3A9CA

Crystal structure of ribose-1,5-bisphosphate isomerase from thermococcus kodakaraensis kod1 in complex with ribulose-1,5-bisphosphate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
320
structure length
319
Chain Sequence
VVKEVLEIAEKIKNMEIRGAGKIARSAAYALQLQAEKSKATNVDEFWKEMKQAAKILFETRPTAVSLPNALRYVMHRGKIAYSSGADLEQLRFVIINAAKEFIHNSEKALERIGEFGAKRIEDGDVIMTHHSKAAISVMKTAWEQGKDIKVIVTETRPKWQGKITAKELASYGIPVIYVVDSAARHYMKMTDKVVMGADSITVNGAVINKIGTALIALTAKEHRVWTMIAAETYKFHPETMLGQLVEIEMRDPTEVIPEDELKTWPKNIEVWNPAFDVTPPEYVDVIITERGIIPPYAAIDILREEFGWALKYTEPWED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B, delta subunit
publication title Dynamic, ligand-dependent conformational change triggers reaction of ribose-1,5-bisphosphate isomerase from Thermococcus kodakarensis KOD1
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Isomerase
total genus 106
structure length 319
sequence length 320
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.3.1.29: Ribose 1,5-bisphosphate isomerase.
pdb deposition date 2009-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.420 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) translation initiation factor eif-2b, domain 1 3a9cA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3a9cA02
4ZEOA 1T9KA 3A9CA 2YRFA 3ECSA 1T5OA 2A0UA 4LDRA 3VM6A 4ZEMA 4LDQA 5DBOA 3A11A 2YVKA 1VB5A 1W2WB
chains in the Genus database with same CATH superfamily
5TGTA 4JJKA 1HSOA 3B1FA 4WZAB 1OAOA 4K9OA 3MF4A 1E5DA 4G1FA 3TJ6A 3JSEO 4K6CA 2E18A 4X85A 4PO3X 5C7YA 3TINA 1D1TA 3PNSA 2CVHA 4CQMA 1KI7A 2C58A 2DTXA 1ONSA 3P7MA 4MUGA 2XMCA 4IWBA 4OHVA 5C7LO 3GRKA 1LI4A 2BEJA 1KEKA 4YO8A 1O2DA 4NZZA 4MQEA 1BCRB 3GCDA 3R74A 1GG5A 1CYDA 3RGWS 3A4VA 1D5CA 4LHVA 2BTOA 3V1YA 1XYGA 1XFDA 3QKRA 2P6MA 1V39A 4ZAZA 1ND6A 4HXYA 1ZRSA 1CLUA 1HNZB 2OQVA 4YCLA 3BFKA 2WJIA 3SGLA 1XX6A 3C85A 4JTAB 1VCOA 4WEOA 5C4IA 1SKYE 1JQDA 2YVAA 2ADFA 1JZSA 1LXCA 1NPYA 2LZ0A 3NQ41 2HHCA 4EG4A 3CLRC 2ACEA 3LKDA 2J4CA 3WY9A 2VJLA 4J91A 3BSSA 3VNUA 3I5XA 4AROA 4EB6B 3GFTA 1M74A 3DBOB 3C7TA 1IXYA 2XZTA 4YXWA 4AY3A 1I5EA 2AD5A 3FHOA 1NT4A 2W22A 4NZOA 1O5TA 4BNNA 3GM3A 1QCYA 3H2KA 4P6VF 5A06A 1H66A 3DULA 3E9ZA 1MVNA 4OHOA 1HLFA 4UOZA 2QUHA 2VATA 3BX1A 5D3MB 5F7ZA 5ELMA 4RD2A 5BOSA 5F33A 1DC7A 2Z58A 4M1QA 1ZW2A 1RWBA 3LA8A 1WX1A 4CCAA 1GTZA 5WRFA 1QYCA 2FETA 4Q7MB 2PR7A 1Z6XA 3FNQA 3OFKA 3RBZA 2GXUA 2JIZA 1YQXA 3EQ9A 2DFKB 4GOKA 5YASA 5TNXA 1RYEA 3RCBA 1CCWA 5D00A 3KZVA 4J7CA 4PAMA 2R6AA 3A9VA 3HP1A 2Y66A 4H6PA 1MNEA 3TFWA 1QQAA 2R2GA 4C4OA 1NXWA 4FQ8A 1GCIA 3AETA 3PNPA 2D5LA 1RWKA 1ZUHA 3C3EA 5AO9A 1M34A 2IDMA 4N5MA 3VU1A 4MRSA 1CFZA 4RM2A 4ND8B 4XWKA 2P3LA 3M5PA 4V03A 3LCVB 5EN4A 4QDKA 1OPRA 1XZEA 2COKA 1R6UA 1WZUA 5DB4A 5JMWA 2GA0A 2ST1A 4RMHA 3OU7A 1WDWB 5K05A 3R0ZA 5C8XA 5H9VA 4GMXA 3VAAA 5T4FA 1RI1A 2UZIR 4YT8A 2Q28A 3E8SA 3R0VA 4UFOA 4XA8A 4UM7A 1V8DA 4UASA 1X7YA 1XO1A 3L8DA 3D4NA 3VKFA 4MW8A 1LDMA 1AGXA 2G70A 1UBSB 4KXMA 3TWOA 2H92A 4Y2HA 1T1IA 4BO9A 3PQ8A 2F1HA 4FN5A 1D2MA 3QPWA 2J9FB 3A4LA 1YA9A 2EG9A 2QRQA 4YRFA 4EJ6A 3UC5A 3U7QA 3BDIA 3W1WA 2NSJA 2FE1A 1JQJC 4UU8A 4RZ2A 4HFRA 2JLYA 1ULZA 2PSFA 3KZNA 5GOTA 2PXHA 4Y30A 3K2IA 4R32A 2GD1O 4D9KA 1NBME 1YWGO 3K0FA 1WHTA 1U1DA 2ZEJA 3D7MA 2X5XA 2EINC 1R0YA 3L8IA 2J3QA 4IH9A 3DCNA 4R2IA 4FQ7A 2WY2D 3H9CA 2YZGA 5JCOC 4LJ9A 1HOXA 3C43A 3X1KA 2PUDA 1IEXA 1X87A 2ZT5A 1XN1A 4B4KA 1JR3A 5CXSA 3OFJA 2HSGA 1AUPA 3FYUA 1AQYA 4IQ4A 1VLHA 4FCTA 2CLEB 3KXLA 3RK1A 3A7EA 1WN0A 4YRGA 3EXG1 2EJCA 4LDNA 3UUFA 1TZJA 3PX2A 4ENQA 3ESRA 4DN6A 2FRXA 2WVQA 3GB9A 1TCUA 4GM4A 5G4LA 3V4VB 3K1TA 1HMOA 2QQ0A 3OEHA 3L7YA 4ZVOA 3KLBA 3H2BA 1N0WA 5I8ZA 3S6JA 1YTUA 4FKBA 4MB6A 3RADC 1HE1C 4QM6A 2A5DA 3LNRA 2UKDA 1JH9A 5DK6A 3D59A 2JIQA 2QT9A 4ZDIA 1PTJA 3H75A 5BURA 2WKRA 3EN0A 1NNLA 2ZI3A 1P75A 1QGZA 1UBJS 2FR8C 3KKNA 3ZCQA 4V3CA 4Q9DA 1U6KA 5A3RA 1ZH4A 4LXXA 3HM2A 1DQYA 2VDVE 4DRYA 2RAVA 1PT9A 5FF9A 2B2NA 1N5OX 1AKEA 1JQLB 5AKGA 4LHXA 3GJRA 1WMDA 3B9PA 3PITA 3QVVA 4ZTBA 4OFWA 4XFJA 1QX4A 2LCHA 5HGJA 3SS9X 3Q9LA 3FOBA 1LSJA 3S68A 4GXTA 5FYQA 5F64A 3FGNA 1NE7A 1V6SA 3T0FA 2XUDA 3NEYA 2DCUA 1G2OA 2BFFB 4HK4A 5C37A 2I5PO 4E7PA 3LW8A 3UK0A 5HA5A 2XLWA 3Q5DA 3ZY6A 2FDCA 1XVVA 2ZBVA 1YKGA 3K35A 1DQPA 1F0PA 1MW9X 2YMQA 4MP6A 3FUUA 4F2HA 2E4AA 1GGJA 1EFHA 3PR3A 3BXFA 3VHLB 1FNCA 1WKBA 3I61A 1GR1A 5DVZA 4XB6B 2VO1A 3ZXSA 2BISA 4PVCA 2I66A 4BLOA 3DQZA 3PEEA 2MSWA 5AD1A 3ZU5A 4LSMA 3DZDA 1K98A 3DKAA 3I2HA 2J6IA 1RXQA 2B21A 4GMHA 4HDKA 5IHXA 3K1JA 1N5LA 2IY8A 4AP6A 2OKCA 1X9HA 3TLAA 3RPEA 4FILA 1Z63A 2ZDGA 4EUEA 5TVKA 2FCRA 3GLSA 3UUGA 1P60A 3LMKA 4L73A 1NKVA 3AEXA 1KJ8A 3MWEA 1FC0A 4IDCA 4A9AA 4QG7A 2BKEA 2TRSB 5C8YF 2XSZD 3IC5A 1HYQA 4GZLA 1ZQ9A 1IBSA 4LV5B 1TWHA 2CHQA 4GUAA 3AF1A 1VPWA 4WADA 3CKKA 2ADOA 2JCSA 1W46A 4AQDA 2RD9A 2BFOA 5LIPA 4L9AA 5E8RA 1E60A 5DGHA 1HFJA 4J2TA 2H2AA 1I51A 1EFRD 3C45A 4DXAA 4U3JA 1BZYA 3JTEA 2BZSA 1RCPA 1OLOA 4J76A 5GIPE 2YWHA 1D6NA 1DUIA 4MH0R 4LBVA 3O6VA 4XWWA 4FW8A 4E5SA 4REQA 4CDNA 2F67A 2QV7A 4GPBA 1UANA 2WIKA 2KX7A 1A8SA 3ACBA 3KJQA 4QYSA 3RNLA 4A4AA 2CK3D 2CKMA 3EFHA 2O20A 2EX0A 2AVNA 4QBHA 4F8EA 3EWIA 2AOTB 2HT1A 1OWMA 2YDXA 1PR1A 2R7VA 2QPAA 3VMFA 4CCYA 2OZPA 3ZV5A 1ETUA 2BUCA 4MCIA 3QSYA 3VNQA 2UUAB 4LAFA 5BWNA 1I4YA 2O9JA 1IUOA 2G88A 1G16A 1EXDA 5IKOA 4YAKA 5MF6A 5FUWA 1MFPA 1S3SA 3JSXA 1S3IA 2XLOA 1VYVA 4ZVPA 1T10A 4DMLA 2OESA 4HGZA 3WK6A 4IUYA 1RWXA 2N9UA 3RFVA 1ZGZA 4N0PA 2OJQA 3HGQA 3D7SA 2CCYA 1T2AA 1ZD3A 1O96A 4D7AA 2JFZA 1TLFA 3MS4A 3MGKA 1UEXC 3GEEA 3HCDA 1LIHA 4E7ZA 3DHYA 3ZEIA 1ZOLA 4P5EA 1YRAA 3W8RA 1KF0A 3MGCA 2EDAA 1T8TA 1E2PA 4E46A 4O02B 5A2QA 3MFYA 1ZYRF 3WS7A 2C2OA 1QYXA 4HLUC 5DX1A 2XB2A 3M1IA 3I1JA 5A5VA 4CIPA 1O8BA 4R83A 4C0SA 5FUXA 3NEPX 3R9IA 2WTUA 2PAFA 3OLWA 2FFQA 3FGPA 4YR7A 4FPXA 2DBZA 3TUIC 5H4GA 3ENZA 1E8NA 4BJ5C 3FOOA 3RT9A 3PEYA 4KIWA 1BDJA 4AJIA 2HRZA 1G6Q1 3GXOA 2M64A 1JHPA 2MMCA 3TX2A 5TS2A 1I2BA 3RVJA 2XECA 3EVDA 1KKMA 3CF0A 4EEXA 3F73A 5DF1A 1PS0A 2BL2A 3GAAA 3Q9NA 1L4GA 4KPYA 4Q4CA 3UNGC 3TLMA 4XD7D 1WW3A 3PHJA 2CMKA 3VNRA 1AZLA 1VG1A 2R7WA 2IIBA 3IPRA 2CLSA 2DGDA 1UK7A 1W4BA 3C3XA 1ZZGA 2XD4A 4QGGA 2XUHA 3QKTA 1D6JA 2XIQA 3NC0C 3WWZA 3KELA 2LPMA 3HY3A 3UZUA 3TQTA 3GYBA 1XRSB 2FLKA 3U0CA 3C2QA 3RSHA 5DHAA 4GE0A 4JLBA 1D8AA 1GYQA 2HZBA 1IM5A 3CUVA 5FEMA 3L7NA 1VIDA 2XSEA 5FOWA 2AZDA 3SXUB 1ZRNA 5AVWA 3TK0A 2F1OA 4EPYA 3MNFA 3KJGA 2A78A 4HGRA 5KKCA 3B6IA 3LVBA 1AVOB 2WJJA 5DMXA 1YXMA 4D26A 5BRJA 4PIMA 4DBVO 2C2KA 4P36A 3W5HA 4G8DA 4CLRA 4ONSA 1G2IA 2XT6A 2DKOA 5A1JA 2OXTA 5K3SA 2XVXA 1WUHS 3EDRA 4QDOA 4HGPA 2O2XA 4IRUB 4CV3A 4JUIA 1WPXA 2JVKA 1VL2A 2NTNA 4B7XA 4CKBB 4U02A 3DTTA 1MMGA 3WLMA 1UKBA 4IGFA 1L7NA 1Z6GA 4P22A 4KODA 1YZGA 3R4CA 1QHHA 5K0SA 5ISMA 1R0BA 2C5BA 3G8BA 4HRXA 2R7NA 1AVTA 4ARCA 3ZUPA 4D74A 3L02A 3L8ZA 4F4FA 4WXYB 3BQNB 4BLVA 1W44A 3K5IA 2JFHA 5AW3A 2C99A 2JGNA 5IN4A 3FTNA 2NYUA 4KPEC 5FA5A 4G3XA 3KVNA 1N7JA 2FVXA 3M2TA 1ENZA 3VVLA 2C4VA 3AEQA 4OIMA 3RBVA 1REQA 2B30A 2YX1A 2FXVA 3QWFA 1NSFA 2CE2X 1FDIA 1CEEA 2QRUA 5IJ9B 2Z5VA 3LPAA 4EH1A 4WXPA 2WD7A 1IQRA 5HYVA 3KSMA 3LVFO 3SHTA 2VSQA 1G64A 3V6MA 2JLRA 1KS9A 3K09A 4F5YA 4L4ZA 2CXQA 2OY0A 4JI7B 1I3NA 4ZEWA 3V1TC 2WF9A 1NN3A 3MS2A 4LSGA 2R65A 5ALYA 3JD4A 1Z34A 1XF9A 4V2UA 5FTJA 4M1KA 1L5VA 3ZZ1A 1I94B 3DAFA 3H5TA 4UFPA 2PKXA 4MYTA 1Q11A 1VDMA 4JNKA 2OV8A 1O6CA 4KLCA 1UFVA 5J9FA 4BE4A 3AC0A 1XNQB 3NTQA 1Q3TA 5C46F 2VLBA 3ESYA 3L6BA 1UFKA 2R5NA 1AC5A 1YRLA 4UBNA 3OZDA 2OGZA 4ZC1A 2NXCA 1VTMP 4UE6A 4NMHA 4MYCA 4CM8B 4G5HA 1E2BA 1WQ1R 2ZTMA 5TVGA 2V7BA 3OX3A 4M0UA 1E94E 1P80A 1CPRA 2IU3A 1LLCA 1I9CA 1Y4UA 4TMZA 3E53A 5T4HA 3L9WA 1DJQA 2P7IA 1KMHA 2PA0A 3KKPA 3PUHA 5EP2A 3ECAA 2AQ8A 3W3AA 1ZYUA 5T8KC 4LDAA 4AMUA 3VKHA 2AX4A 1JECA 2BCGY 4QELA 2J07A 3DC2A 5L0FA 5CM9C 4DRIB 3UGOA 4R84A 1SKUA 3ZCTA 2ZQYA 4JC7A 5D3QA 5LPNA 3PEFA 5BVHB 2QLFA 2FFAA 3DS8A 4M0LA 3D2CA 3F6PA 3Q3VA 5KUTA 3PI7A 3LX6A 3ZTZA 2DZDA 2RCYA 1A5TA 4AG6A 4BV2A 3V4PB 1EK6A 3BWBA 4KQXA 4CTJA 3RWMB 2QGZA 4JLJA 1LRJA 3CB2A 4KRFA 3EG9B 2W2LA 4OK6A 1AMUA 3ROXA 1ZMRA 4BMYA 1BS1A 3IMKA 3OE7D 3V80A 2BV3A 1LH0A 2J9ZB 3HKCB 2KI5A 3AT1A 4MV6A 3KV1A 2G5PA 5KIAA 1SA0A 4HDCA 4QAQA 5FAXA 3UK2A 5JMOA 3G50A 1YOVA 4ILEA 4RANA 3HNRA 3ZNOA 4PPQA 3X2QC 4D92A 3WGZA 1X9IA 1Z56C 3H7AA 3DOCA 3AVTA 3DFIA 1V47A 1YZHA 4K1OA 4NBRA 3WLRA 2DYKA 3L05A 1P9NA 4PLYA 2Q0XA 2O2DA 2Z1DA 4L9WA 1GZ6A 2AEJA 3CH5A 2D13A 2ON6A 4UXJA 1QX3A 2BF4A 4YR9A 1XA4A 3DZGA 4EGJA 2B5OA 5A4AA 4EKDA 1Z4PX 1OAKA 1V4AA 5KOJB 3LX8A 3NBFA 3IHTA 4JCOA 3MINA 4RD9A 2WAXA 3EZFA 2Q4DA 1WCIB 4HDNB 2CJPA 4MKGA 2NGRA 3NGLA 4MMZB 2VQDA 3SOZA 5CNKA 3L6RA 5FHRA 3JVIA 5IM5A 2V6GA 4RXTA 2Q9UA 1WTYA 2ZTHA 2DHEA 3KHTA 4AN0A 5F9HA 2OCCC 1KI4A 3C6YA 5EIFA 1T9DA 2JJQA 4TV8F 4C6TB 1LDBA 2QDKA 5AHOA 1J0XO 5B1AC 4EAAA 4MV4A 2Y3HA 2QL6A 2NIPA 4F92B 1TIKA 2XUGA 1D4ZA 1O94A 1T24A 3NUGA 4KU4A 3GGOA 4E70A 3HACA 4KR3A 4FOSA 2G63A 1RI3A 4YJ2B 4MCAA 3NVDA 1ZEJA 4R6XA 5GQSA 3L8HA 3F98A 2EW1A 3QH4A 1UOPA 5EHNA 4CLXA 1V8PA 2X14A 5FTMA 4G8CA 4RCYA 2QTVB 1EGVB 4YFVA 1XDBA 2FJPA 2YWBA 5BSFA 1P91A 3BHJA 3X3HA 1OXMA 2PX0A 3KB2A 2X7XA 1SY7A 1NVKA 5IBCA 1T8RA 1RLUA 2R7KA 2G83A 1I5RA 4IIGA 3IMEA 3OP1A 2VP5A 4L5YA 3DKKA 4ZTZB 1YL7A 3Q85A 4RU1A 2NSHA 1B1CA 4WIAA 1SCDA 4UBIA 3MBKA 4I4LA 4JVMA 1D0ZA 5MGBA 4C3UA 2VVTA 3ETGA 3GDOA 2EBHX 2IHTA 4YJKA 4RKWA 5MHTA 4LPSA 1FDVA 4BO4A 1Q0RA 4DQKA 2UZ4A 5CRIA 1KQPA 2A86A 3R8CA 3TEJA 4DLRA 1M1NA 3I6YA 4BMOB 1Q0QA 1XVAA 3Q0TA 4C3BA 4Q7CA 1X6VA 3TCXB 3UK6A 3QE2A 5BW8A 4CR8A 3WGJA 2CUZA 1UJBA 4N12A 3EZYA 3H87A 2OQRA 1GPYA 3KEMA 1SHJA 3UQZA 5JZ9A 3WNVA 1R64A 5C18A 5ALXA 1U0LA 1GQFA 2CJWB 3WIVA 3ZDDA 1OIVA 4LRYA 4QDLA 1EUYA 1WCXA 3VJRA 1Z0AA 1W9HA 1K2VN 1U98A 4IWYA 1MB0A 4I08A 1U2DA 1T6UA 3ZDAA 1QVWA 4FINA 3C1TA 4JU9A 4UNIA 3V2GA 2FPLA 1I6WA 3I53A 3HYSA 5B7PA 3H3XA 2PHZA 1JQEA 2Q6LA 1R9NA 1HQDA 4NCXA 4ZI2A 3STWA 5JECA 4D9MA 2YCBA 1MA3A 2IS6A 2OFPA 4R3NA 3NOOA 4I5IA 4LXIA 4C5BA 1N5IA 4R2KA 1C7ZA 1QORA 2BJVA 4YP9A 3EVAA 4K28A 2PKWA 4OHCA 3WBKA 3LHIA 3K6RA 3QBJA 3ETJA 1GAEO 3OJOA 4RPCA 1YKFA 2DQKA 3FMOB 4G85A 3FOFC 3L7OA 2VJDA 2VCEA 1KXJA 2FZ5A 3BICA 3VPCA 3GYGA 3KZOA 4G0UA 2PMEA 5PNTA 3EVBA 5A1TA 2OKUA 3QUBA 5LXTA 5JVDA 1BA3A 5B64A 3NDRA 1DNPA 4MJ3A 2DRIA 3SE7A 1CJVC 2HEIA 5LOVA 1GQAA 4R1OA 3S9OA 2OSVA 2WWRA 2O0HA 4L4RA 1BR4A 2O54A 2IHKA 4AVYA 1NU9C 1IMOA 3I9V1 4HFMA 5LP6A 4JLVA 2HH9A 2XMSA 5CFZA 3IUSA 2WM8A 1Q0FA 2AOUB 4H0CA 4YPFA 2PXXA 4IDBA 1WKCA 1LM3B 4EY5A 3HO8A 3G5UA 4OXKA 3I4UA 3FW1A 3KYCB 1FJXA 5DHTA 3SVLA 3AVUA 2KC3A 2Y9PB 1SQSA 3JPWA 3ZWPA 2QTRA 1PAUA 2GPWA 4RNDB 2ODEA 2RHMA 4UHKA 1PFGA 1UMDA 5EMLA 4RLFA 2PPLA 1EHYA 3K8OE 5SY6A 3FH0A 4A03A 3B6EA 4ZLCA 3KTDA 5HPYB 1K6XA 3TE6A 5FWXB 2WUDA 4JLMA 1Z0UA 1DOWA 5E8JA 1J1ZA 1TT5A 4NWIA 4TYWA 3CVJA 5AHKA 3WICA 4AS2A 2W93A 5EHGA 3A70A 1LNQA 5DTQA 1N7IA 1L5NA 5EIHA 3TI7A 4YQZA 1DE0A 1Y5RA 2JAHA 4K81B 2FN7A 3PHF2 1QB8A 1AZWA 2CXHA 1LE4A 4F2WA 2YKZA 4PYMA 2HTFA 4AJPA 2ZSFA 5HVNA 4ZHQF 1OFHA 4JD5A 4DQXA 3BXPA 1RC0A 3CIFA 2I6QA 4QQFA 4U7PB 4D4LA 4DMRA 1YS9A 1CBUA 4EVSA 2K7FA 4Z54A 2Z83A 2PZ8A 1GG8A 1ULAA 4Y2SA 3WI7A 1EWYA 1W8DA 1XCPA 1RPNA 5G1PA 1NLZA 2GBGA 3S40A 1TCVA 2PSJA 3WK5A 3KQQA 3JY6A 1EDBA 5CB4F 2IPNA 3MC1A 2ENUA 3E9CA 4OV6B 5EMMA 1PEKE 1FAPB 4BIIA 1EFLA 2QMUA 4B40A 3TUZC 3U17A 1U28A 4W5QA 1GNLA 2IEAA 4FYPA 2Z8XA 4IGAA 4WKCA 1QANA 2H9AA 3IOCA 5F5XA 1QGAA 4F85A 4IFTA 1Q0UA 3T95A 5KSYA 3ZWIA 5TX7A 2ECOA 3FZEA 2WD9A 3GVIA 1HT1E 2RGBA 3LDUA 3EWSA 2ZRPA 1E77A 4AKEA 4HNAA 1I9GA 4F6RB 3CPSA 1Q21A 3JQ7A 1RWNA 1DU4A 3HO1A 1YVUA 4I0WB 1JHDA 1MOPA 1XZQA 3H5AA 3ZLVA 2QJOA 2KBFA 4NX2A 4U2FA 4JVSA 2G9RA 1NBOA 4IMPA 1YS7A 2DU8A 4KWIA 5ALUA 1QV6A 3WG9A 1GFIA 4RFSB 2FW7A 2G09A 4D42A 1JEQA 4C29A 5J43A 3OPNA 3ZY5A 3FE2A 3T3NA 2C5AA 4GLOA 2A9JA 2R25B 1FF9A 5GJCA 2VZLA 2JFBA 5D3KA 3A26A 4ZJYA 3DLAA 1OY1A 5F35A 3STYA 3WIEA 1A2BA 3RKOF 4WGGA 2CNDA 5I7VA 3NHWA 1FP1D 1I4EB 3UT5B 2W2TA 4YK7A 5TJ9A 4CV2A 4JITA 4ZV4A 2IXOA 4A2NB 5KTYA 3RYIB 2W6CX 5KWJA 1QYDA 3GLVA 3T34A 3RQGA 1YB5A 5GY7A 2RK4A 1E9BA 3THWB 5A0TA 2NZJA 4DCPA 2E6KA 1XDZA 3VNBA 2GK4A 1RQLA 5A5DA 3GGPA 4FD2A 3BRSA 3U3BA 1NZDA 4FGSA 4YBRA 1XFAA 2MYPA 4HRVA 1VHDA 5IABA 5BYJA 3JWEA 3WLPA 1A98A 2V6IA 3NHBA 2OO5A 3A6DA 5AUQA 3FPBA 1T35A 4CW7A 3AERB 2HFIA 2RKOA 3LC2O 2VOEA 3QEBZ 3ZZMA 3Q5EA 3WB9A 2A1TR 2V8OA 3IXMA 4LTMA 3E9MA 3ZTYA 5JROA 4DWOA 3IDOA 2C98A 1ZK3A 1N8NA 3OQIA 2CXNA 3C39A 4HAYA 3JD3A 3OICA 3DPIA 3SJUA 3SHWA 4FFWA 1B8VA 3Q3HA 2C61A 3T0GA 1ETHA 2J9XB 1Z35A 3B89A 1Y7IA 1U80A 4NAUA 2BEKA 4IHJF 4BPRA 1OZ0A 1HY3A 4GZMA 1P6XA 2JATA 2Z2JA 1QO9A 3X1OA 3S2YA 4D8VA 3HBFA 1P0IA 1I10A 3HBJA 1XRRA 2HD4A 4JSTA 1KPGA 1HNXB 5DTJA 3UV3A 3RTBA 1XQXA 2HZ7A 5KHOC 1UCFA 3AQ4A 2FB9A 3N0VA 2Q5LA 2YL3A 1WZCA 3A2NA 5B55A 2XGMA 3P4XA 1U1FA 4MQLA 1KRXA 4OY3A 1WDKA 1EX6A 2AXQA 1S02A 3QVSA 4ALIA 1BXGA 5TPWB 5K4GA 1PSDA 3AM4A 1U5CA 3DOOA 4ZEVA 4XVQA 5CXXA 1RLIA 2YCLA 2IPOA 1UZUA 3RS8A 4YPVA 4EJFA 1A2QA 3C6BA 1HDOA 3WRYA 2BMFA 1UC8A 2ZQ5A 5GGYA 2NPIA 3Q10A 3IQEA 3WKDA 2B69A 1YVRA 2HF9A 1QS0B 2XS8A 3GEBA 3GBVA 2PZGA 5IFLA 2GS9A 4F7WA 4GE3A 3W6OA 4CFSA 1T3LA 1FZTA 3VGJA 5CIYA 1F6DA 1GYPA 3QPUA 4IG9A 3E3LA 2EERA 4PINA 3JYLA 3EMBA 3DL7A 3KKEA 4X62B 4QUBA 4JI6B 4LERA 2CHVA 2C8JA 4ENPA 5T3TA 3OD5A 5JXIA 3KSBC 1M76A 1MH9A 2Q6OA 5ILGA 3KTAB 1CY6A 4RBNA 1DTWB 3UPTA 1SR8A 4C4PA 4TSFA 2WJGA 3R5FA 3MLAA 3GLGA 5BRAA 3ZBQA 1L9XA 2UZ1B 3U16A 4XWOA 1P2BA 1FMWA 3MFQA 3HBLA 4EHKA 3WSWA 1QNFA 5DBEX 3R5JA 4BQNA 3R7NA 2BEVB 2XTZA 2D5RB 3N87A 5TLSA 2YKGA 1NQUA 1DAIA 1XXLA 4GOOD 4LOLA 3KEQA 5FPKA 3RARA 4JQYA 3VJKA 2CLIB 2P2SA 2BFAA 1KAMA 4HNSA 2Y67A 1X9GA 2WSMA 5A5FA 5KYYA 4BUCA 4G84A 4WY5A 2Q3DA 3EE6A 4QOGA 1UBEA 3OHSX 5HQTA 3FAJA 3HCFA 1SIWA 3H2SA 2NUPA 1V25A 1KOFA 1XWWA 4DREA 4GP7A 2EKPA 5B53A 3G7UA 3LGSA 4E5PA 3N05A 4XM1A 1T2VA 2NSDA 3LY8A 2Y1CA 5L3VA 2G4LA 1LZKA 4WXRA 1IXZA 4E5NA 4RVFA 4XLZA 4EUNA 1RAIA 1YAJA 2EZTA 1S5PA 3VC2A 5HZKA 3PC3A 1Q12A 2WQZA 3B38A 3ZHBA 4FM9A 1UBOS 3HA3A 1IULA 3JCUQ 3N5KA 4EFKA 1EFPB 4BN5A 4Z49A 2I22A 2PTHA 2HSJA 4BHTA 5KNLA 4LCJA 1ODTC 3B2QA 1KKLA 2OLKA 4R1TA 1Q92A 2HJSA 1RAAA 1QIJA 2J3JA 1CZLA 3A6KA 4QJ5A 1TAGA 3PD0A 1PNRA 2YWEA 2YWXA 1QH0A 3RV3A 3SYNA 2B2XA 4CTOA 4DFDA 4EHDA 1R4NA 4ZT2A 3X1XA 2IH4A 2CBGA 3VVBA 2LD4A 3DM9B 5L3RA 2CDQA 3P2YA 5BUZA 4PYNA 3JQ8A 4KQMA 6Q21A 3W9SA 1C1YA 1Z8DA 3W04A 5BV8A 3IBCA 1SB9A 5JJBA 3M4YA 1UPFA 5DLDA 4KYUA 2OVBA 3SX2A 5JJCA 4UCQA 3T7IA 1E4EB 1AS0A 5FOTA 4NTFA 1X8KA 3F5SA 4Y3UA 2QJTA 2CT8A 3LQ1A 2ACWA 2MT9A 4O4JB 2B8WA 3AB8A 2OCYC 2GSWA 3T4UA 1ESCA 1KARA 2PZLA 3NRJA 4WLVA 2WU3A 3BXZA 3BGDA 1RJ9A 1MO3A 1X7XA 1QGUA 2JD1A 3CNOA 4F3RA 5C34B 1OYYA 2NTVA 2MINA 3AFMA 3D8UA 1DJLA 3VU3A 3CLUD 3NYJA 2ZIVB 1Z62A 2PL3A 1AQJA 5JD4A 4DM4A 2WPDA 4OF4A 3AG4C 2J8ZA 3NKVA 3CVXA 4TZKA 1ISFA 2BI4A 2HI0A 4KAXA 4BAUA 3U7RA 4UUOA 3N0WA 5FA6A 4C0BA 4ZAYA 1C17M 1Z5VA 4W7HA 3UFXA 4YGYA 3IOBA 4GLJA 2BGWA 4EITA 3T5MA 1DOVA 3T5GA 2YIDA 3JALB 5BWMA 5EJGA 3A9CA 4TXHA 4X60A 1Z08A 5ELXA 1KTVA 3HLYA 4LGYA 1UP4A 3A6JA 4IEIA 2VSYA 4NARA 3FWNA 4XVCA 5LBTA 4PBRA 1ZRMA 1GGQA 2PZJA 3IDFA 2ICWG 3VKUA 3D4IA 3QIAA 1UMCA 2JGMA 2QTBA 4EI9A 2GD6A 1HE9A 1JUDA 2GCPA 1KQFA 3OCXA 1KGDA 3AG2C 2O3TA 1EWVA 3B7WA 2VDLB 2VSXA 4N48A 3QXJA 3R3XA 3E7PA 1OXKA 1XZNA 1OXUA 4CMKA 3ONVA 1ZI6A 4CF4A 3EGVA 3IOEA 3IBFA 2GERA 1IDN1 2ZXWC 5DRTA 2X0FA 4PC3A 2Q3FA 1ZD2P 5DIFA 1VSQA 1F7VA 3BCSA 1GZ5A 4HB4A 3WFIA 3K8QA 3BB3A 1KIFA 4IQ0A 3QFFA 3QU4A 2D2VA 3H0KA 3VR5H 4UUMA 3R77A 3WLTA 5CA1B 1ABBA 4O2BB 2ZSJA 2QQFA 3WK7A 3NH6A 3VZBA 1JV2B 4FE4A 3M7IA 4HLQB 2O7SA 1IM8A 2D5BA 4AF8A 4C6HA 4QE3A 3AFNA 1Z0FA 4MRVA 3LL7A 1PHPA 3BM5A 3UANA 2VBFA 2QF7A 5TV2A 2E85A 5JTUA 4RFVA 1Y3IA 3VO8A 1NZJA 2P6VA 3U9JA 3QK7A 1J0AA 3KVRA 4G41A 4NYMR 5DNAA 2N42A 3WO1A 4DT1A 2X58A 2A9RA 4G9GA 3QOWA 1T6NA 1S8NA 1ZGHA 4YHBA 1GSAA 3RNOA 2QLBA 1N0UA 4GD3Q 2R7QA 4CF6A 1UKVY 1LX6A 2CZQA 4MWDA 1GRNA 1AKQA 5DVWA 3T1YB 5JYBA 2IM8A 4PIVA 3M6AA 4Q12A 2JBWA 3T5PA 4EG8A 4RJ2A 5SYNA 1XGKA 1VLQA 4DABA 2P9YA 1PQYA 1B00A 1U3GA 3RC7A 3IT3A 1G6KA 4B3SB 4GX1A 5BR4A 1MU0A 1TMKA 4JR0A 3L1VA 1PYOA 2ZBPA 2B7BA 1QF9A 2I3ZA 3WODF 4BGVA 3VKGA 4CMBA 1X94A 2R68A 3LH5A 2GARA 4KQIA 3T8YA 2OBMA 4MPPA 3SQMA 3FDIA 1KZ7B 3N76A 2H08A 4NBKA 3G0IA 1Q1QA 2WM9B 3EZ6A 4R0NA 1R6DA 1LK0A 2PS9A 1L5MA 3DOIA 1YIOA 1IONA 3D6JA 1TZCA 1KU2A 3FLAA 5J23A 1NUAA 4I3FA 5TMBA 4U6SA 4A0QA 4DS3A 2PGIA 1BS9A 3ENKA 3FTDA 1HNWB 2EZ8A 3T3GA 3Q9UA 2UYOA 4P84A 4Q3BA 2OB2A 1MQ9A 3TW8A 1XEFA 1EGHA 4B4UA 1T13A 4ULWA 3KWMA 2B0JA 1G21A 3NV9A 1YB2A 2CHFA 1GTVA 4OXYA 4QPCA 3H3JA 5A69A 4TXLA 3BL6A 1WQ4A 3WA7A 4PX3A 4NABA 2H8AA 3H5OA 4AG3A 3KQTA 2D1YA 4FFPA 1VPVA 3K0KA 2V74B 4IX9A 1T25A 1WD7A 2GEUA 1JWLA 4PLHA 4GSYA 1HYHA 3L7CA 1KI1A 2I54A 4TMWA 2OPHA 1RACA 1CXZA 1E5TA 5LA6A 3ZJ5A 1QU3A 5KCMA 4RPIA 3EXIB 1TM3E 4UTXA 3AR6A 2A9QA 4Y6RA 4O2AF 1MPXA 1C03A 4YN0B 4I66A 1KSJA 1A5SB 2VP6A 3CEPB 3X1WA 4KQ6A 3DMPA 5AKEA 1H2EA 4WDQA 2QSJA 4A8TA 3QUCA 1PUJA 3DWGA 4KFCA 2YV2A 3T7JA 1SBTA 4FW9A 1WB9A 2OUIA 5H0IA 3QEMA 4J49A 1QOQB 3MVEA 1TM1E 1E0DA 1P2SA 1Z8HA 9ABPA 3JR7A 3ROEA 3WDLA 1FNNA 3E84A 4PTLA 3GUUA 4S1VA 3OJEA 2PKEA 4D9FA 2JCXA 3GQBA 4JXXA 3W78A 1FE8A 3RVLA 1KC1A 4CEHB 5CX1B 3U2MA 3FXHA 2X8JB 2FPXA 4KSCA 2GN4A 3CLUC 3AB3A 1NMZA 2PNFA 3NNDA 4LQDA 4HO1X 4H4CA 2FUKA 3CVYA 1NZFA 4H59A 1PEYA 4BY9E 3JYOA 3BMQB 4TZ0A 2PRKA 1O95D 3ULKA 4WN9A 3RC3A 1N3BA 4F4UA 3JQCA 2DUMA 1NXQA 2GHIA 3FYCA 3QVTA 5JY1A 2QNRA 1VJCA 3BJEA 2C3MA 4GRIA 3NVKI 1DC5A 4F86A 4AZVA 3WSVA 2AW5A 4P0QB 1WP9A 2VRNA 4UARA 4RJIA 3ZWVA 3QSGA 3H2JA 4PZCA 1I7LA 4H27A 3V1UA 2H4HA 1AGYA 1N0IA 3TXXA 3ILSA 4EGSA 4HNUA 2DULA 4WNYA 5DNDA 3LG2A 3SQOA 3PQDA 4ZQBA 1FB5A 1W48A 2E5FA 1SCQA 2AFIA 3VA7A 2JDIA 4H6VA 1ZD5A 5SY4A 3GLQA 1ZVZA 1Y3HA 2RKBA 2ZCUA 1I4LD 3AY7A 3P4UA 1M1UA 4RHXA 3GJ0A 4I44A 1PR3A 4HWPA 3SYLA 2GAJA 4AZ3B 1H69A 2VCAA 2EPKX 2P9JA 1JLKA 2ZUUA 3MBGA 4BJ3A 1BNCA 3TTYA 4QSHA 5JLAA 2JBHA 3C8DA 1NX9A 3VU9B 4YUZA 3AUKA 2M1ZA 2PYDA 4C0AC 5G2OA 2CLCX 4CRWB 1SFRA 5JRZA 4JR1A 4WXMA 4HYTA 1ZUWA 3PJRA 3HCAA 3GP5A 4PYIA 3TAHA 3HY4A 2V7QA 1YZLA 1EUCA 2ZCJA 3QV2A 1Y81A 2VSNA 3EASA 3HYCA 1MDFA 3LNCA 5LKAA 2NVWA 5HWSA 3ABQB 2JFWA 1K89A 3D4LA 2XWPA 1DQZA 5B3JA 3SLKA 2PEZA 4H60A 5HXAA 4Q9NA 2ZPAA 4X91A 5K3AA 4OAQA 4NYJR 4IS3A 4QDUA 2I4OA 5BRNA 4IS2A 2CLFB 3WYEA 4R8MA 4ITVA 1CDZA 1VI5A 4X90A 2JFGA 4MI1A 4K03A 5HIMA 1NP3A 2ZYHA 1RQNA 2HFJA 5ERYA 1MQVA 1EE9A 2UXCB 1R5BA 2YL2A 3PX7A 1NLYA 2PA3A 5L40A 2GN2A 3TRKA 4IXTA 3KQHA 3DB2A 4KH0A 4RGBA 2CLOB 1YZTA 3B8EA 5KKAA 4QTZA 2I71A 2HPZA 3D6FA 5JD5A 5I9NA 4FFBB 3RW0A 1Z4QA 1ZESA 2DQSA 4XYMA 3DZHA 3R4VA 2F00A 3D4PA 1IN1A 3PQ6A 4M8SA 2X1VA 5AW8A 1KPHA 3IVGA 4GRDA 1JQ5A 1R4MA 3LM8A 2CDBA 4N76A 5HF5A 1KYVA 1ZJ6A 1FTYA 5BPFA 4OUDB 3SQLA 5C3MA 3G3EA 4M0MA 4L95C 5AVKA 1TKCA 4LYYA 2IYXA 2BJHA 3IOYA 4XGNA 2L6HA 3KKBA 4C0QC 4IJUA 2JL1A 2FAPB 1LPAB 3B1XA 4EQZA 4XPZA 3H11B 3GRAA 3PYXA 1EPUA 2HWYA 2ZJ1A 3TTXA 3SYKA 1ZJ4A 4R9UC 3U56A 1XDSA 5CDYA 3ZIUA 2ZUFA 3KUDA 1E84A 3F49S 3AGTA 1CIPA 4MOWA 1T6XA 2CCGA 5CG2A 1VE7A 3AKYA 1JKJA 5GPBA 4MVWA 4A27A 2OKGA 3BILA 1F0NA 1H05A 3GJYA 3IRUA 4KSYA 4R9RA 3OIYA 2OPBA 5LWQA 2OAQ1 1RPJA 2Z5GA 4OX9Y 2XXAB 5CVDA 5E9WA 5IJ0A 5K6TA 2YINC 4FFVA 3NBAA 4EELA 1Z7EA 1QQ5A 3P2MA 3ZKWA 1YR7A 3ZQ4A 2H9YA 4WHMA 4GOND 5F23A 4JQCA 1TJYA 4MEAA 1GFZA 5AESA 3D1JA 3PC4A 1FP6A 1RC1A 3FUCA 5A4JA 4M2LA 5AKIA 4GR5A 2ZI6A 3ABOB 4BKOA 4L7VA 4WASA 5DCYA 3NBMA 1IN7A 1FU4A 4QU5A 4ZOCA 1Z2CA 2OC9A 1FK8A 3M3PA 4P4TA 3H1FA 3F9RA 1JVSA 4IDQA 2IHBA 2Z08A 3W2FA 1II8A 1FYDA 1L7OA 1LI5A 3GEIA 2BKLA 2W6PA 4EW2A 3W7VA 3OEYA 2YQ4A 5IF3A 3Q6NA 1E83A 2C00A 1QK5A 2ANCA 3SHFA 3K9QO 3OZGA 5IXYA 3F47A 1SXQA 2XCRB 3K0AB 1Q6ZA 4HRAA 4YJFB 2PVPA 2W6OA 4MV8A 4E1AA 2X13A 1R37A 4FDAA 4S2EA 3JCZA 2Q8NA 5L4SA 1VIYA 1EE2A 3BTSA 5JPIA 3C0KA 4UBMA 1R27A 1KDOA 1PWYE 4D4KA 1ORRA 1VLLA 1KVUA 4QA9A 1S2IA 2DG2A 3U26A 2QD3A 4WOPA 1JLSA 1BH6A 5H9WA 1B73A 2HK9A 4C87A 5JZOA 3H84A 3BMNB 4YVFA 1Q20A 1YCFA 2YYSA 2J0WA 3VR5A 2DUUA 1IE3A 3V2IA 2O0KA 3UHPA 2VPZA 3K5PA 3J81A 3IV9A 2C9YA 1KK1A 5FWYA 1C8LA 4C6SA 2QJWA 4PRKA 4BPBA 4LTNA 4URFA 1WHSA 2KMLA 5FL7A 3B8HA 5CPFA 3WWCA 4CKXA 4RKRA 4JBXA 1HRDA 1UP7A 3DVQX 4FDLA 1T43A 2ZKLA 1QFXA 4L8VA 1DXQA 3AUYA 3OX2A 5C8YA 4UVHA 2PL9A 3AIMA 2O1EA 3SSMA 1P2UA 2TYSB 4G5OA 2R97A 5CEEA 2WDZA 2QJFA 3VYTB 1FXWF 2XWQA 3ZDLA 1GRQA 4NV3A 1HR0B 3GHHA 3BIOA 4X20B 1P1CA 2FHSA 2IX3A 2UVPA 1EX1A 2DP4E 1NG9A 2ZXUA 1QPBA 2II6A 1L4NA 4ZCQA 1WUTA 1WY7A 3TQFA 3T7CA 5BSKA 1PP4A 5HIJA 4WKOA 2ASEA 2O07A 3N2ZB 1UH5A 4QUJA 3P9NA 1S89A 1D0YA 4KVGA 5BORA 4CEJA 3G2OA 4DAOA 3SKYA 4P32A 2Z95A 1OR2A 4URVR 3GDFA 1RJFA 5J1SB 1USWA 3ANNA 4AX8A 4NULA 2EEZA 1RM3A 4KCGA 3LZ6A 4L28A 2CHEA 4QQKA 3C5CA 4JT2A 4Z4FA 2NQ2C 2R5WA 3LBFA 3GH3A 4FSXA 3R7AA 2WZFA 4TTTS 1TVCA 4HSGA 4JHLA 2Z4TA 2FEWB 3C7JA 1CHDA 4M49A 4LMBA 4OU5A 3N07A 1K04A 4OIRF 2XCQA 3VR3D 4AJ2A 1UWKA 2QW1A 2IJGX 1NV8A 4Y2GA 3U4HA 5EE9A 1NQWA 2J5BA 3WRXA 2BSQA 3UGTA 3O0DA 3IT0A 1UT8A 4JX8A 4X1OA 4YUXA 4DBLC 1UDCA 4NJEB 3P9KA 3K6BA 4BLUA 5TARA 3MFNA 1ZWKA 3RGGA 1TYBE 1B8OA 3RSCA 2X5OA 2GYVA 2M32A 4CKCB 3N74A 4JI0B 1POWA 1BWPA 4MIEA 3D0RA 3GAMA 4W1QA 3NAZA 4B45A 2JLVA 1EAMA 1YFZA 2RGDA 1V35A 3UGJA 5E4FA 2HSZA 3E35A 5KQMA 3F5QA 2MSNA 4TXJA 5J4HA 1TU4A 5BNZA 4Z1OA 3R7FA 3Q8MA 3VZRA 4YMWA 1V8BA 1XMQB 1XMPA 5BN5B 4MHSA 2V4ZA 1IQPA 2QU7A 1BROA 3T61A 2YYAA 3NVMB 1D0XA 1X42A 4YJDA 3FCCA 1UIRA 5BNWA 4DPLA 4Z6KA 1FYXA 4UDVA 2A1TS 3E7XA 2E5WA 1H2RS 3AGUA 4I50B 4FT4A 3BC1A 1O0CA 1JFRA 4R51A 2ZYSA 1LFDB 2P9QA 4P6IC 2ZUBA 2LDBA 1TF7A 1WXEA 4B9AA 2I34A 2AMJA 1GJRA 4ZI7B 1RAFA 1K4YA 4LXQA 4HUTA 3WQBA 1WBJB 2VJOA 3DO6A 2X4IA 3K71B 4CKEB 3LJBA 4EECA 3A2LA 1YULA 1PIWA 1J1UA 4U2BA 1ADGA 3OPYA 1T0PA 4D4MA 4CQLA 5LYJB 3QLUA 1E3DA 1KDYA 1JG2A 3ZV6A 4CM3A 3LUBA 4BU0A 1A1SA 2EILC 4ETIA 3Q7LA 4Q7QA 1EEHA 4U6QA 1RXYA 3R9WA 3I34X 2RHTA 4R9SA 3DLTA 1WL8A 2ZZMA 1EM8B 3O83A 3BD6A 3OTWA 5HKOA 5EKTA 1TU0A 3IUQA 4TUYF 4PG8A 4M1EA 3LT2A 1C9YA 3D8BA 4FMCB 1WMAA 3GAZA 1KDPA 1ZH0A 5CXUA 3ZIDA 4Q48A 1COZA 5J47A 2BFEB 4TS1A 1R12A 3BULA 3RKSA 2L7AA 1VI2A 4K5QA 1N2CE 3Q3IA 2QAGB 1XC7A 2ILTA 5IG2A 3HVJA 4B3DA 2H1CA 5AKZA 4E3ZA 4Y9RA 3LP5A 3QLVC 3KOZA 5C5IA 1ZVVA 3FOPA 2MU1A 3B9RA 4D3ZA 1N78A 3TVDA 1SHUX 3BB4A 5BVGA 1U7ZA 6GPBA 1BVYF 2VXCA 5KX5B 4DBRA 4H3HB 4J30B 4JOSA 5D5QA 1L5FA 1AS3A 3G68A 2A9VA 3DDCA 5HKAA 5UKDA 2DX7A 3MELA 4WAUA 5EEHA 1U8XX 1RBZA 5I48A 3EPVA 2IBTA 3PDIA 1K08A 1Y42X 5FI0B 2XLCA 3COPA 2VZ9A 4DV2B 3HBAA 1W19A 2XVZA 4ZYLA 1P72A 4MVJG 4NBNA 2QR2A 3ZI0A 5KMGB 3M79A 4BZZA 4WJLA 4CLOB 2IUEA 1NVTA 2REQA 5ERGB 3W1EA 2EFCB 1ZONA 1T1RA 5C5DA 4ZKEA 4FB5A 4R4JA 1GCGA 1SXJB 1XDWA 2WB4A 4BVFA 1IUKA 4YV0A 4CLDA 3RRMA 4NI5A 1Z0ZA 1UXIA 2QN9A 2GYYA 3WHNA 3IUBA 3FI0A 1A1VA 4G1BA 3QVGA 3RSQA 2GO1A 4Y1EA 1KJ9A 2JGDA 3R7WA 1X92A 2POQX 1F06A 2VQFB 4GW3A 1SIBE 1SPBS 1OX4A 4Z9HA 3D7RA 3EF1A 2P2NA 4ZZ3A 1RZVA 4PCVA 1O57A 3Q15C 2AN5A 1HTWA 2JHPA 4AWAA 4I1SA 1KI6A 4HH0A 1EUDB 1JI3A 1D0VA 4RY9A 4KN5A 4P08A 4POOA 3HWRA 4HAIA 2I62A 1KSFX 2PL1A 1PWXA 4DUZB 1XTBA 3DDNA 3FZYA 4EI7A 2NXEA 3I12A 3PEVA 1TU3A 2I8LA 1Z18A 3TZEA 3ASYA 4HEJA 3O4VA 4OYHA 1ZVJA 2OORC 3QUSA 3GK3A 2WU1A 1P4SA 3L49A 4HXEB 1T0UA 1JKIA 2KPOA 3HB0A 2BGJA 2J0UA 2D1SA 4A1OA 2M4EA 1Y7TA 3M6LA 3ZKAA 2Y93A 2GAIA 4C5AA 1YR6A 4R1QA 5GZ3A 1W7AA 3IEIA 2BKXA 4W9NC 4FMBB 3Q8KA 3G1TA 3N75A 4DQVA 4UD6A 1P73A 4W63A 4RTJA 3HEMA 1E32A 3F6SA 1NBMA 3DCYA 3T06B 2P3SA 4AE4B 3ITEA 1QWOA 3OAAA 4D3SA 5C32A 5J5AA 2AVKA 3RVNA 1HTBA 1XZFA 4M8KA 1XEWX 2PEYA 4S1OA 1Y8QB 3GROA 4N6NA 4NBTA 3WB0A 3AF4A 3P2OA 2OBFA 4PQFA 1V5IA 4LNUA 4WINA 2DKNA 3AIIA 4EJSA 2KSFA 3SQWA 3DLHA 2W6JD 3FWYA 2PBLA 4C3OB 4ZVRA 2JVIA 5JNVA 4IFEA 1VHJA 2XZPA 1PYDA 2BC5A 1CQJA 5BQGA 3NYRA 3MMSA 5KJ1A 1ZI9A 1GPUA 4I3HA 2H3HA 1MX1A 1ZSNA 4U7FA 3ELDA 4YJ3B 5DYYA 1Z6PA 3AP3A 2YOHA 3CONA 1V4BA 4FDVA 1Q0DA 4WZBE 4MWZA 1OBHA 5FI3A 2ZUEA 2BHRA 2ZITA 1WZIA 1VJRA 4LIPD 3T3HA 3WAKA 4ESHA 4RH3A 1I7NA 1PZEA 2C88A 2IYLD 4TV8A 3DMFA 2W98A 4TWAA 2WP0A 4L5IA 3VC7A 2A6PA 1M8GA 3WYAA 3KBBA 3FAPB 2JJ1D 1PBTA 6REQB 4PCLA 1ISPA 2GESA 3K8YA 3NP9A 3EGXB 1Q17A 1NA5A 2O3QA 4ZQHA 4CPDA 2WHRA 4YEDA 3UKJA 1OB2A 1P0PA 2Q6IA 3L79A 5CYPA 3O5AA 3K7DA 1II0A 3EXFB 1MQSA 4CEIB 1U5BB 1TK3A 1QO7A 1Y9ZA 2FEKA 1JPVA 2ATVA 1J42A 2JJYA 1OHHD 5E3JA 2ZRBA 7ABPA 4KVFA 4ALMA 4ER0A 2FPIB 1BKSB 2JGJA 4OO3A 5FPHA 4K7BA 2HLHA 3PGMA 5FORA 3ABIA 3KL2A 3BMXA 1P5HA 4GXNA 1SD2A 1SG9A 4EPWA 4YMTA 4N6GA 4O4LB 3BE5A 1R0CA 4ATNA 4Q6BA 3DBHB 5E3IA 3LUGA 1UEJA 2LP4Y 4F1KA 1U8CB 2DB4A 5LQKA 3ZSUA 5AQ1A 4ETNA 2L69A 2C8KA 2ID8A 2A35A 2Q07A 3DKVA 2PGXA 1GU0A 2PGJA 3ZE9A 3DE7X 4XJTA 3G2HA 2EPMX 4PQYA 2GZ3A 1R5JA 3KEFA 3TLBA 1BAPA 3ZQYA 2FX3A 3L7LA 5EZSA 1IUNA 4Y9TA 1KFJB 2CUKA 3W5JA 1W4LA 4R7GA 8ABPA 3D4OA 3AXSA 1LPMA 1JH8A 3STTA 4JB8A 5ESWA 3B36A 1QZXA 1HWYA 1H1LB 3C3PA 1QTNA 4Z4GA 4KQ9A 4BN0A 4KW7A 5EJ8A 4ND4A 2XVAA 3E61A 1M2FA 3ZVNA 1YD7A 5EWJA 1H23A 2IXEA 3BSFA 1U2TA 1YJ5A 5HGXA 5HJ5A 4Q37A 4XIIA 5ER9A 3UMVA 3R9XB 1H6AA 3NCTA 1RHKA 3MPOA 3T9CA 2H2HA 2SKDA 5EIOA 3Q87B 4DCOA 3VR6D 2ZIGA 4FS8A 5IJAA 5IVIA 3ZHUA 1I2MA 3M70A 1ITZA 5LVAA 3CN7A 2GLUA 3GC6A 5LBIA 4FZ5A 2SKEA 2ZOSA 3AUSA 4OXQA 3INNA 4BFSA 3EK2A 5KPJA 3V1NA 4OMCA 1PJZA 4LHWA 4CG1A 1XPJA 3S1AA 4GWLA 2XY4A 4Q4AA 3BTVA 3ICEA 1XT6A 5JAQA 2CNOA 2BE7A 1N2SA 1ZNXA 1MPTA 3NNSA 3G59A 5CM2Z 2FX5A 4LJ7A 1RSZA 1SVNA 1JG6A 4QYXA 3UPDA 4DM7A 3B7PA 4H0NA 1FLVA 3LLKA 3A14A 4MW7A 2OZVA 4NOJA 2B6NA 3QFCA 3PSHA 2HTEA 4UHBA 4RQTA 1EHCA 3DT9A 4D6XA 2JBAA 3LCJA 3MRTA 5TQ2A 4TYNA 3FROA 1EKYA 4QPPA 2PWAA 4O08A 1NSYA 2DOKA 2VHQA 1A8QA 4FXPA 4QJ3A 3PT5A 5EJ4A 4JLSA 1P4JA 3CUSA 3ZGOA 3LP6A 3PQ2A 2DYRC 2FW0A 5F2EA 5JDCA 2P5UA 3RC9A 3JS5A 4U2DA 2FWRA 3PKJA 1FUYB 5DWQA 5DXAA 5GV7A 421PA 4ILKA 3HK2A 2OD2A 5I7RA 1S7GA 2QUBA 1QFSA 1PR4A 4L78A 1VIMA 3TAXA 1OW8A 4S1PA 4XIJA 2HV6A 1NOKA 4ZHQA 4WA7A 2FWIA 4URYR 2IH5A 2FFRA 5BQ3A 4E18A 1Z82A 1ECCA 2XCOA 5DS4A 3NCHA 4ZLDA 4I4IA 1W1IA 1S96A 1ZD9A 2XL4A 3A2KA 3IVAA 3D8HA 1UKCA 2Q46A 2CUTA 3I8OA 3DVAB 4RDHA 2KLBA 2PG3A 1W0KD 1EXWA 2VP0A 2O2EA 3K1AB 3KB1A 2RJOA 4R54A 3LZCA 4YT5A 5EIXA 2CVOA 2R0QC 4B2LA 2AJCA 3PWTA 3DFZA 1U8UA 5CB4A 2XQJA 4Z3KA 4XQCA 1X2BA 1O58A 4RMJA 5DSTA 2VSFA 4HAUA 4I1OA 1A7VA 4BRUA 5H5JA 3CZ4A 2C54A 1HE4A 5J4VA 2WWWA 3OLYA 5L3QA 3L7KA 4D4IA 3E2IA 2PYZA 4WQMA 1MJHA 5IZ4A 1CPQA 3W5SA 5KB3A 4LXTA 4G1VA 7GPBA 3GEMA 3G2QA 1VKNA 1BKYA 4RD6A 3TNLA 1FMTA 4ER3A 2DKFA 4O5AA 1BVHA 4MUYA 1DHTA 2QG6A 3KJEA 5DBOA 3I5AA 1O0BA 3ONEA 4HEQA 2G3VA 4O8CA 4BNHA 3K6SB 3DB1A 4LLEA 1BE1A 1B2RA 5GGXA 2XOXA 4QUHA 4MDHA 3IHUA 1CQXA 1PJ2A 1KORA 1ZSVA 4EHPA 2XVMA 1EK2A 3QHAA 2OAGA 2Y4OA 5BQFA 1N8KA 1QLHA 1YJ8A 5I9LA 1Z16A 5ESDA 3BEOA 3OE1A 2VZEA 1GGHA 4KE8A 5GADl 3TBHA 3L5OA 1MZVA 2BRUA 3BH0A 3IAEA 4B6FA 4KPGA 1XJWA 4KRXA 2YN4A 1T9CA 4X7RA 1FLNA 2GPSA 2X1LA 4WJKB 5LQCA 2H1LA 4F60A 3L8CA 1JHOA 1SJ9A 3KYJA 2VZ8A 2P4HX 3TMYA 3NB0A 4ASUA 4KHPB 1QRSA 5EXTA 3HKKA 4FFLA 2ATEA 3W8HA 3ZDFA 4L6CA 4ZP1A 1V2GA 2HREA 1BGWA 3CJTA 5B58C 3OCCA 1EZZA 4NICA 2QVCA 4M8LA 2D0PB 5FWNA 4JB3A 1YS1X 4KR7A 5IJXA 1D8TA 5B1SA 3BIFA 4NENB 3QKWA 3CUYA 4HAVA 3P8ZA 2R85A 1NVBA 1RWPA 4L0MA 1C8KA 3N0XA 4HQNA 4BJHB 1T1GA 2JASA 4IMIB 1ONOA 5GONF 2B98A 1II9A 3EYWA 5LWHA 3HABA 1QUEA 2YY7A 4CM4B 4JK3A 1DCMA 4W5RA 1W1UA 3IP5A 1CJBA 2WAAA 1V5GA 3PQ4A 4EDHA 3OU6A 3R3SA 3ZWYA 1JFVA 1GD1O 3QITA 3NC4A 5CH3A 1ZN7A 1GZ4A 4X64B 4ZT3A 4O4IB 3W4YA 2ZR0A 2WHQA 1WRBA 4HN4B 2G7ZA 2DBRA 3JZ0A 3DMYA 3PE4A 1ZWLA 4R98A 3KU1A 3WHLA 2QA5A 2FUG1 5J58A 4DQLA 3AV3A 3Q2KA 3AUFA 4FYYA 3HKEA 2AH5A 1INLA 5IAJA 1GCOA 5BN4A 4B3BA 2YQ5A 3OLXA 3AI7A 1YJBA 1E9CA 4OIPF 3P2JA 2BSXA 4XX0A 4N4WA 5H80A 2QTFA 4UE2A 4YB8A 3IQGX 1CUCA 5CYOA 3V55A 4MR9A 4L2IA 5CLLA 2ZBUA 4MTOA 3ILYA 5JCPA 4IHJA 4BO1A 2WC1A 3PJDA 5JD3A 3IAAA 1G5QA 3PCTA 3KR9A 4Z51A 3ER8A 3VM6A 2W6QA 5CGZA 2PWPA 4BFXA 3TXAA 4MVRA 2NU6A 4E11A 3LLMA 4ES6A 3LU1A 4RACA 4WMLA 1Z7GA 2J5XA 3U19A 1QG0A 4P9FA 3KG2A 2R03A 2EATA 2Z09A 2FA9A 3TQRA 2IOFK 5B6JA 1RLMA 1K97A 3UT6A 2QP4A 3FFWA 4FOLA 1O9HA 2NO6A 1JDVA 3NWOA 2H1WA 2H8KA 5HBGA 5ED0A 4E7SA 1CGOA 1VMIA 4WVFA 1F3OA 1Z88A 1NXXA 4MQMA 1VKRA 4QU9A 1Q7BA 5ITZA 4MIKA 1H1TA 3W2WA 2YZ7A 4G0OA 3SJCA 2QX9A 3LX5A 3NYWA 4RZXA 3UATA 2NZVG 2ZXOA 1SU8A 3GX1A 1QHEA 5EKDA 3E03A 1EVZA 3GBSA 4KR2A 3BRWD 3QVJA 3L4SO 1J25A 3VNAA 4UTZA 4WZ6A 1JJFA 3U44A 1YZNA 2PQMA 1U6JA 4BZQA 4B2IA 3WWDA 3EPKA 1Q95A 4BDTA 4A8HA 1YVDA 1T9KA 4B6QA 3NMKA 2FQWA 4WGZA 5AJWA 4QEDA 1THGA 2CFCA 1E2GA 2K87A 3W05A 3NT2A 4CM1A 1K40A 1K9SA 3PDUA 5FH9A 2Z3ZA 3I9V6 4L75A 1C8VB 5EGNA 4EG5A 3LF2A 3T3EA 4WESB 3ZW7A 4RHTA 4E07A 3MTJA 1JOGA 2POCA 4B43A 4AUNA 4UD2A 3E15A 1M6VB 1PLLA 2EFHB 4EHIA 3NRCA 3T0IA 5DNUA 4Q1DA 1EU1A 3IMFA 3MCVA 1W85A 3P1JA 3MSXA 3E3OA 4PO8A 3NGXA 3N3BC 2M6SA 1LS4A 1UXHA 3LFTA 5AIBA 3RWBA 3CCCA 3C8GA 4WH0A 4PFOA 3W3ZB 2BBSA 1KEEB 1EB9A 3H4TA 3LP8A 1GNVA 3EVTA 3KPHA 3P9QA 2HJMA 1J0BA 1JQBA 3SYTA 5CFRA 4I5FA 1LEHA 4OXRA 2OXFA 4EIWA 1LBEA 2VP4A 2WF7A 2X6RA 2FPKA 1RJGA 1BE0A 3KB8A 2A0BA 1EGAA 2HMWA 4F5DA 4OP3A 3A9WA 1KBZA 3TIXB 5DTEA 2CXTA 2FAXA 4F97A 3AF3A 2O6HA 1BCSB 3G9QA 2FJ0A 3Q9SA 4YY3B 2SKCA 4S04A 1VYHA 4H16A 1N6LA 4TTRA 5JUWA 3KHUA 1KJZA 3KOUA 1XELA 3IEXA 4MR7B 3BE4A 3BHNA 2EXXA 2CE7A 3URKA 1EKXA 4F2GA 2H2DA 2B1IA 1M8JA 1Z15A 5A9RA 1UDRA 5EIEA 1C0IA 4IJJA 2GF9A 3AI3A 1N6RA 3I9MA 1DOZA 1CULC 2X5JO 1O6BA 1E3EA 2H07A 3ESDA 3S2FA 1TFRA 4B7CA 1YUNA 1QZTA 1KI8A 3NI2A 1NKSA 4GOMD 1G7SA 3H83A 2G0TA 4DQDA 1BHSA 4G0VA 3O75A 2KQ9A 3RYLA 3ZCPA 3FMIA 4R8KA 3E3MA 4IYRA 4HWKA 4I36A 4Q4ZF 3U37A 3STUA 5AM3A 4AI6A 4OMUA 3QXXA 5JC8A 2G04A 3U09A 2ODNA 2I7DA 4NFYA 1KPIA 1MIOA 4R16A 2I2AA 3KUCA 4EI8A 1QG6A 4E6PA 1XTIA 1M72A 2AFRA 4WKBA 3MN1A 3MYYA 3INYA 2Q62A 2WJHA 3QU9A 5HRCA 2CYCA 5DNCA 3E9RA 4JLWA 2XCTB 1QCZA 3DAHA 1SKQA 3I28A 3WMGA 1OW7A 3IOMA 4URXR 1KKUA 4C78A 4CTKA 1LLFA 4R1PA 1WAMA 2GXSA 4F38A 3LUFA 1M1XB 3VRCA 2ZIXA 2GAAA 5BSMA 2IYUA 2FZGA 2P0NA 5EQTA 3ZQVA 4BNFA 1IZ0A 4CQMB 3OQPA 1A4IA 3RHZA 1PUXA 3B1VA 5LBUA 3KALA 3ILHA 2FSIA 3VR2D 3OESA 4PJLA 2GBIA 3GT0A 3MTIA 1I5OA 4HAOA 1R88A 3D8TA 4OIFA 3DW3X 3K9WA 1SCIA 1T6YA 4MQEB 2RBEA 2XMDA 3C7KA 5IYZF 2E3JA 5A5EA 2RHRA 1H0KA 1Y3DE 3NDPA 3AQCA 1QK3A 4OOEA 4G7HF 1HO3A 4PEVA 3LUDA 4B46A 4UQPA 3JRXA 1QM5A 3H9BA 5BYBA 2JEOA 4UE3S 4RENA 2JPUA 4Q0MA 4Q7KA 1UL1X 3I62A 1R9MA 1GITA 1RQRA 1L4LA 2RGXA 5A4KA 1JLHA 1W36D 5ALEA 3VDMA 1MP0A 5I7UA 1LVUA 1IBLB 4LYHA 4LK3A 5ES3A 3Q98A 1DRVA 4MUJA 1NUUA 1RPTA 2WDPA 3N2LA 4HXGA 2QZZA 1XYVA 4Q18A 4MKZA 4B3FX 1BGVA 1R4AA 2X9QA 5KTSA 1XPOA 4LKRA 1D4OA 1A9XA 2OBXA 4JXKA 3O2QB 4BFZA 4B83A 4BGUA 3EGCA 2OK7A 2RHOA 2WTNA 1YQQA 3I76A 4P3KA 1KVQA 2JA1A 3LJKA 3ND5A 5DGDA 2UYYA 5I7SA 3MSCA 1BU5A 3OKAA 1P5JA 5B4UA 1SCNE 2ZI9A 1G9SA 4MPDA 1GDDA 4PPFA 3GG2A 2Q2QA 1LKZA 2NZ2A 1TPYA 3G4ZA 2HF8A 1BJTA 4N6OA 4JEAA 2YDYA 2QRLA 1U1GA 2JK0A 1W29A 4WI1A 1GKKA 3L6EA 4XWGA 1ORYA 1YE8A 4HHEA 1JWAB 3RV4A 3AETB 4IVQA 4D56A 1TVKA 1M34B 2A33A 2CNKA 4KB5A 4P9TA 2YZ2A 2ZRIA 4I81A 1R9JA 5T3YA 5FBZA 2F1JA 3PGLA 2LVBA 4HRYA 3AQIA 3GFSA 3F9CA 4LWPA 4WSOA 3RRZA 3KE9A 4AKHA 1G4AE 4ZICA 5CVJA 2B5WA 1ZLYA 3DLIA 5CDTA 1SUIA 1OLSA 2JANA 1MVLA 5JWOA 1X7ZA 3UCXA 2EQ5A 3MXOA 1T36A 2ZE8A 3QXCA 2PD6A 1MW8X 2ZANA 3DE1X 2W9XA 4X8OA 1X7YB 2AI2A 2WUFA 3PNOA 3K33A 4A8JB 3F8TA 1Q77A 1N8TA 5K3OA 4QFMA 7MDHA 3FWKA 4EB0A 1A4UA 2QLLA 3VJLA 2VNHA 2CFTA 4NPHA 4RIGA 1S05A 5CFLA 5B12A 4NR0A 2A4MA 2F43A 3ZJ4A 2QI9F 1L1EA 4CODB 1A2KC 2R8YA 2HAEA 1VFPA 2FN3A 2OWEA 1SQ6A 2NT4A 4V0QA 5DNEA 3D7NA 5JAOA 4P58A 2HNAA 1H4SA 1U0OC 3GJQA 4HFKB 4OQYA 3CC8A 3BD9A 3Q7RA 1V3UA 2OU6A 1W73A 1WHTB 4KKXB 4M21A 2AF4C 5KTNA 2KJQA 5AC4A 3PZRA 5J4YA 8AT1A 4GF5A 5TSDA 3K2EA 4X3CA 3W4JA 5IM4F 1AN9A 3CR7A 2MSLA 2HDOA 2OR3A 2OV1A 4O2AA 4IJVA 1IBRA 1XEXA 4NCKA 3E22B 2P0AA 1GUYA 4DOZA 4JKVA 2IS1A 2FOIA 3HJFA 3GDHA 2FFJA 4PHTA 3JT1A 3FYUB 1C9EA 5B30A 2ZYRA 3EIOA 4KMMA 2PIAA 2UZ3A 4CMCA 2ROQA 3MJDA 1MHPA 3PJGA 2DHRA 5JBIA 3HJRA 3EPPA 3A6HA 1E0SA 1M0TA 2WWXA 4QQ8A 1IWBB 3H5WA 4C7MA 4RD0A 4GI7A 3NTXA 4JC4A 1QGDA 1SKBA 2A0YA 5DXFA 3D81A 4XM0A 5EMKA 2BY4A 4UU0A 3OT5A 2D2EA 3HCBA 1ZM4A 3PIIA 3RVDA 3OECA 2XGGA 3W9YA 5B3KA 3G0HA 5DASA 3K6JA 4J2OA 4K40A 2Z04A 2BEUA 4H7EA 4TL9A 4G5SA 4TRNA 5ARDA 4YUAA 4BOYA 2PZBA 3MWLA 3DCIA 2RSLA 3WXMA 2PT5A 1UK6A 5IANA 1OKKA 2I33A 1X80A 3V3TA 3D3WA 1XDDA 2QL5A 2HMVA 2OBBA 2F2TA 1QR6A 1NBAA 3FKJA 2ZYAA 3R5XA 3OC0A 4FT2A 3WWEA 1KYWA 2WZCA 2QTTA 4NTBA 1SAYA 3UV6A 4X71A 2D5CA 5H70A 1JTFA 4CVNA 4B44A 3AG1C 4HEAJ 4EBBA 4L9SA 4BMCA 4QOEA 1TD9A 3FOCA 1DG3A 5FTLA 2PZMA 3FM9A 2L2QA 4MVCA 4UDOA 2C2MA 2QY6A 1NR5A 4F3YA 1Z2NX 3X1DA 4DSAA 3R7CA 3E23A 3N58A 4HBZA 4R2XA 3DR3A 1BMDA 4U2KA 3O8QA 4HH3C 3QFHA 4PQEA 5G0SA 1KK0A 4GP9A 3HUFA 1ADBA 1CF2O 3V6LA 1XQWA 3EEQA 3R5TA 1I14A 1AGRA 2QNIA 1Y63A 3CVVA 1YUBA 4TXMA 1FX0B 4QDJA 1O95C 4LRQA 1BHJA 2R02A 4JSRA 1VIAA 1C3OB 1Q7GA 4YC7A 3EOBI 1KH2A 2CV0A 4V02A 3H0CA 2AE1A 1D5WA 1AV7A 4OGFA 2J7PD 1Q44A 1W36C 3ETLA 3LUAA 4PSDA 4G5XA 3ANTA 2PU5A 4QUDA 4R41A 3ZHOA 1BX1A 4ARSA 4P3PA 1LZLA 1F9AA 2JEYA 2AC4A 4UVEA 3R7DA 2AI3A 1ZNZA 4LFAB 2PJZA 1T5LA 3MWEB 4NJMA 4U7TB 1HC7A 1XTPA 4GVPA 1YDGA 4PE5B 1VECA 1ECFA 3SC6A 4U1RA 4JQOA 2W2NA 4AD8A 3QF4A 1G20E 3TQIA 2Y8EA 2YVQA 1KU6A 4ENTA 3SJBA 5I01A 4XX1A 4BNTA 5D7NA 4PGHA 4Y7CA 2FWNA 1XLUA 1XCOA 4U3JB 2IRWA 4XWJA 3RAFC 4BEVA 3CMMA 4ZRDA 3TIFA 1XXHE 5LL6P 3N9IA 3Q11A 4WUTA 2OAP1 3TTSA 2RGNC 2PZAA 4DNXA 5SZIA 1WSDA 4REQB 4U9HS 3NPAA 2F22A 2JI4A 4KX3A 1UJMA 3ZNQA 4B84A 4OM7A 1GNSA 1P1RA 4O1HA 3RJ9A 1OTHA 2XQKA 2QP9X 3WDSA 3R9KA 1T9HA 3J06A 4Z5XA 1RAGA 1FYEA 3U49A 2OOSA 4MR8A 1T0BA 1HZZA 3D31A 4U7WA 1GR0A 5JARA 3GMSA 3SJAA 2XL8A 1DTEA 4ND7A 4EY3A 1X19A 5HCNA 5FR1A 3I9OA 1WJGA 4JGIA 2O9XA 4PO9A 2V45A 1EH5A 4CXMA 3EC7A 1AH2A 1Q19A 4C2TA 4ZZ2A 3MBIA 3RF6A 1WCWA 3B29A 2LIVA 1I13A 1TFOB 3R3YA 2P2CA 3SYMA 1WV1A 1V54C 1GVHA 4CS9A 1JDSA 1O96B 3NIWA 4JI5B 4YCJA 4AKTA 3FN4A 3I2GA 3V8NA 2FMFA 4BASA 4JYMA 5FV4A 3BPSA 1EINA 3TW0A 4KV7A 4ER9A 1TPZA 4CMEC 5AKKA 3EMVA 2NADA 2DI3A 1RRMA 2PUJA 3K0BA 4ZHSA 3HXQA 3K4QA 1SU4A 1QQ7A 1ZICA 4J0EA 1HDZA 5K0ZA 3KQMA 1PL8A 1DKMA 2IF2A 3TOZA 2OK8A 3UOAB 4GM0A 4JYAB 1NF2A 2NUAA 4UREA 4D6YA 4CDYA 1BDJB 4A15A 1SC1A 2QS9A 3GJ3A 4MS1A 1SM4A 2YZKA 1YTLA 4CDAA 3O03A 4XRRA 5JG7A 2CDNA 4U5XA 5I7EA 2ODAA 1DOHA 2FG7C 3W8EA 3P9IA 5CT8A 3BS4A 4X63A 4DRZA 1VG0B 2I65A 3V4SA 4ZGBA 3COJA 1YDMA 3O8BA 1NATA 3JQFC 4BO8A 5JCJA 2FMXA 2MYTA 1GQOA 3EUEA 3E2MA 2HXSA 1SULA 5GTDA 1ZIDA 4ZI3A 2ANBA 1RHUA 2KYHA 3UGQA 3NWPA 4DV4B 2P6UA 1DKUA 2YMMA 4FD3A 5JSHA 1F60A 4HL6A 4HBGA 3ADPA 4TTSA 3HDYA 4MO2A 5DEIA 1NLUA 4IOKA 3ICQB 3DWWA 1CUSA 4OHMA 2GK6A 2YIMA 3C7DB 5CFNA 4LF5B 3PLRA 4NMWA 4JYZA 4J0QA 1IPFA 1DBSA 2VHZA 1JIVA 1TW2A 5JS1A 3RVKA 4X7MA 3IQZA 3SVZA 4CLRB 2C3PA 4AJ4A 5KSWB 2V0CA 1OVMA 2OO3A 1K05A 4NBSA 4I6GA 3MWYW 1M6HA 4ZVMA 2OCLA 1J2JA 1J0DA 4KMSA 4O79A 4GKVA 4GRAA 3VFDA 4BVKA 1DKPA 5L3SA 4EB8A 2OILA 3C3CA 2ZRDA 1JILA 2PFDA 2RARA 4HQ6A 1DT5A 4NV0A 2JJ2D 5EHIA 4YCMA 1WVMA 2O19A 3LRPA 4TSKA 2QT1A 2UVDA 1QHHB 1WSWA 3RJZA 5AJYA 5CEJA 2I6TA 2EBWA 1CT9A 5A7FA 3KMIA 3H4MA 5F2OA 4DCUA 1BEEA 1TB4A 4A6EA 1V3TA 3P32A 4HJXA 4AO8A 5C1PA 1NU6A 4CJGA 1E1QA 1S8AA 5L7WA 4ZT6A 3RS0A 3LPNA 1U3VA 3NWEA 1WG8A 4M8NE 2AW3A 2QRVB 2D1QA 2X8LA 2M6LA 3KVYA 1FXWA 1YJAA 1BMFA 1RQ2A 4E6EA 4ZVSA 2A92A 3AEQB 1K8QA 1REQB 2BFWA 4L0DA 3D64A 3SX0A 4NRDA 1QSGA 4IV0A 3AFHA 4Z9IA 3M4BA 4HMPA 1ZIPA 1A0BA 4IX1A 3FETA 4HADA 2HRDA 2IFTA 5DBHX 1RBMA 2TMKA 5MGNA 2E0IA 3GO4A 1C4XA 2WD7B 2V54A 1SUWA 1SUCA 1Q0PA 4OFZA 2G9NA 3NJ8A 1NVDA 2OSBA 2PMDA 3WR5A 4XVRA 1FFBA 4J0CA 4IXWA 1T2CA 4ZAFA 3IE0A 2WLSA 3CW9A 1EK1A 1C9JA 4X45A 1XAHA 4MW4A 2MWMA 3LLIA 4QBFA 4N0QA 4PBSA 3MRXA 3B2EA 2XBMA 2PK3A 2BOVA 3N7TA 1YMQA 4MGEA 5JYDA 3C63A 3HVHA 5TPZA 1PCXA 1E2XA 3C15C 4I6JA 5C35A 1GSOA 1CUZA 2GEVA 3ZR4B 2XYRA 3FOWA 3E82A 1YBVA 2MYUA 3AFGA 3F46A 3HN6A 4CNQA 2OEXA 1JPJA 3HV2A 3N39C 3BAFA 2V1UA 1QONA 3PRJA 4YT2A 3THYA 2GJ4A 4EG0A 1PEAA 2JGIA 1E63A 2HMSA 4S3MA 4KUGA 2HIHA 3WWYA 2HL6A 5NULA 2PBFA 5CVCA 3ML1A 3L4JA 5BV1A 1C7IA 1GA6A 2OHHA 2FRVA 3OOJA 4K1XA 3D3EA 3HY6A 3OP4A 2HU8A 4K6OA 2CXUA 2O8EB 3WOVA 2R6HA 4R31A 4JCCA 2O57A 4DF3A 5EQDA 3OPVA 1C0LA 2Q7DA 1WMFA 5CI8A 3AF6A 1MAHA 4JBWA 1DEOA 1G8AA 2ZB2A 3LY7A 3N8GA 3ROQA 3Q7EA 3EOAI 3HMQA 2JLUA 2PU7A 1U8AA 2IYTA 4HY3A 3CR8A 3EVNA 3HFSA 3IUEA 5K45A 2QX4A 2FZCA 2AG8A 2WKSA 3L04A 2WQ7A 3TZCA 3L82B 4QGBA 5HZHA 4OLHA 1N2EA 4I5GA 1YA6A 1U90A 4GECA 2IPLA 2CYDA 3LBHA 4ZJUA 3CSKA 1L7MA 4XTRA 3LV8A 1QSPA 1YARO 4BKUA 3B70A 3LFHA 4RETA 5T7BA 4L4YA 4R0VA 4AMZA 1R0LA 3ZGYA 4HDSA 2GETA 1G0OA 3F5DA 3O94A 4ZIRA 1GGMA 2P1ZA 1SA0B 2V0GA 1MQAA 2PL5A 1Z17A 1ODIA 2Y1KA 2IOYA 5E7QA 4AM8A 1YOVB 3RQEA 4DBZA 4PZYA 1PQWA 1GNPA 3DL0A 3KZCA 5AVTA 2PUFA 1YFLA 1TECE 2IUSA 3ANMA 1U0JA 1SCJA 4Q4LA 2VQ3A 3U9LA 4OLBA 1U2GC 4CDVA 2JIPA 4EF6A 5FX2A 3VYRB 3BA1A 1O54A 4EO7A 4DV3B 3ROZA 1H94A 1RRGA 1GV0A 5EHHA 2NNLD 4B8YA 3E2PA 1THZA 4C6RA 4YMUA 1MT0A 4NXNB 5K0NA 2Q3MA 3TBFA 3EIXA 4ARUA 4IV5A 1KK2A 3MINB 1AG9A 1WWPA 2DPGA 4TUYA 1SUFA 4ERXA 1JR4A 2XDQB 1TUIA 4XUGB 3RSZA 5DT9A 3K9HA 1QAMA 2Q5FA 3IKMB 1NMYA 3REOA 5KYUA 3EULA 4CKYA 3LYLA 2XUAA 5L0GA 4OHFA 2JFQA 4XIYA 4MW3A 1KVRA 2EKDA 2R6ZA 3YASA 1Q15A 2GYUA 2C4UA 3T4PA 1UMBA 1F48A 2VAMA 4F3NA 4WN3A 2ODPA 1ZN2A 4IJ6A 2D5IA 3R41A 3VPHA 3HRKA 3CE6A 2QMYA 3FVVA 1U1CA 4E2FA 4I1PA 4IM7A 2HO5A 3V9PA 1KO7A 4MQ6A 3DMNA 2X1HA 2I55A 1Y0BA 5A3JA 5K0JA 1YB7A 4FYKA 2JHAA 5IH7A 1ZK2A 2I4RA 4PS0A 2EHJA 4KH1A 4FDUA 4NNOA 3IBGA 3PNQA 2IEIA 1D2CA 4WFJA 1QP8A 3K7EA 1NULA 4V1CI 3MGGA 1PHRA 5FEUA 2NV0A 4TKVB 3CMCO 1M3SA 1PJ3A 4M55A 3A04A 1KE2A 4EKYA 3OFND 2Q3JA 1T0IA 4UQLA 3CBQA 3RFYA 2ONCA 3DEZA 5AJHA 4ZRNA 2OCIA 1A95A 3ZDCA 1UDXA 3WLIA 2ICAA 4RNCA 1UFQA 4YRBA 4DANA 1AKMA 1A8PA 4E7OA 4DPMA 4G5GA 2XA2A 4XLLA 4X8HA 3B53X 1U4OA 4FX5A 2XMZA 1PJTA 4QWWA 3L0PA 3ZHSA 4FI3F 3EDMA 3IP1A 4Y98A 1TM2A 2FVYA 4G6ZA 5GIOE 1M1NB 3ZCUA 3EZ2A 2QTHA 3VHXA 3P2KA 3DAPA 2BZGA 4UEQA 2O52A 3S99A 3R0XA 2JK1A 1BOOA 4EYSA 1GFSA 3UJ8A 3DMTA 2VP2A 3AM3A 5IDXA 2DEUA 3SX4A 2HA5A 4KMRA 3ZN2A 5DW3A 3RLFA 1YK1A 5ICCA 2I2WA 3E8MA 4CL8A 1HM5A 3FFXA 2W37A 1FS6A 4C3EA 4MLZA 4A2QA 2OP1A 3EOZA 4D99A 1NI4A 2NZ8A 1SQ5A 4GI3A 2X2FA 2UYQA 2ZUSA 4QI0A 4YRAA 1CDDA 2PLNA 2WYWA 2D0OB 1KMMA 2VRCA 3E4CA 2Z9CA 4E21A 4KVZA 4QJBA 4PZZA 3JVDA 1L0BA 3JWPA 3HUUA 3IBSA 2F6RA 1D1BA 1RT9A 1XZKA 1QCCA 1JJAA 3FYHA 9LDTA 1ODCA 3D8SA 2D1FA 1YA7O 2JF0A 1KJYA 3O90A 1AUVA 4LF8B 3BK1A 3N5CA 3F5FA 4FQ5A 1HH4A 2IBMA 4E4YA 1O77A 4BWFB 1TKAA 1T4BA 3D0KA 1ESEA 4FOOA 2WIGA 2YVUA 3IQWA 4FSDA 3PNLA 1UKZA 2YV4A 3P27A 5BSGA 2IIVA 3L93A 4QOFA 1HFWA 4RFLA 3LQYA 3WLLA 1V71A 1NNI1 1UXJA 5LXTB 4BRSA 3T3MB 1TCAA 1D4AA 4IKEA 1PL6A 3TNDA 2VCYA 3TI9A 1SZCA 1YFKA 4G0YA 2C82A 2HPHA 5LOVB 2RE8A 1RXIA 1C14A 3OMXA 2FMKA 1Z0KA 3GGCA 3PB3A 3K5HA 3GL9A 3HHPA 4JEBA 1E5VA 2H7OA 1NF8A 2ZS7A 1QMGA 3V4FA 3EQZA 4XTCS 5LP6B 1OASA 3PPWA 2WPNA 1DAPA 1Z7BA 4EABA 3HNLA 1UJNA 1I0ZA 1IN5A 5D8DA 3GLFE 3L2OB 5BV7A 2DH6A 4H7JA 3KKMA 1FQKA 3I6IA 3Q88A 3OKFA 1RM0A 4LDRA 1OFTA 3FUTA 4YYZA 3IDAA 4JJGA 2NVUA 1HEIA 4DJ9A 1MEJA 3DR5A 3OUZA 4C03A 1Z13A 2CKDA 1UMDB 2C2GA 5FBLB 2MYSA 3EMDA 3NTUA 1CLEA 2GZDA 4B76A 3KKKA 4EG1A 3I4CA 1IAQA 4A1FA 1Z39A 5AW4A 5BWCA 4JLAA 1TT5B 5CTAA 1PYGA 5FTNA 2FQXA 3WLNA 2GM9A 5DM70 2XUZA 3AY3A 4NSNA 3QKIA 3U6KA 5JEEA 3KD2A 3LGXA 1YL6A 4NMLA 3UJPA 3VF0A 1U9CA 3ZJUA 3HR7A 2JPDA 1DAOA 2DHDA 4M7WA 4BZWA 3SDZA 3MJTA 4AZWA 1BDHA 3BEDA 5K0LA 3IGFA 3P45A 2WA1A 4DNQA 3GM2A 1KQGA 3A2MA 3MTAA 1UXOA 2HGZA 3KOOA 3JZIA 3NJ4A 1G5TA 4XWAA 2IZ7A 3IQHX 3FKSA 3WMXA 5FBHA 1PO7A 5K0BA 4CWAA 1V8ZA 1ZIXA 4N8EA 3P9SA 4QVGA 1M75A 4JGBA 3T9EA 4I99A 1KTMA 1EDOA 1W0JA 2GHQA 3COZA 4ADSG 3HH8A 4YAOA 4IVPA 3JATA 3ETEA 1CUFA 4IQGA 1Y1LA 1GKUB 4UXIA 2HA7A 3T1HB 1AS2A 4NU0A 3BWYA 2N1BA 4YL0A 3LXMA 3ZTTA 5IC5A 3JYHA 5ALJA 1T2FA 3AR9A 2Y3IA 5U4QA 1SXHA 4JP1A 3DOHA 2P40A 4KAFA 3IEVA 3ELBA 1IZ8A 2W58A 3SDBA 4J2HA 4E03A 3DXYA 5EKXA 3AUUA 1A27A 3KLMX 1CZHA 4CI9A 1PK8A 3QW0A 1ZJZA 2WF6A 1HORA 3JRNA 3IKLA 2WUEA 5DZSA 1EBFA 2D74A 2NAFA 2WHPB 4HNAB 2EQAA 3LO5A 2GRUA 4MB2A 3OG9A 1W30A 5K8LA 3IKJA 1JKMA 3JQ7B 3W5AA 5HFNA 3ZVRA 4UM8B 4OQPA 4ZMSA 1LUAA 4MWCA 1C1HA 5G1OA 3U3OA 3F74A 3OIUA 5AUNB 3S1LA 3FFBA 4J3JA 2GX6A 4XJVA 2Y77A 1KFEB 3KOXA 4JVSB 1KMCA 4N5HX 3CISA 2EEPA 4P4LA 2UV8A 1Z5WA 2I4LA 4IARA 3A3YA 1ORIA 4RLQA 3KETA 5LLDA 1OAAA 1SZDA 5LSAA 3T5CA 4P3NA 4ZU3A 4HGYA 4PSAA 3HZRA 1E20A 1VSTA 1NLXA 3RI3A 3ZWKA 5KU7A 1U94A 3BN3A 3JARA 3RTDA 5A5GA 4L6RA 4JKOA 1KP3A 2UZ0A 3E6AA 1H5UA 1YHZA 2G76A 1R18A 3W2GA 4Y0NA 4KFSA 1H8EA 2AN1A 2GR9A 2WG2A 1KRWA 3HA5A 5KINB 3A28A 3FCYA 3U7GA 2OBYA 1G63A 1EFTA 2D2XA 4YP5A 3AJ8A 1UC9A 2A5YB 1S2LA 1LCIA 1MAWA 3THSA 2C94A 3C14C 4L3VA 1Y4DE 3TEFA 3HL0A 2BWJA 4MROA 2C29D 2QE7D 2PT7A 4XLPF 3P71T 1W6UA 4XD2A 4LJRA 2V7UA 1WASA 1GN8A 1G2QA 2D00A 1E1YA 4PZUA 2OQMA 2C78A 3HCNA 3U4MA 4O1IA 3ZU6A 4OI1A 3MUEA 4N3CA 3FPFA 5A6KA 3WGKA 1IK6A 1ZJWA 5JSKA 1XDUA 3SBDA 1A7JA 3PEWA 3K53A 1SN7A 10MHA 3LK7A 1ZDMA 3UXYA 2V03A 4TVBA 2K2WA 4OBWA 1IYZA 5L0HA 5D92A 5HSWA 1U9YA 1TC1A 1VCMA 4PSUA 3UFBA 3PKIA 1IOVA 4DGQA 1N0VC 4RGYA 5DYIA 4HI0E 5TT1A 4F91B 4D45A 4LJ8A 1FOEB 3N8KA 5B1IA 3PL5A 1P6UA 1PK9A 2VJBA 4IIBA 1MIHA 1TAHA 2GZSA 3GVPA 1QK4A 4R0MA 3GJ4A 4Q34A 4G7ZF 3DT6A 3K9CA 3OY2A 2ZULA 4JVNA 3HNKA 2KK1A 3ZHXA 3EFOA 3FWPA 1YZVA 4RHEA 4A5OA 1GLNA 1WOYA </