3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
b'FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
4BJTA 3K6GA 4BJ6C 3CZ6A 3OWTA 4BJ5C
chains in the Genus database with same CATH superfamily
3OYIA 5B1BH 1X2MA 2IPQX 1D8JA 3IQ6A 2Q2EA 2HU9A 2WB1A 2TRTA 4HNUA 4ZYEA 4JIOA 2E34A 2BGCA 3NMJA 1O3QA 1HQCA 4EWCA 5HSWA 1T98A 3KETA 2F5VA 4PJLA 4XLPF 1I4ZA 2GFHA 3H5AA 4U0WA 4WABA 2ZB9A 2QNLA 3JRMO 2Y0SN 2F22A 1QA6A 2V1UA 3AGTA 2Q7RA 1J5YA 1D8KA 2ZCWA 1RC9A 2FX0A 2XAGA 1ST6A 1VMAA 3FOOA 2FUG2 3FK7A 5DDGA 3HOVJ 5JHFA 4MIMA 2EV5A 4F92B 3L2UA 1VK5A 3FVYA 4IRUA 3ZWIA 2KLOA 2GA0A 4HF2A 2VKEA 5GAGJ 4RM2A 1J75A 2X51A 3MZYA 2XGXA 3WU2C 1IN4A 5FLXZ 2RSEB 1PV3A 2EZLA 2VKHA 5DD8A 3OYKA 5IT9Z 3LNQA 1NFOA 3M9AA 3ZMTA 2CCYA 2GM4A 1A0BA 5EYRA 4GYIA 1HDDC 1QU3A 5EG0B 5BMZA 1M2VA 4IHVA 4EBJA 1XSDA 2LC2A 2X1DA 4JKVA 3F8NA 5BS6A 3TDZC 2XLDA 3TP0A 3TW6A 1LS4A 3ZQGA 3RFYA 4AIJA 3HL2A 2H6BA 2JA2A 5CI8A 2ZXWH 4HEAJ 4XN3A 1FPQA 1EH8A 4D0PA 5JUAA 3HUGB 2E7XA 3R6SA 1HE1A 4CH7A 2EIKH 3HGGA 5IOZA 1FYKA 4I44A 2L81A 3GO5A 1KNYA 2X6OA 2R7RA 3AG4C 3PL8A 4XEVA 2GAUA 3U2RA 2TCTA 2KPMA 5L3DA 1QVTA 4RGUA 2W1OA 4FT8A 4HA8A 1NG7A 1D5YA 4JTDB 5DV5A 2EWNA 2Z3YA 3F6OA 3FISA 2HYJA 2VH3A 4EM1A 4EEFG 4G7ZF 3ZDLA 2L9RA 1ZK8A 1M2VB 4N9HA 3NARA 1DOWA 2EA4A 1ZW2A 2XLWA 4U5EE 2HKOA 2DTZA 4I6ZA 3U2LA 1E83A 3MQ0A 4BEHA 2HTJA 4GGGA 3WTUC 2K9NA 3AQCA 1WJFA 2DPUA 4I02A 1VQLI 1B1BA 2XSJC 4A3CJ 2JA8J 5L3CA 3S1RJ 2CMPA 3OYEA 4MTGA 3BZCA 5M5XJ 2BW3B 3HKZN 4EM2A 1M57C 4B8XA 1DPRA 2M64A 3FXHA 5T1DB 2R7VA 5A6KA 4JRZA 2F4MB 2E2IJ 3UMKA 4JVSA 3GMEA 1RUNA 2MBFA 1ENHA 1Z23A 2OPTA 3H1CA 2DYRC 1HW2A 1TW2A 3NG1A 2W25A 3BTLA 2W7NA 3J7AY 4KITB 4C7OA 2IOQA 3K4BA 3R61A 1N78A 1BC7C 3BG5A 3GEZA 3NAUA 1PP7U 3EHNA 3QPSA 2WL8A 2LK4A 3W2AA 1FNNA 2DT6A 1OKKD 4FTHA 1IGNA 3H2VA 4IO9F 5K7ZA 1AKHB 1BL0A 2JD3A 2IS2A 3TOBA 3NYMA 4IQJA 1BW6A 3KEOA 2Y0SA 4WCGA 2K9MA 2CQKA 5IP7J 3L1PA 3JRFA 4XKVA 4DRHB 4ESBA 4FAPB 2STTA 3JRCA 2RNJA 3CUQA 4MVRA 5D92A 2CUJA 1AUEA 3RI4A 2BVMA 2KYHA 2R7SA 2R0QC 1JRAA 4CDYA 1R1UA 1Y39A 3HGYA 1P4WA 5D8LB 2D1VA 1JPJA 2DPDA 3W6VA 3GTLJ 3KYLA 4EGYA 3EHMA 2KIQA 2XRNA 4PDKA 5E3OA 2MHRA 4C7OB 4XPWA 1T6QA 2DGJA 5AGFA 4JJGA 5FZTA 3FBIB 3S93A 1J8YF 2HVSA 4JTCB 5DLJA 1ZELA 1U8BA 2KT0A 3AFHA 3CMMA 4PSWA 5JVEA 2AXTC 2J5OA 5IOYA 3LUTB 5CVJA 4GEHA 3HSRA 2ESNA 1LS1A 3QPHA 2VONA 2L3DA 1I50J 4NC6A 1ITYA 2ZXJA 3E5QA 2XHKA 4G7OF 1NFNA 3RYPA 3E6BA 4ABZA 2JZYA 1LJ9A 5IYBJ 1GM5A 2HPIA 1T38A 4U5CE 2L01A 5DCMB 2K7LA 2VUMJ 1J8MF 3FXKA 3C2BA 3RSNA 4EQQA 4EATA 2KDZA 4BE0A 4G78A 2K02A 1FTTA 1FP2A 3EQLF 3JRGA 4BJ6A 2AU5A 3G1MA 3K7AJ 1MZBA 2Y30A 3K1PA 1P7JA 4LDKA 4GQHA 2VJ5A 4LFUA 3CO6C 3G2BA 2V9VA 1TT5B 1ZQ3P 4OIQF 4HPQA 2M4KA 4BQNA 4CGZA 1ZZPA 3KEYA 5GTHC 2OZUA 2LY1A 2E60A 4Z6YA 5BQIA 1ZW3A 5JI6A 5DTDA 4FX0A 3LSTA 5E79C 2V1DA 2VT3A 2LH9A 1QKRA 3US6A 5LBQA 4OINF 1L3LA 3HOUJ 4RAFA 2L9VA 1YRNB 4FX5A 1FYMA 5L0FA 4XN0A 5A6BA 2VOPA 2MYSA 2VL8A 3HKZA 5JR3A 1JI8A 3ECOA 2Y75A 1Q0MA 3N4MA 2YSRA 5K5QA 5KYUA 1MSFC 4JCZA 2KK1A 2V1NA 4E70A 1V74B 3V8KA 1ZG1A 4E7SA 3VDXA 4G7HF 3U2MA 1BZ4A 3CTAA 4HDUA 2QM3A 2E7WA 2V6EA 4NQWA 1FC3A 2QKMB 2FJ1A 2WTEA 3L2CA 1ZARA 3V8JA 4Y4RA 3BR5A 3T8TA 1IRZA 1V55H 2EB7A 4MTFA 1GLNA 1HDPA 1QHGA 5TISC 4IOAF 3S90A 4L9VA 5IPAA 1S7ZA 3DWWA 3S9OA 4HW0A 4FHTA 2EPLX 1WGXA 5FKMA 4G0HA 2KW3C 4J7TA 4HSRA 3CP2A 2Z2SB 2LRDA 1APCA 2UXXA 4UV9A 2EPNA 3HRUA 3F8FA 2FEZA 3QP6A 4BBSJ 3A11A 4CS7A 1U5TB 2X6WA 1ETXA 4JCHA 1R1TA 2XASA 5F6FA 3ZVRA 2YU9J 4CJGA 2F2EA 1OLTA 4IAQA 3BZKA 4G6DA 2Z16A 2OOCA 3T4RA 1FWZA 2HOEA 3CD6I 5KYUB 1WWXA 2ME0A 1X1PA 1Z67A 2IS1A 5D91A 1YE9A 2OBPA 1OMIA 5LRSA 3QWLA 4L18B 2ZMEC 3RW0A 2JSPA 2KRHA 2L4MA 1IN5A 3DLLF 2VODA 2J9UA 2K86A 3UKGA 4NQWB 1IAWA 1NK2P 2PX0A 4OIPF 2YKZA 2BZTA 2QGUA 3WGHA 5C4XJ 1V3FA 4Y13A 3RZDJ 1W0TA 3E97A 3GF2A 1IV8A 2VBZA 2MSYA 4IRIA 3ZSUA 4DBQA 4KMUX 5K5OA 4C2TA 1X1BA 4JBAA 2QSHX 3VYUB 3RF3A 2OQGA 2BHZA 2ZXRA 1H9GA 3P9IA 1R4NB 3Q0VA 4YFXF 3FKIJ 5KCMA 3CCRI 4LIUA 2J5PA 1UMQA 3OYFA 1DOVA 3QTHA 1BA5A 2ACJA 3KYIA 5HV9A 4EM0B 2TDXA 3SZGA 2GQQA 4BQOA 3OIQA 3R0JA 3OYNA 4OU0A 2EIMH 2WVOA 1BC8C 1RZ4A 3IHUA 4BHPA 1IRFA 1EH6A 3JAMK 3V5ZA 2VKVA 3WGGA 2GAQA 2M87A 4AVZA 3V7SA 1Z0XA 2KRFA 2XSEA 3KEQA 4PGHA 1XPXA 3T6GB 2CSOA 2XIGA 2CH0A 2IYLD 1S9HA 4ER9A 2JSCA 2QE9A 1TTYA 4CDGA 2QUFA 3BG3A 3A9CA 4CYCA 3ZQCA 4D5FA 4MLOA 3HPHA 4NTAA 1QZYA 4BDYA 3DD7A 2DDAA 2MLGA 1ZHTA 2KFDA 1XCBA 3T1BA 3EFOB 4IHWA 3ERMA 5D5VB 3GODA 2WAFA 1G6NA 3TKYA 4LLGF 2XLVA 1G5ZA 3CF5F 4CCMA 2NSFA 3FHZA 3T6BA 2HXOA 2X48A 2XKOA 3PUBA 1AA7A 3C7JA 2PBIA 4A2UA 4CZCA 1AEPA 1RETA 5ILSA 3FXJA 2K9SA 4J30B 1WGWA 1LVAA 4WGZA 1UFMA 5E17F 2DMTA 4A0YA 5IYDJ 3DP7A 2ZO4A 2HV6A 3G6EI 4YJWA 3VWBA 3OL3A 2O3FA 3KLNA 1P7IA 1E3OC 1PD1A 3MYIA 3SP1A 4BG0A 2XPUA 2PX3A 1CGME 1UB9A 1Z3XA 1R00A 3N97A 1M6TA 3C8GA 4I76A 2LBFB 1YI2I 3C2HA 4XRMA 2A5WA 1WOLA 3DE9A 3HTUA 1ZTRA 3D5RC 2G7HA 3EUHC 4I1MA 4R79A 1ZKGA 4MGRA 2AWYA 5AC5A 4MW8A 3EUKL 1J59A 3GLXA 1H89C 3FMQA 4GYGA 5L3FA 2FMLA 4LIVA 3GFJA 3BG7A 1R49A 2V6CA 3BCBA 1USTA 1YITI 1H0MA 3JYYA 4JEAA 3DBRB 2ZJQF 5HNFA 2VPRA 4NC7A 3HEFA 3M8FA 1N25A 5FO5A 1S5LC 2EFQA 2MW8A 3K6BA 1R7JA 4Y17A 2DAOA 1ON2A 1ORJA 2ZNYA 3PQJA 4C3EA 3LNRA 1VF9A 2K85A 2XPVA 1JE8A 3H9QA 3H3VK 1Q1HA 4LG0A 3POVA 2CW0F 4MTEA 4EV0A 1W4MA 1MMSA 3JRAA 3MBGA 2HOAA 1TW3A 3UGPA 3PNYA 3PIOF 1G3SA 5M5WJ 1WZ2A 1XGMA 3MLGA 1IN6A 1W7PA 1FX7A 2P1AA 1ZGAA 1K83J 1LVKA 4UUSB 3MEXA 3VYTB 4HX8A 1I4YA 4GCVA 5ILVA 1J2XA 2QSFX 3DKYA 5FFXA 5FKKA 5HVQC 1G4DA 2JA5J 2CGEA 3NKEA 4M3EA 1G59A 1SAXA 2HZ8A 3L2QA 1FIAA 4KN7X 4V2GA 4XQFA 3LSHA 4D7MA 4IGGA 1BI1A 3AQBA 5EGOB 3L8JA 1JUSA 2QYOA 3DPLC 2VJJA 1MBGA 1Y1WJ 5COFA 3Q5FA 2IA1A 1P4XA 2DOAA 1TWGJ 2Y69H 4Z9HA 3CCJI 1QQ3A 1QBJA 3G3ZA 5J1UA 4CS9A 3QPTA 4ENNA 3A0HC 4ZLDA 3A03A 1IZ1A 2X85A 3HHGA 3QVYA 1VFCA 1RPWA 1W7PB 2NVQJ 1HSJA 4KT6A 3PCVA 2YL7A 2J9WA 5GP9A 1Z21A 2XLOA 5CQEA 3U1DA 4DW6A 1QGPA 2EZKA 4PJJA 4GO1A 4XICA 3COAC 2K4BA 4A3BJ 5HDGA 3I71A 1J7KA 3M1CB 2KSFA 4NDLA 1XX5A 1VQOI 3FXQA 5F64A 3CUOA 3A02A 5FJ8J 1OYWA 2HQNA 1IV6A 2AWCA 1S05A 2PEXA 5DM7F 3EH1A 1BR4A 3LWFA 1DGRM 2R7UA 4QTRA 3L2WA 2PLYA 3NQOA 3ABLC 3UMIA 3QU3A 5LHIA 1D0XA 3EJNA 3WG7C 2H8WA 2X0LA 2BVLA 3KX2A 3TJ6A 1A04A 1QPIA 2QENA 3ZOBA 2DOEA 3KLOA 1FYLA 3U8VA 1I27A 2M3AA 1YG2A 4IZZA 2NOGA 2JMWA 2QVOA 1XMXA 5HLHA 2D1HA 4U5FE 5H6QA 3CJNA 1OCZH 1ODDA 3IEEA 3J81K 3LL7A 1YJ9I 2ELKA 3I54A 3E5UA 4EJWA 3IRRA 4UVCA 2PN6A 2A6EF 2ZXIA 5JS5A 3DBHB 2GXAA 2JA7J 5B1AC 1RKWA 4UDVA 3ECHA 5J4YA 2KNHA 2HJ3A 3EYYA 3OR1C 1W0UA 3ABMC 4IAOA 2FNAA 4CCNA 2JPCA 1OR2A 4PACA 2M34A 3E6DA 5K1YA 3LAJA 1Y1VJ 1ZHYA 2Z5UA 4XLHA 4W1UA 2BXZA 1BI3A 2VCBA 2FMYA 5DQTA 4RAGA 2PFBA 2GIVA 4BQAA 1TWCA 1G2HA 4LITA 3HG9A 1MNDA 5IYCJ 2V26A 4BL0B 4CS8A 2DQLA 4EMSA 2E1CA 3ZC4A 3V5YA 2FXAA 5TGTA 1G3WA 1GXQA 2EINH 4G6QA 4PZJA 4RGXA 4HG2A 1BBYA 5LFAA 3I4NJ 4BGDA 4QPQA 3S1NJ 2WZLA 2XB5A 3K10A 2ZC2A 5BNGA 1LI5A 2IXSA 4UVBA 4BACA 2WVQA 2FBHA 3O8HA 3IKTA 3FAPB 3WU1B 2VBXA 3IV5A 1UZCA 3HTSB 1F4KA 3RIPA 1GV5A 3GANA 3Q0WA 3H9JA 1VQ9I 3JSEO 1MNMC 1BIAA 3AG1C 3JAMZ 3K33A 2WV1A 1LB2A 4IB4A 2W57A 3ULQB 2CFOA 3W8IA 4WF2A 3K9TA 3AGUA 1F9NA 4BEJA 4LLNA 3S0XA 4E6KG 2LF8A 2XLMA 4XPXA 5EHHA 3WTYC 2BYVE 3WG9A 2EZIA 3RQ4A 1YFHA 1LPEA 1V5GA 5FROA 1MW7A 1JUMA 3BLYA 4M9SA 1EA3A 2ZXOA 1GUUA 2O0YA 4HAMA 2KP6A 2M45A 3O10A 3D1NI 3BEHA 2HQ5A 2HFIA 2VN2A 5BQHA 3B0UX 5DD4A 2HPMA 2RVCA 2QLAA 2XL6A 3BR1A 3GORA 2UWMA 5K0IA 4GDFA 2VE8A 4KMFA 2H09A 3BT9A 1SFOJ 1HKTA 4RLFA 1ONVA 2F5EA 2H8RA 3Q7LA 4CUGA 4U7BA 4NY3A 2K9QA 5KYYA 2BE5F 2FSWA 3G50A 1LDKB 4MS2A 1I3QJ 1I39A 2VQCA 1N1CA 1E3PA 5TJ5E 2Z99A 3K4CA 1O3UA 3M4CA 2RC4A 2XGEA 1SF8A 5COMA 2LD6A 5IY5C 2HDCA 1LDJA 3V7RA 1WJ5A 2W4MA 4C9YA 3GEHA 5EEHA 3DAFA 3KL4A 2PG4A 4HFFB 2K5CA 1BBHA 5E20A 1JMWA 3K1IA 2LSEA 1A6IA 2CFXA 4CHUA 1YZAA 2OAZA 1OCRC 2LLKA 3PFIA 3U5SA 3WHCA 2W48A 1A35A 2AQEA 3PM1A 4YELA 1RJ9A 2F5DA 1TWHA 1ETYA 2BXYA 3HRMA 3TEDA 3H35A 4JTAB 1T0FA 4XRFA 1DP7P 1H6GA 3W2WA 3BCAA 3MKWB 1EA8A 1X4PA 1WTYA 3CP8A 3F8MA 3S1MJ 1ETQA 3LOCA 1J09A 2O8XA 3REOA 4A0XA 3KP7A 4N6CA 2GA2A 2H1LA 3HOYJ 3ABKH 2AO9A 3T8RA 3TO7A 3VYRB 1I6XA 1Z3YA 4EJTA 3IPMO 2A05A 1K4SA 2R25A 2CV1A 3U3BA 1YAUO 1P92A 2VLAA 5ED4A 2EPFA 3G71I 1B9MA 2QTVA 2VCCA 3DJNB 1O7LA 2R5YA 3KP5A 3SFZA 2VC9A 3CQZJ 2MGQA 1JPNA 3CCEI 4A69C 4HSTA 3ABUA 5EEAA 5B66C 5IT3A 3KP4A 4XONA 1RJ9B 2ID6A 5HS9A 3AG2C 3KYJA 2RAEA 1UELB 4L5JA 2XXAB 4J19A 3AG3C 2H1KA 1YQAA 2R05A 3H5RA 2D2WA 2DDBA 4EUKB 5GPGB 3BDDA 3C2GA 3PO3J 4KNVA 1NBBA 3VRCA 3X2QH 1LQ1A 1YVIA 2XVCA 1TNTA 3B02A 1X1CA 5F0FA 3DAGA 1L0OC 3GFLA 3Q6NA 1SMYF 1TZLA 1W36C 4L9JA 2JA6J 4E18A 1D0YA 2P6TA 4P5OA 4ZYDA 4OD5A 4PJ0C 4YIIA 3V5XA 2NYXA 2E5NA 3QPLA 1XN7A 1OR7A 5B3SH 3OYDA 4J7YA 3PQKA 3W4YA 4HYEA 5FRNA 2CW8A 1R9TJ 3CEXA 1ON1A 2I10A 4BHCA 1Q0DA 3NRVA 3GTKJ 1SFEA 4PFPA 2VE9A 3GUDA 2M8EA 1T6IA 2RKHA 2P6SA 4HF1A 3C63A 2QUPA 3CLQA 1A31A 3R4KA 2J45A 1RRJA 2R7OA 2BOLA 5EG0A 4MVMA 2Q9CA 4N0BA 1VTNC 2FQ3A 3I5PA 3ZQQA 3BWGA 1SAUA 3CESA 4HQEA 4BDZA 1AHDP 4RGRA 1UJ8A 3A2KA 5IP9J 1TR2A 4XR6A 2LMDA 4RDAA 2D4UA 4BQQA 1WH7A 3DQVC 4KT5C 1HF0A 3J7ZI 4P96A 3MKZA 3KYCB 1KU7A 2MD5A 4IRHA 1MMNA 1JGSA 4A6DA 1YLFA 3F72A 1Q0FA 3HUGA 2Y9ZA 3WGIA 5CVUA 4K7BA 3KZYA 2LFFA 2HS5A 4PGGA 1JHHA 2J0WA 4PUSA 4RAZA 1GVJA 1Z91A 2IGOA 1KYZA 3ZN1A 3K4JA 3RCOA 4RMNA 2HZTA 4CO8A 3MMYB 2KJCA 3AG4H 4I0BA 3EGXA 3OYGA 1XDSA 4XKWA 2IXNA 3IH2A 4RB2C 3KMIA 3ZQFA 1FOYA 1MGTA 1LE8B 4XMYA 3QQAA 3A4CA 3JRIA 3PHF2 5JLIA 3LJBA 3J81Z 4ZDOA 1JT0A 2Q9AA 2K27A 2PMHA 4FCYA 3CAXA 4N06A 1XGSA 2G7UA 4WK8F 3K7DA 1JKRC 2BW3A 4X0RA 3WAQA 5BQGA 2V1XA 3DLAA 1ZAOA 2BY0A 2A5YB 5HOOA 4A3LJ 2LIGA 3FBNB 1I1GA 2FA5A 2CV0A 1OW6A 4WXCA 2XS1A 4LOCA 1HBXG 3I59B 2QF7A 2R02A 3FWEA 3S2WA 3BJAA 3DPTA 3LAPA 2ZXHA 2NVXJ 5AIQA 3SXKA 1G4US 4KIFA 2NVYJ 3VB2A 5A6AA 4GRIA 4M3BA 3EGXB 4BPMA 2PI0A 4XRSG 1K79A 4F55A 3FMRA 2Z1DA 4F91B 1WN0A 3I5QA 4XKCA 2XUBA 5E2QA 3S3OA 5L0HA 4F52A 4ZZDA 2HDWA 2ASRA 2L2OA 3BPXA 1T5OA 1POGA 2NUTB 1IDYA 3M4OJ 1PUEE 5A6JA 5F5FA 4CCOA 2XRHA 3SJMA 2D45A 1IN8A 2MLKA 3MKLA 1P6RA 3QRFF 3F47A 1AKHA 2WZFA 4FETA 1SVMA 3C1DA 1VQ5I 2UZKA 5JRAA 1T6SA 3GEIA 3MFKA 4LB5A 1S8NA 4BBRJ 9ANTA 2MH9A 2NOJB 3GX4X 1MDMA 2K40A 2IBDA 3L2RA 2ZKZA 3DU6A 3I58A 3JTHA 3DEWA 2ISYA 4JX5A 4NHJA 3TJ5A 4E7ZA 2AP3A 2A6HF 4YEJA 4IXAA 2M30A 4ON0A 1UHSA 4UHTA 4WWCA 1DDNA 5E1XA 3S16J 4MW3A 4IQ4A 3W8HA 1P2FA 3TO9A 2IBFA 3WTSC 1HW1A 2YL0A 3S29A 3DTEA 5LEKA 3B0VC 2X1CA 4BXFA 2G0EA 2P81A 5AONA 4XNFA 3MWMA 3MX3A 3W6KB 3HBLA 1FLIA 2B0JA 4MQ9F 1LUJB 2QQ8A 3HYIA 2QSGX 2CNWD 3EUAA 2EIKC 1FMWA 2L0KA 3ZTZA 2E1MC 4LG3A 4D9JA 4BAYA 1TKNA 2DA3A 1Y6DA 3M7GA 2QWWA 4IPAA 4FESA 3GBGA 1TFOB 2E2HJ 1HC8A 4YK5A 2Y48A 1R23A 3KZZA 2R5ZA 4ZTJA 1MDMB 2OQMA 3DM5A 1HA8A 1SZIA 2MH2A 2VIXA 2UXNA 1LE2A 2VC1A 3HM5A 4KN4X 1XS9A 1EJ9A 3GTMJ 3TGNA 3LLKA 5DCMA 4QSHA 3F0CA 2DMUA 4JP0A 5D5XB 3WTVC 3CO7C 3G4XA 3OYJA 4DVYP 2W85A 2LD5A 2DTRA 5CVIA 1O3RA 1VLSA 2V3CC 2J7PD 4RB1A 2W24A 4X6AJ 1I5NA 1PDNC 3VAYA 3ZMSA 3TP3A 2V9KA 3GFIA 2J9VA 1MIJA 3K1MA 3L34A 3OEOA 2XL8A 1YO5C 3E6CC 3S3NA 1UG0A 1P9QC 1FJLA 3S2HJ 3TD7A 2IS4A 4G6TB 3K4LA 1JGGA 4YWQA 2L6HA 2WY7Q 2W00A 4D4NA 4OAZA 3RJPA 2R5ZB 1ETVA 1VQKI 3HHHA 4CXFA 3LSRA 4PSXA 4XOPA 3ATPA 1YYJA 1VNDA 1YRNA 1ZHWA 4JZAA 4ESFA 4U0YA 1D3YA 3I4MJ 4OIRF 1FTZA 4NUBA 3TQNA 2J9BA 1R6RA 4IOCF 2CRGA 2L9SA 3CUQC 4AYBN 2DJIA 3ZCOA 2IW5A 1ETKA 2L6GA 2I8DA 4BJTA 3LSPA 1O5HA 4AE4B 4DRJB 5A2QK 5CJ9A 4Y7NJ 4UNOA 3B6CA 2YQYA 2XM0A 2KJBA 1MBFA 1LIHA 3ZQYA 3KP2A 1ORYA 4QLCU 3OIPA 3ZR8X 5HS7A 2NNYA 1QZEA 1S7OA 1RNLA 3R2PA 2HGCA 4CIHA 4M3FA 4JW1A 3K4NA 3RVYA 1BM9A 1SEUA 1L7CA 3X1OA 2DBBA 3MCZA 4RM3A 2DB4A 2NS8A 5JLWA 4M9XA 4KNWA 4CDAA 1K7AA 1ZVZA 3Q0UA 4RLQA 4NNJA 5J6XA 3T5XA 4FASD 1U5TA 5CQGA 4F3QA 3JR9A 3ZQ7A 3JRDA 1MH3A 4D1QA 1ACIA 3JRBA 1ZG5A 4HX7A 2VJ4A 1E2XA 2J8WA 3QU6A 3LS1A 1AVOB 2Z33A 2D5RB 2PJPA 1E85A 4B3AA 2WADA 1PJRA 3GZNB 1O3TA 3JZ0A 4XLEA 1WKMA 2HI3A 3AAFA 2LP0A 4N4NB 1I6HJ 2XS8A 3K4MA 1XSXA 2V4JC 3A0BC 3LSGA 1NTCA 2LFBA 4H4KC 1H8AC 3F9KA 3LEVA 3B6AA 4P9UA 1PCXA 3GTOJ 5H2FC 2XAHA 1XWJA 1TWAA 3EG9A 4V19K 1QPMA 3RPUA 1LKXA 4YIRX 2EV6A 1R5ID 3IKVA 2AVKA 3WTWC 3O8GA 3TW7A 3QMKA 2CGPA 1Z6RA 5E8GA 5JVGF 5M3FJ 1XZPA 1FBSA 5ICGA 3K1NA 1FT9A 3DKWA 3FX3A 1K61A 3PNVA 1HCRA 3ZN0A 5EK0A 4LD5A 2VT2A 3N05A 2ME6A 5KAFC 2UUHA 3G4SI 1B4AA 2Z9OA 1K78B 4JX6A 3EZIA 3I3LA 2NUPB 2K3PA 2ZSHB 3CC4I 4W8PA 3EETA 4DIQA 5D5UB 4KI2A 2XGDA 5LGTA 3ITFA 1W36D 3B71A 2BHYA 1E84A 4U0VA 5F27A 1QZZA 1TWFJ 4OMYA 2VPLA 4O79A 1S72I 4HF0A 2P0WA 3EFOA 5C3EJ 5J1YA 4KC9A 5FLMJ 1EKEA 2LY9A 2DK5A 2GIZA 3ASOH 2JJ7A 3IUOA 4U87A 4C30A 2I5UA 2I8BA 1STZA 2AXLA 2RDPA 2ZMEB 2WC2A 2OF7A 1TWCJ 1V55C 3JCUQ 2NAZA 4XM3A 4N4WA 1D1AA 4DJAA 3GTJJ 1QQIA 2EJRA 2DYSH 1Z3IX 1V5EA 3FIWA 1I3AA 3HOSA 4AYBA 1YS7A 1RCPA 4E0HA 5DYMA 3A01B 1R1VA 2LCHA 1W5SA 4KISA 3PFYA 3DEUA 4JURI 1PP8F 4RGSA 5IP6A 3HNIA 1E86A 1B72B 1ZHFA 2QQBA 2LBFA 3MZHA 2YWAA 1R71A 3GFMA 2L9JA 1X4OA 4PJNA 4IF4A 4WXDA 3S15J 3R0AA 2PJRA 1B68A 1CPQA 1GDTA 4BUPA 2AQFA 1GXPA 2K9LA 4S05A 1HOMA 2LYCA 4ZTFA 1N77A 1A6QA 3RYLA 2O8KA 2CW7A 3KP6A 2R7XA 3O55A 4A3IJ 3IWFA 1SANA 3KPHA 4DBRA 3CMYA 1UAAA 2NSGA 2AHQA 1HMDA 4CSAA 3QZCA 1QRYA 2LREA 5HS8A 1VQNI 2E87A 1B8IB 2OCCH 4ZYGA 1YS6A 1JOGA 3QODA 2X1EA 3HJCA 2LK2A 1K04A 5L3VA 2A69F 2QA4I 2DA5A 4QDLA 1YIJI 3EUHA 3I0TA 1TQMA 2BY1A 4Q47A 2PF4E 4KBLA 2LY2A 2O9LA 4AU7A 2R7ZJ 1FP1D 3VSLA 1YTYA 3ESWB 4U5DE 2PJRB 2PP4A 4F7ZA 3DU5A 2C04A 2O7OA 1EQ1A 1BN5A 3GM1A 4HBLA 2IA2A 3JSOA 4C3IJ 3B73A 3F22A 2Y3HA 2HQAA 4UUSA 3C62A 2Y9YA 2H7OA 3ZRGA 1T2KA 1RKEB 1T6UA 3HDDA 1PD0A 2R7QA 4D5CA 1YW8A 2DA6A 2JWTA 3SYNA 4FE7A 4I3MA 1DU6A 3BR3A 3KCCA 4RBNA 5EGOA 3L0IA 4U5BE 3FM5A 3V7OA 2F5CA 1TWHJ 4AM3A 4RA2A 1LI7A 3JRHA 3ASNC 3FAJA 5LGNA 1S7AA 4B47A 4HQMA 1ZGJA 1OXBA 3M15A 2EILC 2DT5A 4PJMA 4LMYA 2HKXA 4Q48A 2A68F 4IVNA 3CDHA 1QVUA 2VI6A 1ORKA 4IHTA 3HLZA 2HYFA 3MKYB 2DN0A 1VLTA 2MABA 2R93J 3Q9VA 5EZHA 4QWQA 3TL4X 2XL4A 1JTYA 4Z2YA 2DMQA 1G8XA 2A07F 4JE9A 2XF5A 4B09A 3JCUC 1E0EA 3F8CA 2CUZA 3M1CA 5K7HA 1WCMJ 4G12A 1K6YA 4Y3OA 4G94A 1LM3B 3K2ZA 2CYYA 3OS2A 3FXOA 2GBYA 5J8FA 3LA3A 1YARO 1PUFB 5KYXA 3FDQA 2LFDA 2DFIA 3S84A 2LSOA 1VQ6I 4P55A 2KIMA 1OCPA 4B6IA 2XF7A 5BQTA 3SZTA 4CCLA 3F3XA 3ABLH 4AK9A 3QOPA 3MN2A 5J40A 3GZ5A 3H36A 4AUXA 3V42A 3WG7H 1TNSA 4LACB 2NVUB 5A2QZ 1C17M 4F4BA 1D1CA 2HKVA 2DJNA 5L3EA 2ZFUA 3RQGA 1WJBA 3N24A 4IRGA 3E9VA 3LS0A 3HOXJ 2DMNA 2L6FA 3H0GJ 1TC3C 2JPUA 1OCCH 5J47A 3CCYA 1QNTA 3KH2A 2HYGD 5CKTA 3NMKA 3AL0C 4MO7A 2HFHA 4DNCA 3CC2I 1BJZA 1FNTc 1A36A 3DI5A 1R5GA 3I4PA 5ICFA 4YT4A 4XPYA 3F6VA 3DKAA 3SNHA 1VYIA 4TV7A 3OSFA 5KYXB 4RBOA 5B1AH 4IJAA 1KTMA 3VYWA 4DZPA 5FFZA 2M9HA 4E0IA 4CZZA 3H65A 2WY8Q 3G4ZA 4MVOA 4XEFA 5JFRA 2XSDC 5DQZA 5DM6F 4MEXF 4NTFA 2P0NA 4M3GA 1D5VA 1ZG3A 2YX7A 1OKRA 4CS9C 1DU0A 4XIDA 3AL0B 1Y56A 3LAYA 2KGOA 1WI3A 5EF6A 3OYHA 4HNVA 2RD9A 5F0CA 2FGYA 1B59A 4MVUA 2XLHA 1SD7A 4FQGA 4H54A 2JTVA 4L0ZB 5T3WA 4V2FA 3OMYA 3ISPA 1Q1VA 3HOZJ 2Y69C 3MYFA 4KIBA 3KKBA 4IHSA 3NEUA 1OKKA 5IT9K 3LESA 3EGDB 4EBBA 4ASNA 3S2DJ 2VQGA 2OD5A 4BJ5A 2GA1A 3H0DA 5DS9A 4O6MA 3GLLA 4A3MJ 1ZYRF 2KHMA 2CG4A 1MBHA 1RESA 2PX9A 2COBA 2ESHA 5FKNA 2FU4A 3FXMA 1NZEA 3JREA 2PBEA 2R7DA 3HTKC 2DA7A 4LLCA 1LPQA 2STWA 2HWVA 4Q5SF 2PNOA 3LEOA 3UMHA 3HOTA 1ERDA 1NH3A 4B4CA 1ULYA 4L0YB 3ZPLA 2DT7B 3OR2C 4BU2A 3I9V2 2B63J 4DYQA 4ZZLA 1U2WA 3GTGJ 3ONQA 1IF1A 3CCLI 4YN0B 4J32B 2NRAC 2VCAA 2DXIA 4C3JJ 4DXWA 3GXOA 3KFWX 2NPUA 5E3LA 3TULA 2JN6A 4AL0A 5L0JA 1FY7A 4AD9A 2O03A 2P7CB 5GAEJ 3G1OA 3SFIA 2NS0A 2ETSA 2G9WA 2HNHA 3RTRA 1YA7O 1U6GA 2YL1A 2EIJH 4NQFA 4U5GA 5FB2A 1OCZC 1ZHXA 1S7EA 2QLZA 5K7FA 5EZGA 3M79A 1OJLA 4O5VA 2LKSA 3MZ8A 2PMZN 2ZJPF 1GT0C 2M5WA 1MNEA 1RKTA 1X3ZB 1G4WR 3FDYA 3KIOA 1UG2A 3H9GA 3LFUA 3TO6A 2W84A 1A7VA 5A6BD 2VQHA 3SYTA 1WH5A 2EZHA 3I56I 2FD5A 5IY5H 3WODF 3HZJA 2P61A 2YVKA 5K5RA 4CS8C 4N6HA 4LB6B 2RQPA 2GXBA 1LFPA 4RAYA 1NU7D 3K69A 3UGOA 1WATA 2OU6A 1OCRH 3QOEA 4DYRA 1F1ZA 4QPOA 3V8LA 2R92J 3J7AO 4A5NA 4DQ2A 2IS6A 2JX0A 4XTKA 3L9FA 1Z05A 2DMPA 4EVIA 3OYCA 5M5YJ 1ZN2A 4II3A 4XKBA 1Q0KA 3L2VA 2WZGA 1KA8A 3BZ6A 3SXYA 3CJRB 2QY9A 1LNWA 1V4RA 4EBKA 3IQ5A 2XDVA 1QLEC 3CMAI 2EINC 2OEXA 2KKOA 5BPIA 1OCOC 3U21A 5KK1A 3HXLA 3PUFA 1MSEC 1HY5A 3BR0A 1TQIA 3SDBA 3IWZA 3GYHX 4O6NA 3KP3A 4Z9JA 5B3SC 3CDIA 1U9NA 5FKOA 4IKFA 1ZLKA 1YA9A 5A69A 2WA0A 3ZMUA 1KZHA 2V9PA 5JSLA 3C18A 2FOWA 4XLAA 5HLTA 1IUFA 2JPBA 4AIDA 1CPRA 2XXAA 2OJQA 3K2AA 1RR8C 1B9NA 2M0CA 4A4AA 1K40A 1Z77A 1NG1A 4J01A 2LQGA 2CDQA 3AG2H 1VB5A 3ZQLA 4PR9A 2C6YA 3NYJA 3LQRA 3PIPF 3OY9A 3EPZA 4JQFA 5D6FA 4XK4A 2QZ8A 2JRMA 2XAUA 2HMQA 4BEMJ 2Q8KA 2WB7A 1QO0D 1SD6A 1JJ8C 2V79A 1T95A 1XG1A 1QPUA 2KZGA 4HV6A 5D6EA 1TFKB 1OR3A 5FCLA 1EH7A 2L7KA 2DW4A 4FX4A 3BPVA 5CVRA 2HEOA 3R7CA 5L0DA 1CGOA 3K1IC 3P9KA 1FFTC 4LLLA 3RQIA 4A93J 3CC7I 1R4TA 3O3KA 2CUEA 2DQRA 4A3JJ 1IC8A 4A3GJ 2VOOA 3K6GA 1MKMA 4UXNA 4WX9A 2P5LC 2YU3A 1ZH5A 5D8KB 2EK5A 5DS5A 1E3HA 1V4AA 1T0FC 1Y6IA 3IQCA 2P7VB 1WVRA 5E1ZB 4EIYA 1YLMA 2ZNZA 1CQTA 3RDIA 4YRVA 2GDCA 3KE2A 1YX3A 4EJVA 2E19A 4EJOA 2H7BA 3QW0A 4AIKA 3JW4A 3P9CA 2GWRA 3OS0A 2OV7A 3BY6A 3Q6MA 3IRQA 3OYBA 4M6VA 2Q1ZB 2VQLA 3OWTA 3TMOA 3NRHA 4P6IC 2PMZA 4H0EA 1K05A 5GAHJ 3LNMB 4M63A 2M1BA 4UB6C 2Q3TA 3T0YA 1HKQA 4RDUA 4BXXJ 3U9MA 2CJJA 1GS9A 2EPOA 2VJIA 4M9ZA 1SFKA 1OISA 3FM3A 1GHCA 2V7FA 2HTSA 3LSJA 1VOMA 2KMUA 1PYVA 5J8CA 1WHUA 3ABKC 2WBMA 2FFHA 4KYWA 3VEPA 1G3YA 4HEA2 2J0XA 3ZTMA 2X0CA 2IAIA 1REPC 5C4JJ 5ICCA 1LE8A 3K66A 1JTXA 2E35A 3DBLB 3HPGA 4BE1A 3J06A 3S27A 3C8GD 2WAEA 4FWVA 3F23A 5ILUA 2O61A 3SEZA 5L3QA 2YX4A 3M4BA 4N9IA 2VBWA 4WXHA 5KNLA 1F36A 3W2VA 1CF7A 1TBXA 4NB5A 5F04A 4ZC3A 1YJNI 1ORSC 4ESJA 1Z7UA 5KYWB 3HNLA 1TWAJ 4I98B 1OR7C 2EQRA 1V5FA 2ZJRF 1JJ6C 1FAPB 2L54A 1TQGA 1XTAA 1OYYA 4KDPA 4JYKA 3U0CA 3I59A 1R36A 4ENKA 2IEKA 1Z6TA 4O7GA 2NVTJ 3E6MA 5GADJ 3X2QC 4BS9A 4MVZA 2IA0A 3C3WA 1MBJA 2FQ4A 4OWRB 1TL8A 1WPKA 1XC5A 1XCVA 4B43A 1KU9A 2ID3A 3ZMVA 4JJFA 2NUTA 1C0WA 3AKZA 1V54C 3NMIA 2IJLA 2OKUA 3B0PA 5FRMA 4DYCA 1SVOA 3IH3A 1F43A 1HE9A 3WU0A 5HDKA 1FTSA 1JUPA 3DEEA 2O9XA 1NK3P 1CF7B 2HXIA 2P5KA 3LSIA 4HLYA 5B1BC 5LHGA 4UUVA 3R60A 3WHBA 4PK4A 1W7PD 2XAFA 3U1KA 2OTLI 4BH9A 2H27A 3K70D 3NKDA 3BJ6A 2Q2EB 1VYKA 1D0ZA 5JVTA 3S14J 3DJUB 4CIPA 3L09A 1AU7A 1VQ7I 2J46A 2GOXB 1RR7A 4EJUA 3BP8A 4FE4A 2K4JA 1HSTA 3GVAA 3ZQIA 5DS4A 4DVZA 3MD2A 5B5EC 3E7LA 4J00A 2ECBA 4DOZA 4ENJA 4HDVA 3D5LA 3JSPA 2DYRH 2MA3A 3LA2A 4QI2A 3HNJA 4CJOA 5FD5A 4RD9A 2VBYA 3JYHA 3O6XA 3IAM2 3ZQHA 4HOBA 2XROA 5AC4A 4D7NA 3DPUA 2FRHA 3H92A 1WJCA 2F5FA 3QYBA 4P9TA 2UV1A 3O39A 5E33A 4BE2A 2KQ9A 3SDGA 1FOXA 2XLEA 2JVGA 2E36A 4Y33A 1FOKA 1OQYA 2MFZA 1KQ0A 2HQRA 2LKPA 4B1RA 3RKYA 2LG4A 4R1HA 4GXOA 2LTPA 2VXZA 1KONA 3E1SA 2ZXWC 4KJZA 3LMMA 3BTJA 3LSKA 4LK1F 3K1HA 3ZMDA 4KFCA 1YJGA 2BY3A 256BA 5FKLA 4AWXB 4CDVA 1MMAA 4BHBA 3H5NA 3SXZA 3PSFA 1LFUP 3GWLA 5CVVA 2BL2A 4L5IA 4XOTA 2DFEA 4U5HA 3W3CA 2GXGA 3ZQVA 2IRFG 1ETWA 4E4HA 1QZXA 2HUJA 3S1QJ 3F21A 4A3FJ 5J3LA 4CCKA 2IVMA 2JVHA 2OUMA 3SZPA 3CCVI 2CQNA 2L7FP 5DCFA 1HW5A 3RPQA 1X3UA 2F4OB 2DODA 3M8EA 3TBIA 1RXQA 3U3FA 1RI7A 3G1LA 2A6TA 2Z15A 4LLEA 4AE4A 2IXMA 4BEHB 3ELKA 2IP2A 2E1MB 4PFOA 1R58A 4EGZA 5FLVA 3SZRA 2L7ZA 4HRIA 2L4AA 4OOIA 2Y3GA 3J80K 4MQVA 4Q7CA 4NTBA 2IGMA 2FF4A 3BR2A 3J7YJ 1RKCA 1SMTA 3MVPA 4A3EJ 1RUOA 1J9IA 1TLHB 2E71A 2N8GA 3CCMI 1O57A 2WAQN 5CYVA 2OC6A 4ZDLA 2LDUA 3E70C 4MTOA 4GYTA 2HOTA 2M2EA 3P5JA 4E7HA 4NC3A 3IH4A 3P7NA 2EPMX 5F5HA 3ABTA 4KICA 3F46A 1T33A 1JR8A 2QCOA 2MG4A 2L5QA 4AVPA 2ZSIB 1YDIA 1Z7Qc 1R5HA 2P6VA 4W97A 3E5XA 1D1BA 2KDOA 1GVDA 1EV7A 2E1OA 2XC7A 3FXUA 2KQRA 3DMDA 2QQAA 1BR1A 1BR2A 2R4GA 2P4WA 3RQFA 2ZJ2A 3GM3A 3WTTC 4X1EA 1NG6A 3RIRA 2X4HA 3PSIA 3DWLE 4IEJA 3PO2J 2YR2A 3CQZA 3BROA 3BOQA 4JOMA 3BJOA 3E0JB 1QHHD 1HXDA 1H88C 3CF2A 1MBKA 3CUQB 4G8XA 3FKJA 1WJDA 4O3MA 4OAYA 2OG2A 4XWJA 4A0ZA 2CWEA 4YFNF 4I1OB 3CDLA 4DGWB 3TK0A 4ULVA 1IDZA 5DVWA 5E3AA 1U89A 5LRRA 2ZFWA 1FBUA 1GV2A 2I15A 3EPVA 2UUZA 4LJZF 4QI0A 2MC3A 3K4KA 3H2UA 2CO5A 3OL4A 1MMDA 1KU2A 2L02A 4CICA 1WWPA 1MH4A 1EKYA 1K78A 3SQNA 4BJ6C 1Q0GA 3QW1A 1EI7A 4A6EA 3OSGA 1ZR4A 3I55I 1C02A 5GTIC 4C2MJ 2YZSA 4R32A 4IX7A 1A5JA 2G3VA 2NUPA 1IRGA 1KGSA 1AWCA 2BEOA 3DTKA 1SFUA 3C8ZA 2PQ8A 1W2WA 1PVEA 4ENMA 2WVNA 1Y0UA 5LHHA 3JTGA 3OA1A 5KAIC 2UUIA 2QKLB 2LOOA 3HJEA 4UVAA 3QYEA 1BJAA 5J1RA 1W5CC 4NC8A 4E7KA 4HE8D 1W1WE 1SD5A 2QBYA 2EFPA 1U5TC 5J4VA 3DF8A 2ZMEA 2P8TA 5AIPA 5DUKA 1DQUA 2COMA 3WTXC 3B29A 2OU2A 4M72A 4QIWN 5BOXA 2JK3A 4O6JA 3VPRA 1YIOA 2A0UA 3VF0A 4IARA 2RQQA 3OV8A 5E3CA 2DU9A 1OYIA 3K0LA 1MJBA 1JT6A 3ZP5A 3TOAA 5E8IA 1N75A 3A01A 1IG7A 4L9TA 2ZPAA 5FGMA 2EV0A 3ECSA 1SFXA 5L0IA 2BY2A 2XAJA 4YFKF 1B72A 1ZREA 2L7AA 2NXNB 4A12A 4IHXA 2P5VA 1WJAA 1K6OA 1VTMP 4MEYF 3MFNA 3WTZA 2HZDA 2DFHA 2VKDA 4XLCA 5D5WB 2KZVA 3LA7A 3PNTA 5EDNA 2WWYA 4KUMA 5F1JA 3I4UA 3QAHA 4C3DA 3TOLA 5F0HA 2OTJI 2WAQA 3PJRA 3KZIC 2KC3A 4HV5A 2QEXI 3JTLO 2QBYB 1F1MA 4LDRA 2VB6A 3VOEA 1MQVA 4I0AA 4M74A 2B9SA 3V4GA 4XBFA 3DM9B 2L9NA 1O3SA 3CCUI 3DZAA 4NCQA 1B8IA 1YW9A 1VI0A 3BR6A 4MFDA 1ZHZA 3QVZA 3H3ZA 5ERIA 3PDMP 2XKPA 2M7BA 3ZXSA 2GWWA 3CLOA 1MBEA 1OFCX 3EDPA 4YL3A 4MNUA 4F93B 1IZMA 1UG7A 1W5TA 5HDNA 3L8IA 1KU3A 2DA4A 3FHNA 2LKXA 1WQ2A 4AIHA 1M56C 5CI9A 2RGVA 3DTIA 4LGWA 5L3BA 1T8IA 4HZFA 2Q0OA 3I64A 3KYDB 2Q9BA 2GZWA 4DZJA 1A7DA 4MVSA 2R03A 1LEAA 3GWNA 1ZRCA 3GEEA 2XAQA 2RN7A 3GM2A 3VSKA 1S3JA 1RKEA 2R7TA 2EFWA 4JEBA 5GPAA 2M4GA 4M6YA 4HNTA 1Z6AA 3IAS2 1G3TA 3HC7A 2Y3BA 3L1MA 4AX2A 1S6LA 4M3DA 4XSXF 1TP4A 2CQ7A 2ELHA 5EJCA 3A1YA 5D4SA 2ADUA 1BI2A 4MTDA 1DUXC 2E2JJ 2EIMC 1VQPI 3ASOC 3GTQJ 3FOPA 4DJ9A 3FXRA 2RV8A 2EBIA 4RB0A 3D5SC 4HLXA 2YLGA 2OJED 4I99C 1IO2A 3ASNH 2F48A 3BTCA 3LQQA 1SYQA 3SHFA 3CMEI 3S3MA 4YT5A 1KYWA 3ERED 2EILH 2IXOA 4E17A 1FOWA 1IXRC 3U9JA 5F08A 4K0DA 2MD0A 3FF5A 2EFNA 3RH3A 3EYIA 4XQ1A 3HSEA 4BJ1A 3PMRA 2WV0A 1T39A 2HJMA 2M0MA 4ZLCA 4UY8I 5M3MJ 2HV7A 3VODA 2HSBA 4YL0A 1OQCA 2XM4A 3Q3SA 2CV2A 2DK8A 2Y2ZA 1ZRDA 1XGOA 2D5VA 3BRJA 5L0GA 2B7EA 1J0RA 5LD2C 1DP3A 1SR2A 1Z1DA 1WSUA 2YS9A 2ISZA 1DPUA 2MC4A 5E18F 1HKSA 4CSAC 3WE3A 5DEQA 4CYCB 4M6XA 4EKWA 3CJTB 1U78A 1PUFA 2ZBKA 4RS8A 2OA4A 1U8RA 3LSMA 1YYVA 5KHDA 4A3DJ 4UUTA 4LDQA 3OYMA 3E3VA 4P9FA 3FMSA 1IUYA 4XLFA 1VZ0A 3EG9B 1HLVA 2W9YA 3OYAA 1A41A 1VQ4I 2OCCC 2O5RA 3QYFA 1K4TA 3FK6A 3DCFA 2A1DD 2YLIA 1UCRA 3ZMZA 3J80Z 4WGYA 1X3WB 3ROUA 4ITVA 2M4EA 2W4BA 4XLNF 2DCEA 1FZPB 4OD4A 2KL4A 1XDUA 1FSEA 3IP4B 1SVLA 2ICWG 3CJQB 3L00A 3RKWA 1I1SA 3FXLA 2IXPA 2Y0MA 3L7WA 2CQXA 1MJAA 2BC5A 3C8GB 1X2NA 2QQ9A 2R9RB 3GCMA 1OPCA 3RKQA 1M2OA 4L6RA 2KIUA 1APLC 4M73A 4IJJA 1ZU4A 1IXCA 2PFDA 1T9KA 3H3UA 1XD7A 1U0BB 1FIPA 1JAFA 1BDJB 2A0BA 1LFBA 4KNYA 4LK0F 4UV8A 1O87A 2MWQA 3B9QA 3IC7A 2YUSA 3JRTA 4Z9IA 3WE2A 2H6CA 2R7WA 1LE4A 1ZGWA 2NS7A 3K70C 1YZCA 5CIVA 2K3FA 4NBQA 1YOVB 3JSZA 3VYSB 1JKPC 3U8PA 2IM8A 1X58A 4JX4A 4E7IA 1X1AA 1YHQI 1U6HA 3TDUC 4CSWA 2PMUA 1ZRFA 2XPWA 4AC0A 5HNHA 4AL1A 4LG0B 3TQOA 2Y39A 3EGDA 3OOUA 2HDDA 4U7DA 4WJ0A 2DI3A 3OIOA 1AOYA 6PAXA 1XGNA 1QSPA 3BG6A 1NHAA 1WASA 2LVSA 4XORA 1WRJA 3ABMH 1M1EB 2JRTA 3N2ZB 2ECCA 3RVZA 2KISA 3M8JA 2FNPA 4GFBA 1OW8A 4YIFA 3AJMA 1FSHA 4U9DA 3W6JB 2X6XA 5HLGA 4HFKB 4Y15A 1XZQA 5H6RA 2EFOA 1FEXA 3FHDA 2DA2A 1YX5A 5L0CA 4KIGA 2YEVA 2M8GX 3ML6A 2H94A 4UB8C 1Y0NA 1H7IA 2FOKA 4OMZA 4IWBA 1FBQA 2RNGA 5C44J 1HMOA 4K1OA 4U9EA 1JXSA 3HSFA 5FLXK 4ZDPA 1QVXA 2CNWA 4ZYAA 2TMVP 3M3YJ 5FD6A 5JLXA 4BXUA 2C03A 2DLLA 4U88A 2W45A 1BOAA 2JUGA 4CYDA 3RYRA 2OCEA 1IJWC 2CS3A 1IXSB 2DOFA 2F4IA 2LF7A 1MJ9A 4II2A 1Y8QB 1XB4A 1OCCC 2KJGA 4YT8A 4L5EA 2LR8A 3D0SA 3SXMA 1R4MB 2FE3A 3CZ6A 3AG1H 1IW7F 1VQMI 3IQTA 3EZHA 5TRDA 1O7FA 1C03A 3UNGC 2VASA 2Y31A 1UFBA 3RZOJ 2J7PA 2W82A 3BQYA 1EF4A 4IL6C 1U0JA 2HMZA 2HVRA 5E3MA 1FR0A 2L7MP 3M1EA 1T56A 1WJEA 1JKQC 1Z9CA 3TOMA 3LFKA 2Q4FA 1BW5A 2BV6A 4C3BA 3V7CA 2F6CA 4BJ5C 3CCQI 2ZD9A 1WFXA 4K2EA 4I01A 5E3NA 5BPDA 2BBYA 3OYLA 4RB3C 1KQ9A 4EHPA 1XMAA 4M71A 1Y4CA 5DS6A 2R3SA 3WHNA 2M7AA 3O2PE 2CU7A 3Q9SA 4I7HA 3NWSA 1ZU5A 4KA4A 4MNDA 4OIOF 4N4OB 3F8BA 1DGWY 1OCOH 2HSQA 1BIBA 1ZLJA 3I53A 4XL9A 3M07A 3ZIBA 1ZR2A 1NSGB 3CSKA 1UHWA 4B3XA 4I09A 1VQ8I 3DKXA 2CUFA 2YRFA 1B6AA 5COGA 5L3GA 3ZGKA 1CGNA 3HB9A 1IN7A 4BYYA 4CA0A 1U3EM 2LP4A 1H9TA 1BI0A 4HX4A 1YW7A 1RIOH 1YYXA 4Q4ZF 3VM6A 3EH2A 1FMVA 4E7LA 2Y3DA 2JUCA 3FZVA 1NU9C 5F1RA 2XV4S 2YHSA 2IGNA 3S17J 4LERA 5EEGA 3RPUD 1LDDA 2E1NA 4XRSA 1FFHA 2FBIA 2HVQA 2WB1N 4R8HA 1MD0A 3RKXA 1F5TA 1OCTC 4YL1A 4CX9A 2CQQA 3NWTA 4FISA 1OXKA 3LLIA 2GOMA 4Y52J 1L3PA 2HOSA 4O6YA 4B44A 4CCJA 2KIFA 2JQ7A 5D4RA 2AS5F 3HOWJ 4D4XA 1T08B 4ANJA 1YJWI 2IGKA 2IT0A 2OQRA 2YPRA 2EIJC 1Y8RB 2GLOA 2YLDA 3DE8A 1SC7A 4G9YA 1OW7A 1Z63A 1I5ZA 4S04A 3HIFA 5H20A 4IHYA 3GTPJ 2A61A 2G3KA 1RMVA 3BG9A 3RQEA 2B0HA 2XB0X 2JT1A 3Q7GA 2P7VA 2ZXPA 4MHGA 4PCQA 3AG3H 3DFGA 4S0HB 4ZJZA 5DUIA 2O6GE 3AOUA 5JT4A 2W4SA 4B48A 2FAPB 3BTIA 2DA1A 3GZ6A 2XGCA 3T9OA 1TQPA 1BOBA 2YL3A 4BY7J 2E5ZA 3HRTA 2DO7A 5KVRA 1KQ8A 2CYDA 2FBKA 3BC8A 5HLIA 1GGQA 5TJJA 2H8AA 4ONSA 1R22A 1UHMA 5CLSA 4C2UA 4CBEA 1MMGA 2XRLA 3HRSA 1USSA 2NNNA 3HNKA 2EH3A 1WI9A 3OOPA 3ZG1A 3HKKA 1CGPA 3BQZA 5KYNA 5LEJA 1LEBA 1SD4A 2G62A 3SEOA 2A3SA 2HR3A 5ICEA 5JHUA 3NYLA 4YT2A 4ETSA 1TT0A 3I5UA 2X9DA 5LLQA 4XSZF 3S28A 5KYYB 2Q00A 1U9OA 2B0LA 1X19A 3JT1A 2XF6A 2OZ6A 3S8PA 3NDBB 1GQAA 2RREA 4I2OA 2ETHA 3U9GA 3RKOF 5B3IA 2H7VC 1P4AA 4ULWA 2VXDA 1A7EA 2R7FA 2EA2A 4P1WA 2DYSC 1S29A 1XSVA 2VC0A 2DFFA 3SEQA 3G73A 5KYWA 5CPRB 5F28E 1JKOC 3UR3C 4ZYHA 1T01A 1NLXA 5EGYA 2ELJA 4A2NB 1XMKA 5E1WA 3GW2A 4A3KJ 4BKXA 5T3TA 2NG1A 5LGUA 1JHFA 1IRXA 1X1DA 3IL2A 1TWGA 5JP7A 3OS1A 4MVQA 3N0TA 4E7JA 1Z5ZA 4C3HJ 5HODA 4ZH4F 3S32A 1O4XA 3MAJA 1E17A 3DV8A 4BNCA 5BUOA 4W8KA 1Z7LA 4MFEA 4DRIB 2OEVA 4L9NA 2LNBA 3GWZA 2KRCA 2EPKX 2X6YA 5GPCA 1V54H 3DXJF 4XEKA 3T6JA 4A5MA 4JK1X 4X0GA 3CCSI 3VFZA 3QP5A 4YG2F 1ETOA 4BY1J 2R5YB 3O6BB 4JC7A
chains in the Genus database with same CATH topology
1D1BA 4QDLA 2KDOA 2PF4E 3OYIA 4KBLA 2LY2A 2XC7A 5DQTA 2KQRA 1TWCA 3DMDA 4LITA 2HU9A 2WB1A 3HG9A 1BR1A 1MNDA 4AU7A 1BR2A 4HNUA 2R4GA 2V26A 4BL0B 4CS8A 4EWCA 3VSLA 5HSWA 4U5DE 3ZC4A 2F5VA 4PJLA 2PJRB 2GFHA 2PP4A 3H5AA 5TGTA 4XLPF 3DU5A 2C04A 1NG6A 5LFAA 3PSIA 3DWLE 4HG2A 4BGDA 4QPQA 4JOMA 2WZLA 2Y3HA 3CQZA 3K10A 2HQAA 3E0JB 1QHHD 2H7OA 2IXSA 4BACA 3CF2A 3ZRGA 1ST6A 1VMAA 2FUG2 3FKJA 2WVQA 1WJDA 5JHFA 1VK5A 4F92B 3L2UA 4OAYA 1PD0A 3FVYA 4IRUA 2KLOA 2R7QA 2OG2A 4XWJA 3RIPA 4RM2A 4I1OB 2X51A 3SYNA 4DGWB 3GANA 3H9JA 4I3MA 3AG1C 4RBNA 5DVWA 3K33A 3L0IA 4U5BE 5E3AA 3W8IA 2CFOA 2VKHA 3EPVA 3V7OA 4BEJA 3OYKA 3S0XA 2UUZA 4E6KG 4QI0A 3K4KA 3OL4A 3ASNC 1MMDA 1KU2A 4B47A 3FAJA 2EILC 4BJ6C 5EHHA 4PJMA 3RQ4A 2YZSA 1QU3A 4IX7A 1V5GA 5FROA 1M2VA 1MW7A 3BLYA 2A68F 2G3VA 2NUPA 1EA3A 2ZXOA 2KP6A 3HLZA 3MKYB 2LC2A 2X1DA 3DTKA 3B0UX 3RFYA 2MABA 2HPMA 1W2WA 2XL4A 3TL4X 2UWMA 2WVNA 3OA1A 3HL2A 2JA2A 5CI8A 4HEAJ 1G8XA 4XN3A 2QKLB 2XF5A 2LOOA 4RLFA 1E0EA 3QYEA 3HUGB 3Q7LA 4NC8A 2CUZA 3M1CA 4CUGA 4U7BA 4E7KA 2BE5F 4HE8D 4NY3A 5KYYA 4CH7A 1K6YA 1LDKB 4Y3OA 4I44A 2VQCA 1N1CA 2L81A 1DQUA 3K4CA 3OS2A 2R7RA 3AG4C 3PL8A 5KYXA 1SF8A 3FDQA 2KPMA 5IY5C 2RQQA 2W1OA 1WJ5A 1NG7A 5E3CA 4C9YA 4B6IA 3DAFA 3KL4A 2XF7A 2ZPAA 1N75A 4HFFB 3ECSA 2K5CA 4CCLA 2VH3A 2LSEA 4AK9A 4G7ZF 4U5EE 1M2VB 1OCRC 3V42A 4LACB 4F4BA 1D1CA 2AQEA 4YELA 4BEHA 1RJ9A 2ZFUA 1TWHA 3AQCA 1WJFA 1WJAA 1WJBA 3N24A 2HZDA 4XLCA 2VKDA 1NU7D 3E9VA 2KZVA 2XSJC 3PNTA 3H35A 3I4UA 3LS0A 4C3DA 3W2WA 2CMPA 3BCAA 3OYEA 3KH2A 3MKWB 2BW3B 5CKTA 1X4PA 3AL0C 2WAQA 3PJRA 3CP8A 1M57C 1J09A 5T1DB 2R7VA 2VB6A 4YT4A 3UMKA 3VYRB 3SNHA 1Z3YA 1VYIA 4JVSA 5KYXB 3DM9B 2L9NA 1Z23A 2CV1A 3DZAA 3VYWA 2DYRC 3H65A 2VLAA 2WY8Q 3NG1A 1ZHZA 2QTVA 3J7AY 2W7NA 3DJNB 4KITB 5DQZA 4C7OA 2M7BA 3ZXSA 2IOQA 3K4BA 1N78A 1JPNA 4CS9C 4HSTA 3EHNA 4F93B 1IZMA 3AL0B 2WL8A 1Y56A 3LAYA 4XONA 3W2AA 2DT6A 1RJ9B 1OKKD 3FHNA 3AG2C 2XXAB 1UELB 2JD3A 2KGOA 1M56C 5CI9A 2IS2A 3DTIA 3OYHA 4IQJA 3AG3C 3NYMA 3H5RA 2FGYA 2Y0SA 3C2GA 2K9MA 2Q9BA 4KNVA 5T3WA 4XKVA 3OMYA 2Y69C 3KKBA 1X1CA 3Q6NA 3DAGA 1TZLA 1OKKA 1SMYF 1W36C 3VSKA 1D0YA 3LESA 4P5OA 3EGDB 4OD5A 2R7TA 5D92A 2CUJA 4EBBA 2E5NA 2VQGA 4BJ5A 2BVMA 4O6MA 3H0DA 3OYDA 2M4GA 2R7SA 2KHMA 1ZYRF 4HNTA 1Z6AA 3IAS2 5FRNA 2Y3BA 2CW8A 3HC7A 1JPJA 4AX2A 1NZEA 3KYLA 3EHMA 4C7OB 3HTKC 4LLCA 3A1YA 2DGJA 4JJGA 2EIMC 4PFPA 3ASOC 3FBIB 3S93A 1J8YF 2HVSA 3UMHA 5DLJA 3HOTA 1ERDA 4Q5SF 1ZELA 3D5SC 3AFHA 4PSWA 3CMMA 2DT7B 3OR2C 4BU2A 2J45A 4YT5A 2R7OA 2BOLA 3I9V2 3S3MA 4GEHA 2Q9CA 2IXOA 1LS1A 3I5PA 3ZQQA 1SAUA 3CESA 4BDZA 4K0DA 2MD0A 3ONQA 3A2KA 3RH3A 1TR2A 4XR6A 4YN0B 4J32B 4BJ1A 4RDAA 3PMRA 4G7OF 4ZLCA 4BQQA 2M0MA 3DQVC 2DXIA 2HV7A 3MKZA 2HPIA 4U5CE 2CV2A 1MMNA 1J8MF 5LD2C 3RSNA 1DP3A 4K7BA 2HNHA 2MC4A 3RTRA 4EATA 4BE0A 4CSAC 2J0WA 4U5GA 1ZHXA 4PUSA 1OCZC 3EQLF 4BJ6A 2IGOA 3K4JA 3RCOA 2VJ5A 1MNEA 4RMNA 3FDYA 3G2BA 3H9GA 3LSMA 3MMYB 3LFUA 5KHDA 3EGXA 3OYGA 4HPQA 3OYMA 2VQHA 4XKWA 4OIQF 2M4KA 3SYTA 4BQNA 3KEYA 3WODF 2IXNA 2LY1A 2E60A 4XLFA 3KMIA 1VZ0A 4CS8C 3EG9B 2W9YA 3OYAA 4XMYA 1LFPA 2LH9A 3A4CA 2OCCC 2O5RA 3QYFA 4OINF 3PHF2 3UGOA 2A1DD 3QOEA 3LJBA 4FX5A 4QPOA 4XN0A 2IS6A 4XTKA 2MYSA 4ZDOA 3OYCA 2Q9AA 2VL8A 3HKZA 4ITVA 1JI8A 2M4EA 4II3A 4XKBA 2W4BA 4N06A 4XLNF 2DCEA 3K7DA 4OD4A 2BW3A 2KL4A 3IP4B 3L2VA 2WZGA 3CJQB 4X0RA 5KYUA 3DLAA 2IXPA 2V1NA 5HOOA 3CJRB 3FBNB 3VDXA 4E7SA 2CV0A 2QY9A 4G7HF 2XDVA 1QLEC 3DPTA 2EINC 2ZXHA 2V6EA 1OCOC 3U21A 2QKMB 3HXLA 1M2OA 4GRIA 4Y4RA 3EGXB 3SDBA 4IJJA 1ZU4A 4O6NA 2PFDA 4F55A 1GLNA 1QHGA 2Z1DA 4F91B 3I5QA 4XKCA 5E2QA 5B3SC 3S3OA 1S7ZA 4F52A 2NUTB 2HDWA 4IKFA 2L2OA 4G0HA 2WA0A 1O87A 2KW3C 2MWQA 3B9QA 4CCOA 2XRHA 5F5FA 4HSRA 3JRTA 3CP2A 2Z2SB 2LRDA 4XLAA 5HLTA 3F47A 2R7WA 2XXAA 2WZFA 4CS7A 2X6WA 4FETA 3K70C 1NG1A 4J01A 2CDQA 4JCHA 3JSZA 3VYSB 1OLTA 2NOJB 2Z16A 3NYJA 3L2RA 3DU6A 4E7IA 3T4RA 5KYUB 3OY9A 1X1AA 3EPZA 4JQFA 4CSWA 4E7ZA 2IS1A 5D91A 2A6HF 4YEJA 4AE4A 1YE9A 2XAUA 5HNHA 2WB7A 2JSPA 2KRHA 3OOUA 2Y39A 3EGDA 2J9UA 4NQWB 1T95A 2PX0A 4WJ0A 4IQ4A 4OIPF 3W8HA 3S29A 3BG6A 3DTEA 2L7KA 5FCLA 2X1CA 4DBQA 3ZSUA 4BXFA 3B0VC 4C2TA 1X1BA 4XORA 4XNFA 3VYUB 3MX3A 3N2ZB 2B0JA 4MQ9F 3M8JA 2ZXRA 3K1IC 1FFTC 4HFKB 2X6XA 5KCMA 4LIUA 3OYFA 3EUAA 2CNWD 2EIKC 3SZGA 1FMWA 3K6GA 4BQOA 2E1MC 3OIQA 1YX5A 4LG3A 4D9JA 3OYNA 1TKNA 2WVOA 3FHDA 4FESA 2YEVA 5DS5A 3GBGA 1T0FC 1Y6IA 4IWBA 4ZTJA 2RNGA 3DM5A 1HA8A 1SZIA 4ZDPA 2CNWA 2VIXA 4ZYAA 4YRVA 1YX3A 4AVZA 3LLKA 2C03A 2H7BA 2W45A 2XSEA 2JUGA 3OS0A 2OV7A 2IYLD 2CH0A 3Q6MA 1S9HA 3OYJA 4DVYP 3OYBA 2CS3A 2F4IA 2Q1ZB 2VQLA 3OWTA 3TMOA 3NRHA 4P6IC 2V3CC 2PMZA 2J7PD 4M63A 4II2A 2Q3TA 3VAYA 1OCCC 4MLOA 2KJGA 3HPHA 4YT8A 2VJIA 4BDYA 2V9KA 1SFKA 3DD7A 3CZ6A 2V7FA 1IW7F 1ZHTA 2J9VA 1VOMA 2KMUA 3L34A 3OEOA 1PYVA 3EFOB 3EZHA 3ABKC 3GODA 3S3NA 2WBMA 2WAFA 1UG0A 2FFHA 4HEA2 2VASA 3UNGC 4CCMA 2J0XA 1P9QC 2J7PA 3T6BA 2W82A 2IS4A 3TD7A 4CZCA 3PUBA 3K4LA 1AA7A 4G6TB 2DYSC 3EG9A 2WY7Q 1U0JA 2W00A 3K66A 3HPGA 4J30B 4OAZA 4BE1A 1WGWA 2HVRA 3S27A 2WAEA 4FWVA 4PSXA 4XOPA 1ZHWA 4JZAA 3SEZA 2HV6A 4YJWA 1WJEA 5L3QA 4OIRF 3VWBA 3OL3A 4NUBA 5KNLA 1PD1A 1R6RA 3W2VA 3SP1A 2L9SA 4ZC3A 4C3BA 4BG0A 2DJIA 2F6CA 3ZCOA 2PX3A 1Z3XA 5KYWB 4BJ5C 2I8DA 1WFXA 1OR7C 2W4MA 1V5FA 4BJTA 3OYLA 1O5HA 4AE4B 2LBFB 5DS6A 3C2HA 4O7GA 2A5WA 2M7AA 3X2QC 3D5RC 4BS9A 3NWSA 3EUHC 1ZU5A 4MNDA 3OIPA 3ZR8X 4N4OB 4I1MA 4OIOF 1DGWY 4R79A 4OWRB 3EUKL 4B43A 4XL9A 4JJFA 4CIHA 3ZIBA 2NUTA 3CSKA 3K4NA 3AKZA 1V54C 4B3XA 4LIVA 3X1OA 3B0PA 3BG7A 3DKXA 3BCBA 4RM3A 5FRMA 4KNWA 4RLQA 3ZGKA 4NNJA 4FASD 5CQGA 4F3QA 5HNFA 1FTSA 4CA0A 3DEEA 4NC7A 2O9XA 4D1QA 3LSIA 3K6BA 5B1BC 4Q4ZF 2VJ4A 3EH2A 1FMVA 4PK4A 3LS1A 4E7LA 2Y3DA 4C3EA 3LNRA 2D5RB 1NU9C 3K70D 3NKDA 2YHSA 2Q2EB 1PJRA 1D0ZA 2IGNA 2WADA 3H9QA 1VYKA 4XLEA 3DJUB 2CW0F 2J46A 4LERA 3POVA 2GOXB 4N4NB 3RPUD 1FFHA 2HVQA 3K4MA 2V4JC 3LSGA 3UGPA 3NWTA 3LLIA 3PNYA 2GOMA 4DVZA 3MD2A 4H4KC 5DS4A 3F9KA 3MLGA 4O6YA 4B44A 3LEVA 4J00A 4CCJA 4DOZA 1PCXA 1LVKA 1TWAA 3D5LA 3VYTB 4QI2A 4ANJA 2IGKA 1LKXA 4RD9A 2EIJC 1Z63A 3DKYA 5HVQC 2CGEA 3JYHA 3NKEA 3O6XA 1G59A 3IAM2 3QMKA 3L2QA 4XQFA 3LSHA 2G3KA 3AQBA 3DPUA 3Q7GA 2P7VA 2ZXPA 4YWQA 1WJCA 3PNVA 3QYBA 4ZJZA 3DPLC 3N05A 2W4SA 2UV1A 3O39A 4B48A 2VJJA 4BE2A 2KQ9A 5E33A 1BOBA 4JW1A 2E5ZA 2DOAA 2JVGA 3I3LA 3EZIA 3BC8A 4Y33A 2MFZA 2NUPB 2K3PA 4CS9A 2ZSHB 4CBEA 4C2UA 1MMGA 4DIQA 4ZLDA 2X85A 4KI2A 2LG4A 3ITFA 2VXZA 1W36D 1KONA 3E1SA 4KT6A 2ZXWC 3ZG1A 4KJZA 3LMMA 3LSKA 2J9WA 5KYNA 1Z21A 2VPLA 3K1HA 5CQEA 2G62A 4PJJA 3SEOA 4O79A 3NYLA 2P0WA 4YT2A 1MMAA 3EFOA 3H5NA 4KC9A 1TT0A 3PSFA 3M1CB 3S28A 5KYYB 3ZVRA 4U87A 3IUOA 4C30A 2I8BA 1X19A 3JT1A 2XF6A 4XOTA 4U5HA 3W3CA 3S8PA 3NDBB 1V55C 3EH1A 3JCUQ 4XM3A 1BR4A 1D1AA 4DJAA 2RREA 4E4HA 1QZXA 1Z3IX 1DGRM 2R7UA 3RKOF 1V5EA 3L2WA 2H7VC 3ABLC 4ULWA 3UMIA 3HOSA 4AYBA 2VXDA 1D0XA 4CCKA 3EJNA 2JVHA 3WG7C 2OUMA 4P1WA 2BVLA 3KX2A 4KISA 3PFYA 4JURI 3SEQA 5KYWA 5CPRB 3TBIA 2M3AA 2A6TA 2Z15A 4LLEA 3UR3C 2LBFA 4BEHB 2IXMA 4IZZA 2E1MB 2ELJA 4PFOA 3SZRA 5EGYA 2L9JA 1X4OA 4PJNA 4A2NB 4HRIA 4U5FE 2Y3GA 3IEEA 5T3TA 2PJRA 2NG1A 4Q7CA 2IGMA 3LL7A 2AQFA 4BUPA 1IRXA 1X1DA 2K9LA 1TWGA 2LYCA 3OS1A 4ZTFA 1N77A 3N0TA 4E7JA 1Z5ZA 3RYLA 2CW7A 2R7XA 2A6EF 2ZXIA 3S32A 4ZDLA 3E70C 2OC6A 5B1AC 4GYTA 5BUOA 4W8KA 1Z7LA 4E7HA 4DBRA 2KNHA 2KRCA 1UAAA 2X6YA 5F5HA 3DXJF 3F46A 3OR1C 3ABMC 3T6JA 4IAOA 3QZCA 2LREA 4CSAA 4CCNA 2L5QA 4X0GA 2E87A 2ZSIB 3QODA 2X1EA 1ZHYA 3HJCA 5L3VA 2P6VA 2A69F 4XLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJT A;  3K6G A;  4BJ6 C;  3CZ6 A;  3OWT A;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 3OYI A;  5B1B H;  1X2M A;  2IPQ X;  1D8J A;  3IQ6 A;  2Q2E A;  2HU9 A;  2WB1 A;  2TRT A;  4HNU A;  4ZYE A;  4JIO A;  2E34 A;  2BGC A;  3NMJ A;  1O3Q A;  1HQC A;  4EWC A;  5HSW A;  1T98 A;  3KET A;  2F5V A;  4PJL A;  4XLP F;  1I4Z A;  2GFH A;  3H5A A;  4U0W A;  4WAB A;  2ZB9 A;  2QNL A;  3JRM O;  2Y0S N;  2F22 A;  1QA6 A;  2V1U A;  3AGT A;  2Q7R A;  1J5Y A;  1D8K A;  2ZCW A;  1RC9 A;  2FX0 A;  2XAG A;  1ST6 A;  1VMA A;  3FOO A;  2FUG 2;  3FK7 A;  5DDG A;  3HOV J;  5JHF A;  4MIM A;  2EV5 A;  4F92 B;  3L2U A;  1VK5 A;  3FVY A;  4IRU A;  3ZWI A;  2KLO A;  2GA0 A;  4HF2 A;  2VKE A;  5GAG J;  4RM2 A;  1J75 A;  2X51 A;  3MZY A;  2XGX A;  3WU2 C;  1IN4 A;  5FLX Z;  2RSE B;  1PV3 A;  2EZL A;  2VKH A;  5DD8 A;  3OYK A;  5IT9 Z;  3LNQ A;  1NFO A;  3M9A A;  3ZMT A;  2CCY A;  2GM4 A;  1A0B A;  5EYR A;  4GYI A;  1HDD C;  1QU3 A;  5EG0 B;  5BMZ A;  1M2V A;  4IHV A;  4EBJ A;  1XSD A;  2LC2 A;  2X1D A;  4JKV A;  3F8N A;  5BS6 A;  3TDZ C;  2XLD A;  3TP0 A;  3TW6 A;  1LS4 A;  3ZQG A;  3RFY A;  4AIJ A;  3HL2 A;  2H6B A;  2JA2 A;  5CI8 A;  2ZXW H;  4HEA J;  4XN3 A;  1FPQ A;  1EH8 A;  4D0P A;  5JUA A;  3HUG B;  2E7X A;  3R6S A;  1HE1 A;  4CH7 A;  2EIK H;  3HGG A;  5IOZ A;  1FYK A;  4I44 A;  2L81 A;  3GO5 A;  1KNY A;  2X6O A;  2R7R A;  3AG4 C;  3PL8 A;  4XEV A;  2GAU A;  3U2R A;  2TCT A;  2KPM A;  5L3D A;  1QVT A;  4RGU A;  2W1O A;  4FT8 A;  4HA8 A;  1NG7 A;  1D5Y A;  4JTD B;  5DV5 A;  2EWN A;  2Z3Y A;  3F6O A;  3FIS A;  2HYJ A;  2VH3 A;  4EM1 A;  4EEF G;  4G7Z F;  3ZDL A;  2L9R A;  1ZK8 A;  1M2V B;  4N9H A;  3NAR A;  1DOW A;  2EA4 A;  1ZW2 A;  2XLW A;  4U5E E;  2HKO A;  2DTZ A;  4I6Z A;  3U2L A;  1E83 A;  3MQ0 A;  4BEH A;  2HTJ A;  4GGG A;  3WTU C;  2K9N A;  3AQC A;  1WJF A;  2DPU A;  4I02 A;  1VQL I;  1B1B A;  2XSJ C;  4A3C J;  2JA8 J;  5L3C A;  3S1R J;  2CMP A;  3OYE A;  4MTG A;  3BZC A;  5M5X J;  2BW3 B;  3HKZ N;  4EM2 A;  1M57 C;  4B8X A;  1DPR A;  2M64 A;  3FXH A;  5T1D B;  2R7V A;  5A6K A;  4JRZ A;  2F4M B;  2E2I J;  3UMK A;  4JVS A;  3GME A;  1RUN A;  2MBF A;  1ENH A;  1Z23 A;  2OPT A;  3H1C A;  2DYR C;  1HW2 A;  1TW2 A;  3NG1 A;  2W25 A;  3BTL A;  2W7N A;  3J7A Y;  4KIT B;  4C7O A;  2IOQ A;  3K4B A;  3R61 A;  1N78 A;  1BC7 C;  3BG5 A;  3GEZ A;  3NAU A;  1PP7 U;  3EHN A;  3QPS A;  2WL8 A;  2LK4 A;  3W2A A;  1FNN A;  2DT6 A;  1OKK D;  4FTH A;  1IGN A;  3H2V A;  4IO9 F;  5K7Z A;  1AKH B;  1BL0 A;  2JD3 A;  2IS2 A;  3TOB A;  3NYM A;  4IQJ A;  1BW6 A;  3KEO A;  2Y0S A;  4WCG A;  2K9M A;  2CQK A;  5IP7 J;  3L1P A;  3JRF A;  4XKV A;  4DRH B;  4ESB A;  4FAP B;  2STT A;  3JRC A;  2RNJ A;  3CUQ A;  4MVR A;  5D92 A;  2CUJ A;  1AUE A;  3RI4 A;  2BVM A;  2KYH A;  2R7S A;  2R0Q C;  1JRA A;  4CDY A;  1R1U A;  1Y39 A;  3HGY A;  1P4W A;  5D8L B;  2D1V A;  1JPJ A;  2DPD A;  3W6V A;  3GTL J;  3KYL A;  4EGY A;  3EHM A;  2KIQ A;  2XRN A;  4PDK A;  5E3O A;  2MHR A;  4C7O B;  4XPW A;  1T6Q A;  2DGJ A;  5AGF A;  4JJG A;  5FZT A;  3FBI B;  3S93 A;  1J8Y F;  2HVS A;  4JTC B;  5DLJ A;  1ZEL A;  1U8B A;  2KT0 A;  3AFH A;  3CMM A;  4PSW A;  5JVE A;  2AXT C;  2J5O A;  5IOY A;  3LUT B;  5CVJ A;  4GEH A;  3HSR A;  2ESN A;  1LS1 A;  3QPH A;  2VON A;  2L3D A;  1I50 J;  4NC6 A;  1ITY A;  2ZXJ A;  3E5Q A;  2XHK A;  4G7O F;  1NFN A;  3RYP A;  3E6B A;  4ABZ A;  2JZY A;  1LJ9 A;  5IYB J;  1GM5 A;  2HPI A;  1T38 A;  4U5C E;  2L01 A;  5DCM B;  2K7L A;  2VUM J;  1J8M F;  3FXK A;  3C2B A;  3RSN A;  4EQQ A;  4EAT A;  2KDZ A;  4BE0 A;  4G78 A;  2K02 A;  1FTT A;  1FP2 A;  3EQL F;  3JRG A;  4BJ6 A;  2AU5 A;  3G1M A;  3K7A J;  1MZB A;  2Y30 A;  3K1P A;  1P7J A;  4LDK A;  4GQH A;  2VJ5 A;  4LFU A;  3CO6 C;  3G2B A;  2V9V A;  1TT5 B;  1ZQ3 P;  4OIQ F;  4HPQ A;  2M4K A;  4BQN A;  4CGZ A;  1ZZP A;  3KEY A;  5GTH C;  2OZU A;  2LY1 A;  2E60 A;  4Z6Y A;  5BQI A;  1ZW3 A;  5JI6 A;  5DTD A;  4FX0 A;  3LST A;  5E79 C;  2V1D A;  2VT3 A;  2LH9 A;  1QKR A;  3US6 A;  5LBQ A;  4OIN F;  1L3L A;  3HOU J;  4RAF A;  2L9V A;  1YRN B;  4FX5 A;  1FYM A;  5L0F A;  4XN0 A;  5A6B A;  2VOP A;  2MYS A;  2VL8 A;  3HKZ A;  5JR3 A;  1JI8 A;  3ECO A;  2Y75 A;  1Q0M A;  3N4M A;  2YSR A;  5K5Q A;  5KYU A;  1MSF C;  4JCZ A;  2KK1 A;  2V1N A;  4E70 A;  1V74 B;  3V8K A;  1ZG1 A;  4E7S A;  3VDX A;  4G7H F;  3U2M A;  1BZ4 A;  3CTA A;  4HDU A;  2QM3 A;  2E7W A;  2V6E A;  4NQW A;  1FC3 A;  2QKM B;  2FJ1 A;  2WTE A;  3L2C A;  1ZAR A;  3V8J A;  4Y4R A;  3BR5 A;  3T8T A;  1IRZ A;  1V55 H;  2EB7 A;  4MTF A;  1GLN A;  1HDP A;  1QHG A;  5TIS C;  4IOA F;  3S90 A;  4L9V A;  5IPA A;  1S7Z A;  3DWW A;  3S9O A;  4HW0 A;  4FHT A;  2EPL X;  1WGX A;  5FKM A;  4G0H A;  2KW3 C;  4J7T A;  4HSR A;  3CP2 A;  2Z2S B;  2LRD A;  1APC A;  2UXX A;  4UV9 A;  2EPN A;  3HRU A;  3F8F A;  2FEZ A;  3QP6 A;  4BBS J;  3A11 A;  4CS7 A;  1U5T B;  2X6W A;  1ETX A;  4JCH A;  1R1T A;  2XAS A;  5F6F A;  3ZVR A;  2YU9 J;  4CJG A;  2F2E A;  1OLT A;  4IAQ A;  3BZK A;  4G6D A;  2Z16 A;  2OOC A;  3T4R A;  1FWZ A;  2HOE A;  3CD6 I;  5KYU B;  1WWX A;  2ME0 A;  1X1P A;  1Z67 A;  2IS1 A;  5D91 A;  1YE9 A;  2OBP A;  1OMI A;  5LRS A;  3QWL A;  4L18 B;  2ZME C;  3RW0 A;  2JSP A;  2KRH A;  2L4M A;  1IN5 A;  3DLL F;  2VOD A;  2J9U A;  2K86 A;  3UKG A;  4NQW B;  1IAW A;  1NK2 P;  2PX0 A;  4OIP F;  2YKZ A;  2BZT A;  2QGU A;  3WGH A;  5C4X J;  1V3F A;  4Y13 A;  3RZD J;  1W0T A;  3E97 A;  3GF2 A;  1IV8 A;  2VBZ A;  2MSY A;  4IRI A;  3ZSU A;  4DBQ A;  4KMU X;  5K5O A;  4C2T A;  1X1B A;  4JBA A;  2QSH X;  3VYU B;  3RF3 A;  2OQG A;  2BHZ A;  2ZXR A;  1H9G A;  3P9I A;  1R4N B;  3Q0V A;  4YFX F;  3FKI J;  5KCM A;  3CCR I;  4LIU A;  2J5P A;  1UMQ A;  3OYF A;  1DOV A;  3QTH A;  1BA5 A;  2ACJ A;  3KYI A;  5HV9 A;  4EM0 B;  2TDX A;  3SZG A;  2GQQ A;  4BQO A;  3OIQ A;  3R0J A;  3OYN A;  4OU0 A;  2EIM H;  2WVO A;  1BC8 C;  1RZ4 A;  3IHU A;  4BHP A;  1IRF A;  1EH6 A;  3JAM K;  3V5Z A;  2VKV A;  3WGG A;  2GAQ A;  2M87 A;  4AVZ A;  3V7S A;  1Z0X A;  2KRF A;  2XSE A;  3KEQ A;  4PGH A;  1XPX A;  3T6G B;  2CSO A;  2XIG A;  2CH0 A;  2IYL D;  1S9H A;  4ER9 A;  2JSC A;  2QE9 A;  1TTY A;  4CDG A;  2QUF A;  3BG3 A;  3A9C A;  4CYC A;  3ZQC A;  4D5F A;  4MLO A;  3HPH A;  4NTA A;  1QZY A;  4BDY A;  3DD7 A;  2DDA A;  2MLG A;  1ZHT A;  2KFD A;  1XCB A;  3T1B A;  3EFO B;  4IHW A;  3ERM A;  5D5V B;  3GOD A;  2WAF A;  1G6N A;  3TKY A;  4LLG F;  2XLV A;  1G5Z A;  3CF5 F;  4CCM A;  2NSF A;  3FHZ A;  3T6B A;  2HXO A;  2X48 A;  2XKO A;  3PUB A;  1AA7 A;  3C7J A;  2PBI A;  4A2U A;  4CZC A;  1AEP A;  1RET A;  5ILS A;  3FXJ A;  2K9S A;  4J30 B;  1WGW A;  1LVA A;  4WGZ A;  1UFM A;  5E17 F;  2DMT A;  4A0Y A;  5IYD J;  3DP7 A;  2ZO4 A;  2HV6 A;  3G6E I;  4YJW A;  3VWB A;  3OL3 A;  2O3F A;  3KLN A;  1P7I A;  1E3O C;  1PD1 A;  3MYI A;  3SP1 A;  4BG0 A;  2XPU A;  2PX3 A;  1CGM E;  1UB9 A;  1Z3X A;  1R00 A;  3N97 A;  1M6T A;  3C8G A;  4I76 A;  2LBF B;  1YI2 I;  3C2H A;  4XRM A;  2A5W A;  1WOL A;  3DE9 A;  3HTU A;  1ZTR A;  3D5R C;  2G7H A;  3EUH C;  4I1M A;  4R79 A;  1ZKG A;  4MGR A;  2AWY A;  5AC5 A;  4MW8 A;  3EUK L;  1J59 A;  3GLX A;  1H89 C;  3FMQ A;  4GYG A;  5L3F A;  2FML A;  4LIV A;  3GFJ A;  3BG7 A;  1R49 A;  2V6C A;  3BCB A;  1UST A;  1YIT I;  1H0M A;  3JYY A;  4JEA A;  3DBR B;  2ZJQ F;  5HNF A;  2VPR A;  4NC7 A;  3HEF A;  3M8F A;  1N25 A;  5FO5 A;  1S5L C;  2EFQ A;  2MW8 A;  3K6B A;  1R7J A;  4Y17 A;  2DAO A;  1ON2 A;  1ORJ A;  2ZNY A;  3PQJ A;  4C3E A;  3LNR A;  1VF9 A;  2K85 A;  2XPV A;  1JE8 A;  3H9Q A;  3H3V K;  1Q1H A;  4LG0 A;  3POV A;  2CW0 F;  4MTE A;  4EV0 A;  1W4M A;  1MMS A;  3JRA A;  3MBG A;  2HOA A;  1TW3 A;  3UGP A;  3PNY A;  3PIO F;  1G3S A;  5M5W J;  1WZ2 A;  1XGM A;  3MLG A;  1IN6 A;  1W7P A;  1FX7 A;  2P1A A;  1ZGA A;  1K83 J;  1LVK A;  4UUS B;  3MEX A;  3VYT B;  4HX8 A;  1I4Y A;  4GCV A;  5ILV A;  1J2X A;  2QSF X;  3DKY A;  5FFX A;  5FKK A;  5HVQ C;  1G4D A;  2JA5 J;  2CGE A;  3NKE A;  4M3E A;  1G59 A;  1SAX A;  2HZ8 A;  3L2Q A;  1FIA A;  4KN7 X;  4V2G A;  4XQF A;  3LSH A;  4D7M A;  4IGG A;  1BI1 A;  3AQB A;  5EGO B;  3L8J A;  1JUS A;  2QYO A;  3DPL C;  2VJJ A;  1MBG A;  1Y1W J;  5COF A;  3Q5F A;  2IA1 A;  1P4X A;  2DOA A;  1TWG J;  2Y69 H;  4Z9H A;  3CCJ I;  1QQ3 A;  1QBJ A;  3G3Z A;  5J1U A;  4CS9 A;  3QPT A;  4ENN A;  3A0H C;  4ZLD A;  3A03 A;  1IZ1 A;  2X85 A;  3HHG A;  3QVY A;  1VFC A;  1RPW A;  1W7P B;  2NVQ J;  1HSJ A;  4KT6 A;  3PCV A;  2YL7 A;  2J9W A;  5GP9 A;  1Z21 A;  2XLO A;  5CQE A;  3U1D A;  4DW6 A;  1QGP A;  2EZK A;  4PJJ A;  4GO1 A;  4XIC A;  3COA C;  2K4B A;  4A3B J;  5HDG A;  3I71 A;  1J7K A;  3M1C B;  2KSF A;  4NDL A;  1XX5 A;  1VQO I;  3FXQ A;  5F64 A;  3CUO A;  3A02 A;  5FJ8 J;  1OYW A;  2HQN A;  1IV6 A;  2AWC A;  1S05 A;  2PEX A;  5DM7 F;  3EH1 A;  1BR4 A;  3LWF A;  1DGR M;  2R7U A;  4QTR A;  3L2W A;  2PLY A;  3NQO A;  3ABL C;  3UMI A;  3QU3 A;  5LHI A;  1D0X A;  3EJN A;  3WG7 C;  2H8W A;  2X0L A;  2BVL A;  3KX2 A;  3TJ6 A;  1A04 A;  1QPI A;  2QEN A;  3ZOB A;  2DOE A;  3KLO A;  1FYL A;  3U8V A;  1I27 A;  2M3A A;  1YG2 A;  4IZZ A;  2NOG A;  2JMW A;  2QVO A;  1XMX A;  5HLH A;  2D1H A;  4U5F E;  5H6Q A;  3CJN A;  1OCZ H;  1ODD A;  3IEE A;  3J81 K;  3LL7 A;  1YJ9 I;  2ELK A;  3I54 A;  3E5U A;  4EJW A;  3IRR A;  4UVC A;  2PN6 A;  2A6E F;  2ZXI A;  5JS5 A;  3DBH B;  2GXA A;  2JA7 J;  5B1A C;  1RKW A;  4UDV A;  3ECH A;  5J4Y A;  2KNH A;  2HJ3 A;  3EYY A;  3OR1 C;  1W0U A;  3ABM C;  4IAO A;  2FNA A;  4CCN A;  2JPC A;  1OR2 A;  4PAC A;  2M34 A;  3E6D A;  5K1Y A;  3LAJ A;  1Y1V J;  1ZHY A;  2Z5U A;  4XLH A;  4W1U A;  2BXZ A;  1BI3 A;  2VCB A;  2FMY A;  5DQT A;  4RAG A;  2PFB A;  2GIV A;  4BQA A;  1TWC A;  1G2H A;  4LIT A;  3HG9 A;  1MND A;  5IYC J;  2V26 A;  4BL0 B;  4CS8 A;  2DQL A;  4EMS A;  2E1C A;  3ZC4 A;  3V5Y A;  2FXA A;  5TGT A;  1G3W A;  1GXQ A;  2EIN H;  4G6Q A;  4PZJ A;  4RGX A;  4HG2 A;  1BBY A;  5LFA A;  3I4N J;  4BGD A;  4QPQ A;  3S1N J;  2WZL A;  2XB5 A;  3K10 A;  2ZC2 A;  5BNG A;  1LI5 A;  2IXS A;  4UVB A;  4BAC A;  2WVQ A;  2FBH A;  3O8H A;  3IKT A;  3FAP B;  3WU1 B;  2VBX A;  3IV5 A;  1UZC A;  3HTS B;  1F4K A;  3RIP A;  1GV5 A;  3GAN A;  3Q0W A;  3H9J A;  1VQ9 I;  3JSE O;  1MNM C;  1BIA A;  3AG1 C;  3JAM Z;  3K33 A;  2WV1 A;  1LB2 A;  4IB4 A;  2W57 A;  3ULQ B;  2CFO A;  3W8I A;  4WF2 A;  3K9T A;  3AGU A;  1F9N A;  4BEJ A;  4LLN A;  3S0X A;  4E6K G;  2LF8 A;  2XLM A;  4XPX A;  5EHH A;  3WTY C;  2BYV E;  3WG9 A;  2EZI A;  3RQ4 A;  1YFH A;  1LPE A;  1V5G A;  5FRO A;  1MW7 A;  1JUM A;  3BLY A;  4M9S A;  1EA3 A;  2ZXO A;  1GUU A;  2O0Y A;  4HAM A;  2KP6 A;  2M45 A;  3O10 A;  3D1N I;  3BEH A;  2HQ5 A;  2HFI A;  2VN2 A;  5BQH A;  3B0U X;  5DD4 A;  2HPM A;  2RVC A;  2QLA A;  2XL6 A;  3BR1 A;  3GOR A;  2UWM A;  5K0I A;  4GDF A;  2VE8 A;  4KMF A;  2H09 A;  3BT9 A;  1SFO J;  1HKT A;  4RLF A;  1ONV A;  2F5E A;  2H8R A;  3Q7L A;  4CUG A;  4U7B A;  4NY3 A;  2K9Q A;  5KYY A;  2BE5 F;  2FSW A;  3G50 A;  1LDK B;  4MS2 A;  1I3Q J;  1I39 A;  2VQC A;  1N1C A;  1E3P A;  5TJ5 E;  2Z99 A;  3K4C A;  1O3U A;  3M4C A;  2RC4 A;  2XGE A;  1SF8 A;  5COM A;  2LD6 A;  5IY5 C;  2HDC A;  1LDJ A;  3V7R A;  1WJ5 A;  2W4M A;  4C9Y A;  3GEH A;  5EEH A;  3DAF A;  3KL4 A;  2PG4 A;  4HFF B;  2K5C A;  1BBH A;  5E20 A;  1JMW A;  3K1I A;  2LSE A;  1A6I A;  2CFX A;  4CHU A;  1YZA A;  2OAZ A;  1OCR C;  2LLK A;  3PFI A;  3U5S A;  3WHC A;  2W48 A;  1A35 A;  2AQE A;  3PM1 A;  4YEL A;  1RJ9 A;  2F5D A;  1TWH A;  1ETY A;  2BXY A;  3HRM A;  3TED A;  3H35 A;  4JTA B;  1T0F A;  4XRF A;  1DP7 P;  1H6G A;  3W2W A;  3BCA A;  3MKW B;  1EA8 A;  1X4P A;  1WTY A;  3CP8 A;  3F8M A;  3S1M J;  1ETQ A;  3LOC A;  1J09 A;  2O8X A;  3REO A;  4A0X A;  3KP7 A;  4N6C A;  2GA2 A;  2H1L A;  3HOY J;  3ABK H;  2AO9 A;  3T8R A;  3TO7 A;  3VYR B;  1I6X A;  1Z3Y A;  4EJT A;  3IPM O;  2A05 A;  1K4S A;  2R25 A;  2CV1 A;  3U3B A;  1YAU O;  1P92 A;  2VLA A;  5ED4 A;  2EPF A;  3G71 I;  1B9M A;  2QTV A;  2VCC A;  3DJN B;  1O7L A;  2R5Y A;  3KP5 A;  3SFZ A;  2VC9 A;  3CQZ J;  2MGQ A;  1JPN A;  3CCE I;  4A69 C;  4HST A;  3ABU A;  5EEA A;  5B66 C;  5IT3 A;  3KP4 A;  4XON A;  1RJ9 B;  2ID6 A;  5HS9 A;  3AG2 C;  3KYJ A;  2RAE A;  1UEL B;  4L5J A;  2XXA B;  4J19 A;  3AG3 C;  2H1K A;  1YQA A;  2R05 A;  3H5R A;  2D2W A;  2DDB A;  4EUK B;  5GPG B;  3BDD A;  3C2G A;  3PO3 J;  4KNV A;  1NBB A;  3VRC A;  3X2Q H;  1LQ1 A;  1YVI A;  2XVC A;  1TNT A;  3B02 A;  1X1C A;  5F0F A;  3DAG A;  1L0O C;  3GFL A;  3Q6N A;  1SMY F;  1TZL A;  1W36 C;  4L9J A;  2JA6 J;  4E18 A;  1D0Y A;  2P6T A;  4P5O A;  4ZYD A;  4OD5 A;  4PJ0 C;  4YII A;  3V5X A;  2NYX A;  2E5N A;  3QPL A;  1XN7 A;  1OR7 A;  5B3S H;  3OYD A;  4J7Y A;  3PQK A;  3W4Y A;  4HYE A;  5FRN A;  2CW8 A;  1R9T J;  3CEX A;  1ON1 A;  2I10 A;  4BHC A;  1Q0D A;  3NRV A;  3GTK J;  1SFE A;  4PFP A;  2VE9 A;  3GUD A;  2M8E A;  1T6I A;  2RKH A;  2P6S A;  4HF1 A;  3C63 A;  2QUP A;  3CLQ A;  1A31 A;  3R4K A;  2J45 A;  1RRJ A;  2R7O A;  2BOL A;  5EG0 A;  4MVM A;  2Q9C A;  4N0B A;  1VTN C;  2FQ3 A;  3I5P A;  3ZQQ A;  3BWG A;  1SAU A;  3CES A;  4HQE A;  4BDZ A;  1AHD P;  4RGR A;  1UJ8 A;  3A2K A;  5IP9 J;  1TR2 A;  4XR6 A;  2LMD A;  4RDA A;  2D4U A;  4BQQ A;  1WH7 A;  3DQV C;  4KT5 C;  1HF0 A;  3J7Z I;  4P96 A;  3MKZ A;  3KYC B;  1KU7 A;  2MD5 A;  4IRH A;  1MMN A;  1JGS A;  4A6D A;  1YLF A;  3F72 A;  1Q0F A;  3HUG A;  2Y9Z A;  3WGI A;  5CVU A;  4K7B A;  3KZY A;  2LFF A;  2HS5 A;  4PGG A;  1JHH A;  2J0W A;  4PUS A;  4RAZ A;  1GVJ A;  1Z91 A;  2IGO A;  1KYZ A;  3ZN1 A;  3K4J A;  3RCO A;  4RMN A;  2HZT A;  4CO8 A;  3MMY B;  2KJC A;  3AG4 H;  4I0B A;  3EGX A;  3OYG A;  1XDS A;  4XKW A;  2IXN A;  3IH2 A;  4RB2 C;  3KMI A;  3ZQF A;  1FOY A;  1MGT A;  1LE8 B;  4XMY A;  3QQA A;  3A4C A;  3JRI A;  3PHF 2;  5JLI A;  3LJB A;  3J81 Z;  4ZDO A;  1JT0 A;  2Q9A A;  2K27 A;  2PMH A;  4FCY A;  3CAX A;  4N06 A;  1XGS A;  2G7U A;  4WK8 F;  3K7D A;  1JKR C;  2BW3 A;  4X0R A;  3WAQ A;  5BQG A;  2V1X A;  3DLA A;  1ZAO A;  2BY0 A;  2A5Y B;  5HOO A;  4A3L J;  2LIG A;  3FBN B;  1I1G A;  2FA5 A;  2CV0 A;  1OW6 A;  4WXC A;  2XS1 A;  4LOC A;  1HBX G;  3I59 B;  2QF7 A;  2R02 A;  3FWE A;  3S2W A;  3BJA A;  3DPT A;  3LAP A;  2ZXH A;  2NVX J;  5AIQ A;  3SXK A;  1G4U S;  4KIF A;  2NVY J;  3VB2 A;  5A6A A;  4GRI A;  4M3B A;  3EGX B;  4BPM A;  2PI0 A;  4XRS G;  1K79 A;  4F55 A;  3FMR A;  2Z1D A;  4F91 B;  1WN0 A;  3I5Q A;  4XKC A;  2XUB A;  5E2Q A;  3S3O A;  5L0H A;  4F52 A;  4ZZD A;  2HDW A;  2ASR A;  2L2O A;  3BPX A;  1T5O A;  1POG A;  2NUT B;  1IDY A;  3M4O J;  1PUE E;  5A6J A;  5F5F A;  4CCO A;  2XRH A;  3SJM A;  2D45 A;  1IN8 A;  2MLK A;  3MKL A;  1P6R A;  3QRF F;  3F47 A;  1AKH A;  2WZF A;  4FET A;  1SVM A;  3C1D A;  1VQ5 I;  2UZK A;  5JRA A;  1T6S A;  3GEI A;  3MFK A;  4LB5 A;  1S8N A;  4BBR J;  9ANT A;  2MH9 A;  2NOJ B;  3GX4 X;  1MDM A;  2K40 A;  2IBD A;  3L2R A;  2ZKZ A;  3DU6 A;  3I58 A;  3JTH A;  3DEW A;  2ISY A;  4JX5 A;  4NHJ A;  3TJ5 A;  4E7Z A;  2AP3 A;  2A6H F;  4YEJ A;  4IXA A;  2M30 A;  4ON0 A;  1UHS A;  4UHT A;  4WWC A;  1DDN A;  5E1X A;  3S16 J;  4MW3 A;  4IQ4 A;  3W8H A;  1P2F A;  3TO9 A;  2IBF A;  3WTS C;  1HW1 A;  2YL0 A;  3S29 A;  3DTE A;  5LEK A;  3B0V C;  2X1C A;  4BXF A;  2G0E A;  2P81 A;  5AON A;  4XNF A;  3MWM A;  3MX3 A;  3W6K B;  3HBL A;  1FLI A;  2B0J A;  4MQ9 F;  1LUJ B;  2QQ8 A;  3HYI A;  2QSG X;  2CNW D;  3EUA A;  2EIK C;  1FMW A;  2L0K A;  3ZTZ A;  2E1M C;  4LG3 A;  4D9J A;  4BAY A;  1TKN A;  2DA3 A;  1Y6D A;  3M7G A;  2QWW A;  4IPA A;  4FES A;  3GBG A;  1TFO B;  2E2H J;  1HC8 A;  4YK5 A;  2Y48 A;  1R23 A;  3KZZ A;  2R5Z A;  4ZTJ A;  1MDM B;  2OQM A;  3DM5 A;  1HA8 A;  1SZI A;  2MH2 A;  2VIX A;  2UXN A;  1LE2 A;  2VC1 A;  3HM5 A;  4KN4 X;  1XS9 A;  1EJ9 A;  3GTM J;  3TGN A;  3LLK A;  5DCM A;  4QSH A;  3F0C A;  2DMU A;  4JP0 A;  5D5X B;  3WTV C;  3CO7 C;  3G4X A;  3OYJ A;  4DVY P;  2W85 A;  2LD5 A;  2DTR A;  5CVI A;  1O3R A;  1VLS A;  2V3C C;  2J7P D;  4RB1 A;  2W24 A;  4X6A J;  1I5N A;  1PDN C;  3VAY A;  3ZMS A;  3TP3 A;  2V9K A;  3GFI A;  2J9V A;  1MIJ A;  3K1M A;  3L34 A;  3OEO A;  2XL8 A;  1YO5 C;  3E6C C;  3S3N A;  1UG0 A;  1P9Q C;  1FJL A;  3S2H J;  3TD7 A;  2IS4 A;  4G6T B;  3K4L A;  1JGG A;  4YWQ A;  2L6H A;  2WY7 Q;  2W00 A;  4D4N A;  4OAZ A;  3RJP A;  2R5Z B;  1ETV A;  1VQK I;  3HHH A;  4CXF A;  3LSR A;  4PSX A;  4XOP A;  3ATP A;  1YYJ A;  1VND A;  1YRN A;  1ZHW A;  4JZA A;  4ESF A;  4U0Y A;  1D3Y A;  3I4M J;  4OIR F;  1FTZ A;  4NUB A;  3TQN A;  2J9B A;  1R6R A;  4IOC F;  2CRG A;  2L9S A;  3CUQ C;  4AYB N;  2DJI A;  3ZCO A;  2IW5 A;  1ETK A;  2L6G A;  2I8D A;  4BJT A;  3LSP A;  1O5H A;  4AE4 B;  4DRJ B;  5A2Q K;  5CJ9 A;  4Y7N J;  4UNO A;  3B6C A;  2YQY A;  2XM0 A;  2KJB A;  1MBF A;  1LIH A;  3ZQY A;  3KP2 A;  1ORY A;  4QLC U;  3OIP A;  3ZR8 X;  5HS7 A;  2NNY A;  1QZE A;  1S7O A;  1RNL A;  3R2P A;  2HGC A;  4CIH A;  4M3F A;  4JW1 A;  3K4N A;  3RVY A;  1BM9 A;  1SEU A;  1L7C A;  3X1O A;  2DBB A;  3MCZ A;  4RM3 A;  2DB4 A;  2NS8 A;  5JLW A;  4M9X A;  4KNW A;  4CDA A;  1K7A A;  1ZVZ A;  3Q0U A;  4RLQ A;  4NNJ A;  5J6X A;  3T5X A;  4FAS D;  1U5T A;  5CQG A;  4F3Q A;  3JR9 A;  3ZQ7 A;  3JRD A;  1MH3 A;  4D1Q A;  1ACI A;  3JRB A;  1ZG5 A;  4HX7 A;  2VJ4 A;  1E2X A;  2J8W A;  3QU6 A;  3LS1 A;  1AVO B;  2Z33 A;  2D5R B;  2PJP A;  1E85 A;  4B3A A;  2WAD A;  1PJR A;  3GZN B;  1O3T A;  3JZ0 A;  4XLE A;  1WKM A;  2HI3 A;  3AAF A;  2LP0 A;  4N4N B;  1I6H J;  2XS8 A;  3K4M A;  1XSX A;  2V4J C;  3A0B C;  3LSG A;  1NTC A;  2LFB A;  4H4K C;  1H8A C;  3F9K A;  3LEV A;  3B6A A;  4P9U A;  1PCX A;  3GTO J;  5H2F C;  2XAH A;  1XWJ A;  1TWA A;  3EG9 A;  4V19 K;  1QPM A;  3RPU A;  1LKX A;  4YIR X;  2EV6 A;  1R5I D;  3IKV A;  2AVK A;  3WTW C;  3O8G A;  3TW7 A;  3QMK A;  2CGP A;  1Z6R A;  5E8G A;  5JVG F;  5M3F J;  1XZP A;  1FBS A;  5ICG A;  3K1N A;  1FT9 A;  3DKW A;  3FX3 A;  1K61 A;  3PNV A;  1HCR A;  3ZN0 A;  5EK0 A;  4LD5 A;  2VT2 A;  3N05 A;  2ME6 A;  5KAF C;  2UUH A;  3G4S I;  1B4A A;  2Z9O A;  1K78 B;  4JX6 A;  3EZI A;  3I3L A;  2NUP B;  2K3P A;  2ZSH B;  3CC4 I;  4W8P A;  3EET A;  4DIQ A;  5D5U B;  4KI2 A;  2XGD A;  5LGT A;  3ITF A;  1W36 D;  3B71 A;  2BHY A;  1E84 A;  4U0V A;  5F27 A;  1QZZ A;  1TWF J;  4OMY A;  2VPL A;  4O79 A;  1S72 I;  4HF0 A;  2P0W A;  3EFO A;  5C3E J;  5J1Y A;  4KC9 A;  5FLM J;  1EKE A;  2LY9 A;  2DK5 A;  2GIZ A;  3ASO H;  2JJ7 A;  3IUO A;  4U87 A;  4C30 A;  2I5U A;  2I8B A;  1STZ A;  2AXL A;  2RDP A;  2ZME B;  2WC2 A;  2OF7 A;  1TWC J;  1V55 C;  3JCU Q;  2NAZ A;  4XM3 A;  4N4W A;  1D1A A;  4DJA A;  3GTJ J;  1QQI A;  2EJR A;  2DYS H;  1Z3I X;  1V5E A;  3FIW A;  1I3A A;  3HOS A;  4AYB A;  1YS7 A;  1RCP A;  4E0H A;  5DYM A;  3A01 B;  1R1V A;  2LCH A;  1W5S A;  4KIS A;  3PFY A;  3DEU A;  4JUR I;  1PP8 F;  4RGS A;  5IP6 A;  3HNI A;  1E86 A;  1B72 B;  1ZHF A;  2QQB A;  2LBF A;  3MZH A;  2YWA A;  1R71 A;  3GFM A;  2L9J A;  1X4O A;  4PJN A;  4IF4 A;  4WXD A;  3S15 J;  3R0A A;  2PJR A;  1B68 A;  1CPQ A;  1GDT A;  4BUP A;  2AQF A;  1GXP A;  2K9L A;  4S05 A;  1HOM A;  2LYC A;  4ZTF A;  1N77 A;  1A6Q A;  3RYL A;  2O8K A;  2CW7 A;  3KP6 A;  2R7X A;  3O55 A;  4A3I J;  3IWF A;  1SAN A;  3KPH A;  4DBR A;  3CMY A;  1UAA A;  2NSG A;  2AHQ A;  1HMD A;  4CSA A;  3QZC A;  1QRY A;  2LRE A;  5HS8 A;  1VQN I;  2E87 A;  1B8I B;  2OCC H;  4ZYG A;  1YS6 A;  1JOG A;  3QOD A;  2X1E A;  3HJC A;  2LK2 A;  1K04 A;  5L3V A;  2A69 F;  2QA4 I;  2DA5 A;  4QDL A;  1YIJ I;  3EUH A;  3I0T A;  1TQM A;  2BY1 A;  4Q47 A;  2PF4 E;  4KBL A;  2LY2 A;  2O9L A;  4AU7 A;  2R7Z J;  1FP1 D;  3VSL A;  1YTY A;  3ESW B;  4U5D E;  2PJR B;  2PP4 A;  4F7Z A;  3DU5 A;  2C04 A;  2O7O A;  1EQ1 A;  1BN5 A;  3GM1 A;  4HBL A;  2IA2 A;  3JSO A;  4C3I J;  3B73 A;  3F22 A;  2Y3H A;  2HQA A;  4UUS A;  3C62 A;  2Y9Y A;  2H7O A;  3ZRG A;  1T2K A;  1RKE B;  1T6U A;  3HDD A;  1PD0 A;  2R7Q A;  4D5C A;  1YW8 A;  2DA6 A;  2JWT A;  3SYN A;  4FE7 A;  4I3M A;  1DU6 A;  3BR3 A;  3KCC A;  4RBN A;  5EGO A;  3L0I A;  4U5B E;  3FM5 A;  3V7O A;  2F5C A;  1TWH J;  4AM3 A;  4RA2 A;  1LI7 A;  3JRH A;  3ASN C;  3FAJ A;  5LGN A;  1S7A A;  4B47 A;  4HQM A;  1ZGJ A;  1OXB A;  3M15 A;  2EIL C;  2DT5 A;  4PJM A;  4LMY A;  2HKX A;  4Q48 A;  2A68 F;  4IVN A;  3CDH A;  1QVU A;  2VI6 A;  1ORK A;  4IHT A;  3HLZ A;  2HYF A;  3MKY B;  2DN0 A;  1VLT A;  2MAB A;  2R93 J;  3Q9V A;  5EZH A;  4QWQ A;  3TL4 X;  2XL4 A;  1JTY A;  4Z2Y A;  2DMQ A;  1G8X A;  2A07 F;  4JE9 A;  2XF5 A;  4B09 A;  3JCU C;  1E0E A;  3F8C A;  2CUZ A;  3M1C A;  5K7H A;  1WCM J;  4G12 A;  1K6Y A;  4Y3O A;  4G94 A;  1LM3 B;  3K2Z A;  2CYY A;  3OS2 A;  3FXO A;  2GBY A;  5J8F A;  3LA3 A;  1YAR O;  1PUF B;  5KYX A;  3FDQ A;  2LFD A;  2DFI A;  3S84 A;  2LSO A;  1VQ6 I;  4P55 A;  2KIM A;  1OCP A;  4B6I A;  2XF7 A;  5BQT A;  3SZT A;  4CCL A;  3F3X A;  3ABL H;  4AK9 A;  3QOP A;  3MN2 A;  5J40 A;  3GZ5 A;  3H36 A;  4AUX A;  3V42 A;  3WG7 H;  1TNS A;  4LAC B;  2NVU B;  5A2Q Z;  1C17 M;  4F4B A;  1D1C A;  2HKV A;  2DJN A;  5L3E A;  2ZFU A;  3RQG A;  1WJB A;  3N24 A;  4IRG A;  3E9V A;  3LS0 A;  3HOX J;  2DMN A;  2L6F A;  3H0G J;  1TC3 C;  2JPU A;  1OCC H;  5J47 A;  3CCY A;  1QNT A;  3KH2 A;  2HYG D;  5CKT A;  3NMK A;  3AL0 C;  4MO7 A;  2HFH A;  4DNC A;  3CC2 I;  1BJZ A;  1FNT c;  1A36 A;  3DI5 A;  1R5G A;  3I4P A;  5ICF A;  4YT4 A;  4XPY A;  3F6V A;  3DKA A;  3SNH A;  1VYI A;  4TV7 A;  3OSF A;  5KYX B;  4RBO A;  5B1A H;  4IJA A;  1KTM A;  3VYW A;  4DZP A;  5FFZ A;  2M9H A;  4E0I A;  4CZZ A;  3H65 A;  2WY8 Q;  3G4Z A;  4MVO A;  4XEF A;  5JFR A;  2XSD C;  5DQZ A;  5DM6 F;  4MEX F;  4NTF A;  2P0N A;  4M3G A;  1D5V A;  1ZG3 A;  2YX7 A;  1OKR A;  4CS9 C;  1DU0 A;  4XID A;  3AL0 B;  1Y56 A;  3LAY A;  2KGO A;  1WI3 A;  5EF6 A;  3OYH A;  4HNV A;  2RD9 A;  5F0C A;  2FGY A;  1B59 A;  4MVU A;  2XLH A;  1SD7 A;  4FQG A;  4H54 A;  2JTV A;  4L0Z B;  5T3W A;  4V2F A;  3OMY A;  3ISP A;  1Q1V A;  3HOZ J;  2Y69 C;  3MYF A;  4KIB A;  3KKB A;  4IHS A;  3NEU A;  1OKK A;  5IT9 K;  3LES A;  3EGD B;  4EBB A;  4ASN A;  3S2D J;  2VQG A;  2OD5 A;  4BJ5 A;  2GA1 A;  3H0D A;  5DS9 A;  4O6M A;  3GLL A;  4A3M J;  1ZYR F;  2KHM A;  2CG4 A;  1MBH A;  1RES A;  2PX9 A;  2COB A;  2ESH A;  5FKN A;  2FU4 A;  3FXM A;  1NZE A;  3JRE A;  2PBE A;  2R7D A;  3HTK C;  2DA7 A;  4LLC A;  1LPQ A;  2STW A;  2HWV A;  4Q5S F;  2PNO A;  3LEO A;  3UMH A;  3HOT A;  1ERD A;  1NH3 A;  4B4C A;  1ULY A;  4L0Y B;  3ZPL A;  2DT7 B;  3OR2 C;  4BU2 A;  3I9V 2;  2B63 J;  4DYQ A;  4ZZL A;  1U2W A;  3GTG J;  3ONQ A;  1IF1 A;  3CCL I;  4YN0 B;  4J32 B;  2NRA C;  2VCA A;  2DXI A;  4C3J J;  4DXW A;  3GXO A;  3KFW X;  2NPU A;  5E3L A;  3TUL A;  2JN6 A;  4AL0 A;  5L0J A;  1FY7 A;  4AD9 A;  2O03 A;  2P7C B;  5GAE J;  3G1O A;  3SFI A;  2NS0 A;  2ETS A;  2G9W A;  2HNH A;  3RTR A;  1YA7 O;  1U6G A;  2YL1 A;  2EIJ H;  4NQF A;  4U5G A;  5FB2 A;  1OCZ C;  1ZHX A;  1S7E A;  2QLZ A;  5K7F A;  5EZG A;  3M79 A;  1OJL A;  4O5V A;  2LKS A;  3MZ8 A;  2PMZ N;  2ZJP F;  1GT0 C;  2M5W A;  1MNE A;  1RKT A;  1X3Z B;  1G4W R;  3FDY A;  3KIO A;  1UG2 A;  3H9G A;  3LFU A;  3TO6 A;  2W84 A;  1A7V A;  5A6B D;  2VQH A;  3SYT A;  1WH5 A;  2EZH A;  3I56 I;  2FD5 A;  5IY5 H;  3WOD F;  3HZJ A;  2P61 A;  2YVK A;  5K5R A;  4CS8 C;  4N6H A;  4LB6 B;  2RQP A;  2GXB A;  1LFP A;  4RAY A;  1NU7 D;  3K69 A;  3UGO A;  1WAT A;  2OU6 A;  1OCR H;  3QOE A;  4DYR A;  1F1Z A;  4QPO A;  3V8L A;  2R92 J;  3J7A O;  4A5N A;  4DQ2 A;  2IS6 A;  2JX0 A;  4XTK A;  3L9F A;  1Z05 A;  2DMP A;  4EVI A;  3OYC A;  5M5Y J;  1ZN2 A;  4II3 A;  4XKB A;  1Q0K A;  3L2V A;  2WZG A;  1KA8 A;  3BZ6 A;  3SXY A;  3CJR B;  2QY9 A;  1LNW A;  1V4R A;  4EBK A;  3IQ5 A;  2XDV A;  1QLE C;  3CMA I;  2EIN C;  2OEX A;  2KKO A;  5BPI A;  1OCO C;  3U21 A;  5KK1 A;  3HXL A;  3PUF A;  1MSE C;  1HY5 A;  3BR0 A;  1TQI A;  3SDB A;  3IWZ A;  3GYH X;  4O6N A;  3KP3 A;  4Z9J A;  5B3S C;  3CDI A;  1U9N A;  5FKO A;  4IKF A;  1ZLK A;  1YA9 A;  5A69 A;  2WA0 A;  3ZMU A;  1KZH A;  2V9P A;  5JSL A;  3C18 A;  2FOW A;  4XLA A;  5HLT A;  1IUF A;  2JPB A;  4AID A;  1CPR A;  2XXA A;  2OJQ A;  3K2A A;  1RR8 C;  1B9N A;  2M0C A;  4A4A A;  1K40 A;  1Z77 A;  1NG1 A;  4J01 A;  2LQG A;  2CDQ A;  3AG2 H;  1VB5 A;  3ZQL A;  4PR9 A;  2C6Y A;  3NYJ A;  3LQR A;  3PIP F;  3OY9 A;  3EPZ A;  4JQF A;  5D6F A;  4XK4 A;  2QZ8 A;  2JRM A;  2XAU A;  2HMQ A;  4BEM J;  2Q8K A;  2WB7 A;  1QO0 D;  1SD6 A;  1JJ8 C;  2V79 A;  1T95 A;  1XG1 A;  1QPU A;  2KZG A;  4HV6 A;  5D6E A;  1TFK B;  1OR3 A;  5FCL A;  1EH7 A;  2L7K A;  2DW4 A;  4FX4 A;  3BPV A;  5CVR A;  2HEO A;  3R7C A;  5L0D A;  1CGO A;  3K1I C;  3P9K A;  1FFT C;  4LLL A;  3RQI A;  4A93 J;  3CC7 I;  1R4T A;  3O3K A;  2CUE A;  2DQR A;  4A3J J;  1IC8 A;  4A3G J;  2VOO A;  3K6G A;  1MKM A;  4UXN A;  4WX9 A;  2P5L C;  2YU3 A;  1ZH5 A;  5D8K B;  2EK5 A;  5DS5 A;  1E3H A;  1V4A A;  1T0F C;  1Y6I A;  3IQC A;  2P7V B;  1WVR A;  5E1Z B;  4EIY A;  1YLM A;  2ZNZ A;  1CQT A;  3RDI A;  4YRV A;  2GDC A;  3KE2 A;  1YX3 A;  4EJV A;  2E19 A;  4EJO A;  2H7B A;  3QW0 A;  4AIK A;  3JW4 A;  3P9C A;  2GWR A;  3OS0 A;  2OV7 A;  3BY6 A;  3Q6M A;  3IRQ A;  3OYB A;  4M6V A;  2Q1Z B;  2VQL A;  3OWT A;  3TMO A;  3NRH A;  4P6I C;  2PMZ A;  4H0E A;  1K05 A;  5GAH J;  3LNM B;  4M63 A;  2M1B A;  4UB6 C;  2Q3T A;  3T0Y A;  1HKQ A;  4RDU A;  4BXX J;  3U9M A;  2CJJ A;  1GS9 A;  2EPO A;  2VJI A;  4M9Z A;  1SFK A;  1OIS A;  3FM3 A;  1GHC A;  2V7F A;  2HTS A;  3LSJ A;  1VOM A;  2KMU A;  1PYV A;  5J8C A;  1WHU A;  3ABK C;  2WBM A;  2FFH A;  4KYW A;  3VEP A;  1G3Y A;  4HEA 2;  2J0X A;  3ZTM A;  2X0C A;  2IAI A;  1REP C;  5C4J J;  5ICC A;  1LE8 A;  3K66 A;  1JTX A;  2E35 A;  3DBL B;  3HPG A;  4BE1 A;  3J06 A;  3S27 A;  3C8G D;  2WAE A;  4FWV A;  3F23 A;  5ILU A;  2O61 A;  3SEZ A;  5L3Q A;  2YX4 A;  3M4B A;  4N9I A;  2VBW A;  4WXH A;  5KNL A;  1F36 A;  3W2V A;  1CF7 A;  1TBX A;  4NB5 A;  5F04 A;  4ZC3 A;  1YJN I;  1ORS C;  4ESJ A;  1Z7U A;  5KYW B;  3HNL A;  1TWA J;  4I98 B;  1OR7 C;  2EQR A;  1V5F A;  2ZJR F;  1JJ6 C;  1FAP B;  2L54 A;  1TQG A;  1XTA A;  1OYY A;  4KDP A;  4JYK A;  3U0C A;  3I59 A;  1R36 A;  4ENK A;  2IEK A;  1Z6T A;  4O7G A;  2NVT J;  3E6M A;  5GAD J;  3X2Q C;  4BS9 A;  4MVZ A;  2IA0 A;  3C3W A;  1MBJ A;  2FQ4 A;  4OWR B;  1TL8 A;  1WPK A;  1XC5 A;  1XCV A;  4B43 A;  1KU9 A;  2ID3 A;  3ZMV A;  4JJF A;  2NUT A;  1C0W A;  3AKZ A;  1V54 C;  3NMI A;  2IJL A;  2OKU A;  3B0P A;  5FRM A;  4DYC A;  1SVO A;  3IH3 A;  1F43 A;  1HE9 A;  3WU0 A;  5HDK A;  1FTS A;  1JUP A;  3DEE A;  2O9X A;  1NK3 P;  1CF7 B;  2HXI A;  2P5K A;  3LSI A;  4HLY A;  5B1B C;  5LHG A;  4UUV A;  3R60 A;  3WHB A;  4PK4 A;  1W7P D;  2XAF A;  3U1K A;  2OTL I;  4BH9 A;  2H27 A;  3K70 D;  3NKD A;  3BJ6 A;  2Q2E B;  1VYK A;  1D0Z A;  5JVT A;  3S14 J;  3DJU B;  4CIP A;  3L09 A;  1AU7 A;  1VQ7 I;  2J46 A;  2GOX B;  1RR7 A;  4EJU A;  3BP8 A;  4FE4 A;  2K4J A;  1HST A;  3GVA A;  3ZQI A;  5DS4 A;  4DVZ A;  3MD2 A;  5B5E C;  3E7L A;  4J00 A;  2ECB A;  4DOZ A;  4ENJ A;  4HDV A;  3D5L A;  3JSP A;  2DYR H;  2MA3 A;  3LA2 A;  4QI2 A;  3HNJ A;  4CJO A;  5FD5 A;  4RD9 A;  2VBY A;  3JYH A;  3O6X A;  3IAM 2;  3ZQH A;  4HOB A;  2XRO A;  5AC4 A;  4D7N A;  3DPU A;  2FRH A;  3H92 A;  1WJC A;  2F5F A;  3QYB A;  4P9T A;  2UV1 A;  3O39 A;  5E33 A;  4BE2 A;  2KQ9 A;  3SDG A;  1FOX A;  2XLE A;  2JVG A;  2E36 A;  4Y33 A;  1FOK A;  1OQY A;  2MFZ A;  1KQ0 A;  2HQR A;  2LKP A;  4B1R A;  3RKY A;  2LG4 A;  4R1H A;  4GXO A;  2LTP A;  2VXZ A;  1KON A;  3E1S A;  2ZXW C;  4KJZ A;  3LMM A;  3BTJ A;  3LSK A;  4LK1 F;  3K1H A;  3ZMD A;  4KFC A;  1YJG A;  2BY3 A;  256B A;  5FKL A;  4AWX B;  4CDV A;  1MMA A;  4BHB A;  3H5N A;  3SXZ A;  3PSF A;  1LFU P;  3GWL A;  5CVV A;  2BL2 A;  4L5I A;  4XOT A;  2DFE A;  4U5H A;  3W3C A;  2GXG A;  3ZQV A;  2IRF G;  1ETW A;  4E4H A;  1QZX A;  2HUJ A;  3S1Q J;  3F21 A;  4A3F J;  5J3L A;  4CCK A;  2IVM A;  2JVH A;  2OUM A;  3SZP A;  3CCV I;  2CQN A;  2L7F P;  5DCF A;  1HW5 A;  3RPQ A;  1X3U A;  2F4O B;  2DOD A;  3M8E A;  3TBI A;  1RXQ A;  3U3F A;  1RI7 A;  3G1L A;  2A6T A;  2Z15 A;  4LLE A;  4AE4 A;  2IXM A;  4BEH B;  3ELK A;  2IP2 A;  2E1M B;  4PFO A;  1R58 A;  4EGZ A;  5FLV A;  3SZR A;  2L7Z A;  4HRI A;  2L4A A;  4OOI A;  2Y3G A;  3J80 K;  4MQV A;  4Q7C A;  4NTB A;  2IGM A;  2FF4 A;  3BR2 A;  3J7Y J;  1RKC A;  1SMT A;  3MVP A;  4A3E J;  1RUO A;  1J9I A;  1TLH B;  2E71 A;  2N8G A;  3CCM I;  1O57 A;  2WAQ N;  5CYV A;  2OC6 A;  4ZDL A;  2LDU A;  3E70 C;  4MTO A;  4GYT A;  2HOT A;  2M2E A;  3P5J A;  4E7H A;  4NC3 A;  3IH4 A;  3P7N A;  2EPM X;  5F5H A;  3ABT A;  4KIC A;  3F46 A;  1T33 A;  1JR8 A;  2QCO A;  2MG4 A;  2L5Q A;  4AVP A;  2ZSI B;  1YDI A;  1Z7Q c;  1R5H A;  2P6V A;  4W97 A;  3E5X A;  1D1B A;  2KDO A;  1GVD A;  1EV7 A;  2E1O A;  2XC7 A;  3FXU A;  2KQR A;  3DMD A;  2QQA A;  1BR1 A;  1BR2 A;  2R4G A;  2P4W A;  3RQF A;  2ZJ2 A;  3GM3 A;  3WTT C;  4X1E A;  1NG6 A;  3RIR A;  2X4H A;  3PSI A;  3DWL E;  4IEJ A;  3PO2 J;  2YR2 A;  3CQZ A;  3BRO A;  3BOQ A;  4JOM A;  3BJO A;  3E0J B;  1QHH D;  1HXD A;  1H88 C;  3CF2 A;  1MBK A;  3CUQ B;  4G8X A;  3FKJ A;  1WJD A;  4O3M A;  4OAY A;  2OG2 A;  4XWJ A;  4A0Z A;  2CWE A;  4YFN F;  4I1O B;  3CDL A;  4DGW B;  3TK0 A;  4ULV A;  1IDZ A;  5DVW A;  5E3A A;  1U89 A;  5LRR A;  2ZFW A;  1FBU A;  1GV2 A;  2I15 A;  3EPV A;  2UUZ A;  4LJZ F;  4QI0 A;  2MC3 A;  3K4K A;  3H2U A;  2CO5 A;  3OL4 A;  1MMD A;  1KU2 A;  2L02 A;  4CIC A;  1WWP A;  1MH4 A;  1EKY A;  1K78 A;  3SQN A;  4BJ6 C;  1Q0G A;  3QW1 A;  1EI7 A;  4A6E A;  3OSG A;  1ZR4 A;  3I55 I;  1C02 A;  5GTI C;  4C2M J;  2YZS A;  4R32 A;  4IX7 A;  1A5J A;  2G3V A;  2NUP A;  1IRG A;  1KGS A;  1AWC A;  2BEO A;  3DTK A;  1SFU A;  3C8Z A;  2PQ8 A;  1W2W A;  1PVE A;  4ENM A;  2WVN A;  1Y0U A;  5LHH A;  3JTG A;  3OA1 A;  5KAI C;  2UUI A;  2QKL B;  2LOO A;  3HJE A;  4UVA A;  3QYE A;  1BJA A;  5J1R A;  1W5C C;  4NC8 A;  4E7K A;  4HE8 D;  1W1W E;  1SD5 A;  2QBY A;  2EFP A;  1U5T C;  5J4V A;  3DF8 A;  2ZME A;  2P8T A;  5AIP A;  5DUK A;  1DQU A;  2COM A;  3WTX C;  3B29 A;  2OU2 A;  4M72 A;  4QIW N;  5BOX A;  2JK3 A;  4O6J A;  3VPR A;  1YIO A;  2A0U A;  3VF0 A;  4IAR A;  2RQQ A;  3OV8 A;  5E3C A;  2DU9 A;  1OYI A;  3K0L A;  1MJB A;  1JT6 A;  3ZP5 A;  3TOA A;  5E8I A;  1N75 A;  3A01 A;  1IG7 A;  4L9T A;  2ZPA A;  5FGM A;  2EV0 A;  3ECS A;  1SFX A;  5L0I A;  2BY2 A;  2XAJ A;  4YFK F;  1B72 A;  1ZRE A;  2L7A A;  2NXN B;  4A12 A;  4IHX A;  2P5V A;  1WJA A;  1K6O A;  1VTM P;  4MEY F;  3MFN A;  3WTZ A;  2HZD A;  2DFH A;  2VKD A;  4XLC A;  5D5W B;  2KZV A;  3LA7 A;  3PNT A;  5EDN A;  2WWY A;  4KUM A;  5F1J A;  3I4U A;  3QAH A;  4C3D A;  3TOL A;  5F0H A;  2OTJ I;  2WAQ A;  3PJR A;  3KZI C;  2KC3 A;  4HV5 A;  2QEX I;  3JTL O;  2QBY B;  1F1M A;  4LDR A;  2VB6 A;  3VOE A;  1MQV A;  4I0A A;  4M74 A;  2B9S A;  3V4G A;  4XBF A;  3DM9 B;  2L9N A;  1O3S A;  3CCU I;  3DZA A;  4NCQ A;  1B8I A;  1YW9 A;  1VI0 A;  3BR6 A;  4MFD A;  1ZHZ A;  3QVZ A;  3H3Z A;  5ERI A;  3PDM P;  2XKP A;  2M7B A;  3ZXS A;  2GWW A;  3CLO A;  1MBE A;  1OFC X;  3EDP A;  4YL3 A;  4MNU A;  4F93 B;  1IZM A;  1UG7 A;  1W5T A;  5HDN A;  3L8I A;  1KU3 A;  2DA4 A;  3FHN A;  2LKX A;  1WQ2 A;  4AIH A;  1M56 C;  5CI9 A;  2RGV A;  3DTI A;  4LGW A;  5L3B A;  1T8I A;  4HZF A;  2Q0O A;  3I64 A;  3KYD B;  2Q9B A;  2GZW A;  4DZJ A;  1A7D A;  4MVS A;  2R03 A;  1LEA A;  3GWN A;  1ZRC A;  3GEE A;  2XAQ A;  2RN7 A;  3GM2 A;  3VSK A;  1S3J A;  1RKE A;  2R7T A;  2EFW A;  4JEB A;  5GPA A;  2M4G A;  4M6Y A;  4HNT A;  1Z6A A;  3IAS 2;  1G3T A;  3HC7 A;  2Y3B A;  3L1M A;  4AX2 A;  1S6L A;  4M3D A;  4XSX F;  1TP4 A;  2CQ7 A;  2ELH A;  5EJC A;  3A1Y A;  5D4S A;  2ADU A;  1BI2 A;  4MTD A;  1DUX C;  2E2J J;  2EIM C;  1VQP I;  3ASO C;  3GTQ J;  3FOP A;  4DJ9 A;  3FXR A;  2RV8 A;  2EBI A;  4RB0 A;  3D5S C;  4HLX A;  2YLG A;  2OJE D;  4I99 C;  1IO2 A;  3ASN H;  2F48 A;  3BTC A;  3LQQ A;  1SYQ A;  3SHF A;  3CME I;  3S3M A;  4YT5 A;  1KYW A;  3ERE D;  2EIL H;  2IXO A;  4E17 A;  1FOW A;  1IXR C;  3U9J A;  5F08 A;  4K0D A;  2MD0 A;  3FF5 A;  2EFN A;  3RH3 A;  3EYI A;  4XQ1 A;  3HSE A;  4BJ1 A;  3PMR A;  2WV0 A;  1T39 A;  2HJM A;  2M0M A;  4ZLC A;  4UY8 I;  5M3M J;  2HV7 A;  3VOD A;  2HSB A;  4YL0 A;  1OQC A;  2XM4 A;  3Q3S A;  2CV2 A;  2DK8 A;  2Y2Z A;  1ZRD A;  1XGO A;  2D5V A;  3BRJ A;  5L0G A;  2B7E A;  1J0R A;  5LD2 C;  1DP3 A;  1SR2 A;  1Z1D A;  1WSU A;  2YS9 A;  2ISZ A;  1DPU A;  2MC4 A;  5E18 F;  1HKS A;  4CSA C;  3WE3 A;  5DEQ A;  4CYC B;  4M6X A;  4EKW A;  3CJT B;  1U78 A;  1PUF A;  2ZBK A;  4RS8 A;  2OA4 A;  1U8R A;  3LSM A;  1YYV A;  5KHD A;  4A3D J;  4UUT A;  4LDQ A;  3OYM A;  3E3V A;  4P9F A;  3FMS A;  1IUY A;  4XLF A;  1VZ0 A;  3EG9 B;  1HLV A;  2W9Y A;  3OYA A;  1A41 A;  1VQ4 I;  2OCC C;  2O5R A;  3QYF A;  1K4T A;  3FK6 A;  3DCF A;  2A1D D;  2YLI A;  1UCR A;  3ZMZ A;  3J80 Z;  4WGY A;  1X3W B;  3ROU A;  4ITV A;  2M4E A;  2W4B A;  4XLN F;  2DCE A;  1FZP B;  4OD4 A;  2KL4 A;  1XDU A;  1FSE A;  3IP4 B;  1SVL A;  2ICW G;  3CJQ B;  3L00 A;  3RKW A;  1I1S A;  3FXL A;  2IXP A;  2Y0M A;  3L7W A;  2CQX A;  1MJA A;  2BC5 A;  3C8G B;  1X2N A;  2QQ9 A;  2R9R B;  3GCM A;  1OPC A;  3RKQ A;  1M2O A;  4L6R A;  2KIU A;  1APL C;  4M73 A;  4IJJ A;  1ZU4 A;  1IXC A;  2PFD A;  1T9K A;  3H3U A;  1XD7 A;  1U0B B;  1FIP A;  1JAF A;  1BDJ B;  2A0B A;  1LFB A;  4KNY A;  4LK0 F;  4UV8 A;  1O87 A;  2MWQ A;  3B9Q A;  3IC7 A;  2YUS A;  3JRT A;  4Z9I A;  3WE2 A;  2H6C A;  2R7W A;  1LE4 A;  1ZGW A;  2NS7 A;  3K70 C;  1YZC A;  5CIV A;  2K3F A;  4NBQ A;  1YOV B;  3JSZ A;  3VYS B;  1JKP C;  3U8P A;  2IM8 A;  1X58 A;  4JX4 A;  4E7I A;  1X1A A;  1YHQ I;  1U6H A;  3TDU C;  4CSW A;  2PMU A;  1ZRF A;  2XPW A;  4AC0 A;  5HNH A;  4AL1 A;  4LG0 B;  3TQO A;  2Y39 A;  3EGD A;  3OOU A;  2HDD A;  4U7D A;  4WJ0 A;  2DI3 A;  3OIO A;  1AOY A;  6PAX A;  1XGN A;  1QSP A;  3BG6 A;  1NHA A;  1WAS A;  2LVS A;  4XOR A;  1WRJ A;  3ABM H;  1M1E B;  2JRT A;  3N2Z B;  2ECC A;  3RVZ A;  2KIS A;  3M8J A;  2FNP A;  4GFB A;  1OW8 A;  4YIF A;  3AJM A;  1FSH A;  4U9D A;  3W6J B;  2X6X A;  5HLG A;  4HFK B;  4Y15 A;  1XZQ A;  5H6R A;  2EFO A;  1FEX A;  3FHD A;  2DA2 A;  1YX5 A;  5L0C A;  4KIG A;  2YEV A;  2M8G X;  3ML6 A;  2H94 A;  4UB8 C;  1Y0N A;  1H7I A;  2FOK A;  4OMZ A;  4IWB A;  1FBQ A;  2RNG A;  5C44 J;  1HMO A;  4K1O A;  4U9E A;  1JXS A;  3HSF A;  5FLX K;  4ZDP A;  1QVX A;  2CNW A;  4ZYA A;  2TMV P;  3M3Y J;  5FD6 A;  5JLX A;  4BXU A;  2C03 A;  2DLL A;  4U88 A;  2W45 A;  1BOA A;  2JUG A;  4CYD A;  3RYR A;  2OCE A;  1IJW C;  2CS3 A;  1IXS B;  2DOF A;  2F4I A;  2LF7 A;  1MJ9 A;  4II2 A;  1Y8Q B;  1XB4 A;  1OCC C;  2KJG A;  4YT8 A;  4L5E A;  2LR8 A;  3D0S A;  3SXM A;  1R4M B;  2FE3 A;  3CZ6 A;  3AG1 H;  1IW7 F;  1VQM I;  3IQT A;  3EZH A;  5TRD A;  1O7F A;  1C03 A;  3UNG C;  2VAS A;  2Y31 A;  1UFB A;  3RZO J;  2J7P A;  2W82 A;  3BQY A;  1EF4 A;  4IL6 C;  1U0J A;  2HMZ A;  2HVR A;  5E3M A;  1FR0 A;  2L7M P;  3M1E A;  1T56 A;  1WJE A;  1JKQ C;  1Z9C A;  3TOM A;  3LFK A;  2Q4F A;  1BW5 A;  2BV6 A;  4C3B A;  3V7C A;  2F6C A;  4BJ5 C;  3CCQ I;  2ZD9 A;  1WFX A;  4K2E A;  4I01 A;  5E3N A;  5BPD A;  2BBY A;  3OYL A;  4RB3 C;  1KQ9 A;  4EHP A;  1XMA A;  4M71 A;  1Y4C A;  5DS6 A;  2R3S A;  3WHN A;  2M7A A;  3O2P E;  2CU7 A;  3Q9S A;  4I7H A;  3NWS A;  1ZU5 A;  4KA4 A;  4MND A;  4OIO F;  4N4O B;  3F8B A;  1DGW Y;  1OCO H;  2HSQ A;  1BIB A;  1ZLJ A;  3I53 A;  4XL9 A;  3M07 A;  3ZIB A;  1ZR2 A;  1NSG B;  3CSK A;  1UHW A;  4B3X A;  4I09 A;  1VQ8 I;  3DKX A;  2CUF A;  2YRF A;  1B6A A;  5COG A;  5L3G A;  3ZGK A;  1CGN A;  3HB9 A;  1IN7 A;  4BYY A;  4CA0 A;  1U3E M;  2LP4 A;  1H9T A;  1BI0 A;  4HX4 A;  1YW7 A;  1RIO H;  1YYX A;  4Q4Z F;  3VM6 A;  3EH2 A;  1FMV A;  4E7L A;  2Y3D A;  2JUC A;  3FZV A;  1NU9 C;  5F1R A;  2XV4 S;  2YHS A;  2IGN A;  3S17 J;  4LER A;  5EEG A;  3RPU D;  1LDD A;  2E1N A;  4XRS A;  1FFH A;  2FBI A;  2HVQ A;  2WB1 N;  4R8H A;  1MD0 A;  3RKX A;  1F5T A;  1OCT C;  4YL1 A;  4CX9 A;  2CQQ A;  3NWT A;  4FIS A;  1OXK A;  3LLI A;  2GOM A;  4Y52 J;  1L3P A;  2HOS A;  4O6Y A;  4B44 A;  4CCJ A;  2KIF A;  2JQ7 A;  5D4R A;  2AS5 F;  3HOW J;  4D4X A;  1T08 B;  4ANJ A;  1YJW I;  2IGK A;  2IT0 A;  2OQR A;  2YPR A;  2EIJ C;  1Y8R B;  2GLO A;  2YLD A;  3DE8 A;  1SC7 A;  4G9Y A;  1OW7 A;  1Z63 A;  1I5Z A;  4S04 A;  3HIF A;  5H20 A;  4IHY A;  3GTP J;  2A61 A;  2G3K A;  1RMV A;  3BG9 A;  3RQE A;  2B0H A;  2XB0 X;  2JT1 A;  3Q7G A;  2P7V A;  2ZXP A;  4MHG A;  4PCQ A;  3AG3 H;  3DFG A;  4S0H B;  4ZJZ A;  5DUI A;  2O6G E;  3AOU A;  5JT4 A;  2W4S A;  4B48 A;  2FAP B;  3BTI A;  2DA1 A;  3GZ6 A;  2XGC A;  3T9O A;  1TQP A;  1BOB A;  2YL3 A;  4BY7 J;  2E5Z A;  3HRT A;  2DO7 A;  5KVR A;  1KQ8 A;  2CYD A;  2FBK A;  3BC8 A;  5HLI A;  1GGQ A;  5TJJ A;  2H8A A;  4ONS A;  1R22 A;  1UHM A;  5CLS A;  4C2U A;  4CBE A;  1MMG A;  2XRL A;  3HRS A;  1USS A;  2NNN A;  3HNK A;  2EH3 A;  1WI9 A;  3OOP A;  3ZG1 A;  3HKK A;  1CGP A;  3BQZ A;  5KYN A;  5LEJ A;  1LEB A;  1SD4 A;  2G62 A;  3SEO A;  2A3S A;  2HR3 A;  5ICE A;  5JHU A;  3NYL A;  4YT2 A;  4ETS A;  1TT0 A;  3I5U A;  2X9D A;  5LLQ A;  4XSZ F;  3S28 A;  5KYY B;  2Q00 A;  1U9O A;  2B0L A;  1X19 A;  3JT1 A;  2XF6 A;  2OZ6 A;  3S8P A;  3NDB B;  1GQA A;  2RRE A;  4I2O A;  2ETH A;  3U9G A;  3RKO F;  5B3I A;  2H7V C;  1P4A A;  4ULW A;  2VXD A;  1A7E A;  2R7F A;  2EA2 A;  4P1W A;  2DYS C;  1S29 A;  1XSV A;  2VC0 A;  2DFF A;  3SEQ A;  3G73 A;  5KYW A;  5CPR B;  5F28 E;  1JKO C;  3UR3 C;  4ZYH A;  1T01 A;  1NLX A;  5EGY A;  2ELJ A;  4A2N B;  1XMK A;  5E1W A;  3GW2 A;  4A3K J;  4BKX A;  5T3T A;  2NG1 A;  5LGU A;  1JHF A;  1IRX A;  1X1D A;  3IL2 A;  1TWG A;  5JP7 A;  3OS1 A;  4MVQ A;  3N0T A;  4E7J A;  1Z5Z A;  4C3H J;  5HOD A;  4ZH4 F;  3S32 A;  1O4X A;  3MAJ A;  1E17 A;  3DV8 A;  4BNC A;  5BUO A;  4W8K A;  1Z7L A;  4MFE A;  4DRI B;  2OEV A;  4L9N A;  2LNB A;  3GWZ A;  2KRC A;  2EPK X;  2X6Y A;  5GPC A;  1V54 H;  3DXJ F;  4XEK A;  3T6J A;  4A5M A;  4JK1 X;  4X0G A;  3CCS I;  3VFZ A;  3QP5 A;  4YG2 F;  1ETO A;  4BY1 J;  2R5Y B;  3O6B B;  4JC7 A; 
#chains in the Genus database with same CATH homology
 1D1B A;  4QDL A;  2KDO A;  2PF4 E;  3OYI A;  4KBL A;  2LY2 A;  2XC7 A;  5DQT A;  2KQR A;  1TWC A;  3DMD A;  4LIT A;  2HU9 A;  2WB1 A;  3HG9 A;  1BR1 A;  1MND A;  4AU7 A;  1BR2 A;  4HNU A;  2R4G A;  2V26 A;  4BL0 B;  4CS8 A;  4EWC A;  3VSL A;  5HSW A;  4U5D E;  3ZC4 A;  2F5V A;  4PJL A;  2PJR B;  2GFH A;  2PP4 A;  3H5A A;  5TGT A;  4XLP F;  3DU5 A;  2C04 A;  1NG6 A;  5LFA A;  3PSI A;  3DWL E;  4HG2 A;  4BGD A;  4QPQ A;  4JOM A;  2WZL A;  2Y3H A;  3CQZ A;  3K10 A;  2HQA A;  3E0J B;  1QHH D;  2H7O A;  2IXS A;  4BAC A;  3CF2 A;  3ZRG A;  1ST6 A;  1VMA A;  2FUG 2;  3FKJ A;  2WVQ A;  1WJD A;  5JHF A;  1VK5 A;  4F92 B;  3L2U A;  4OAY A;  1PD0 A;  3FVY A;  4IRU A;  2KLO A;  2R7Q A;  2OG2 A;  4XWJ A;  3RIP A;  4RM2 A;  4I1O B;  2X51 A;  3SYN A;  4DGW B;  3GAN A;  3H9J A;  4I3M A;  3AG1 C;  4RBN A;  5DVW A;  3K33 A;  3L0I A;  4U5B E;  5E3A A;  3W8I A;  2CFO A;  2VKH A;  3EPV A;  3V7O A;  4BEJ A;  3OYK A;  3S0X A;  2UUZ A;  4E6K G;  4QI0 A;  3K4K A;  3OL4 A;  3ASN C;  1MMD A;  1KU2 A;  4B47 A;  3FAJ A;  2EIL C;  4BJ6 C;  5EHH A;  4PJM A;  3RQ4 A;  2YZS A;  1QU3 A;  4IX7 A;  1V5G A;  5FRO A;  1M2V A;  1MW7 A;  3BLY A;  2A68 F;  2G3V A;  2NUP A;  1EA3 A;  2ZXO A;  2KP6 A;  3HLZ A;  3MKY B;  2LC2 A;  2X1D A;  3DTK A;  3B0U X;  3RFY A;  2MAB A;  2HPM A;  1W2W A;  2XL4 A;  3TL4 X;  2UWM A;  2WVN A;  3OA1 A;  3HL2 A;  2JA2 A;  5CI8 A;  4HEA J;  1G8X A;  4XN3 A;  2QKL B;  2XF5 A;  2LOO A;  4RLF A;  1E0E A;  3QYE A;  3HUG B;  3Q7L A;  4NC8 A;  2CUZ A;  3M1C A;  4CUG A;  4U7B A;  4E7K A;  2BE5 F;  4HE8 D;  4NY3 A;  5KYY A;  4CH7 A;  1K6Y A;  1LDK B;  4Y3O A;  4I44 A;  2VQC A;  1N1C A;  2L81 A;  1DQU A;  3K4C A;  3OS2 A;  2R7R A;  3AG4 C;  3PL8 A;  5KYX A;  1SF8 A;  3FDQ A;  2KPM A;  5IY5 C;  2RQQ A;  2W1O A;  1WJ5 A;  1NG7 A;  5E3C A;  4C9Y A;  4B6I A;  3DAF A;  3KL4 A;  2XF7 A;  2ZPA A;  1N75 A;  4HFF B;  3ECS A;  2K5C A;  4CCL A;  2VH3 A;  2LSE A;  4AK9 A;  4G7Z F;  4U5E E;  1M2V B;  1OCR C;  3V42 A;  4LAC B;  4F4B A;  1D1C A;  2AQE A;  4YEL A;  4BEH A;  1RJ9 A;  2ZFU A;  1TWH A;  3AQC A;  1WJF A;  1WJA A;  1WJB A;  3N24 A;  2HZD A;  4XLC A;  2VKD A;  1NU7 D;  3E9V A;  2KZV A;  2XSJ C;  3PNT A;  3H35 A;  3I4U A;  3LS0 A;  4C3D A;  3W2W A;  2CMP A;  3BCA A;  3OYE A;  3KH2 A;  3MKW B;  2BW3 B;  5CKT A;  1X4P A;  3AL0 C;  2WAQ A;  3PJR A;  3CP8 A;  1M57 C;  1J09 A;  5T1D B;  2R7V A;  2VB6 A;  4YT4 A;  3UMK A;  3VYR B;  3SNH A;  1Z3Y A;  1VYI A;  4JVS A;  5KYX B;  3DM9 B;  2L9N A;  1Z23 A;  2CV1 A;  3DZA A;  3VYW A;  2DYR C;  3H65 A;  2VLA A;  2WY8 Q;  3NG1 A;  1ZHZ A;  2QTV A;  3J7A Y;  2W7N A;  3DJN B;  4KIT B;  5DQZ A;  4C7O A;  2M7B A;  3ZXS A;  2IOQ A;  3K4B A;  1N78 A;  1JPN A;  4CS9 C;  4HST A;  3EHN A;  4F93 B;  1IZM A;  3AL0 B;  2WL8 A;  1Y56 A;  3LAY A;  4XON A;  3W2A A;  2DT6 A;  1RJ9 B;  1OKK D;  3FHN A;  3AG2 C;  2XXA B;  1UEL B;  2JD3 A;  2KGO A;  1M56 C;  5CI9 A;  2IS2 A;  3DTI A;  3OYH A;  4IQJ A;  3AG3 C;  3NYM A;  3H5R A;  2FGY A;  2Y0S A;  3C2G A;  2K9M A;  2Q9B A;  4KNV A;  5T3W A;  4XKV A;  3OMY A;  2Y69 C;  3KKB A;  1X1C A;  3Q6N A;  3DAG A;  1TZL A;  1OKK A;  1SMY F;  1W36 C;  3VSK A;  1D0Y A;  3LES A;  4P5O A;  3EGD B;  4OD5 A;  2R7T A;  5D92 A;  2CUJ A;  4EBB A;  2E5N A;  2VQG A;  4BJ5 A;  2BVM A;  4O6M A;  3H0D A;  3OYD A;  2M4G A;  2R7S A;  2KHM A;  1ZYR F;  4HNT A;  1Z6A A;  3IAS 2;  5FRN A;  2Y3B A;  2CW8 A;  3HC7 A;  1JPJ A;  4AX2 A;  1NZE A;  3KYL A;  3EHM A;  4C7O B;  3HTK C;  4LLC A;  3A1Y A;  2DGJ A;  4JJG A;  2EIM C;  4PFP A;  3ASO C;  3FBI B;  3S93 A;  1J8Y F;  2HVS A;  3UMH A;  5DLJ A;  3HOT A;  1ERD A;  4Q5S F;  1ZEL A;  3D5S C;  3AFH A;  4PSW A;  3CMM A;  2DT7 B;  3OR2 C;  4BU2 A;  2J45 A;  4YT5 A;  2R7O A;  2BOL A;  3I9V 2;  3S3M A;  4GEH A;  2Q9C A;  2IXO A;  1LS1 A;  3I5P A;  3ZQQ A;  1SAU A;  3CES A;  4BDZ A;  4K0D A;  2MD0 A;  3ONQ A;  3A2K A;  3RH3 A;  1TR2 A;  4XR6 A;  4YN0 B;  4J32 B;  4BJ1 A;  4RDA A;  3PMR A;  4G7O F;  4ZLC A;  4BQQ A;  2M0M A;  3DQV C;  2DXI A;  2HV7 A;  3MKZ A;  2HPI A;  4U5C E;  2CV2 A;  1MMN A;  1J8M F;  5LD2 C;  3RSN A;  1DP3 A;  4K7B A;  2HNH A;  2MC4 A;  3RTR A;  4EAT A;  4BE0 A;  4CSA C;  2J0W A;  4U5G A;  1ZHX A;  4PUS A;  1OCZ C;  3EQL F;  4BJ6 A;  2IGO A;  3K4J A;  3RCO A;  2VJ5 A;  1MNE A;  4RMN A;  3FDY A;  3G2B A;  3H9G A;  3LSM A;  3MMY B;  3LFU A;  5KHD A;  3EGX A;  3OYG A;  4HPQ A;  3OYM A;  2VQH A;  4XKW A;  4OIQ F;  2M4K A;  3SYT A;  4BQN A;  3KEY A;  3WOD F;  2IXN A;  2LY1 A;  2E60 A;  4XLF A;  3KMI A;  1VZ0 A;  4CS8 C;  3EG9 B;  2W9Y A;  3OYA A;  4XMY A;  1LFP A;  2LH9 A;  3A4C A;  2OCC C;  2O5R A;  3QYF A;  4OIN F;  3PHF 2;  3UGO A;  2A1D D;  3QOE A;  3LJB A;  4FX5 A;  4QPO A;  4XN0 A;  2IS6 A;  4XTK A;  2MYS A;  4ZDO A;  3OYC A;  2Q9A A;  2VL8 A;  3HKZ A;  4ITV A;  1JI8 A;  2M4E A;  4II3 A;  4XKB A;  2W4B A;  4N06 A;  4XLN F;  2DCE A;  3K7D A;  4OD4 A;  2BW3 A;  2KL4 A;  3IP4 B;  3L2V A;  2WZG A;  3CJQ B;  4X0R A;  5KYU A;  3DLA A;  2IXP A;  2V1N A;  5HOO A;  3CJR B;  3FBN B;  3VDX A;  4E7S A;  2CV0 A;  2QY9 A;  4G7H F;  2XDV A;  1QLE C;  3DPT A;  2EIN C;  2ZXH A;  2V6E A;  1OCO C;  3U21 A;  2QKM B;  3HXL A;  1M2O A;  4GRI A;  4Y4R A;  3EGX B;  3SDB A;  4IJJ A;  1ZU4 A;  4O6N A;  2PFD A;  4F55 A;  1GLN A;  1QHG A;  2Z1D A;  4F91 B;  3I5Q A;  4XKC A;  5E2Q A;  5B3S C;  3S3O A;  1S7Z A;  4F52 A;  2NUT B;  2HDW A;  4IKF A;  2L2O A;  4G0H A;  2WA0 A;  1O87 A;  2KW3 C;  2MWQ A;  3B9Q A;  4CCO A;  2XRH A;  5F5F A;  4HSR A;  3JRT A;  3CP2 A;  2Z2S B;  2LRD A;  4XLA A;  5HLT A;  3F47 A;  2R7W A;  2XXA A;  2WZF A;  4CS7 A;  2X6W A;  4FET A;  3K70 C;  1NG1 A;  4J01 A;  2CDQ A;  4JCH A;  3JSZ A;  3VYS B;  1OLT A;  2NOJ B;  2Z16 A;  3NYJ A;  3L2R A;  3DU6 A;  4E7I A;  3T4R A;  5KYU B;  3OY9 A;  1X1A A;  3EPZ A;  4JQF A;  4CSW A;  4E7Z A;  2IS1 A;  5D91 A;  2A6H F;  4YEJ A;  4AE4 A;  1YE9 A;  2XAU A;  5HNH A;  2WB7 A;  2JSP A;  2KRH A;  3OOU A;  2Y39 A;  3EGD A;  2J9U A;  4NQW B;  1T95 A;  2PX0 A;  4WJ0 A;  4IQ4 A;  4OIP F;  3W8H A;  3S29 A;  3BG6 A;  3DTE A;  2L7K A;  5FCL A;  2X1C A;  4DBQ A;  3ZSU A;  4BXF A;  3B0V C;  4C2T A;  1X1B A;  4XOR A;  4XNF A;  3VYU B;  3MX3 A;  3N2Z B;  2B0J A;  4MQ9 F;  3M8J A;  2ZXR A;  3K1I C;  1FFT C;  4HFK B;  2X6X A;  5KCM A;  4LIU A;  3OYF A;  3EUA A;  2CNW D;  2EIK C;  3SZG A;  1FMW A;  3K6G A;  4BQO A;  2E1M C;  3OIQ A;  1YX5 A;  4LG3 A;  4D9J A;  3OYN A;  1TKN A;  2WVO A;  3FHD A;  4FES A;  2YEV A;  5DS5 A;  3GBG A;  1T0F C;  1Y6I A;  4IWB A;  4ZTJ A;  2RNG A;  3DM5 A;  1HA8 A;  1SZI A;  4ZDP A;  2CNW A;  2VIX A;  4ZYA A;  4YRV A;  1YX3 A;  4AVZ A;  3LLK A;  2C03 A;  2H7B A;  2W45 A;  2XSE A;  2JUG A;  3OS0 A;  2OV7 A;  2IYL D;  2CH0 A;  3Q6M A;  1S9H A;  3OYJ A;  4DVY P;  3OYB A;  2CS3 A;  2F4I A;  2Q1Z B;  2VQL A;  3OWT A;  3TMO A;  3NRH A;  4P6I C;  2V3C C;  2PMZ A;  2J7P D;  4M63 A;  4II2 A;  2Q3T A;  3VAY A;  1OCC C;  4MLO A;  2KJG A;  3HPH A;  4YT8 A;  2VJI A;  4BDY A;  2V9K A;  1SFK A;  3DD7 A;  3CZ6 A;  2V7F A;  1IW7 F;  1ZHT A;  2J9V A;  1VOM A;  2KMU A;  3L34 A;  3OEO A;  1PYV A;  3EFO B;  3EZH A;  3ABK C;  3GOD A;  3S3N A;  2WBM A;  2WAF A;  1UG0 A;  2FFH A;  4HEA 2;  2VAS A;  3UNG C;  4CCM A;  2J0X A;  1P9Q C;  2J7P A;  3T6B A;  2W82 A;  2IS4 A;  3TD7 A;  4CZC A;  3PUB A;  3K4L A;  1AA7 A;  4G6T B;  2DYS C;  3EG9 A;  2WY7 Q;  1U0J A;  2W00 A;  3K66 A;  3HPG A;  4J30 B;  4OAZ A;  4BE1 A;  1WGW A;  2HVR A;  3S27 A;  2WAE A;  4FWV A;  4PSX A;  4XOP A;  1ZHW A;  4JZA A;  3SEZ A;  2HV6 A;  4YJW A;  1WJE A;  5L3Q A;  4OIR F;  3VWB A;  3OL3 A;  4NUB A;  5KNL A;  1PD1 A;  1R6R A;  3W2V A;  3SP1 A;  2L9S A;  4ZC3 A;  4C3B A;  4BG0 A;  2DJI A;  2F6C A;  3ZCO A;  2PX3 A;  1Z3X A;  5KYW B;  4BJ5 C;  2I8D A;  1WFX A;  1OR7 C;  2W4M A;  1V5F A;  4BJT A;  3OYL A;  1O5H A;  4AE4 B;  2LBF B;  5DS6 A;  3C2H A;  4O7G A;  2A5W A;  2M7A A;  3X2Q C;  3D5R C;  4BS9 A;  3NWS A;  3EUH C;  1ZU5 A;  4MND A;  3OIP A;  3ZR8 X;  4N4O B;  4I1M A;  4OIO F;  1DGW Y;  4R79 A;  4OWR B;  3EUK L;  4B43 A;  4XL9 A;  4JJF A;  4CIH A;  3ZIB A;  2NUT A;  3CSK A;  3K4N A;  3AKZ A;  1V54 C;  4B3X A;  4LIV A;  3X1O A;  3B0P A;  3BG7 A;  3DKX A;  3BCB A;  4RM3 A;  5FRM A;  4KNW A;  4RLQ A;  3ZGK A;  4NNJ A;  4FAS D;  5CQG A;  4F3Q A;  5HNF A;  1FTS A;  4CA0 A;  3DEE A;  4NC7 A;  2O9X A;  4D1Q A;  3LSI A;  3K6B A;  5B1B C;  4Q4Z F;  2VJ4 A;  3EH2 A;  1FMV A;  4PK4 A;  3LS1 A;  4E7L A;  2Y3D A;  4C3E A;  3LNR A;  2D5R B;  1NU9 C;  3K70 D;  3NKD A;  2YHS A;  2Q2E B;  1PJR A;  1D0Z A;  2IGN A;  2WAD A;  3H9Q A;  1VYK A;  4XLE A;  3DJU B;  2CW0 F;  2J46 A;  4LER A;  3POV A;  2GOX B;  4N4N B;  3RPU D;  1FFH A;  2HVQ A;  3K4M A;  2V4J C;  3LSG A;  3UGP A;  3NWT A;  3LLI A;  3PNY A;  2GOM A;  4DVZ A;  3MD2 A;  4H4K C;  5DS4 A;  3F9K A;  3MLG A;  4O6Y A;  4B44 A;  3LEV A;  4J00 A;  4CCJ A;  4DOZ A;  1PCX A;  1LVK A;  1TWA A;  3D5L A;  3VYT B;  4QI2 A;  4ANJ A;  2IGK A;  1LKX A;  4RD9 A;  2EIJ C;  1Z63 A;  3DKY A;  5HVQ C;  2CGE A;  3JYH A;  3NKE A;  3O6X A;  1G59 A;  3IAM 2;  3QMK A;  3L2Q A;  4XQF A;  3LSH A;  2G3K A;  3AQB A;  3DPU A;  3Q7G A;  2P7V A;  2ZXP A;  4YWQ A;  1WJC A;  3PNV A;  3QYB A;  4ZJZ A;  3DPL C;  3N05 A;  2W4S A;  2UV1 A;  3O39 A;  4B48 A;  2VJJ A;  4BE2 A;  2KQ9 A;  5E33 A;  1BOB A;  4JW1 A;  2E5Z A;  2DOA A;  2JVG A;  3I3L A;  3EZI A;  3BC8 A;  4Y33 A;  2MFZ A;  2NUP B;  2K3P A;  4CS9 A;  2ZSH B;  4CBE A;  4C2U A;  1MMG A;  4DIQ A;  4ZLD A;  2X85 A;  4KI2 A;  2LG4 A;  3ITF A;  2VXZ A;  1W36 D;  1KON A;  3E1S A;  4KT6 A;  2ZXW C;  3ZG1 A;  4KJZ A;  3LMM A;  3LSK A;  2J9W A;  5KYN A;  1Z21 A;  2VPL A;  3K1H A;  5CQE A;  2G62 A;  4PJJ A;  3SEO A;  4O79 A;  3NYL A;  2P0W A;  4YT2 A;  1MMA A;  3EFO A;  3H5N A;  4KC9 A;  1TT0 A;  3PSF A;  3M1C B;  3S28 A;  5KYY B;  3ZVR A;  4U87 A;  3IUO A;  4C30 A;  2I8B A;  1X19 A;  3JT1 A;  2XF6 A;  4XOT A;  4U5H A;  3W3C A;  3S8P A;  3NDB B;  1V55 C;  3EH1 A;  3JCU Q;  4XM3 A;  1BR4 A;  1D1A A;  4DJA A;  2RRE A;  4E4H A;  1QZX A;  1Z3I X;  1DGR M;  2R7U A;  3RKO F;  1V5E A;  3L2W A;  2H7V C;  3ABL C;  4ULW A;  3UMI A;  3HOS A;  4AYB A;  2VXD A;  1D0X A;  4CCK A;  3EJN A;  2JVH A;  3WG7 C;  2OUM A;  4P1W A;  2BVL A;  3KX2 A;  4KIS A;  3PFY A;  4JUR I;  3SEQ A;  5KYW A;  5CPR B;  3TBI A;  2M3A A;  2A6T A;  2Z15 A;  4LLE A;  3UR3 C;  2LBF A;  4BEH B;  2IXM A;  4IZZ A;  2E1M B;  2ELJ A;  4PFO A;  3SZR A;  5EGY A;  2L9J A;  1X4O A;  4PJN A;  4A2N B;  4HRI A;  4U5F E;  2Y3G A;  3IEE A;  5T3T A;  2PJR A;  2NG1 A;  4Q7C A;  2IGM A;  3LL7 A;  2AQF A;  4BUP A;  1IRX A;  1X1D A;  2K9L A;  1TWG A;  2LYC A;  3OS1 A;  4ZTF A;  1N77 A;  3N0T A;  4E7J A;  1Z5Z A;  3RYL A;  2CW7 A;  2R7X A;  2A6E F;  2ZXI A;  3S32 A;  4ZDL A;  3E70 C;  2OC6 A;  5B1A C;  4GYT A;  5BUO A;  4W8K A;  1Z7L A;  4E7H A;  4DBR A;  2KNH A;  2KRC A;  1UAA A;  2X6Y A;  5F5H A;  3DXJ F;  3F46 A;  3OR1 C;  3ABM C;  3T6J A;  4IAO A;  3QZC A;  2LRE A;  4CSA A;  4CCN A;  2L5Q A;  4X0G A;  2E87 A;  2ZSI B;  3QOD A;  2X1E A;  1ZHY A;  3HJC A;  5L3V A;  2P6V A;  2A69 F;  4XLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...