA 4MI3A 3DSRA 3FVWA 4QAQA 4YP9A 3DCIA 4J7TA 2W5UA 1ZU4A 2ZS9A 5LP1A 2ZEJA 1RXIA 4X93A 2O5VA 1DRWA 2WM9B 4J7YA 3LXRA 4M21A 3CG4A 5KOYA 4MP6A 5K3AA 2OJED 1H3FA 4OHRA 3DZFA 4FFVA 2OM2A 2O0HA 4UXJA 5JU6A 4MVYA 4ES6A 5JYCA 4O4JF 3TXAA 4P0PB 1FB5A 3G0HA 4Y2VA 3GGDA 2FZKA 3KWLA 4YAIA 1Q7RA 3TAXA 2D5CA 4ESOA 4DWJA 4CSAA 1WZUA 4JOSA 1G20E 2WJAA 1W5EA 4D3YA 4YRMA 1M73E 1XD2A 3D8NA 1ODJA 1QANA 5FUXA 3R0JA 3HTXA 3NLLA 2BI7A 3KXLA 3CXRA 2H4YA 1QFYA 5LNK6 4TSFA 4IHQA 2I7DA 2IV7A 2IPOA 6ADHA 3CHYA 2QX9A 4QNRA 3MLGA 2I91A 3H9CA 5SZIA 1ZW1A 1MQ8B 1BS2A 3SG0A 1VRCA 3GJ4A 3PC8C 4CM3A 3NYIA 3E0QA 3VJLA 3WLJA 2C7OA 5FB3A 2G83A 1DADA 3OJWA 4JZKA 1WZ2A 2VP5A 4N0PA 2Y4OA 2V8BA 4IKOA 1BOOA 2NYVA 3U3XA 2VUTA 1JLHA 5EAIA 5JT4A 1I6WA 1QIFA 4P9FA 3URMA 4J30B 1K92A 1GPMA 1S1MA 1V2GA 3OY7A 1D2GA 2IA5A 2DGJA 3K0KA 5IN5A 3F9RA 2JC3A 5H5JA 1WNFA 1P5HA 3MMSA 4KXUA 2FSUA 4UE2A 4AKGA 1NBEA 1OPXA 3KETA 5FUBA 4UMEA 4YK5A 5AXCA 1EFRD 3TUIC 4ZO8A 3IYLW 4IUDS 2G40A 3SS8A 1PAUA 1X1EA 1VA5A 4MHTA 1T0IA 2D2FA 2WDPA 1A7KA 2ENWA 5E6RB 3RVBA 3JARA 3RSHA 4RGYA 3ZLVA 5J2TB 3I01M 4BL5A 1ZH6A 1Q95A 3KL2A 5T3WA 1RWQA 2BV3A 3SS9X 4WCFC 3VDRA 1H1DA 3KR9A 3OBIA 2W6MA 4FYPA 3REFA 4MKIA 2Y3GA 3ZHZA 3REQB 2VF4X 3V1KA 3DB2A 3GJYA 4JYCA 5FADA 3UJDA 4CDYA 2FEAA 3ZG1A 2C2WA 2XTZA 5ALKA 4KWEA 1TUBB 3F90A 2P4EA 3NIDB 3AHDA 3I2KA 5H0IA 3K1YA 2VT3A 3FVVA 2PJRA 4Y1RB 4A8PA 4RCZA 2DGDA 3B3JA 3ZH9B 2BL4A 3R8XA 4CMCA 4JBGA 4JQZA 4PC7A 2JIOA 4KXVA 1YCGA 3HVJA 2WAXA 2XJ9A 3ITEA 4R3WA 3I9FA 3AOEC 1BHQ1 5E1BA 1HG0A 3L5KA 1Y9DA 3B3GA 3OE4A 3KRTA 3DMYA 1TQ2A 3TPZA 3I61A 4C04A 2QN7A 4RXTA 3WSWA 3BH7A 2F17A 4D8WA 2VK1A 2V59A 1TQ8A 3EY9A 5KNCD 3RBVA 4XWWA 1QZZA 1N4DA 1YL7A 1XMOB 4OBXA 4G24A 2UZIR 2HT6A 1A7DA 3RKSA 2CNWA 3FZQA 3B1KA 2QN6A 1X6VA 3HEBA 1T6ZA 4O2BF 2IYXA 3OA1A 2REXB 6REQA 3RWMB 3A7EA 2H4XA 2HQBA 4KN8A 2I6TA 1Z4QA 1A4IA 2RGUA 1NRJB 3EQZA 4QNNA 3VSBA 3S2EA 1XNQB 3HJCA 4LZOA 1VSQA 2DYSC 2MU1A 4DQDA 2GAJA 1P61B 5IASA 1XAJA 4YWQA 1MJGA 5LMCA 3ZTMA 5CGQB 5E9AA 4BQQA 2E9SA 1YS4A 5GP1A 5CIQA 3PQDA 3WZ2A 5IARA 5FTKA 3R3WA 5FP0A 1OIVA 3A4YA 2FF5A 2XXJA 1T9BA 4BNDA 2I2WA 4LHVA 4DYDA 4CM9A 4RTQA 3C2QA 3HR8A 5LWQA 1ESDA 3DD5A 3A2MA 2FVYA 4MV1A 4A6XA 1CIVA 3B7WA 4I1VA 4YJWA 3RFYA 4UBOA 4NNJA 2P9HA 1EE2A 3EXG1 3AFHA 3GT7A 2PRIA 2FFQA 2ZVDA 3BUSA 4DRZA 1ZZPA 5EMKA 1E2JA 4FDUA 3TF5A 3MGGA 4RTPA 3G8BA 3R5HA 2G9VA 3DT6A 2XL8A 3H5WA 2RGEA 3GLHA 3FIUA 3NWEA 1MC8A 3P97A 4C4TA 3DJYA 4I6EA 1I7DA 3ZHRA 1AQNA 3H3JA 4XKJA 3MFQA 2A9RA 3OX1A 4EKWA 1CEQA 1YJGA 3FNHA 5ELMA 4UU8A 2VYNA 4JIOA 4OHCA 2PLWA 2NO4A 2B8EA 4UHJA 1P77A 4AZ0B 3GV0A 3T0FA 3NKVA 3RD5A 4Q7JB 3MWDA 1D3AA 3WNVA 4L08A 5FPKA 1YQDA 4K7JA 2D00A 1D1BA 1OAOA 3PDIB 1OPRA 2VYQA 4LHWA 3O21A 4Q9IA 1AVOB 4LBZA 4PY2A 1W2WA 2H7OA 4G4IA 2QTAA 3DPIA 4UCQA 3QVUA 3S3TA 3H2JA 3DMFA 1G5HA 3D8SA 1NVDA 4IDGA 2LSEA 3SS7X 1KFBB 2CB9A 3GGSA 3BICA 4LNUA 4JA0A 4Y2JA 4Z2YA 2JCSA 3ZE7A 4CCAA 4CYMA 3B7GA 1WAMA 4OHZA 3HTKC 2F3UA 1KSHA 4TMVA 4CS7A 2HK7A 1KNQA 2AZDA 5DBOA 1EVJA 3S8YA 2ACVA 4NRDA 3K33A 1IPFA 1EGQA 2GKSA 1SOUA 1GLNA 2BEUB 4RPGA 1BQEA 1SU6A 3TDMA 5FUQA 4CF6A 3MN1A 4CLRA 1GVNB 1TC1A 1QQ5A 4QYXA 1EJBA 4FR5A 2J0SA 4PGAA 2J6BA 3BF7A 3GOHA 1Z68A 5CA0A 1EUZA 2DJIA 4G1EB 3CX3A 3GMIA 2RBEA 3WLPA 1KIMA 1LDMA 4MRRA 3D7RA 3ROEA 4Z54A 1R0ZA 4IUBS 3LRPA 1O0CA 4HYTA 4BUCA 3R7DA 3CIFA 4A91A 5KKNB 1LFAA 1H69A 2CHUA 4N7MA 3WLKX 3PUYA 4N3GA 2BR4A 4HGYA 3PQ8A 1HDIA 5COFA 3LVFO 1Z5GA 1XCGB 4Y2QA 4EFDA 1CPQA 3E8XA 4N3AA 1GZHB 1YMUA 5H70A 4B6IA 2OYCA 2W4MA 3MGKA 3SX0A 4UE6A 3N7TA 3GEMA 2DUJA 2V7GA 3L7OA 2G72A 2CUTA 2VK8A 1VL1A 2IGBA 2NNLD 3OHMA 2DKOA 5DWQA 2MHCA 1NMSA 3JYNA 5J4LA 3WHIA 4AVYA 4KW7A 4ARSA 4V24A 3IHWA 1Z6AA 1LLFA 4YV7A 1QH1A 2IXAA 1HZZA 4B2PA 1QBKC 1PNVA 1FUIA 3BGIA 1PLJA 1M5TA 4HBGA 3L8EA 1L7QA 3G4XA 2C04A 2Q6VA 3I2GA 1R4MA 4J7UA 3RS4A 3FNEA 4K6FA 3FZYA 1G8MA 1M0WA 4WN9B 2NX2A 1VQ1A 4OI4A 2SKDA 3STXA 3EVNA 3NTVA 1PG2A 3T7IA 1I4EB 2CFRA 5CVDA 1L3PA 4ZCLA 3KR0A 3MTAA 3GWZA 2NNWB 3DD7A 3N2ZB 1Z7BA 3AGTA 4DYHA 2R8BA 3NI2A 2JAPA 3BWMA 1P1JA 3LS2A 4IIJA 4PIPA 1MDBA 3ONFA 5KOHB 3Q9NA 2IKQA 1JIIA 4JLUA 3MJCA 2IYSA 3K1HA 2ASVA 1YO6A 1JL3A 4CCSA 1YDGA 1RADA 2VDQB 5F73A 4LGMA 2VTBA 4QUJA 3BE6A 3PCVA 4I5IA 4HOYA 4I50A 4J0QA 2PFSA 2O2ZA 3BIFA 3KT0A 4KR0A 2ICWG 1Y9EA 4NJMB 3M5CA 1CUEA 1M75A 2XZOA 1NSFA 1PV2A 5HE9A 3P9ZA 4GPD1 1ADJA 4OOFA 2A4MA 4NZ9A 4LOKA 4CMAA 3QEOA 2JIQA 5B53A 4IPTA 4R8RA 5CTAA 3FHTA 3VKVA 5AIBA 2PIAA 4ZOLA 3GLHE 5I7FA 3T1QA 1DAMA 1AGNA 3BCUA 2HMQA 3NX4A 5EKUA 4C78A 4MQMA 1E7WA 2CXPA 1Y3FE 4Y9DA 1KXJA 3EZ9A 1Z35A 3DAGA 1SM4A 4B4VA 5JWOA 3ABIA 4A8HA 5T1DB 4F9FA 1AMUA 4NXMB 3NEJA 1T6BY 4MRMB 1NMYA 1TCUA 4BO2A 3BL5A 2G3VA 5E7JA 3C70A 4FFDA 5K0TA 1Q16A 4ZN6A 2BEWA 2VSYA 1U7OA 3IJPA 5BR1A 3F6SA 1NC3A 3S28A 1F7VA 3WK4A 4JB2A 2A57A 4WT7A 5FF9A 4TRMA 3SEAA 10MHA 3R40A 3KYCA 4UM9B 1CUIA 2DFPA 2AFHA 5I5GA 2CFIA 2NZ2A 4V3CA 2XT9A 1I01A 1NXVA 4UPEA 1B2LA 4BXOB 1Z29A 1Q17A 5LJIA 4E2ZA 1UWCA 3D3NA 1NXXA 5KIAA 1NUAA 2F6RA 3DDOA 4X1KB 1H2HA 5SY9A 4ZCQA 3FI0A 3PGJA 3I34X 1QG4A 4MYDA 3A1SA 4Q9DA 4S2UA 3AFGA 4ETIA 1YKFA 1Z5WA 4O4JA 4JJ6A 2FZEA 2J9BA 1QIMA 1Y33E 3P32A 2ZRKA 4OU5A 3QKWA 3RF3A 4CR7A 4TMZA 2ZRFA 2HWKA 1WCV1 4Q9KA 2B30A 3UT0A 4KPFC 1NUSA 1Z62A 4JVLA 5A3SA 3M4BA 4DEVA 1Q77A 5DS6A 2I3DA 4L2IA 1EVEA 1MJNA 1BFUA 4BRWA 2FW1A 3PG5A 2JAHA 1A8SA 1C17M 5EVJA 5FCLA 5K8VA 4CN8A 4EB6A 4P1ZA 3M8KA 3OUZA 2N1BA 1B7GO 3O6XA 4WGGA 1XU9A 2QQGA 4EB0A 1KI4A 5JS6A 1RLOA 4WNYA 2PXCA 1ODIA 1NF3A 2QTVA 2C7RA 2HHJA 4EFKA 1P29A 1AGYA 1C81A 2O2IA 1B6TA 4GXQA 1VIMA 1S3GA 4G2NA 1UBNA 4LGYA 3VKWA 4EARA 3L49A 1OV4A 4JP1A 4CEIB 4JIGA 2Z04A 3O4VA 5ECYA 3L04A 3AR4A 3Q5EA 3TJRA 2CFOA 1YQTA 1H5UA 1T9CA 4I55F 2ONYA 5ENVA 4CCYA 4UFOA 1G16A 3SYMA 1FU8A 1JJIA 3QF4A 2Q21A 1FTNA 5LVAA 4FFLA 2WHYA 3EASA 1ZY2A 2BM1A 2D3WA 3IBFA 3LA6A 3QU5A 3FOAA 4LLEA 1M6HA 1UCFA 4FDAA 3CFYA 4FWBA 4XVCA 4YWJA 4OLJA 4G0HA 1SU4A 2E18A 3CVOA 3OTGA 3R75A 5U9CA 2BE7A 4ETWA 1ZW3A 2OQIA 2QTTA 2RHGB 3UA3A 1U4SA 2OO3A 3INNA 1ZM3A 3E5MA 5FHQA 4C3BA 1YJAA 3PUWA 2QRVB 2YXDA 3VZCA 2D62A 2WU3A 1BXZA 5JUWA 1PR5A 3BE5A 4KJZA 3SLKA 4ZEMA 3SOZA 3QYAA 4LKOA 5AOBA 1KNYA 3LUBA 1F20A 1QHYA 5K51A 1IOWA 2WNSA 3O0TA 4NG4A 4GOJA 2J6HA 3HXLA 4Y18A 2JNWA 2JFVA 2FUG1 3FCEA 3HKCB 4MR8B 3FHDA 5HG0A 4DAEA 2X40A 3M15A 1TCAA 4OQZA 1F12A 2XVMA 1TWGA 3BXHA 1WQ1R 3U7EB 2ZI6A 2GCOB 2QV0A 1GS9A 1DI0A 2R47A 3PI6A 4IZ6A 4MRNA 2F22A 3ZK9A 5IZCC 1CVIA 2DLDA 5HJEA 3NP7A 1Z6TA 2JGNA 5AVJA 2WWTA 1GUYA 5AKXA 1NNI1 2RGBA 4D1YA 3EWNA 1YNSA 4JDPA 2XBMA 4REOA 3UHPA 1S6YA 5HOQA 3FWNA 4LXIA 3C5EA 3RTBA 4G36A 4F11A 2ZRHA 4MDFA 2IIQA 2WIGA 4LXTA 4M98A 2QVCA 3PXEA 1PJBA 2QUIA 4KNYA 2QZPA 4FSDA 2HZ8A 4JSYA 3NIFB 1PKEA 3CNEA 4DIKA 4RZSA 3HE3A 3WDKA 2DHRA 2A5FA 4BNZA 2EQBA 2VHUA 3MJFA 1FFCA 3WMWA 3L7MA 1G0NA 3K5IA 3HN6A 3L05A 3GFTA 1JEEA 3PSHA 4QG3A 4LGVA 3JALA 1R6DA 2ZWVA 1IJBA 4GAEA 2XPCA 2YYSA 3I42A 4YMSA 3L6UA 5EPEA 2QF7A 2AFHE 1BTOA 1E3IA 2OEPA 2RHCA 1WZCA 5FAXA 1XTIA 2DM6A 1X8JA 4FE7A 4URVR 1I7SB 1RD4A 2XKKA 2WUEA 3NHJA 5EMHA 4W8OA 3RJ9A 2BMJA 2GK7A 1ECCA 4DR6B 1IEQA 3Q10A 5K3CA 1J0XO 2NUBA 3OJEA 3FROA 3BMNA 3PPXA 5K0FA 3SWWA 4JVOA 4Q1VA 4M6WA 4MYUA 1ABFA 2F1RA 4AJHA 4E0BA 1YS6A 3M6MD 4LI3X 1UK9A 4X91A 5IRCD 2GJKA 3DTNA 1WDMA 5JY6A 3NXSA 2JAWA 5L6MB 4D25A 4U9UA 2XEDA 1VXOA 1TZKA 3L8YA 4AJIA 1E18A 4R3NA 4MV8A 4K05A 4G5XA 2H52A 1NNSA 1JNYA 4ZC1A 1YAUO 4PRKA 2OO7A 2W2KA 3PZRA 4BHTA 4MPJA 1ZNYA 3V4ZA 3B3FA 3U3FA 4TZ6A 2CDNA 2O2SA 3IT3A 2YMMA 3TQTA 4OHMA 2D1TA 1SVMA 2HWYA 2NTJA 4N48A 4NCXA 4DT1A 3DBRA 4GWKA 4KLAA 1ZISA 3QF7A 5JLIA 2BGNA 3O9MA 4D5EA 4IICA 4HDNB 3B6EA 3ITDA 4BVBA 4K6OA 5A6BA 3FYCA 4JUCA 2C9MA 3ZZTA 3G8CA 3NBYC 3IKVA 2NZ8A 3NWJA 1A3CA 3G2MA 1L7CA 1O9HA 3CW8X 3KP1A 3ZD8A 3C1TA 2ZOSA 5HRCA 3ZLJA 3HO1A 2FUNB 2CNNA 3UNGC 1KI1A 5JV5A 3AMVA 2YV5A 2PGXA 5EKSA 2L17A 3ABMC 4DNXA 1G2QA 1SD1A 4JGGA 3H4VA 3U3OA 4Q3KA 2LP4Y 3GLQA 4E51A 2WMOB 3FGPA 4H7EA 1VSTA 2DWQA 4IJVA 1P2UA 2D8AA 1U8TA 1JJVA 2ZIFA 2I2FA 2XLVA 2TYSB 1HT3A 4Y8VA 3SZMA 4QFBA 1U89A 3RU2A 4H7FA 3PGMA 3FOFC 256BA 2EGGA 2V1UA 2BHRA 1IZ9A 3FSGA 4XTKA 1JR2A 1AJEA 4HNGA 3NV9A 4BJHB 2AVNA 4YRZA 1A71A 3L7AA 4LISA 9ABPA 1LQTA 4MIEA 4FOLA 4D3DA 4G07A 1RYHA 2I7CA 3A4MA 3RNLA 3QMKA 2AXPA 5JDIC 3A6EA 4QLOA 1JAIA 4OQPA 4BVGA 3R0XA 1WIWA 2PZLA 3OLWA 4GE0A 2PJZA 1KP9A 1KR2A 4BFUA 5TF4A 4TM7A 4YT4A 1EBUA 4LXYA 3ER9A 4R4JA 5CT4A 4H18A 2AUNA 3IPMO 5EP1A 3HCOA 3LNTA 2C07A 4YCNA 4OREX 1N0VC 3TOXA 3DOOA 2J4DA 5D84A 1G18A 4L7VA 5JD3A 1COZA 1PKXA 4HGQA 2ONCA 4I3FA 2ZREA 1O0BA 1IY9A 3UXYA 3UAYA 5BQHA 3IEXA 5CAEA 2WNIA 3ZG6A 4PPGA 5H8WA 3VH2A 4IKPA 5F64A 5HPYB 3RVPA 1Z2DA 1KXZA 1AGXA 4QPJC 2W90A 4V0SA 3IOEA 4BGUA 4LBWA 3VHXA 5L8VA 3BWEA 4ICIA 1GT6A 3F47A 2WPNA 1LBTA 4TQGA 4D0NA 1YDWA 4GX5A 3SDBA 4O4IB 4ZVUA 3WYDA 2PQ0A 1S3SA 4TROA 2G8NA 3D6NB 3WIUA 3M1LA 2Q28A 2QZ9A 3M1AA 1EWVA 3WJ2A 13PKA 4HHEA 3D6TB 4ND6A 2QTLA 2V7QD 5E7QA 4XLPF 1KEZA 5JADA 4GKKB 1EFDN 1XDWA 1P1RA 1BVYF 4EUHA 2ZDQA 3S5UA 2F43B 4OO3A 1XRLA 4Q4CA 3OOSA 3HLTA 1JJAA 3EG9B 3HZOA 4ISBA 3TUJC 4EJSA 5J4YA 1INLA 2KS6A 1FBTA 1S2LA 3WFIA 3A9RA 5EE0A 1A4UA 1IHOA 3GLGB 1CJSA 5F9MA 3K1JA 4JT9A 2RHBA 2VP6A 1JB1A 1T6NA 1QE5A 4BX0A 3DE7X 2PS0A 4JI3B 3PB3A 2VK4A 4G37A 5CEFA 1A9YA 2JEOA 3O1JC 3OWTA 2HIMA 4YRGA 2Z6UA 3QKTA 2HLNA 2XAAA 3KXPA 4MS2A 1RXVA 3MTEA 4NKRA 1PYOA 3S8EA 1SCUB 4ALJA 3LDUA 5LLSA 4HGRA 2C59A 2MSKA 2ZIGA 5KWJA 1QHNA 5C5EA 3OCCA 3KKOA 2Y93A 4Q1CA 2WFLA 3O2NA 4RYLA 5FD8A 4QDTA 5CBPB 1Z6QA 1VG0B 5DHPA 3W3AA 3E22A 3W9UA 2F00A 1JFTA 4DYVA 1MQ9A 2XCUA 3MPUA 1HGXA 4JBWA 4H3VA 3L1HA 5FL3A 3Q1LA 5BORA 1J99A 2PUTA 2GVDC 4XQ9A 4D2IA 2QX7A 2W37A 2AWOA 2QI9C 1LDNA 1DC7A 1WXHA 4P80A 2OYRA 4QSHA 2JPUA 2GKOA 5L3SB 1K5HA 1W0KD 3HP7A 4WJKB 5AP9A 4B44A 3IUNA 1P5FA 1STOA 2K4MA 4A1FA 1XNRB 2J32A 5JI3E 4XWAA 4YLYA 1KYQA 1TVKA 3DV0A 5TB5A 1V35A 4OI0A 3UHOA 3IRVA 4UOEA 3Q85A 2ZI9A 3AUYA 4K2AA 4XZ3A 2DXIA 2BZ1A 3P9CA 1U3WA 5FWAA 1CXZA 1UBHS 3ZDQA 1F3OA 3AL0C 3OM1A 4E15A 1EZ4A 2PD3A 5LJLA 4JLPA 2WWWA 3PD0A 1FDWA 2Q99A 3L4JA 4BLRA 1LDYA 3LUJA 3NBKA 1ULTA 4G2TA 4OGLA 4WHMA 5K4GA 3M7IA 1QKIA 5DHUA 1X77A 5HZHA 1RJFA 3NOXA 5L53A 5FI1B 2V7VA 2QL9A 4OGWA 3LQQA 2OB1A 4KQ6A 2A0YA 1CDEA 1RQPA 4IHAA 7AT1A 4CKEB 1ZW2A 2KHZA 1CR1A 3HA2A 1SHKA 2I4OA 3VI3B 2QMYA 5LQCA 1GZ7A 1B4DA 2WFMA 3TVDA 4AMZA 4HB3A 3HA7A 4KEAA 2YHAA 1RJDA 4I8IA 1M57C 1MPTA 4LHYA 4RK1A 5AJHA 3OJLA 1GTL1 1FFXA 5T7BA 3ZHTA 2X0CA 5I48A 3SE7A 5FI0B 1GQSA 3LHFA 2VTEA 4R3UC 1KJIA 1R7RA 4TTSA 5JROA 3A2NA 2BH9A 2YLDA 5AMXA 4G63A 1TMGE 4N0QA 4DMHA 1K5PA 4WINA 3KVVA 4ZYVA 3ABSB 5EJMA 1HYGA 2EJCA 4M1WA 1LF5A 3KEMA 4MHOA 9GPBA 1YC5A 1X2EA 2Y1CA 3SVLA 4B5KA 1E2GA 2JAOA 1Q19A 2QT9A 1V7CA 2D8MA 1G2OA 5HCUA 4FD3A 1RKVA 1TM5E 3KKNA 5DWDA 4DBVO 1G291 4MV3A 1JEYB 3VHQA 1HFJA 1V8BA 4I0WB 4LOAA 5KQGA 5LQJA 1EG2A 5H16A 4J6FA 1P2GA 4RA6B 2P61A 3UUGA 3HVIA 4JLWA 3GCWA 1SBQA 3U3DA 3FLBA 3L02A 1DBIA 2CHGA 4Y67A 2XEXA 2C5GA 1YZGA 3A06A 2JFPA 3EZXA 1C3XA 4AS2A 4GPTA 2V45A 3PD1A 4IB4A 2C4MA 2TMDA 4OBWA 4BZPA 1YRLA 721PA 1EKXA 1G8SA 3DWGA 4GUAA 1IUPA 4NCIA 4TSKA 3RV3A 1DJNA 3MS7A 2WICA 3I12A 1SQ5A 4Y2RA 1UQUA 2P9EA 3P0IA 4C3OB 3PKIA 3UB2A 1VYKA 3WLHA 4MJLA 2VPXA 3IAHA 1SVUA 2EL9A 3FHJA 3U49A 4XA8A 4BMNA 3WK8A 3AHEA 3A10A 1L4BA 1J25A 5TLSA 3M70A 3EPVA 3PI7A 2DVMA 4X60A 3T15A 4PN7A 5CA0F 3VR5H 5IDVA 3KT3A 4HDAA 1G8KA 4I9FA 5C1PA 4R2JA 3MYFA 1HEIA 5FV7A 1FJGB 4QODA 4RCYA 3BRQA 2HJRA 5CM9C 3CINA 3KHKA 3N8DA 2H1RA 4EM6A 3VNSA 4BX3A 5L7TA 1P81A 2C0CA 4GP6A 1MDFA 3T1YB 1MB9A 1W6UA 2C97A 3EEYA 4JI8B 1OR3A 2JD3A 4Q34A 2ISCA 1IRIA 3LESA 5DTQA 2ZU6A 2IUTA 2HA0A 3VV2A 3S99A 2OKCA 5KSYA 1SZPA 1AS3A 1VE3A 1ULBA 1K4KA 4NL4H 1HH4A 2XGGA 4YRJA 3ABKC 1M7BA 1K2WA 3ZWYA 3P2JA 3QYPA 1GTMA 1N2CB 2AFIA 1YDEA 1RYNA 3OP1A 1JAXA 5TNXA 2HX1A 1GP2A 2PQ2A 2WKWA 2QUHA 5IEJA 1VYTA 4GD3Q 1WUYA 2VHZA 3Q98A 4JLMA 2JLBA 3W6OA 3VR4H 4M0UA 3ONVA 4HKTA 3GUCA 5AO9A 1Q3KA 2OCBA 3L0OA 4LDPA 1F0YA 1XN4A 3C3CA 3M89A 1GCIA 4BNLA 5IT0A 4DPMA 3QOFA 4RACA 4RD0A 4N5MA 2CLDX 1VJ0A 3T5DA 4EUFA 5AJTA 1MOSA 3MLAA 1QQAA 4CKCB 3O74A 5JSKA 2B4YA 1H8ED 6NULA 1CGME 4KR6A 1FU4A 4IXWA 2GD1O 1U3UA 4IIJF 1S3IA 2WABA 1RTKA 4PE5B 3IQGX 3R5FA 3P20A 4D74A 3C7CB 5E3IA 2P5UA 4IRUB 2Q9CA 4V0OA 4EYKA 1AZSC 2W2QA 1MNAA 2Q3EA 1GPDG 1UG7A 5JSZA 4BDSA 1H0SA 1XRQA 2YNMA 3Q0EA 4GT1A 4ZEOA 1FQOA 3M1CB 3DDCA 4KX5A 4DJ5X 1NJ2A 4AYXA 3SDSA 1AU9A 4HQFA 5BVGB 4U9EA 3IEMA 2VA9A 3O3MB 1UM8A 1REQA 1X9IA 4G5RA 3D7NA 4QJ4A 5D3MA 2GBGA 5EMJA 3QELA 3MWGA 1DG1G 4ZOLF 3TZQA 1QTRA 2HF2A 1NZEA 3DZHA 5G1NA 2G6BA 1I2ZA 1CQPA 2QORA 1PL8A 5L3ZA 3WIOA 4CSAC 2Q7RA 3W1WA 4C2UA 5BOSA 5FBZA 5DM1A 1BS9A 1QV7A 2BSXA 1TKCA 3I3SR 1MOZA 2I2CA 4H2DA 2VHXA 2VNSA 2DUNA 2IEIA 5LMZA 3PGVA 3C8HA 1HX7A 4NEQA 3MD9A 1XLWA 3FM9A 3DXXA 3ORFA 4IG4A 4BJ6C 4XM2A 2E1RA 4IXNA 4O79A 3HYSA 3IVXA 4B4KA 2C3UA 2UV8A 4UTRA 3RIEA 3E3NA 2OBBA 3LC2O 1GUBA 2RHLA 1AZLA 2ZRBA 3BL8A 2P4HX 3HACA 3X43A 4DIFA 2HA2A 1BR4A 1XVVA 3A3KA 4JBYA 1YZAA 2E2WA 2OBLA 5FNVB 3R3UA 2WJ4A 2IP4A 3TRJA 5C1DA 5LQMA 1UKAA 2OFOA 2B0CA 3L93A 1NSYA 5JZSA 2HRZA 1EA5A 3RTAA 3HMQA 3RQSA 4YUWA 4ZI2A 3SM9A 3CBGA 1YVUA 5E95A 2XBUA 4IDDA 2FMFA 2G9UA 2VYVD 1ZEJA 4QDUA 3G23A 3DEZA 1VSBA 2XRYA 4RD2A 2JGDB 2XTAA 4D41A 2W8BA 3AJRA 3MRVA 3RHZA 1VECA 4JYZA 4GOXA 4LWZA 2ZTSA 3K8ZA 3EXEB 3VF0A 1JHRA 4DZZA 4XIFA 1T0JB 2G71A 3EMBA 5C5IA 1EK0A 3DZJA 1T2CA 1I4LD 4UPDA 1CUVA 1BDHA 2GYWA 4JTCB 3B51X 1LNZA 3DE5X 5IX8A 4OXNA 2JGLA 1IB6A 4XM1A 4ILKA 1EU1A 1UPTA 1Q0TA 4L16A 4EKGA 1N2XA 4O6NA 3WHLA 4DANA 1NN1A 4XX0B 3UUEA 4E46A 4BY9E 3T4EA 1VOTA 5CFRA 3BX1A 2MCFA 3ED5A 4YECA 3FAJA 3TNDA 1BW9B 4RNDB 2W2TA 2Q4OA 4U3JB 4CTNA 2XHZA 4P0TA 1OFUA 3EYAA 3PQ6A 3CZ6A 3LX8A 3WE7A 1E4EA 1YU9A 2KQUA 1ZH2A 1NLXA 1N6RA 1VPTA 1CHDA 5K0ZA 3NH6A 3GAZA 5HGJA 1QS0B 2AFIE 3C8GD 4O2AA 4ALLA 3USZA 4R81A 4CI9A 3QMVA 821PA 3QU7A 3PXDA 5AKJA 3NMUF 3V1YA 1JDPA 5JTUA 1T25A 1C1DA 2YVUA 1E2HA 1XRNA 1FNSA 4UEOA 4K6HA 1YJBA 2HSDA 3U40A 5LD2B 1I9CA 2PZAA 4NMWA 1F48A 2I6SA 5A6JA 1ND6A 2WG2A 1FTGA 4MW4A 3L0SA 2ODAA 1TAHA 1H8HD 4HATA 1TLTA 1LY1A 3OIVA 4S2EA 5CT6A 2B4TO 3KD2A 1OLUA 5GADl 1LXCA 1K68A 3UJ7A 4J9VA 1Y42X 4N03A 4ZQBA 4HRVA 2HIHA 5MN4A 4GYTA 4CRWB 2YJNA 1Z4IA 4IX1A 5DHQA 1QRAA 2QNBA 4R51A 4TV9B 1WOMA 5KVCA 1SUWA 3LQRA 1OWOA 4AXXA 1XZDA 1OZGA 4TWAA 2OK7A 1AIPA 3OE7D 2OM6A 3GA5A 3OZFA 4L73A 2ON6A 5LYJB 4ME6A 4G9EA 4NG5A 1ADYA 4G97A 4UULA 5AWFC 5DEOA 5JAMA 1UP4A 3WL4A 3FNBA 4GNRA 1ZA2A 1H2RS 2FAPB 3BRWA 3VX3A 2Z95A 1XJ0A 2GZ1A 5DYGA 1XVLA 3JSZA 4YQFA 2MIIA 2Q45A 3O6VA 3E3AA 3QG1A 3CR3C 4L8WB 5KYYA 4LZJA 2I62A 5C3MA 1CJCA 2JHPA 2IW1A 4C0HA 4YL1A 2PAFA 1XLTC 5KEIA 4R68A 1Q22A 2H48A 4LYEA 1B8NA 4PZYA 1DDOA 1N25A 4UBJA 3OCZA 4WKPA 4UU1A 3GZTB 5DXJA 1UJMA 1KIFA 3RV4A 3V4LA 2YIDA 1WCIA 3RC9A 5C8DA 2GWWA 5A3RA 3HN2A 2UYOA 5ADUS 2GA8A 3SX2A 1NIJA 2EKBA 1J21A 3Q12A 1A1VA 3AV0B 1SZIA 2DPHA 3A3NA 3VSAA 4NZNA 4AD8A 1N33B 3OFVA 3O82A 1PWXA 1L0BA 5H02A 3LIIA 3YASA 4CV3A 4EPYA 3N9IA 4LSZA 4B9EA 5EMMA 2G28A 1EP1B 1PVVA 2Y68A 1O7JA 3KX2A 1LPOA 3VPGA 1J8QA 3NRCA 1QPBA 2BGMA 1Y3CE 1G4WR 5KVVA 1TFRA 4EHFA 2QRZA 2GCPA 3L0IB 4PRLA 1WXGA 1PJ4A 2QM7A 4M36A 3EFEA 4HXFB 4PV7A 1OILA 3WLAA 2XYQA 4C0XA 3AINA 1G17A 1XQ6A 2ZYTX 2FK7A 3B1WA 4RAOA 1OLXB 1KJ9A 4PZ9A 2Q7XA 4HQKA 4UOQA 3LT4A 3FMIA 5K3BA 3ZWIA 4RANA 3VR0A 3UW1A 4ER5A 1NASA 1S8FA 2BJVA 4R31A 5JR3A 2VF5X 1M8GA 3BIXA 3SBXA 1FRZA 1IUOA 1VSUA 3ZVKA 3OPYI 4LAFA 1GZ4A 1U5CA 1L4KA 3V4RA 3VR6H 4NZPA 4HSEA 3K32A 1QV9A 2WIJA 5B1YA 4FI3C 3NEAA 2W70A 1HE9A 5A9SB 2OV3A 1UC4B 3K2QA 1ORJA 1RE0A 1H4SA 2WVOA 4HYYA 4RIHA 3L7DA 3LVQE 1V3TA 2NACA 4ASUD 4KDRA 4NFHA 5DTMA 4ROTA 5YASA 3JAMA 1ZR2A 2GEFA 1P2VA 2VP4A 1TJ3A 2WR8A 4TTVA 1AQLA 1K6IA 4YDRA 4AL4A 4GICA 2H4JA 4LOHA 5E3HA 1OMOA 4C22A 4D0SA 4AJ2A 5ICSA 1KZ1A 3US6A 4GBGA 2AH5A 3EWSA 1HNXB 1RJEA 5EHXA 1EVIA 2JCYA 3IVAA 4EAQA 1K8XB 5BWBA 5JJIA 4HJXA 3BJZA 3ZV6A 3R9WA 5ALTA 2TMYA 2C4UA 1BWQA 1OBCA 1P9NA 1NVVQ 3F8SA 3OFNA 3A9VA 3LXMA 1W36B 3UAXA 5L51A 3IPCA 1T9ZA 4M0DA 3OOJA 2XT0A 4NTZA 3RQEA 4A92A 5IYZF 4D9BA 3UBTA 2FEWB 3RC3A 4R84A 2AOTB 4XQCA 4PQYA 3E9ZA 4QO8A 4NDAA 4YCDA 3PX7A 1S2DA 4KPUA 1OX6A 3KOZA 1VZ2A 2GX6A 3KB2A 3P2OA 3Q9UA 1Y6ZA 1DS6A 1HZZC 1E9CA 3RJMA 1RLMA 4MDHA 5GVRA 4HGPA 4WL0A 4BOYA 2OZPA 4A4DA 3O9ZA 2DPGA 2W6QA 4MW3A 2XCOA 4UXHA 4EZBA 1WY5A 3X2SA 4B85A 3ROXA 2E4WA 4Q12A 2HHLA 4JDUA 3BXEA 1OBVA 3NCHA 2WJYA 4BFVA 1I5OA 2AI2A 4YYEA 2QMQA 2BHSA 3FJYA 4EX7A 4FOPA 2OGWA 5E6UB 2F59A 2HUNA 4XE5A 3EXIA 1BA3A 3AJ9A 3AG5A 3UHFA 3AV3A 1UUFA 3FHLA 3NDJA 2HA3A 3QVYA 3V00A 1W0JD 3U62A 4X1YB 4DLZA 1K0FA 2ZIWB 4CS8A 1AKYA 5FL7A 4NSNA 1QLHA 3HY6A 1NMQA 1N2IA 5JJCA 3R9XB 4TL6A 3GQBA 5H83A 1CP3A 5DM70 5CX1B 1YULA 4KGZA 2Q0HA 1FXUA 4GVPA 3LDHA 1ODTC 4RTKA 3O31A 1SURA 4QG7A 2J0UB 3B6IA 1YK0A 3ESYA 2OD9A 4BFYA 3TG8A 2FEKA 5F2KA 2X4DA 2VXOA 2XNDA 1B6RA 1S9HA 4B7XA 3TDKA 3UAGA 1BHSA 1GG5A 5GJVC 4Y2GA 5TQ0B 4G89A 4CTKA 4ILEA 1MT3A 4HG2A 1P2SA 3ZNPA 3QLVA 3R74A 3ZXYA 4P31A 5AVYA 4MX8A 1OLSB 5L3VA 1F2TB 3TH5A 3GGGA 4KXQA 3IMGA 4R8KA 2CL7X 1HY3A 5C53B 3ZY2A 4MQFA 3GJ8A 5ERYA 2GYVA 3ZWAA 3O4IA 1RRKA 1JN0A 1DL5A 5KPDA 4NP6A 3PTAA 2AFVA 3N24A 3KEOA 1VLVA 1E2EA 2C4NA 5ALEA 2GPYA 3BSSA 4DRHB 3AF5A 3O7MA 2Z43A 1DIRA 3LS1A 3ZE6A 4XUDA 1KYXA 4RGQA 4DAOA 2PMWB 3HV2A 3VYTB 3VC3A 2EIKC 4DLBA 2GN6A 3KQVA 3DE3X 2IOFK 3V3TA 2AUMA 1OT5A 1UT8A 2G5PA 2ZRIA 3DKRA 3RAGA 1CFJA 4GQIA 4F8JA 1XMIA 1C03A 1M2HA 3MRXA 4EECA 5DSZA 5JG7A 1B14A 1NLUA 3W2VA 2NN3C 5REQA 3PDHA 3KZ1E 4EHIA 5D6NA 4G4SP 4ND8A 4TKUB 3IHLA 2VAVA 4X44A 5CU7A 2XITA 2QIOA 1RWPA 4GEHA 3OZCA 2G7MC 1LDEA 3H8JA 4EHPA 2B2CA 4U2FA 1SXJA 4O8CA 3L4BA 1DXQA 4CGZA 3FAKA 1A0OA 4DMFA 4YL3A 3PVZA 4JQOA 3MHPA 2IBTA 1CQJA 3BQMB 2JFUA 1NFNA 1DHTA 2R6AA 1YFKA 5GM2A 4JOQA 5FFNA 3SFVA 4FYVA 3IXMA 3VHLB 3ZGXA 4UUOA 4G0UA 1Y3AA 5H4HA 4ID9A 3AOUA 1LSUA 2EP8A 3ZHXA 1DBQA 4PHTA 1QR6A 3W2WA 4WSOA 3G7NA 5DN9A 1XR3A 1VMAA 5CIVA 1ZXBA 3IIMA 4G5FA 4R8VA 3B13B 2QZ4A 1JMWA 1P6QA 5G3YA 3OWOA 3R77A 4RELA 3TOZA 2CV1A 4H17A 3OHSX 1C9NA 2OLEA 2QRNA 4EPTA 4HNVA 4FFOA 5D91A 1TEHA 2KI5A 3IMCA 1XVAA 1LQ2A 2QJFA 4PK4A 3DE8A 4NQZA 5MN5A 3EDQA 1KZ6A 3L06A 1N1CA 2A5GA 1Q3HA 2B1QA 5F21A 1GLGA 3CNQS 3LZDA 3EFBA 3FI9A 1F4VA 1SIBE 4NU8X 1KR5A 3PRHA 3HDYA 1BDBA 1PR2A 1SO8A 1XAIA 1XA0A 3U9LA 2FP4B 3KT8A 4R2LA 4IGIA 2RAVA 2CMHA 2HSWA 3IULA 1YWGO 1OGJA 3IAUA 1T5IA 3QHQA 1WPQA 3FRHA 2B99A 4WOKA 1PFVA 4GKVA 3FAPB 4J7AA 3JTMA 2Q27A 2E21A 5B55A 1UBFA 2ZS7A 4JEHA 1Z8HA 3G85A 3HYRA 1V47A 2HHHB 1KJQA 4KB5A 1GQRA 4N6GA 3SVTA 1AQJA 1F6BA 4ZEXA 3FHOA 4CQNA 4LE0A 2JLSA 4U9IS 3BOSA 1X92A 4MIKA 4DLYA 1OW7A 4MQ5A 3S9OA 4BS9A 5LLDA 1NY6A 2BSAA 4PLCA 3FPEA 1WV1A 3GB9A 4EA9A 4C0JA 3TD9A 3R3ZA 3HDJA 4XJSA 2BTQA 4ND1A 3W8EA 1J8YF 1K5DA 1ESMA 4B2LA 1X7XA 3OD1A 2B34A 2PFDA 3ICPA 1FXWA 3HYLA 1A77A 3K2IA 1HR0B 3NJ4A 1NQVA 5AC4A 5KTOA 2UZ1A 4JLNA 4BX9A 4ARZB 2I1LA 2BHLA 2FMUA 4PZPA 4QYMA 3NM4A 1OTYA 2ECKA 1Z4NA 1SCDA 1YI8A 4RZUA 4OIPF 3GELA 2I6XA 2O23A 2AOXA 4GVXA 3MJHA 1K75A 2VZLA 1ZESA 2X6QA 2WFAA 1BE6A 4AG6A 1OFVA 1U6IA 4JT8A 1ML4A 4B79A 4AKEA 1Y7HA 2I34A 5EP4A 4ONEA 4BLPA 3GFFA 2X1MA 4LVOA 4HN2A 1P0PA 1D1QA 2P9CA 3X2QC 5KWIA 2BKVA 4D9NA 5JO9A 2CHVA 2ZJYA 4EL0A 2KC3A 3A28A 4BFCA 1ZN2A 1GGNA 3EIHA 3FWPA 3GDWA 1YL5A 1UFBA 3ELUA 5BYKA 1HMDA 4H15A 3KUUA 3O91A 3KJXA 4HP8A 1L5QA 2E4YA 1DXOA 3AL3A 3CZAA 3WKCA 5D3KA 4ECEA 2TMGA 2K7FA 1VM6A 1VLSA 3NKFA 2DBQA 1ZGCA 5FTWA 3PRJA 1KMMA 4QGBA 4UTNA 2OWEA 4CMHA 5C8YB 2CLSA 4AJ9A 2B7CA 4UBKA 4B8ZA 1WBBA 1EWRA 1M56C 2IBFA 4NYMR 5FLYA 3MCWA 5K0CA 5I3ZA 3BEDA 3L92A 5LMNB 2DBRA 1M0SA 2YL0A 5HEKA 1JPUA 3HJAA 2NXCA 1TDJA 4Z3OA 1C5KA 2HAEA 5ULLA 4UAGA 3ZVRA 3RFUA 1YUBA 1P60A 3HNOA 4EH1A 2WNHA 4TUYB 4YUAA 3H42B 2P3QA 3DE1X 3LEOA 3F97A 3LM8A 2QVLA 5I01A 2FW6A 3R09A 1Q11A 3LWNA 4JK3A 1JTFA 1B76A 3VGJA 1SXJE 2ZYIA 1SHJA 4XYBA 5JNVA 4QDJA 4PGGA 2A88A 4HH4A 4UMVA 4EZIA 5DN6D 1IN5A 2NP6A 1THZA 3HFSA 3OLQA 4PLHA 2Z2KA 3KE9A 5K2MA 4B3JA 2O6LA 4XWOA 1U2RA 4ZPJA 3R2PA 1WETA 3VR5D 1TADA 2FLWA 1KC1A 3M1IA 3ECCA 5E8JA 4PYRA 3JD4A 5CXSA 1OXBA 2WT8A 3DMHA 5IF9A 4QM6A 1VA4A 1QUFA 4IOMA 1FC0A 3MINA 1Z4PX 1F7UA 1N32B 1HTBA 2DPLA 2UAGA 2I3AA 2YZ2A 4BLTA 3G8YA 3C8GB 4CS9C 3W8RA 2ZG6A 3MCUA 1C9EA 1E96A 3I9V6 1G4US 4AN1A 5A4MS 4ALNA 4OP1A 3PR1A 1U7TA 3V8NA 1H5NA 1D4AA 3Q2OA 5CURA 4PAMA 3Q2KA 1WUKS 1OKKA 4RNCA 3HB0A 4CMIA 2C29D 1VLHA 4DXHA 3W4IA 4MWGA 5J58A 3SBDA 1IUNA 4DWVA 3PZBA 2IYZA 5AKHA 4H54A 1Y8QB 2AMVA 3LWZA 2W8ZA 5CIWA 4KH0A 5I6DA 3HKEB 4DPKA 5JVDA 4LN1A 4C3VA 3K73O 1TOAA 1A7VA 4MR7A 1C29B 4D9KA 3D4OA 2A1IA 4WCFB 3JSAA 4G9BA 3VR4D 3UC5A 2QN3A 2Q8PA 1NZFA 3E9YA 3OOHA 1EVLA 4DDHA 4UDVA 2LDBA 2GYUA 3UATA 4LDZA 2RAPA 3TMAA 3LP8A 4BGDA 1JGTA 3ESBA 2ZJFA 1P9OA 4RFLA 3AEZA 4CU5A 3IQXA 1R15A 3G1WA 4LE1A 5DIFA 4ID3A 3ZXIA 3U44A 2YN0A 2D5LA 2F67A 3FCAA 3RYHB 2FJPA 3QV2A 4C89A 2C2YA 3KUKA 3F96A 4DC1A 2BGLA 4F5ZA 2OBFA 5JAPA 3B1ZA 4MQUA 2FEMA 4W8KA 4BP1A 3T9CA 4GI2A 4X0RA 1C0PA 2P9TA 4IRMA 1V8PA 4KLNA 1XK6A 1M74A 4MRVA 5BQPA 3DB1A 4Y98A 2B4RO 2QPTA 2OL4A 4F38A 2QBYA 4EA6A 4UOZA 4YJGA 4F8YA 4M9RA 4MIOA 3O75A 4HDOB 2IYTA 4LWOA 3WL8A 1CJBA 4YJHB 1SUSA 3FYUC 4WKBA 4DG9A 1K7CA 4RA9B 4Y2UA 2I3GA 4DDTA 1D9XA 3JTLO 4CU2A 4CMEA 4KE7A 1AGRA 1M34B 5IYZA 3AFMA 3RYFA 4C43A 1Q92A 4KBGA 1U9IA 5WRFA 3F9CA 1NU8A 2XI4A 4KV7A 3JAWA 3RYIA 2GEBA 3MHTA 1WXQA 1Z7EA 3E81A 1DRJA 5EP2A 5TF0A 3B6MA 3RT7A 4ZQEA 4LHXA 1SUPA 1EFAA 2YC4C 1OW3B 1U9JA 5JQGB 1GU0A 3X1YA 4Q93A 3DOCA 2PXAA 3AVYA 3R7NA 3H4TA 5KUTA 2PZKA 3TJ5A 2GWRA 3ZEAA 4CLXA 1XNGA 1N4AA 2BGTA 3AOGA 4ZI7B 3C14C 3HJBA 5LZ5A 3GRVA 2A58A 1CUJA 3HP1A 2V9PA 2LRHA 1ZPDA 4E30A 4DLNA 2ODEA 2HO5A 5DOZA 3AYZB 4C4YA 1Z4OA 1RQXA 4KMOA 5DK6A 1L9XA 1WU8A 4P7BA 5CK5A 4D4LA 4AS1A 1W75A 5JATA 1H9GA 2CXOA 3UG7A 1FLNA 1JECA 3D1VA 3IUBA 1E63A 3HZRA 5CCDA 1V5GA 4LDQA 1RDFA 4PACA 1NKTA 3VTKA 2VDUE 3IHKA 1DBSA 3GFOA 3HKDB 5ALGA 1ZQ1A 2B7LA 3A11A 3PL1A 5IW8A 2B98A 4EB3A 1Q6YA 3WNQA 3BE4A 2GYYA 1PJLA 4PNEA 4EHDA 2AEFA 4QDKA 5FV4A 1BXRA 2OXFA 4MP8A 2NW6A 5DS5A 3B53X 3VPCA 1XZMA 4C0KA 1JG3A 1UJ6A 2JI6A 1ZWLA 4DA6A 4BASA 4L95C 5L7WA 3DJUB 1G8HA 2UYYA 1IH8A 4RUKA 3PNVA 1Z2EA 1NRIA 3JQQA 4BE4A 3T7DA 4MGKR 5JSQA 1DKOA 2JHAA 1TVCA 3CLUC 2GLTA 2AXNA 3ROTA 3DR3A 4AX8A 2JAQA 3IEIA 3UMGA 2DG2A 3KB6A 4OHXA 4UD6A 2OZVA 5CD9A 3AI1A 4MWTA 3D3WA 2NZUG 3OA2A 3URKA 3K3PA 3KJGA 4O2AF 2M1XA 4OFBA 4BVJA 2Y39A 5B6JA 3RLFA 4MS3B 1XZNA 2B6HA 2DWOA 1KVTA 2DP4E 4BZZA 2VH2A 3RVMA 4AUEA 4II3A 3M4CA 4QGHA 2KW3C 3DNFA 4H7IA 2BGUA 4OGKA 1KK1A 2OV8A 3U7JA 3IQ5A 3K9FC 4MQ4A 4M87A 1NW7A 4PLGA 4HTFB 1RHQA 2FB9A 4P6IC 5C52B 1L4EA 1LPSA 3K9GA 3CR8A 4C4OA 1A7EA 2VC9A 1MGPA 1G1AA 2YV2A 3AM3A 4BBJA 1TPZA 3V55A 2QYHA 3LBIA 1KPIA 4JKYA 4MPDA 3Q7LA 1Q21A 4WY8A 1YU6A 3CGGA 3BWDD 3HNIA 2VHWA 5KDDA 1MG0A 2DFKB 4J0GA 4PRYA 1H2YA 3MT7A 3G8DA 2YXNA 1BMTA 5CG1A 4Q3BA 4H0FA 1SWVA 1CR4A 2YYYA 4RF5A 1J1UA 1IHXA 1SUDA 1LBQA 3WI7A 1SELA 1KMIY 4RDAA 2C03A 2IV3A 5CCXA 1YAJA 5A9RA 5BT8A 3RHTA 2BEVB 5LBUA 3TE7A 4L9SA 1ORRA 2W2XA 2P8JA 2R2GA 3PDJA 3ICCA 1T01A 4NCNA 1KQPA 4MVMA 4HQ6A 2B83A 3D9QX 2YW9A 2BE9A 4OH7A 4QEZA 2FEOA 2Y1FA 1OAAA 5EJAA 2VH3A 5DWVA 1R88A 1U5AA 4RKYA 2FFBA 4EOGA 3AZQA 1J6UA 4RDHA 4BRZA 1WY7A 3NM5A 4IIFA 3W8FA 1SC1A 1FE8A 5BSHA 4I36A 1NVKA 4RXMA 5DVZA 4CM4B 2XUQA 3B3QA 1J7KA 5J2UF 1QFSA 4NICA 5FTJA 4EPWA 4KE9A 1KBQA 4YK7A 2OPHA 3GJ3A 5B6PA 1NU7D 1OBOA 4X71A 4EMUA 1FTWA 3CUUA 4BP3A 3CVVA 5E3AA 3G1TA 5I9MA 3W5DA 4RZ3A 4N41A 1L1QA 1YT5A 3F4KA 4HAOA 5IS2A 3Q4GA 1RXWA 1YOVA 3LGXA 4ZAXA 4PZEA 2O57A 3LHIA 1YOBA 3FLMA 1IQRA 4BFLA 4AMGA 3T3HA 2R7WA 4EBFA 4UKDA 1P18A 1M1UA 4LMPA 5AM0A 1R0CA 3A26A 4EGFA 3KLMX 4D81A 3HPQA 4LF5B 3E03A 1OVGA 5DISB 2J3QA 4G01B 4KIWA 3T3PB 4PSUA 3D2AA 1I33A 2Q1UA 2IOHA 1TJPB 5DM60 5AJZA 3DCJA 5JRAA 4LS3A 5L4SA 2XB9A 2PGJA 2ZE7A 4NE7A 2J3KA 4ZDIA 1JIXA 3WLFA 3MIIA 1XEAA 3I9OA 2XA2A 4YN3A 1G7RA 2PGNA 2Q5LA 3OM0A 3RUPA 3DAPA 5EJEA 4TLBA 1XTPA 1J9EA 5BV8A 4R1UA 2ZT8A 4QXQA 2FH5B 1ZW6A 3AXSA 4I2NA 4YCSA 4J29A 4X1IA 3PU6A 3WDMA 2C7QA 3I73A 5F77A 2XLOA 4PXSA 2DAPA 4JLOA 1YVRA 2XGMA 4DA4A 1C50A 4BP8A 2FWNA 2PGAA 5KAMA 2KBEA 1DTWB 1IZ8A 4QI0A 1WWKA 5L0CA 1EVKA 3DAYA 1YRAA 1R9JA 2WA1A 1V5IA 4N5NA 3F71A 4EW1A 3QX7A 2IPXA 2TMKA 1BZYA 3ZNQA 1UDAA 3VPBA 3VDQA 5JAQA 2VNKA 3ZWWA 4G1MB 1DWUA 3UXMA 3VR6D 2IYLD 1Y63A 4KO4S 2IFTA 3C39A 3H1EA 3LECA 5I9LA 4G8CA 2LKDA 2IHUA 3HA3A 3I83A 2ODQA 3LUCA 4H1WA 5F1KA 4A2NB 4CMGA 3B48A 4OJMX 1LDGA 1QGUA 3Q5GA 2V6JA 1W85A 1CJKC 5CDUA 3O8QA 2DY0A 3WP1B 4QTZA 3VUEA 1O1YA 4XPYA 2B3TA 1QPGA 4YROA 4GSYA 3I04M 3PTLA 4JN6B 3D2BA 1QTIA 3T8YA 1I7QB 3CLRC 4QFCA 2KE5A 3OZXA 3PDWA 3C7JA 2XUHA 1FPMA 2ZSDA 5KZMB 3ITKA 4H59A 2GXQA 2VPPA 1QGYA 2OE2A 1JJ7A 5GTDA 1H94A 2GAAA 3EQ9A 2XCTB 3FOOA 2FPPB 1UZUA 2X6TA 2WLSA 4YMHA 3AEUA 3V1LA 3RASA 5AW4A 1NT4A 4JLJA 3V6LA 4JEBA 221PA 3S0JA 3HVUA 2IIBA 2PJDA 1BX3A 3COWA 1PWHA 2GXSA 1TTHA 5J3JA 1UFRA 1PYGA 3BMXA 3IH5A 1ZJYA 5KX5F 3UQZA 1ADFA 5AVSA 2C5AA 2YL1A 3WR5A 3V5XA 5DLEA 3AQ4A 1THMA 3MYIA 2DBZA 3ACCA 5K09A 1GGVA 3FGZA 3CQ9A 3GFQA 4QX6A 8MHTA 4BPBA 3TR0A 1YZKA 1E0AA 1DUSA 2CK3D 2UZAA 4L3OA 3RADC 3OPNA 5DT2A 2FCAA 3AM1A 2NPUA 1QH8B 4YTEA 3ROFA 2HLDD 1L1RA 4MVXA 4TKVB 4KWHA 1J4AA 1SOAA 1VHJA 2P2NA 2ZUEA 3MBGA 2EJWA 1ZI8A 2WQZA 5DMXA 1Z2CA 3MZ0A 2J1LA 4JBHA 2NO0A 4H7DA 2OBNA 2A1TS 3H6KA 3T35A 5G41A 1QFZA 5T4HA 4YP5A 3OEHD 5EE3A 3GAFA 1ZKMA 2BBTA 2FA9A 3PQCA 3GLKA 4QUAA 1PR1A 4OP3A 5EI5A 5SV2A 2GSWA 1UDRA 1CLEA 3ROPA 1M7HA 4MRPA 2BFAA 1LPMA 4C07A 3DAHA 3I5XA 3M4NA 2DUMA 1E8MA 3LCJA 2YNMC 2FSFA 2PKRA 5EJ9A 1UPAA 3IV9A 3NPAA 1IQPA 5FR2A 4HDMA 3MPOA 2JBAA 4M1ZA 1E62A 1GGMA 2HGSA 4N39A 1KEWA 4BNTA 4QJBA 1KRHA 1NW4A 4DXAA 2WI8A 2YDXA 2JFBA 4UCXA 4LQLA 2JLYA 3ET4A 3J7TA 3TI9A 3LT0A 5DE3A 3EZIA 2O5EA 2ZTUA 3WYFA 5K8IA 2GEUA 1K04A 1FAPB 1HEUA 5KYXB 4Z9FA 3D6VA 2NXJA 4YMWA 5EMLA 3E9EA 1POWA 4EHJA 5F76A 4ZT3A 1E9AA 4O2BB 3ASUA 1X9GA 4YJFB 1U7DA 2PRSA 3KT6A 3WKBA 5JXIA 4CLOA 2J3DA 2GVZC 4W8GA 4Y2HA 2CDCA 5LCXA 4UBMA 3VNAA 1VBNA 1P91A 3C63A 2IEBA 5K4HA 1IJEA 2G5TA 2QTMA 4BWGA 1Y9ZA 1DFIA 4HK4A 3K71B 2PX6A 1P74A 3GYGA 5I9NA 3FR7A 5I45A 1LBIA 5DZSA 1F6WA 1GGHA 5J5AA 1R27A 2AYXA 1NVEA 1YF3A 2PRYA 3Q7PA 2CXSA 1YQQA 3C5HA 2DQ4A 4M1EA 4BB0A 2M9MA 4MS4B 1CUXA 4KXMA 2IHTA 4CIXA 2JH9A 3QK7A 2WJPA 2FPSA 4AG5A 4BX2A 3A37A 5H9WA 5FKJA 5A9TA 1Z13A 1TWCA 4HWKA 3DDWA 4K9SA 5CFOA 1SU8A 3OCVA 3RTEA 1LS4A 2FZVA 3T61A 3WOHA 3DKKA 1K86A 4ZVNA 4D0LB 3UB4A 4WZAA 3AUJB 4X6XA 3CH5A 5EPOA 1E9FA 1L8XA 1JIVA 3NMIA 2Q7OE 3R6WA 1T91A 2VCEA 4K9PA 4D9FA 1KSGA 3HXQA 4U5HA 1UXOA 2OYSA 4WUVA 4IH9A 1FNMA 1QCDA 2ZJ7A 1H1LB 4RPJA 4KQ9A 3ELBA 3THWA 4TSFD 3NBUA 2OQRA 4U8HA 3V2HA 5FBLB 4F5WA 4BO1A 3UA4A 3GMSA 3EGOA 3ND9A 2I6UA 4J03A 3PT5A 2V58A 3KPUA 3VM6A 1ZN9A 3AVUA 3FRJA 3VBCA 2IHKA 1HNWB 2NZXA 2RMKA 3KSRA 3C8MA 3DL2A 3TMKA 3VNBA 1IATA 4NFSA 5TJ9A 2ASRA 4IDQA 1BXKA 4FCTA 3GGJA 4X97A 4LE2A 2PU7A 4FXPA 2QN2A 1VGVA 4PU0A 2ODNA 1ONBA 2QX4A 2QRMA 2VKTA 4DUGA 4M8IA 1CYEA 5F7XA 4N5DA 1G4AE 1DEOA 1IOZA </