3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
1T5OA 2YRFA 1W2WB 3A11A 4LDQA 5DBOA 4ZEMA 2YVKA 1T9KA 1VB5A 3ECSA 3VM6A 3A9CA 4LDRA 2A0UA 4ZEOA
chains in the Genus database with same CATH superfamily
4M9QA 1E0JA 2PZLA 3TAXA 1MJHA 3DE3X 5BN5A 1HKHA 4FKBA 3MLAA 2NSJA 1CC1S 5JAIA 4Y2VA 5EJMA 3CVXA 2NN3C 4MKXA 3ETDA 5A5EA 2XPCA 4ALLA 3GGSA 1AGXA 4ZJYA 2J3DA 3TPFA 4PYRA 1VJ5A 3TGWA 5EP1A 5AVKA 3TGPA 1XTQA 3IP7A 5JLJA 1QF9A 5AVOA 3VVMA 3RJTA 3W5HA 1JHZA 1A77A 2JZNA 4C4OA 4UDXX 3O1LA 5JC8A 3IDAA 2O23A 3QPVA 4LRQA 4UPVA 1DTWB 5KCZA 5A5GA 1BA2A 2Y9MB 4E09A 3RTGA 1XNGA 3DCYA 4J4TA 3VX4A 4B2LA 4IF4A 1QPGA 2E5WA 4XQCA 3X44A 2J0UB 5CP8A 4UAJA 1GDTA 1UC4B 4GOLD 4Y2UA 3HV0A 5CCBA 3OH8A 4BE7B 5B5SA 2C2MA 4ZQHA 5IW8A 4DDKA 3VKUA 4NOLA 3V1KA 1GT6A 1MW9X 1W1IA 4OHZA 3C3MA 3TI7A 1I3LA 1JPNA 4JN6B 3AVXA 3S40A 1TPYA 5H59A 5AKJA 3W8DA 1YULA 4L5IA 4OOFA 2I4RA 4G1FA 1IWOA 5FIUA 3L04A 4UBOA 4ENUA 5LOVA 1ACMA 5T4BA 4E11A 3W04A 3IP3A 2I99A 1L1FA 1J2TA 3AJMA 5EXEA 5J2UA 3DP9A 1KI2A 2D8AA 4LF7B 4DV3B 5JJ5A 1X13A 1CNFA 4JZAA 1FSFA 4U0JA 2WL8A 2EV9A 3R9XB 2QX6A 5LQKA 1P6QA 2QVLA 2JK0A 3PWTA 3S27A 3TLGB 3NHBA 4FMCB 2X6RA 1L7DA 1NUHA 3C5WP 5G02A 3V8PA 5I7VA 3BFJA 3G2IA 1XR3A 3BJIC 5DM1A 1GFIA 1C9MA 3UCXA 5L3RA 4BMZA 3U19A 4O3MA 3OWOA 2V6MA 2V5AA 1S3SA 2OKCA 3T7IA 4XVUA 5SICE 2R1TA 1N8NA 3N0XA 4XWWA 3G8BA 4NV3A 4C3ZA 1D1CA 1NVMB 1RCUA 2XZDA 4Y1RA 2C54A 3LTNC 1AO0A 4WK2B 2X8WA 1GUZA 4Z5XA 4OO3A 5JS2A 2XADA 2B0CA 3K73O 1SCBA 4AN1A 2EZUA 2I2WA 1U0NA 2D3TA 4D3ZA 1PJTA 1M73E 1W4AA 5BW4A 2H65A 3MTGA 4RJIA 2R9RB 1E0AA 3NVDA 1IBMB 5HRUA 1DG9A 4UULA 1RMTA 4RJJA 1M2VA 3ZTZA 2D8MA 5C2JB 2GEFA 3GJ0A 3SQMA 4ETWA 3AI1A 2Q4BA 4DJFC 3MIZA 2R7XA 4RVDA 2XCOA 3AJAA 3DC7A 4YN0B 3WGYA 1NOJA 3SIWA 1P8JA 4ED9A 3VKGA 2FHPA 2KJQA 2W6JA 1K92A 2UUIA 3EODA 4LHXA 2FA9A 1Y4AE 3P9RA 4XIFA 1APCA 2WAOA 3PJDA 1H1LB 1H8HD 3VJKA 5K05A 5BSGA 4LGMA 3SDBA 1I5OA 3K9CA 4B4VA 2YMLA 5SYMA 3D4NA 2QMUA 1E0SA 5DQTA 4ARCA 1JT9A 5BNTA 4D0NA 4R1QA 2JA1A 3OM1A 1L6RA 4UHEA 4JVSB 1FFDA 2CVHA 3SZGA 5JVDF 3VC7A 2BZGA 1T43A 2ZYAA 3O73A 4I08A 5ALFA 4DW8A 4Y2PA 4L5JA 1U2GA 1PT9A 4B9AA 4MQBA 1KWGA 1H0RA 2C2OA 3VR4A 5EWLA 4IYJA 3AI7A 3I2GA 1NUQA 4FI3F 1JHQA 3DGFC 4HWKA 2R79A 3ZLBA 4Z9YA 2HXGA 1XHLA 4URXR 3U7FB 1QQTA 4IVQA 1BKSB 3BQ9A 1C4WA 2Q3TA 1FCJA 2G06A 3QLEA 4YK7A 4OFZA 1K6XA 3RCBA 3I04A 1U8CB 4QOEA 2Q4TA 4IGGA 4WGYA 1TQDA 1N2EA 4O63O 4D8VA 2WWGA 5B7PA 1P2BA 4KB5A 2P90A 1JH8A 2ZTUA 2D6FA 2XLOA 3NYIA 1Q6YA 1RHKA 4HGZA 3H6KA 1EX1A 2B98A 3C3KA 4U2EA 1YUNA 3BTSA 5JEDA 3FXHA 1CDDA 1VMAA 4BNDB 4QGHA 3BCUA 1XZEA 5LWQA 3WYGA 4XI9A 2OUIA 4EL5A 2YVAA 3OZTA 4H6PA 2D1TA 2W2MA 1HDIA 1UT5A 3BFKA 2ZUFA 4O2BB 5FAKA 5EC8A 1CY1A 3CVUA 1TJNA 4MVJI 4X20B 3S81A 3PDUA 5B1YA 3KNZA 4ZAVA 4X1OA 4KP7A 5C4IA 2XZPA 2I1VB 3AONB 4U7PB 5LSAA 3O4GA 4IIGA 2Q46A 1UPBA 2PT5A 1CEYA 5IJ9B 4FIDA 1J56A 5T8KA 4YRTA 5KYYB 2ZYSA 4JH0A 4RIIA 4X7PA 1GEEA 5JD6A 3I8OA 3ESYA 4WX2B 4I1PA 1JIVA 2OQIA 1G8KA 4NTBA 3HYLA 3EWAA 4ROSA 3D6FA 1O4VA 1U6JA 3QMWA 5ALRA 1WY7A 4F9FA 2XECA 2R3SA 4LHYA 2AG6A 3BPSA 4LVCA 4NJEA 4JOQA 4QUKA 5FWAA 1JNYA 1UBNA 3EPRA 3SQXA 1N0IA 1Y9EA 1BVHA 1P9RA 2H29A 1GGFA 1WOMA 1X80B 2R97A 1FBNA 3ANNA 3RJ9A 3SOPA 2XB4A 4V0MA 1XQXA 3QNMA 2X0FA 1KIMA 2ON6A 2PM8A 5CLHA 1S2IA 3TZEA 1PQYA 3CPHA 1JU3A 2XUKA 4AMBA 1X92A 4MZXA 5JAHA 1E58A 1K05A 1OD6A 4PO8A 1K1EA 1V3UA 2GN0A 1TZMA 5E2IA 4O8ZA 4AJPA 2XAUA 3ADDA 1NQXA 3DE5X 2Q5JA 1OX4A 4K9QA 4MR8B 4IWYA 4N40A 4WKBA 2DJIA 3DO8A 1SCJA 5SY9A 3OEHA 1G5PA 1WOYA 3IAM6 1HI9A 2GZSA 4JR0A 1F9AA 3TZCA 3OU6A 4DR2B 2YMPA 3RK0A 2HWUA 4QTYA 2BLLA 4LGCA 3N24A 3WNVA 4WOBA 3P0JA 1GYQA 1T2DA 5JCOA 4M8KA 4UHDA 1YC5A 1W59A 2BFEB 2OSBA 1NSGB 1IHOA 1DEHA 1KQGA 2EW2A 1PAUA 2WT9A 2V6BA 2ZEJA 4EECA 2AD5A 2WWHA 4DSZA 1T9ZA 2H1OA 4IIHA 3LBHA 3C70A 1H9BA 1TZ2A 4WGFA 4J2TA 4H7KA 3TUZC 4H1VA 2A4KA 3M1LA 4MR7A 5CX4A 4JI1B 5B7NA 1KDZA 1O97D 4GX5A 1OE0A 3CUUA 3CFYA 3B3FA 2ODWA 3RVZA 1TJ4A 1GILA 1NVGA 2V59A 2Y2VA 3F8TA 5JW6A 2C07A 1XP5A 3VTZA 1NNEA 3S2EA 1HE5A 2RIPA 4DWJA 3MJEA 1BFKA 16PKA 4LI0A 4AURA 4LRUA 1KAGA 3IP5A 5E0OA 4ZO8A 4MV5A 1MFPA 5EJ8A 4CKCA 3LYHA 4ML3A 1CUXA 5IAKA 2IYVA 2WR8A 3VZDA 4WERA 2QUZA 1T6BY 2JHGA 1HE1C 1B0ZA 3DV9A 1OZFA 1ST3A 1D07A 4RDCA 1J9GA 5GIOE 2Z1MA 3ZU6A 3ESRA 4V3BA 3K9BA 521PA 2F43A 5L40A 2VN8A 3ZHSA 3L1IA 2XDAA 1XZHA 3UHAA 4IW3B 2FB9A 4MP8A 2ZTVA 5EKSA 5EHGA 5CHYA 3TKYA 3JVIA 1IY0A 2Z2XA 2A5FA 3OD1A 5EXTA 3LPCA 3DCNA 1QGAA 4S1VA 4O4IF 4I4LA 1JZSA 3K0CA 4TV8A 5DPMA 3ICOA 4JX8A 2VXOA 4YHHB 1J07A 1R0WA 4Z8YA 3VJMA 2FUG6 2EC5A 3EXG2 4FFOA 4FMDF 4C4AA 5HQTA 4ZTBA 4RGBA 4E30A 1WG8A 1LBSA 4N41A 2Z09A 2HJ9A 3FJOA 2AQIA 1AS0A 2EAUA 4R4JA 1ISMA 3ZD9A 1XHEA 4ZCTA 2HMYB 2ZS8A 3ILVA 1XZ8A 4RIGA 1RI2A 1ULUA 1YD7A 3U9TA 1UPCA 2AJCA 3JW8A 1ZUNA 1OFUA 2ORYA 3Q9SA 4RA6B 4B3SB 1R0LA 4CM4B 3ABRB 1KPGA 3K70B 1UKVY 2O8DA 3UAYA 2JH8A 5GGXA 1HGXA 4XIJA 4F97A 3LX8A 2CVQA 3NHYA 4QRIA 2VH2A 3H5VA 4LOIA 3P9KA 5I5GA 1E9SA 1V16B 1A8PA 1XMPA 1Z29A 1QFSA 1GKUB 3FNHA 1US8B 4HTFA 1XZNA 2AFRA 4Z4IA 2WHQA 4GM0A 5A62A 4RV4A 3HJAA 3D1LA 2R8RA 5L0IA 3KOMA 5GV8A 2N47A 5K0CA 3ETEA 4TS9A 3USZA 1H0HA 3HLZA 1ZM9A 4P7KA 2WTEA 1L3BA 2BCEA 2Z9CA 1LM3B 3HA2A 1CVLA 1CVIA 1SQSA 3ZCTA 2VP9A 3EEFA 5JADA 3U7GA 1MNQA 1PWHA 4BFXA 2P79A 4DR4B 5KX5B 1T36A 2P9BA 4C9BA 3K1YA 2UYYA 3G02A 1B15A 2WABA 1JOGA 3ZGZA 4ARUA 3F6RA 3HM2A 5FXMA 3W34A 4LNUB 3W2WA 5JECA 3DVAB 3DTVD 1JJ7A 4PAWA 221PA 3SBXA 1IE3A 3QJ5A 2JEYA 2ZYIA 2IELA 4RGVA 4WECA 2RGUA 2WMNB 4PYNA 4BFZA 4MKFA 4PW0A 1EA7A 1XTUA 4PGMA 2XRYA 2KSQA 4LZWA 1Z0IA 3CZAA 1S05A 5FLEX 3P45A 2DYSC 1UG7A 4OYRA 3U2LA 1T91A 4KR7A 5EZYA 1ISIA 1U0BB 3HN6A 3O82A 1RKQA 1OI3A 3LUGA 4YDSA 1BYIA 4KGZA 1P2UA 1RKEB 3ZEIA 2R44A 4DQ0A 4X63A 4EATA 4MGKR 3M81A 1Q21A 7YASA 2XYVA 5LQUA 4RY0A 5KYXB 3J7TA 3RIGA 3TLXA 1FC0A 3E9ZA 3HN2A 2C5LA 2QUAA 3HJTA 1H22A 5COGA 3W4YA 2E4WA 1ZNXA 5KYUB 5IDVA 3DAGA 2C2ZA 3WIVA 2BE7A 3BRJA 4RWEA 3PE3A 3W4IA 4R2MA 2YYZA 1V2HE 1GSAA 1VQ1A 1J24A 4C6TA 3C43A 2OCXA 5H16A 2AFHE 4B3DA 2G28A 1JMVA 3KSDO 3ML1A 3GT3A 2R03A 1VI2A 2YZNA 3K7EA 2G88A 1ZGCA 1L5HB 2PF4E 4DGSA 1A5SB 3ZCSA 3RUEA 4MH0R 5DRYA 5AW4A 3EF3A 2B99A 2ZWOA 2VG8A 4MKGA 2C94A 1ZQ9A 1KAEA 3QE3A 4QBTA 3WMWA 4D4GA 3THWA 2B4KA 3O7MA 2HADA 1TZJA 1T8YA 4RZQA 3DA8A 3OOWA 4I6EA 3SF8B 2X2EA 2ECFA 3TQIA 2VPYA 3N0TA 2RHWA 1NBWB 1QOZA 4MUXA 1K9VF 4OG2A 3AG1C 3NMIA 1NZDA 4U6QA 3JRMO 3I0ZA 4RU1A 3A05A 1CYDA 1WS6A 3C45A 3TR6A 3L4EA 3AQ4A 2XTZA 5T41A 2YZSA 4HRYA 2I80A 3FVVA 1T4CA 2C4MA 4IFEA 4MS4A 2IXTA 1FP1D 4OAQA 5GM2A 2VBGA 2FFQA 4IQFA 2BHLA 4D8WA 1E60A 4BUZA 4U1RA 3UFXA 3KEFA 2VP2A 3PSAA 5E33A 1EUQA 2QL7A 1Z18A 1OLXA 1HTBA 1M0SA 1NDUA 1G1MA 1P7CA 4H1WA 1Z75A 3I01M 5EMLA 2X8AA 1HURA 1E85A 4RL6A 3ZDDA 5HGXA 3X1MA 1XA3A 1X1CA 3NHMA 2AJLI 4C1NA 3PT5A 1Z0SA 4J1SA 5TY0A 3C97A 4GMDA 2G8NA 2VJPA 4MVJG 2ABWA 1RKCA 1R50A 4N6HA 2HJVA 3SYTA 1KTIA 4YGYA 4EBFA 1YAHA 1PF7E 1CERA 3KKQA 2H9AA 2VHTA 2EZ4A 1WKCA 2RAVA 5LZ9A 1R0XA 3HB0A 4G9BA 4JEMA 3AFHA 2QPLA 2WRZA 4B3XA 5AUOB 4MQMA 4D82A 1YOVB 4P3NA 1K8ZB 3ZU5A 3KYJA 3HCAA 1IQ0A 2F3PA 3E7WA 5HZKA 4Q1CA 4ULWA 2CBXA 2CLCX 3QE4A 3N1UA 3DEIA 5LA6A 2FEKA 5FTJA 5IXYA 5FBRB 4X1YB 2QVBA 1BBHA 3ANSA 2PG3A 4HJRA 2OHJA 1U2GC 1QWSA 4GFDA 1JJBA 3DF9A 3IPYA 1IN6A 2D5IA 1WQ3A 5LC1A 2IYQA 4UMVA 1M67A 4H3KB 2L42A 4GOMD 4RZXA 3C7DB 2LFFA 1W46A 1BRMA 1KEWA 3WMGA 1MCZA 3TE7A 4JT8A 2A0WA 4NK4A 3TOLA 5FUWA 2QN1A 4AO7A 4HEHA 1VJ1A 1XZJA 4MV1A 4M98A 2NM0A 4L4RA 3OD5A 2NVOA 3NDIA 1F4LA 1GKKA 2ONCA 4NNOA 1B23P 4PZLA 1A97A 2O57A 2OHHA 4O59O 3LKBA 1QS0A 3GRZA 5KVCA 4CIAA 3FUVA 3W8NA 1XBTA 4HQKA 3EIEA 3K8YA 5B3JA 3ANYB 4ZDJA 3DOEA 3GGPA 4QFMA 4BE4A 5I4CA 3AG5A 3H1PA 1V47A 4ASUA 2QVZX 4CN9A 1FTWA 1ZHHA 2AR7A 2GPBA 1SUIA 1NSYA 4CM8B 3ADKA 4UQLA 1YIOA 2XXJA 3T8YA 1PK8A 1P5HA 4XD2A 1ZL0A 2RAPA 2WYUA 4HDNA 4B4UA 2IS1A 1N6NA 1I4EB 4O08A 4O4LB 4P81A 1QGOA 4ABTA 4FHEA 2YS6A 1NNLA 1JLKA 1H93A 1VL0A 5U4XA 1M2HA 1K4YA 2BMEA 2X9QA 5DGTA 5EIWA 1R9JA 3THYA 3W9UA 1GAJA 4E46A 4GKAA 2PFSA 1LXCA 4KK3A 5C3MA 4DUYB 2WPNA 5J9FA 5AJYA 3OHMA 3T1OA 2HY7A 2XOEA 5EL0A 4ZDWA 3IA2A 5DYWA 2C5EA 3QGMA 4ZVPA 2P2SA 2OCKA 5T8KC 4YRGA 3DJFA 5E4JA 4HN2A 4MW5A 4BFLA 4WBNF 3KQOA 1XV5A 4GPD1 1FDSA 3M2PA 1ZHFA 4LZJA 5B37A 2I1LA 5J40A 2XF2A 4XGIA 1UAAA 1D9XA 2O4CA 2MSKA 5EHIA 1U7UA 1SG9A 4N5MA 4H3VA 1L4BA 1OYVA 2OM2A 2F2TA 2NO6A 3GFGA 4QDOA 5KZMB 4AKHA 3IE1A 4D4KA 2ZUSA 1X7YB 2W4BA 4N8EA 4F5ZA 3NT4A 1N6RA 3ZWNA 4RHXA 5BNIA 1Q6ZA 4Q16A 2QUJA 1Z4MA 1G64A 4RL4A 4BLPA 4EUKB 2D1YA 1AUVA 1KNQA 1CUJA 3PNOA 4C5AA 1JHVA 3PQ4A 4FHFA 3NKFA 1E20A 2ID9A 2V65A 1IM8A 4M0MA 2V6GA 4QNNA 4RJTA 3RRFA 3NDBB 3PD0A 1NXSA 4P38A 4XR9A 4JI5B 5FEUA 2IHZA 2OYRA 3WADA 3UWMA 1E2QA 2R87A 3E3LA 3P97A 1Z13A 2R9VA 4HBGA 3AGTA 4YMIA 2AS0A 1KOFA 2WNHA 1RHQA 2W6OA 4A8HA 2GEVA 4MA5A 1Q0TA 2VZ9A 2PX5A 3FCSB 5JCOC 1MUUA 3MYYA 2Z8YM 2R4UA 5A2GA 4PR0A 4N65A 3OE1A 5TMBA 3UVEA 4W5OA 2ID8A 2Q9UA 1VCOA 3WLOA 4LDAA 4J4HA 1G8PA 5BN3A 4DNQA 4GLLA 1CUDA 2JBAB 1TEXA 4DV6B 1PW7A 2ZI6A 4OHRA 3ELBA 3R3JA 3ZJYA 4RJ2A 2D4AA 1HDCA 1DBPA 4NLLA 4H1TA 1J8QA 3IRVA 3WNZA 3PNBA 5IYZB 4WN9A 4GWLA 4FGZA 3GFOA 2NU8A 1RC8A 3ZG6A 2DERA 3WMFA 3UMMA 5DNVA 1R6XA 1T8SA 2Y0CA 3MUOA 3KJQA 4H59A 5A4JA 2EDCA 1M66A 2I9PA 3FTFA 2J9WA 4XWAA 4PX5A 5JEEA 2W45A 2XB8A 2OXRA 2B82A 2W83A 2CDQA 2I4TA 1A2BA 4DZZA 2IK8A 4CM3A 4ZV4A 4QELA 3AP3A 3KYBA 3CA8A 2R84A 1AKEA 1JJVA 5KCMA 1U2PA 1MAVA 4B82A 5HKKD 1WF6A 4KSYA 3QKIA 3DDZX 4O1MA 1ZZPA 4D57A 4C6RA 4XPIB 2PH3A 2PX2A 2IE8A 4EG0A 3I30X 2BM9A 4XA8A 1F1JA 2HRBA 3N8GA 4AL4A 3EIFA 1U5AA 4AUMA 5ALGA 1P9OA 3TZHA 4CMEA 3AB3A 3RYHB 2O2YA 2O06A 3DD1A 3REQA 3PD7A 3O4RA 3QITA 2X3FA 3G9UA 1UH5A 4V24A 1Y42X 4EZIA 1Y6FA 1V6CA 1P9NA 2HJRA 1J1UA 3ET5A 2PWAA 1QR6A 2GDZA 1FLDA 3K0CC 5L95A 2P5YA 2YLIA 1YVEI 4OUKX 4FB4A 3LC2O 3UK7A 1R74A 1G21E 2BSQA 4I1VA 2FY8A 5HIJA 3B1JA 3WS7A 3DJUB 2DY1A 4BRWA 1MTZA 4GMHA 2LTAA 4GL4A 2NPUA 3GFFA 5AW0A 1LPPA 3PDMP 3ZS9A 3U44B 4JZKA 2C4VA 3TD7A 2R62A 5TQVA 3ZU4A 2CXOA 4CF3A 2Q6TA 1MZVA 4YDRA 5I7EA 2PT6A 4MI9A 2DCMA 4LECA 5AW1A 1H9GA 5DBOA 5FL7D 3I4FA 1NHGA 3MJSA 4TYNA 1VGVA 3TDMA 3HO6A 4I6GA 3GEEA 1JTVA 2A6HF 2SECE 4GL2A 4A6DA 4U7WA 2VVTA 3EQLF 4WWHA 1CGNA 1INLA 3T9OA 2X51A 4Y98A 3QWAA 4FFMA 2KHZA 3PEVA 2H5LA 1NYRA 1WHTB 2ZTSA 2ZBGA 4KV7A 1JB1A 5K8IA 3V8MA 2M1XA 1KORA 4L0QA 4L0DA 2UZ1A 3T5MA 3PHF2 2ZRDA 5KHLB 2VAMA 4L76A 1WCV1 4DLUA 3WIDA 4RTJA 1QAOA 5TF0A 2PSDA 3SXYA 1VP3A 2BZ0A 3T3IA 1ZWKA 2IXFA 3EZHA 4WA8A 1HM5A 1KQNA 4MUGA 4DR1B 3BH0A 3Q3JB 3OEED 1RP7A 3A25A 4N82A 4FOPA 3TW8B 4BV8A 5I9TA 2ODTX 3ESDA 3UJNA 3C7KA 3NM5A 1E3WB 4MZDA 4ENTA 1ZHYA 2O07A 4OK5A 2FW6A 4KO1S 3QSYA 1WZUA 3BJEA 1JAFA 4XVHA 1TC1A 4CLEA 3KTAB 2AXQA 1ZGHA 1Q17A 2R7KA 1PT6A 2GHTA 3MWLA 5FL3A 4KI2A 1N1CA 3HC7A 1FX0A 1X7HA 5B57C 5EXXA 3H11A 3N39C 2VT2A 1TKRA 2EW8A 3WLSA 1GZUA 3CLRC 3AW9A 2G4CA 1XD2B 2IZZA 2DM6A 3QI7A 1U7WA 1ZG3A 4TSFA 3QG1A 4I8XA 3EF0A 1GG2A 1EFHA 4MV4A 3UYKA 5DM2A 1J90A 3H1FA 2B8TA 3IC5A 4DCUA 4KV9A 1LDNA 3DBIA 1JW9B 2ZCUA 3P0RA 3W9BA 3P27A 2B8WA 3BMCB 4U2KA 1TYBE 2GBLA 2GBCA 1GA6A 3TIGA 3AVTA 4I4TF 4YUXA 5TVGA 4KG7A 1G2IA 3M1AA 4F9TA 1OASA 3KPHA 5JCXA 4TTIA 4EA8A 5KQLA 5HM8A 3GEPA 2CKMA 3MCZA 4B7XA 2C3PA 5AK0A 3ZWDA 2P6MA 3DNPA 2Q5LA 2WZFA 3M1YA 2P41A 1CEQA 4AIIA 1VBFA 1FDUA 4MWCA 2H1IA 1DX9A 3EMVA 3JQGA 4XM2A 3LTEA 2Z6QA 4KUHA 4RK0A 3AUFA 1LDBA 4BNZA 4G86A 3RVYA 3LLSA 2Z56A 5T64A 1QGYA 4U7JA 1JDSA 1SO8A 2MIIA 2P2DA 3GQBA 3MAGA 4Q7JB 5D84A 1G20E 1T3HA 3LCVB 2BGMA 3MWKA 3NBAA 3ANMA 1CHDA 3V7UA 4XSHA 1EP3B 3X1OA 5DT9A 4NATA 3HKDB 4F2GA 1DI0A 5TJHA 5ALJA 3MM4A 3FKJA 3TS1A 3U2QA 5E4FA 3UYLA 3O8RA 4F3KA 2WHPB 4S1PA 2Y0DA 1OFUX 4DLWA 1KVSA 4HAYA 3OKPA 2XZTA 3WK7A 3ND9A 4DSNA 5KNLA 4QXMA 1AZSC 2Z1NA 5BV7A 5CNKA 1ETHA 3WZLA 3I5YA 1RBZA 1Y8ZA 4F4CA 4TVOA 4U5FE 2JX0A 1EUYA 1ANKA 3D7NA 3U7IA 1OBFO 3LF2A 1BXGA 1JXMA 3OF3A 3KH2A 1L7CA 1K3UB 3CO0S 2GUWA 2QUKA 1WX1A 2ASEA 4TS1A 3G4ZA 4U5CE 2BJHA 4M0UA 1VL8A 4CUZA 2M9MA 3WGGA 3TOSA 4PAMA 1M6WA 1D1AA 1M6VA 3KUDA 2DG2A 2WTAA 4MJ3A 1KI6A 4O1HA 3C7TA 2FPIA 1YJ5A 1C30B 3LOUA 4Q66C 2DECA 4NZMA 3CYFA 3CLVA 3STYA 4AIRA 2A86A 3H1BA 1ECBA 1UEIA 5F12A 4TT3D 2DYRC 3FNEA 4R1NA 3IUMA 1AN0A 1SVKA 4OX9Y 5H4HA 4I4IA 2XMPA 2HHHB 4IXMA 1SZJG 4I9NA 4Z9IA 3AXTA 2OR3A 4IIJA 1E1QA 4NE9A 1SMKA 5JANA 2IY9A 2NADA 4C6HA 3ZLJA 3KLNA 2AC7A 1XPUA 5EGNA 4MRRA 4JJ7A 3DZHA 1Y1TA 3U3BA 2VIIA 2PFDA 3F7OA 1C8LA 4K9KA 4H1UA 4QDKA 5ICSA 1G5RA 1X14A 2Y67A 1GL7A 1EDBA 4A73A 3CY6A 3BX1A 5J2TF 1SCQA 3UMKA 5F5NA 5KWSA 1XRQA 1Q0GA 3OZGA 1A50B 4GKBA 5BQ5A 2FN4A 4WXPA 5LJIA 5B3JC 3I3SR 2I8AA 1VGQA 4RHUA 1UMCB 3NIFB 3NUZA 2IBSA 4ZZ1A 4K7BA 1S9DA 1N2OA 4FSXA 4AICA 5J58A 3U6KA 1JLMA 3A3KA 3QVLA 4FDTA 1M8GA 4UBMA 4ZU6X 4DSTA 1HQDA 4B6OA 5DBIA 4D96A 3LZDA 3UGKA 4LJ4A 4U2GA 3PVZA 1IL0A 2JJ8A 3HL0A 3KB1A 4FXPA 3R8FA 3EVTA 1J8YF 4TKUA 5D3KA 2OILA 3K9LA 5BOSA 4J2OA 2VZ0A 4HGPA 4HLUA 1KMHB 2ZXWC 4IM7A 2XNDD 2W71A 3OT1A 4NU8X 2G4LA 1RR6A 3H1TA 4ZEMA 3OM0A 1RPNA 4ZYUA 1E1DA 3E81A 3G5LA 1ZJ5A 3T5DA 2P9YA 1YCGA 3EFOB 3EGDB 1R15A 4UMFA 2V96A 6ADHA 1YKFA 1KI1A 4G2NA 5IZCA 4CEIB 1XIVA 3L8EA 2JGRA 1BW9B 4UTRA 5GVSA 3ELUA 5GM1A 1ZGAA 1ZZEA 4DIOA 3RFTA 2P7VA 2R1VA 2A4MA 3JQBA 3MIIA 4QPCA 3ZWWA 2Q0HA 1MU0A 2IU3A 2A9FA 3WLHA 5LOVF 3ND5A 3BGWA 5D6NA 3FIJA 4O4HA 3CGWA 4JC7A 4AU1A 3NH9A 3AFOA 2R6ZA 1LS1A 1XKQA 3AF1A 1C5KA 1HEYA 4F72A 5JJBA 2UYOA 1EUZA 4NBRA 2FLVA 3G2NA 1PQUA 4OIPF 5JXGA 4IWXA 3A2LA 4R0NA 4EZBA 3IBTA 8MHTA 3AP1A 4YJFA 1GLVA 3UV6A 2ZU6A 3TBHA 3RQEA 4UM8B 1F0YA 2HMSA 3CUKA 1NUTA 1D7OA 2JFNA 2BTEA 1SKBA 5K7SA 3RFXA 1G2OA 5F28E 2VHZA 2Y0PA 1GV1A 3EAGA 2C3UA 3A6KA 5HOEA 4IRXA 3ICCA 4XIYA 2ZAGA 3NAQA 2G0NA 4QM6A 1ZRMA 4BUCA 4H7PA 2IDJA 2ISSD 2CCKA 4GBMA 3T7EA 2Q21A 2NVBA 1UKZA 4YYZA 4XX1A 1I7SB 4D4XA 4MPPA 4M1KA 1Z4JA 2J41A 1NE2A 3MS4A 1NRXA 4ONEA 4COKA 2GN2A 3BDVA 2JAOA 2GESA 2NPIA 3KJEA 4ONSA 3WGVA 1C80A 1HL3A 3TW0A 4C2TA 3EC2A 2Z58A 5IG2A 1ZCAA 2YN4A 5FYQA 2RAUA 1NNUA 1GQYA 4UTPA 4ZU3A 4TRNA 5H8WA 4RS4A 2P6PA 3M6MD 3U4GA 1ZM2A 4CI0B 3WKDA 2Q5IA 2PLWA 5I7RA 4QO8A 5KNCH 1W36D 4HOYA 1VL5A 4G5QA 3AEKA 2WJGA 3FPEA 3H9EO 2O2JA 2ZTMA 1B1AA 3MWGA 4F4IA 4JT2A 4M54A 5ALQA 2Q1WA 1Z5ZA 1I4LD 1ZVZA 4MK4A 2WLTA 4ZIRA 4X91A 1LVUA 2W58A 2AWOA 2C7OA 2HPVA 1B93A 2J0VA 1A5ZA 1DJLA 4F21A 2Q4RA 2R1UA 4DHEA 5ALEA 2FWBA 3S2FA 1AF4A 1WA5A 1ISFA 5A3JA 1V5GA 3E22B 1THGA 1X1QA 4BIMA 3Q9UA 2FSSA 1ZW3A 2ZYDA 4H6WA 2AZXA 2XD9A 4RLHA 1YB6A 1VLLA 4NX2A 1TLTA 4XYLA 1SIBE 3IIMA 1V7PC 3P19A 2QZZA 2X76A 4DIEA 2XVZA 2FPXA 3KHTA 1V55C 1NVBA 4ZYXA 1HLFA 3N59A 2BF4A 2JGDB 3DT8A 2IL1A 4BZWA 1DBIA 3JQEA 4MI1A 2P78A 5C4GB 4WLEA 2VDWB 4GEHA 2ZTLA 1DAHA 4Z9HA 2WVHA 2IE0A 2JGJA 2CE2X 2IWRA 4BNFA 1M2FA 4MNDA 4V2IA 1CE8A 4DLNA 2XA9A 2RGRA 1W76A 2X40A 2KK1A 2VDRB 2PZBA 3AY7A 1IY1A 1PVVA 2R7TA 2WNSA 2DR0A 4R7ZA 3DH0A 4LJSA 5FUBA 4MMXB 4QDJA 4GBED 3W3AH 4WZAB 2WAAA 2JH9A 1NWCA 1GZDA 4WK4B 3JR3A 3ESXA 4WASA 5T4EA 3DVRX 2VPQA 1NI4A 2IXBA 3ESBA 2NSFA 4LC9A 1KZ4A 4ZOEA 1PR2A 2E6KA 3ZZTA 2YWAA 5JBQA 1PR0A 2DBQA 4QUGA 1BTOA 1VSBA 3FGPA 3LO8A 5E1OA 1B6RA 1RCPA 3GW8A 1E6WA 3V6LA 4WXRA 5TXGA 2BIFA 1WSWA 3P9PA 4JUDX 2P0EA 4LE1A 3FGZA 2Z4SA 2J07A 3S4YA 2QR5A 2OVBA 3JVEA 3ZCPA 2YWEA 2D0IA 1GPAA 1A27A 1UP4A 4J2HA 4JCOA 3TLKA 4UNRA 1ZNYA 1CUGA 4OQNA 1XDUA 3MAJA 1F7UA 2QTHA 3PUXA 1RWKA 3S2SA 4I3GA 5DF1A 4P3PA 5A6AA 4GZ3A 3DDUA 3FZEA 2D00A 4WAUA 4NVRA 2DX7A 4YJ2F 1JEQA 2J9FB 3R7SA 1PZFA 3NALA 2PAAA 4RF3A 3Q9LA 2R60A 4TXMA 4AN0A 3GZ4A 2NSDA 2R48A 4MQEA 3ABOB 3ZGYA 3RYFA 1P0MA 2P40A 1NBHA 2FXIA 1NG1A 2YJ4A 3ON5A 4NMLA 4C43A 3BWEA 1YKSA 3SYNA 3VR3A 2PLNA 3MMPA 3I9LA 1W47A 3ZHRA 2EATA 1KERA 2R85A 5CGQB 3Q7QA 5EJGA 5KOJB 1QVZA 1VTKA 5JZOA 2ZJ3A 1QFXA 1RWWA 4H0CA 1UMDB 3B8EA 1HA3A 3SN6A 5DN9A 1ZGBA 1GU0A 2KM1A 4Z9AA 1W2GA 3FZQA 3MVEA 4LYJA 4LF8B 3AG6A 1COWD 1YHNA 4CMBA 3M4CA 1MH1A 3BXHA 1ODLA 1PG5A 2GBLC 5E9QA 1VSTA 4MS3A 1O6GA 1UK8A 3FNBA 2QTFA 4O2AF 4HV4A 2VYFA 4FN5A 3RYIB 2QLFA 2IVZA 3BB1A 1GTJ1 4XYMA 3L0BA 3D0RA 3CU5A 2BHRA 2ONZA 1DSSG 1GXSB 3VPHA 4V0SA 2UVPA 2R5FA 4I99A 3ETNA 3LT2A 1XTRA 1A9SA 1U3TA 1GUFA 3P2EA 5BYKA 3O1HB 3WWEA 3WA6A 3R5HA 5DJ5A 2I2FA 4XSVA 1VZ3A 1I4ZA 1JX6A 3RREA 3L6CA 1LY1A 4FLMA 2EZ9A 2G7ZA 1KDOA 5AMXA 2V0NA 1LDEA 1SCUB 4RQAA 1L4KA 4Q24A 3A37A 1GUAA 1AB6A 4D6XA 3GUVA 1BR2A 1VKNA 2VC9A 2QR2A 2BGKA 2GK6A 1XTIA 1HDYA 1O9BA 3ZU2A 5J43A 3OE7A 4D4IA 1XZMA 3HKEA 5KTSA 4YYEA 3ABKC 1XAIA 2HCJB 3QMVA 3LFTA 3FNIA 3PUJA 3U26A 1J0XO 4CEHB 3M6FA 1SHTX 2RH4A 3W06A 1Y8QB 1L4EA 2ORIA 4BMCA 3MJTA 2NPOA 1NR1A 2BGTA 4O6MA 1X1RA 3ZJUA 1MGOA 4YJHA 7GPBA 1X1TA 1G59A 1IK6A 3O2JA 2VK8A 3GLKA 2ZVQX 3THSA 2C0PA 3DXFA 2XJ4A 1U5BA 4US2R 1FVHA 2A68F 4E1AA 4XUDA 2NVUA 3QIAA 3J81k 3N58A 2AXEA 5L4LA 4X8MA 4EQZA 2I91A 4YCSA 3GUHA 2HQBA 3SYMA 5BV8A 4OP3A 3BIXA 3RUHA 4C7OB 3GJ4A 4YK5A 3T3MB 4KXMA 3EULA 1I7NA 4IX1A 4N3GA 4EZEA 3W9YA 1IG0A 2ET6A 5FPHA 2QWXA 4NYMR 1CPRA 3WJ1A 5H02A 2OGSA 2QTTA 1TMYA 1E2PA 1WSAA 5TNXA 2BKEA 5EJFA 4E5NA 4B5LA 1B2LA 5A5FA 5E9WA 3BIWA 1NX9A 4OHUA 2Q7XA 1TFRA 3SXKA 1YDEA 4HRVA 2AN3A 1M34E 3PP8A 3IJEB 5D6OA 5DHUA 1Z83A 2FPMA 4HS9A 1WLYA 1NP7A 5BPHA 2BP7A 3LY8A 4Z1MD 4MCAA 1KQ3A 2RSLA 4CL3A 5KREA 2XMCA 1XYYA 1SXJA 3ABSB 3A2MA 5EIXA 1U98A 3EDQA 1ICEA 4E88A 1WQ1R 3MX3A 1NZJA 2GJ9A 1Y3DE 1ORYA 1FS4A 5AOAA 2P75A 3O8QA 3JVUA 3F46A 4OBEA 3LESA 2ADOA 1FFYA 3LHIA 1LPSA 4GM1A 3MZ0A 5DCUA 3FROA 4PPGA 3SOZA 4NOKA 1W5SA 1DJNA 4MV8A 4PYMA 4MVXA 1PJ4A 2W42A 1ZH6A 1D4OA 3R09A 1DO2A 5KO2A 3RSZA 4S1TA 1QH1B 2AYZA 1ORIA 3B3QA 1ECPA 1I51A 3LUKA 2DI3A 3AETB 3ZKWA 4BC0A 4JA0A 1E84A 1H42A 1GOTA 1LCIA 4IMJB 4ND1A 2ADMA 1VKZA 1LI4A 2FSIA 2P4UA 3O2QB 4E6PA 3U9MA 3ETCA 3E2MA 3YASA 3BHMA 4L16A 3IURA 3COZA 4GI2A 1BQ3A 4HLUC 2VTVA 3CLKA 3L7JA 4M87A 2Z4TA 1DAMA 4LFCB 4OX9B 1EFDN 1Y8CA 3L1JA 1EYZA 2O8EA 5HK8A 5CB4A 4C76A 2CLKB 3S2UA 4MGHA 3VZSA 2QJOA 2ORWA 3BJMA 5KPDA 1C03A 4DMMA 4L4XA 1UOOA 1YI0A 2EWWA 2CYBA 3MHPA 3ROQA 2IS6A 1XK7A 1EFRA 2FW8A 4XARA 3LP8A 4AJIA 2R7WA 7ABPA 4AJOA 4KE9A 3QUBA 3C1OA 3SIXA 4WKPA 1XNJA 1S2DA 1QRAA 3J81A 4EWCA 5MF6A 1IOVA 4Z4FA 1BG6A 2QB5A 1E9FA 3QK7A 2JRLA 1WHSB 3LZCA 4O6YA 3JQBC 4IHQA 3BXEA 4B4DA 3VOBA 3JQAD 2I3AA 4PHHA 4DIMA 4XIGS 4CIWA 5LKAA 2NXJA 4DRXB 5EE0A 4FBGA 1TUBB 2FQXA 5DXJA 3MBOA 3BUSA 2BFWA 1N0VC 4EYSA 3W3AD 2ZATA 5K4AA 4U4AA 4YRSA 1TI7A 3SX0A 1D8TA 4QI2A 2AVNA 5JUAA 1JEJA 4YRNA 2GD0A 2A1DD 4N48A 1D0VA 3VU3A 4MA0A 3HM9A 3QTLA 2PCLA 4DLYA 3IOEA 4BQFA 4CMCA 2ILTA 2RI6A 1X9IA 5BYAA 5A5DA 1GKIA 1S2GA 4HPJB 3D7RA 2W2TA 4Q4HB 4A10A 2D54A 4AG6A 1TVKA 5EYPB 1JR3D 3OZRA 1RFLA 5AKXA 2VT7A 4TXNA 3N7UA 4ZVVA 1SC1A 1PL7A 4UHKA 4QQNA 3VR5H 2CW5A 2DZDA 1Y80A 5ETJA 2FTKE 1N4DA 3IBFA 1XAGA 4KJXA 5EJ2A 4OK3A 5AW2A 5K3FB 3HUEA 1L8OA 2TSYB 5KQRA 1JDJA 1R27A 5JXIA 3KYDA 3B2QA 5KSZA 1CULC 4Y6QA 1UJ4A 3RGGA 5F5FA 4LWPA 3ZDAA 4NICA 2YVQA 3EB9A 1P2DA 3Q5GA 3SM3A 4WSOA 5J1TB 3T4RA 9LDTA 2LGJA 4E7SA 2BRUA 1NLUA 2PKQO 2ZDGA 2WVQA 1KJIA 4L7VA 4XGQA 3ZBPA 5JXHA 2EKDA 1S7ZA 2ZBQA 1ZA1A 3QVTA 1J0AA 4MRPA 4N0EA 2XMGA 3AUSA 1JI3A 3QBVA 1M1NA 3VXKA 1U0HC 5D86A 5JTTA 5EZ6B 4OXRA 1N6HA 3EFBA 3HJRA 1FIUA 3WDKA 3QKRB 4QUJA 1P1IA 1L5KA 1GAEO 4CDAA 4I4CA 3MTEA 1W0CA 1XTSA 2LD6A 5KSWB 4DXDA 3LWDA 3ENQA 1WEKA 5DVZA 3E70C 4P9FA 4V0NA 4UDOA 3U0CA 3S55A 2XUJA 1FJXA 4CQMD 4BN5A 2QROA 4IGAA 5LA6F 3M8KA 4W5TA 1YVRA 1MKYA 3O0DA 2C96A 3GRYA 2ZB2A 3L0ZA 5H3HA 1GGKA 4F5WA 5K4HA 1EDOA 3ENVA 4JI0B 4QXPA 4DRJB 4XEHA 1LPEA 2PMBA 5BN1A 3PHGA 4WXHA 2J7PA 4U9EA 3HBJA 1KO1A 1PWZA 1QFMA 4HWGA 4YUAA 4MW0A 3FUUA 2UXCB 3RAGA 2SBTA 1YR1A 2NUPB 1E59A 5LMCA 3PX7A 4I1SA 5I6DA 5I8ZA 4BEWA 3CLTD 5KS2A 4LERA 4CG1A 2A0YA 1NBMD 4HGQA 2FOLA 4EB6A 4NPCA 3TQFA 3BA1A 3JRWA 2M6LA 1L7EA 4AWAA 1WVGA 4OHMA 4OI2A 1SVMA 4PFOA 1MMFB 2R66A 2CC2A 2BGIA 1H2WA 4ETIA 4KR3A 3UHPA 4N0DA 1XU7A 4MYRA 1XJ0A 1K7EB 3EWIA 4RZUA 3WWCA 3OM9A 4KBYA 3Q4GA 4S1OA 3RBAA 4LVOA 1WVMA 1IW7F 4JBHA 1RRVA 3DL4A 3U17A 2FPOA 3VYTB 2Q45A 2E4ZA 4DBVO 5EKUA 1NVVQ 4H0FA 1SC4A 4H3SA 2J3MA 3V1MA 1SHLA 1UR5A 2H2IA 1JG4A 2HX1A 2OV2A 4QJ3A 3VZQA 2GXSA 1YE8A 2H31A 6REQA 1FYFA 2NIPA 1L8XA 4BB5A 4BMXA 5C5EA 3GEIA 4TMVA 3QVKA 3V3KA 5KJ6A 2HYIC 1YUMA 2JFBA 5CG1A 2Q5HA 1ZHOA 1RJFA 1EGHA 4NE7A 2GF2A 1LV7A 2VBIA 5GQSA 5AHOA 2NVWA 3LOPA 1FSPA 2XEDA 1YQEA 1ZPDA 1ATIA 5J4HA 1ZCFA 4OB7A 2JLZA 4YP6A 3FR8A 4L8WB 2FPPB 3KEOA 2HKIA 5CH3A 2XGJA 3NHAA 4UKDA 1NR5A 1T1EA 1EFPA 4DOZA 4J1NA 2Z5LA 2QSJA 4RF2A 1KZ6A 1Z2OX 1YL5A 2I76A 1ZEJA 3BRSA 4LCBA 3VDQA 5AJXA 1VTMP 1N78A 4FLEA 4C0BA 3KOZA 2BGNA 2HH9A 4PQYA 4O4JF 1C1XB 2AZDA 3EVFA 5DWDA 2CFIA 4RA9B 5BWNA 3ZVMA 1BH2A 2WG1A 2XF8A 5GPGB 1AX9A 4YJGB 1QPUA 4DBLC 2W98A 2AOTA 2IGBA 1SOVA 1B4DA 2BHTA 5HTKA 2YVUA 2ZIFA 4DNFA 4OM8A 2EIXA 4C7JA 2NQTA 1XJWA 1B0UA 4RH1A 3AGPA 1U8YA 3PCXA 2EP8A 4IX9A 1W0JD 4CM1A 3PNMA 4ER0A 2PRYA 4X66B 4QM7A 1KSJA 2NTJA 3ZDYB 4KXNA 2PMKA 3KE8A 3H4VA 3HYNA 1WATA 4C0HA 4IV8A 3C3CA 4OH1A 3MFQA 1OCZC 4EMUA 2G0AA 1IEVA 4EKYA 4KXXA 2C3MA 5JARA 2FFHA 2JD0A 1ULZA 3LBIA 4JLUA 4M1MA 4KRYA 4UHHA 5MGNA 1VHWA 2D0OB 2P1ZA 2WSSD 1E2DA 4X5OA 4IIVA 3Q6NA 1DOHA 1L7BA 3PXCX 3STTA 3NDJA 2ZYHA 1WAMA 5IBQA 3GRFA 4ZVKA 3RQSA 1Z5OA 2BE5F 2FVYA 1VE5A 3KZ1E 4G0QA 3UV3A 4Z0HO 3GLIB 5AJUA 2ISCA 3SAJA 5BMVA 2DC1A 2DBVO 1AQJA 3I9KA 2PSSA 5JS7A 2GZHA 5FKJA 1IHYA 5AXAA 1E0DA 4C89A 3USCS 3G82C 2ZJBA 3L7IA 1E7SA 5BWOA 4W99A 2GVZC 3FAKA 3U0VA 3SCZA 3GLHB 2OCYC 5IHPA 4ARZA 1HL7A 1D1TA 1M1YE 1BXRB 5L3VA 1NF9A 3PGA1 5GVRA 3W5UA 4FIZA 1N7HA 2VI5A 3TSZA 4DABA 4OGGA 2GVDC 4HFJA 3OJEA 2FU5C 3EAQA 4S2UA 3NKDA 2OCBA 5E8RA 3KJZA 4QPDA 4QXAA 3F7MA 3Q7EA 3RIPA 3DPUA 1DWQA 3B5IA 1PU2A 3L4JA 3DWFA 1OMOA 3KRTA 3AZQA 3PEFA 3N2ZB 2VPTA 3WLNA 3IEKA 3L2OB 4G65A 4ZT6A 3PWSA 4Q3BA 4OB8A 3OCJA 3L3BA 1HFKA 2J33A 3H65A 1ODTC 4H7EA 3UMSA 3LUTB 4IUDS 1D2EA 3A1TA 2GN8A 4PZ9A 5JYEA 3JZIA 3T35A 1H8HA 1EKXA 1Y5NA 2C78A 1CDZA 4YAIA 1EQUA 5K3AA 5CVCA 3AEXA 2PUEA 2I71A 2FV8A 3G5UA 4PG6A 2B1GA 1J0DA 1ICIA 5TF4A 1IJFA 1GLNA 2IYYA 2P7IA 1XZKA 2EYUA 3VR5D 3PDWA 1BEZA 2K6GA 1SXJC 1P9WA 4NC3A 4CJGA 4OGFA 3UH1A 5LFAA 4LJ7A 3ZUPA 1H2XA 5GAJA 2OG1A 3VSDA 2AW3A 5DGIA 3AVUA 3EGWA 1OXTA 1DBRA 4RH0A 2P2CA 1CJTC 2QTVA 4KHPB 3TIVA 1VPLA 1G19A 4BKPA 2P5SA 5ICEA 3SXJA 3EUAA 2FVXA 3SSMA 1EK1A 1NMYA 4HN4B 3DE6X 3O4FA 5JBNA 4GX0A 4QBHA 2Z6UA 2QRLA 3QFHA 3TYXA 5GADl 1FTSA 3H8SA 1RAEA 2H4FA 3SBEA 1G41A 2CT8A 1KIFA 3SJUA 2WFMA 3QSGA 3PC2A 5KTPA 2FAXA 4Z9XA 1EESA 2HNBA 2JHAA 2GX6A 1Y7PA 4EPRA 3ETLA 2PWYA 4CGZA 1WOLA 2I6QA 3RWOA 4N6GA 3RHZA 3MTJA 2IHYA 4OHYA 1IY9A 1JIKA 4FGUA 4YREA 4K2AA 2WDZA 4A0QA 4CIDA 1U81A 4YONB 1EMDA 5FOWA 3UM9A 4JP8A 1EXNA 4JCCA 4FFBA 4EJSB 3RF6A 4EQ6B 3H2ZA 3RANA 3QY0A 4JEAA 3SSNA 1L5VA 2I6SA 4DQDA 4LXGA 2TECE 3DEAA 5LQNA 4BO6A 3RR2A 1SOUA 2DOKA 4UBLA 3R3WA 1L1EA 2FWIA 4K3VA 2L9JA 2QTNA 1NYQA 3OFND 4AF8A 1G6HA 4LDJA 1VM6A 2GM4A 5CH5A 2XLHA 2QE7D 2BCJQ 1M8FA 5CFMA 1H0SA 2RGYA 1EVKA 3DYVA 4JW1A 1NJSA 3ZLTA 2XT6A 4MW3A 4PZYA 1CJVC 1M8PA 3L0YA 4EG1A 1QQAA 3R5JA 3SEAA 3UMFA 4AY5A 4BE9A 1S2OA 2XTAA 1VHLA 3S5UA 5T3WA 1II8A 3VH3A 5FHQA 3GZNB 4J91A 2ZVDA 1OLUA 2OV4A 3AK4A 4MLDA 1FBTA 1I10A 3CJRA 1PV3A 1W94A 2J9UA 4E1VA 2Y1DA 4NZZA 1FFGA 3MGAA 4LJ5A 1AK1A 4OA5A 1ETUA 1EHYA 2APJA 1NYLA 1TEVA 4BJ1A 1N8TA 3NMUF 4NFLA 1KO7A 1DFGA 1PE0A 1IBCA 2MT9A 3AXSA 1NP6A 5A5VA 1G8GA 3B85A 3TQRA 1G38A 3GLFB 1V3VA 1KR5A 4AVYA 1HFWA 1TO6A 3I73A 1YARO 3VRCA 5CG2A 4R1SA 2R6DA 4R7GA 3ZIBA 1LX7A 3IEPA 4E5PA 4K6CA 1RYHA 5KYKA 1SKQA 4LV8B 2X1MA 3F3KA 3CF2A 2XZOA 4NG4A 2ZXEA 4LDNA 2V55B 1PL8A 1ADJA 2PYIA 1I1NA 5IUKC 4HDKA 4B17A 3FUXA 1D8AA 3DXYA 4LF9B 1YZNA 4G7HF 2GWRA 4CPDA 2CUTA 2OV1A 3IQ6A 3EW9A 3A9SA 1URPA 1G3RA 1CHNA 3DE4X 1X7XA 4QHTA 4QYIA 3LA6A 1P1CA 2J9BA 4LYYA 3SZ3A 3K5PA 4BCCA 1N2CA 2XTJA 3LKDA 2H5JA 1D6SA 1W35A 5EMNA 1PEKE 2BRUC 1HT0A 3FMFA 1P19A 3I34X 1A96A 4G9GA 2O0LA 2CXSA 3Q88A 3VDMA 1OV4A 3M9WA 1YDIA 4JOBA 5EP3A 4GX2A 1R8YA 4I1OA 4EO7A 1E9AA 1O3UA 3ZDXB 3DZKA 4R01A 1YCDA 1GYRA 3HEMA 1IPFA 3FR7A 3JX9A 3S7TA 3MBGA 3FH0A 1YS2X 3KYCA 1NT2A 2WM8A 2GCIA 1IFXA 3IOBA 1Q74A 2PZFA 2QTLA 4RK6A 1Z0AA 1VLSA 4PPYA 1GTL1 4IOKA 4XWYA 3X1ZA 4JZYA 2F3UA 2C8LA 4NBWA 2H07A 4GP7A 1YBMA 2GJ8A 2JGEA 3T9BA 4Z4HA 2XB2A 3PR1A 3PFHA 2HV7A 3WLTA 1RJDA 5U9CA 1BWSA 4Z7JA 4WEQA 2JW5A 1H3EA 1LWOA 2GKOA 4DCOA 4MS1B 4JC8A 3IELA 3IEEA 3IMFA 3ZWOA 3LHFA 1ZX1A 3GNSA 2R751 5KOYA 3W05A 1BS2A 1GGHA 4LUCA 5A6KA 2EOAA 1L5FA 4YMSA 2ZIWB 1UC8A 4XPWA 1H2AS 4LY3A 1HRKA 1ZK2A 1XA4A 1LNQA 3NT5A 3D4IA 2OMKA 3BGDA 8GPBA 2OCGA 1XXHA 1UCFA 1ZBDA 3A8TA 4M86A 3RVSA 2TS1A 1VKHA 2OFWA 5DNDA 4AO6A 2OBYA 4RESA 5KDOA 3NBKA 3X43A 5FNVA 4EM6A 1PQPA 1Y3HA 3OZEA 1R6TA 3AHGA 5BQIA 3D4PA 5LU8A 2PL3A 3QKUA 3ABMC 5DH9A 1YYJA 2D7CA 1OI7A 4KGVA 4EF5A 5E3AA 1F60A 4YWJA 5JQGB 4KC9A 1R8JA 1ZMRA 4IDFA 1E89A 4M1SA 5AOBA 2VDNB 2IIPA 3AHCA 3TNYA 3LK6A 4Q5IA 2J30A 2WB4A 1V7ZA 2E6UX 5BWBA 4BX9A 4OD4A 1N3IA 4F4JA 2PRIA 3M1CB 5ESWA 1CXZA 4M6WA 1I0IA 3IAS1 4IDOA 4DIDA 4BEMJ 4KO8A 2QTBA 3A6FA 1G8YA 4RWZA 1B1CA 1MLDA 4DCNA 2I2XB 1DGQA 4RACA 3TDKA 2YKGA 2H1RA 3N5KA 5I7OA 1ZN2A 1USUA 2HT1A 5BV2P 3HZZA 2UUHA 1UJCA 1Z2DA 6Q21A 4BXOA 4OXKA 2FSPA 2R86A 3FVRA 2ZXOA 2ZJFA 2QQ5A 3OQ1A 1AHHA 3WSWA 3RS9A 3FAPB 2O19A 5SZIA 1K68A 3JS5A 4FXOA 1NVFA 1JXOA 2QVGA 3EDMA 4CM6A 1XRLA 5BVGA 4U7GA 4O4HF 3M0EA 4OLFA 4L6CA 3A4LA 2PH7A 1N7GA 3G6KA 5HF9A 3ZDFA 3IAFA 4BQQA 2QN3A 1P3JA 4G0PA 3I8SA 3R4VA 3PUVA 3PXAA 3DTVA 2W8BA 3FOOA 3ABZA 5F33A 2BMFA 1XT6A 1KJQA 4A91A 1WBBA 3PDJA 4AE4B 1JQJC 3L05A 1HE8B 2R4TA 3TNJA 4BMYA 4UZFA 1P1HA 1QPZA 2OE2A 3AUXA 3K94A 3HU5A 2YIJA 4QUBA 4LRTB 4XDYA 5KC9A 2A9OA 4TWJA 3PC6A 1IN1A 1OVGA 1PEYA 4EJ6A 3DE1X 3LQKA 5JPIA 2V54A 4HDRB 1MPXA 1ESEA 4KH0A 2GF9A 3QQPA 1WW2A 1BCRA 2RG7A 1S4MA 4P84A 4LGYA 1A88A 2J0SA 3MOGA 3AHHA 4GM4A 2E37A 3WGOA 1Z2AA 1USKA 3A6LA 1GNTA 4X41A 1VXRA 2MSEB 1GPKA 1OXXK 1YZUA 1JU9A 4QFCA 4LE0A 4XLZA 4XRGA 2DWOA 4ND5A 3LCJA 3WMEA 1NPYA 1E2UA 3GV0A 2YDYA 1DQRA 2ONJA 3AHIA 3OQHA 4PZZA 4EO9A 4JUFA 2JAWA 3LUAA 3QZCA 1XQVA 2ZRKA 4JIMA 2PNOA 4CQMA 3MB8A 5T6BA 3FPKA 4OHKA 4Z0NA 4RMHA 4LS3A 3M79A 1EP1B 2HTEA 5J2UF 1NA5A 5LD2B 1QQ3A 4BAUA 4JV5B 2A59A 4ZVLA 5AJVB 4YRPA 4PNEA 5BSMA 2IHJA 3W4KA 4F5YA 4ENPA 1VE3A 4N6NA 2AHOA 2O9JA 2VJOA 1L7RA 4NH0A 3PKZA 5LYJA 4JI2B 4C05A 4EB0A 1PWEA 3IERA 2XM0A 1FMLA 5CT5A 3FMSA 1VIMA 4JQYA 1SIUA 1S2LA 1LA2A 2QX7A 2VPIA 2V7VA 2HMUA 2XYHA 1ZSNA 2RI1A 5CXSA 5AM0A 3LSTA 2I6XA 4WIAA 4C78A 1Y7HA 1ZH4A 3CX6A 2VDMB 2I9KA 4DMUB 1WPGA 2AJ8A 2IITA 4L9SA 1ABFA 1C1DA 3CEPB 4E5UA 4XXHA 3FNQA 4IG4A 3RUAA 1Z56C 1JYFA 1OB2A 3BILA 1PR1A 2ID7A 2VR1A 3PQ3A 4FPXA 5DCWA 1I7PA 3KDAA 1AB5A 1RHUA 4GSLA 4YQFA 1KGDA 2BISA 2O5CA 2WFAA 2J9VA 3L40A 4BNXA 4PVDA 4K8OA 4BNMA 3PFGA 5A4IS 3D64A 4CS9A 1WSDA 3FGOA 2XVAA 3HMQA 1QUEA 5AICA 3FRHA 2YYSA 4Y7CA 1A1SA 3NW9A 3VR6H 3FCYA 4NDZA 2QQ0A 4PZUA 2J6IA 2QNLA 4I1IA 4ND8B 1O03A 3MT7A 3I5PA 4OKSA 1FP2A 3QQ5A 3CQ9A 2BEWA 2AOUB 3GDHA 2RGDA 4HGYA 2XCUA 3WYBA 3ZU3A 4MQ4A 3WB9A 1U5CA 4L75A 3VKHA 4TS4A 1P5ZB 5GJWC 3HWX1 2FGYA 4GVXA 5SZHB 3AEUA 3GGJA 3T3HA 4R1LA 3LXUX 1GG8A 3C6XA 3ONEA 4EVRA 2BTQB 1U9JA 3T41A 3TCNA 1MO3A 1KH2A 1T1RA 4QYTA 2RJ3A 1LUAA 4PO3X 4CMEC 2I55A 4F2HA 4CKBA 2JAQA 4DVJA 3KJFA 3HADA 2HREA 3EVBA 1RPAA 1D2NA 5BT9A 3BB3A 3LDUA 1R2QA 1JF8A 2I4MA 3X0DA 3HSSA 4EABA 4OJQA 2IHTA 2ACWA 4AZ0B 2VP4A 3NTOA 5IVKA 4D4MA 2VJMA 5D51S 1ZKDA 4DRHB 3MFNA 5L0GA 2XQVA 1JEYB 3RJZA 3OX1A 1L5LA 2HRCA 3E05A 3DMNA 3ZX5A 1DJQA 5TQ2B 4KMMA 2GNAA 2C57A 4FNAA 2QMHA 2A88A 3DV0B 4QUAA 2O1EA 1QO0D 3L4SO 4MQ9F 2HLNA 3A1EA 4J0DA 4W9MC 2A7QA 1Q3TA 4DJDC 4YRRA 3KC2A 3Q11A 1JBEA 3OWTA 4LJYA 4YX9A 1QDEA 3FKQA 1MZPA 1POWA 1D6NA 3F49S 3TNFA 5FTKA 1N7JA 3T6GB 4C20A 1F8XA 3AOGA 3KZMA 5FOVA 1ZK1A 4MVQA 4F4FA 3U7EB 1VRVA 3V8RA 1KYVA 3G0HA 2GKSA 1KXZA 3JWGA 1XQ9A 1NQUA 5DHAA 4GQAA 2YHIA 3C3PA 1K86A 4NG5A 1DC6A 4QREA 1XEWX 4BNWA 4B87A 4RABA 2W2KB 3UAOA 5DHSA 2HS5A 2H0RA 3ISTA 2JIPA 1T5SA 1Q0MA 1RBQA 4LEIA 5B4UA 2VZ8A 1EVQA 1KDYA 3TFOA 4X90A 3M4XA 4OQYA 3ZNQA 1BHSA 2NTNA 4ZANA 1JFVA 4KMRA 4Q9IA 5ALPA 1KBZA 3HUTA 1WB5A 2HU7A 2SCUB 1DUVG 5C8YA 5K0GA 1NU8A 4B3RB 2BKVA 5KQMA 3R0IA 3LC1O 1YVUA 2D3WA 2IZ5A 4O3FA 1D3AA 3UXYA 5UKDA 2DQYA 1P74A 4ZO7A 1HG1A 3PEEA 1QDUA 4IJ6A 4N3CA 5E6UA 4MYDA 3CZPA 5DBEX 1OH7A 4NBKA 2AEFA 1Z6GA 4ZN6A 4MVJM 2DE0X 3KQUA 4NQRA 1E2KA 3KOWA 2ZJ5A 3V8QA 1JBQA 4HNAB 4GI7A 2JLAA 3CVVA 2MWQA 4CKEA 1K97A 2E21A 2JCGA 2BEKA 3TM4A 1VYVA 2ZAOA 1DV1A 1R4NB 3OPYI 1HDEA 4EI2A 3ZHUA 5K0JA 4B8WA 2O2XA 4PO9A 3FYHA 1WGWA 2Y1WA 1EVYA 2PFKA 3JYHA 4Q4LA 5EFOA 1VLJA 4RTOA 3D2LA 1NVUQ 4LTNA 3OBIA 1IM2A 4DIUA 2GXUA 1GTG1 4FDLA 1ZM3A 4HVTA 1X2EA 5DZSA 1JA0A 1QKIA 2D2VA 2NU7A 1MGPA 4IDGA 1TF5A 1O97C 2Q8QA 2OGWA 3LT4A 2J9RA 1Y89A 3QOYA 1N2BA 5LP6A 3IUSA 4PYJA 2CZQA 2CXTA 3KB6A 3LL4A 3STUA 4UQOA 2NO7A 4GLFA 1P1RA 3EYAA 3IO3A 5GY7A 4FZ3A 4M0LA 3IBGA 3I1JA 2EFJA 2I7VA 2AKYA 1XCLA 3O5AA 3TL6A 2NQ8A 1RSZA 1HW1A 5HKKA 3V00A 4V1CI 1HUQA 3MLGA 3X1WA 1TEZA 3LQRA 4LK2A 5FWYA 1HV8A 3S1AA 2BI4A 1L9KA 1EUDB 3U3JA 3CAXA 4CG0A 2O8FA 1RC0A 3RC1A 1BX1A 1CY2A 3TJMA 3W6UA 1SBQA 2Y6UA 3SQNA 2HDHA 2BC5A 2QSZA 2DU8A 1GAXA 1P91A 2HRDA 5CIYA 3INYA 1XL1A 1E3DA 3G2MA 4KRFA 2MYPA 3WWYA 2BN4A 3WJ2A 3CEXA 1SU6A 3I2JA 3GLGB 2W2OA 3DMYA 3GMIA 3LPAA 1UPUA 3MINB 4FBMA 1G4HA 4JLPA 3EUWA 3EXFA 5K3OA 4PONA 1TM2A 1BQ4A 4X45A 3E2IA 1O8CA 1P4AA 1Y1KE 4HVCA 4BECA 4GRIA 1GL3A 4DEXA 5HIAA 1OY1A 4O25A 1QYCA 3OKCA 4MUYA 2FP4A 1OC2A 3MRVA 2LKDA 4ZKEA 3R74A 4QBKA 3T1NA 3A1CA 3C7JA 3OPNA 2NLOA 3P9NA 4W5RA 4ZQGA 2WSIA 2YWFA 4TOIA 1YF3A 1NU6A 3LPMA 1OFVA 3RQGA 1SCAA 2D74A 1D4AA 3ECCA 2X1HA 4TV8F 4LRXA 5FL7A 3SSAA 4ZK6A 5HFNA 1TJ5A 1U7PA 1RPZA 2YC4C 3MJCA 4DA4A 4EKEA 2GPWA 1I3MA 1CFZA 3O6XA 1JHRA 2JEOA 1NIJA 4QXRA 4YJWA 5D3QA 1Z5PA 4D9GA 1SUBA 2W2XA 3S90A 1XG5A 3AM4A 1ZH8A 2G80A 5M7EA 4MVWA 3OLQA 3EEYA 1E9BA 1E79D 7MHTA 3RW9A 3DAPA 3AUAA 4C4SA 5NULA 4HSGA 4G36A 4Y6RA 4EIYA 1VRCA 1L7AA 3W2GA 1OW8A 3EMBA 3RTDA 1G18A 2UU9B 1SXGA 4LY9A 3O0TA 5EKDA 3R6WA 1B0AA 3DE9A 5J1SB 1M54A 1M5RA 1LJUA 3UAWA 3OEEA 3SX4A 3NB0A 4MAAA 2D2FA 3LGAA 2Y0EA 3O4JA 1OXKA 1AUQA 1A1VA 5A9SA 4RKEA 3UB2A 3TZBA 1W1UA 1BFUA 5KTOA 4HWSA 1MF7A 1DAFA 4DMRA 3EWSA 3B6MA 2V7EA 5K6RA 1I4OA 2QT1A 3M4JA 1QHHB 3P4XA 1K4KA 1L8QA 3L02A 4K6KA 1V5WA 3L8MA 5M04A 2B8JA 5CAEA 2H3EA 1LTHR 2O52A 1Q44A 5KNCD 1YQ9A 3SHOA 4F9EA 2G17A 3LC7O 1UP7A 4UE3S 3UKOA 4PLVA 5ICFA 5L6LB 4K6OA 1G5TA 1YFKA 3C0KA 3IQDB 4HQRA 4LRSB 3QZUA 1G4AE 3H2JA 1WDLA 1FPQA 1QK3A 4LQLA 1CR0A 3A4NA 4WY8A 2WUEA 2EEPA 4UC0A 6LDHA 3JRTA 4HDMA 4DV1B 3NKVA 4N54A 1RPTA 4P8RA 5L53A 3NI2A 3CEHA 2RGBA 5G4KB 1PTKA 4BP8A 1R88A 3M9LA 2YY6A 4ILKA 1FQWA 4EITA 5LNK1 5CLLA 2PQ0A 3NOXA 2F9FA 3FTNA 3RS7A 1UFKA 4Z3DA 3ZIAD 2H1CA 3ZNPA 3DPSA 4YPOA 1A7VA 2CBZA 1RC1A 4ZLCA 3WL3A 3L6UA 5AHKA 4MPRA 1XU9A 2EL9A 1IULA 5EZYF 5BW5A 4F4HA 4K1OA 3WRYA 3PPIA 4F11A 3V4SA 2W90A 3QKTA 1UBFA 5ICGA 3MERA 5C7OO 1JI0A 3DOJA 3VC2A 1E6UA 1LK0A 1KF0A 5FO0A 3CE9A 1W4BA 5IZCC 1VMIA 4REQA 1AHIA 4NY3A 1N2IA 1A7UA 3DULA 2OP1A 5H83A 1WF3A 3KALA 2QY9A 3PQEA 4F8JA 3GZJA 4K7JA 4TV9A 1XZQA 3M3PA 4UEWA 2JFPA 4G8BA 2HJGA 3FUWA 5D01A 2ZP1A 1GN8A 1KAMA 2ZSFA 4XYGA 5EJ6A 4IARA 3GGCA 2PR7A 1HKUA 4PG5A 5EJ4A 2AFVA 3NOQA 2ZIUB 2X15A 3ZDLA 4E5KA 2GZ2A 4J7TA 1FS6A 3U4DA 1RI5A 5ENZA 3KETA 1KYTA 2ZBUA 4AKTA 1EIZA 2JL1A 4IIUA 1V37A 3H5OA 3Q8LA 4OQFA 3KQKA 3OCZA 5DV9A 4EDHA 1E4EA 3ZLUA 2VYVD 2I1QA 1PJ8A 3KEQA 2EBWA 1TF2A 5A1JA 3GWGA 1ZN8A 2NW6A 2B7CA 4HDSA 1C8KA 3S5JA 2X5JO 4OQ4A 3EN0A 1I30A 2G1AA 3N3BC 1VJDA 4LG1A 2PT7A 1CRWG 1I7DA 3D6JA 3PR3A 1G4WR 1V8DA 2DHCA 4NKRA 1HDRA 3EG9A 1CYEA 1JDPA 3ANLA 1V4VA 2E4AA 4CTNA 2ZIGA 1UJ6A 2OSVA 4N0QA 2DQZA 4P4SA 3JCZA 2FG5A 2EHJA 4LJAA 1CR6A 4B33A 1FP6A 3T3DA 3IQ5A 3TO5A 4J0JA 4P80A 4LRYA 2H85A 1PFVA 3M82A 2G9RA 1VPTA 3JQCA 1RZVA 4KEAA 2JGLA 3K6JA 1S7CA 3U3ZA 3PNLA 4AI6A 4YP7A 4OHPA 5AM1A 1K8RA 3BSWA 3TR5A 2Q50A 3QV1A 2LXNA 2OO5A 5FOSA 1SC9A 3CBQA 2ZI3A 5JY1A 4XFJA 3ZGVA 4CS9C 4NL4H 3WKAA 1X7GA 4Z2YA 1N0WA 2P5TB 2VBCA 2G70A 3AFNA 4HRAA 2OD7A 3OQBA 2H7OA 2ZTHA 5I9IA 3RVQA 4TT3A 3QOFA 3BWVA 5FCDA 3TJZA 3CVWA 2XLMA 2HEIA 4IMRA 2A9RA 4DBLE 2QUPA 2PUBA 5JROA 4K05A 3BULA 3A7DA 2X41A 3DVQX 4JWKA 2ZQ5A 3IKVA 3QPDA 5DLYA 3RU9A 3KXKA 3ELWA 3K6RA 2AOXA 4EIWA 1TM4E 3S3TA 3Q3IA 1P0IA 4YAFA 5JDIA 1I36A 2F6RA 3LM8A 5CD1A 3GN2A 4Z7QB 3PB3A 4U5GA 1R4ZA 3IMCA 4IINA 4LTDA 3O55A 2B1JA 4Z4CA 1S01A 1TYEB 4ZWNA 1NFNA 3HWWA 2G04A 1M6NA 1AF7A 4KYVA 5SYNA 4B83A 2HI0A 2QIPA 1X7ZB 3EARA 3IKLA 1PUJA 2M32A 1T4BA 3E7DA 2EX1A 5CJ2A 3K4HA 2BR5A 4RKFA 1RRFA 2YZMA 4M89A 4D9NA 3HA5A 2I62A 3C14C 1N5MA 3IUQA 2PGXA 4M99A 1YTLA 3OZDA 4E5VA 5HSWA 4WZ6A 4RVCA 4ZOLB 2VSYA 2VZEA 5HBRA 2FSVA 1EK0A 5THKA 3AY0A 2GHQA 4OAPA 1A76A 2XR1A 1NXPA 3RRMA 4G5FA 2Q3LA 3IT0A 1R4MB 2OZEA 2JFGA 4MI3A 1FYWA 3IB3A 1Q0UA 1APBA 1EWVA 4KNYA 2VDQB 3V4LA 5D5PA 1S2NA 4ZCQA 3HUDA 3OKFA 4V0ME 4PANA 5EHXA 2XNDA 2HWWA 4QUHA 1T1GA 2VKTA 2DJ5A 4JXXA 4BX0A 2FAPB 2PJUA 3SICE 1ZD5A 3UWOA 3HB5X 3H2HA 2VHUA 2D1QA 4B3IA 9LDBA 5K0SA 3G0OA 3EZ6A 1V1MB 3OZUA 3IQXA 2A5JA 3NR2A 2AD1A 4TPKA 1J22A 1YZHA 2Q27A 4H15A 5PGMA 1T15A 2GAIA 3UUFA 1WIWA 3QF4A 3PF8A 1Z6XA 3F1LA 2QGFA 1DWUA 5CURA 1F4PA 3FDQA 3DL2A 1ZNWA 5DM0A 3L43A 3FXAA 3L92A 1A41A 4DRYA 1HYHA 3WV5A 4PHFA 2RHDA 3LT5A 2HWXA 4GMGA 4MV0A 4ID3A 4RPCA 3RHFA 3CRZA 3OY2A 3VTKA 4EFDA 5KSYA 3RPEA 1QUFA 1O58A 4KHZA 4D9JA 1WZEA 3EGIA 4QRHA 3INRA 2XE6A 4BWFB 1MIOB 1D09A 1ND5A 2PRJA 3RNOA 4A27A 2XLCA 3O90A 2I6UA 1IXKA 3ZQKA 4BWVA 2BGWA 1BIFA 5GGYA 4AQYB 4BVAA 2H1VA 1Y5RA 3PHJA 4RD2A 4R83A 4BVHA 3K0KA 3OLCX 4KYTA 1KE2A 1S4QA 3NORA 6PFKA 2BL2A 3ZHVA 3OTIA 3MW8A 3USES 3PEYA 1LLFA 2CZGA 4CM7A 3NGLA 5K8CA 1SD2A 4HP8A 4R1MA 3WIOA 3N8KA 4QJBA 4DMCA 4ZJPA 2Q5FA 3ZBQA 2D0DA 2VWQA 1JFFA 2NU9B 1NJ8A 4QOGA 1QR2A 4WESA 1SXQA 3B1WA 4HNSA 3TMYA 4PE5B 4LISA 3R7CA 2XDYA 4ACBA 5DHTA 3UC9A 3QVXA 1CF9A 4IHJA 1V5IA 1IEXA 1MJ5A 4IQGA 1L3CA 3N6XA 4L74A 5KKNB 3WGQA 2O2ZA 4G8CA 4GGOA 2X8JA 2WAYA 2JJ1D 4J16A 3JALB 1B76A 4HSEA 3U31A 3HACA 3W1EA 1TWGA 3HMKA 4HH0A 4A6XA 4CDMA 1Q1GA 2AVKA 1NW9B 1LW7A 3K0FA 1C3OB 2IGTA 2REQA 5LP6C 1BA3A 2HIAA 4FS3A 1EFCA 3I9FA 5K0TA 3WL4A 1OX5A 3KLMX 1MX3A 2NZ8A 2W6QA 2Y1XA 1VYUA 2RHLA 2VHVA 3DV2A 1F2UA 2P9TA 1ZS9A 4WTOA 1ZGJA 2JB9A 3T61A 3CLHA 2HW8A 3V4OA 1NW8A 2LP4Y 4U5QA 4LSWA 3UWDA 2OZLB 3CKYA 2P4SA 1XWWA 5LB4A 2JFFA 2V6FA 5CBPA 4CLOB 3BMQA 4BNKA 3CRQA 4OYLA 3PR2B 5IJ0A 5LR6A 2G3KA 2LQGA 2PVSA 4AF7A 4C0SA 2X22A 3VH4A 4HX5A 3FPGA 4RVFA 1I0ZA 1G2QA 2C5FA 5FFNA 3TL2A 4F6LA 3KSAC 4WNAA 3L1MA 2WYWA 5FWXA 1J0CA 1W85A 4YT2A 1M76A 1N3BA 1ZVMA 2WJ4A 3B6IA 4M76B 1XZFA 2ZCVA 1Y4UA 1O5TA 3H18A 1P31A 2YV5A 5BR7A 2P0YA 3P9SA 5D3MA 4Q3CA 3WLMA 3OJ0A 1PZMA 1PFQA 2L7AA 1N2SA 4FN4A 1IN4A 4TL6A 2XM4A 2Q6OA 1ZYRF 4C87A 4DIBA 1L5NA 4I5EA 3BERA 3Q40A 2O2HA 4LOLA 4QHSA 4I9UA 2VDPB 5B36A 4JLVA 2WYIA 2I3GA 1REQB 4GP9A 1XJCA 3E18A 4V2UA 4FS8A 4DC9A 2HMAA 1B7GO 1ENYA 4CTOA 1HT2E 1WDMA 4REOA 1JHYA 1DHTA 2PJZA 1CJUC 2QN7A 3PCTA 1V71A 3US6A 5HEKA 2Q1TA 3K4PA 2J0EA 2ES4A 1BKDR 5CCEA 3SXMA 1H05A 1H66A 4CIHA 4DA8A 3HN7A 1HW2A 2QTWB 1T3LA 1U8UA 3TQSA 3C98A 4MO9A 4MUJA 2F1JA 4M7WA 4R98A 2IUTA 2A9PA 2Z2YA 4WFQA 1SKYB 3F2IA 3L9XA 4RVSA 1Y6JA 2CL0X 4NMHA 2GCPA 4PTYA 3DO6A 3D8BA 2ZQZA 3NU1A 2FZCA 4PG7A 5MGBA 4ZAFA 2R0QC 4OMFG 3QUSA 2OC9A 2K4MA 3T9FA 5F2NA 1UM9A 3ZNNA 4BKOA 1XLWA 1ZDMA 1UKYA 1NFRA 3EEQA 1TCCA 3IIKA 3EPHA 4RETA 1KYYA 4JSRA 1RVV1 2AFHB 4QU0A 4MHTA 2B5WA 4YT8A 2AOVA 3U3RA 1VLVA 2CVPA 3A6DA 2WZCA 3FSEA 2DXIA 1QQ7A 1LD3A 3T3GA 2VP3A 1G4UR 3CGGA 1L7XA 1EUCB 2IIVA 4G1MB 4CRWB 4M9ZA 2H6EA 5L0FA 3BVPA 4CMIB 1UBMS 1NDQA 4MJXA 4Q9HA 1SD1A 2VHQA 3JQ7B 4FFRA 1RM0A 4RVNA 3I52A 3A31A 1VYIA 2F22A 2W2NA 3B0VC 4HAWA 3MXTA 4TLBA 1KNXA 3RRXA 3NHFA 2HPAA 3GUZA 1DCTA 2VEDA 5C34B 3FDXA 2XL6A 4Q9NA 3ZDZB 3FD8A 4KFRA 5DIFA 5B1SA 5MN4A 1J2JA 3O26A 3W6OA 1V1JA 3I58A 5JVDB 1Z34A 3JAWB 2PXHA 4Y6PA 3QMKA 3HB1A 4HZUA 4ON9A 3R7WA 3T1TA 3FLBA 4N3NA 3BAZA 1G1AA 4RSMA 2NSGA 5G53C 1H2FA 1COWA 2CV1A 3A4IA 1TU3A 3L1UA 4HXYA 4H27A 5KYGA 3K5WA 4KLAA 2IXOA 1YBVA 3B2NA 4LE2A 4BJTA 3ESCA 4DLLA 4RMJA 2FZEA 3WRYC 5FUXA 4DG9A 4X8HA 3LNCA 3T15A 4GGPA 4WLFA 4YUVA 5F52A 4ETMA 4GG1A 4YRMA 3UT6A 4INZA 3UGJA 3ND6A 1ULTA 3FPLA 5JCJD 4KGXA 3H83A 4QXOA 2XLBA 4QAJA 2ZIXB 3PLAE 5JRDS 1QAMA 2IOFK 4AJNA 5ELLA 5JG7A 4HXFB 3LRPA 4HEA1 3IPLA 3W8IA 3BJZA 4XUEA 1QC5A 2QN6A 1TQ6A 5DS5A 1BMQA 1H69A 2OCPA 2FE1A 3UJAA 4INPA 3QFTA 4ER9A 3AWDA 2EVWX 4X1KA 4AUEA 2KW3C 1GO2A 2RC5A 2V8BA 2LVBA 1IG3A 4M36A 2UYGA 3DOHA 5I9NA 2XODA 3LMKA 4YPFA 2J5XA 2CDNA 3LH5A 5EUCA 1Z4QA 3MMZA 1FUYB 4RPKA 3ROTA 5BUSA 1S2MA 2OESA 1Z25A 4CMKA 4CG3A 2FQ1A 2HFJA 3R4CA 2BEVA 4G0XA 5DM70 3DBRB 2GVNA 2OO3A 3FDZB 5IVPA 3G5AA 5EJ5A 3H2VA 2NNLD 3D8HA 3PUYA 1D4FA 3GMTA 4J0GA 2FQYA 4YQYA 3R44A 4LV6A 2XD4A 5K45A 2HMWA 5LP1A 3D7KA 2V7PA 2CCYA 3RIEA 2OO7A 1RPJA 2B1RA 3H05A 4YH1A 4XQEA 9GPBA 4M1QA 3EXEA 4DLZA 4V1CB 4PEVA 4BL5A 3RTCA 4QOSA 4Y3UA 5HS6A 4M7RA 2C3YA 4I50B 2YDXA 1VG1A 4F86A 1ABBA 4GR5A 3A9CA 1QKJA 4OHBA 3I2FA 1LIHA 2DTXA 4NF2A 2OO5C 1GU1A 3PUHA 4HYQA 1R5NA 3BEHA 2PUTA 4HNUA 4KCGA 1L7MA 1WKVA 5ECGC 4D0GA 4C0LA 3LS1A 2Y3DA 1SM4A 2QR3A 2I78A 4IZOA 3H9UA 1VP9A 3T38A 3L5KA 3I64A 2OGTA 1CQWA 4MUEA 5FNVF 2VFAA 4HAXA 1U2QA 2NAFA 1K7YA 3B8HA 1NQVA 2OB2A 3AQBA 1R5BA 2CLLB 1Z4NA 3AVQA 1JIUA 4Z1MA 1XP8A 3AL3A 4R3UC 4XQ1A 4Q1FA 2I4NA 5CH8A 3H2IA 4HGNA 4V0KA 3WG9A 3MCWA 3R3HA 5JDIC 1MW8X 3D6HA 1R12A 4FEEA 4IIBA 1FDRA 2C2YA 3PYXA 4EHAA 4PYIA 1T9BA 2FKNA 3HHEA 2PPVA 1A71A 1H2EA 1MRZA 3E48A 1B8OA 1M2OA 1UBLS 4DMHA 1W44A 4IIJF 4HAUA 5K6AA 5EZSA 2R47A 2XYRA 3SJAA 5JI2E 4FFLA 3C8GD 1WBDA 2QLMA 4UTZA 2DFVA 3H17A 4I9FA 4JL6A 5DK4A 2AJBA 2OBLA 3GJYA 5AVWA 1DCMA 1U9ZA 5CFZA 1Z5WA 2CY0A 1IXYA 4RZIA 1KVRA 4UOZA 1QK5A 1C7IA 1E4YA 2CLDX 2Q4DA 4FWVA 2ZT8A 1PX0A 4EBKA 3DR5A 1U8ZA 3L7LA 3SHWA 3MJDA 4A2PA 4PTLA 1T4DA 1FJHA 2II6A 1CP2A 3UJ3X 2FSVC 5DM4A 1M72A 1DBWA 4MEAA 4OIQF 3ZVLA 5CDSA 5CIWA 3BXZA 3FVWA 2WIGA 1F8UA 4DLPA 3TW6A 4G0VA 1QHYA 1KRXA 4PIMA 1DXYA 2W8ZA 3PKIA 1RTKA 1EE1A 2V7QD 4B4WA 4HH1A 3V7YA 4KXUA 2Z3VA 3ASYA 3STWA 2O20A 1DDOA 3GP3A 3UENA 2WKWA 3ND7A 1XMOB 2KB0A 3RROA 1KFJB 4IPTA 2XNCA 1P6UA 3CSDA 4U8GA 2YXLA 3LBYA 3PGKA 4Q47A 4ISBA 5F4ZA 1K40A 4Z2AA 1EBBA 3KE9A 4JSTA 5B1HA 3RVLA 2IBFA 1YR8A 2H8GA 2GYUA 3GJ6A 1QG6A 2OQMA 3V8BA 2R7NA 4BRUA 4RORA 1Q2UA 4U5BE 4YUYA 4EA9A 1E6CA 5LQCA 5BNFA 1GUDA 5L9AA 7REQB 4I44A 4XX0B 2HD4A 2JFWA 1RXSA 1UBSB 3L8HA 1EVEA 3NCHA 4P08A 1FQOA 4O4IB 1T2FA 4OIRF 3JQAA 1N5IA 2IXEA 3HDTA 4PQEA 2EPNA 1E69A 3A3OA 5C1PA 1V96A 2ZU0C 3ZXSA 4FMDB 1CRZA 2P8JA 4EAQA 2ZZKA 3CEMA 3II6X 3W3AA 2UZ0A 1XMJA 1FX1A 2OLKA 4KMSA 1XEXA 1N6KA 4LXHA 1TZBA 1GRQA 3FOZA 3TIXB 3UMHA 5HOQA 1MAAA 3JZMA 4R5MA 4MQLA 1W5TA 3SEFA 1ECCA 1QP8A 1VJGA 4JBWA 1BSVA 1Z5VA 5FULA 1J2UA 3O7WA 4R7TA 3CF4G 3VJRA 1PJZA 1YT5A 4OJKA 5FA6A 2JEZA 5IWAB 1RLJA 1RXIA 2DETA 5AUQA 3H4MA 3FZNA 4XLTA 1LH0A 1GZHB 1SBNE 4PC6A 2Y9PB 2FMFA 4PWZA 2PU7A 5BNZA 3ASOC 4BQRA 1RMYA 1OXSC 1XMXA 2GDJA 5CA1A 2ZITA 2W11A 4D3SA 1ENOA 3V48A 1RWVA 4V38A 1A82A 1JR3A 1RQ7A 4ID9A 1M2WA 1GS9A 1QTRA 4YP1A 3UNGC 2HQOA 3SK0A 4BKRA 2OFXA 1KYXA 3S2ZA 1O57A 3DC2A 3OEYA 4KJZA 1CUEA 1QCYA 1OTHA 2QX9A 2XX3A 5JMWA 2XWSA 2GCOB 3PHCA 4ENVA 1YI8A 3DT9A 3GX1A 3D7SA 4CTKA 1KGSA 3D6MA 5KHAA 1YFLA 1G9SA 3SGLA 1KETA 4GXRA 4W1RA 2IYWA 2QZ9A 4J7CA 4JWTA 5BW6B 4IDAA 2HSGA 1ZD1A 1SKMA 4J16C 4ZHQA 1P8AA 2QUIA 2PQ2A 1JPUA 4CJXA 1G21B 4ZYTA 3DM9B 4E4TA 1U2TA 2MR5A 2EIHA 4BRZA 1BXKA 4R8VA 1TMOA 2SHKA 3NYRA 5AWFC 4HX9A 3SZUA 4BKUA 1PZXA 4OAOA 1W36C 2QBYB 2B37A 3D6NB 1TMKA 2VAVA 5AIAA 3ZXUB 2YOGA 4NESA 4ZQCB 1G66A 4KQGA 3UT5A 1U3UA 3HBNA 4MMZB 1GR1A 2VHWA 2VPWA 3TM5A 3GUYA 4Q3KA 3MRTA 4BO3A 5G1PA 2OXFA 1OAKA 4C4TA 4FDUA 5EXPA 5BYJA 4IDHA 1QBKC 1CRLA 4PINA 3ZI0A 3TRDA 3CMMA 3P2KA 4YN3A 1XK6A 1XJ5A 4Q48A 4CIXA 2JFZA 3P4UA 5K03A 1J23A 5D5HA 3BXGA 2IHUA 4A5SA 5KWVA 1U0TA 4DR3B 4N5DA 2PD3A 5B3LA 1WSBA 4UM9B 1RM5A 1LBEA 5HMMA 4EHBA 2PZJA 3KIPA 4BNJA 1W30A 1VPEA 4JBIA 4LVUA 2UUAB 2VCYA 4RFVA 2CHEA 4WCFB 3T1QA 1GFSA 3WFZA 3A4YA 1B68A 1NN3A 1ZWLA 1GZ4A 1UZAA 5BYBA 4TQUS 2C4UA 2FWAA 1I3KA 4YROA 5JNRA 3TR0A 3L8IA 1UT6A 3DZ8A 2WF7A 3Q7RA 4TKVA 3BL5A 2XE4A 1NBMA 3JQ8B 4P2GA 5B1AC 3B6EA 3O31A 2GYWA 3OLXA 1NVXQ 1AIPA 1I13A 1WB4A 4YHBA 1XTZA 4PS1A 2IEYA 5FFMA 4IS3A 4ARSA 3GB9A 4ZCRA