3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
2YVKA 3VM6A 4ZEMA 5DBOA 3A9CA 2A0UA 1W2WB 4LDQA 2YRFA 1T9KA 4LDRA 3ECSA 1T5OA 4ZEOA 1VB5A 3A11A
chains in the Genus database with same CATH superfamily
1HM5A 1PHRA 4DNQA 4BXOA 5JCOC 2IKSA 4F9GA 1S8NA 4R7TA 1VYKA 5JWRA 4N0PA 3CKYA 4DR4B 1Q0TA 4DV4B 3HR4A 3DWIA 4WAUA 3DXFA 4ONEA 4ZDKA 3ZIDA 2HF2A 3GWGA 3RWMB 3DKVA 2Y1CA 1NFRA 1X7ZB 3TOCA 3OICA 3ZVNA 4Q6WA 3VMFA 2CD7A 2RC6A 3CZMA 7REQA 4DFDA 5K0EA 3HKDB 2ZQZA 1PLLA 3RREA 3AQIA 1BHO1 1EVYA 3BE5A 5ITVA 1WBBA 4CMGA 4TYWA 4A0RA 2R84A 2W8BB 1V39A 1T6XA 3OT5A 3STVA 3ZE2B 2H52A 5ALRA 5IH7A 4BLVA 1ZXLA 1JAHA 3ZZTA 1M3SA 1BGWA 1VA4A 2A59A 3AXTA 4BO5A 1NPTO 3D59A 3S2GA 4B1FA 4XYEA 1ADGA 2XSZD 3C74A 3PHBE 5I7EA 4AS1A 2AD1A 4MARA 2Q27A 4N82A 1AMUA 4E5KA 3IQEA 3QWBA 4J4TA 4AG3A 2AWNA 4PZUA 3NOVA 1RI4A 3B9PA 4E7OA 4YCLA 1K0UA 3EIHA 5AI6A 4GWLA 2O4UX 1E5QA 1JKFA 1PX2A 2XDAA 3DMPA 5HDBB 1ZUNB 4HEA6 3WTCA 4JI8B 2CDRA 2P91A 2PNFA 1F8UA 4UVEA 4EW3A 3EF0A 1SZPA 2CFCA 2FPUA 2JCXA 3ZJYA 5H4GA 2AOUB 2RKWA 1T35A 4N5IX 4YO7A 5CEEA 1IEVA 2AXPA 1VCMA 3EMBA 1I30A 3IX7A 5IJWA 5JMOA 2MU1A 4IJVA 1RJFA 4HOYA 4Q9HA 1E1YA 4DJEC 1G8JA 2XM4A 1EBUA 2XBLA 4EG5A 3FFBA 3EWNA 4K9SA 2YCLA 4PAMA 3BSYA 5BSMA 5CIVA 4E2YA 1KO1A 2XSZA 2LR0A 2QTAA 2XWPA 3PQ2A 4DLXA 4CETA 4KL8S 1EH5A 4BVEA 3E61A 4DBLE 4N48A 2N9UA 4Z4EA 4QYXA 1BCSB 1B2RA 4UCFA 2PZGA 3PUJA 1SIOA 5HM6A 5EP1A 2QTFA 3I92A 4Y0VA 3WMWA 4D98A 1Z34A 4IILA 5F77A 2HS5A 3NT2A 1EFLA 1SVSA 4IG4A 2OOCA 5EWJB 3DPUA 1V6SA 4WZBE 4EL5A 1O5OA 2OLJA 3FDXA 1YV9A 1H5NA 4J0CA 1SIBE 5AHWA 2CW5A 4QATA 1W1IA 4YRLA 5DNAA 5A3JA 4YJ2F 5CDSA 5HE9A 3A1NA 2PNJA 4ZDWA 2Z83A 3VNAA 4A92A 1VE3A 3IAS1 3OSZA 1MVLA 5KJ1A 1U7UA 2PH1A 3KBBA 4RK6A 1KO5A 3W1WA 2ASEA 4NOKA 3WAGA 4E5MA 1NYRA 2WWTA 5LQJA 2O9XA 1A7VA 2D1RA 3DKPA 2F8SA 5EXEA 4Q3KA 2W70A 3EPHA 1GQOA 3VGPA 2FRXA 1H2XA 5DK4A 1YRYE 3H2KA 4C4YA 2J9BA 3K15A 5AJUA 4UCXA 3A4MA 5ERXA 5FPYA 1PIWA 2ZR0A 1FDSA 3O93A 4YCJA 4EMBA 1W88B 4JXZA 3LYAA 3EXHC 4QREA 3TLYA 3V1YA 3M49A 4AU1A 2EVWX 2EZ8A 2N3ZA 2F9LA 2HFJA 3N8DA 4Y2QA 4LQLA 1XWWA 2RB4A 2EOAA 3W4YA 3LBAA 2BFWA 4YK5A 1Z0DA 3GHHA 3LCCA 3ZTMA 4N3AA 5H7XA 3EPJA 2UXBB 3EULA 2ZE8A 5FL3A 1TU3A 4B2YA 4AXBA 2D3WA 2FP3A 3NYIA 2NT3A 1VG0B 1HE8B 4IHAA 4R32A 3JVVA 3NV7A 3E5HA 3FLMA 3KKZA 3DBLB 4KH1A 5EVJA 3T3HA 5HGXA 2HC9A 2JBAA 3C3BA 1H69A 3UJHA 1H4VB 2A5YB 3JQDA 1IOLA 3EEBA 1ZGHA 1GFWA 4CMAA 1TIKA 5IWAB 4RS4A 3WWOA 2B2CA 1N2OA 1CUZA 1IBSA 2QRGA 4WN9A 4JSYA 1YA6A 2QL5A 2HBZA 3N8GA 2LW7A 3ZHBA 2O06A 2QNLA 2PT7A 1I7SB 5J63A 1XP5A 1ZNZA 3GA0A 2IV3A 3OOHA 1FP4B 1GNSA 3SDBA 1OIVA 2D5AA 1K7SN 3W8FA 2A9JA 5SYAA 1QC5A 4G0WA 3V34A 1IC6A 2VJYA 4EI2A 3G7NA 4DWOA 1B2LA 1AF7A 1U98A 3UJNA 2RH8A 3B0VC 3CLVA 2G5CA 4PLPA 1GHTA 2GHQA 2XNJA 3RAGA 4M22A 3ROTA 4S1TA 1GZSA 3M8KA 3HCRA 2YIMA 3PRKE 2O3QA 2Y99A 4X5OA 1Y9DA 1C3VA 2C5FA 4KDEA 3RKRA 2W71A 2HT6A 2OXIA 1VLHA 1BMFD 1OWLA 1RCPA 3QU9A 4DLUA 4Z1OA 5ES4B 3JARA 2G63A 3CEMA 4TN1A 1QHIA 4GOKA 5ELMA 3WLQA 2BFMA 4A91A 2XCRB 1C4WA 3G8CA 2Q0XA 3FVVA 3SKXA 4LX0A 3UAWA 4LKOA 1BS2A 2YJ4A 3GA7A 5K3BA 2O8CB 2WKQA 2GBGA 4MVSA 2OO3A 1JZTA 3BHMA 3F73A 2XTNA 3BRQA 3H5NA 3OG9A 2C2OA 4YRDA 4DDKA 2IWRA 3TLJA 1RWMA 2PAFA 3LRXA 4D6PA 2JX0A 3I6BA 4BFLA 1FMTA 2ZRFA 4FOOA 5E9JA 2YDXA 3WAKA 5LPNA 3T15A 3TSAA 4J4HA 2FEAA 2HU2A 3IE1A 1JB9A 2XLCA 4OGWA 1PO7A 2HKVA 2FG5A 3V1KA 3WLKX 4B4UA 2QG6A 2PZKA 4PYLA 3B3JA 3U44A 4IKEA 3JRTA 4CEJB 3QUTA 2MHCA 3AF3A 3DKKA 4ND1A 1K6IA 4P3XA 3ZY5A 1E1NA 1QFZA 3HU1A 4JBWA 4YVFA 1KJ8A 4DXAA 2G67A 5J23A 4DEYA 2PANA 5T8KC 4KRXA 5COMA 2P62A 3HA2A 1GAQA 1ST2A 3USZA 1EMDA 1XRPA 1Y63A 1YDGA 2OKGA 3FNBA 2IYYA 3OZIA 1UPFA 2FRDA 4B17A 2ZTMA 3A4IA 1EUDB 2AJ8A 1FFDA 2IHZA 4XIFA 2CHGA 2F1KA 4LDJA 4HGYA 4NG4A 3MBOA 2I6QA 2JKZA 1IN6A 2LPMA 3ZUGA 4P9TA 3CBQA 3PRYA 5I7AA 2W6PA 1YB1A 3RRBA 3ZI7A 1PEDA 5JLIA 1ZP6A 2GBIA 1WXQA 2XB9A 3SXYA 1P0MA 3L4BA 1XNQB 2VP0A 5F9HA 1M7BA 1NQ5A 3UNXA 4LPSA 1DLJA 3MTAA 2J0WA 1S7ZA 5BXQC 5IANA 1E7WA 4O02B 2B5OA 4XEVA 3WADA 1ZONA 3QF4A 4J0FA 4BXOB 3OLXA 1M83A 4OYYA 1U31A 4CR8A 1OASA 2CLKB 4NK5A 2IXMA 3GDWA 1SA0B 2A4MA 2IUFA 2C5EA 1GCOA 3UMBA 2W0MA 4ESEA 3A9WA 5KTSA 4K26A 1UBRS 3E1SA 4UDOA 4N7RA 4CODB 1PQUA 2PTHA 1F2TA 1XA3A 3VYUB 4GUAA 4PJNA 4LSZA 4Q1BA 1KZ6A 1U90A 1N1MA 2NQ2C 3K16A 3KXLA 1MQSA 3ZY3A 2HXSA 3RIHA 3Q40A 1ULUA 4YROA 2GT1A 4KO8A 3VZDA 5EJ8A 4I1VA 4UREA 1BYIA 3ZG1A 1YA4A 3B82A 3PQCA 2RI6A 4A1FA 3GCXA 2XTZA 2H2HA 4AKSA 3U8PA 4BB6A 2FZ5A 1KR5A 2EWWA 4QQFA 3QW2A 2HA6A 2J8WA 2Z43A 1N4DA 5EHXA 4OD0A 1F6DA 4QDXA 5IFKA 2ZRCA 4KH0A 2IS4A 1Q0MA 4R69A 4LE2A 2ZTVA 5KMGA 4HSEA 1UXJA 1SBZA 2XZDA 2B99A 4D4MA 5GIPE 3ELBA 3SF8A 5LCXA 4GDMA 1B43A 1QDEA 2ASVA 2CLOB 3ZEAA 4EZEA 1YJXA 1RKCA 1HOTA 1EJ6A 1NR5A 3L0BA 1AZTA 2XH8A 4RQAA 4US0R 3SHOA 5DM70 4UDXX 3CVWA 4F6CA 2QMQA 2QRPA 3OLVA 3L2OB 4ZQIA 4DXDA 2JAWA 4Y2PA 1KE2A 2XCTB 2YV3A 4GPD1 1LKZA 1O97D 3RSGA 2SNIE 1C0LA 3HXOA 3H8JA 2G1JA 3OLQA 2V5UA 3FPFA 2OFPA 1F48A 1XFAA 5EP3A 2OZEA 4FEYA 1RLTA 3QBJA 4EMTA 1C3LA 3H6KA 5KWEA 3KYCA 4B84A 2H1IA 3HB0A 2WU1A 5E2IA 5KC9A 1FSGA 2C4KA 3BKWA 3U61B 3P0FA 3L0OA 1G5ZA 1OKKD 1R12A 4MVZA 4DA6A 4EW1A 2OWEA 4I4IA 2V7WA 1KKUA 3CAXA 1V2GA 3OQ1A 5ELLA 3E3AA 3WLEA 1RXCA 4OQLA 1RKEA 5B64A 5DW3A 2QT0A 3F8SA 5AMXA 3E4DA 2VPPA 1DC7A 3IP5A 4GI1A 4P22A 4EB6B 1LX6A 3JD1A 1ZM9A 2P2DA 1OLXB 4NYIQ 4BEVA 4TVSA 3PNQA 3G0HA 1VB5A 2ATIA 2HGSA 3ER9A 2A84A 3QVWA 4LJ8A 3X2QC 1J2YA 4B9EA 3I0NA 1Q21A 4YJGA 3WRWA 4PM4A 1W5AA 2X86A 2YNMD 1ZH6A 3MGKA 2BC9A 1F3OA 3EG9B 3GGGA 1GL7A 3N3BC 1OX4A 4LYGA 4WZ6A 4XRRA 1GPYA 1EX7A 1MDBA 3K9LA 4MROA 2NU9B 5EE0A 4PJMA 3CG4A 3UB4A 1EX1A 2AB0A 3CTPA 5FTWA 1JA9A 1JG6A 4AS3A 3KFXA 2BELA 1JFSA 4KLAA 4G84A 4NYMR 2GZRA 2YZSA 3L43A 4EL0A 4K9DA 5JLJA 2JGJA 3A04A 1C17M 1JAIA 4M49A 4QFCA 2GPJA 2V59A 2NXNA 3LUKA 2HJRA 3RFUA 2DE0X 3RUIA 4Q16A 2Y71A 4BB5A 4BFUA 3EGDB 3L8IA 1YVPA 2ZU0C 3OUUA 4ZVPA 5JG7A 4D3ZA 1G4US 5KYGA 2ZYRA 4FP9A 4GECA 1JBEA 4MV9A 4RDAA 2HSDA 2P7VA 3NCHA 2QTHA 5TMDA 1K08A 1Z4LA 4AZWA 4CM6A 4Z51A 3HUDA 5K0JA 3JQAB 1KNQA 2A9QA 1XCJA 3REOA 3VH2A 2ZI3A 4YMVA 3L3BA 3GORA 4FR2A 4MIKA 2I1VB 4LRUA 4WCFA 4D0SA 3LF2A 2RONA 2YWEA 4PZCA 5KYXA 4IFIA 4NEQA 3LVFO 3FAKA 3N5KA 3RIYA 5IG2A 4AJLA 3HCAA 3TIFA 4EAQA 1T8RA 1HE2A 2RK4A 3KQPA 4JE9A 4O2AA 4CQMB 1RKBA 4CTMA 4JLWA 3S6JA 3K7DA 4G9EA 2WAOA 4CU5A 2BSXA 4Y9TA 2ZQ5A 1YARO 2J0UA 2MSLA 5AC4A 3GLFA 1KJYA 3LEOA 2XDYA 2ZYWX 4X6UA 2CV0A 1DAPA 1NAIA 2AJBA 4XZ3A 2YQ5A 3ZGNA 2AEEA 3HU2A 1KDVA 2YN4A 4CPDA 1RW4A 3JPYA 3WBFA 4V39A 1HBJA 1L5WA 3H17A 2GCIA 1U7XA 4QUHA 5IW8A 1YONA 2MSEB 4KUGA 3FWYA 3ZE6A 4F1KA 3ANXA 5L6LB 1QZUA 4OAPA 4YGXB 2CWWA 2VKQA 5K3DA 4X66B 2XXAB 3IVRA 3PITA 3IOCA 4CIVA 3GODA 2QEQA 1FMCA 4PGGA 4RVCA 4ZVKA 1EQAA 5LLSA 4BFCA 1XRNA 1GQFA 4MI1A 1FP1D 4S12A 1E1DA 2WYVA 5EAIA 1CJSA 2ONYA 3AQCA 3K2EA 5J5AA 4EGFA 4DRYA 1OH7A 4R01A 4I1UA 2VDMB 4NCQA 4AMVA 1AUVA 3C16C 1FNDA 1IB0A 2NTVA 2ZYVX 4MVCA 5T5QA 3CW2A 3LG2A 3H1TA 5HG0A 3V8VA 3B5EA 2OAP1 1B8PA 2NV6A 3V6MA 4I36A 3CB4A 4D5EA 5JMTA 1JHAA 1QNLA 3AFHA 1E2PA 3A58B 1EUQA 4X63A 5AHKA 3KPHA 4QPNA 4DLSA 3BXFA 4W7IA 1X8KA 2X9GA 4R8MA 4JI4B 1WSWA 2WV7A 3GJ6A 3LQ4A 4Q7MB 4P4NA 5FWAA 3OCYA 1SVMA 1U8FO 2PX2A 1I2DA 5DSZA 1Q57A 3EC2A 1GEEA 4WZAA 1XZBA 4ZT2A 4EDHA 3EEOA 4HVTA 1GTVA 4MIEA 4DQLA 2A6PA 1NXXA 3FAJA 2JGIA 5HFJA 2ZSJA 3NEJA 1JTVA 5BWNA 1IHUA 4R31A 3MTDA 5IEJA 3QVTA 3V4RA 3VNUA 5J4LA 3L93A 5DYWA 1BMDA 1H9CA 4RK0A 3OOWA 3ONEA 2I7DA 3UWDA 2I22A 2VBIA 5AQ1A 3SFVA 3DZ8A 4HLUC 5H1YA 1GTRA 3OKCA 3TOSA 3WFIA 1XK7A 2EJUA 2FU5C 3O2SB 4M9RA 3AG1C 3DDNA 4EG6A 2HDNB 2IEBA 3KXDA 3VDNB 4TWAA 1AQYA 2DWQA 1YMUA 2VYVD 3SYLA 4D81A 1MFPA 2VXOA 3AHFA 4IS2A 4P81A 5CB8A 4Q1DA 1RJ9B 2OKCA 2VCAA 3LHSA 3P8ZA 4D92A 3JQ7A 1Z06A 1DMSA 4DEVA 4HGZA 4RJKA 4U6NA 1DAOA 4EY6A 1IZ8A 4YT5A 4KAAA 5HJ7A 4E7PA 4QUGA 4FN4A 4MVJM 3A31A 3B6ZA 3DV0A 3A9RA 4L9RA 4YDQA 2YZGA 4PBRA 2ZXUA 1X7WB 2VIIA 3EPKA 1OYVA 4ZO9A 4BBZA 4ITUA 4RXMA 1GO2A 5EXTA 4MCIA 2C54A 1QGED 1EX9A 2HQRA 1M9NA 3OWHA 4JSRA 3EFEA 3NOXA 3NWJA 4MX8A 4TXLA 5AKXA 3L0PA 4TTTS 3VVCA 3K4QA 5IVHA 5A6KA 1LVHA 2JCBA 3HO6A 3B6KA 1S01A 4NI5A 4RHTA 4NTAA 2F3RA 1GTJ1 4CCWA 5A4KA 4OJKA 2A7XA 1RWQA 4IWYA 2XV1A 4EZIA 4CG2A 1GPUA 2IPMA 1D1PA 3Q0EA 3QMMA 3VO9A 4K6HA 3OEYA 3FGPA 5CLGA 1NWHA 1D6MA 2VHJA 3P27A 4XD2A 5BNWA 5LQMA 4G5GA 1VOMA 3OFNA 1V0JA 1XQVA 1V5GA 5EGNA 3M6AA 2OA0A 5A6JA 3QSGA 5BW6B 2VS1A 3BCHA 4HFFB 3LXXA 1SR8A 4J94A 4JJKA 4JYZA 4V38A 4N41A 5ELXA 2NM0A 3EHDA 4JEBA 2W11A 4JBXA 2DUNA 4M1SA 3ZQKA 1KDPA 4U7GA 3SEFA 3MWDA 1AEPA 3FWZA 1HEYA 1Z8DA 5LBIA 3V80A 3MGAA 3EZLA 1P8JA 4K9QA 1ADJA 3O2QB 1I32A 5K1ZA 2NVBA 4QU5A 1I6WA 3CLSD 2DI3A 3EDOA 5BSFA 2JLXA 3RU2A 1YIDA 2XLBA 4KK4A 3DFMA 5LDDC 3DVSX 1CNFA 5GV8A 2JRCA 3N6XA 2OV2A 3ITDA 3PGLA 3QIVA 3NTLA 5BN3B 2VC9A 3PVCA 3CA8A 3GJRA 1Y81A 3OJ0A 3G9UA 1JIVA 1D4OA 1N3LA 1H5UA 3I28A 3JXEA 4W6ZA 5JJIA 5AICA 1BXKA 1L5MA 3GDFA 3INRA 3D02A 3OEHA 1I4ZA 1QFMA 1DAFA 2B36A 2FCRA 3D6NB 1KFCB 4LXUA 1J1ZA 1CUSA 1LJUA 1RAGA 2V7QD 1CVRA 1XD2B 3BD6A 4IH4A 3ZLVA 1KVTA 4YMGA 2R1TB 4ACBA 3NFYA 1N5OX 1AB5A 4KE8A 1RACA 1XEAA 3KTAA 3KWFA 1E0KA 1S7GA 4WUTA 3SMVA 1TAGA 4EVSA 3A2NA 4CTOA 3CKLA 4HJXA 4UOZA 3B0UX 2RAPA 3QLJA 4LNUA 3O10A 5H16A 1B0PA 1NIJA 3EA4A 5I4KA 3AP1A 1N3IA 13PKA 2RH9B 2QKYA 3O9VA 4WKPA 3GLFE 1DBRA 5FA8A 5BQOA 2WKRA 2QRZA 2FVXA 1ENZA 2OZKA 3AF0A 3BAFA 2GZ3A 2PMEA 5AKLA 2ZJOA 1DBSA 1VHJA 4W8PA 4YBRA 2IX3A 2W6NA 2XPCA 4BMDA 5K3OA 3RSSA 1PHPA 3B1KA 1Z3CA 3ESQA 3DTYA 2N46A 3I64A 3M5CA 3MRVA 3D5EA 4GLLA 2C8JA 2RHGB 3O3OB 4HFJA 4HL6A 4MO9A 4OV6B 3R7WB 3ZDFA 5C37A 3FHCB 3IAHA 2CLDX 1X1EA 2XIJA 1SXJC 5JZMA 2NTEA 1PR1A 1TWHA 3V4ZA 3R7CA 1FX0A 3CNOA 2H2IA 3HU3A 2OJED 1Y33E 2D13A 1WKBA 5J2TF 1DC3A 4EJFA 3BTSA 4D9JA 3L04A 1MORA 2AKAB 3B1VA 4KN5A 2OV4A 4BCCA 1Q0FA 1EYZA 3DT9A 4CS9C 1XEWY 3IPCA 3LPLA 2R9RB 4WLOA 3UAOA 1U8ZA 5JMPA 3THYA 3VYVA 2RKOA 3GZTB 4OVKA 4E14A 1N77A 3P2OA 4LY6A 2ODWA 5J2TB 1MT0A 3HL0A 4WNYA 2EBFX 3RS9A 2KC3A 2C2XA 3X1MA 4C6TB 2LVBA 3V4FA 1YQUA 5JPIA 1XMJA 4KLRA 3QKSA 3E22A 2MMCA 2I3AA 3BHIA 4B48A 3V1MA 2IYRA 2CCYA 1G0NA 5IMBA 4DQKA 2CWDA 1I8TA 3B70A 3I9KA 4HRYA 1UT5A 3DZBA 5KTYA 4Q3AA 2Q21A 1D0YA 1N8TA 4H27A 3KR9A 1N1GA 2XJ9A 1AKVA 2DF8A 1GYQA 5E9WA 5T4EA 4CM9D 4EK9A 4R2IA 1G41A 1KHHA 3NIGB 4JBGA 3AEKA 1RM3A 1JDPA 2O2GA 4Q4LA 1RCTE 1P7ZA 4G78A 2DCMA 3AU9A 1R9MA 4HAZA 3F6PA 1XP8A 2N1MA 3JSZA 4M7OA 3RSFA 4L4UA 3FN4A 3DO6A 2JEYA 1UMCA 1G7RA 2IXGA 2JVKA 4Y6LA 4Y9DA 5AI4A 4U7JA 5KKAA 3ZYZA 4RVFA 4P5EA 4HUTA 4MMZB 1XUOA 5CP8A 3ZWPA 3INTA 3AQBA 2ID8A 4YEDA 3W1VA 3ZHQA 2AUMA 4WOJA 3B6IA 1QYVA 3KHUA 3KKPA 5GGXA 3Q5GA 5ICCA 5HF8A 2NUTB 4QOSA 4XLPF 5T4FA 3VU8A 3I4LA 1M72A 1QHNA 2CVQA 1JV2B 2Y1LA 3Q3CA 4KMMA 5EZQA 2ZIEA 4GQHA 4ES6A 1DOVA 1XZQA 3CKKA 5E4FA 2GF9A 2VRWA 2I4IA 1ZCFA 2Q6LA 2TMKA 3ZHVA 1BVYF 4EJSB 4O4IF 2ZIZA 2W22A 2KLHA 4JOCA 4RTOA 3D8BA 1QGUA 2IOFK 1N5RA 1RXIA 3CE6A 4WL0A 1U8EA 4LSWA 3FVTA 4PSAA 4B3GA 1KDOA 1K06A 1MBZA 3LLCA 5JO9A 2AE2A 2YV1A 4F5DA 2VHXA 3UJ6A 2OEVA 1H6AA 1R2QA 2O8BA 4Y6SA 4M1MA 5H68A 3DJNB 2MT9A 4D02A 4BE4A 1H9AA 3LUBA 4E07A 5AVOA 3VUFA 1II8B 1AA6A 2BTEA 4RJ2A 5CG1A 2QLJA 3AETA 2ZJ2A 1XU9A 2P5SA 4OIMA 2VRBA 1J0DA 1P8AA 3D4NA 3HNRA 1T24A 3WIBA 1W73A 3DV2A 4YFYA 2NYVA 1KWKA 2F22A 1KZGB 2C7VA 3ANSA 2HREA 1WIWA 4A0FA 2VJAA 3OZDA 4QAJA 4KP7A 5A6VA 4LAFA 4TTPA 4YRAA 3O4GA 5KYNA 1U8UA 1H9GA 5DWQA 3W5VA 4J32B 4JOQA 1AJEA 1JLRA 1A98A 2QR5A 1YACA 4HX9A 3QXHA 4F60A 3NKEA 2PY6A 3P9YA 3DZKA 4RD9A 1ENPA 2TSYB 2I7CA 3NHMA 2W2OA 1K3FA 4J0HA 2QDKA 4IXMA 4DUGD 4ZLCA 4WT7A 3S28A 2YOFA 3T06B 1NVKA 3O7WA 2PD3A 5JH7A 3T7SA 1O9HA 1E6MA 5FUXA 3EC1A 2QLAA 5JWOA 3T1YB 2VZ8A 4IMPA 1A76A 4I8XA 4AP6A 3MLBA 1E3DA 2VP4A 4JP3A 4QYIA 3L6RA 4OI0A 1XHEA 2JH8A 2MSNA 1QIGA 3QEMB 2W0SA 3DT8A 4O4HB 3WODF 3DFKA 3G0CA 4Z3OA 2G1PA 3VR2D 4PHHA 3EXEA 3GVCA 3IE2A 4M9XA 3T4RA 1DRUA 4ZD6A 1UMBB 4P38A 4GAEA 2QN6A 3H04A 1NSTA 1PDVA 1BSVA 1ODLA 1V9SA 2WI8A 3CVOA 1JHPA 5E7MA 1VG8A 1KJ9A 1KH3A 1NFNA 4D8XA 4TS9A 3OCJA 5KTNA 2YHBA 4UTZA 1OC4A 1I3KA 1OGIA 2V4MA 1SBHA 1XCLA 2EBHX 1QMGA 4W8KA 4FFPA 4REQA 3V46A 3U3XA 1J8QA 1M1NA 3B2QA 1R74A 2FSFA 3JSEO 3KYDB 4ZALA 4AO8A 3OQNA 3GLIB 1PFWA 1IXYA 4L8LA 4FWBA 3GD7A 1L8AA 2ZYSA 3COVA 5IKPA 1UMKA 1A4IA 2PLAA 5ECYA 2RGYA 1QO7A 3IEXA 3HP1A 1NKVA 4D2IA 4A4AA 4Z0HO 2H7YA 2SKDA 3U56A 5FADA 4DNXA 1ZR4A 3R09A 4IHJA 1W4BA 2GERA 2DGJA 4AICA 1G2PA 1TTHA 4BTVA 1AKTA 2PBFA 4GX1A 5ALGA 5TGZA 3LHDA 1EVZA 2FPPA 2CBXA 7YASA 2RAVA 4M8KA 3UXMA 5MDHA 1UCFA 3DQQA 4JDPA 4JC0A 2BHRA 1KZYC 3O73A 3RYCB 2J7KA 4NBRA 5KWIA 4HDNB 4FESA 4CG3A 4CMEA 4BGIA 4CCYB 3TW4A 4IEEA 3I9OA 3WYAA 4OUDA 4C0BA 3UGOA 4IQFA 3SIPA 3BZUA 5EMKA 2IYPA 4N7MA 5A4DA 4PC2A 5DSTA 3V3TA 4W8OA 2A1DD 3TULA 1RFGE 2PKRA 3CE9A 3R5XA 4U2GA 4XIIA 4L0QA 3SJAA 1WW8A 1HW1A 1ONPA 5JROA 1JFRA 3PXGA 1T3SA 5ABPA 3ATPA 2I9KA 3JYYA 5J5CA 1Z45A 5CK4A 5JSLA 2X4GA 2GAQA 2EFHB 3RT7A 3H97A 3DEHA 1OFIA 2WKSA 3JQPA 3PGKA 5T6BA 3T6BA 5B3IA 1RZUA 4FGWA 3NIDB 2XT6A 3AI2A 3M4JA 1MVNA 1TL7C 5FLXA 3O1IC 2GYUA 1KU0A 2V4ZA 2C7PA 2FTKE 4I1MA 1PSZA 5JCZA 3TZKA 4QDOA 3PUYA 5BNIA 2VDKB 4AT1A 1RXEA 3SK0A 4IIGA 6AT1A 3HSSA 3S8YA 1UG7A 3I1JA 1P4GA 3INYA 4IH1A 1P0QA 3OT1A 1BE8A 1DIRA 2P9TA 2XGSA 2IYAA 3BN3A 3L0CA 3PTZA 4YL3A 3FROA 3S1AB 1T3GA 3AEYA 4AG5A 1ETHA 3QQPA 3AVQA 2O23A 4NARA 1DG1G 3V8QA 2QIOA 4OIPF 1E8NA 1FJ2A 3H6GA 3QVVA 3IGFA 1LD3A 3KK0A 5TMBA 3UJ8A 4PYJA 4HUQB 3QFHA 1E9BA 1RTKA 1P1JA 1T0BA 1TADA 1Y0BA 2QPTA 4HADA 2GRJA 4TUYF 4BO4A 3BXOA 4ZCMA 1SJ9A 2VSQA 1QTIA 1QIJA 4G81A 3UHFA 2JHPA 5ALWA 3SHFA 4S04A 1R0ZA 1V3UA 4TMFA 4ZREA 1WXHA 1HA3A 1QC5B 1XMIA 2OVBA 3BD9A 3DOEA 2ERCA 4B7AA 1DWPA 1TF5A 1ZMRA 4K6GA 5DXAA 2NMVA 4P9FA 1KU2A 4P36A 2AOVA 3EVBA 3DZDA 4M46A 3K30A 4FB4A 2R87A 1NXQA 2L6FA 2HFIA 3K1IA 1KH1A 2XODA 3D7SA 3IO3A 1FSSA 2P69A 4HVAA 4I1IA 1M2KA 3RDPA 4PQYA 3Q8MA 4XWTA 2PUWA 4ZXFA 4BUJA 3JWGA 3WHKA 3H11B 1PT8A 2Q1SA 3L06A 1ZYRF 1SKYB 2IYZA 3IMEA 4PQEA 3TM5A 3VJMA 2M6KA 4ALMA 4AM8A 4DBZA 4GPTA 4F5YA 2B9EA 1ILEA 5AWFC 2F48A 1R8SA 1L1FA 3D81A 2O6LA 3C62A 1Y5NA 3DWFA 3QPVA 3IR5A 4UPVA 3AY6A 3MWEA 3ZE8A 2P11A 2PH3A 4J7CA 2W2LD 4TV9F 2WHYA 4WFKA 3I61A 2DBRA 3WRXA 4H3HB 3GCGA 2QWXA 3ZWVA 4H1WA 5EI5A 1LNSA 3X44A 4H0CA 1KAHA 5GPBA 3HO1A 5ED0A 1IM8A 2NXJA 3PYMA 3AL2A 4QHTA 5LUAA 2KGOA 4BGUA 4CKEA 2REQA 1PR0A 3FSEA 3IAS6 1IOVA 4R9RA 3G0OA 1NU8A 2ZVDA 3R5TA 3J80A 1QH8B 2WZFA 3PJDA 3WA7A 3I72A 3PQ4A 3AT1A 5FPSA 3R6WA 1BDMA 1XSEA 3DS8A 2ISCA 2NU6A 1W34A 1HK7A 1ISPA 1IE3A 2CJFA 1JPUA 2P3LA 3O1LA 4N4AA 4NBTA 3WNQA 1AXEA 1PZXA 4ZO8A 4YUVA 3QLTA 1LRKA 1GPH1 4MUIA 3EEIA 2FYTA 1Q74A 1EEHA 1JECA 2XYVA 4IEIA 4OJNA 4AY4A 4BX2A 3IV6A 1NQWA 4MOWA 4PFQA 2W45A 2IEZA 3L8MA 3PZBA 5DI3B 3DDCA 1OUMA 3KALA 1KMCA 3O92A 3DGEC 3OQJA 3KQKA 2XAAA 1HXHA 1BEEA 2IDJA 1KJNA 5ER6A 3DVQX 4LOAA 1SXJB 5BN5A 1OLSA 2VK2A 1N8KA 1JT9A 1RMVA 2IHVA 4UUAA 5KVVA 3DB2A 3A3YA 2EU8A 4UMFA 3VAZA 1HFJA 1PR2A 3Q88A 4IIVA 1T26A 3VYTB 4GP6A 5HK9A 2VATA 4AJPA 1BJKA 3SR4A 4HAOA 1OR8A 1HORA 2IITA 2VEOA 3LV8A 4ND7A 4DADA 2AK2A 1UBSB 1YRLA 3RVNA 3PLAE 3UW3A 3DOOA 2UV8A 4FFOA 3JCUQ 1ZINA 4Q5IA 2ZDQA 4Q47A 2XZLA 2XMBA 3M1AA 1CQJB 1TK2A 2GCNA 3IULA 4XPZA 1Z5WA 3F9IA 3X1YA 5I7RA 3D7NA 5JANA 1GLNA 2IYQA 3UMKA 1YL6A 2GPYA 2HMAA 1QFYA 3H2HA 4OB7A 5DHRA 3TXXA 4EFNA 5KNDD 2ARKA 1E3QA 2DPHA 4NESA 1B3BA 1L7EA 3F1KA 4HDKB 1GSIA 2ZQYA 1H93A 1HMOA 1DPGA 4G5XA 4QJ5A 5AUQA 1F12A 2YJ6A 4MNTA 3RAJA 4YUWA 4G63A 2ZTLA 4PLFA 5AK4A 1YCGA 4RKFA 5EINA 4HLCA 1F4VA 4J16C 1YDIA 2R5FA 3T6GB 3JQ8B 4O29A 4RK4A 4RY9A 4E32A 1YZVA 1U7ZA 3H8WA 4P08A 4Z4IA 3OIYA 3ZCSA 1ZZEA 3G68A 3JASA 2QYTA 3HFJA 4RIEA 3T3IA 5KDLA 4BFWA 2BY4A 4AURA 1ZIOA 1CS0B 2HJWA 5C8YA 2QGNA 2Q62A 3MS7A 1TWCA 4MB6A 4PBSA 3UCEA 3L7NA 2XIQA 3ZGLA 4JEUA 5B55A 1Z23A 2YWHA 5F3DA 5D1NA 1G20E 1FRFS 2WICA 4HGNA 3QFFA 4TRJA 2XMDA 5IF3A 2DUWA 2HH9A 2IYOA 1BHJA 1GGFA 1SXJE 4I3MA 3AMVA 2Z1DA 2X5KO 3LK6A 3ORRA 2B0HA 1D8AA 4X00A 4B45A 3I58A 2ZIWB 3BAZA 3C3CA 3DMTA 3L07A 4PGHA 4DWWA 4X1YB 3H1GA 2Z5VA 1DGQA 4LMBA 2Z3WA 4NX2A 2KBEA 3HDYA 1U2GA 3KL2A 1M75A 1IEXA 1FTGA 2CUKA 3C41J 4ZHQA 1V3QE 1YJBA 5JS7A 4KITB 4M0UA 3EFBA 3V7UA 4YHHB 1WB4A 1OXTA 1TA9A 4XEFA 2Q29A 5IDWA 4KMSA 3PC2A 1B1AA 1NLZA 2R6JA 2GN6A 1I3LA 2RHDA 2ZEJA 3KYJB 2IDMA 1V54C 2F62A 2ODNA 2P65A 3PENA 3Q5DA 5F78A 3RVJA 4D7AA 421PA 3CSUA 4DBVO 1XZAA 2OCDA 4M8LA 4M55A 1T2DA 3KKLA 4PTLA 5I5GA 1KERA 3KOYA 3C1TA 3RBXA 3O0DA 2JGEA 2BBTA 1KJQA 1PEKE 3PDCA 1I7LA 4PYMA 1J22A 1J1IA 1L0BA 1QRDA 1A8IA 4CEIA 1KP2A 4PO8A 1LVUA 5LU8A 4X0RA 2GUGA 1G63A 3HV2A 3ND9A 5KNDH 2AQ8A 4BB0A 1D1SA 3OFJA 2VYCA 4PGFA 4URFA 2DEUA 1NG9A 3KEMA 3ITEA 3R3XA 5G3ZA 3QPAA 3SBEA 5F28E 5J40A 3KR0A 2B5VA 1U3TA 1ZEJA 3PC6A 1XVVA 3TB4A 4IDDA 2HB6A 3T95A 4BG0A 5K0TA 2J3QA 3L0YA 2GN2A 4G1EB 4XEHA 2BGIA 1QHHA 3M1YA 3FOOA 5IXSA 3ZBQA 2VSNA 1NFQA 3U37A 5EIFA 5M34A 3OOEA 3QKTA 4NENA 4XVCA 3N2IA 1NTOA 3ZDLA 2XQJA 3RK1A 2V9CA 2B7LA 3PXUA 1ESDA 2XCQA 1UXOA 2XYHA 2G7MC 4NBLA 4AS2A 1V4BA 1WL8A 1CUAA 1B14A 2PX4A 4LG1A 1JR3A 1V4NA 1Q7EA 4KQWA 4K9KA 2QJOA 3FHTA 2R7WA 3T1HB 1M1NB 3FIUA 3GLIA 3PSHA 2DAPA 2BHLA 1KA9H 4MS3A 4CIHA 2HOQA 4I6GA 3F3MA 4GQAA 3UK2A 3WGOA 3U4HA 4OA5A 3NGXA 3ZJTA 5JFGA 5KOHA 3GDHA 2LXNA 3ZZUA 1IW7F 4CG0A 2H2AA 1JLHA 2OZLA 3ABQB 3AX6A 3WG7C 3HVJA 3NIFB 2OFXA 4RO0A 4U5QA 4MICA 3CVXA 2FSGA 1OAOA 2JASA 3MJCA 3ND8A 4M98A 2P2ZA 2ZIXB 5JAIA 3PWZA 2I4LA 3LY5A 1Z68A 1HT2E 1PQ4A 2OCAA 4UHKA 4V2UA 4WOBA 5BR8B 1ATZA 2CL6X 3ZDBA 3FKSD 1JZSA 1VOTA 2G08A 3VV3A 1NN3A 2EERA 4R9VA 3HWSA 3MJFA 3SLRA 1ISIA 1YE8A 3IUJA 1WDMA 2XMZA 2FPKA 5DGXA 3QKWA 3TQIA 4CIWA 1E5XA 5E7IA 4I5EA 1GL3A 4F4DA 1EINA 4G25A 1PN3A 3FYUA 4RD0A 1E2DA 1E7RA 1OW6A 4GRAA 4CMJA 3U3ZA 3VPSA 5A6BD 1SVNA 4KX5A 2MOKA 3BYZA 5I51A 4INPA 4H1UA 3G7UA 4TMVA 4BQEA 1OA1A 2EC5A 1H42A 4DIKA 1EUCB 2W90A 3DAYA 4Q34A 4ZAFA 4ALIA 3ICQB 4FLEA 4CN9A 4EUKA 2B78A 4U7DA 4H16A 3WRXC 1P31A 1ORSC 2R65A 4O3MA 2FW8A 3DMHA 3O4FA 3IAM1 4QOFA 5ALEA 4KXXA 3NDRA 2WV9A 3NM5A 4JIGA 4U5DE 5BT8A 2PFSA 4W9MC 3HCCA 2VAMA 1XHFA 4YT4A 1EP1B 4OGKA 5J4HA 1S3FA 1MNEA 5ERYA 2AMJA 4YFVA 4L72A 2R8BA 1AKMA 3PVSA 4IYJA 3ER8A 2J32A 4C7KA 4CV0A 4YPVA 3EGWA 2XCLA 2ECQA 3V9PA 2I2WA 3FTEA 2BP7A 2GZSA 3UC5A 2O2IA 4F06A 4UFPA 3RPEA 4I44A 1CJTC 3C7AA 1S2GA 2ID4A 3WIOA 4Y7CA 4LK2A 2BGLA 3ODGA 2ERYA 1Z63A 4ECAA 2YQ4A 2ZVQX 2WWHA 3X2EA 5JSUA 3JYNA 1P2VA 4ZPJA 3Q7TA 2CXHA 4L7QA 1Q11A 4IFTA 4CKXA 1U1EA 4WSOA 1CYEA 4JDUA 5CFZA 1O6ZA 5KU1A 3EASA 1PDOA 3T1OA 3LLKA 3W7AA 2WB7A 2ASRA 1SCJA 4JP5A 2WIDA 3IPAA 1PJTA 2ZIFA 1WDKA 5JBNA 4IF6A 1E2EA 2JCVA 1TQ8A 1QVWA 1ZI8A 3CEPB 4MCAA 4C29A 1U11A 2QVYX 4E22A 1C4OA 5KOJA 1IMOA 3A9UA 4Q1AA 4IDBA 3GUVA 2VL7A 1LDMA 5CDFA 4L6RA 4C7BA 5BR1A 4R81A 3U4MA 1QDLB 1IN4A 2HADA 2YV4A 1N32B 3ZXYA 4B3IA 5HSGA 2EZ4A 5IJAA 3Q98A 2J5RA 3SXMA 3JU3A 2ERXA 3GJ8A 1EFKA 2WEKA 4FKMA 4QL3A 2CDAA 1IULA 5JZVA 1OROA 1I0LA 1MDFA 4IJ5A 4RH3A 3G2LA 1ST6A 2I1QA 5LN1A 3CHYA 1W93A 1ZD2P 1G59A 3W3AD 1Q22A 4DM3A 2DU8A 3IQIX 2OC4A 1FJXA 3ZD8A 1V16A 2GAJA 2QLBA 4HWSA 1ZAYA 1A82A 3QMPA 3PDMP 3JWPA 4K2AA 2PU5A 4WCVA 1GZVA 4FDTA 1LBTA 2A30A 1JG4A 3IT3A 3MJTA 4C3EA 1YZUA 2NVWA 3QUAA 4X85A 5M7EA 2A1UA 3RHSA 1JHVA 2DMRA 2WTXA 4OQYA 1DIGA 1WWPA 5MN5A 3PCVA 3N0XA 3MUOA 5DYGA 3RYFA 4ZRNA 4TV9B 4KHZA 1K3UB 1HE1C 1VL2A 1Z2OX 3QU4A 1T13A 3DO5A 4YDSA 4AYWA 2LQGA 1GUZA 5J2UB 1PNVA 4X1KB 3T7AA 1Y6GA 3V8NA 1IMJA 1PNQA 3KD3A 3EGDA 3LNMB 9LDBA 3WGQA 1NPDA 3UXYA 1V1RA 2JIMA 3MJSA 1SKMA 4LJYA 1O97C 4YRMA 4NDZA 3U3DA 3FOPA 1N8NA 3P52A 4UAVA 4FXPA 2YIDA 3F5QA 1YMQA 1ZYUA 2AXQA 1XE3A 4WV3A 3VU1A 3ZW8A 2UUOA 3T99A 3TR6A 3HB4X 3JSAA 2BMAA 4WN9B 2G76A 1AUEA 3IB6A 4L57A 4PWZA 2V0CA 3ENNA 4R1MA 5DYTA 3T41A 4PC3A 4FFBB 1QH9A 4OHOA 3VHLB 5A5EA 4ZEVA 2PA3A 1E4OA 4HDRB 2WVHA 1S02A 2XZPA 4LXXA 3EVNA 4U3JA 3AUAA 4JR1A 3VR3D 4DR6B 5CCDA 1JMKC 4C6RA 1JH8A 1H66A 2ZBRA 3HI4A 4OM8A 4NJMB 1D7OA 3SLKA 1V7CA 2XS8A 2PNOA 4C88A 1JXOA 1QS0A 1S9HA 1SY7A 3IDSA 3IXQA 1CY8A 1YQDA 3LQ1A 2BN4A 4QUEA 5CM9C 4E1VA 1JR3E 1DP4A 1NVGA 2H29A 3P19A 3VTKA 1Y80A 3TDMA 5H02A 2YL3A 1WKCA 3AIKA 2H5EA 2IPAB 3K2IA 1SGWA 5JNSA 4FUTA 5A7HA 1ZVJA 3HTKC 1FYEA 2QLMA 2X9LA 1AOXA 4YP6A 1I9CA 3SJCA 2B35A 1ZQ9A 2PO7A 1I1QB 4QSMA 1TO1E 3EMVA 4BVAA 2JFWA 3GPCA 1XBTA 3N5CA 3B9QA 3DB1A 4JT8A 1KR2A 1DAIA 3I37X 2R00C 3E27A 2DFVA 5FLKA 2EL9A 4RK5A 5FUQA 3TI9A 4JB2A 4MVYA 3RTEA 2BSQA 2CMHA 4YK7A 2JIQA 1F0YA 1NVWQ 3R0ZA 3DL0A 4FFSA 2RGNC 2ZI9A 3MCUA 4ZCPA 4U6SA 4OMCA 1AQLA 4FN5A 4A73A 2DH6A 5FR2A 1P77A 1XWIA 4URUR 1KEKA 4R8SA 2DFLA 4RESA 2PUGA 1YZCA 2O50A 2R66A 2DC1A 4J07A 2Z15A 1O2DA 5FQOA 4C9BA 1SKUA 5EJ6A 4PC7A 1U0RA 3C4QA 2PX8A 3JRWA 1G5HA 1D3AA 1UMDA 3G0BA 4GP9A 3TFOA 3TGLA 1I2ZA 5CI8A 2IW3A 3IBSA 3LYHA 4I7EA 4P4LA 1XHLA 2FW0A 3B38A 5KQGA 1R64A 1ZVKA 5GOZA 3UM9A 4KIJA 3HKEB 4B6JA 1N78A 3V8BA 2WE7A 2Q5EA 5A0FA 4BMCA 2I2XB 2AXNA 2A9FA 3PJFA 3QMWA 3KS9A 3UWMA 4KE6A 2XUHA 4ZZIA 2PG3A 3QBTA 5HKLA 5SZHB 4EYSA 4MRAA 4F3NA 1E0SA 3CV3A 1UT8A 1PJZA 2EW1A 2QHXA 2R0QC 1UZUA 2HI0A 2ZI6A 3WK5A 3ADKA 4AY2A 3HB9A 1BFKA 4CIXA 4EQ6A 4J0GA 4U2FA 4B33A 1CS4C 2BL4A 4NDNE 2XITA 4G1VA 2HMZA 4JJEA 4PX9A 3Q7SA 4PRYA 5IVDA 5HP4A 1MO4A 1PVVA 4S1NA 3VV2A 1C2TA 4DSNA 4J3FA 3WAQA 1J7KA 2I8AA 3K6RA 4XJSA 1GZ4A 2JI9A 3IDFA 1ZUNA 1D2HA 2HUPA 4FT4A 3R4VA 1G42A 4JWKA 4ZVTA 3JPWA 3JQCA 2EKDA 2IYEA 2KW3C 5COAA 3F1LA 2P0YA 3E3MA 3QW4B 1Y8ZA 3ZBPA 3KX2A 4JK3A 4H59A 3GAZA 4FYYA 3TJMA 1N36B 4OLBA 1ZITA 4KSBA 2HHHB 3FFXA 2BJVA 3TW8B 4Z3DA 1MO2A 1P7VA 4JLBA 3ZQYA 1HGXA 3CZ5A 1CUBA 1N6KA 1BG6A 1YZLA 4Q1CA 4LFAB 5E1MA 3RBZA 3BF8A 3DWGA 1GA6A 1XK6A 4S2EA 1J09A 2PRSA 3NRBA 5ALZA 4J0JA 2B1QA 4EBBA 1OXBA 2BUBA 3HM2A 4HT3B 5JYEA 2WAAA 5DLQC 5LP6B 4GD3Q 4G1CA 4PZAA 5GZ3A 1KOJA 2F55A 2HZ7A 3R5JA 4INZA 4M0KA 2KQ9A 1S1CA 3EG5A 3ROZA 3TI7A 3DBHB 1SOVA 1XDZA 3EEYA 3NBQA 2Z58A 3UENA 3E84A 2TECE 3ZWCA 2C1XA 2H54A 4OG2A 5JY1A 4DV6B 5AJHA 5DJ5A 1AS3A 1H0RA 1U1FA 5D3ZA 5REQA 1K86A 2EJVA 3T7EA 4CLRA 1HFWA 4H4CA 1QIKA 3JTEA 3DMTC 4IH9A 4NCXA 1XNHA 3GM2A 4K3UA 4L22A 4OBWA 4OYHA 4QYMA 2YJNA 3EA5A 4XUEA 2UAGA 5HCUA 4LF7B 4ER0A 1RRGA 3DNFA 5CXUA 4C0SA 3WWDA 1T8TA 2GK3A 1V9LA 2YZ7A 3UBTA 5COGA 2EGHA 1TK9A 3KDAA 4K9NA 5C32A 5LXTF 3FXAA 3LOUA 3PICA 1Q83A 1VLLA 3FYHA 4HS9A 4JLAA 4KSYA 5J9FA 4E4YA 3OFSA 5CI9A 2O5VA 3EXIA 1Y42X 4RA6B 2B4QA 5ALJA 3QLUA 3U5SA 2IHUA 5CLIA 1X77A 3AOEA 4H35A 1NULA 1L3BA 4OIQF 1BMTA 2AE1A 2X1MA 3CX3A 3H42B 4HSGA 4G4SP 4B7ZA 4DARA 1T36A 1W52X 3E2PA 4GGMX 2V5AA 1W8DA 4EABA 4C5BA 3AESB 2V5VA 3GZ4A 4WLNA 4C14A 4F4HA 3NQ41 5L3QA 1P2FA 1BFDA 2OKUA 1WVGA 1NHWA 2H3EA 2IHTA 2VSXA 2XGGA 2GHIA 3LWDA 4J03A 3ZU6A 3DUWA 5IJ9A 2VQ6A 1QKKA 4B6EA 3G50A 4F6RB 5JS5A 2GF0A 4G1BA 3ZGZA 3DLTA 3LCUA 4EUKB 1KEPA 4KKXB 2H1FA 3TX6A 1FE8A 3U81A 1XZCA 2B4TO 4P58A 4EO4A 3KZCA 4E1BA 1HYHA 4V0KA 1N5IA 5DHQA 3HK2A 1QIHA 1LKXA 4H7FA 5AM5A 1OMOA 4J0DA 3RWOA 3W5DA 4CM3A 3GF4A 1I6LA 1KI6B 2UYYA 4E0IA 3S7TA 1Q1NA 1H8HD 3ZNPA 4WNCA 4PXAA 4KVGA 1Z6TA 1W49A 1JQEA 2V9PA 3GHYA 3LUCA 3Q5EA 5JAHA 1RM5A 4O4LB 4FILA 4BP9A 4DRHB 1KYXA 2L69A 3MCVA 3N7UA 3ZWQA 2Y69C 2GJ8A 1LZLA 1YR7A 2Y05A 1Y6RA 3TFQA 4BFXA 2QZSA 1O96B 4HNRA 3N2GA 5C34B 2HV9A 4IR7A 4EY5A 3FD8A 1PL7A 3RVMA 4AF7A 1E69A 2WD7B 3VH4A 3WGMA 3KHTA 4XVUA 1XCPA 3CH5A 2VDUE 3EFHA 1E9SA 1Z7GA 2J09A 1JU4A 3D4OA 4ZOLB 4KQMA 2FX3A 5C1BA 1E9RA 2ODAA 4KQFA 3OU6A 3VVMA 2NO1A 3GUCA 1JFFA 3OBIA 2P2LA 3K1ZA 3M15A 1AH2A 4RJJA 1Y4ZA 1VTKA 5EKTA 3EQ9A 4V0LA 3T94A 1QE5A 4YP5A 2I0FA 4B3XA 3NI2A 3RFTA 1ZH0A 3M4ZA 2XE6A 3RGWS 4TKUA 1JAXA 1P2UA 1QV6A 2ZSKA 3G8AA 4FI3C 1L7OA 3T3PB 1XPOA 1BGVA 4I5IA 2ZBDA 4IM7A 1YL5A 3QLEA 1R4AA 2L18A 4N47A 1GU0A 5AVTA 4QDLA 1GM5A 1TOAA 1W19A 2Q00A 2GLTA 3O8RA 1QQ3A 2NZXA 4HBGA 3GFPA 5JTUA 3BKXA 3THRA 1U2QA 4I9HA 2AU5A 1Z74A 3K4PA 3P0IA 2YL7A 1PJ4A 4R4JA 4E31A 5DNWA 4LJAA 3ZW7A 4JLKA 3C6MA 5LC1A 3HACA 4BKRA 4DV5B 3HN6A 5F4BA 4X65B 1Q3KA 4UE2A 3SXUA 1UR5A 3G9ZA 4KR7A 3U2MA 3IAEA 1C7IA 3BWXA 1O54A 2WJAA 3UMMA 3WYBA 3T9CA 3WP1B 4DCJA 1WWKA 4MITA 4DIMA 2NO7A 1D9ZA 1ZKMA 2WB2A 3CC8A 4ZEWA 1KDYA 4DRZA 3THYB 3E35A 4U00A 4CF6A 5FTJA 2C9ZA 4PICA 2VR1A 5DCWA 3GNLA 2QXUA 5LQAA 4CQNA 5E3IA 2WYHA 1QS0B 3CNHA 4TSRA 4TX1A 5CD9A 3MELA 4J6FA 4HDOB 1DDIA 1FUYB 2CB9A 1GNQA 4J9UE 1KJIA 1WPRA 2A33A 2PA0A 1IWPB 1QH1B 3MZ0A 2DXIA 4C0KA 4KWTA 1JMYA 3EIEA 4OU5A 2G9ZA 1EHCA 3CIOA 3T9OA 3WIDA 1P9NA 5FP0A 3RARA 3TKLA 4M76B 4QFDA 1AKUA 1MX1A 3RJ9A 1IPEA 3CG0A 3U9LA 1CGME 1U1GA 3BXHA 1W581 5JHGB 1D8TA 4MCJA 2EG5A 5AK5A 1E58A 1NLMA 2Y3IA 2FWBA 3EC7A 1EKXA 3E4CA 1NA5A 1E3EA 4JI2B 3K0AB 3ROMA 1CHNA 4GOLD 4TRMA 1M2JA 1EXDA 2PBEA 4GRDA 4FPXA 4KODA 3KMIA 1T1EA 2EJBA 2QJRA 4DABA 8LDHA 4YJ2A 3RIPA 1H1TA 5DHSA 4QEKA 1IN5A 1JQLB 3AEUA 5BWBA 1M6VA 3AR6A 1OT5A 4YAUA 3F46A 5CHYA 4MYCA 3W9BA 2WOJA 3ELDA 3K9GA 1Q5PA 2BHSA 4O5AA 5KYWA 5AYVA 1K4YA 3USES 4OK6A 4Q4CA 1DADA 4GU5A 1XT6A 5B1EA 3QBEA 2NADA 3I5PA 3Q11A 3LFHA 5B4TA 2AIRA 4G5QA 1YAHA 4D9BA 2IEDA 5FI3A 5FTLA 4GL4A 1M5UA 4KFRA 3NHKA 3S81A 2L17A 3H2YA 1O94A 3MQ4A 2YJGA 3ND7A 3QBVA 4KQEA 3EQ2A 4TM7A 4UEOA 1V43A 1B6RA 4MQLA 4GPAA 1D4FA 3QITA 2UZAA 4ZAZA 4OL0A 1M6YA 3CWQA 1E2IA 1V4AA 3CFYA 4TOIA 3AGPA 3GCZA 2A3NA 1HOXA 3F5FA 3O3NB 3MYFA 4WK2B 2YW2A 3I3OA 2ONCA 3PHCA 5DGIA 2Y3DA 1XCBA 2WHQA 3HC7A 4MWEA 3BXPA 1GPAA 2ZRPA 1SPBS 2N75A 3JZFA 1RWXA 5AJZA 4HRAA 3UUGA 1W0CA 1E4EA 2GCOA 2XOKD 3GFQA 4QU9A 4J90A 1W5BA 4UHDA 3D6TB 1WU7A 3EFOB 4WW0A 1L7NA 5DBIA 2AF3C 2ZYHA 3FMSA 2BWJA 2H11A 1PJAA 5I9BA 2X8AA 1FYFA 3LPMA 1N7HA 2Q50A 2PSEA 1JLLB 1R9GA 1R5BA 4RZXA 9GPBA 4M1ZA 3T38A 1W4AA 2FR0A 3M79A 3QQ5A 3QVGB 3OURA 2B61A 5L45A 4G4IA 4LQCA 1DTEA 1F4PA 4IZ6A 4PS0A 5F9MA 2O8EB 2OCKA 4FUQA 1TC2A 5KUTA 1NE2A 4TPKA 5FEUA 4EG3A 3IPMO 5CA1B 1NRIA 2NO9A 3MTJA 4KPYA 5EXPA 4PAWA 3T5GA 2VHVA 4D26A 1E32A 5DEIA 1UIMA 4OHYA 1SCIA 1L9KA 1JGTA 2ZR8A 1E98A 4I5GA 1E64A 1LNQA 3LUGA 1N5JA 3U80A 1EVIA 1NDHA 1WPGA 2PL5A 5BSTA 1QRTA 3ADCA 3WDKA 4BPRA 3AM1A 5BUSA 2RG1A 1U1DA 2I2FA 1LK5A 4Q01A 1UKZA 3NRHA 2JD0A 3BE8A 3A36A 4JEIA 3EVAA 4RCZA 4YJFA 2B69A 4DPLA 5LP6F 2A35A 5EESA 4FK8A 4PG8A 2VB6A 3E9RA 1TYAE 1Y3CE 3CRW1 5T4BA 1VHLA 4V24A 1M6NA 1V4VA 3CLKA 4NYJR 3FCYA 4OKIA 4P93A 2YLIA 3LY7A 4TTVA 4FOPA 3TRJA 3TVDA 3QTHA 3LW8A 3TDNA 1N2CE 1OWOA 4FD2A 3VPXA 4YI3A 3ORYA 4IIHA 1L4YA 3NDIA 4YTEA 2JGAA 4LJ9A 4DCGA 3BBLA 4JKVA 4DIUA 4BJ3A 4EJ2A 2W9YA 2X2FA 4UZSA 3IBFA 4NCBA 1CQWA 3UT6A 2Y1DA 4MUMA 4BEMJ 1U99A 3BRWD 3PD0A 4CIDA 2VXYA 4IW3B 4RKEA 4JI6B 3C8MA 1YA7O 1Y1RA 1X3LA 2VT6A 3F6YA 3K9CA 3EMKA 3MT9A 3NRCA 1FU8A 2J59A 3OTGA 4OUKX 1FFBA 1GYPA 3L34A 2ZU6A 3IP9A 4LEIA 3SYKA 3ABOB 3HKCA 3IJRA 1ZSYA 5D86A 1NC1A 3LU1A 4QTZA 3IMKA 3SNHA 1YSCA 3IIIA 1PGPA 1YRQA 1UFOA 4AYXA 2XAUA 1UAGA 3EQZA 1JNYA 4JEAA 4MA0A 1CF4A 1BQEA 3D3WA 5I7FA 3PWTA 3FFWA 4HCJA 3DFFA 2EQAA 1GP2A 2I67A 4QNNA 1QRAA 1ZHYA 3H2ZA 4GGPA 4YCAA 3WB2A 4CVNA 2PUEA 1E4EB 1FFXB 4N65A 1SHJA 4WFQA 4JAVC 1NW6A 3NKDA 1OFGA 3I2GA 1R37A 4J1QA 4COOA 1QF6A 1YYJA 4BFVA 1UWVA 4NK4A 1ISGA 1I5RA 4X1KA 1MOPA 2F1RA 1EP9A 2O57A 1EI7A 1ISSA 2LWIA 3H9UA 1G8FA 3LLSA 3S0XA 1XL1A 1IEWA 2R8RA 1RHMA 1UBEA 2HA5A 3K72B 2FZVA 3ZPXA 1FS5A 4WECA 4WKNA 5CUQA 4LLCA 2UUAB 4I14A 1GG5A 2WSIA 4F9TA 3HV0A 5I45A 1MRZA 3G1TA 3M0EA 2WYOA 1NTRA 2YEVA 4WY8A 1NP3A 3FWPA 2EFJA 3DHNA 2OENG 3P4XA 1QWOA 1G0OA 2GN9A 3L92A 1MV5A 2Y0PA 2AN1A 2PCLA 4C05A 1C4KA 2YHSA 5I9MA 5HXAA 1IHOA 2Q6IA 4KI0A 4UUNA 4DLZA 2CVZA 5B5SA 2IPXA 1SCUA 1UIRA 4AKIA 4Z6KA 1BOOA 1WNTA 2B3TA 4QPPA 3ZXIA 4CLOA 3N7TA 4PINA 3ZVRA 3GMDA 7MDHA 5CLQA 1XVIA 4IF4A 4IIYA 3GAMA 4BVGA 4WFJA 3ZBUA 1A2OA 2DKFA 2VRCD 1T8WA 2C88A 1FP6A 2PLWA 3LC2O 1PWXA 1X87A 3PG5A 2XBUA 5HQ3B 2NNWB 2BFEB 4DMUB 3QE9Y 3RFXA 3IBYA 1L4NA 4HNGA 3TFWA 1ZJJA 4RPCA 4JB3A 4RZHA 4KBYA 1BDBA 3TCKA 4E1AA 2L81A 3C3WA 1OV4A 5LZ5A 4AZSA 4MEBA 3ESRA 5U1PA 5ADWA 3GJ0A 3U4IA 5LIRA 2QAGA 3SWWA 4UDNA 3RSLA 2W2XA 1ZA1A 3JQ9A 2CSUA 1PQWA 1UDCA 3IT1A 1RJDA 4E09A 3F6BX 3THOA 4D1YA 4A16A 3E8XA 4EPWA 4YUXA 4B09A 2YZ2A 3QLVA 4K9OA 5EJFA 2QBYB 1JYEA 4ZOLA 5GGYA 2FXVA 4IZHA 2R5WA 5FEMA 2F90A 1P3JA 2JD2A 2Q6TA 2O2JA 2J6HA 2Y2UA 5D5HA 1V26A 4M7RA 2YJTD 2ZBVA 4NAHA 5M2QA 2IJGX 3KJGA 2R47A 4OH7A 2Y4NA 2WPNA 4G9BA 4RETA 3AVTA 5TT1A 3HVUA 3P0JA 1CIPA 3IDAA 5E4YA 2AYXA 4ETIA 5FOQA 1BZYA 2QJFA 3QI2A 2R02A 2IXOA 3OZFA 4J76A 4J30B 1NBMA 4LHYA 3TNFA 2QW8A 2ZB7A 1E5DA 2V97A 2SCUB 3N70A 4NPCA 4D4XA 1IONA 4KAJA 1DCFA 2FAXA 1H8HA 1NQXA 2CY0A 5I7WA 4KQGA 2IIPA 5I01A 1T9AA 4LV8B 1Z0JA 1V6AA 2QQFA 1MO5A 1BD3A 3D3QA 5FA6A 4ND2A 1TM3E 5T57A 3JTLO 3FH0A 3M1LA 3PUHA 3SD7A 4YT8A 3UGTA 4CR6A 1A9QA 1AKRA 3CF4G 1JWAB 3R9XB 2JGKA 1WLYA 3W0LB 4ZGGA 4UUPA 2ETXA 2ET6A 4ENWA 1FU4A 1CKEA 2F4NA 1XJQA 4WZBA 3SDSA 5T8KA 2AL7A 2FQXA 3RBAA 2IY7A 3NWBA 4XB6B 4IJMA 3WIUA 3T3NA 1KOFA 1ZGJA 2B4AA 3QX9A 4EIWA 4FOLA 4L95C 4R5HA 4LJKA 4L28A 1DUIA 1HW2A 1PFGA 1IZ9A 3E7PA 3AKZA 3PPVA 5AOCA 4YT2A 1GGJA 2RBKA 4AMYA 1XDGA 2J0UB 2PQMA 4RVUA 3S3TA 1NFFA 1Y9EA 3P2KA 4D0NA 3V7WA 1JR8A 4H6WA 3GLRA 1U2PA 1CJUC 3I5UA 1TUIA 3PWSA 3WNCA 3PP8A 3BHNA 2R6R1 2X3FA 3PFWO 4HNAB 2QRVB 5T3UA 4G89A 4K0DA 1N2CA 3JQGA 1SBYA 3M9WA 4RLQA 3ZOKA 1UK6A 1CEQA 3MGBA 4ZP1A 1XDDA 2GEVA 4R1UA 4QU8A 2PKXA 4N5MA 4DCNA 1CY2A 4ZKDA 4P4SA 3OEOA 5EIBD 1Q1EA 2ZOSA 2WINI 3C3YA 1EQ1A 3DCYA 4ZKEA 2WWVD 4WGFA 1GVNB 4NV0A 1I5NA 2QU7A 4N6NA 4NV1A 2G3VA 3LUTB 4M8SA 2O05A 4WXHA 5BWOA 4X92A 4J7TA 4WEQA 4IX1A 1N2GA 3NH6A 5J1TB 4B31A 2Y1FA 1QHEA 2QE9A 1C30B 4DLTA 4FEAA 1DFHA 5E6UA 2DHDA 4V0RA 4ZAYA 3UT5B 2YXBA 5EJ5A 3ZV3A 3KQNA 3RE1A 4EW2A 2GS9A 2P5YA 4HWPA 3EZ9A 1FPQA 1GT6A 1J24A 3WNVA 3ADPA 2YKZA 5EIXA 4HDAA 3A25A 3OOJA 2WLTA 2X23A 5LD2C 4QBGB 1J2RA 4QAQA 1M2WA 1MABB 1TU4A 1ZMXA 4Y1GA 2UUPA 5CAEB 4QUBA 2IBSA 4JL8A 1RQXA 3V2IA 2YWRA 5CPBA 4Z4GA 1DJPA 1M2HA 2G36A 3EXHB 3LT5A 1RCFA 2J8ZA 4MKRA 3T1NA 3KB6A 4DG9A 2O8EA 4GXQA 1E3MA 1NJGA 2HWUA 3FPHA 1A69A 2VKTA 3GNTA 2NVOA 4AE4B 1GZHB 1YQWA 4H7KA 4PG6A 4HK4A 4X7MA 4CKWB 4DCUA 4A0GA 3IEEA 4E7SA 2DSTA 5CIWA 3TL3A 4NZOA 2H4YA 2RAFA 1B23P 4PN7A 2Q3LA 1QTQA 4GBGA 2V7BA 1XZNA 4JCCA 3SS9X 4BL5A 2CNNA 3OQ6A 2FI1A 2P4QA 3WV4A 2PCJA 2PUTA 4L8WB 1NXTA 1JQJC 1ZVQA 3CR3C 3GWZA 1N4AA 2GCOB 3ONVA 2X0KA 1RZVA 1XYYA 2KX7A 521PA 4WESA 5G02A 3IVGA 2PGIA 3HO8A 2FZ4A 3QVOA 4I4LA 4CF5A 1H8ED 1QX3A 4Z4FA 1JKJA 5EZYB 1H5QA 3TZLA 5C80A 3DG9A 3OQMA 2WM8A 3FOBA 4HTFA 1A0BA 4QM6A 4XVRA 2ZREA 1Y7TA 1UQRA 4KIGA 1RJ9A 5DN6D 4ALLA 2C5SA 1AF4A 2GDZA 4F0JA 1HO3A 3PKIA 3EAFA 1H2AS 4ARZB 1GG9A 4JTAB 2HA3A 2LKCA 2Q4TA 4QDKA 1J25A 4YRSA 1RBQA 2FWPA 1U2RA 1VG9B 4LUCA 4JLOA 4G56A 3ZV4A 3PT9A 5K0IA 3E81A 1QG6A 2I6GA 4TKVA 2EWMA 3AZOA 3D7MA 1M33A 3BS4A 1DG3A 1QPGA 2E9SA 1S7CA 1DUVG 1GDTA 1IIBA 1R0SA 3A37A 3GGCA 3ICVA 3VYWA 2VZ9A 3A6LA 4MVJA 4R2HA 5D7BA 3ZLUA 4RA9B 2Q5JA 3C43A 4Z99A 3L6CA 3ZHTA 3EVGA 3LLUA 5D1HA 5CLJA 4MHSA 2JFHA 2WA1A 4BYMA 3F9CA 4O2RA 5L0GA 3PQ3A 5EHNA 3WLLA 4F5WA 2J9VA 3K70B 5E4TA 5L0FA 2ONZA 4R1PA 4RD1A 3KQVA 1JEJA 4P7JA 1C8VB 2NSDA 2A7QA 1TO6A 2R25B 1YR2A 2YJ3A 4XLZA 1NZJA 1HTTA 1XZMA 1CFZA 1U3UA 3VBEA 1T1IA 1RWPA 1RTTA 3FVYA 3AGTA 2ZXWC 1QGYA 1ODIA 1QOZA 1E0JA 2PGJA 1DIAA 3MYRA 3NWPA 4PCLA 5DNEA 5DULA 4QVIA 2GXAA 4KIFA 3KQSA 3PQ8A 4RC9A 4KXVA 3ZEIA 4EA6A 5I8WA 3EEFA 4PSKA 5C7YA 1TF2A 4BRSA 3KSBC 1OHHD 3JZDA 4AYTA 2COKA 2DUUA 1QPUA 5IS2A 1IXSB 5JFOA 2H92A 2OZLB 2J5BA 5AUOB 5HRCA 2G28A 1RVV1 1N9GA 3SSOA 3VNQA 3C3XA 1NJ6A 3AERA 2WTEA 3G8DA 4L76A 4IOLA 4G0UA 3AUJB 1DPFA 1RC0A 1ZOLA 1VHWA 3V9AA 2LE0A 3B3GA 4M0LA 3VC3A 2ZETA 1WN0A 1G5FA 1LLCA 3DA8A 4A03A 1W2WA 1HQKA 3C8GD 4EBKA 2X8WA 3HKEA 1OCRC 2BGJA 4X3PA 1LY1A 4D96A 1V8DA 3RS0A 4ZN6A 3TDKA 5JE8A 2VA9A 5F35A 3HDQA 1USKA 3PX3A 5BWMA 1NX9A 3SFTA 1N7GA 2CZGA 3D54D 2LKDA 1VBKA 4DA7A 2ZB8A 4ON9A 3CUSA 1GFIA 4P7BA 2EATA 4Y0AA 5EUQB 4I4NA 3UA3A 1R50A 3HNJA 1NI4B 2VNIA 1MZVA 4F71A 4FONA 3TZ6A 3V55A 1JEEA 1Z4IA 5C1DA 3HDGA 3KQQA 4HVCA 4X91A 2WSYB 4X1IB 5AI5A 4YIKA 5A5GA 1RXYA 4FYJA 3AR9A 1U6IA 4F21A 4WJ0A 2XMRA 3IRVA 4P3NA 2KLBA 4P7KA 2PSSA 3VKWA 2HIMA 2FZWA 2VFAA 4LY0A 3CNEA 3TBFA 2XTJA 3U9SA 4ZIRA 3OA1A 1U80A 1OAAA 1UP6A 2GEJA 2QM3A 4RIFA 1P3DA 5EWLB 1PKEA 3ONFA 3N6RA 4ULWA 2VJOA 3K0SA 4ZYXA 1VE9A 4QDTA 1AHNA 2F3TA 4JT9A 3EIXA 5GIOE 3N05A 3OM9A 2AFHE 2RIRA 2FJPA 4IV0A 3U39A 4ZYLA 2HCRA 2QAGB 2EW2A 2CVOA 3JARB 3QKIA 5DHPA 3RTBA 2FSVC 3F5SA 4EX7A 3BXEA 4B34A 3A6FA 4JURI 3T61A 2K4MA 2ZIAA 4LWZA 3VTAA 1PR5A 1CQPA 1FUKA 4PJJA 3DFIA 2BGWA 3F74A 2JHGA 4MJXA 3IKMB 4PXYA 4L15A 3JX9A 4AMGA 3F4KA 4FOTA 1J00A 3RVPA 3C5WP 4G0VA 4B3RB 4O5OA 4U9DA 1SMYF 4E2ZA 4JODA 3VRHA 1AK1A 1EDZA 3ESCA 3WSWA 4IMJB 3UJPA 1MJFA 3IQ6A 2CMDA 4RW0A 3H1BA 3ZWNA 4E4RA 4J7UA 1GRRA 5BV0A 5C5DA 2HTFA 2WM3A 1RXQA 3BZBA 2HLDD 3IERA 5HTOA 5A1JA 1Y4DE 2JEOA 3DDHA 4IRXA 4DCPA 1XDBA 4KPEC 1QYXA 2FV8A 1U2ZA 2H51A 3ZWXA 4B6QA 3CSSA 4Q7CA 4QTXA 1VJTA 1XRMA 2EFDB 1J5PA 1W36D 1A72A 4ETNA 3GLKA 2C1EA 4KWHA 1XTQA 1UBKS 4BNJA 4JJZA 1ORIA 2O7SA 5ALVA 4WMLA 4X71A 2OTCA 4ZHQF 4KPUB 2IH5A 4FJ1A 4H17A 4F93B 1X86B 2O8VA 4KYIB 3ESBA 3U13A 5JCJD 4BNDA 2J9XB 3H5OA 3HWX1 5FWXA 1EDEA 2CB0A 3VZRA 1KYZA 4OHMA 4LF5B 4F2HA 1A8PA 1R7RA 1U4OA 2PXCA 4MR9A 4AZ3B 2IS6A 3O1JC 1XO1A 2IYWA 5TGDA 3GLUA 4M1WA 1C9MA 5DCLA 5BQ3A 3T5MA 5EJAA 1VSQA 2QTGA 2D0IA 3PCXA 3FI9A 3KQOA 2PX6A 2NSLA 5KSZA 2H06A 3WHLA 4NTZA 3P2IA 1F6BA 4IY1A 3JW8A 1KYQA 4URZR 2QTLA 1M8GA 3OMLA 1KS2A 3AZQA 3FAZA 1NVAA 1REQA 3PFFA 2HYDA 4X1IA 4CM5A 2OMEA 1NWCA 3A14A 4PQGA 4E08A 1J39A 3EW9A 1THTA 1ZN2A 3Q3IA 1YZQA 1K2VN 4ZQBA 1QRUA 4E30A 4CS8C 2I3DA 3AKEA 4NZMA 2HHCA 4E12A 4F72A 1ZMBA 3W2HA 1FTSA 1CUIA 2C96A 1NOKA 2AHOA 3WQRA 2DOKA 4FW8A 2DHCA 5ER9A 1EA8A 1SK9A 3NHRA 2E21A 3KE8A 4YO8A 4O4LA 5E8RA 2J9RA 2FFBA 4H18A 4DZRA 4K1LA 2NO0A 3MFQA 4I6EA 1FUUA 4C08A 2Q6OA 4CS7A 2Y0BA 3MILA 3TLZA 3LI2A 5ANRB 2FMKA 2ZAGA 4H0FA 1NQOA 2WTMA 1FXSA 4C7XA 1FFSA 1CFJA 2A0KA 1OBFO 2NOAA 2QV0A 4WLEA 3MOIA 5D3MB 1M6TA 3UT5A 3ZJUA 1PD0A 4F2GA 4YJDA 1SWWA 3GBPA 1UANA 3S2UA 2B1JA 4KXQA 4YYZA 1FFCA 3FSGD 1QGOA 4NBSA 2GFQA 3DV0B 5EKXA 5A2QA 3ADDA 4M63A 1P61B 1WLSA 3RVDA 1A9PA 2CJPA 4UU1A 4YLGA 3AV3A 1KDZA 1DEOA 1VXOA 3T34A 3UHPA 4DIOA 5CCXA 2C7GA 4DV2B 3TL2A 3ET4A 2IXAA 4N3CA 1NSYA 1GGKA 4OL9A 4YRJA 3K32A 4UULA 5HSWA 3DTVD 1ZOOA 3ZE0B 4WZAE 4C30A 1DO2A 5AT1A 2C3OA 3BMNA 2NU6B 2XKAA 3ESZA 3VO2A 2XLWA 4AE4A 1MGPA 1THMA 2BUAA 3H1AA 4NWIA 2J7PA 2E4WA 4CKWA 4J1TA 2H7BA 4UXHA 1WUKS 5TSDA 1F2UB 1JVNA 2SBTA 3NALA 2HF9A 1GVHA 1WY7A 4YJWA 4B40A 2AOWA 1VMDA 1D0XA 3UNGC 4ZZ0A 5BSUA 3WDLA 4QZVA 3PUXA 1MOZA 2WJJA 4NBVA 1RDFA 3D1VA 3K7EA 2HBYA 3OLWA 4Q3LA 2FPXA 5JAQA 1X7YB 2PKWA 3IS3A 3S2SA 3TE6A 4I2NA 5KO2A 1N0UA 2FZLA 3CISA 3O26A 5JECA 3DE1X 1PE0A 4G7OF 4TTIA 4UBIA 3CCBA 3HGMA 3IUEA 1QOQB 3ISTA 1XZGA 4UUMA 4L51A 5F1YA 5B2FA 3MWDB 3LUPA 1MABA 3EQ8A 1YOVB 2QJWA 3AJRA 1G2OA 3U3JA 5ILOA 4OFWA 4QX6A 3ZDQA 5EQJB 1QRSA 3I0ZA 3IPRA 5J2UF 1U0EA 1ZUD1 5G1PA 4AZVA 3G23A 3U3RA 5B6IA 5JQGF 4ABTA 4G5HA 4R1SA 4OB8A 3GLHA 4X94A 2CDNA 3EZGA 4L0MA 1XYGA 5JNRA 1BR2A 1X1RA 5K0BA 4B6PA 1VIAA 1NGSA 2HMWA 3OHMA 2OLKA 5EMHA 2C2ZA 3VR5D 1G21E 3IJ5A 4M9QA 5KZMB 1E2FA 2CXSA 1JMVA 1JAFA 5L0JA 1X94A 3EISA 2HTEA 1UH5A 2OCPA 2IXEA 2ZE7A 1F8FA 1P2BA 4LWPA 2FPPB 2I62A 4MYTA 3GG9A 3FZQA 3RRYA 2FK8A 2E3JA 2Y1WA 3HDHA 3LKVA 5JSYA 1KXJA 2BEVB 1VE6A 3CX4A 4MQEA 1K0FA 1DX4A 2LUOA 4FHCA 1LCIA 1PBTA 1ULZA 3HDVA 2DQKA 2E4XA 1OQCA 4ZT7A 3ZIUA 4HVLA 2XBMA 4CWAA 1ESNA 3EVZA 4YA6A 1O7JA 1SUDA 1E9AA 3ROQA 2FWJA 3B51X 2Z4TA 5CDUA 5SZJA 5DS4A 1SVOA 4J3NA 2ZE5A 3U9JA 4P6IC 5LLDA 4E33A 1R6XA 1I2CA 4CDMA 3BBPA 3LQQA 1XVTA 2VDWB 1C9JA 1BEUB 2B4YA 2DWOA 4K6CA 4MKFA 4MV1A 5G3YA 2DBZA 3ZH2A 4Z4HA 1PAUA 4JL6A 3RVKA 4X24A 1S05A 3BDVA 2FW6A 2P5TB 3DJYA 2HX1A 3OTIA 4X8MA 7ABPA 4FM9A 3GLGB 4MINA 1UOPA 2B7BA 1BA2A 3TGWA 3TZHA 821PA 2B25A 6REQB 1MC4A 2M6SA 2WNHA 3BILA 3QPUA 5KTTA 1VSVA 2A0YA 1E66A 1IZ0A 4LVOA 2WG1A 2V7UA 3NWOA 4CDAA 2BOVA 2VK8A 2FHPA 1GG2A 1YS2X 2O5RA 1IQUA 1UEIA 3WJ2A 4R2LA 2NPIA 5BSRA 3K4HA 2DVMA 1F2UA 3L01A 2I3GA 3PEUA 4IKOA 1UOEA 3N6VA 2XWJI 3OZBA 4HN2A 3KYJA 1ZLYA 2Q1WA 1OREA 2R7LA 1U4NA 2WFLB 2PH5A 1PLJA 4ESHA 1O9BA 1NM5C 4BPBA 1K5HA 2PKCA 4IQ0A 4RZUA 4H9GA 1MENA 3HUUA 3OA2A 4LYEA 1S2IA 3A32A 3L6EA 3KAKA 4BC0A 4HV4A 1C7QA 3Q3EA 3WGKA 4JP8A 4R16A 1T6QA 1LPNA 2GNOA 2YICA 3THSA 2XF8A 2PQ2A 3B71A 4RQBA 5ALIA 2QIPA 5FOWA 1JUDA 2BEKA 5AKGA 3MK31 1S2OA 3Q6IA 4BECA 4CQLA 4DY4A 1MIHA 5FJJA 1WVMA 4N03A 4LFCB 2O2XA 2TRSB 5LP1A 1E2NA 3EXIB 3L7YA 3ORSA 5EQTA 4YLEA 7MHTA 5NLLA 3A6ZA 3GWLA 1N5KA 5IH3A 3TQOA 3JQBC 4RZ3A 1JP7A 2F7SA 4DF3A 5C51B 3SC4A 3NMUF 4TMTA 1EE2A 3EB9A 3FETA 3MW8A 1FDRA 1YULA 3IXMA 1UPUA 1U0TA 2O1EA 1HLPA 5LFAA 3NHLA 3OU2A 4ITRC 1MC8A 1G8MA 2B1IA 2BPOA 2QZ4A 2GRUA 2YFHA 3PI7A 4PAQA 3S40A 2DPMA 3PRHA 4W6QA 2GKOA 4DW8A 1ZLXA 5DHAA 1YI8A 1YBVA 1QCZA 4KN9S 5IT4A 3KHSA 1BYUA 4JR2A 1YQXA 2BE7A 2YW9A 4JT2A 2JD1A 2QZZA 3VVBA 3PEWA 1FSPA 3DQPA 4U39A 4ALNA 3L4JA 4OPMA 2FPRA 3HJCA 4O4JF 2MSWA 3OFND 1YK1A 3WQBA 3BFJA 2I6FA 3CZPA 2E5LB 3A10A 2LIGA 4LRWA 3CH6A 5DRYA 3G9XA 5DZSA 4NQFA 1ZC3A 1U7DA 2H31A 3PNOA 4V0MA 4C0WA 1Z8HA 4E6PA 4U7PB 1C41A 4HG2A 5LZ4A 2G62A 2X4LA 4HB2A 3WISA 5F2NA 1N5MA 4E5UA 3VJRA 1MN6A 3L4BC 5ECGC 3IAUA 1OYOA 1CZOA 1EBBA 2WHXA 4R6WA 4DM7A 3AGUA 3EGXB 5KX5A 1A7DA 1MCZA 3BSWA 1XROA 3HP7A 3N59A 3H2IA 3KPJA 5D51S 4QSHA 3N76A 4FDMA 4LJ4A 4DN6A 2H17A 4PEVA 4QARA 4MVRA 4CL0A 2HPHA 3R40A 3ZWMA 2UZIR 4XM2A 4B75A 1GTG1 2W6MA 1EAMA 1TFRA 2BFBA 2ZUBA 4GDFA 1KI2A 3AB3A 2CE7A 3MT8A 3I30X 2AI2A 1PT6A 4CIYA 1SOWA 3AY3A 1QVAA 3PCRB 5DB4A 1TUBB 3RYIA 2WABA 3AW8A 4P4GA 4RKQA 3VR4H 5A3RA 4LJ5A 4CXMA 1E2LA 1K6JA 3DFUA 4PONA 4RHUA 2O8NA 1WGWA 4NRDA 5FPQA 4ZK6A 2YV5A 1K5DA 2BGRA 3GYBA 4HPJB 2NU9A 3DV9A 3COSA 3H9CA 3G4ZA 4XAQA 1B1CA 4KBLA 2QN1A 3H1FA 4YRRA 5DTQA 5JTTA 1ESMA 3N0WA 1L5YA 2C2YA 1NBAA 2YX1A 2Q1XA 1C7ZA 1F0PA 2EPMX 1UEJA 3I1FA 3N2NA 1CZNA 2XF2A 2B1GA 5AK6A 4WJLA 1KVUA 3VZPA 1QQAA 1J8FA 1UQUA 2O8FA 5EWMA 1P7WA 1I01A 4C4TA 4EIYA 4CUZA 5E3CA 4Y2UA 2QX8A 4QOHA 4U7HA 5CH5A 1VYIA 2AFRA 4E5DA 3K96A 1AGXA 3GT0A 2BFDB 3PE3A 1JSRA 5T64A 4JH0A 5ALNA 3QX8A 2LRHA 1YZ3A 4LCEA 5MHTA 3JQAA 3ORQA 4Z1MD 1JPVA 1NV9A 2P9YA 3W4KA 2NXEA 1OHHA 3D0RA 3SLGA 1AQIA 3AZPA 4HMPA 5GTDA 3ZGVA 4BNFA 3AVYA 4V1CB 2PRJA 3P9RA 1KYYA 4IRMA 4KR0A 1ZQ1A 3PPYA 3NMKA 1UP7A 2NTNA 2RH4A 2IOYA 3KELA 4GNRA 4KQHA 4OQ4A 4MI3A 4H7PA 4QUAA 4GEKA 3UMJA 4DLVA 2WP8J 1TM7E 3DEFA 3T7CA 3UJ7A 3E0QA 1DL5A 3K0HA 4NU6A 5CB6A 2RG7A 4JD5A 3RW9A 4ER3A 1KYVA 3ZJVA 1WU8A 3LRPA 5JFTA 2OPBA 2VSYA 5LUBA 3AEKB 4DMGA 3GRPA 5FV4A 5CFOA 1ST3A 1O95A 5HE8A 5KNBD 3A4LA 4L2IA 3DAHA 4XWJA 4RPJA 2A14A 1R8QA 2YOGA 5JT4A 3VC7A 2MYSA 3STHA 2P1AA 1ZHWA 3F7TA 3R3ZA 3WY9A 4FGSA 3G59A 3OF2A 2HV6A 4IWBA 1HQCA 1QK3A 3NBFA 3R6DA 5BMVF 1Z26A 1XYVA 2IIBA 2ZJ8A 4JI5B 4BIIA 1V55C 3IYLW 3R0XA 3C15C 1PK8A 4PR3A 7GPBA 3FTFA 2IOFA 4CN8A 4QOJA 5JAPA 1SUWA 4UASA 1BKYA 1PT7A 1J4AA 4GW3A 5AVJA 4FCCA 5AXBA 3RSQA 4LWQA 4BVFA 1EZ4A 3AP3A 1HFEL 2AF4C 5KPJA 4AJ2A 2DT8A 4U7WA 3G79A 4HYEA 1TVEA 1EA7A 2ZIUB 4D5GA 1YJCA 1JI3A 2XUGA 5B1BC 3RS5A 2Y1XA 3E7FA 4Q9AA 3I6YA 5K09A 5LJLA 1ZCJA 3FG9A 3FNGA 1XJ5A 5FD8A 2H1RA 5L9AA 3DJFA 3AJDA 3JZAA 2ZWAA 2YWFA 3MSCA 5CVUA 1T8SA 3C8DA 5JSQA 5KQRA 3KQUA 2VDOB 2W6CX 3AILA 4QGAA 2C9YA 1LRLA 1OVGA 1Q44A 3CX8A 3PQ7A 2G40A 1SCKA 1US8A 3ASYA 4RV4A 4UXIA 4YAOA 1G2QA 5FYQA 4C1BA 4CNQA 4NAUA 3E82A 4GMGA 4RD2A 3TNDA 1T5IA 4ZTZB 1GZ6A 3F4LA 5KREA 3AOEC 3AF2A 4MW1A 4QULA 1MQVA 3ROEA 4UZFA 4BMXA 1JDBC 2YLDA 1KJWA 1CUDA 4KLZA 3RQIA 3TK1A 3AM4A 3SQWA 2W2PA 1M74A 3KUUA 1ENYA 2PZBA 3DE3X 1QJCA 1IY9A 2JIOA 3JAKA 2AG8A 3LSTA 4ZYYA 4TQ9A 1MC1A 3GMIA 1VCIA 2GEKA 2AX4A 1MNQA 1A9ZA 1IN7A 1H2ZA 2ACWA 5ESDA 5AW4A 4P82A 3GRAA 4F86A 4WOKA 1DUSA 5A02A 1Y9AA 1U2GC 4FFBA 1ZHZA 4A0QA 4TYYA 4YJKA 3R7DA 3GROA 5DKFA 3W2WA 1JLLA 2YNMA 2FEXA 1W5EA 4KO1S 3AEQA 3GGJA 3TOXA 1UFRA 1P5RA 3N74A 3DE5X 5D87A 4L74A 1M1ZA 5HJ2A 3DLBA 4Z4QA 3W04A 5AKJA 3IQZA 4ZA2A 4EKIA 2WJZB 3HWRA 2H7VA 1ZH2A 3KB1A 5HF5A 5BWCA 1X15A 3PNBA 4WK6A 2PKQP 1WRBA 4YL1A 1U4SA 1NXWA 3BL6A 2CNBA 4V0ME 1N6RA 4G8BA 4JUFA 1G8HA 2K7ZA 1SH7A 5CXQA 4LERA 2BKAA 2RKBA 2VOJA 3PF9A 2V7GA 3FBTA 5EERA 1GZDA 4N12A 2XCSB 5LIPA 3NYWA 1R5NA 3OWTA 4DOZA 2VP3A 1T9DA 4TT8A 1Q95A 2A0FA 2W2LA 3G0IA 4XCVA 5G2OA 4RDHA 2DFPA 1X19A 1PYOA 3RS4A 4IVRA 4YMIA 2HZ8A 3W6UA 4DJ5X 4BFYA 1T2FA 2BMDA 2B8TA 4UJ3A 2QTRA 4GKAA 3AL3A