3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
b'VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
4ZEMA 5DBOA 1VB5A 2A0UA 1W2WB 1T5OA 3A11A 4LDQA 3ECSA 3A9CA 1T9KA 2YRFA 3VM6A 2YVKA 4LDRA 4ZEOA
chains in the Genus database with same CATH superfamily
2R8RA 3ZI4A 1H9AA 3ZZ0A 3TLKA 5FWYB 2FPRA 4F4DA 4RD1A 6REQA 3UJNA 2GZ3A 1L5LA 5GAJA 3AGTA 5CU7A 3HKBB 5CCDA 4Q3DA 4OHOA 1IG3A 4CS9A 2GA9A 1KGSA 3NASA 2IS6A 3QXSA 3HGMA 2E4ZA 1Z4QA 2YYYA 5IK2D 1C3JA 5EIXA 2VUTA 1SBCA 3T1HB 1UANA 2RGNC 2M1ZA 4OB6A 1VYIA 2HSWA 1XB2A 4RPJA 2V3VA 1J2TA 2XTJA 1P5ZB 1DRKA 4R98A 1T8PA 1AQLA 2GVNA 1YA7O 4IIJF 1WMFA 3TI9A 3W3ZB 4M8KA 1AY0A 2B98A 3OJOA 4RU1A 4AICA 2VJPA 2C54A 2GZDA 1Z5UA 3AH8A 4IPTA 2R1VA 3QXXA 2Y1WA 3HWX1 2HJ3A 1WMDA 3TJ5A 5KOHA 3SPXA 4K2AA 3MWJA 2CYBA 3RVPA 3TPFA 2AOWA 1YNOA 3M8KA 4K6KA 4U6QA 3ED1A 3QJGA 3LHKA 2HIGA 3CLUC 3KT3A 3ZD8A 1FSZA 4YVFA 3KQHA 2D2XA 4V3BA 2YXBA 3HB4X 2OWDA 4QTTB 4IMIB 3V2HA 3DMGA 3NC1C 4WERA 3SAJA 4DC1A 5DNUA 1HDIA 3QPAA 2C61A 4GZLA 2EU8A 4N41A 1AK2A 1TVMA 1NI4A 3HU5A 4HZGA 3O1JC 1OIVA 3HSYA 4OL9A 2F3UA 2OD9A 2JGKA 1E4EA 2VXBA 4M8SA 1JG7A 4TZ6A 3KG2A 4XQ9A 3NIBA 2XR1A 4HB2A 5TMEA 1L7NA 2OB1A 5TGZA 1T6IA 1XZPA 1NP7A 1E9FA 4OD5A 2A14A 3EJNA 4L22A 3Q5GA 4LS3A 1MENA 3GW8A 4IILA 1E79A 1KBOA 1N5DA 4AZTA 1UM9A 4KIGA 1DJLA 3MZ0A 3A1NA 5AW3A 2VPPA 2Q5CA 2J9ZB 1YB1A 3NTQA 4PNEA 3CX7A 5K6AA 3MJCA 3R76A 4ONEA 3UAWA 2P30A 1F3OA 1V1JA 5KHLB 2AFIB 1J0BA 3I5PA 1C3EA 4ZJPA 3CE6A 3QXHA 3PHCA 3S29A 1HMPA 1QFMA 1JDNA 5EIWA 4L16A 2FY8A 1BDBA 1HDOA 5K09A 1H5QA 3DV2A 1KDYA 4AKHA 3SQNA 3REFA 2TMYA 4A2QA 4MUXA 3OEED 4QO7A 1VBNA 3E81A 5MN6A 1FNTc 3AUSA 1Z18A 5TS3A 1GAJA 2B9VA 1G6OA 3GDWA 1PVOA 3R3SA 3HHEA 3B85A 2JEYA 5ALFA 3H83A 4ZOLB 5JAMA 1HMDA 2PMKA 1BVRA 4Q7LA 4FJ1A 1Y3AA 1QRAA 1KXJA 4C3ZA 2HJSA 1NUPA 2MSWA 3AJ9A 2Q3HA 4OFWA 1OHHD 1PTJA 4C1BA 4BZZA 4OBXA 3S1SA 4GW3A 3I0ZA 4JVLA 1F9AA 2G5PA 3QPBA 4TLAA 3SZUA 1KO1A 3LT1A 1CDEA 3NWPA 3PF8A 4MQFA 2J32A 2BKVA 1LFDB 1O6FA 3BJRA 3FN4A 2JK1A 5D87A 5AVXA 1W5BA 3MJHA 1ECPA 3AF1A 3B1XA 4OMDA 3M4BA 2AI1A 3QKSB 1M6HA 2BKXA 1RXYA 2XNSA 3FRHA 4ENWA 1H3EA 4MMZB 1LNSA 4BYGA 1GDHA 2B78A 4Q3OA 4TV9A 1KKMA 3AOUA 1X7ZA 4EA8A 3REQB 4O2LA 4ZHQB 5KPDA 4G09A 4NG4A 1C7EA 5LPNA 1Q7RA 3W8FA 5T4FA 2HBRA 1SG6A 3B51X 1SG0A 2DLCX 2I7VA 2POQX 3EZNA 3NTOA 4QODA 1KAGA 2GZ2A 3HZZA 3SCZA 1WIWA 2G5GX 1YRAA 1PFYA 5DNVA 3IEPA 1S89A 1YJAA 1JMVA 4UUQA 4RK5A 1BNCA 4DQUA 4NULA 1D0ZA 3QBTA 1E6WA 1IXKA 3YASA 4GX0A 2Q6LA 1R6VA 4QNRA 2P27A 5ULLA 1JHXA 2P9HA 2CNWD 2I4MA 2OKGA 1GPJA 4K3VA 3U7QA 5TQJA 3D31A 5GGYA 2IDMA 4CMIB 3LZCA 5ISMA 4O2AA 5KB3A 1G20B 4EMUA 2BZ0A 1E0DA 1P80A 3F4LA 4OTZA 2AXQA 5DYWA 3UGPA 5K8LA 1E7SA 3D3EA 3MMXA 4HEA6 3U39A 2FI1A 4IH1A 1U80A 1JX6A 1LV7A 3CZQA 5KC9A 3I64A 3RPEA 3FGZA 2OGUA 4GGPA 3HJHA 3LUBA 4FI3C 4J76A 5CHYA 2KYRA 2XIQA 1UWCA 2H85A 2H5IA 3QHAA 1GITA 4U2CA 3PC8A 4KQWA 1L5RA 3UWOA 4KGVA 2WIGA 4L6RA 3MMZA 2BMFA 5CURA 1LK0A 2CL5A 3HCEA 5AVYA 1YIOA 3BEDA 1E3SA 3VU3A 2AJLI 1DXOA 2HBYA 4JHXA 2GWWA 4X45A 1A88A 4NH4A 1T0JB 2FZ5A 4O3FA 2Q45A 1NNSA 3AR8A 1YI1A 2PX4A 4WVFA 2OG1A 2PX6A 3CV3A 4RHTA 2LNDA 1E3LA 4FYIA 5E3IA 1E20A 5F21A 5EZYA 1JR8A 4J0GA 2YASA 3Q2KA 4EYSA 4BQSA 4J94A 3ICPA 3IOEA 3K6SB 4UATA 2HCRA 1T4GA 4HZIA 5BUSA 4MS4B 4RTLA 5LU8A 1E6LA 2JAHA 3PNSA 4XDZA 2CUNA 1LSJA 3GD7A 1Y6FA 2PXXA 5E2IA 3AHJA 4QGBA 1ORYA 5BSGA 4DEXA 2FKNA 4HGRA 4MW4A 2V65A 1HDXA 1QBGA 2BUBA 2IYOA 3L4BA 5LQRA 1G1AA 1PKXA 3LYAA 2VJNA 2FUKA 1X1TA 4DJ9A 5HF8A 3IBGA 1DWQA 3FY4A 1Y7TA 2IWRA 1PYDA 4ZAZA 1Z13A 2LFDA 2HDWA 1SPXA 3EUWA 2AX3A 1Y8QB 2CKMA 1PEAA 1F8FA 2Q1UA 3L7OA 4YCAA 1KDPA 4MS1A 3V5XA 3HKEB 3OLYA 4FFPA 3MELA 3BMNB 3ZVLA 1VYVA 4UHCA 1ZW3A 2WWFA 1Y3DE 4W5RA 1QVXA 1VHQA 3NLLA 2KJQA 2F22A 1FRVA 2GTHA 3PR3A 4H7KA 2QYTA 2GK3A 5BR1A 2A57A 1DAKA 2WHQA 4WBNB 1HE3A 4JMPA 4WZBE 4CZ2A 4RVSA 4YIHA 1XZAA 3DAYA 3IPCA 4L0DA 5IJ9B 3D1LA 3FOWA 3OFND 4W8GA 4KXXA 4N5HX 3AB3A 5H3HA 3JAMA 4EKYA 3LQ4A 4YK7A 5BV2P 2HA6A 1FTQA 3B5IA 3OZTA 3OPNA 2R8YA 1SXJE 2CLIB 3W5AA 3H87A 3BJMA 1UFKA 2DG2A 1PWYE 5E9JA 1MW8X 4PAOA 3NANA 1KVSA 1ZH8A 3PFNA 4XEHA 1QQAA 1NWCA 1QJCA 1UXGA 2ZE7A 3CF0A 4Q15A 3KHKA 3V48A 5EHGA 4BNDB 2IXDA 3OFJA 1H0RA 4EUFA 1QQ5A 5TT0A 4EDFA 3H2IA 5CA0A 5F5NA 3UJ9A 1FXWF 3RJMA 1K9VF 4MVJG 2C03A 1Z0DA 3BGDA 2YHUA 2O8EA 4ZO7A 2CFCA 2FPUA 4JLUA 1R0BA 4OIMA 2R7NA 5EQFA 4G8JA 3WIDA 2EILC 3PXCX 2XEXA 2ZRQA 2BHTA 3U7IA 1FSPA 3LY9A 5T6BA 4X3OA 2DU8A 5UKDA 4J7TA 4E7SA 1JF8A 3GQVA 2A1UB 1NAIA 3UJHA 1GTJ1 4ZI5A 5GONB 2C77A 3OZRA 2QN8A 2CD9A 1T6XA 3EVNA 2X2FA 3AFNA 1ORWA 1RPZA 4KDEA 1G8GA 1ZXBA 3EEBA 2C9OA 4QU9A 3K2BA 4QSMA 3KU1A 3CUYA 2VYVA 3FHJA 4R1QA 4EEXA 3E9RA 1RTKA 2B5WA 2NM0A 4EA7A 2H4JA 4C4XA 4XWAA 1GTG1 3J7AC 1GM5A 3CCFA 4AG3A 2HSBA 2E6UX 4NQFA 3AUAA 3PFGA 1JR2A 1ODKA 3CLTD 2YLGA 2WG0A 2IQ5A 5BNWA 3GFOA 4N82A 3D43A 3OQIA 4YAKA 4BCCA 4UUPA 4J4TA 1IZ0A 4AP6A 2FW8A 1B8NA 2ADOA 3MGAA 1W6UA 4AY2A 1TK3A 1Z5OA 4EVSA 3BRWD 2QD1A 4FCCA 1YARO 1TNDA 4X90A 5IWAB 1NW9B 1OAAA 3F4BA 1Y6ZA 1P7WA 4PPNA 4Q12A 4B3HA 4EKIA 2DH5A 1B0PA 1Q21A 4JYBA 3IULA 3W6UA 2FOIA 5E8RA 3RNOA 3KWJA 3WZMA 3M2TA 3OICA 4AKEA 1RLTA 2EDAA 3NZEA 4K2HA 2IVFA 2FOXA 5BUZA 1UODA 2RHOA 5FO1A 1N7IA 4JVOA 1TL7C 2VQDA 1ILWA 4OY3A 5CT6A 1N1DA 1HW1A 3U7RA 2R00A 5IVDA 3A04A 3ABMC 3DYBA 3I62A 3ONFA 1R5JA 3OQMA 1F4PA 1TIBA 5KSOA 4D4XA 2A9RA 4XGNA 1P31A 4A92A 3W6OA 3A6PC 2BGUA 2OZLA 3F8SA 4YJKA 2GNPA 3RVJA 3UF0A 2EATA 3CPJB 5FOSA 4UC0A 3QF4B 4F5WA 1XJWA 2OLEA 4QUKA 4UPDA 4D46A 1JFFA 4ZDJA 1YE5A 5LA6F 2E4UA 4HNVA 2Y2UA 4JUFA 1BGWA 2ZPAA 2AHRA 4BNXA 1WCXA 4QFDA 1L1RA 4HNAB 3OPYB 2H9YA 3EQZA 1YVIA 3ZNPA 4D5GA 4WCFA 3RUHA 3UMBA 5ALXA 3KIPA 5AKZA 4NMWA 2YRXA 3LLMA 2CDAA 3AILA 1TO1E 3QU7A 1D0VA 1TCCA 4Q4HB 4RFSB 4KE8A 1R3DA 3D4BA 5FJIA 4FHEA 4ARUA 3H2UA 3GPBA 1JPJA 4BX9A 2OCXA 1MO5A 4X1KA 1YDGA 3TBHA 3DMRA 2J0QA 1QRSA 3FR8A 1K7FB 4MB0A 2QPOA 3TPCA 1I3MA 1OA0A 3B1VA 4MAAA 3NR2A 5E4FA 2HHHB 3AYZB 2OBFA 2Q3JA 3H4TA 3H9QA 3X2EA 3L7LA 4QOEA 2R6JA 1O6BA 2J4DA 1AE1A 2PWYA 2X7XA 3L0ZA 3FYSA 3R2JA 3PZRA 2WILA 4F4UA 4HVLA 1AO3A 3GFGA 2UUPA 4UBOA 2PUVA 1VB3A 1YL6A 1Z83A 3FYDA 1K6EA 2VJBA 2WM3A 3UHAA 2IYEA 4YONB 1DKRA 4MVSA 2AIRA 3TSOA 3T0IA 1SQ5A 3HJRA 1OXKA 3CUWA 3BTUA 2ONJA 4FBLA 1F12A 2MR6A 3RJ9A 3AO0B 1QV6A 3OC0A 1ZGCA 2OC9A 2G7ZA 5EN4A 2HNBA 2DBRA 3E9NA 5IAEA 1K8RA 5AJTA 2FX5A 2OEVA 2E6KA 2QXYA 4AWXA 3R7CA 4BP8A 1BJRE 1IQRA 2L19A 4E1VA 4DWWA 4N3BA 2ZXUA 1M1ZA 3NOOA 4IIDA 5ALZA 1L7OA 2PKEA 3GT0A 2JLYA 5MN5A 3W4JA 4MR9A 3KUUA 2BEUB 1M6WA 5EWJA 4NZMA 5EP2A 4B6JA 4EM6A 1SD2A 3G7UA 1G8FA 1L1QA 4CEJB 2PD3A 2EL9A 3K9WA 3K0KA 3DLHA 2OBYA 4C7XA 3SLRA 5JQWA 4CV1A 2W2QA 4X97A 1D1TA 4WFQA 5H82A 4IUBS 3C16C 3ZCTA 2H5EA 3AQBA 4OO3A 3X1YA 2LGJA 1N5JA 4X66B 4POAA 2OHOA 5IP5A 3JWPA 2C4NA 1QKKA 3LP5A 1V6AA 2O3QA 3PUHA 2VXCA 2VHVA 2NSLA 1ES9A 4WY8A 1NBBA 2SNIE 1CKEA 1FVOA 5GOTA 4KBLA 4N6HA 2DLNA 4BDTA 4EYOA 3PIIA 2PU5A 4GOLD 4ZVNA 4NOLA 2R5FA 1PF7E 1ORSC 4PCVA 5K45A 3C7CB 1MRSA 3D6AA 4B6OA 2IHBA 1PEYA 4CKXA 3QFCA 3LQ2A 3R7AA 3Q8MA 1GQOA 3QX9A 1E5VA 4C6HA 3DNPA 3VPFA 2V8OA 1V71A 2R03A 5AM0A 2F4VB 1W1IA 2SKEA 1WU8A 1JDJA 1FS4A 2G72A 2EVWX 1FFHA 3FPSA 5A02A 1YVEI 3ASUA 1XZNA 3UOGA 4DXAA 2NQ8A 3K7EA 1OU4A 1R9JA 1QX4A 3G2NA 1J0AA 3D6VA 2P2CA 1V9SA 3BGOS 3D2LA 2QSJA 2GB4A 1ZW6A 1PBNA 3I23A 2IZ7A 1HWYA 2ZTHA 4KXQA 2NZUG 3HADA 1KAEA 1ZD2P 1UFVA 4W99A 1Y9JA 4NCHA 2DGDA 3LNMB 4ERXA 4BHTA 1T13A 5JWRA 1V5WA 2BCEA 3N2ZB 5AMXA 3S8EA 4JU8A 2FPPA 4J7AA 3EVDA 5HKLA 3OWTA 1L4HA 2XZOA 2P9EA 1TD9A 3IUQA 4XFDA 3WAJA 5B2FA 3CLTC 5ICCA 4DLAA 1TQ4A 1KJQA 1J06A 5SICE 3AVTA 4DDUA 3LLKA 1KQNA 3WGTA 4QELA 1ZC3A 4MRRA 4RWEA 1I7SB 4GUDA 5FPKA 1FUKA 3HXOA 3GEEA 4BNUA 2J46A 1MXFA 2A5YB 2ZZMA 5TXGA 5G1NA 3AVQA 1DG1G 1CS0B 5BSMA 3MUEA 3KSDO 1Z6PA 4RSGA 5KYXB 4K9PA 4KE9A 1B93A 5D5PA 4IRUA 5CDGA 4DCMA 4YCCA 5CTJA 4LRQA 1GO2A 4R4JA 1DIGA 4P4SA 1GUAA 3SVTA 4BYMA 5HZKA 4H7FA 1B43A 2XUJA 3OZVA 4WLUA 5DH9A 4FB5A 1KZ1A 5C8DA 3RIMA 4TUYF 3V4RA 1OW3B 1X1EA 2QR5A 1QOQB 3MPUA 1TT5A 2P4HX 4G9EA 1FTGA 4Q47A 1NOIA 2R87A 3CJRA 4O4LF 4Y1RA 1L4UA 2H92A 2AYXA 1AMUA 2C2KA 3AZQA 4JEAA 4WN3A 5F5HA 3T4XA 2OECA 3F3MA 3ZC3A 1EEXB 4CL0A 1UINA 4M1MA 3OURA 3HTXA 4OHMA 1R0ZA 4AX2A 1QO0A 1MO6A 1Z5VA 3K0HA 2PT5A 2O5RA 4D8TA 1S2DA 5DLJA 4LJRA 1WA5A 4PZYA 4OUKX 4M99A 2P6UA 2BFPA 2JFGA 3M9XA 2FXIA 2HIMA 4JAVC 2EKBA 1OYYA 1Q84A 2FN7A 2PH7A 4XIJA 5B1IA 1O9HA 4RMGA 2WIBA 2O8CB 2E5WA 4DXDA 4DHEA 4K1OA 3K66A 1NQTA 1VL5A 1P2BA 2FCRA 1HY5A 5LD2B 1W30A 1IY2A 1N92A 3KAKA 4F2HA 1VPTA 2O48X 5ERXA 2VNAA 3ABZA 3ELBA 2Q99A 5EK0A 4R2XA 1TU0A 2D5IA 5EGNA 3WKAA 1VKNA 1C9YA 1OV6A 4GOND 1KJ8A 3K9GA 3CXRA 3E35A 3SXZA 1JKFA 5ALYA 3L06A 1I5OA 3FVWA 1NBOA 1KPIA 3JWEA 2NZ2A 1N25A 4L5IA 3JRMO 1XDGA 2P9YA 3MN1A 2H4HA 3F6RA 1N2JA 2ZKIA 2IPOA 4QU5A 4MS2A 3UAVA 5CNMA 1XA0A 3F6YA 2W6OA 5KVSA 2P1DA 3EZ9A 3VR6A 2WTBA 3T1QA 1LPMA 1BROA 3OPXA 1UP4A 1FVXA 1ZY2A 5B4TA 3RYHA 4DMLA 1G291 3DE8A 3D6HA 2AG5A 4YRAA 2WG2A 3WGVA 4CFZA 4X7PA 3KZMA 4YQZA 3QNMA 3V1KA 4QG3A 3JYPA 1R88A 3KKOA 4X1YA 2JIBA 1G8HA 5F73A 1OLXA 3S70A 1A0BA 2DFLA 3PFKA 5DU2A 1QPGA 3O92A 4UE2A 4F21A 2RAVA 1FFYA 1DX6A 3V3TA 1GQYA 4XUCA 4RTMA 2QSZA 4E2WA 1JKXA 2FEPA 2H1HA 3S27A 1TCBA 3QU2A 3U26A 2VPQA 5IKMA 1VJRA 2Q7XA 1J4AA 1NJSA 2JIOA 1KZ6A 1FFTC 4MWDA 3ADCA 4XLTA 2EIHA 4OD4A 3ZCQA 2GO1A 3WGKA 4HFRA 3WY9A 3Q0EA 2XTZA 3C3WA 1DAOA 3VU9A 1VSQA 4FYMA 3DTNA 4KR9A 3SIPA 2XTAA 4MA4A 1KI4A 1YB6A 2ZUCA 3H8JA 3I0MA 5DXFA 2ZQYA 4N8EA 5HCIA 1T8UA 3TSAA 3VJRA 2VYCA 2XLEA 3UB2A 4TRJA 1CB7A 3SEAA 4YI5A 2GVZC 4YYZA 5JNLA 1N33B 2GM4A 4OX9B 1KJIA 1ESCA 2H3HA 5KOJB 3T12A 1VOMA 4F3KA 2EQBA 1D1AA 1R6UA 2ZYAA 3N8KA 1TM3E 2O7RA 3GZNA 2ZTSA 1WOMA 5BSKA 1JG3A 4XPIA 2IEYA 1O9BA 2JJ1A 1ELOA 1GSAA 2QW0X 3UFXB 2OHGA 3UHFA 3ROKA 2II6A 4BECA 3T61A 4KH0A 3ZEIA 2RHBA 3NDJA 2COUA 5JH7B 4TXLA 3NHMA 2X5JO 1DAEA 2RCNA 4WLVA 3TJ6A 4LA4A 4R9NA 3NCHA 1CHNA 2B3DA 2BAGA 1MJ5A 4DDTA 4FX2A 3S4YA 1YA8A 1VRVA 3LBHA 3HXKA 3EASA 2PSHA 4TKZA 5FWYA 1NTOA 3AEYA 3HKBA 1ULTA 4B33A 5KNDA 1EJBA 1QH9A 4YRIA 5LYJF 2OCYC 1UKVY 1DT3A 2C2YA 1ORHA 4RA6B 2FKAA 4XGKA 4A1FA 1WDTA 5L0JA 3L92A 3THSA 5F64A 2PD4A 4XKJA 1XROA 3UV6A 2Z58A 1V5IA 2QM3A 3G5LA 1T0BA 2P3QA 2VR1A 3PCXA 4UU8A 2P6NA 2RI0A 4X0EA 1Z6ZA 1ZD3A 3IAFA 4K9NA 5LZ7A 3M1AA 1SK9A 1WZUA 3NV7A 4B6GA 3LRXA 1EDOA 2FFAA 2H51A 3ICWA 3DOOA 1NBWB 3H5VA 1BR2A 3TKLA 2QR2A 1W36D 4Y2XA 2LUOA 4DGSA 3VR6H 3JT1A 3TLCA 3K31A 3KV3O 3IQIX 4NFHA 2JK0A 2FXVA 1VCMA 2Q62A 3NTRA 1OH8A 4RK6A 3QUAA 4UE6A 3SSMA 1NXVA 4R6WA 1EK0A 5DYNA 5BRNA 3OEWA 5K0ZA 4QUGA 5A5FA 1EXVA 4KAJA 1Q0GA 1JWLA 3RRJA 3EZYA 2P7VA 1I6MA 3HY6A 5DXJA 1H2RS 5HW0A 4DMHA 4M0UA 3EIQA 4UAJA 5JALA 4NZ9A 1M57C 2EPLX 2HJMA 5DS5A 3F97A 3IIMA 4U2GA 5JW6A 5K05A 1KA9H 2IY9A 3PC2A 4B3SB 1ZN8A 4NBRA 4JJAA 5B36A 1QKRA 4F5DA 2R4TA 2QUHA 3DMFA 4C0XA 4JURI 1MOZA 1ZJWA 1OFVA 4O4IF 3K32A 4G0ZA 4ROTA 3DL4A 3H9JA 2BC5A 1USGA 2O59A 4LJLA 3QMPA 1XO1A 4CBVA 5C8YB 4B4DA 2NW6A 1W4CA 1TAHA 3IQHX 3Q3CA 4GX1A 2IYUA 3AMVA 1ADGA 1O89A 4AWBA 2QNRA 2FPXA 5K8JB 4DCCA 3V7YA 4YQFA 2AFIA 2NV6A 2EJUA 4NYJR 4HG2A 3SOZA 4TTSA 4RHCA 3BL6A 1J8YF 1U4SA 4Q1CA 4X0RA 4D3FA 1D2CA 1SU4A 1OIXA 4RE5A 1NMXA 4PS1A 2UZ4A 3LXUX 3G4XA 3G9UA 3ZLTA 4JHLA 2Q3EA 1KU6A 2FSPA 1TD1A 5IAJA 3A4MA 3HCBA 3MD0A 2PNOA 2Y3BA 3FOCA 2W6MA 2AEEA 3A2LA 3MSXA 2HMVA 4KR7A 1TGYA 1NQVA 3NC0C 3H9GA 4TZ0A 4LN1A 4Z9YA 1RJEA 1QM5A 4B3GA 3QA3E 4BAGA 3IEVA 5ED4A 1JQAA 1E9DA 4JJ6A 4YT4A 4UE3S 4Z8XA 2ZJOA 2W2LA 5H5JA 1E9BA 1N6IA 3PA6A 2VJMB 5F7ZA 3BZBA 5A5EA 3EIOA 3O03A 1NLZA 3FXAA 4JFAA 3GLQA 4XYLA 1KH1A 4F2PA 4CM8B 5JS2A 3R8FA 2FB9A 1UXJA 2FX2A 5AH0A 2HT1A 2QVCA 2X7JA 3WL7A 1DELA 4EENA 3QKSA 1N3IA 5BT8A 1GYRA 5IG2A 1QONA 4IZOA 3VPDA 3OH8A 2AXPA 3BKWA 4J16C 2XF8A 2XYPA 2P2LA 3KB1A 3K4PA 3CNBA 4S2UA 2AOVA 3REQA 5JZ9A 2V9ZA 4J91A 4ZHQA 5JCOC 3EWNA 4H3SA 3ZV4A 2CUKA 2EP8A 2B0HA 1CZOA 2E4YA 2YWBA 2PANA 2PUDA 3C39A 4ALLA 4BGEA 3G6KA 5HDQA 4KREA 4RUKA 1R5ID 4E22A 2HPVA 4C0QC 3D8SA 1V7QA 5EIBD 4GM1A 2F3TA 4F85A 5AUOB 4R68A 5J1SB 2CUTA 3DW3X 3CH7A 1QHHB 5TR9A 3NIWA 2CFRA 1PDVA 1XZHA 1R74A 4PYLA 4UU1A 2YQ4A 4BUJA 4GQAA 4R5HA 1JH8A 2JAXA 4RADA 1XEWX 4ZVMA 3KLPX 3IV6A 1GG2A 5FLXA 2QVXX 1RP7A 1TWAA 1QPZA 1D04A 2FHPA 4QC2A 2WM2A 4CMIA 1G20A 4U7GA 3Q7GA 3HP4A 5F1YA 4N5IX 3C5WP 4NE2A 5TJHA 1Z7Qc 1ZH2A 2P5TB 3NJRA 1G8MA 3ENKA 3IKTA 1RABA 3K9LA 4H9GA 3RTBA 2JI7A 1ZOOA 2VDPB 2BCGY 4QYWA 4AKTA 2Q1YA 1I4EB 5BV7A 4H6WA 3KHSA 5KKNB 1DIRA 4CT4B 1E3QA 4UEJA 3EGOA 4E7PA 4YUZA 2GCGA 3VRHA 2IPMA 4HE8D 4OP1A 3K9FC 1O95D 3H1GA 3BN3A 1EJ0A 1ILEA 3KSUA 4WGGA 4AE4B 2NSFA 2I6TA 2H17A 3GAZA 2QTLA 2D62A 1IB6A 1W59A 1Q74A 5FNZA 3DMYA 1QYIA 3VPAA 3ELYA 5EEGA 4MPJA 3IQFA 4R5MA 3RQGA 5B6IA 4CEIB 1PV3A 3ZBPA 2VTVA 4X1IB 3H2BA 5TRTA 1T1RA 1VE3A 3RKOF 1OSNA 3LLVA 4GRAA 5JRDS 3CCBA 2XKAA 4ZC8A 2YHBA 3BQNB 1QG2A 2OO5A 4RLHA 3RSLA 2ZI3A 2B8EA 2QVGA 4HB0A 1UR5A 3SIRA 4X1YB 1UZUA 3GRRA 3K6SA 2Q4EA 3E5MA 1FSGA 4Q1EA 1VMAA 4MS4A 3HRKA 4UCQA 1YHNA 1TECE 1IW7F 2L82A 3KQYA 3DHEA 3KZKA 4DA9A 3NRBA 2Q5IA 1GRCA 2ONCA 5IDWA 3UCFA 3BBPA 4R2MA 4KBYA 1KDOA 3Q3JB 3B2QA 3FXHA 2OORC 4AJPA 2NZ8A 4EW3A 4RQUA 1SU7A 2AR9A 3F78A 4AIRA 2ORIA 4DBZA 1BWQA 3PICA 4CJGA 5ITZB 1M1UA 2PL1A 4A0GA 3UAOA 4GWKA 2ERCA 3IUJA 4JCCA 1QORA 2HQOA 1A7JA 1Y8QA 4BQPA 5KKCA 3MLAA 5FI5A 3VFDA 3KOXA 3HKEA 3ZDFA 3E03A 4LDZA 3LA6A 3BMNA 4GR4A 3FD8A 4FWTA 3NHWA 2R1TB 1P1JA 1ZD8A 1W76A 1UKZA 3E82A 4GU5A 3PGLA 3DWIA 4KU4A 4N40A 4DIDA 2NVUB 2Z5GA 2XGMA 3B3AA 1IK4A 2B61A 4FHDA 1IHUA 3CRQA 4Q6WA 3AL0C 1TTQB 3WLOA 4URXR 4WBNA 5BNFA 4F3CA 1GZHB 4CDNA 2XMZA 1B14A 3QJ5A 4Y98A 3IJPA 2Y1DA 4N4WA 2PQMA 3R6LA 3WIEA 4N48A 2H1SA 3EVGA 4UHJA 2WF6A 4DRZA 1PT5A 2XA1A 4CEHB 3PFHA 1E8DA 3DT8A 3FUWA 4U5DE 2CL7X 1NASA 3KXIA 3E8XA 4CV3A 1ZL2A 5I6DA 3LTEA 3VPHA 2HXSA 3NCTA 3CO5A 4RHYA 1AQJA 5FTKA 3ONWA 2JKVA 1DBWA 4QEZA 3EPJA 4X65B 3LVBA 2HPAA 3AB8A 2I2DA 1GRQA 2VAVA 4BNDA 1PFWA 3WG9A 4QQKA 4JKVA 1JB1A 4HLCA 5FWNA 5SZIA 3QITA 3OFSA 3KUCA 1R37A 1OQCA 3E61A 2RMKA 4LYEA 1GRNA 1I01A 2A5DA 4IKEA 4ODIA 1JNXX 3LIPA 2CVFA 4R3NA 3FBWA 1X39A 2XWBF 2QZJA 2JJ8A 3DO6A 2PWZA 5CT4A 2C1EA 1UXOA 1TWGA 3CZPA 3OP4A 4TQ9A 4ZQGA 5LUBA 3AQIA 4W1SA 3MF4A 1KR5A 3MJ4A 3ET4A 3AM3A 5F3RA 4ACBA 4G0HA 1DWUA 3NBAA 3I45A 3IR6A 4ZT4A 2A1UA 4I9HA 3PNKA 2ZUEA 3SZMA 1MQ8B 4LDAA 1LIHA 4C6SA 3AOGA 5GONA 2ZUBA 1GNSA 4XA8A 3VDXA 3EAFA 4F9GA 3NHLA 2JFXA 3WIOA 3TXYA 1HFWA 4LK3A 1K5DA 2HV9A 2JFVA 1YV9A 2WVOA 4M1SA 3L5OA 3DE6X 5JMPA 1BGXT 3WK6A 3E5NA 5L3QB 3NM6B 5G40A 4C30A 3D54D 4QBFA 2HF9A 1T9AA 4B83A 4Q4CA 1YS7A 1F17A 5FWDA 3L40A 4I1RA 1ZR4A 1AXRA 2JLVA 2BKUA 2QYSA 2R44A 4N54A 3SKVA 1RMQA 4Z49A 2CE2X 2WQ6A 3U9JA 1TEHA 4F3TA 3GFTA 4BDSA 3WZLA 1R0CA 4UM8B 3IMKA 3LBNA 1U0NA 1WUJS 2GN1A 2BM9A 3ANXA 4RV9A 5JAZA 4OMFG 3X1ZA 1EP3B 4V24A 2BSQA 1D0YA 1A9RA 1CY7A 1KKLA 4EZEA 3I6MA 3CLKA 2PX5A 3BREA 4EVQA 4KUEA 1S2LA 3KETA 1M7HA 5I8PA 5AHOA 3K1ZA 4RDIA 3W06A 5EIBC 3IVGA 4H16A 5D5HA 5ARDA 4BIIA 5TF4A 3R5TA 3DBVO 4Q7QA 1H0KA 2FGKA 3AI7A 1FQWA 3GZJA 2JPDA 4C01A 4FYPA 5TJ5E 1P0CA 1ESNA 3RFVA 3HACA 1YR8A 4XM2A 3FRJA 1OB2A 4WFIA 1PK8A 5DNAA 2XUKA 4RCVA 2D0DA 5TLSA 3DKAA 2VIIA 1V74B 1EIWA 4GPAA 3EC2A 1SELA 3QF4A 3QENA 1OH5A 5JVEA 5I7FA 2Y0EA 4ME6A 2V7WA 2PKRA 4RPHA 4NOKA 1QK4A 2HA5A 3E8MA 1R00A 1FW8A 1PK9A 4ZVRA 2C8KA 2PTGA 1UZNA 1E3EA 4A2CA 4OIQF 4HNAA 3OPYA 5JP7A 3H0KA 4WBSA 3U7HB 3U81A 4EJSC 2XS8A 1O95C 1XYVA 3E9YA 4MJ7A 4F9FA 4YL0A 2AGVA 3A70A 4ZK6A 1JHZA 3N59A 1BCRB 1FCJA 4MTFA 4Q4HA 4JC0A 4RFSA 1PT9A 3KUDA 5IBPA 2D1FA 3PC7A 5HR5A 4TYPA 1J21A 4YJHA 1VSTA 3OCCA 1M5UA 4UM5A 2QWXA 3U0BA 2Y71A 1SHUX 4U7JA 3M4ZA 3KZXA 4OLJA 4UHDA 4DB2A 4EKEA 3R5KA 3SD7A 3KKPA 1OAKA 1TPZA 4QEKA 1EEHA 2H6EA 3ZTTA 2QLJA 4GBGA 3ZXXA 3P20A 3C48A 3UVEA 3DFUA 3LRTA 4J7YA 1XD2B 4NATA 1NBHA 4L5YA 3KB6A 3MCVA 1U2GA 2IZOA 3GOQA 1DBIA 2IT1A 2V55B 1CWUA 1L5MA 3JQQA 2QTAA 4QDUA 4CF4A 1IIBA 1RQLA 2DUMA 1C0IA 1H22A 4RY9A 2VYVD 4AYWA 3TN7A 4WI1A 3R3UA 3D64A 1PNRA 5IDXA 3SI7A 3OWOA 3R0VA 1Y6DA 1C30B 1N9GB 1V55C 1WG8A 3JZAA 3F7MA 1E1MA 4I46A 2R02A 3M9WA 2PMBA 2DHEA 4QM6A 3LY5A 1RWKA 4R32A 2D3TA 2LPMA 1C3XA 2Y67A 1RS0A 1BC5A 3DL2A 4IIUA 2Y0CA 3AQ4A 2GFQA 5DSZA 4ZZIA 2OBXA 1LBTA 3TVYA 2UYOA 4GDFA 2LDXA 4DAOA 1XC7A 2PSSA 2BEUA 3U48A 2C7PA 1SOVA 1ZGZA 2DJIA 1KOGA 4YLEA 2WSIA 1NE7A 3VH4A 5AICA 4H7EA 4CEJA 3TIIA 1LS4A 3AEZA 5IPFA 1J25A 2BN4A 4IDOA 5HOQA 4ZFNA 3SYLA 3X2SA 4EF5A 5ALVA 3M4NA 5AOVA 4ND8B 2GFIA 1AN9A 1SUCA 3SM9A 2N42A 4LCEA 1XRPA 2OB2A 1FLVA 5TQ0B 3KOYA 4WY5A 3QSYA 1BSVA 1E1NA 3RSCA 1ZUHA 3K15A 4FLMA 3U7EB 1KAMA 4U5GA 5B1EA 4QUJA 4LMRA 1JU3A 4O4JB 3E4DA 2ZITA 2PUWA 4G0PA 1DJOA 2PZLA 3FTCA 4WEOA 2WUWE 2WFMA 2PWPA 4YT2A 1F1BA 1T5DX 3QE0A 3GUVA 1RC8A 3SHQA 1SVSA 3OTIA 1UBOS 4QYTA 2E55A 2WKPA 4FFOA 3AFOA 3L8HA 1LY1A 3EISA 4QE3A 2EF1A 4YA6A 6Q21A 4DV0B 2XE4A 3CB2A 3BFJA 4UMEA 1COWA 3MFQA 2EP7A 3SU8A 4FSHA 5I7RA 1YVDA 3GX1A 3ZDYB 3LWNA 4HWSA 1VC2A 3MJRA 1KR2A 2VWHA 1GQFA 1O4WA 1NBAA 1C0LA 2HO4A 4BNHA 1UK9A 1WKCA 3NORA 3V55A 1U7TA 4AYXA 3O2QB 2V6IA 4BOYA 5CJJA 4DJAA 4PPGA 1JZQA 1MHTA 1K0FA 3WAGA 1N1MA 2XGOA 2JJQA 2P9JA 1JI3A 5AJUA 3VHXA 3ZHTA 4BO1A 3C87A 1G2OA 3LC1O 4QOGA 4DIEA 4BRSA 4YC7A 1INLA 1WD5A 1IL0A 4HP8A 4Q19A 4EJ0A 4UAUA 1CC1S 2WHRA 4GPIB 3STYA 1T34A 3GNTA 2PY6A 4XWTA 4IIFA 2BSXA 3JR3A 5HRUA 2J0SA 4LE2A 3W9UA 2KC3A 1THMA 3VH3A 3CS3A 4B3RB 2Y3IA 4OQMA 4NBUA 1NGSA 4JJIA 5H16A 3GLFB 2YL7A 1RXWA 3B12A 5JS5A 4EL5A 2WABA 2AP3A 5E1MA 2QQ5A 1WN0A 3W2GA 3IBTA 4OLFA 1YD7A 3TKAA 2E7ZA 2A7XA 3TTYA 2IXBA 2HADA 5CDTA 3CH6A 4P2GA 3FE2A 1QMGA 3ZOZA 2VSOA 1I2BA 4LWOA 3WYBA 4H31A 4TV9F 3D1VA 1SKYE 2Y39A 2QDXA 4W6QA 1LQTA 1USUA 4XEVA 3R20A 3OE5A 3FVQA 5JFOA 3OZ7A 3U16A 3K16A 1LDEA 2JGLA 3VJMA 1HR0B 5CYGA 4GRIA 1HO3A 3I30X 4W5OA 2JIMA 4R2KA 1HK7A 3S9OA 1CS0A 1I7QB 3W5JA 1T1GA 1L7RA 1XA3A 3IQGX 5KYXA 2V96A 1AURA 2A4KA 3NW9A 4U3JB 3L8FA 4PJNA 3RO7A 3QFHA 3HGTA 4BX0A 4CMGA 4K40A 3AHGA 1I5RA 2LCFA 1LQUA 2LCIA 1SC6A 4TKVB 3H84A 4D98A 2CFOA 3I6ZA 4O2AF 3RROA 4NK5A 2RH5A 1HQYE 2YQYA 3U9SA 3HJNA 3ST7A 4FT4A 3SYMA 4NMLA 3S68A 4BPRA 1PR6A 3DR3A 1JDPA 3TEFA 5JAPA 1EG2A 2C4TA 3BWVA 2FOLA 3QVZA 1L4MA 2WYVA 3M2PA 2P7IA 3M81A 4XLZA 1MJGA 1BDMA 3E2MA 1FL9A 3PQDA 3FNGA 3B29A 1UK8A 4WNCA 4P9FA 3GBSA 5DW0A 4OK3A 2JBWA 5FQNA 2XF2A 2G62A 4GP6A 5BPFA 1D6SA 1ZSYA 2QXTA 1DC4A 2Y05A 3KZVA 3O7MA 3MUOA 2YWAA 3R0IA 3D5QA 4YR9A 1KP3A 4G0XA 4LQCA 1WASA 2DZDA 2O8CA 1HXHA 4WAUA 1UMKA 3P2YA 1XZCA 3ABQB 2FFBA 2D1SA 1IONA 3TW0A 3DWEX 2J48A 4RVCA 2ORVA 3PPWA 1OWMA 1SA0B 5IFKA 4YRFA 1I7PA 5B57C 5ESRA 4MI6A 3HUEA 3M6FA 2D3WA 2FJUA 1KTVA 1APCA 4J6FA 5HYVA 5FCDA 5EZYF 4ETNA 1JMWA 4NQZA 2I7DA 5GJCA 1QUFA 2RK3A 1Q83A 4X20B 2AR0A 2X8WA 3RC3A 3K30A 1W0JA 2PVCA 3RC8A 1ODFA 1NMZA 5A4KA 1A96A 1CZKA 5ENVA 1SIWA 2FPIB 4L76A 3FWZA 2B1IA 4F3RA 2VCEA 2FG5A 1BKSB 1TX4B 4GLFA 2B82A 3PHIA 2XODA 1XXLA 3ONVA 4HDQB 4G1BA 1TFRA 5LCXA 1H4QA 1V54C 5DF1A 3WBFA 1PS8A 5F4BA 3R3JA 4IDCA 3GK3A 5ED0A 4LCJA 4CODB 3AHCA 4EG8A 4ZVSA 3QZCA 4DA7A 4A5OA 3EQLF 5HIMA 2HL6A 2PXCA 5C0OE 1JN0A 4V0OA 4E33A 4XB6B 3FWNA 2WWHA 4TT3D 2BR4A 1S05A 1GZVA 2FFRA 1X8KA 1XVAA 4EY3A 1YQQA 2PLWA 2ZJ8A 1OI3A 1S0UA 1IN1A 3DA8A 3TIXB 4EG1A 4BLVA 5FCLA 2OCPA 3O4RA 3LF2A 4PQYA 3EMDA 3KAJA 1OROA 4NVRA 5KVAA 1FJ2A 1FDSA 1L7XA 1BD4A 5DP2A 1I4TD 1N32B 3CU5A 1OPRA 3OKPA 4BV2A 5EMNA 4ERNA 1GFIA 1TM4E 4PAMA 1SUPA 3I8XA 1XTJA 3DDNA 1BQ3A 3ESRA 4YJHB 5KOJA 1EDDA 2BDEA 5B12A 2J3IA 1YBHA 4CDGA 2GFHA 5KQLA 3KBBA 4NPAA 1J07A 3HSKA 3GRVA 4LX0A 2ECOA 3UFXA 4H0FA 2EP5A 4E88A 1VZ3A 1NJ8A 5KIAA 5FBQB 1T8SA 2EWVA 5ICSA 3PF9A 1SH7A 3K0CC 5JH7A 1DAGA 2HSJA 3GBVA 2Q7DA 3OCJA 4CBEA 2PUFA 1E63A 4UEOA 2QTWB 2Z3VA 2A0YA 3OZEA 2FP3A 5F5FA 5LJIA 1Z4LA 1RXUA 5U9CA 3HYSA 4D0NA 2HKIA 3BFXA 3ND6A 5CA0F 3GFBA 1EBUA 2CFSA 2BVNA 4GWLA 1SYQA 1FB5A 4H4DA 3PPVA 2YKZA 4G3XA 1AS3A 4RA6A 1YZUA 1QO0D 1GNTA 4AMYA 3PGMA 5M29A 13PKA 3VZDA 3FVVA 4JWKA 4GKAA 1VE7A 2YQZA 5DNEA 4GBED 5DM2A 3PKZA 4PGFA 4HWGA 4E07A 4HDSB 3TW6A 4QDXA 3TNYA 1JR3D 4P38A 5LZ8A 1FNSA 1Q0UA 5F2KA 1SVNA 4LMPA 1ONBA 4UEKA 4KFSA 1PZEA 4M0KA 4FKMA 4FR2A 3DUWA 2FK8A 2F1HA 5DTEA 3D0RA 1UL1X 1SCKA 3FR7A 4BMCA 1PR0A 2O8NA 5K3CA 1MQAA 5CFOA 2YN2A 1NNEA 3CAXA 2P8JA 1ECBA 4F4JA 3EYAA 3BRJA 1I7NA 1RWPA 2I29A 3BGSA 2OVBA 3JTMA 3L1HA 3IEXA 3VR6D 3C6YA 3E9EA 2VUIB 3EFEA 3HZOA 4JUIA 1G19A 1D0IA 2FN9A 3C98A 2DCUA 2OUKA 1XMPA 4K9MA 2JRCA 5FAKA 1QHEA 4RJTA 3ZQYA 1U7WA 2R96A 2OGWA 4FDMA 2ZJ7A 4UBIA 4ZC1A 3IEKA 3DOEA 3DE1X 1L3CA 4LOIA 1X2EA 3EMVA 3NJ8A 4NCIA 4AUMA 3EXAA 4JLPA 4PG5A 4QOFA 3ZTYA 3ZLUA 3U7FB 1SOUA 3FHLA 5DV9A 5LB4A 3BHJA 2IUTA 4DSZA 4XASA 4G78A 4N6CA 1J39A 5LJLA 3M3PA 3UMKA 4OHYA 1VXRA 2B30A 1PP4A 5C8YA 1YR6A 2AS0A 4R8MA 1PJRA 4JT4A 2NPUA 3BMCB 4HGOA 1L4LA 4M87A 3ZQ6A 3CF6R 1L9XA 5BSUA 5IS2A 2BGRA 3VHXB 5MHTA 1R16A 4MDHA 4TL9A 3SEOA 2CLMB 4LY0A 2ABWA 3HCFA 4UKDA 1BZYA 4ZCSA 4I44A 2JI4A 2A0KA 2I71A 3HZHA 3FJYA 1B16A 5IULC 3QYPA 2EINC 5HKBA 2FPWA 5AKLA 2IPAB 3FUVA 2ZR8A 1RFLA 1UIRA 1UPFA 3L9WA 3LDAA 3ZDXB 2IGBA 2VHCA 1II0A 3E05A 2RBKA 4GOOD 3LAWA 1NLMA 3FGNA 1CT9A 4Q24A 3O31A 3P5SA 3BSFA 4JA0A 4D9EA 4QTZA 4P93A 4GL4A 1VI2A 2H57A 4PWZA 4N3CA 4ZV9A 1A7EA 1RZRA 2HREA 1AUEA 1U7OA 5LDHA 4A8JB 1AV7A 5K4AA 4DVYP 2HMUA 1G4US 4ID3A 3O47A 3R75A 2DFKB 1A4XA 1GA1A 5THXA 3AG1C 3K8OE 1GZSA 3EEQA 4BU1A 3IIEA 3RTGA 2CVZA 2EKDA 2Q5HA 2A92A 1Y4UA 2VJMA 2O2SA 4X00A 5ALHA 3F73A 2C31A 4CM8A 4PZPA 4U2EA 4QOHA 3GAAA 1NR1A 3PRKE 1VE6A 1RLIA 1OX6A 4LZPA 4XR9A 2AB0A 4CDYA 3KKLA 1KNXA 2D1TA 4ZTUB 4DIKA 5BQIA 4O02B 5HJ2A 3EX7C 2RHHA 3GWZA 5TNXA 3HPQA 4YRGA 2WV9A 1UOPA 2ZRBA 3N6VA 4ER7A 4CR8A 3UJ7A 5DM4A 1QXSA 3VYWA 4MYDA 2GBLA 1GRVA 2ANCA 2YOFA 5L6MB 1Q7BA 2OENG 1VYUA 2D0IA 4PFKA 4AC9A 1QP0A 4LXGA 1GDTA 2IDKA 4XE5A 4I66A 5LWHA 4KXMA 4XWJA 4A4AA 3LDUA 4L8VA 1DOAA 1QHHA 4PPFA 1XUOA 3F6CA 1NF2A 2C8VA 5CVJA 3FFBA 3TPZA 3E9QA 4GSYA 4NX2A 3MFYA 1TUBA 4ON9A 2PH1A 4PO9A 2IZ1A 2ZE8A 1G9XA 3ZXUB 3DEHA 2F8TA 2P2SA 4DMFA 3WL3A 2QUPA 3ELUA 2XL4A 3GANA 1DAFA 4BN4A 2BUAA 3K6JA 4O4HB 1HI9A 4LDNA 1C14A 4XX0B 4PVDA 1WTAA 3MBOA 2VRCA 4HDMB 4BQNA 1D2HA 3BMXA 4C05A 1KEPA 3C63A 2ZRIA 3NFRA 4WINA 5JS7A 2NGRA 1MVNA 5CUQA 4B7CA 3GJXC 4OU5A 3RSZA 4EPYA 1O8BA 2HRRA 3IEEA 4E2ZA 1IN6A 5DLYA 1ZL0A 2IF2A 4AE4A 3RRMA 1AGPA 4ZV4A 1PWXA 3BA1A 1II8B 4G56A 3ZBQA 1QH0A 5GMOA 4JR1A 2CHUA 2PNFA 5HE8A 3KE9A 4E1AA 4CEIA 4PZAA 4X1IA 4ZYVA 5HP4A 5SYNA 4ZYWA 3MS7A 4RHFA 4N49A 4BUZA 3DKPA 1FXSA 1H2ZA 2RAPA 2X5KO 3I9LA 1XRRA 2B94A 2L81A 1BMFA 3Q4GA 4DR2B 1CPQA 4GQBA 1AD2A 4WOPA 1DCTA 5J4LA 4B1FA 3CSKA 4GG1A 1OCCC 3IS3A 1V5EA 2JGDB 2FEXA 3RS9A 3ZY4A 1S3SA 4FMPA 3D81A 1TA0A 3PUXA 4LE0A 5KJ6A 2VF2A 1T6ZA 3C4QA 1VE1A 2HWKA 5IJAA 4LISA 4K9DA 3VX4A 1XX6A 3OOYA 4ER0A 3TEJA 1M8GA 5CLJA 1SO8A 3PG5A 5F3WB 3ER9A 1N1CA 3ERCA 5BQHA 5ITZA 2JJMA 1Y9ZA 2GDZA 3OCXA 2B35A 1H6GA 3HDQA 3SX2A 1G8AA 1U28C 3ITDA 5EVJA 2P2YA 1MMNA 4ZO6A 1FJXA 1DC6A 4EG6A 1C17M 4CU5A 1MB3A 4R71A 5LQCA 2IC5A 2XQVA 3RRBA 2R1TA 3STTA 4FGUA 2DB3A 3BB1A 2QGFA 4V0NA 4H7DA 3O95A 1EGHA 2NVUA 3C5EA 1S8NA 5KTTA 3I3OA 4ICIA 5F5LA 4F7DA 4IZ6A 3L4KA 2FRDA 2VF8A 1NNI1 4D96A 1JXQA 2O0KA 6PFKA 3AM5A 2IHTA 4Y7CA 2OCDA 2KW3C 1DKNA 5AIAA 4AXBA 1E2NA 3OI7A 5FTMA 1Y1QA 1GUYA 3QEKA 3QU5A 2BF4A 4QRIA 5L9AA 2RI1A 2D13A 3M6UA 2HWUA 1QE5A 4CEHA 5JLAA 3VZSA 2WZCA 5AHKA 1SUDA 3L18A 2E4AA 3NBYC 3UUFA 3U3FA 3FBGA 4S0XA 3CVOA 4PFQA 4CW7A 3ORSA 4W5WA 3H5IA 2ZM6B 3LHSA 1EXNA 2DR0A 3IMFA 2BHLA 4WJKB 5EJ9A 1R18A 4X8HA 2XYQA 4JI7B 2ODNA 3F5FA 1DBRA 4ILKA 3E84A 4WE3A 2EJTA 3PQ5A 6ABPA 1G17A 3HH8A 3KHUA 4CF6A 5ALJA 4Q7CA 3KJHA 1DMSA 4A6XA 2G4VA 2PCJA 1YVRA 1EHIA 1KWKA 3RU2A 4W8KA 4PY2A 4OMUA 2PKYX 1L5HB 2OJQA 4M22A 2H8GA 4KNYA 5CFZA 2EZTA 4MCJA 1IBSA 4A2WA 3E70C 4XJXA 5FLKA 5KTKA 1RZUA 1U2RA 1HFJA 1SNYA 1TOAA 3P94A 1KORA 2ZU0C 4LBVA 5EFZA 3OWHA 1AKMA 2D5CA 2G1UA 4B45A 5LMNB 3CLSD 3A1TA 2ZRDA 2J3HA 4AL0A 4YV0A 4XIYA 2HDNB 4KC0A 3DCYA 5L3QA 4U5QA 2Q9UA 1TDJA 1POWA 1O7JA 5IARA 1KO7A 1F8YA 5C5EA 5DT9A 3Q10A 4A0QA 4LWZA 1SU8A 3UWPA 1P1HA 1A2KC 3DDWA 1P7CA 4AB1A 1P9WA 2W4QA 4C3EA 2OCCC 5LVAA 3ZWCA 3L4EA 1L5SA 2ZZNA 3AM1A 5K2MA 2ZT5A 1O03A 1T6QA 2CMGA 3ETEA 4BLWA 1V6SA 1ECLA 5AI4A 1E5TA 3I05A 5FQOA 4TN5A 3NKLA 3FTDA 5EIOA 2AMYA 5CCEA 3X43A 3K4HA 1AOXA 1ULHA 1GR1A 1O94D 2B37A 2GYUA 3EAQA 4I19A 4AFNA 1EVIA 4JIGA 1KNYA 3RV3A 5JJCA 4OQDA 3JZMA 2VHQA 4ZEVA 1SBYA 3O94A 2KGOA 2P8SA 1X8JA 4KN9S 3VR2A 1P91A 3T1TA 1V7CA 3PNPA 3TB4A 2O1XA 5FUBA 3NHRA 1P5JA 2O14A 4HAOA 5C1IA 4URHA 2EW8A 5H8WA 5A05A 4TLCA 3ESZA 5AP9A 2H08A 3H4VA 4PZ9A 1K68A 4BV9A 3PNLA 3Q85A 1JECA 1TXGA 5IKOA 3P71T 5JDCA 1XVTA 3GLGB 4M89A 4REOA 5KNDH 3GVXA 3LE8A 3OLCX 3AIIA 5F3DA 1MNAA 5EZ6B 4F71A 2CSXA 3TLYA 1P2UA 3NEPX 3UOWA 2CXTA 3CEJA 3ZWAA 2IA5A 2Y9MB 3G2JA 2I7TA 3I9OA 3QTBA 4IIBA 2GF9A 2LVBA 4S2EA 1X7YB 1Q1ZA 4PX5A 5C80A 2WU8A 2L6GA 5D86A 3K5PA 1W1UA 3QM1A 4FE4A 3AR5A 3OUZA 2PEZA 4M46A 3NHKA 3WWZA 4IDFA 4CPDA 4BLQA 3G49A 4QUHA 2VB6A 1W52X 3CRMA 5AXDA 1MDBA 4PLZA 2H3EA 2IHVA 4TWJA 1L8QA 3Q15C 1BCRA 1Z0KA 2AVNA 4OH7A 3T9FA 2HA2A 4MAMA 4Y7DA 3NRHA 2P4UA 4CN9A 3GVIA 3CBGA 2HEGA 5B6PA 1RWWA 4M1WA 2W2KA 1NMSA 3AP3A 1ZEMA 1U3VA 4RVFA 4PHCA 2WQZA 3FJ1A 2GD2A 3T5GA 3PXXA 1QRDA 4B6RA 4DCJA 4WOJA 1EAMA 3MYRA 2GPAA 5IYZB 4BFSA 2BUCA 4O6VA 2WZBA 1E7QA 2XIJA 1NFFA 2PJUA 3B6KA 1UJ2A 1XD2A 3MHTA 6ADHA 3FKQA 4WEQA 1U6IA 1TUBB 4CQMB 2O5CA 2ISSD 1GPNA 4JBIA 4HPXB 4KC9A 4G24A 1R8XA 4DKXA 2D4UA 3TLGB 2W70A 2IBSA 5CDSA 2I91A 2PMDA 4ER3A 2OHIA 2WF8A 2ZYIA 1OH7A 2OZVA 1VLLA 4NV0A 2AD1A 3AUFA 3O21A 3AV0B 5LBUA 2BW0A 2EQAA 1F0YA 3NHJA 5FFMA 3H17A 3TZ6A 4FMCB 5E3AA 3QVYA 1ECCA 1BMDA 4EHBA 3L8IA 4QPJC 1C30A 1N9GA 1E99A 3PJDA 3WQBA 3HL4A 1WPGA 3C5HA 3OPMA 1YZGA 3DH0A 1ZVKA 3N70A 3X1OA 1Q0QA 3DDOA 2Z98A 3WK7A 1E79D 5ILGA 1T3TA 2WB7A 1YQ9A 2J8WA 3VH1A 2QW8A 2QOEA 2XRHA 4MVJM 1HEYA 3DE9A 4LYAA 1HMOA 4QXAA 1B0AA 3H9BA 3LLUA 3L0OA 3T9CA 1CGOA 1ZM7A 3QH4A 1FX1A 4A8HA 5C37A 3UMJA 2XECA 2CYCA 4LGVA 1X7DA 4LIPD 4ND8A 5E9QA 2PF4E 1EX9A 1RT9A 2QENA 3F49S 3JQCA 1XE3A 3QPDA 4V0LA 2JGAA 4BWVA 2QX9A 3HI4A 4HFNA 3V4SA 4CTOA 5TQ0A 2BEWB 1H9BA 3ATPA 1QX3A 2HRBA 1R9MA 2XMDA 4Z0TA 4ND1A 3R77A 4PIPA 4OJYA 4L85A 3KRTA 1KJJA 3RYLA 4O4JA 4ESEA 3SICE 4QL3A 5KVCA 4MDFA 5E2BA 4YUXA 1DDIA 2D6FA 3FYCA 3H5OA 1KP9A 1RKXA 3PHLA 2GD1O 3WI7A 2ENWA 3V3KA 1E2FA 3CR8A 3UTCA 4NMMA 1ZNXA 4HWTA 5EUCA 4LVNA 3L1UA 5C4IA 1O97D 1IJBA 3ECCA 4PRYA 4EFKA 3BE4A 3PYMA 3SXMA 3ACCA 1W36C 3JWJA 2ZR9A 3QIAA 5KU1A 4RVNA 3VOSA 5AVJA 9ATCA 5BR8B 5CRIA 4Q1AA 4AXXA 4Y2TA 4OSPA 1G66A 4HNSA 3SE0A 4ZOLF 1ONSA 2QGZA 3ROXA 2HHCA 1YC2A 1S4QA 3T7KA 1L4EA 1KYIA 1SCQA 3ZUGA 3FCYA 2R6CA 3TAXA 1HF3A 4BV3A 4KLZA 5F4ZA 1PJTA 2VO1A 3A9SA 3PX7A 3QX8A 3CLSC 2E87A 1CFZA 4C0HA 1V0JA 1L4YA 1RMVA 2X77A 3FOPA 3K20A 3GLFA 1HL3A 1VYHA 2E9SA 3PWKA 4YP0A 1U0LA 5BMVB 1JIUA 4FPXA 3O75A 5LR6A 2QJOA 4OREX 4OXKA 5L51A 3I73A 3JQFC 3DZJA 5E7QA 1CUXA 3R0ZA 2I62A 2OWEA 2OO7A 1Z5NA 3KYBA 2R8ZA 1QPBA 1GPKA 2GXAA 2CE7A 4NZPA 4XM1A 5IAAA 4ZHQF 1LA2A 4EY4A 1ZRNA 1XQ1A 4Q1FA 4FFBB 4PO8A 3MX3A 1P3Y1 3LWBA 2QN6A 1O94C 3UW1A 4AVYA 3DKKA 4TROA 1LTQA 2IIVA 2WHYA 1K7EB 4U3JA 4K88A 1PI3A 1P7PA 5B53A 1X1RA 2Q0HA 2BFWA 1KZHA 3UHPA 5IMBA 3H11B 1JQ3A 2QD2A 4J0JA 1BN7A 1TQDA 3V7NA 1QIIA 2A35A 4RKWA 2QP9X 1G9TA 2C2BA 2O9XA 4TKVA 3BERA 4MUGA 4JXZA 1G8XA 2VDNB 2WMOB 5TQVA 3L6UA 1E4OA 3QLVA 1SRQA 1M34E 1B8OA 1OAOA 4NF2A 2X0JA 2AZXA 2OOSA 4I1PA 3U3MA 4DLWA 4IDNA 5HIIA 2XT0A 1YE3A 4HX9A 4Y2UA 1SQFA 3CZ5A 5B3IA 3C6BA 4YT5A 3PUYA 2AF4C 2VJYA 3UJ6A 2QXUA 2A4MA 1DX9A 2FE1A 1WLYA 1QHNA 2TMVP 5AW2A 3KTFA 4BO5A 3L0BA 1QBKC 1PIWA 3UXYA 3OZCA 2B69A 1W48A 2WJWA 4CS9C 4QDOA 4DSAA 4DAEA 2H1OA 4QJ4A 2Y1XA 4ZMSA 4QM7A 3GJYA 4J4HA 2ZE6A 4YFYA 5L0GA 5IXYA 3KTAB 1ACLA 3W8HA 1ZYRF 2TSYB 5DVWA 1H69A 3TQRA 4WNYA 1FYDA 3GA7A 1SA0A 3B5EA 3UMCA 1DJPA 2EGHA 2QRPA 3EGIA 1SVWA 5J2TB 1C9JA 2EPKX 3QOXA 4K1LA 4F6RB 3NKDA 2EEPA 2ZBVA 5A2GA 3CVYA 4NJEB 4X20A 1Q1NA 4PLYA 3Q0IA 2WB4A 4NOMA 1J97A 2IKQA 2FPIA 2CXPA 1IOZA 3W9BA 1PR3A 4JCOA 3ZG6A 1OY1A 2YY6A 3BORA 4BGUA 4OG2A 3SVZA 3NETA 2I65A 5TDHA 1CUBA 5BVHB 5DZSA 3T5AA 2NPIA 1DWOA 1EHCA 5L8VA 5EHIA 1LI5A 2Q3TA 2VDUE 4Y6PA 4L9WA 2R60A 2DQSA 4EA9A 1BN6A 2YMPA 2WIAA 4F2GA 4QU0A 2HRCA 2WHXA 5MFZA 4RV5A 3S1AB 4TMWA 2YJ4A 4CF3A 2IXGA 4YPFA 1W581 5LLSA 3GLUA 3R5XA 2KI5A 5I7EA 5EJ8A 1HE1A 2DHDA 3GEDA 5AW4A 2GAQA 4H7HA 5NLLA 1ZA2A 2Z43A 2XEDA 2J9FB 4MGYR 3LECA 4DR1B 1XKLA 3M1IA 1A7VA 5JE8A 3PSAA 4GM4A 3MERA 1D9ZA 1LRJA 2QE6A 1SBHA 5JVDB 4RMHA 2ZR0A 1I51A 5KWEA 4UARA 4WBNF 3FOZA 4OATA 1K66A 5HS4A 3PENA 3RWOA 3ROMA 1SVKA 4WKOA 4MW2A 4HB3A 2W2KB 2COEA 1CR4A 3AHHA 1ZICA 2XMSA 3MHPA 4ZT3A 3RS0A 1NY6A 3CW2A 1GT6A 3VF0A 4E5UA 2BRUA 5IKXA 1UBLS 1WXGA 4BMSA 2ZDGA 5BSTA 4WASA 4A0FA 1FDVA 3NS7A 2DWCA 3G88A 1IC6A 3ICOA 1TU3A 2B1QA 1KVQA 4F91B 4W8OA 3AR7A 5DTIA 2R7UA 1Y42X 4EGQA 3P4UA 2B25A 3A8TA 1JFTA 4LG1A 2WIJA 2V0NA 4GQIA 5K20A 1ZGHA 1CRQA 4EHPA 1G6HA 1PTJC 2PK3A 1O97C 3NGLA 4UHEA 3AFGA 3NRCA 1G3MA 5JFGA 4ESOA 4N3AA 3KQMA 4N4AA 1JDUA 3H2KA 2HZBA 4PYJA 2DB4A 2HZ8A 1E2LA 1ID1A 4RA9B 3ISJA 3ESQA 4MRNA 3R2PA 3L7CA 1RU3A 4RPIA 2FW7A 4U9IS 2ZYRA 3RW9A 1JAFA 4H1WA 2R3SA 1IN5A 3K92A 4HDSA 3RANA 2PUHA 1E4YA 3RVBA 3U4IA 1ZLYA 4M7WA 4BX3A 4OQNA 1KMIY 5GONF 1WWKA 3UGQA 1Z0JA 1Z2EA 1ZIXA 2CYAA 5BT9A 4CS7A 4B3DA 4HPJB 1HZZA 4TLDA 3WJAA 4OQEA 3WLEA 3RWBA 2XYVA 3ASOC 3L9XA 3HUUA 3PGA1 5AI0A 3GWLA 1DTSA 5AC5A 2PZMA 3FDZB 3L1VA 2I7CA 1KEVA 1Z6AA 2H4FA 2HQBA 4E94A 1QE3A 3HNIA 1DFHA 4OHCA 3ZDCA 3SJAA 4KFCA 4EO7A 1W0JD 4P84A 4HAVA 1ZSNA 2XMGA 3GDFA 5HOEA 4BO2A 1XHLA 1AHNA 4DZZA 1SVUA 3G79A 2XGJA 4ZPXA 5D6NA 3BFVA 1FDTA 5BNTA 4GMFA 5EI5A 1YB4A 3ZW8A 4XPZA 2PSFA 1MNQA 3H4IA 2FWJA 1S8OA 2VP6A 4M1TA 4IVNA 1YS2X 3WL8A 3V4LA 4XWOA 1TTTA 1NLUA 1TC1A 3TI7A 2RGWA 1JAYA 5EESA 5GV8A 4DQKA 1TF2A 1TM1E 2JA2A 4YBRA 1EUZA 3U5ZB 2NZYA 1L9KA 4WLOA 2K2QB 3WXBA 1WWPA 3FOFC 1H6DA 3UMRA 1CDOA 1EQ2A 3VNRA 1XF1A 1VA5A 4EECA 1SWWA 1VL8A 2OBLA 1X86B 4CMBA 3PC8C 3V00A 2UUIA 4KYUA 2ZXEA 3BMCA 4NEGA 3I4LA 4FZ3A 5CM2Z 4KQ2A 5I3ZA 1KJYA 2QP3A 5A03A 4RF4A 1DRJA 4KXUA 2Q5EA 1CVLA 3NEYA 4NDNE 4PZCA 2R79A 4CLRB 1YHYA 4IGFA 3U3ZA 3X1JA 3RFXA 5G4LA 1WBJB 4I3MA 1JEQB 3NATA 2Q5JA 2BDTA 1T3HA 3MJDA 3FPHA 3IT2A 4CRWB 3EDYA 4HR7A 1FXUA 1YBAA 3BIWA 2J6CA 3I39X 5DRYA 5KNCA 1W4BA 3AOEA 5K1ZA 1NR7A 3ILHA 3TOVA 2ZRNA 1Z5ZA 5DPMA 3R40A 4OBEA 2MIIA 1K89A 1IPEA 4RIEA 4A8JA 4GBJA 3MMSA 3A2NA 2Z4TA 5ER6A 3PIRA 2J59A 2C0CA 4ARZB 2YVQA 4JZKA 4Y8VA 1M6NA 2ZCVA 1KI9A 4DOMA 4WH0A 1EWYA 5ICFA 4I5FA 3FWPA 4K81B 4RVUA 1E8MA 1UKEA 3X0DA 3NHZA 1P0FA 2G71A 3PHGA 3L4BC 3W2EA 1HE8B 4BJ6C 1LU9A 1O5OA 2QU7A 2KSFA 4LKRA 5HVNA 3QF7A 2I3ZA 1LPSA 5BW8A 3RFTA 2Q4DA 2O0JA 4BQRA 2QU8A 3BZUA 2CNNA 2OC4A 3PDUA 1JL3A 1RCTE 1ZC4A 4X92A 1N8NA 5COQA 4CN8A 1PJ2A 3TFWA 3RYIB 1O87A 2VCCA 1Q7GA 3ENWA 5FFFA 3TXXA 4WACA 5CA1B 1DLIA 2GKGA 1PNVA 4OHUA 3TOSA 3C5VA 3C6MA 3TLJA 2GILA 3DZKA 3ZWDA 3CINA 8ATCA 2X8LA 4PSUA 3K2QA 1XCMA 2XCOA 3L84A 2FHSA 1A9OA 2DX7A 4B48A 3D4OA 4MWTA 4CT0A 3EA0A 1QIEA 1P1IA 1UFOA 1YLMA 1K40A 3TH5A 3ORFA 1CR2A 5C35A 5TMBA 1JSRA 1ZOIA 4NBWA 1YACA 3UGTA 3L93A 2VOEA 3WGZA 5ILQA 1XDBA 2ADFA 3V5YA 3FGPA 3OT1B 1V4VA 2YYSA 1ADCA 2W48A 3O38A 1VL0A 1RACA 4RS4A 3K1AB 4O4HA 3EVCA 1U02A 4XX0A 1KVRA 2W22A 5FUXA 4HDMA 1AB5A 1GPBA 3CURA 1G59A 1SQ6A 2G06A 2BONA 4ROSA 1OVGA 3C2QA 4Q3EA 1BFKA 3RGWS 1XD8A 3N6XA 3GL9A 4M9XA 1ZH4A 3MYYA 2BBOA 3OMWA 2UXBB 4IQ0A 2MINB 4YMHA 1Z0FA 3THYB 2JLWA 1CJMA 1QQ6A 3DMNA 4UZSA 4ZLDA 4M86A 4N7JA 1LLFA 4KWCA 4NY1A 2GHTA 2NU7B 4YRLA 5KYTA 1Q16A 1X6VA 4JLBA 1I6WA 5B30A 2DWUA 5DN9A 4Q4ZF 1ABBA 1II8A 1MB2A 4U5EE 1IHPA 3TRFA 3ZZTA 1K06A 2JAWA 3D3WB 1UXHA 2ZIEA 1YVPA 2JVKA 1XVUA 4GI1A 3UMSA 1U2PA 4BNZA 5KNCH 2OHJA 1X70A 2P41A 3AF0A 5EP3A 2WYHA 3EW9A 4YJ3B 1KYTA 3GP5A 1AKQA 2W83A 2C78A 5GY7A 4LRXA 2Q0QA 2V45A 4EGFA 3TZLA 4OQQA 3ZCPA 3THWB 1HC7A 3OM8A 4WX2B 4FNAA 1LWOA 2VTKA 4AQDA 3ZW7A 4BB9A 5J4HA 1GSIA 4GPBA 2JGDA 5CG1A 5JYCA 5KTRA 2BMEA 2A78A 3DKRA 1SCNE 4ADSG 4US1R 3SR3A 2EPOA 2HX1A 2H65A 2JL1A 4BFXA 1X1CA 4TM7A 1JQDA 5EKDA 2CJFA 1PWZA 3MQ4A 4IUYA 3P9SA 4M8LA 2XY4A 2Q27A 3U31A 4PZEA 2BGMA 3BRQA 4G4JA 1DHTA 1V8DA 2J7KA 4BEBA 5ALOA 1ACMA 3DEJA 3EZ6A 4R9RA 5EGSA 1AQUA 3IVMA 2NIPA 2XVZA 4DDWA 4KSYA 1N2XA 3ZZUA 1GGNA 5CDYA 1OUMA 4RPLA 2XCRB 4P0PB 2WEKA 5KYNA 1CQIB 2H2AA 5EUBA 2O2JA 3IXLA 2C5HA 3FFWA 1A5TA 3KD2A 5M5BA 2XYHA 1U9IA 1OIWA 1NJ2A 2WF9A 3ZWOA 2IELA 3PL1A 3DOHA 2R00C 4AUNA 2C04A 3HB7A 4KPGA 2ZROA 3P7MA 3LFUA 2ZTUA 1RXQA 2YKGA 1Q0HA 1JG4A 1H66A 1N3YA 3G50A 2J85A 3A6JA 3VNUA 3E0XA 1KAHA 3A1UA 1OBVA 1R4NB 5IT5A 5LQDA 1Z8HA 3TW8B 2FEOA 4BVBA 1ATZA 4WIAA 1T5SA 2ETXA 1E6UA 2PS3A 1KMMA 3PLNA 2WAAA 4G2NA 3FBTA 4NTBA 4N65A 3T99A 1OVMA 4D82A 3O3CA 4IAOA 1KL7A 1JV2B 4IXNA 1UOEA 1Z88A 4D41A 1WMAA 4NYMQ 3RS7A 4ZQEA 1M73E 3V8VA 3WMWA 4WCFC 5B58T 4BZQA 3G0OA 2PL3A 2Y0DA 1YBVA 4GMDA 1BAPA 3RKUA 3VR0A 3VYVA 2AWCA 3WGUA 4XIIA 2PH5A 2V3CC 1I3KA 1QZXA 2ZQ5A 4Z86A 4MCAA 2BI4A 3GEPA 3AUTA 5CITA 4BEVA 1L5YA 4MITA 2BJWA 3OTQA 2XUPA 4MW0A 3V7OA 4PYKA 1L5HA 4YV7A 4CCYB 1YJXA 4S1OA 1V6CA 1QTIA 4W5HA 2B2XA 2AJDA 4MEJA 2QP4A 1XRNA 3QYAA 4WJ0A 1N0UA 3RUDA 1DEOA 1U2EA 1GU0A 3QOWA 3NM5A 1HLGA 4G5SA 3VR5A 3ME5A 4NU0A 3N5KA 4O6MA 2F7SA 3ML1A 4GL2A 4DDMA 2G83A 5TGDA 1X9GA 2M6KA 4F06A 5C51B 4Z6KA 3Q2OA 4YAGA 2ZB4A 4AG5A 4FFSA 2DPMA 2NTEA 3CM0A 2DKFA 1CQZA 1WRBA 3ZXYA 1GFSA 4P5DA 1XN4A 2Z09A 2V59A 5JAHA 1ZHHA 2EKLA 2BLLA 2GA0A 1Y37A 3IMGA 1KI2A 4G85A 5G1OA 1S3GA 4EMSA 3MUNA 2WUEA 4Q9LA 4PN7A 4WRRA 3IP8A 4BNTA 4Q7JB 1K0UA 2H5LA 1C03A 1OXSC 5T6MA 3WJ2A 4L4SA 3GH1A 5KWVA 5GZ1A 1TI7A 3WB1A 3W8NA 4EF6A 2WVGA 4NMHA 1FOEB 4RH3A 2GZ1A 2HA3A 3ZU3A 4YRDA 5TY0A 1Q0RA 4XB2A 3RVZA 2Z1NA 1RCFA 5K0CA 5B1SA 2QMZA 3SJZA 1YIDA 2JFWA 1BW9B 2BGKA 3PNVA 1LBHA 4CG3A 1PR1A 2BMAA 4Z2AA 1L7AA 1EVKA 1JYSA 4QQ8A 3KKKA 3WOVA 1A7AA 4DXHA 2Z1DA 3VAAA 4RXUA 4G5FA 4GI7A 4DY6A 5IX8A 1LPAB 3TSZA 2X2EA 4QWMA 1MGPA 3LHIA 2VSXA 2OLKA 4B7AA 1QDUA 1TKAA 2JJ1D 4F93B 4P7GA 3ITFA 4L4ZA 3IB6A 2VI5A 3GLGA 4JLKA 5EZQA 5IMSA 1IRIA 2FW9A 3N39C 2VEOA 1I6LA 3QBVA 2PM8A 4PV7A 1PX0A 4IEIA 4JTDB 3PA8A 2V9PA 1G8JA 1E64A 2RGRA 3KC2A 1VSVA 4HX5A 4YP7A 5P8WA 2IM8A 2OO3A 1OOEA 3TGLA 2GXSA 2X8JB 3IELA 5BN3B 5JBNA 2EHDA 1X7YA 4HGZA 3DBHB 2GBPA 3GLSA 2HMWA 2OK8A 3JR7A 4HI0E 5KNDD 3DDZX 4UBNA 3TDMA 2P1RA 2GX6A 4TXJA 3P19A 1XMIA 5K3SA 5ENDA 4LGYA 2X9GA 3RIEA 1Z12A 4IYJA 3CQZA 1W75A 4QIHA 4MP8A 5JH7F 4OXXA 4XGRA 1UF9A 4YDQA 3ZY3A 1TB4A 4XZ3A 4PX2A 3TGPA 4R2IA 4LXUA 4RHXA 5I01A 4IJVA 2AG8A 4L57A 1DS6A 4KRYA 2C7VA 3NBFA 1KQGA 1OZ0A 3DGFC 2KQUA 4JL6A 4K9QA 4CF5A 4IIHA 3RSOA 3VR5H 4C04A 4BFCA 5JS1A 2JI8A 2XQKA 2YHSA 3OVMA 4BVHA 2UZ0A 1IM8A 3FVYA 1VSBA 5IYZA 3HCOA 4N7RA 2W43A 1RI5A 3I2GA 4F4FA 2IXAA 1SURA 4C7OA 2GNOA 4PWYA 3EB9A 3NHPA 5I9MA 4M0DA 4GE0A 3C97A 4YCJA 4P81A 2PNJA 5K8VA 5I3CA 3SLKA 4CQMA 1JTFA 2HQSA 4IWBA 4B47A 2ZIWB 3WQSB 3B8HA 4XM0A 4CQNA 2OKUA 5FOUA 2JIQA 1NP6A 3TLGA 5CM9C 1DHRA 2ISCA 4IJ5A 3AKCA 4H59A 3RVOA 1UDAA 3PXGA 2WVNA 4IJKA 5J47A 1Z08A 1ZX1A 1GA6A 2VDQB 1JXOA 3SC2B 5JFTA 2DBQA 3UW3A 3EJ6A 4H35A 1SR8A 3AR4A 1E0KA 4ZT6A 1OI4A 1PW5A 2PJZA 4EAQA 3UAGA 1ID8A 2FV8A 5GJWC 3R3ZA 4Z9XA 1W5EA 4JROA 5EAIA 3PI6A 2AUTA 4FYKA 3QOYA 3W2IA 5KOIA 3TG2A 3S28A 1Z56C 4TTPA 4PW0A 1NSYA 2P9FA 3MTIA 1GQ2A 1KZ9A 5L6LB 3EPRA 3U3BA 4DLSA 4PC1A 4J3NA 3L7NA 4JH0A 1TJPB 2FEAA 3T1NA 3WGLA 2XMQA 1WVGA 4ALMA 4D4MA 1V7PC 2HFIA 3QTHA 3KJIA 4ISCA 2VP3A 3NYLA 4X9XA 2NO9A 3H5RA 4MJ3A 2BEWA 3Q40A 3MRVA 1R7RA 3QMVA 5AW8A 4CUJA 3FWHA 1FTNA 1EGMB 3LCJA 4QPPA 4AYTA 3VOTA 3M33A 2IW1A 2ZWOA 2DWQA 3TTWA 2O8VA 3H1EA 3U2MA 1D07A 5C8YF 3BE5A 1LPOA 4QGAA 5B1HA 5CIQA 2BHRA 3PVZA 5KBYA 4GXNA 4BFLA 2HR1A 1MAAA 1SOMA 1BDIA 1EFRA 1BEZA 3T1YB 2G4LA 3G4ZA 4EGCB 2KWIA 3HJGA 3QVMA 3EQ7A 4TTQA 4EL0A 3FCCA 2QM7A 4HLDA 4R0VA 2P0YA 1IJEA 2NYUA 1E9SA 2YV4A 4IMPA 3KV1A 1NU8A 2W2LD 3DLBA 4KQHA 1MB4A 4LK2A 4LACB 5FWXB 5BNZA 2P78A 3O4VA 2C7BA 3AR2A 3FTFA 5C81A 3I5XA 1RKUA 1CX9B 1DI0A 2FWBA 4LV5B 4MRPA 2XUOA 4XARA 3SIXA 1CW2B 4CT5A 3UAYA 3PMRA 1FU8A 1GUZA 5FF9A 1WEHA 1LX7A 5D5QA 1Q0TA 1K8XB 3AY0A 1ZKMA 2G67A 2ZSAA 1CTQA 3EHDA 5H02A 3C15C 1QHYA 3EA5A 2BGNA 1D6NA 8ABPA 1JIKA 4KR3A 2CV2A 3COVA 1MC1A 1W4RA 3MS4A 4EYQA 3H7AA 3R6GA 2BKLA 3RUAA 2A9FA 2WPDA 4E5YA 3KPHA 3VM6A 3GLVA 1Z37A 1XALA 3Q72A 2QUAA 1JR3E 2POCA 5BMVA 4FW8A 1AM4D 2P0AA 5CYOA 4KXFB 3AW9A 4Y2PA 3Q6IA 2H0AA 2VP2A 2XZTA 1X42A 3FNEA 4C0LA 2QTVB 4I5EA 4QBIA 1XDWA 2H7CA 4FSDA 3NI2A 2FMHA 1FJGB 4CR7A 3QEOA 2CEKA 2NV0A 3TTUA 3IUPA 2GDCA 4F72A 1P75A 2O2EA 1IEVA 1Z33A 1D5WA 1Z07A 4FFBA 3SHWA 3HDTA 2JJ2A 5CW2A 2JCYA 1GZ4A 2I6GA 1U11A 3M4XA 4C22A 5B6JA 4Z0PA 2X51A 4QT4A 1BKDR 3TQSA 2X15A 3H11A 3COPA 2AA3A 5F33A 2XMRA 5CFQA 4C78A 4A6PA 1ZHTA 3GD5A 3N2IA 1Z45A 3T4PA 4UM9B 1J24A 2H31A 2ZXRA 1B4DA 3KAQA 3RVMA 1U8UA 1G41A 4EO4A 4ND2A 5B1DA 3TYXA 1SU6A 1GKUB 3ZJTA 1Q1AA 2A6PA 3NPMA 3PI7A 1AQYA 1LK7A 1C8KA 4I6EA 1CY1A 1Q17A 4DLVA 3EPVA 1LNQA 2OESA 4WUTA 3LHDA 1PL6A 2GRJA 3EH1A 2PX0A 5DCYA 5I7WA 5JRJA 4J1NA 3STWA 2ORYA 4KNWA 3LK6A 3OZIA 3KEOA 3H1BA 2AWNA 3QW2A 1NN1A 3HNPA 2C98A 5DQZA 3IQWA 4QUDA 5IKPA 2C2XA 4JI1B 3V7UA 3T7IA 1VRWA 2KQ9A 1L7PA 3KTAA 1H2XA 2ATVA 1XAGA 1KK0A 3V1NA 2B4YA 2EIJC 5GVSA 1N8KA 1ZMXA 1XLWA 3EULA 4JJEA 2PRZA 1QWOA 2QN3A 4LOJA 3WGHA 2CCJA 3ODGA 4IVPA 5JQGB 5AW5A 5J2TA 2R7TA 3MWEB 3WG7C 5EKSA 3DP9A 4F6RA 1ZM2A 4LPKA 5CPBA 1EX6A 4RGQA 1ST3A 4NJEA 1R6AA 3LBAA 3FTNA 4UCFA 3UUWA 3NWJA 3VSCA 3HCWA 3OA2A 2QTGA 2VSFA 4W1QA 1HW2A 1TMKA 3LXRA 3AVOA 4GKBA 3WDMA 3VKVA 4FYJA 3ETGA 2W93A 4FJ2A 2EFHB 5L0DA 2H2FA 4OYRA 2IOHA 3HWRA 4B76A 5BVHA 2WVHA 4EKDA 1K88A 4DSNA 1YONA 1VG9B 1FMCA 2ZBQA 5H4GA 3E9VA 3GDGA 3GU3A 4BLPA 1PR2A 2GVDC 5C2JB 3LL7A 4ZOAA 4L27A 1H2BA 4DLYA 3QLJA 1RAHA 4IXMA 3S1AA 3FPCA 1Q20A 2UYHA 4Z4EA 1K6XA 2J4FA 1I4OA 2OLJA 4CQLB 3LP8A 4UULA 1RDFA 4TMKA 2B7LA 1IHYA 4KNVA 5FTLA 2J9FA 2JGMA 3NB0A 2EFJA 5TSDA 1PQUA 3LDFA 4UHBA 4ASUA 4Q03A 2EGGA 1DKUA 4MWCA 2KK1A 4LOKA 8AT1A 1OR8A 4KOAA 5DYIA 4JKIA 4EQZA 3V33A 4BBAA 1JUDA 1CQPA 1RBYA 4DEVA 3HUTA 3JYNA 3W5VA 5JVDA 2JLZA 1VZ2A 1UC5B 2FSGA 2WYOA 3V5ZA 1NXTA 2XB4A 1LVKA 3E7DA 3ZI7A 2C8JA 4LF4B 3CCCA 5U4XA 4P4LA 3AEUB 4GOJA 1VECA 3GJ3A 3D3NA 2J3DA 1JA1A 3ZI0A 2C2OA 4LX8A 2VNHA 4IBOA 4KQEA 3B7PA 3WYGA 3KWLA 3L6EA 4EG7A 3DGEC 2AFHE 4L6AA 2IV3A 5JNUA 5IZCA 1BO6A 1TRKA 1LW6E 1YQGA 4IIXA 4Y6QA 1BQEA 3LS2A 2QW1A 4C7OB 5G02A 2B4QA 4D6XA 4O1IA 2ZPUA 4Q02A 4NICA 1LRKA 1NXXA 4RKEA 3IILA 3I3SR 4ZOBA 3R8XA 1PS0A 1M2HA 1Q0FA 1WCV1 2MSDB 3VNAA 1IOLA 4IH4A 4YIKA 4RKYA 4R1UA 3AESB 1QIKA 1XMOB 1FFXB 2AOUB 3VHLB 2YZGA 4RA9A 1MT3A 1OW6A 4LXYA 1DCMA 1XWWA 3BGWA 3NBQA 1TVKB 1Z22A 5JSQA 2AFIE 3UYKA 4XDYA 1YVUA 3O0DA 3GVHA 3H6KA 2P2DA 1T2DA 5DLPA 1TYCA 3DXFA 3A06A 1SMYF 2PZEA 2ZUFA 4B71A 4HATA 3OEHA 1E61A 1AN0A 1NVWQ 5I5GA 4UZFA 3W79A 1ZMTA 1IAQA 3RASA 4BFZA 3MT8A 3DHYA 2GMWA 3FDZA 4MNTA 2PX3A 3T3PB 5HBGA 3VDMA 5HKAA 1G8PA 3IQEA 1MIHA 1VCHA 3HR8A 4RIHA 5HWSA 3URMA 1JIQA 4BVLA 1GQAA 3RSQA 3A27A 4PYOA 3FMPB 2VZ9A 5GQSA 1G9SA 1Q92A 3ASVA 1VHTA 3CPEA 4B3XA 4RIGA 3UBMA 1SCUB 4DRXA 2OFXA 3QEMB 2R6ZA 3IP1A 1RZVA 3IALA 3PHHA 1CRLA 4HH4A 4QHSA 2JFBA 3VOBA 1YJ5A 4LXXA 4LOLA 3WLTA 1YZTA 5GVRA 3JQBA 3WTBA 2C4WA 1QK3A 1EB8A 4KXWA 4W63A 4LF7B 1NLYA 3WWCA 3RYFB 2XMBA 3BDVA 4PFJA 2I9KA 2P9BA 4BRZA 4UDVA 3NYWA 3FVTA 5KAMA 1KZYC 4X93A 4M1QA 2PA0A 2IU0A 4MW9A 2Q49A 2X0FA 4EMTA 5PGMA 2B6NA 3C70A 1DKMA 5KNLA 2D1QA 4YL3A 1MT0A 4BPBA 2QRLA 5FV4A 2VUUA 1UMCB 3CZ4A 4EW6A 1YOVB 1F8UA 3OZFA 4BV8A 1DXHA 1FBNA 2Z8ZA 2ZXWC 2QD4A 4MI1A 1L4FA 1NYTA 2IZZA 4JBWA 3VR3A 2RJ3A 3LTNC 2JANA 1H5NA 2NG1A 2YZNA 3B2NA 1VSUA 2Q4RA 4ZAXA 3N58A 3AVPA 4UHHA 2BD0A 2DBZA 2G9UA 1J8VA 1A9QA 3FDQA 4D97A 2O7QA 1EE2A 4ZEWA 4CLRA 4ACAA 4QGHA 4XVCA 5L0CA 2QHXA 3BE8A 1AQIA 1JEQA 2VAWA 3IAS1 3SHFA 4DS3A 2NXWA 4KLNA 5CPFA 4RELA 3WFJA 4GKJB 5IUKC 1G5PA 2VVTA 2YFQA 4XPWA 2OO5C 1SOAA 2PGJA 1KE2A 3L8YA 3RHZA 5AI9A 3F3YA 2OHVA 3IERA 4JITA 4ARVA 3GPDG 4C7JA 1EGVB 4PXYA 5L7WA 2GPNA 4FQ8A 4C29A 4ARZA 3NKFA 2ZYGA 1P2VA 2C3UA 3OJWA 3IOBA 4B81A 2IWHA 3DJNB 3QI2A 5JY1A 5FUVA 2O06A 3HVHA 1DX4A 3USZA 2WD9A 1CVRA 2Q3FA 3HP7A 3RFCA 3EZFA 3JAKB 5JO9A 3ENZA 4O7GA 4G97A 3G5UA 4IY1A 3E27A 1CUWA 4DN6A 2PUBA 2CCYA 4K8OA 4ND6A 3IUYA 4RNCA 3FOAA 3H8VA 2AX4A 3RYIA 3TINA 2PYZA 9LDTA 5CA1A 2HPHA 1D2NA 1J6UA 4GUAA 1ZONA 2R8OA 2ZXPA 4WZZA 4X24A 2JLXA