3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
molecule keywords Translation initiation factor eIF-2B, delta subunit
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
5DBOA 2A0UA 4LDRA 2YRFA 1T5OA 2YVKA 4LDQA 3A11A 3VM6A 4ZEMA 1T9KA 1W2WB 4ZEOA 3ECSA 3A9CA 1VB5A
chains in the Genus database with same CATH superfamily
3BDIA 1ECLA 4QATA 1UFQA 2HIGA 3WKDA 4ZALA 4BNVA 1XTPA 2OFOA 4TS1A 1RXWA 4W8OA 4Y9UA 4JI0B 2QR3A 4QJ3A 3I3OA 2E7ZA 1QIFA 3FGOA 2JJ8A 2P4HX 4JI7B 5DWVA 4RZSA 2YWFA 1XVVA 3DH0A 3FFXA 3F5DA 2YHIA 4RVOA 4U7FA 5DOVA 2YNMC 3VR6D 3D8TA 3Q15C 3EVCA 2ZOSA 1Z4IA 2OBBA 5DBFA 2ET6A 3HP7A 4WASA 1M34E 1PUXA 4B6IA 1VB5A 3HNJA 1WJGA 1C9MA 3QX3A 1Z4QA 4P3NA 1VRVA 1G21A 2G8NA 4KK3A 1ZZGA 3K1TA 4X8LA 4OBWA 3CAXA 3OCJA 2GFIA 2TS1A 3C4JA 3B3GA 3T7CA 3TAXA 3OOSA 2PUTA 4TTQA 1E9SA 4HGZA 3OFJA 3LQKA 4DCCA 3H7IA 1YBMA 3DT8A 2BBSA 2PWYA 2QVBA 3OLVA 4GMGA 3SQOA 2H8KA 3WHNA 4N01A 1YCGA 3KDAA 3M6XA 4UUAA 1FNMA 4BMPB 2YUTA 2C54A 1CUSA 2EL7A 3MZ0A 1D6NA 4DNFA 3D6NB 4EYKA 2QB5A 2QN6A 4G41A 5FQOA 4YP0A 1IAVA 1O5TA 3LUHA 3Q7GA 4O6NA 2QVGA 5CIYA 1K98A 3SPXA 3N8KA 3LLMA 4MS1A 4QPZA 5B2EA 1FFXB 1L4BA 1MO5A 1XMSA 3HCBA 5IULC 4MCJA 3PGKA 3VVMA 2IYAA 4A8JB 2MSEB 4J9UE 4BXOB 3RF6A 3IQTA 5EI5A 1QTQA 1XA3A 5EGNA 1OA0A 2G82A 4HB2A 1EEXB 2WVGA 4P4LA 2H8AA 4NLLA 2VCYA 2P6NA 1U65A 1ZHYA 3CFYA 4I4TA 4KPFC 1NI3A 4MJXA 3UXYA 1H3EA 1J0AA 1RAAA 1YQDA 4P31A 2PEYA 1GVNB 2B8EA 3AEQB 2P4UA 3FWKA 4QDJA 2PJDA 4FC7A 4GP9A 2JCYA 3KZOA 4OOFA 2QV7A 2IYVA 4WNIA 2EJBA 3NHMA 4P7BA 2YZSA 1VCOA 2Q1XA 3HEBA 3IFSA 1OLOA 1N25A 3NCHA 3OKPA 5FORA 5EVCA 3WRXC 1EYZA 3FYTA 4C05A 3ZQVA 1ZEJA 3ZU4A 4DUYB 1O6ZA 5AJHA 1JBEA 4XM2A 3TR0A 4D0GA 4YL0A 1ADBA 3FUXA 3UMHA 5T6BA 1N4AA 3K05A 3JSEO 6CHYA 2YFHA 4IMPA 3RI3A 3AVTA 1BWPA 2I54A 4E4TA 4N7BA 2BKXA 1ZL2A 3JWEA 4CXMA 2C5EA 4NV3A 2VRWA 1WOYA 4WEQA 2BC9A 4HYEA 3RVDA 1U8FO 2YV3A 3ZOZA 1YC2A 1VJTA 2F17A 2F55A 4PLYA 5F7OA 5HZMA 5LBIA 2XMQA 3NIFB 3NWJA 1M2OA 1SELA 2QMEA 4HUQB 4KPEC 3ZD7A 2IIBA 2VBIA 2WFZA 3IVRA 5TV2A 5HKAA 4UAUA 1BMQA 4HNGA 4IFIA 2OYSA 3UWMA 5L9AA 5LKAA 3AEQA 2ZB8A 4MVOA 1FLAA 4KE6A 1OI3A 3CG0A 1JT2A 3ZZ0A 4AQDA 3NHSA 4BVBA 4R0VA 4E15A 4J29A 3EX7C 1LD3A 4PFPA 3KOYA 3L5KA 2WU8A 1ECFA 1QONA 4J0DA 4CJXA 4MZDA 5J2UA 1M8FA 1XTTA 1FDSA 3K0FA 2VBCA 1QMGA 3QJGA 1NC1A 2I3ZA 1B74A 1EBUA 1W76A 4M6WA 3AJ8A 3H3XA 2HWUA 2O7SA 3UJDA 3LIPA 2EW1A 2ZXRA 2VAVA 3WMWA 4IIXA 4QFMA 5ESDA 4PO3X 4OMDA 4BFUA 5FL3A 3T1OA 2HLDA 4H4EA 1JA1A 3NBYC 3A26A 3I1YA 4E5DA 2ZIVB 3AG2C 2R8EA 4IPTA 4HL6A 4XR9A 1K1EA 5GOTA 1NF9A 5KMGB 3RSOA 3ANTA 2OKUA 1HZZC 1NSGB 4HB0A 1KI6A 5J4YA 2PR7A 1DBVO 4MAAA 4A6XA 4LKRA 5KNBH 1JAFA 1IHYA 4FE3A 1DVRA 4Z0PA 3TQOA 2BFCA 5ITZA 4IM7A 2Z15A 3GUZA 2BMWA 1KJJA 2RHOA 4J6FA 4YP6A 5IBRA 5KTRA 1FP7A 2XUZA 1Z6YA 3IAFA 4IZIA 4KTTE 4V02A 3FMIA 5DCWA 4AJOA 3HO1A 2B6NA 4R6XA 2BFBA 2HFKA 3IT0A 4LHZA 3CGWA 4MMXB 2XRFA 4WD3A 1D7AA 5LBTA 4RWZA 4HVAA 2WVOA 1MV5A 1R6VA 4B35A 2HS5A 2H7YA 5LR6A 3PF9A 4ZT4A 2VCBA 4E3WA 4D5GA 3G5UA 4GSLA 4GEKA 1RLJA 2CJYA 4NZNA 4P0TA 3V4SA 4LOLA 1FP4A 3BD9A 2IW1A 4PAGA 2MSLA 5L3QA 4XWAA 2RHLA 3NTQA 2G6TA 4Z6KA 4ER3A 2UYHA 4BX8A 5E6SA 1JTFA 3AKYA 2HRQA 2MTBA 3AERB 1N5JA 1G0NA 3BB4A 4O8ZA 5F12A 2FPIB 1P0FA 3KJQA 3ZGXA 4WOBA 5EHZA 4DXWA 4Y2TA 5HPYB 4XZ3A 2XT9A 5AKHA 4KJZA 3OM1A 1ULHA 3JYPA 2B4YA 4U0JA 3ZPXA 2C58A 1TLLA 3K2EA 4CKYA 4Z7NB 4H1WA 1LF0A 2D0OB 2OCBA 2QTLA 3CIOA 4OHXA 3V7WA 4CMCA 4QREA 5A0TA 1DJOA 4CIPA 1XZCA 4C0LA 1F5NA 1KK3A 4UU1A 1B42A 221PA 4L28A 2IOFK 1CZNA 4BECA 2HSDA 2GJ8A 1PGNA 1C9DB 2CFTA 3LOPA 2IS1A 1A5AB 4ROTA 4Q1DA 4EHNA 5JYDA 5IM4F 3ZVNA 2P2SA 5F9FA 3QELB 5ITVA 4G0NA 1W34A 4AN0A 1PQ4A 2G0NA 3OTQA 1DOHA 2IP4A 5ARBA 1OU4A 2P62A 3CXRA 3QLVC 1KIFA 1DV2A 2FCAA 1OXXK 3C4VA 3A37A 1C03A 3IP9A 4TKUA 5HF9A 3VPXA 3A14A 2NG1A 2AOWA 1KWGA 1GADO 4CUZA 3DKAA 5CT6A 5ADWA 4UASA 1HEUA 1TU3A 1B6RA 1XB2A 2G7ZA 2V6GA 1ZWKA 2XDYA 2ZATA 1NQUA 2PZAA 2HF7A 3D7LA 4PCLA 1PJBA 4W5NA 4XYBA 4RL6A 1J8MF 1JN0A 4YR9A 2RGGA 4BUJA 1G0OA 5BWOA 3RUPA 4R31A 1CQIA 3N75A 4MUEA 4REMA 3VR3A 2C5LA 2HHLA 3EVEA 4JEAA 1JX6A 1F38A 4R5MA 1F6BA 1DO2A 3C3WA 3HBAA 3HHPA 3Q7RA 3TIGA 4JB3A 3CX6A 4EF4A 1HW1A 1TU0A 4AJ1A 1XMXA 4QFDA 2X0JA 4XB2A 4CV0A 2H2GA 1CUUA 3HKDB 4ND6A 4CMGA 1KYZA 4KJXA 1RPJA 2GCOA 2PA3A 3DM9B 3DT9A 1KQNA 4R2HA 5DFAA 4ITVA 3MILA 3V48A 3ZBQA 4RD3A 1TO6A 5A3SA 1W5FA 2DY0A 3D6JA 3ANNA 4JLNA 1MZPA 1UPAA 2J9RA 4LTDA 4KN8A 4G0UA 1B16A 3IO5A 2OM6A 3TNDA 3JQ7A 4I2VA 1NLYA 5EZYF 1N5LA 3Q3VA 1V54C 3BIWA 2WJAA 4NE2A 4QG7A 5FNZA 2PGIA 3IGFA 2V5VA 1Z15A 1PIWA 5AI5A 3M15A 2QSUA 3F7TA 4NEQA 3SZGA 2F3UA 2HHCA 3DMTA 3VBEA 2H2FA 5L0CA 5JASA 1KEKA 4J8PA 2P7VA 2YYAA 2GPJA 1A1SA 1G17A 4NS4A 5G53C 1FNNA 4U9UA 1RRMA 2R4UA 5J1TB 4LJ5A 4JJGA 1FL9A 1BH2A 1Z4OA 4M49A 2I2BA 3WGUA 3ZJUA 2MINB 2WM8A 4DDWA 1Q12A 1VKRA 3AF1A 5EHXA 5I01A 4ESHA 3TL3A 3MJ4A 4Y2JA 1AUXA 2J32A 1QORA 3ATPA 4UM7A 3GWNA 2OZLB 3TPFA 2YFYA 4AXBA 1UJNA 1FMTA 1OQCA 3LRXA 3ETNA 4GPZA 5JWHA 2ZD9A 3EAQA 2RD2A 2AS0A 4AP9A 1N2OA 4IFBA 3DKPA 4E5VA 1MXHA 3CLUC 3RUFA 4E30A 2YEVA 1TECE 4JI1B 1GNPA 1HDCA 3L8MA 2WLSA 2VWGA 3BD7A 4MO2A 1FU4A 3GJZA 4K86A 4UAGA 2ZR7A 4DHWA 4LF7B 3BJEA 1USWA 1CDZA 5BWMA 4I1VA 5HIAA 2FJPA 2WJ6A 3IEEA 1P5JA 4G1MB 1XO1A 2ODPA 2P9EA 5TPZA 3U4GA 4ZT2A 2PGOA 2C2WA 3AG1C 3WHLA 1OR3A 1XF9A 1E2KA 5IC6A 3AESA 1Z6TA 2Q2WA 2X76A 3EDYA 1Z62A 5EKTA 1HE3A 3RREA 1WPQA 2B1JA 5HR5A 2YASA 5DXJA 2PGDA 3K9LA 1OZ0A 2C2BA 1N1CA 1YKFA 3RFVA 3UH0A 1IN1A 3AM4A 3F6SA 4XD2A 1H93A 4RV9A 5DPMA 1YU6A 2VDUE 4EL5A 2FDCA 4WZ6A 2PEZA 4Z54A 4ITRC 4RL4A 1D4OA 2Y1OA 4NDZA 4DWWA 5IFKA 4RJJA 2DSTA 3D8RA 4IZOA 5KNCA 3OJWA 4Z4QA 4N6GA 5EWJA 1L5HB 3QUBA 1RQ2A 2FEMA 3BG5A 3V7FA 4I99A 1UJ2A 3MN1A 3P9YA 4JBIA 1BS2A 1ZYRF 3FOPA 2P1DA 1AVOB 2YWJA 1K8RA 2O50A 2ZRQA 3AOEC 1OBHA 2HMVA 3R7SA 2FZEA 4EHHA 1T6ZA 2J48A 4W6ZA 3UK6A 1W25A 1GGVA 1MH9A 1OXKB 1ZI9A 3OZGA 3TCXB 3L05A 1LQTA 5LUAA 3GGDA 1AGRA 2QMQA 1S05A 4NZPA 4CT0A 1UDBA 4GLOA 2OXEA 4IGIA 1IDN1 1BDBA 5J5AA 2QD5A 2YS6A 2XS1A 2Q9UA 1IN6A 2VDWA 4L9AA 1WXHA 3JRXA 1RXCA 2J0XA 3PEVA 4D4JA 3G7SA 5ECGC 3ZKWB 4BP8A 3ZDAA 1HDIA 2QR2A 5EESA 1JP7A 4JLSA 3U40A 5D7NA 4ZYWA 4RHEA 4FAPB 3ZTMA 3Q6MA 2Q5JA 3F9IA 1QTRA 3QZCA 1MDFA 1RVV1 4U7TB 4KQMA 5DKFA 1F2UB 3DZJA 3T3EA 4BFWA 3EEFA 3GU3A 3FZGA 4TXLA 4U2BA 3O0DA 4F06A 5LYJF 1YCFA 2AK3A 4C4AA 5C8VA 3H8JA 4OQYA 4P3YA 4YALA 4CIVA 3MJFA 5G1OA 1XZJA 4EHJA 2PIAA 3DTVD 3VI3B 4DUGD 4OTZA 1ODKA 1OBVA 3ZD8A 2I1VB 2MJLA 4Q1EA 1K7XB 3UT6A 3DCNA 5J2TA 4HXFB 2VDJA 2VF8A 3DFMA 1RZRA 4XM1A 4B9EA 1QE3A 1IY8A 1XEFA 2QLMA 2VCHA 3KEMA 4MP8A 2REBA 3BGVA 3RQEA 3GODA 3V7OA 4BBJA 1O8BA 3E5HA 4X24A 2HHAA 1C7JA 2AVNA 3KQVA 4BO6A 1XRJA 5DYYA 3GNSA 1I9CA 4OP2A 5CA0A 4F0JA 5BW8A 5JFGA 2VRNA 3LF1A 1EXNA 3LDAA 4O2BF 1GQOA 1KYVA 4QGBA 4PCUA 3ZE7A 5IVHA 3A6KA 3PJFA 4XCQA 1VOTA 3NGLA 3QPDA 3QP9A 1IBRA 1KXJA 2FE1A 3A10A 2OB2A 1E7YA 3SIXA 1H42A 2TECE 2I2CA 3HDTA 1N1DA 2NVUA 1CZLA 1NG1A 2RK6A 3C1OA 4YQYA 3M3DA 1NKVA 4Q16A 3R8CA 1ZUNB 1NVVQ 3NEPX 4DLWA 3SHTA 3PLRA 1E9VA 4F97A 5FBQB 2WSBA 3G50A 2YVAA 2RGXA 3PVSA 2HMYB 4F3KA 1NT4A 1PV4A 4AD8A 3COSA 4I36A 4OLAA 1UT8A 1EH5A 3IOEA 5BR8B 1HLGA 3WYBA 2ORIA 3DBVO 4OXNA 3O90A 2RB4A 2FOIA 6REQB 4OFZA 2IY7A 3ILSA 1QGOA 1DJNA 3K6KA 1CUYA 5COAA 3HLZA 2VHEA 4H1HA 2C1EA 3DZIA 1VL2A 4HNRA 3OEYA 2JHFA 1TEXA 2VJMA 4J7UA 1FBTA 2DQ4A 1FQOA 4OL9A 2CDRA 4YONB 3OLXA 5EZ6B 4AUEA 2VDLB 5LM3A 5CDFA 1WXFA 5FUXA 1ZEMA 4Y67A 3O8BA 5A7GA 2VI5A 2OHJA 5B58C 1QCYA 2QBYA 4KREA 1KBZA 2XJ4A 1W87A 2BGJA 4PZDA 2NNLD 5EZYB 2IV7A 4I1YA 5DGXA 4E21A 1ENOA 1DMSA 2WSYB 2A9RA 1RXIA 4QD3A 5WRFA 5A5FA 4D99A 4TZTA 5IANA 1WB4A 1HTWA 2UZIR 1LXCA 2AG1A 2IEDA 2ZSDA 3H6GA 1JPNA 4O1MA 2B7LA 5DS6A 4PICA 3C1UA 3GORA 1EM8B 5L3ZA 2M1ZA 4B34A 3WL5A 1F20A 1EB8A 2OK7A 2OMEA 4HRVA 4RTLA 4RTPA 1QWSA 2OHIA 3R6GA 1RPAA 2RSLA 3M2PA 1FEZA 4HH4A 5JPIA 6YASA 4OPMA 1X7DA 5AM0A 2Z6VA 4UBNA 3RUEA 4YCNA 1BIFA 1RYFA 2GZMA 3BZWA 2IX3A 2HDHA 4BRSA 4KMSA 1XMOB 2NT3A 2I4IA 2IITA 3K8QA 4WHMA 4ID9A 3K5PA 2EERA 2O52A 2NTYC 3N5CA 3P0IA 1YB4A 4P82A 3FMGA 4U5DE 3A3PA 3AXSA 4MLPA 5CX4A 4YDQA 1ZH0A 2XZPA 3BGIA 1FFSA 2H8GA 1W85A 1MB4A 3U7FB 2DJ5A 2OXIA 1E64A 4BPMA 2QE7D 3DV0B 4BP9A 1XQWA 4DL9A 3P9NA 4RCYA 5K0FA 5AHXA 3AETB 4L76A 1O8CA 1D7OA 1QH1A 1ODJA 3DMFA 4E7SA 4JEIA 1TFRA 1GPMA 1PW7A 3QYAA 4QHTA 4PC2A 1BG6A 4I1PA 1GZ3A 4M0DA 1VI6A 1A27A 2AFHE 5BN3A 2W0SA 4PG5A 4XQEA 2AW5A 5HM8A 2PX8A 1LNQA 3DVLA 4BJ5C 2EARA 5FAKA 1ZOLA 3VJMA 1XRNA 4R3NA 4JI8B 1MQ8B 5EC8A 3MFNA 3VKUA 4B7XA 1YO6A 1GL6A 3IHTA 1GQYA 3GCXA 4JDPA 1S9DA 2YDXA 3PXUA 2FW8A 4MTGA 4PC6A 1YCHA 5EPUA 4EBBA 4J0KA 4BLPA 4B6FA 4CZ2A 3RAJA 4M1EA 4ZAVA 3UHJA 1HMPA 3P0HA 3OQIB 4J0CA 3SYRA 4RNDB 4CEIB 5KHLB 4FEEA 1P77A 3PXXA 4G56A 4OHKA 5CVVA 3VBCA 3RD5A 3EXG2 2XV1A 1GRCA 2W2LD 1VJCA 1I3LA 1OFVA 3R75A 5I45A 5IHXA 3REQB 3K71B 2H3HA 3DOFA 2OZLA 3O47A 1ZCBA 1BHJA 1MQ9A 3O39A 4MAMA 5AM4A 3US6A 2P91A 3KAPA 3T34A 3JTLO 4RZ2A 4A2WA 3W5IA 1JHQA 4TS3A 5CVDA 4EWCA 5EJIA 4A0QA 3AZOA 3C1AA 3FTFA 4F46A 1E1QD 3OQPA 4F92B 3HHEA 4ZPXA 1T3TA 1ZVZA 4CIHA 4IS2A 2HGZA 3S1AB 2VJCA 3HYRA 3SE0A 3ER9A 1O87A 1D09A 4D4HA 3H75A 1XMVA 2RGAA 4GDMA 3Q7QA 5FLXA 2SNIE 2QD1A 3N87A 5E0OA 1O3UA 4CW7A 2VNIA 4JLWA 1LLQA 4OBBA 3WO1A 5HOQA 1PGOA 1BVUA 2JBHA 2X8BA 3SS7X 3TLBA 1E32A 1C9KA 1QH8B 4AL0A 1W4RA 1X7YB 4HDMB 4Q00A 1WB6A 2MSCB 1PL7A 3WLFA 4ZMBA 3KKOA 5B6JA 4DDMA 4CL0A 5DTEA 1V3UA 3W0LB 5FWXB 1ST2A 3TNYA 1GGHA 4HAUA 3TRDA 1CF9A 4R32A 4Z0NA 4C0WA 2MCFA 2PUFA 2CXNA 1U1IA 3ZKAA 4Q6BA 4X93A 2WV7A 4PXAA 1CY7A 3A6GA 1DQRA 1JFLA 2X2EA 4BY9E 2WT9A 4LXUA 1WX1A 3C62A 4UOQA 3VZDA 1UQRA 4FFNA 5T3UA 5JNUA 1RAHA 2ONKA 2WUGA 4G25A 2WWTA 1YZHA 3E7PA 2OFXA 3ZQJA 1V8DA 2IXEA 4C4SA 4RZXA 1Z0FA 4WFJA 3K0SA 4YMWA 3BRWD 4NJOA 4DQUA 4NJEA 3ELDA 3LL4A 1XX6A 2MWQA 4E17A 1OQAA 4N18A 3GRAA 4CNBA 3COZA 1WSBA 2J3IA 3H5AA 3LBNA 3SEFA 3OE4A 1XTIA 3A31A 3EAFA 1BE1A 3PWTA 2VZ8A 1E3TA 1JLLB 4IUDS 4QDOA 1MR3F 4BZZA 5CB0A 1OVMA 5JW6A 3M82A 4LERA 3RUAA 1Z13A 4TLAA 2G88A 3PGJA 1W4LA 1UBNA 2HD4A 3EULA 1J42A 3IMCA 3DB1A 2ONCA 2ZT8A 1JFVA 2FSFA 2GM9A 3GIDA 4IVPA 2X0EA 1RNLA 4HDRB 1ZLXA 3EUEA 1DGQA 3OLCX 4DZZA 3IAHA 4KQGA 2RHBA 3WGQA 2R7MA 1UWCA 3P19A 3HKKA 4IVQA 3MXOA 4I3GA 5CW1A 5SYNA 1JEQB 4BMZA 1DAFA 4CM4A 1ZNXA 4DLRA 1J00A 1ONPA 5KDDA 4R54A 3L04A 3L0YA 5IYZF 4RK6A 3SR0A 4IQ4A 5FTMA 3CEAA 5KYWA 3F98A 2QRZA 4E5YA 1ZLYA 2FETA 4F9FA 3VRCA 4PRYA 4YP7A 3RUIA 2Q4OA 2I34A 1U9JA 3L40A 3L5OA 4QX6A 1XNQB 4PCVA 3FTEA 2I4MA 2X0FA 3DUFA 2LXNA 2FWNA 4OH1A 4ABTA 3WQQA 2JAXA 3V6MA 1WXQA 1RKEA 2VNKA 3CWQA 3ET5A 3NH9A 3CLRC 5AK6A 1PR2A 4D9MA 3RS4A 3H9EO 5HHTA 1XJ0A 3Q8WA 1XGKA 2IV2X 5HM6A 1BFKA 1JB9A 2Q5FA 1MAHA 3V8QA 3H2HA 5I48A 2V3WA 3EN0A 3NEAA 3DD7A 2I55A 5HK8A 3RWBA 3CNQS 1ZXBA 5G02A 3NBZC 3SDBA 5ALOA 5CG1A 2HT6A 2XCQA 4OLHA 3U5TA 4CMBA 1DJQA 1WVGA 1Y8RA 3NYRA 1UH5A 2IYPA 5AOVA 3TB6A 5K4HA 1QU2A 4BKUA 4ZVNA 2FDRA 4HN4B 5GJBA 3QQPA 4D8YA 1YASA 3TF5A 4JIMA 2GPWA 5SZJA 3AM1A 3DWWA 1OMOA 1P1KA 1RR6A 1CY0A 1WD7A 1Y9JA 2KPOA 2B0CA 2VSYA 3AKEA 4FDMA 4LHSA 4M1WA 4XIGS 4HPWA 3UYKA 1DKQA 4Z4HA 4HWSA 2OHOA 4F1JA 1ZN7A 3ICEA 2C3YA 5G4KB 3FVRA 5AVXA 3WLLA 4LV6A 4EG4A 1RXUA 2E1PA 3S8EA 3PRKE 1KPIA 1RKBA 4QLBA 4L3WA 1J5XA 1ZA2A 3URKA 2X8LA 2WHEA 2XHZA 4JK3A 1K9VF 2SECE 4Z8YA 5I4BA 4MHTA 4JD5A 4EGFA 2QX9A 5EPOA 1A8UA 2JAUA 2WYWA 4H6XA 3ZI4A 4HQOA 3RLIA 1IY0A 5IAJA 3CWCA 3R3WA 4R5HA 5EZYA 3UNXA 4F9TA 1MVOA 1FFYA 2CWDA 4WOKA 1PJSA 1WZIA 3JZMA 3HADA 4EJSC 4HDOB 3UT5A 3W6NA 1WEKA 4DBQA 4B3FX 3MHPA 4JHXA 2VH1A 1C4KA 1JRLA 1QQ7A 2PL5A 4HXGA 5CM8B 2GM4A 4FZRA 4C6RA 1GPNA 5GVSA 3TUZC 4IIUA 1Q21A 4FCVA 5DLQC 1D9XA 3DPIA 5EN4A 4N47A 5I8WA 2IVFA 4F9EA 1XTQA 2BISA 2PPVA 4NE7A 2Q46A 4U7DA 3EXG1 3OWHA 3ND9A 2WWRA 3FHCB 2G9ZA 4QTZA 4HGRA 4FHCA 3NKEA 2I6XA 1YS2X 1XRQA 1KYWA 3LC7O 4X63A 2BGGA 4MDEA 3JSXA 3BCSA 3ZBUA 3K6RA 2QZJA 3BFJA 3EGXB 1RS0A 2HQRA 2CHFA 3H2IA 1XKLA 4M88A 3EVAA 4WXMA 2M6LA 3ZCXA 4MSUA 2IYXA 2IEBA 1MFZA 4GMXA 2F59A 4A27A 3KYCB 2HA4A 5AKLA 1NXOA 1Y6ZA 3OIVA 3G5LA 5A5DA 4BNTA 3T0IA 1OI4A 1DQNA 3OJEA 1GGNA 1X0XA 1YRWA 1Z3CA 1ZSVA 1E2LA 2LBPA 2ONYA 3G8AA 5K0TA 2BMJA 1WZEA 4FP9A 1U90A 3K8YA 4TOIA 1A5BB 1WUKS 4EECA 2GUGA 3C3JA 5JSQA 5HUJA 1V3QE 1O95A 1ZOIA 5KJFA 4BP3A 3EDCA 1MV8A 4Q47A 1M5RA 3S70A 1ZJ5A 3FUVA 4DDHA 2E87A 4DMLA 3GR6A 4GGPA 4L1KA 1H69A 3FI0A 4I4LA 1KRWA 3TVYA 2QVCA 3OM8A 2YHAA 3VPFA 4TWZA 1SNYA 4ND8B 1G16A 1R0KA 3UR3C 3GCDA 4L72A 4OA5A 4QO7A 3RYFA 3SHWA 3NYJA 4CMIB 4WBNA 5BW5A 1S8OA 2DYSC 1Z47A 3KKLA 4JJ6A 4UNNA 5CT8A 4DADA 1H8EA 1Z29A 3OF3A 5EUQB 1KFCB 5KWEA 2W6JD 3WQBA 4A8PA 4DJJA 5BV1A 1MAUA 1TZ2A 5B6IA 1KORA 3D54D 3DFIA 5JBIA 3ILHA 4WESA 4EVRA 1Z4NA 1U8XX 1DBIA 2PYIA 3KOMA 3DDNA 3TBHA 4EUEA 1R4TA 4JAVC 1VHTA 3R09A 1PUJA 1NVMB 3WG9A 4JVLA 4Z3OA 2XTMA 1U3VA 3HWRA 3OLZA 4GEGA 2C9MA 4M7OA 5EMMA 3UPUA 3R9IA 4CLEA 1UBCA 2C4MA 2WRZA 1PYGA 2GLTA 1L7MA 1GZ7A 2BFMA 2X8WA 4PV7A 1T1RA 4RABA 1NXXA 3MVEA 4LZWA 3WNVA 4LHYA 1F4PA 1JYFA 2BWJA 3HVUA 3JPWA 3N07A 3RYIB 5IDVA 4WGYA 2ZSIA 1DC8A 1M8JA 2J67A 3DZGA 4KWEA 1EX9A 4ZHQF 1UPFA 3U4QA 3B2QA 5LIRA 1WV1A 3DYIA 1NPYA 2WC1A 4Y2QA 3GUCA 1ONBA 5LMUB 5JHGB 3K30A 2ZYWX 4JXKA 1WETA 1N1GA 3M6WA 1R6UA 4ZCQA 4LVNA 3T6GB 2QP3A 2YOFA 3AOUA 4G0VA 2CJFA 2GILA 1RLMA 2JD0A 4ZVOA 1S01A 3R7WB 1W59A 5COMA 3UMCA 3H4VA 3L4BA 1R4NB 1XEXB 1NBEA 3EGCA 4FLFA 4I3FA 4EGCB 5LQCA 3SQXA 1RKCA 3VR2D 1VTKA 2EYQA 1O3YA 2HF9A 1EXDA 1GGMA 1QZUA 1M2NA 1P7WA 1CZOA 2PLAA 2TMKA 4LXHA 5LU8A 3N5KA 3W04A 1U0SY 3PXGA 4ARZA 4FGSA 1D8TA 4HTAA 5CB4A 2YWXA 1U63A 2OL4A 1Z22A 1B0PA 4HRXA 3T0GA 1MQSA 1NN3A 2RKBA 3RJZA 4Q7MB 1SULA 4O2BA 4WRRA 1AEPA 4Q1VA 1OW7A 3CW2A 2O4UX 1YQEA 4TXHA 4IGGA 4A8JA 2C5FA 2HHJA 1DQSA 1OFUA 1WXXA 1S2LA 2OA0A 1Z5WA 1U9YA 3STVA 3ZQ4A 3UAVA 8OHMA 3QJ5A 1EVKA 1E6EA 5KQMA 3C87A 3K6BA 4GZ6A 4FPXA 4LOIA 2X0IA 3V34A 4Y30A 3HABA 5T1DB 2E21A 4ZWNA 2MR5A 1CZKA 1DCKA 5DGHA 3MIZA 4H7IA 3B5JA 2VDMB 4W7SA 5IDWA 4YRIA 2ZS8A 3QFFA 4AF6A 1Z0SA 2I80A 3R44A 1ZSYA 3D02A 1OWOA 2BUBA 2JCVA 3WSWA 4IBOA 1B1CA 1ULSA 1XTKA 3K9CA 5T57A 3U4MA 5JJCA 4IH4A 4KITB 5FO0A 4BWVA 4YRGA 5JY6A 4UMVA 2QTAA 4YMUA 3TBFA 3D4NA 4WKCA 4DQ0A 2G08A 4PSDA 5K7SA 2CXXA 1IOLA 4OU4A 1I24A 3QW0A 1H22A 4UNSA 1HT1E 2WM9B 3RRJA 1T6XA 1U99A 3ZLTA 4RLSA 4XWKA 4OB7A 2QN3A 3U2MA 4K6GA 5EJ9A 3ABOB 2PX6A 3OEEA 2WWYA 1ZESA 3S55A 1GTZA 2XRZA 2H2WA 2Q21A 2F62A 4MINA 4Z99A 4NPCA 1YZNA 5FTJA 3RJTA 3VSBA 3ZXXA 4CIBA 2OAGA 2OHVA 4M0UA 4LY3A 1EVQA 1KJYA 3RKRA 4BNWA 1ZH2A 5LZ4A 2XSZA 1MF7A 1WMBA 4MS1B 5E4TA 1KU2A 1SXHA 3S29A 2FUKA 1QUFA 3P97A 4KLRA 4WT7A 1TEHA 4BC1A 4CLXA 2OKCA 3KWJA 1R64A 1NT2A 4GU5A 1AO0A 4FBGA 1YJ8A 5E95A 1MAAA 4GR4A 3HA3A 3M8KA 4F71A 3SC2B 2C29D 2WMOB 4EKNB 3A6HA 2QRKA 4QHSA 3O1LA 2VPZA 4QSMA 4RVFA 3BXOA 2GPTA 2A5JA 1JUDA 4IHAA 4JC0A 1G21B 4MUAA 1XNJA 4TMFA 2XE4A 1YBFA 5EQJB 3T7TA 1I1OA 5LXTB 4RORA 2IXBA 1XQYA 4JKIA 4ZEMA 2VYQA 4H35A 2AOUA 1JSCA 5JCZA 2Q3EA 3JAWA 4L3VA 4CDAA 4AKTA 4BKOA 4OI4A 3TJZA 4K9LA 1KJZA 5B57C 3PFKA 3SG0A 2MIIA 3HCCA 4S0XA 5EWMA 5KPDA 1LY1A 2QVZX 3B38A 1HQKA 1K2WA 4BLRA 5T67A 3U61B 3GW8A 1E1KA 2XIQA 4OFWA 2XDWA 3HU5A 4BMDA 4F3RA 3M5PA 1P72A 4CDRA 3CCCA 3ITNA 4CBEA 1MENA 1WAMA 4RVNA 1NMQA 2ILVA 4TN1A 4BZXA 3MLBA 4RYDA 4UE2A 4WWHA 5ALMA 2WF9A 1GSIA 5LQUA 5KYXA 2VF5X 3ECAA 2ZRKA 1TYZA 4N0QA 4KR9A 4ZOLA 5H83A 2A58A 5KPJA 1CDDA 4ZQIA 5FTWA 1YZVA 2HLNA 4IDEA 4I3MA 2EW2A 3DHEA 3SXJA 4LBYA 1LV7A 1WV0A 1VE9A 2HPAA 1KFKB 3MWFA 4ZQFA 4RDXA 5LP1A 3E8XA 2F9LA 1AA6A 1IVSA 2XUOA 1Q0LA 3LQFA 4F8JA 1P74A 4Q19A 2AD5A 5SICE 4Q18A 1YZCA 4C01A 1F14A 2AV6A 1RRFA 2VJPA 5BSEA 4KQKA 4NPAA 4N0MA 1AXGA 1OXUA 3GIWA 3P2KA 4FFSA 3KP1A 3T5CA 4AW9A 1WCIA 4J43A 4RDIA 1WMDA 3F2IA 3KOZA 5BOVA 4OHVA 2RE8A 2R7KA 4PJJA 2BZSA 2O2YA 2V26A 3Q11A 2QRMA 3R6WA 4OG2A 2OFWA 3H1BA 1VYUA 4LZOA 1H6AA 4DT1A 4H3HB 4FD2A 3WL7A 3IRUA 1U2GC 1XZAA 3SOZA 4AIIA 3NP9A 4CHGA 3KTDA 1JHYA 5DTJA 3IC5A 2QJFA 4UBLA 1Y80A 1E7SA 1YJXA 2B34A 1RHJA 3B0VC 3A9UA 3P71T 3LQYA 5CH5A 1LM3B 5KX5F 1ODIA 3D8BA 3IAAA 5ANRB 1YQUA 1RPNA 1C0EA 3HPRA 3SC3A 5ES4B 1CJCA 3NKVA 2A5YB 3AHIA 2Q1UA 2C4VA 2XKBA 3CG4A 4RLFA 4TRJA 2OVFA 2JLXA 3BA6A 1DT3A 4EZBA 1P9WA 4IVNA 5ADVA 3EVDA 3G59A 4C4OA 5CFZA 4B17A 2HLDD 2DG2A 1GDTA 5EIFA 1OX5A 1DU4A 3BXPA 4MQBA 4DXDA 2ZIUB 3I9KA 5J23A 1X7YA 4FE4A 4HDMA 2BEWA 1Z63A 1REQA 3AJMA 4LSZA 4IJWA 4WLFA 5AW9A 3M79A 3ADCA 3IAM1 1DKLA 2IOQA 1IEWA 2C7VA 3CEPB 3K0CA 5IBQA 3UB4A 3D6TB 3WL6A 3RH3A 4MGIR 2D0PB 5EGSA 4X85A 3SJAA 2YWRA 4BQQA 5FDFA 3UCEA 3PUYA 2R6ZA 3P5BA 2ZIAA 4MX8A 4UTXA 4ERNA 3KJNA 1PLJA 1T34A 1X80A 2NZWA 3AIKA 3NNSA 3RFFA 5BN5B 4P54A 1N5DA 4DJ9A 1K66A 3TXAA 3C5EA 3E27A 3T3HA 4MWBA 4YJ2A 4NU0A 4BYMA 5H4HA 3UOWA 4D0RA 1W88A 3ZVLA 4BMOB 3RIXA 3L9XA 1MVLA 3WK6A 4HQNA 5FBRB 1P2SA 2ONZA 2W6JA 4K03A 4KRYA 5KYYB 4TM8A 3T41A 4BBZA 2ZTMA 5INTA 3LNCA 3GGJA 3JRMO 2OP1A 1ZXLA 4DR4B 4LRQA 3OECA 4ZO4A 1T4MA 2C2KA 2CEAA 2QRHA 3VR5H 1HSZA 2AEMA 3LOUA 2CHUA 4HLNA 4FZVA 4C76A 5D84A 4LDKA 2C31A 4X1YA 1DDOA 1YB5A 1W36C 2UUCB 3CLVA 4W7HA 1FTWA 3LU1A 1QIKA 4TUYF 5HMLA 2DP4E 3MPOA 1E2GA 3UMSA 3VZPA 5DGDA 2Q5CA 4FSXA 2PLWA 1ENPA 3KM0A 3PYLA 1DZIA 4W63A 3TDNA 3TR5A 4AI6A 3KLPX 3RT1A 2XJ9A 1COWA 5JROA 3MBGA 1I80A 2BTQB 4CPDA 3MINB 1II8B 4BNHA 4F4BA 3IB3A 1TUBA 3MWDB 4Y2SA 4G89A 3IKLA 4OIRF 2X1MA 4FGJA 1FSPA 1RQLA 2OXRA 3OM9A 3QX7A 3FPSA 1L4MA 1SUPA 4QJBA 3L0SA 3NT4A 5DVZA 1G98A 2AR7A 2CLMB 1EB9A 4OHYA 4MITA 1AUQA 5HKKA 2QQ5A 2FLWA 4IIJF 1HYQA 1OWNA 3KELA 3MTEA 5JMOA 2VAXA 4QEKA 1RI2A 3UJ6A 1MPXA 5BPFA 3L02A 5ES3A 4ZZ1A 3OQNA 4J3NA 1ATIA 3HVKA 3ZWOA 2OEXA 1JJAA 5K6RA 4QVIA 2P6RA 4ARAA 2PAAA 2LCQA 1P1HA 2L17A 3FE2A 2BTEA 4RKQA 5DLPA 3JQPA 3CE9A 3PHBE 4FILA 3E9VA 4P3PA 5FEMA 3U13A 2XNHA 4JJZA 1ESNA 2JLSA 3KYJB 1OWMA 1R88A 2PTGA 1AN0A 4EI2A 2VYND 2PTHA 3JYOA 3SOPA 2HSZA 1GYPA 3UGOA 1Q0SA 5K1ZA 4I1RA 1BEZA 3AR3A 3KAKA 4CG0A 4ZDJA 3BCRA 4RU1A 3K72B 4FGWA 4YJHA 2O8FA 4QU0A 1QTNA 3CKYA 1VI2A 3OTWA 2JCXA 2P9FA 2A78A 3FJOA 5NLLA 4AVYA 4GRAA 5HSGA 5JFOA 1VYTA 1RYMA 2FX5A 2JW5A 2PV7A 2YCLA 2D1QA 4DNOA 3ZYZA 1T2FA 3AM3A 5AM2A 1QG2A 3PNPA 3DCYA 1A82A 3GWZA 1QP0A 1VYHA 3FSRA 4PJMA 2XOKD 3DR5A 1DG1G 3B8HA 3B9BA 1ZAYA 1EGVB 3OIWA 4RYLA 1P2DA 1PT5A 3LFHA 1J20A 4O4JF 3HLYA 3QOWA 1DOVA 4MPJA 2JARA 4UUPA 5TPWA 2B0JA 2ZS7A 4QZVA 1SCQA 4PONA 3PNLA 1GARA 2ZS9A 1K5DA 4IKEA 1SCBA 1NJ8A 1Q3TA 3I2KA 5ADUS 1FTNA 3T7JA 3H8SA 3JASA 3CH5A 2CLLB 4C4XA 4ZICA 1NDQA 1NW3A 4QDTA 4ULWA 5M3BA 1CP3A 1C1XA 3CB2A 1CUEA 4MYRA 4QWWA 4UMEA 3UAZA 5H1YA 4DHEA 2VQEB 2JLAA 2WAYA 3V5YA 2C4TA 3NIGB 1ULZA 3RGGA 1X1AA 4UDYX 1J8YF 1ZH6A 1JI3A 1UIRA 2WVNA 2X4DA 5BNFA 4ES6A 4E0HA 1HMOA 1FUKA 3TJRA 1DRUA 1JG4A 3QOXA 3I5MA 2P65A 2PLRA 2X1VA 2OXTA 1KAGA 1POWA 5E38A 4HQRA 2WTXA 4F12A 3FUTA 1ENZA 5EOVA 4LHEA 5DDIP 1TKBA 3NHRA 3GAZA 1A88A 1GZ6A 1WO8A 2CXTA 4IP0A 2O3UA 4GPBA 3UW3A 1XCPA 1A9RA 3V7UA 4HRAA 4NBTA 1WPGA 3WJ7A 4XWTA 1ZMRA 2AQKA 2UVPA 1LC0A 4KRGA 4MKZA 4YGYA 4ZQHA 2ZITA 4ZRMA 2ECPA 2Q6KA 4DLPA 2G67A 2HNKA 5DYNA 1VJRA 5EXPA 1D1QA 1GQFA 5JSZB 3K9NA 3PNMA 1RI5A 1YIOA 3R3YA 3TM4A 3E3MA 3AP3A 2LIVA 1TO2E 2EIXA 5AD1A 2QLFA 5FULA 2PM8A 1YZYA 4L6RA 1BYIA 4Y1RB 5EIWA 4FT4A 4IR7A 1C4WA 2HJGA 3VKHA 1QWOA 3ESAA 1LLCA 2JASA 4IWXA 5BQHA 3OTOB 5ELXA 3N0TA 1N0WA 2C7RA 3PXDA 4TSFA 1V16B 4FOSA 2FEAA 1R6TA 2G5PA 3G6WA 3CH4B 2O57A 3HZZA 4ZXPA 2NUBA 3D8SA 1X7WA 2WINI 2OKGA 2ISCA 1SXJD 1N7IA 1Y3CE 4P35A 4YHHB 5GONB 3U4AA 4KEAA 4NECA 5F28E 2PKEA 1MIOB 2O2IA 4GM1A 4O6YA 5CIVA 1W46A 3T6JA 2JGLA 2NAFA 4G5XA 4Q4JA 1KSGA 4XRGA 4A2PA 5BYAA 1TLFA 2WUFA 4GSKA 1KMHB 5HFJA 1R9GA 2IYEA 1WLSA 2GZ3A 3G0OA 3I8OA 4LDNA 1ACLA 5D8DA 2ZBQA 3P2OA 4JB2A 3LA8A 3PJEA 1SU6A 4BVLA 1LSSA 3CF6R 1ZGBA 4FYPA 4I1UA 1DWUA 5B1SA 3AR7A 4NE9A 5IWAB 4MUHA 1DEAA 1W0KD 3RYTC 2C3PA 3TSAA 2GEKA 5C46F 3W4YA 3K0BA 3ETHA 1KGDA 4J30B 4DMFA 3S0XA 4M9QA 5LU9A 4CSAC 4EF6A 4NK5A 3CVWA 3PHCA 1GXSA 2PRKA 5KEIA 3DFUA 4EL0A 4BFVA 4BMSA 4JTCB 1TCCA 2DXIA 5AK0A 3O8NA 4W99A 4A9AA 3VF0A 1PR9A 2QDKA 3NYLA 3UMIA 2ID9A 1S5PA 2FPSA 1C2TA 2QR5A 1AIPA 4R05A 4LK2A 1WDLA 4XEVA 5DLJA 2G9QA 1N7HA 3LRPA 2BY4A 2JPDA 4N3NA 1OWPA 1PE0A 5A05A 4MP6A 3WIUA 2IU4A 3KPYA 3TFQA 3DFZA 4QBHA 4XIFA 5HFAA 4OQLA 4X3PA 4KDCA 4EG1A 5BSWA 3GT4A 1CETA 4ER6A 1NMXA 3RK1A 3BFPA 4Z7QB 1U8YA 2EQ5A 1YZAA 5L7WA 3E6AA 4MQ9F 1ORJA 2JJ2A 4FZ3A 4DMHA 1E5QA 5BSHA 5MN6A 3MINA 5FEUA 1WHSB 3F4KA 4M1YA 4KOEC 3FUCA 2QIOA 3DNFA 5EJEA 2GD1O 1X87A 5C81A 3JAMA 2G07A 5DWDA 1YMVA 4FVTA 3FKJA 3L0OA 1VZ2A 4EW6A 3JALA 4C30A 2FEKA 2QRQA 3HJHA 4G1EB 1RQGA 2ZE7A 5EXTA 2FPWA 3MLAA 2NUAA 3HL0A 4GOXA 1Y1LA 3I4CA 5M7EA 3K92A 4UHDA 3A6LA 4MYSA 4RKEA 4JP2A 1SN7A 5C51B 1E6KA 1SBHA 3I0ZA 3K1AB 4EYEA 3DE2X 5EFZA 3P0RA 4F5DA 1J5EB 3NQ41 5IABA 4KC9A 1JSRA 2W83A 3DHVA 3OICA 5EXDA 1DUVG 4AY5A 5BW6B 2SKEA 1QGYA 2WZDA 3QUCA 2IOHA 1EWVA 1W73A 2WHPA 2Z56A 1Y7IA 4J7TA 5ER9A 2BBTA 1NG9A 3DW3X 1NMSA 2ZJOA 4YUAA 1CQXA 3ESBA 3EWAA 1NVBA 1WU7A 5BN5A 4B3SB 2EKZA 3MQFA 3U3OA 1NLZA 3DBLB 2B3TA 4JURI 3GI1A 3KBBA 3PWSA 1O58A 1WULS 1NN0A 4JVMA 4N54A 4E31A 2PJRA 1I33A 3SF8A 4TTIA 5IYZB 2HBQA 4OEHA 1KP9A 1LSOA 3ZC4A 3GL9A 3PDCA 3W5UA 5TIIA 1E77A 5GV7A 4G8DA 3OY2A 4QYTA 4DSOA 1MCZA 3ZZ1A 2O1WA 1G4AE 3LTEA 5BNIA 3I9NA 1BR4A 4H1UA 4HZUA 4ZGWA 2BLNA 1NTRA 1GKUB 3DPUA 3RKOF 4HPXB 4L5CA 3U4HA 4OAQA 4RKRA 2WMYA 3UJBA 2X2FA 4BV2A 1KZ7B 4N5NA 5G3YA 5JAUA 2AX4A 3UHPA 4E5SA 4UMFA 2V4MA 4DSAA 3NXKA 1T3SA 3RQIA 4B7ZA 3O8CA 3RVRA 2YIDA 5HQJA 1DAPA 1KDRA 3CJQA 4EG6A 1SB9A 2GYYA 4FMDB 5I7WA 3H9QA 4K6CA 3PITA 1FW6A 3BIXA 3I9LA 3OP4A 3FCXA 1HW2A 3AVWA 3GJ6A 4L85A 4JI4B 2EPKX 3ELUA 4EKEA 2VT2A 1K7CA 1RI4A 5DTIA 4CKCB 7GPBA 5KNLA 2I1LA 1XPUA 4JL8A 2IDMA 2V9ZA 3AVOA 2YVKA 1SC9A 2H2IA 3G49A 3NP7A 4H4CA 3WZ2A 1BDIA 8AT1A 2BE5F 3M2TA 4F38A 2N1MA 1NBHA 3QQ5A 4B33A 4J0EA 4Y6LA 2O0MA 1VLTA 2FVYA 2D0DA 4PZZA 1NAIA 3QX9A 3SSOA 2KJGA 1CKEA 1C0KA 1QIGA 2J4FA 1T5TA 5HV9A 1BR2A 3Q6IA 1Y3AA 3AY3A 4KN5A 1KK1A 5LB2A 1Z36A 3PWZA 1PKXA 2CCKA 2XM4A 2O2GA 1B93A 3J7TA 4HGNA 3DE9A 4CKEB 4DBZA 3WLEA 1KVTA 5IAGA 2QTRA 5JH7B 1AHNA 1WASA 1HQDA 3LGSA 4PS1A 4UDNA 5HE8A 1C1XB 2V7UA 4BB5A 2OQMA 1RCUA 3H04A 3R4CA 5KB3A 2I2DA 3A1VA 4CKCA 4ZMRA 2L19A 5AUOB 2A1IA 4ANJA 2GOYA 1D2CA 3NU1A 3HCNA 2V0GA 4MTCA 2AXQA 4DMMA 1I3NA 4EJSB 5K0EA 1G18A 3SVTA 3B48A 4R7GA 3MWJA 1R0SA 1C14A 5FP0A 4CFSA 1JB1A 4PBRA 2JD3A 4N12A 2FEPA 4B80A 1RQPA 2C00A 9GPBA 5K3EA 1G55A 2HJMA 2A84A 4MQEB 4ZZIA 2AA3A 2O2XA 1I7NA 3KR9A 1XDUA 2Q4EA 8ABPA 1SOUA 1P75A 1CF2O 1YFJA 3K5HA 5AC4A 8LDHA 5TT0A 5FUQA 1YE8A 1NX6A 3RS3A 5KAMA 4F4CA 2J9VA 4RQBA 1YC5A 5JSHA 3G2HA 4GC5A 3AUAA 3RG2A 3W6PA 3JR7A 5GPBA 3T52A 1JNYA 2FRDC 3GA5A 5JYEA 5KWVA 3AFHA 3UJAA 3N8GA 1IM5A 4IWYA 4AJHA 1UEIA 2J0EA 2R6HA 3PQ8A 4GH5A 4Q48A 3PC8A 4DRXA 3U2LA 2R6GA 3ST7A 3V2GA 3FDFA 2YRFA 2HNAA 1MA3A 4UHFA 2ZCJA 2Z2YA 4U7HA 3FR8A 3AL3A 2JL1A 5JRDS 5BW4A 1J8VA 3HJBA 1D9ZA 1JEQA 4GM0A 1XK7A 5B1BC 5IXSA 2H16A 2CVQA 4G23A 2VTDA 4K9KA 4Q4JB 4R2XA 3FNGA 1E8NA 3A9CA 1OFGA 2DHRA 1ZOOA 2QSYA 4HFJA 3BGDA 3Q6NA 4MVJD 2IXOA 1EGMB 3IR5A 4IV0A 1TU4A 4M87A 4RELA 1L5FA 3VYSB 4BWGA 3ZDFA 5BWBA 3ZNOA 5IJZA 1SVSA 1ZL0A 1Q3KA 1YVRA 2TSYB 2VL7A 1K5GA 3SYNA 1W96A 1NQWA 1PR3A 1BJKA 4PACA 1TQDA 1EM8A 1PZXA 1V7CA 2DQZA 1KEVA 3CMCO 3H5IA 3H4IA 3Q41A 4NH4A 3ZHOA 5T64A 4ARUA 3HYNA 3AUJB 3EZYA 2A1UA 1AQ6A 1M2HA 2JRLA 2QN9A 3EXFB 4AJPA 2PFGA 3HNIA 5AHKA 3U81A 5K0BA 16PKA 3SFVA 4N6NA 4KC0A 3D4BA 4B6RA 4CLOB 4QGAA 1E84A 1LK0A 1XDWA 2FMKA 2QT0A 2JIZA 3M33A 3FPJA 4KQ6A 1HK7A 4UNIA 3VR6A 2OAQ1 4NJMA 2RAVA 4V0SA 1IEXA 4FOLA 3SYLA 5IVPA 1JU4A 1N6LA 3UMYA 4OM8A 1V5IA 4PR3A 2ZCUA 3DDHA 3M3PA 2ZT5A 4HO1X 3QVGA 4XD7A 4D3XA 5L6LB 2P9GA 4RHCA 4UTVA 2H1SA 5JECA 3ZGYA 5TF4A 2GI4A 3NI2A 3AQCA 2N1BA 4L6IA 1R10A 4E0BA 3QEJA 1NZEA 3FPAA 1OTXA 1FP2A 1I4DD 4ZQGA 2SCUB 3B1KA 1GYRA 1JVNA 1TO1E 4X1OA 4ZCMA 3ONNA 3PI6A 1KTVA 4H1VA 5IVDA 4BL5A 4M55A 1B8PA 5J2TF 1ZUHA 1FK8A 4WUVA 2VC9A 4P7FA 3PGLA 5B58T 3CR3C 3NBMA 1R5BA 4HWPA 4ENRA 5IF3A 4IHJB 1XPOA 4Q1CA 4Z1MA 5LXTF 1Z38A 3FZEA 1MW8X 1JE1A 3WFZA 3QNMA 4CTOA 1F17A 4EDFA 3L79A 2ORWA 4HAZA 1UMBB 1D1TA 2GEFA 2BM0A 3JWJA 1MNAA 1YDWA 1J2YA 2BW0A 3KT8A 3EG9A 4XOUA 1XPRA 1I6KA 3ETLA 3E22B 5BUSA 5LZ8A 1FFGA 4C2UA 4L8FA 3KFVA 2C77A 2QAGC 4RSHA 3NR2A 4B7CA 4COOA 1RWNA 1PNRA 1RC1A 3K09C 4X1YB 1W4ZA 3DVAB 5KCZA 2J9WA 2GARA 2WWXA 2GXSA 1E3SA 2XWBF 4I6GA 4PWZA 3J81A 4HATA 4IO0A 4WNCA 5FADA 1EFUA 4CUJA 2CLIB 4K9DA 2YLIA 1VE6A 3TDKA 4ZCPA 3ZDZB 2BGNA 5IP5A 4BXOA 1GGJA 3C5HA 5CM2Z 3A4NA 3U8PA 2VBFA 3L8HA 2BSXA 4JGBA 5FWDA 2ZSKA 2VK2A 3DDSA 3T4UA 4FFLA 4FKMA 1NW8A 1EX6A 1EP1B 2H1FA 5EGYA 4JV5B 3LCJA 3X2SA 1T8WA 1Z8DA 4QJ5A 5ESRA 3VZRA 5GGYA 3CQ9A 1RKEB 1PWYE 2NTNA 3TTSA 2YLDA 3RVLA 3GANA 3THXB 4WY2A 3BE8A 3QG5A 2J1LA 2AMFA 3IDFA 3KXPA 5DX1A 3BDAA 4YP5A 4F4FA 5BVHB 3GEEA 1LGYA 1Q11A 2WIAA 5LZ5A 1Q0FA 4OK3A 1U0RA 2Y05A 4M21A 1XZPA 4Q4AA 2GS9A 4PX2A 2FZ4A 3KUUA 3VU1A 3OC6A 1ZX1A 3W1VA 3EGEA 2CCYA 3EIHA 3QE0A 4YI5A 2O5CA 1NQVA 2BP7B 1CTQA 2XNCA 5EXSA 4M3NA 2PKQO 4NU5A 2R7OA 3O6XA 4AF7A 3RS7A 4DYDA 1Y6FA 2Q3LA 4MWOA 3DA8A 2Q1TA 4MWDA 4TV8F 4YJHB 4A8HA 2O8FB 4HS4A 1T0BA 4F6LA 1VA5A 3DC7A 2OM2A 1AGXA 1OI7A 3WKCA 9MHTA 5EIBC 3ZHSA 1MJGM 2CHEA 2CB0A 1IY2A 1N2CA 1DWQA 4C43A 4C6HA 1EUQA 2QUAA 3OEHA 3PKJA 1XJWA 2WJ4A 3THOA 4A8JC 3K7EA 4DA7A 3U56A 3GN2A 5IZCA 3K9HA 4QC2A 4I44A 3PICA 2XGGA 4UHEA 5H68A 1G20A 1W19A 2P67A 1H23A 2QMUA 1B0UA 4RK4A 5EZQA 3AJEA 3ZHYA 1N0UA 3E9CA 2PS1A 1DAKA 4X61A 1VKJA 1XCGB 4NCQA 1W2WB 1Q7CA 1UEJA 2W2KB 2L6GA 1S9HA 3ENZA 3LMKA 3OX4A 4HEA1 4TKUB 2P7IA 4BVKA 1TMKA 3TYXA 5JD3A 3RVOA 2IFTA 1YZLA 1YE3A 4S1NA 3ZLBA 4UCXA 4D9JA 4RKFA 2VNAA 2D5RB 1P7CA 2I78A 3DKVA 2GSWA 3MJVA 4N9QA 5LBUA 5TQ0B 4B3CA 2Q29A 3LAYA 5REQA 3K9QO 3QBDA 2BFFA 3AB3A 3RS0A 2Y27A 3C24A 3NHBA 5C7LO 2ORVA 2CNKA 3GLHE 3HKBB 2JFWA 2RONA 4ILKA 4NZYA 4EFDA 4HNTA 3AJRA 2XOKA 2E4ZA 1R3UA 2PKXA 1O5IA 3T99A 4DTCA 1J1ZA 4RD9A 1FQKA 1E3DA 1DQZA 2IGBA 3AG4C 2Z4RA 3O8OB 3DWEX 4IWNA 5GY7A 4AWXA 4POOA 2CJWA 4EO4A 4X1IA 2FW7A 2JBAB 2LCIA 4QYIA 5HCUA 1NBMA 1BCSB 1H8HA 1WPRA 4NCNA 1ZUD1 3MTDA 4BN0A 2ZRAA 5ELLA 2PD3A 4JZKA 3IUNA 4HNHA 2YY6A 4PRZA 2RH8A 2R5WA 3KYCA 4L4ZA 4YCJA 5DH9A 3ORHA 5CB4B 5IK2D 1LW7A 1WLYA 4FWIB 1Q2XA 2ZSJA 4AMBA 2RGDA 1E2IA 1KPHA 1FY2A 4BQNA 3OBIA 3DXYA 4EPWA 3BOSA 2WJIA 1N6KA 1XLVA 1L1FA 4MV0A 1VIAA 4IOKA 4TTPA 4N4WA 2G71A 2WP8J 1Q44A 3PCXA 4A1FA 4DNPA 5JAMA 4MVJI 1OW6A 3FTNA 1GZDA 1OC2A 3BHIA 2Z4TA 4MP3A 4NCKA 3CVOA 2RMKA 3ND5A 1C9YA 1WTYA 1K4MA 3EXAA 3HVIA 3NALA 3PL1A 4PPQA 3O8OA 3WYGA 3QYJA 4QEZA 2QTFA 2W2PA 4FYIA 2F1KA 1P9OA 1T3LA 4AMGA 1H8ED 2WKPA 2RARA 4UZFA 4CF3A 3IA2A 5JOQA 3NC1C 2YKGA 4JBXA 4WX2B 4MYTA 4AROA 3OQMA 2IZ6A 1UKCA 1G8AA 1GRQA 3EEIA 3KMIA 4IVRA 2RGRA 4EBJA 1ODCA 2R8RA 1CV2A 4Y6GB 3BE5A 2I29A 3R3HA 4XKJA 5CH8A 3RU3A 3STUA 4JASB 3CSUA 3LYUA 4B87A 1EK0A 3O92A 4NATA 4PYLA 1KZ9A 3ZWCA 5LFAA 1CR4A 2AX3A 1CZHA 3LWDA 2OHGA 4LSGA 1LI4A 3ZW8A 2QUKA 4Q01A 1DDIA 3M6AA 3K1JA 3QVGB 4M1SA 2JKZA 5AJZA 3VSEA 3MYIA 1MJHA 2AFHB 2DLDA 2JIDA 2YL0A 1T8PA 4R6WA 4TMWA 1NY5A 3LT5A 4S04A 2ZM5A 3E1SA 3NTRA 1RP1A 1PDOA 2FX2A 3LUKA 1JDZA 1A96A 2E9SA 3K0CC 3ITFA 1EWKA 2RHRA 4YRBA 2BN4A 4U6QA 2Q7XA 3NEJA 1Y1RA 3SQWA 2AYXA 3D5EA 3GB9A 1Y42X 3FETA 3ZHBA 3V3KA 1BO6A 3MGAA 4AMUA 5D5PA 3EXFA 1CNFA 3M6IA 3GJRA 3PIRA 2YHSA 3OFSA 4Y6OA 5MDHA 2J5RA 5LMNB 2I3AA 4BJTA 1FVXA 4OJMX 4XLPF 5B3LA 4JJAA 2B8TA 4P7JA 4EGSA 4ZIRA 5ESXA 4FYMA 3GBVA 4C0HA 2YVLA 4CDYA 1NFRA 3BMOB 4IXTA 4GICA 3W4JA 1FU8A 2EPOA 4YUWA 1HFJA 2ETSA 1EK2A 2FVXA 2OV3A 2WJVA 3MAAC 4WZZA 5G0SA 2V3VA 3IUBA 2NSGA 1U94A 1CUCA 1LTQA 1M6VB 2AEFA 4R0NA 4YI3A 4UKDA 2ZTHA 4KACA 1NFNA 1T5BA 2FUEA 4O59O 3DEFA 2H85A 3RFTA 3WE7A 3L82B 4BNFA 3A6PC 2RH5A 3OPQA 4JFAA 3UOAB 2FMTA 3TOMA 1RRGA 5C8DA 5JZOA 2O2HA 3PK0A 4YJ3A 5K0CA 1GQ2A 3OE5A 3OG9A 4LCBA 4QYWA 3B51X 3G8CA 4KR3A 2R7NA 4ZTBA 3V4FA 3LUDA 1RZVA 5KOIA 1NNEA 2LDBA 2HA7A 2P3OA 3PZBA 1JAZA 5IHPA 5ISMA 5A6BD 1JT9A 3KKPA 5JVDB 3LUJA 3NS7A 5KNBD 1ILWA 4UM5A 3N8DA 1A0OA 3A06A 1QYVA 4JWTA 3BMOA 2AR9A 3C5VA 4HZGA 4ZZ0A 3C16C 2D5BA 4LCEA 3OF5A 5A6JA 2MYSA 1JBQA 2OG1A 3CLRD 3PVZA 3V8BA 3WAKA 4CBVA 5BXYA 1TM7E 1WDMA 1YDGA 1JU9A 1Z6GA 2Q0HA 4LKOA 3THYA 3PQEA 3V80A 1W2GA 4MAFA 3W79A 4ZV4A 3U7QA 3KB6A 4G5HA 4L16A 2V6MA 3K33A 1YQTA 4QVKA 1ZH8A 5FB3A 4CCYA 4E2FA 4AKEA 1XXHE 4OHOA 3CW8X 4EY8A 4YAWA 5JLAA 2FWAA 1PV2A 3TIFA 3RIMA 1L7QA 2V6IA 2BPOA 1NN1A 2DFVA 3E5NA 3KKBA 4MQ6A 5DTMA 1VE7A 2OFFA 1O03A 4JU9A 1SIUA 4BNXA 2W45A 1R0CA 2H2HA 1N7GA 1LWNA 2QF7A 3DGEC 4RIGA 4WZAB 4XM0A 4ZRDA 3R74A 2JVIA 4P6VF 3AIIA 3SZOA 1QV6A 1XYGA 1WUIS 3QSGA 1UXKA 2Q3JA 2XL6A 3I8SA 3OEED 3NIBA 2RJOA 5CGQB 3A1CA 4N1AA 4TMTA 4KFTA 3D7RA 2NZUG 3DUWA 1WU8A 3CC8A 1RJDA 2NO7A 5G2OA 2ZEJA 1EA5A 2X5NA 5BP7A 3X1XA 1CBUA 3AEUA 1D0IA 1KY2A 3FDJA 3SVZA 5JNLA 1UPBA 4B4DA 5SY4A 3RYFB 2O23A 2VQ3A 4J7AA 2OZPA 1KY3A 2A67A 4LBWA 1CB0A 3ZZUA 1QS0A 4BNKA 3MWGA 3PNOA 3NAQA 4IJJA 4FGKA 2GA8A 3L06A 4PIPA 3CR7A 5T8KC 4BE4A 5K51A 4TLBA 1MW9X 1XALA 2VP2A 3BL5A 4NS1A 2NV6A 1WY7A 2I99A 2AR0A 4MGEA 3TOVA 5LPNA 1I7SB 1HUQA 2R85A 4ENQA 5TE9A 3HP1A 4PM4A 3M4BA 5BSGA 4W5OA 5C5IA 5IH3A 4F21A 1NKSA 2NUPA 1BHO1 4BGVA 4B6OA 3HKDA 3C6MA 2XQVA 3STYA 2P9HA 2ZTVA 3KLMX 4B6SA 3ISTA 1VKHA 3WJAA 2MHRA 1P1BA 2J5KA 4GECA 2JIQA 4HDSB 2B25A 3FWHA 4YL3A 3AVVA 2Z9DA 5J9FA 1DT5A 2X41A 2P8SA 3ZTWA 1GNQA 4K6KA 2OYCA 1F2UA 3STTA 4D8XA 1KI2A 3MF4A 3EW9A 4NOJA 5FV4A 3E8MA 1B14A 1CEQA 3GY0A 1RYNA 1Z2AA 2WMNB 3LBYA 4IGFA 4WN9A 4X91A 3OMWA 1ID8A 5CFOA 2R7TA 2OILA 4LYHA 3DQPA 4URHA 1USGA 3E81A 2OXFA 4X7BA 3GUHA 3NMIA 4OU5A 4YQZA 1LSUA 1QQ3A 2ORYA 1BEUB 3UHAA 2J3EA 1P81A 4FOTA 1T8UA 3MQ2A 1QKKA 1OXSC 2LDXA 4BRWA 2DWOA 2NPIA 2J46A 1O6CA 1I4LD 3D3NA 2BGMA 3ZTZA 3L0DA 2LTAA 5BXQC 3D2CA 2PZKA 4CU2A 1QFSA 1C30A 2HA0A 3M6LA 2VF4X 3BTUA 4G0HA 5CNJA 4DJTA 2A86A 4RA6A 3V1NA 1LZKA 3EC2A 4UVIA 2AZDA 3C4QA 3TIXB 1S96A 4K1XA 1NW7A 2VO1A 3FYSA 1DFHA 1G3UA 3OE7D 5JI3E 2R48A 1KI9A 3GD7A 4J2OA 3EYWA 4LNUB 1XRMA 4O4JA 4PYNA 5EP3A 4HKTA 4N7RA 4RSRA 3UUFA 1JBKA 5KNDA 3EXEB 1GTG1 1ONNA 2JAOA 1L3CA 2OOKA 3C7TA 1P3JA 3TNFA 2J6HA 4RIHA 2B20A 3B1YA 3I04M 4KTVE 3KTFA 3HL4A 2RIPA 2AUNA 2F4VB 1HDXA 1YT5A 3W2VA 1IJEA 3HM2A 4LOHA 4JR1A 3C48A 4MWSA 2KYHA 1YBVA 2HO5A 2XNKA 2EBFX 4PF1A 2NYAA 1CB7A 4N5LA 2JBAA 4YCAA 5BT9A 1C3LA 2REOA 2W58A 3O26A 5GIOE 5F2EA 5F64A 3HDVA 1KO4A 4C1NA 1ISGA 2EEZA 3H1AA 1A76A 1QQTA 2G3KA 1R1DA 1SXGA 3RU9A 4BTVA 3U7GA 4BEWA 3CZRA 1YIAA 5ELMA 3BWXA 1JR3E 1T2AA 1WQ4A 2GX6A 2ZTUA 3A1FA 2FMIA 1ZHHA 3W3AA 1Z06A 2CXSA 2QN7A 2PVCA 4LYAA 2KC3A 5CCDA 1GPKA 2HW8A 2FMUA 4TLDA 1H2RS 5AVVA 3GARA 1QIJA 4D82A 1KOJA 3K4HA 4MJ7A 2G62A 5B4TA 4DV4B 4D80A 4ZHQA 3MPUA 4QUDA 1UBMS 3ZWMA 4CIAA 4R16A 2ZI7A 2Q9BA 5AI4A 3TL6A 2QD2A 4Y2VA 1YJCA 2G72A 4QUKA 2C83A 5T6MA 4KW7A 2QRPA 3JWGA 1FS6A 1G9XA 3TAUA 4RQTA 2WMDA 4HSEA 1WHTA 3GEMA 2P78A 3L6DA 4Y6RA 1KOLA 3D3WB 4CETA 2D7JA 2BI7A 1U1GA 4S12A 3B6EA 3VHXB 1Q91A 3SLRA 3E9QA 3KSDO 1ZSNA 5DSZA 4JA2A 4PQYA 4KBLA 3RF3A 3TRFA 2P0YA 2VIIA 2XT0A 4KYVA 2W22A 1V5EA 3K1ZA 4C89A 4W8KA 3R23A 5B7NA 1QUEA 1GUAA 2X5JO 2XXBA 2P35A 3EF1A 4IX9A 3T4EA 4C4RA 4YASA 3ZJTA 2JEYA 1U7OA 1RAIA 4A03A 2DFDA 5LXTA 2HSWA 5BYJA 4DIOA 3RTGA 4Z9AA 4YPOA 4DSZA 2MU1A 1E9AA 3OVMA 4PNEA 3SQNA 2ZBFA 4C1BA 2XTAA 3VRHA 3AF2A 1GKYA 1H2AS 2ZB3A 2HA5A 4HJRA 4G5YA 1CRLA 1EDEA 3DXXA 1JWBB 4OQFA 3UHOA 4X64B 3ZG6A 1PQYA 2HJ3A 1VC2A 5FIUA 5IDYA 5KTYA 1COWD 4EPRA 1EFAA 1TF5A 2D13A 1E7MA 1T10A 3BL8A 4KE7A 3JWPA 1Z2OX 3IBFA 3HY6A 2H0QA 3STXA 2CV0A 3MMNA 3AO0B 2AC2A 3QY9A 3AW8A 2IYTA 4BE9A 4XCVA 4DRJB 2B4RO 4U2KA 2ZUSA 2J9FA 4MRAA 1JJ7A 1TZJA 4S35A 1T1SA 1Z0DA 3E53A 1T4DA 2JK0A 4LC1A 5EJ8A 1ISRA 2QLAA 1C8LA 1CGOA 3ZV7A 3PGVA 2OZKA 3VNAA 3AT1A 3F4LA 2FSSA 1EESA 4JGGA 4YRRA 2IJGX 1NXTA 1LDBA 2DETA 5CLGA 1Q74A 5D3MA 1BMFA 5ALDA 1IWBB 3HU3A 4JS0A 3PGXA 2C2HA 2FWJA 3SEQA 5IJ9B 5KINB 3G0HA 1LCIA 3MJCA 1O6GA 3DE1X 4R1LA 1QVRA 1XMPA 4K6MA 1I36A 4O4LA 4FWTA 2OUIA 4OQEA 4E18A 3S7ZA 3OFKA 1OCEA 1R8YA 2DPXA 4ZI7A 1R66A 4QDKA 1WQ3A 4AX4A 2WWVD 4S1TA 4ESEA 3GDHA 5K0IA 4CG2A 2FX3A 4HWKA 1OFHA 1DC4A 1GZUA 5FR2A 5DRYA 4PYOA 1JJFA 1WKCA 4HG2A 1NLUA 2BI8A 2ODEA 3LQ2A 5I9SA 3GEIA 4R1QA 2OMKA 3CZ9A 5E3HA 2VEDA 2CXQA 3BSSA 1TQ4A 3BF8A 4ETMA 1H0HA 3IERA 5ARDA 2J33A 1E4EA 1UODA 4X6LA 5AXAA 3WYNA 2IY9A 5ER6A 1Z4PX 2VHTA 3KSUA 3DO6A 5CB8A 3LBIA 1BFUA 1CP2A 1KOFA 2D5IA 2ZRIA 3LZ6A 2Q5IA 3GMTA 4ZZ2A 3RIHA 4B8WA 1OR2A 1GU1A 3LCVB 3Q3JB 4MCHA 4GRIA 1E7RA 3OZSA 2RDMA 3HUUA 1BCRA 1EWTA 3OKAA 2CMHA 4REOA 1T9KA 5EMJA 2Q0SA 1N0IA 3MLEA 1U7TA 5UKDA 1NSTA 1SCUB 1VCNA 2F90A 3LFTA 3LVQE 3LDFA 2D4AA 3MGBA 2Q5QA 3P2IA 4G9EA 4YBZA 4A1OA 1E4OA 2R0QC 2CF5A 3LCUA 3P2JA 4B4KA 2CJWB 1JJBA 2QN2A 2BFEA 4WY5A 3NNNA 3TLJA 5JSUA 5D91A 5MGBA 5B1EA 1J7JA 3A9TA 4G5GA 4DAOA 5IKEA 2B61A 2EF1A 2X3FA 1ZVMA 4PC1A 3GEGA 1TZBA 2DC1A 3DFFA 1M33A 5AKIA 2F22A 3LY7A 1HL7A 4YN0B 2GAOA 1EVIA 3F6BX 3HA5A 3OZVA 3R1IA 4OK5A 1RCPA 5T3YA 2RGBA 1H9TA 3V1YA 4PSUA 5DM60 3I73A 4CLHA 5CPBA 1U31A 1X7WB 2NSJA 2P1RA 3OEOA 2OQIA 3E9RA 4WLOA 5DW0A 5B3IA 1T15A 2X5OA 5TQ0A 4AG5A 2C7QA 2A0BA 1TW2A 1XKQA 2H9IA 5IZCC 1YE5A 3LZDA 5I9IA 3BICA 1OYYA 4YCDA 3CZ6A 2OHHA 3H4TA 3V4RA 1ARZA 2XD4A 1EJ0A 4MVRA 1T1IA 1E3LA 1ZQ9A 2Z4SA 5A4MS 2COKA 3REOA 2ZE5A 4E33A 2AXNA 2WA1A 1AQJA 3ZWVA 4P81A 1PTJA 2D0IA 3H2VA 5ED0A 5K01A 5JXGA 3G9TA 2XMGA 3I76A 3M5CA 3R5SA 2AC7A 3EQZA 4G8JA 1Y34E 4L95C 3I53A 4JI5B 4KRFA 2LR0A 3KKKA 3NJ4A 3AUSA 1E7QA 4HDRA 3KUXA 4X94A 1EFPB 2XKAA 2IEIA 3HGQA 4FHEA 4YAUA 3I58A 2YKZA 3RRNA 2CMKA 2JAQA 1E1MA 1LW6E 2F4NA 2WTMA 5C7IO 2X7XA 1KDOA 3SCZA 3TLAA 4CM4B 4J1TC 4KQ1A 3QGMA 4C06A 4DBLE 2YQ5A 1RWXA 3CW9A 3SBOA 1NBOA 1YZ3A 1RMYA 3OZAA 1GGKA 3FVQA 2F2TA 3LD9A 1KIMA 1T9GR 2HJWA 2I6FA 2X58A 1P2BA 3OFVA 4JSYA 3S84A 2GBLA 4WKOA 4DPKA 1G3MA 1TJ5A 1WY5A 1Y3BE 2FH5B 1QGUB 2O0KA 2VTVA 2EG9A 3IQ6A 3CLTC 3NWOA 2JLQA 5JRJA 5K6AC 3Q88A 3IIJA 1XJCA 3B12A 4E08A 1KMHA 5G41A 1OCRC 3SZLA 4CVNA 2DRIA 2B36A 3ODPA 1NF2A 1KMCA 2FTKE 3RSLA 1HX7A 3KQUA 4BAUA 4UCFA 2XBLA 1AHPA 1HETA 1GG2A 1N6IA 3FLEA 3GRZA 4EKDA 3OKFA 3EIEA 2FLKA 4PTZA 1S8AA 4Y2RA 4ZJYA 5BUQA 1F8XA 3NAGA 1CR2A 1FUIA 1RIFA 1LBHA 4ZVPA 5GZ1A 4Y0AA 3N05A 1EE2A 1MJNA 1LI7A 4JL5A 3DL2A 3A4YA 2AP3A 2C3OA 3UTDA 2AEEA 2MSKA 4WZAA 2EILC 1PNTA 1OIWA 5IF9A 4TQ9A 4BGUA 3GVCA 1EAMA 4PYKA 4K8OA 1JILA 1E2UA 2P5UA 5ALYA 4ZI7F 1QGUA 2J5QA 3I8XA 4TVOA 3DKRA 5C5EA 4G0OA 5KTOA 5JNRA 5J5CA 2UYYA 2VF2A 1GEEA 2YJGA 2LSEA 3AY7A 3P9KA 4HC4A 3U7HB 3X1DA 1DX9A 3AETA 1J8QA 3OO1A 5EIBD 2PZMA 1PNOA 1G5HA 1PZNA 4C7KA 2DHDA 3FGNA 4I4NA 4Q7CA 3D3WA 5K05A 1DBSA 3EBLA 3T4XA 1G6Q1 1CJUC 2QVXX 4Q4DA 3TIIA 2IQIA 1QFXA 1SKQA 3TLEA 1BHQ1 1BC5A 4MVQA 4TKVB 2BZGA 2HV8A 3K6SA 5JWRA 3HYCA 3QF4A 4NMXB 2CK3D 4TM7A 3I30X 3EUAA 4IDQA 3TVTA 1F3OA 3ONFA 2BF4A 4B3XA 4MWTA 4DXHA 4WFKA 2EU8A 1NLFA 1MABA 1QGZA 2PUAA 1P9RA 5EPEA 1KJIA 1XVAA 4KIGA 2FLVA 3FHLA 3MRXA 5AW4A 1EZ1A 2WJZB 4CS9A 3AFOA 3PHIA 1U9CA 3IDQA 4PY2A 4MVXA 1JEJA 1N6HA 4G65A 3VDNB 5JALA 4JNKA 3ZHRA 2Y6UA 3PU6A 2C07A 2JLVA 4H7DA 1N0VC 3N7UA 1YJAA 4JQOA 1NWHA 1PZGA 4R8KA 2WHYA 3HXOA 1FXUA 3QMKA 1YDFA 3CN9A 1XT6A 3N2LA 5IAOA 3EMDA 2FP3A 2QMZA 3VR4H 2Y69C 4YJGB 1F8UA 3LXXA 4JBWA 4H1TA 2ZE6A 4WLNA 5L0GA 1Q6YA 2AYYA 3F67A 1PBTA 1XELA 1RTKA 2BMAA 2XMZA 1K6MA 5DNWA 4GQBA 4Z86A 3J06A 1Z25A 4QUIA 2E55A 1F2VA 3S28A 3C39A 1YVEI 4HFNA 2F8TA 4FHFA 1NVVR 3E7XA 3HCAA 4X1KB 3GLGA 1E79D 3F1LA 3TL2A 2WU0A 3UANA 4NH0A 4EQZA 2WOJA 5KCMA 4HLUA 4X44A 3KL4A 2J4CA 3TVDA 1TM5E 3NYQA 1QPBA 3B6JA 1PEYA 4KAJA 4XASA 3U7JA 3EEOA 2Z83A 2ZJ4A 1JEDA 4NBNA 4ZT3A 2XUKA 1MGPA 4KXXA 5GAJA 4RESA 1ZU4A 1DDGA 1JZSA 1YS4A 3EHEA 3G1UA 4DUZB 2I15A 2VSQA 2PRYA 4ZAYA 3NHYA 4POAA 4DIEA 2FFHA 1BN7A 1SHTX 3QU2A 4UBOA 4V1CB 1U11A 2QPOA 3OOWA 2H51A 1QB8A 1T24A 4Q3DA 4UPVA 2XVMA 1FRZA 4XQCA 4EW3A 1XLWA 2J59A 1XU9A 4FDTA 4PGMA 3GRRA 2POQX 2XYRA 3DWGA 4EKIA 1EQ1A 1CUHA 3V55A 5EE0A 2HV7A 4JVOA 5IKMA 4CS9C 5JAIA 4KR6A 3O75A 2XLDA 1PLLA 1M34B 2WP0A 3TSOA 3LF2A 3WR5A 1QJ4A 3PQCA 4ETWA 1PGJA 3E70C 1ZW1A 3OZIA 2H6EA 1WWPA 3UY4A 2BM8A 4G2TA 5LWHA 3M4ZA 3EVZA 1VE3A 3OESA 2Y1WA 3FMOB 3U09A 3D6VA 4AKGA 1XZDA 1MNDA 1X80B 4NMHA 1LC3A 5KAPA 4N65A 1TJYA 4OSPA 4MVJM 1TFKB 4ZYZA 5IJ9A 3ZCSA 3IAUA 2NAPA 3W8DA 1U3CA 2M98A 4Z0HO 5P21A 1TCBA 2FQQA 3EHDA 1W0KA 1FYWA 2XMRA 4G4JA 2COEA 1ZJWA 2ANCA 4E6EA 5C9ZA 1VHDA 3PA8A 4G4SO 1JDVA 1Q14A 3DCJA 4CRWB 5IY5C 3D7KA 4ML3A 3ZV6A 1R6XA 5I7UA 4C3EA 1AY0A 1P2GA 3KEFA 1MO4A 2EZTA 2HRBA 1GCUA 3VOAA 4V0ME 3V7NA 2KB0A 2QZ9A 3QVMA 4B44A 3FMFA 4RPIA 3AXTA 2XGJA 2FN4A 1JXQA 1OZAA 2V74B 2YWCA 4X7PA 3V32A 5I7OA 1USIA 1Z12A 3I9JA 3V5ZA 2FHSA 3K0KA 2P1AA 1M1YE 1RM4A 5EKSA 2V0NA 3VC7A 3STWA 3B1ZA 5AESA 2GKSA 2P1ZA 4S1WA 4UHKA 3ESZA 1LRLA 1MX5A 1S2MA 1ZD4A 1R0RE 4IOLA 4AUMA 4JLPA 1JQEA 3HI4A 2OC4A 2WWWA 1QAQA 3ZU6A 4RPJA 5HRCA 1JG7A 1DUSA 2N75A 4QOEA 3ICQB 4R8MA 5LQNA 1Z0KA 5T4FA 4AYTA 1UDCA 3VO2A 3WGKA 2IYSA 2XWPA 3L4BC 3L2OB 5TGZA 3EOZA 1TGVA 4C7JA 1CEXA 3C41J 3IYLW 4OLJA 5E1MA 4EELA 5LMZA 4HD8A 1U7WA 3CZPA 4QPPA 1RJFA 1QE0A 3D0RA 1W52X 4IDOA 3CNEA 4EY5A 1UWVA 4RV5A 3JARB 5CFNA 5DBOA 4PYRA 5IN5A 4MUFA 4EM6A 1NVAA 4P4SB 2CN1A 1CYDA 2J5BA 3GV0A 2ECQA 3BBPA 1HT2E 4MW4A 5JAPA 5KNCH 2ZXFA 5FOVA 4M2LA 1JDTA 4MI9A 3F6EX 5B3JA 1GHTA 3JRTA 3OQBA 4K0RA 1W36B 3KQOA 3VTZA 4YMIA 1PJAA 4RIIA 3O2NA 3U7IA 1FX1A 3GFTA 2UVQA 4W7IA 3CZQA 1CUAA 4KMOA 5E1BA 2W2XA 1CCWA 1PWHA 1YL7A 3CVJA 3TD6A 3ZHUA 4E5KA 1TA9A 4ONSA 4BPRA 2C8JA 1CD5A 4EYQA 2J3MA 1H1LB 3ZNPA 3H5NA 5ILQA 4XEUA 4ND5A 4ZYTA 1ZKMA 1GCIA 3JVIA 1HG1A 3TM5A 1F2TB 1BHSA 3LL7A 2MSWA 4F4DA 4DV5B 1QX3A 5DYTA 1SU7A 1QKJA 1PFWA 2R6JA 3L8DA 5D6OA 3ZWAA 3X1ZA 1HE4A 3F6RA 3RVSA 1GEGA 4JBHA 2HPZA 3KH2A 4NABA 4XTRA 5AW1A 3S27A 3WLIA 4PG8A 5LOVA 4JYAB 1O54A 1MEJA 5SYMA 1YYJA 1ZHWA 1JHUA 1ZW6A 2HU5A 2WD7A 4KRXA 5DXAA 4UE3S 4E2WA 3QMMA 4P3XA 3ONDA 2XYQA 2JZNA 5KKCA 1LPSA 1S8FA 2EFGA 3THYB 1LEHA 2B1QA 1MJGA 5DSTA 1R00A 2WQ6A 1S7CA 1E3WA 3KSBC 3FPHA 5L51A 1SXQA 2JK1A 1L4GA 4TKMA 3JQAA 3G23A 1YZTA 4CS8A 2VPWA 3H5TA 1EZ4A 4IF4A 4IIGA 1I2CA 2OV1A 4Q6WA 5IJXA 1NV9A 3RHTA 5DYGA 3ZHTA 2H54A 1ISSA 4TRMA 4UQPA 1Y37A 2ZZMA 5I9TA 3KPUA 1KHHA 4CYMA 1NQOA 1E1RD 3SZ3A 2C2YA 1KJWA 1V8FA 2PHZA 2OU6A 1OV4A 5E4JA 4I1SA 5EWJB 3AP2A 1GUZA 2PKWA 3BEDA 3E9MA 4ISCA 2Z09A 1YGYA 4OQNA 4NEGA 5HJ5A 1HNZB 1N33B 1J0EA 3LESA 4WKBA 1NP6A 5G0UA 5KTNA 2CLSA 1EVEA 1UANA 1VBMA 3AY6A 3Q5GA 3DZHA 2EFHB 5AICA 5D5HA 5E6SB 4L08A 4FCWA 5TC4A 2OB1A 4MPPA 4R9RA 1F2DA 3R3VA 3PQ6A 3KVRA 4HNAA 5DWQA 3M6MD 1RWKA 1AB5A 4KPUB 3SYMA 2CV2A 3K0FB 3O8QA 3R5XA 4EENA 1YJBA 2P30A 2PDAA 1LU9A 1OJ7A 3DLCA 3O4FA 4BQRA 3KWLA 1JHAA 4G24A 3HBMA 4OOEA 2RH9B 4K7BA 1MN6A 1CQIB 3SYKA 5GONA 4I1IA 1N9GA 1R0BA 4L27A 2X42A 1SXJB 3GLHA 1QKRA 4EAAA 7REQB 4C5CA 1R0LA 3FXHA 4W5TA 2W8BA 3K5IA 3MB8A 2GB4A 3NHZA 3VOTA 4CI0B 4DQKA 3THWA 4JC5A 4R3UC 2CDNA 2EOAA 3F8TA 3IEIA 1F3LA 3T3DA 1HRKA 5K0SA 4BLOA 2X6RA 2YC4C 3KHSA 4RFLA 4UEQA 5ALNA 2ANBA 4M7WA 3ZQYA 1PFUA 1HE2A 2B3DA 3DE8A 1GR1A 2H9YA 3ZWDA 3EFOA 2DBRA 4ND1A 1NVDA 5JZSA 4RXUA 2ZI6A 3HKBA 3IDZA 4GKBA 4OXYA 2JVJA 2JH9A 2CFRA 3CF4A 4F2WA 4HBZA 4DY4A 5FKJA 2G5GX 4HCJA 2IXGA 1T5HX 1JHMA 3H6HA 1T6BY 2AZMA 2IZ7A 3RC8A 3TE7A 2H5EA 2BBOA 1E5VA 1EQAA 1YA7O 1CXZA 3C8ZA 1MB3A 2CYAA 2RGNA 2XGOA 2AJLI 1NPDA 1ZMBA 2R00C 2YC2C 1AKQA 2ZB2A 3HEAA 4LYYA 4JC4A 4NMLA 4J91A 4K28A 3FVVA 4HAIA 3E35A 1E4VA 1ZICA 4ZO6A 3LX8A 3Q2OA 3FROA 5FPYA 5GJWC 3KTAA 1NI4A 3RVBA 1ZHTA 1EFDN 3UAXA 3UUGA 3GT3A 3WIVA 4DB4A 2UKDA 2DB4A 1UJ5A 1EUDA 3ENWA 4BLQA 2XMBA 1QDLB 5GINE 3A1TA 2ZUEA 2JCBA 5F5NA 2X1HA 5JCOC 1U1EA 2V6BA 2M64A 3WC4A 1DRWA 1M1XB 4GX1A 2QS9A 4ZQEA 2C7PA 1CE8B 4IW3B 2PH5A 4UFNA 3PUXA 2WA2A 1VMDA 4F84A 1M7GA 1E9DA 3BXZA 4FIZA 3OPNA 3I04A 5HZGA 4OGLA 4DF3A 2JH3A 1M6WA 1M2VA 1SKAA 2ZAMA 4LVOA 4MRVA 3BIFA 1QG4A 2E18A 3R6TA 5K8CA 4E22A 1F06A 1SA0B 2QL6A 3UMMA 3ZWXA 5DK6A 2MT9A 3ZCTA 4ETNA 1E3JA 3V3TA 5IUJC 1C1YA 4LJ7A 1F5SA 2HPHA 1MOPA 4CTKA 2GK3A 3AGQA 3K73O 1K5PA 4PHFA 3L8JA 1ZUWA 2Y77A 1SOWA 1TR2A 4TYMA 3TMYA 2D3TA 4US0R 4BN4A 3G5AA 2UZ1B 1GZVA 3AWIA 5LD2B 1YB2A 4J90A 3JZDA 3LLVA 4YT5A 2XLBA 4PG4A 1LLUA 2H2AA 1IPFA 3JQDA 3KOOA 1NGSA 2HIMA 3HZOA 1C41A 4BB9A 1TVCA 3BHMA 4I8DA 1OZFA 1JLKA 4YGXB 3HDHA 4D26A 4G2NA 3E03A 1KSJA 1TM3E 3IDSA 3MWEB 4II3A 3WGLA 2RAFA 3S9OA 2GTHA 1DEKA 5JNVA 4B3RB 3ZCVA 2ZJYA 3Q9UA 5T3TA 1H0SA 3PEFA 4LSWA 3WB0A 4YX9A 2O8CB 1FDWA 1AZSC 5J4LA 4Z7JA 4KSBA 2K7FA 1DEOA 2H5JA 3UGTA 1DKRA 1XDDA 2BV3A 2ECKA