3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
3K6GA 3CZ6A 4BJ6C 3OWTA 4BJTA 4BJ5C
chains in the Genus database with same CATH superfamily
1GV2A 3I5PA 3GTMJ 5CVJA 3B29A 4BYYA 4LDQA 3BJAA 5FKLA 3UGPA 1YA7O 1X2MA 1ZW2A 3S3NA 5B3SH 2FFHA 4AC0A 4H0EA 1SC7A 2MH2A 2JUGA 3A01B 2QNLA 4RLFA 3GFIA 1MJAA 1Q0KA 4BBSJ 1VYIA 4NQFA 1T08B 4JX6A 4ESBA 5EGOA 4J19A 2F5CA 2V9KA 2PX0A 4O3MA 3V5ZA 2I8DA 1KU7A 2YL1A 1B59A 1BZ4A 1B1BA 2PG4A 2EH3A 5JLIA 4LIVA 2R9RB 3VYSB 2EV5A 2ZXHA 4D0PA 2L7FP 1ORKA 5ILVA 1T6IA 3DLLF 4PK4A 3M1CB 3S2DJ 1EI7A 1S7OA 3CJQB 1FTZA 3W4YA 4HQEA 2HPIA 3OYGA 3ABMC 2IGMA 3VSLA 3IWZA 4CCLA 1U8BA 2X0LA 4XOTA 2CV2A 1VYKA 3IC7A 2YX4A 1OCRC 3FBNB 3W2VA 2G7UA 2V26A 1BDJB 1UFBA 3F6VA 3T9OA 2BY2A 5F27A 1R4MB 4L0ZB 3K70C 3B02A 1YQAA 4HDUA 2AU5A 4D4XA 3FAPB 3PIPF 2HZDA 4A3GJ 3GEEA 3ZQ7A 3C8GB 3GZNB 1RKCA 3HNKA 2E87A 3GMEA 2X0CA 2E1NA 1J8MF 3ZCOA 2ZXIA 2OUMA 4ETSA 5IP9J 5A6AA 4PJJA 4HF1A 2IPQX 1PV3A 2HYGD 1ZKGA 4DXWA 2KISA 4JYKA 1U5TB 3WTVC 4Q5SF 1SF8A 2W57A 4FE7A 3L0IA 5J1UA 1WQ2A 3KYJA 4WABA 5B3SC 3EUKL 4A0XA 3DAFA 4KICA 3H0DA 4LB6B 1FBQA 3GM1A 2WB1A 2JWTA 9ANTA 1IW7F 2LDUA 2YEVA 5AIPA 4XPXA 4IRIA 3V5YA 1EH7A 4I44A 2R7SA 3L1PA 3CO6C 5JHUA 1YIOA 3LL7A 4HLXA 4IJAA 2ESNA 4KITB 1C0WA 5DLJA 4IQ4A 4U9EA 1ONVA 2PMZA 2EZLA 5IOZA 1DGRM 1BW5A 3VF0A 2NVQJ 2MLKA 2XGXA 4KBLA 3T6GB 1Q0MA 3BPXA 5DCMB 4EJUA 5IYCJ 1GVJA 3H65A 3EJNA 4X1EA 5CIVA 1AEPA 1MBGA 3LMMA 4CS7A 5KNLA 1MH4A 3J80Z 2L9NA 3M9AA 4U5FE 3HG9A 1V5FA 3MZYA 3MVPA 4RM3A 1DPUA 2EFOA 2X1EA 2KW3C 3HOWJ 1AWCA 1NU7D 5HOOA 5EEGA 1M57C 2PF4E 5JFRA 4JJFA 1LB2A 1KYZA 1WWXA 3D5LA 1OMIA 3L2RA 3PCVA 2L4MA 2VBWA 1OCOC 1H7IA 1X4PA 3TO9A 4N6HA 2O03A 1TTYA 3IV5A 3HUGA 2Y3BA 2H94A 2IRFG 2LF7A 1R49A 2VONA 1J09A 1G4WR 4AVZA 3GXOA 3EH2A 5HSWA 1B72A 5E17F 1TWGJ 4XLCA 4KDPA 1ZR4A 1HOMA 4MTGA 2LLKA 4HDVA 5FROA 2A6HF 4YFNF 4NC6A 2EA4A 4HBLA 5FD5A 1WZ2A 5BOXA 1HMDA 1TR2A 2DYSH 2L6HA 3ABLC 3QZCA 4S04A 3DEUA 3CESA 2IS1A 1LDDA 3FXMA 5DM7F 1YHQI 3LUTB 1JMWA 3G1OA 2E60A 4I98B 3NWSA 3ZMSA 5KYNA 4HF2A 2CFOA 3L2WA 2K3FA 4EBKA 3WTZA 1USTA 2D5VA 1IN6A 2H6CA 3BPVA 3GTLJ 5COGA 2YL3A 1K04A 1FBSA 2P4WA 4OD4A 3RFYA 5AC4A 2FE3A 1J0RA 1R4NB 2ESHA 3JRAA 4MTOA 5LGUA 3BT9A 3TKYA 1QHHD 1DU0A 4HEA2 2ECBA 3REOA 3RDIA 1EJ9A 4IHXA 3PO2J 1HKTA 3CAXA 3AFHA 2HQRA 5IP6A 4I1OB 4WXCA 4U0VA 4CS9A 4XOPA 3OYKA 2EIMH 2IXMA 5LGNA 2BGCA 2HV6A 3QYFA 4XKCA 3EGXA 2K40A 1GT0C 3WHBA 1RUNA 3TJ5A 2GZWA 3OS2A 3HKZA 2VL8A 2M34A 3SQNA 3V8LA 1OFCX 3T4RA 1LEAA 1ENHA 2ZD9A 3IWFA 3TO7A 3KLNA 2ZB9A 3F8FA 3Q0VA 2NXNB 1PUFB 1U0BB 1MKMA 1Q1HA 3CCMI 4UXNA 3U1KA 4IQJA 2FSWA 3PSIA 4WK8F 1E17A 3I58A 2M4KA 1TWAA 2J9WA 4PJMA 1T6SA 1J9IA 3KEYA 4XLAA 4ZYDA 1H9GA 1JAFA 4MNDA 5GADJ 2DYSC 5BQGA 2CO5A 1E86A 1HSTA 2XAHA 2E1MC 2F5VA 5DYMA 3J81K 1RCPA 2DGJA 3HDDA 2ZXPA 4LOCA 3DEWA 1GGQA 3DWLE 3P7NA 2R5YB 1EQ1A 2W24A 3O3KA 4D1QA 4M74A 1X2NA 2HVSA 4HEAJ 4P9TA 2DN0A 3H9GA 1J2XA 5F28E 3SDBA 2CQXA 2OQMA 2PFDA 4XEVA 5EGOB 3EUHC 1EH8A 3E9VA 3ZWIA 1H9TA 3BWGA 4MTEA 5KYWB 1T0FA 1T8IA 2P6SA 2XS1A 3H5NA 4O6YA 3RIRA 3E6BA 2HUJA 1X1BA 3CCQI 3QOEA 1HXDA 1IDYA 3DJUB 2AXLA 4BJ6C 2WV1A 4GDFA 1HW5A 3JRHA 4XSZF 4KIFA 2O3FA 4A2UA 2GAQA 1U6HA 3FKJA 2IS2A 2DA4A 1QPIA 5FKOA 5GAGJ 1P7JA 2XGEA 3F6OA 4HE8D 2IXSA 3OR2C 3RPQA 5A2QK 2M87A 1FWZA 3ROUA 2P81A 1X3WB 3K1HA 1RUOA 3IP4B 2HQ5A 1MH3A 2QCOA 5KVRA 1Z05A 3KEQA 3DWWA 1XDSA 1XMAA 2M9HA 4A4AA 1EV7A 4M63A 2J45A 4M3DA 2NRAC 4TV7A 4A6EA 2VJ4A 4BH9A 4C3IJ 2ASRA 4MS2A 4ZYHA 2F48A 4LMYA 2HSQA 2Q2EA 5L3EA 1ST6A 4BHCA 4DRHB 5IY5H 3B0UX 1DP7P 1WN0A 1Q0FA 3F8MA 3NYJA 2JPUA 3E6CC 4BEJA 2YL0A 4IF4A 5DVWA 3NKEA 3UR3C 1W5SA 1DQUA 5K7FA 4JTCB 2H8WA 3KZIC 5DCFA 1ZHTA 1QPMA 3Q6NA 2XF7A 4HV5A 3S2WA 2K9MA 2KC3A 1T2KA 3IPMO 1RIOH 4JX5A 2KRHA 4X6AJ 4OD5A 2J8WA 1X3UA 2RV8A 3PM1A 2OD5A 1W2WA 3DKWA 3F22A 2ISZA 1LUJB 2CUEA 3LNRA 2M1BA 3BY6A 5GAEJ 2CSOA 1IRGA 4W8KA 1R1TA 5TGTA 1S72I 1ZRDA 3TOLA 1Y39A 2CGEA 3B73A 3L00A 4U7BA 2VCCA 1R5GA 1SFXA 1R7JA 3RYRA 1ZQ3P 5L3CA 4FX5A 2IBFA 4UY8I 3WU2C 3GWZA 3M15A 3HOXJ 3LNQA 2K27A 3FM5A 4PGGA 4OMYA 3F3XA 2KIMA 3O55A 2HOEA 1HF0A 1W36C 1LE4A 2Y2ZA 4CJOA 4JE9A 1OQYA 1ORJA 4L9TA 3WTXC 4E0IA 3E0JB 2OTLI 2MD5A 1BC7C 2JA5J 1JGSA 4I0AA 4B09A 1D0YA 2X1DA 2EIJC 2A5YB 4ENMA 1BR1A 2PBIA 3RIPA 1OQCA 3G50A 3ZQQA 2OC6A 3IKTA 2E71A 2HEOA 2VC9A 2VASA 3CC4I 5IY5C 2BHYA 2Z1DA 2PBEA 1ZG1A 2Q8KA 3VOEA 4C2MJ 4MFDA 3HUGB 4NCQA 2V1UA 2R7UA 1T6QA 1M1EB 1LI7A 4QWQA 4J7TA 5FLVA 3EYIA 4CS8A 3C8ZA 4IPAA 3NDBB 2GFHA 4HX4A 1PYVA 1VTMP 2E5NA 2QLAA 5M5WJ 1D5YA 3MFNA 2XS8A 4GO1A 3HC7A 4G12A 1R58A 2QQ9A 2WB1N 3HNJA 3V5XA 1OJLA 3D1NI 2XXAA 2DFHA 4D5CA 1Z7LA 1V4AA 3DQVC 2ELJA 1JKQC 4QIWN 3RKXA 1RPWA 1O3UA 2NNNA 4DNCA 5KYYA 3E6MA 1ETVA 3A02A 3K4LA 3ZSUA 2XB0X 1N75A 3BP8A 3X2QH 2I10A 3V7RA 1FSHA 3LSTA 1OYYA 4L5EA 4N4NB 5H20A 1G59A 2OEXA 3LNMB 4CJGA 1ON1A 3OYHA 3DV8A 2W48A 3GEHA 2LF8A 3I4UA 1KONA 3M4BA 3GTJJ 3CO7C 3TOAA 4MLOA 3E5QA 3SXKA 2Y48A 3JRIA 3QOPA 3TW6A 1DDNA 3JCUC 2DMTA 3EGXB 2XSJC 3ZC4A 2EV6A 5KYUB 5HNFA 1M6TA 3AL0C 2HFIA 3L8JA 4ASNA 1FX7A 2R7QA 1QVTA 1U6GA 1QA6A 2B0HA 1HLVA 3EYYA 2DPDA 2XLMA 2FOWA 3WTYC 2V9PA 1R6RA 1O3RA 3S2HJ 2EILH 5FZTA 2WVNA 4M6YA 4DIQA 1ETWA 3MKYB 2WVOA 2KKOA 1RZ4A 1USSA 3DP7A 1RESA 2JA7J 4JW1A 1N77A 1S3JA 2LD5A 2XSEA 1MNDA 2G9WA 2OZ6A 2NVTJ 4M73A 1W7PD 5B66C 2XASA 4A12A 4I01A 5BPDA 2R7TA 2J0WA 4G6TB 1DP3A 1IO2A 3G71I 2FEZA 2VB6A 4W1UA 5FJ8J 2HGCA 4XL9A 3A0HC 4KYWA 1EKYA 3U3FA 1EF4A 2DYRH 4CYDA 3IRRA 4YIRX 3NRVA 3DKAA 4KNVA 4FASD 3CP8A 3R0JA 3KMIA 2ZCWA 5EEHA 3FXJA 4J7YA 2LOOA 2RQQA 2V1DA 4E7IA 1LDJA 3OS1A 2DFEA 2VPRA 3A0BC 2EV0A 3CJNA 2LFDA 4NTBA 4EJOA 1MMGA 1Z9CA 3VRCA 4JC7A 2L4AA 3B6CA 4A3LJ 1DU6A 4EIYA 3KFWX 1O3QA 4PDKA 4M3GA 2AHQA 3CZ6A 3TDZC 2GA0A 3I54A 1ZG3A 5J1RA 4YJWA 3FOPA 3LLKA 5JS5A 1ZLKA 1P4WA 3OYMA 1YZAA 4BU2A 2FOKA 2AWYA 5C44J 2VOOA 2PN6A 4MTDA 3KP6A 1O3TA 3ECHA 3QPSA 5L0DA 2BEOA 4BL0B 2AWCA 1JKPC 2EILC 1JUMA 4D9JA 1C17M 3HNLA 4AL1A 5AC5A 5L0JA 2CQNA 2AXTC 4NC8A 4EJVA 2R7XA 1M2VA 5M5XJ 4RBNA 4C3EA 4O6JA 1VI0A 1VLSA 2MW8A 3BRJA 3JYYA 4BPMA 3PDMP 3HKZN 4C7OA 2AO9A 3A1YA 1QZYA 1QQ3A 3V4GA 1ULYA 4J01A 1P7IA 3D5SC 1XS9A 1AU7A 5FLXK 3CUQC 4BJ1A 3OYLA 1MW7A 2C6YA 2CNWA 2ZJPF 1TZLA 1JUSA 5E3MA 5CI8A 3OEOA 2DBBA 4WXHA 2GWWA 2DYRC 5DS4A 2CUFA 1TNTA 3WE2A 3UGOA 2O8XA 3Q0WA 4AIKA 2KIQA 4YFXF 2CQ7A 3MYIA 3ABUA 2EPKX 4HOBA 2TRTA 5DS6A 3HEFA 4DQ2A 3DTEA 1AVOB 2CFXA 2P7CB 4IHWA 2D5RB 5BMZA 4IZZA 4MVUA 3NARA 2DPUA 256BA 2KDZA 2M7AA 3G2BA 1FZPB 2HOTA 3H9QA 2STWA 5JUAA 5EZHA 4E7ZA 3Q5FA 2XHKA 1D1CA 3KEOA 4LFUA 3A2KA 2W45A 3C62A 3RVZA 3FXOA 3CJRB 2ME6A 1JI8A 1XSDA 2FUG2 2Q00A 4MVMA 2UZKA 1YO5C 4Y33A 2QF7A 2F5FA 1XG1A 5TISC 1X1PA 1Y6IA 2FQ3A 4M3BA 2EQRA 2GA2A 4HF0A 4ONSA 4BJ6A 3BJOA 3HL2A 4RAGA 4IWBA 3FHZA 3LAJA 3PIOF 3Q7LA 3F23A 3E5UA 4KUMA 2HKXA 3VWBA 5K7ZA 3PNVA 4PJNA 2QTVA 3L2CA 2MLGA 4C3JJ 2LBFA 3DLAA 5FD6A 3DU6A 3HZJA 4YIFA 3RH3A 3BG5A 5B5EC 4DYCA 2HYJA 3HOTA 2HOAA 3GX4X 3M1EA 4KT5C 1FIAA 2PJRB 3A4CA 1VLTA 3I4NJ 2W82A 3PNTA 3BEHA 1KQ9A 3BDDA 1OKRA 4AM3A 2HSBA 1JUPA 4FESA 4M72A 3MBGA 3I56I 2DB4A 5JSLA 2EIKH 5E1WA 3K7DA 1UZCA 4B43A 1NFOA 3J81Z 2DLLA 2V1XA 4JURI 4B6IA 4ON0A 5J4YA 1D8KA 3TOBA 4OINF 4XPWA 5A6JA 4PFOA 1SFEA 2A3SA 3FXUA 4IJJA 2JSCA 4R1HA 4BQAA 2HJ3A 3LWFA 2BXYA 3ASNH 4CH7A 2Y3GA 2ZXRA 1APLC 5J47A 4CS9C 2DXIA 4H4KC 1MGTA 1OCZH 1Z77A 1LFBA 3QYEA 5J6XA 2QQBA 1ZG5A 1I1GA 2FMYA 2OPTA 1G3TA 2L54A 3ZQVA 3GEZA 2MD0A 4UB6C 4IXAA 4AK9A 2IOQA 2R4GA 4PFPA 5KYYB 1J7KA 4C30A 1E3OC 1FIPA 1B8IB 1R5HA 3HPGA 3LSIA 4LIUA 4CYCB 3TEDA 2EZHA 1X19A 4NTFA 2JZYA 3OIPA 2W7NA 1ITYA 3I5QA 3V7SA 4RDUA 3K66A 4ENNA 1B4AA 3K1MA 1MBHA 3K4BA 3S32A 3TO6A 1XWJA 1B9MA 2NOJB 5KYWA 1PDNC 3MEXA 2HFHA 2ZJ2A 4S0HB 1HC8A 1IRXA 1XZPA 4MVRA 2M8EA 2JA2A 4MW3A 3G3ZA 3VFZA 2MABA 2DA3A 1P4AA 2VQCA 3OIQA 1O57A 1EA3A 5A2QZ 1NTCA 1CQTA 1G3WA 4G0HA 2VXZA 5IYBJ 1ZAOA 3K0LA 2XF6A 1RRJA 4U5HA 2Y3DA 3WAQA 3AGUA 1G3SA 5DV5A 4FX0A 4XEKA 3T6JA 3HPHA 1Y4CA 2JUCA 5B1AH 3JRMO 2DDAA 2EIKC 1OKKD 1OXBA 3G4ZA 3L8IA 2GIZA 2QEXI 4JCZA 4ITVA 4AVPA 3VYWA 2ME0A 3IKVA 4NC3A 2KJBA 1T0FC 1BBHA 4G6DA 4AIJA 3IUOA 5ERIA 3L7WA 4IRGA 1G6NA 3WE3A 4CHUA 4WGYA 1GM5A 3F9KA 3MLGA 2FBIA 4BEHA 3FMRA 3K7AJ 2P61A 2DA2A 3ASNC 3QTHA 4FISA 4LGWA 1U89A 5M3FJ 1POGA 5KK1A 4XONA 3I53A 4Z2YA 1BI3A 3B6AA 1R71A 1B6AA 5HNHA 3U3BA 4M6VA 1E0EA 2JPCA 3GM3A 4U9DA 1BI1A 1XDUA 3OSGA 2KJGA 1EKEA 2F2EA 1GDTA 2G7HA 2PMHA 4AUXA 4F7ZA 2OG2A 4IB4A 4KT6A 3ZQHA 1O7FA 4FCYA 5CYVA 3LESA 4YT4A 2DDBA 1IXSB 2IA0A 5B1BH 5D8KB 1TC3C 1XSXA 3I64A 5LHIA 1XB4A 3SDGA 2HR3A 2NAZA 2MSYA 2M5WA 3BTCA 4XBFA 1Y0UA 1HSJA 1Z6TA 3DAGA 1OCPA 4FE4A 4UNOA 3HIFA 1G4US 2OQRA 3HSRA 3TBIA 1R22A 1WGWA 3CCUI 4Q4ZF 1LS1A 1OCCC 4KI2A 2HZ8A 3E5XA 2V6EA 2L2OA 1K78A 2O0YA 1VQPI 3VYRB 1BR2A 5D92A 1BA5A 3C2HA 4MQ9F 2A6EF 2XAUA 2PFBA 1M2VB 4A3BJ 4OIOF 1LEBA 2NS8A 3JW4A 3KE2A 3ULQB 4O6NA 3C7JA 4ULWA 2FGYA 3CCSI 1O5HA 3BOQA 3U1DA 1K7AA 1AHDP 2EPLX 2DCEA 1CPRA 3JRDA 4K2EA 3F47A 2FNAA 1GXQA 5L3DA 4IRHA 4L5JA 3RZDJ 3HBLA 4Y7NJ 4I2OA 2ECCA 2M4GA 2H1KA 1GVDA 3IAS2 3WGIA 2E1MB 3BR6A 4QDLA 2BW3A 3N97A 2GDCA 1F9NA 2L9VA 1JJ8C 3ERED 5GTIC 2VH3A 3BR2A 5CPRB 2DT7B 3T8RA 1JXSA 3RVYA 4RB1A 2CV0A 4RAFA 1T5OA 1VK5A 4MVSA 2O5RA 1ZELA 4PJ0C 3RI4A 2ZNYA 3AGTA 1UG2A 2UV1A 2DJIA 3QWLA 2RREA 2CU7A 4Z6YA 2EK5A 1SD7A 3K1IA 1FPQA 3KP3A 4Y17A 5LHHA 1FYLA 5DS5A 3JTHA 4XRSA 4HX8A 2H1LA 4CGZA 1YS7A 4P1WA 1LDKB 1YX5A 1ETQA 2CW8A 4RB0A 3ZRGA 2OEVA 1CF7A 1WJDA 3ZOBA 3QPLA 3JRFA 2HDCA 3LEVA 3NEUA 2V3CC 5FFXA 1W5CC 2V7FA 2DMNA 3FXKA 1SMYF 4KNYA 4ULVA 3WU1B 1T95A 3U8VA 4CS8C 1V3FA 1I50J 2NVXJ 5KYXB 1JR8A 2CQQA 2R92J 1RR8C 3K70D 4KC9A 3V7CA 1S7ZA 1N78A 3G4XA 2F5DA 1HE9A 3M7GA 4NBQA 4AIDA 2JTVA 1ZHWA 2NPUA 2VOPA 4AYBA 4NQWB 2DOAA 1RJ9A 4LK1F 3QAHA 1QHGA 4UV9A 1IZ1A 3VDXA 3C3WA 4AU7A 3JT1A 1E83A 3POVA 2PX9A 3CUQA 2DFFA 1QO0D 2W4MA 2DMPA 2QKMB 4A5MA 4P96A 1NK3P 2P5KA 1UHMA 2M2EA 1YYXA 2VKVA 4KFCA 3LS1A 2EFWA 2Y0SA 2PP4A 1ON2A 5LBQA 1LPQA 1FFTC 2M4EA 1SFOJ 3V7OA 3GODA 2VN2A 2PMUA 1L7CA 4PCQA 3ZMDA 2IEKA 3AG1H 5D8LB 1PP7U 1ZHZA 2OCCH 1Z7Qc 3ZQGA 1Y1VJ 4IAOA 4MIMA 5EG0A 3AG4H 3S1MJ 1Q1VA 4ESFA 2GXAA 1Q0GA 1VOMA 3CD6I 4DGWB 2D45A 2H7BA 2IM8A 3CUOA 2WWYA 3CSKA 2BBYA 3VSKA 4ABZA 1JE8A 1D3YA 4CDAA 2OV7A 3M07A 1FAPB 5DD4A 4K0DA 4BQQA 2RKHA 3FBIB 5HLGA 1RKTA 1CGME 4CCMA 2XLVA 4B3AA 1DOVA 2KYHA 4FWVA 5A6BA 1JGGA 3BCBA 4A2NB 2ICWG 2X1CA 2NYXA 1SD4A 5M3MJ 4Q7CA 2DMUA 1XZQA 3L2UA 3DU5A 3GTOJ 3T0YA 2A1DD 1OXKA 1RI7A 3AG2H 2NG1A 2YLDA 3N24A 5EJCA 4CO8A 4EVIA 2L7ZA 5FKNA 1T98A 1HMOA 2A0UA 3HB9A 2BYVE 1WKMA 3KPHA 3I5UA 2QQ8A 4A3KJ 2XIGA 2EINH 3EFOA 3H9JA 3GTQJ 3I71A 2FBHA 3W8IA 4M9XA 5FLXZ 6PAXA 4Z9HA 2QYOA 2DA1A 4RB3C 5DD8A 4HYEA 3R61A 1V54H 2BZTA 2NVYJ 2VXDA 1FOWA 2VE8A 1IXRC 4BY7J 2BE5F 1Z63A 3ZQLA 3AG1C 2R7RA 2OCCC 3ZQCA 4P9FA 4BEHB 3VAYA 2FMLA 4GXOA 2O61A 1BI0A 4PSWA 4R8HA 1NBBA 4LDKA 4OOIA 4DYQA 2OU2A 3Q9SA 1FC3A 1UMQA 2BHZA 2BVMA 1SZIA 2CUJA 2UUIA 4PR9A 4A0YA 2QKLB 4HFFB 2XUBA 1VQMI 4MEYF 2J7PD 1WGXA 5D5WB 3PNYA 2OKUA 3NMKA 1WOLA 5EDNA 3CCEI 3EPZA 2JVGA 2J9BA 3DEEA 2KJCA 4RM2A 1FFHA 1TQIA 1TT0A 5LFAA 1FJLA 3ZXSA 4AX2A 3MKZA 1B9NA 5HDGA 2OZUA 1CGNA 2GA1A 2ZJRF 1ZR2A 3AG2C 4BXFA 2HDDA 2Z33A 4X0RA 3R2PA 3F0CA 3JCUQ 1OLTA 2Y0MA 2RQPA 2XRLA 3S8PA 1KU2A 1V74B 1TQGA 2MBFA 2VJ5A 4XK4A 2E1CA 1T33A 3EHMA 4MO7A 1W0TA 2EINC 5CVUA 5L0HA 4WJ0A 1K78B 3DE9A 1LJ9A 3TL4X 4B1RA 2OU6A 1UG7A 1ZHYA 2VODA 3JSEO 4XLNF 3CMMA 3JREA 3AL0B 2UXXA 3BC8A 4XM3A 3AG3H 2H27A 1V54C 4YRVA 4MW8A 3EQLF 1IRZA 3ZVRA 4AIHA 1WVRA 2DA5A 4HV6A 4U5EE 2UUHA 4OWRB 1K6OA 1V5EA 2HQAA 1SYQA 1P2FA 3FZVA 2Y3HA 4XWJA 2ZFWA 1YJNI 1DUXC 2I8BA 2CRGA 1PVEA 2L01A 2K9LA 1Z91A 2BW3B 1FSEA 4ZH4F 2C04A 2Q9AA 1KNYA 2EIMC 1VQKI 3OYDA 4BG0A 3M8JA 4ZYGA 2MYSA 4F55A 2E2HJ 2IS4A 4XLHA 4Q48A 1RXQA 5BQIA 4XICA 3RPUD 3OYFA 3KKBA 3C8GD 1W5TA 2L7AA 3IQTA 1YX3A 3OYNA 3O8GA 4YN0B 3QPHA 1T56A 1TP4A 2OAZA 3C1DA 2NS0A 2GIVA 2P8TA 2NNYA 4L18B 3GFJA 4KA4A 3DMDA 4CX9A 1VQNI 2OA4A 4MFEA 3L2QA 1HBXG 4U87A 1TWHA 3KH2A 3P5JA 3RQ4A 4B47A 3ELKA 2VC0A 3JRBA 4IOAF 1CF7B 5K0IA 3EGDA 3IAM2 2XAGA 2GQQA 3G6EI 4G6QA 5A69A 1MSFC 2ZBKA 2NUTA 4O6MA 3VPRA 1T6UA 4QLCU 3HRMA 1KZHA 1IN5A 1TQPA 1QZXA 2KP6A 5K1YA 2DQRA 3FMSA 3CC2I 2L6FA 3QW0A 3AG3C 4HNUA 5IP7J 5LEKA 3VM6A 4LB5A 2KIUA 5H6QA 4EHPA 4A69C 4DRJB 4GYGA 3OSFA 4XEFA 4L6RA 5AGFA 1X1AA 5E3AA 2RN7A 2OF7A 1MDMA 3K9TA 3K2AA 2LTPA 4F93B 3GCMA 1TLHB 3HRSA 1RC9A 2HI3A 4FHTA 3P9CA 3CCRI 2P6TA 3CUQB 1G2HA 1M56C 3DTKA 2XLDA 2PI0A 3QVYA 2EBIA 4I7HA 2E2IJ 1BJZA 3EG9A 3CCLI 2HTSA 2CQKA 3ATPA 1I3AA 5HS9A 2LKXA 1JOGA 1XGMA 4IHTA 2BVLA 3IRQA 4BJ5A 1T39A 4LK0F 5JT4A 3JR9A 4Y52J 1JHHA 1EA8A 2FNPA 5FFZA 1K61A 2ACJA 4JJGA 2VKDA 2CMPA 2LMDA 1TW3A 4WF2A 1MNMC 4HRIA 2VCAA 4CIPA 2K5CA 3CJTB 2YUSA 3Q7GA 2GOXB 2EZIA 2JX0A 3BR1A 3DBHB 3R0AA 4A6DA 2PX3A 2B0LA 4N4WA 2IXOA 4PZJA 1J5YA 4C2TA 4YT5A 2VQGA 1IV8A 2Q0OA 1IGNA 5E8IA 2O6GE 2CYYA 2JA6J 4U88A 5LRRA 1FYMA 1YOVB 2DTZA 5IT3A 3J7YJ 1W36D 2M0MA 4P5OA 3ZG1A 1KTMA 2LQGA 4A3EJ 1S7AA 1VB5A 3GORA 1OW6A 2EWNA 3BCAA 1FOXA 3CMAI 4LLCA 4Q47A 1VQ4I 2K3PA 1B72B 4G7ZF 1L3PA 1Z21A 1I1SA 3GZ6A 3M8FA 1MJ9A 3DZAA 1MJBA 3S29A 4F4BA 4GEHA 3NAUA 1JKOC 3CF2A 5E1ZB 3EFOB 1Z1DA 1RMVA 4QPOA 2Y9YA 1ZTRA 2YPRA 4A0ZA 5J8FA 1RETA 3HGGA 5COMA 2ETSA 3S0XA 1HW1A 1F1MA 1HKQA 3BQYA 4AYBN 4A3CJ 5H6RA 4S05A 3F8CA 2CJJA 1TQMA 4V2GA 1OW7A 4ZTFA 1KQ8A 1S9HA 3IH4A 2IYLD 1NG1A 2PMZN 2P1AA 4QI0A 4YWQA 3LA2A 2IA1A 1BOBA 1CPQA 2CYDA 1IRFA 1D1AA 3HRTA 2VT2A 2Y9ZA 2L7MP 3WU0A 4RMNA 4OIQF 4CIHA 1L3LA 2ZXOA 3TDUC 1QPUA 1C03A 2JRMA 4HSRA 5K5OA 3S27A 2Q1ZB 5LRSA 3GM2A 3W6JB 4CDYA 3GLLA 4YT8A 2LC2A 4RB2C 3AQBA 3OA1A 4I76A 1APCA 2WADA 3WODF 3LSRA 1K4SA 2CV1A 3IEEA 3S84A 3QP5A 5H2FC 3S3OA 4YL1A 5CVVA 2YVKA 1UG0A 1FOKA 1K40A 3PFIA 4P9UA 4E6KG 2WAQA 2MGQA 3VEPA 2NS7A 2LSEA 2WAEA 3VYUB 4KIGA 2M3AA 2DTRA 5FKKA 2W1OA 2HXOA 4BE2A 1SAUA 4LG0A 3W2WA 1U8RA 1WPKA 2Q4FA 1KQ0A 1H0MA 2YRFA 4BEMJ 2Y30A 1YE9A 4OAYA 4CA0A 3K33A 3EDPA 3MD2A 2DAOA 2EA2A 3OV8A 5IT9K 3AJMA 3ZMVA 2XKOA 2XVCA 3M79A 2DA7A 3B0PA 4C3BA 2ZXJA 3I0TA 5FRMA 5E8GA 1JT6A 3QODA 4DJAA 2XLWA 3H3ZA 4DOZA 3K1IC 3CCJI 2FXAA 1HDDC 4BXXJ 1OR7A 1VFCA 3E97A 4LD5A 3PMRA 4JQFA 1ZLJA 3OL3A 1YLFA 4IO9F 4UUSA 2R03A 2R7DA 5L0GA 1ETXA 1G3YA 3KYDB 1QKRA 1Y8QB 1ETYA 2DOFA 1OPCA 1A04A 3FF5A 4N9IA 4PUSA 2DT5A 3V8KA 3TGNA 3IL2A 1R9TJ 1LQ1A 2W00A 3LSMA 3NKDA 2EFPA 5EHHA 1NZEA 1ZHXA 1VQ8I 2NUPA 4O7GA 4X0GA 1ORYA 1K4TA 3KL4A 4JEAA 2BXZA 1ZW3A 3LAYA 2K7LA 3FHNA 2LSOA 5BQTA 1S6LA 1ZGJA 3U8PA 2B9SA 1FTSA 1MD0A 3BTJA 1BL0A 2HMZA 2RDPA 2B0JA 3CEXA 3RCOA 3PUBA 4HFKB 2LH9A 2B63J 1MMDA 1ODDA 4HPQA 4U5DE 5L3QA 1I6XA 3V8JA 3W3CA 1I39A 4JZAA 1E2XA 3LEOA 3FK6A 1IJWC 1JKRC 3FOOA 1FP1D 3T6BA 1YS6A 4YEJA 3DE8A 4UVBA 4NHJA 1ACIA 4L9VA 1HA8A 3C2GA 2QUPA 2O9LA 1Q0DA 3EGDB 5D5XB 2XGDA 4O5VA 2Q2EB 4BUPA 4EV0A 3K1PA 3I4PA 3DXJF 5KHDA 2NUTB 2O7OA 1SFKA 2XPUA 3IQCA 4JEBA 5JVGF 2BY3A 4J32B 1VQ7I 2HMQA 3F46A 4CCKA 5F6FA 1O3SA 4AD9A 4FTHA 1YW7A 1WSUA 2CUZA 1ZHFA 1SVMA 3G1LA 3ZQIA 1WCMJ 3A01A 4QI2A 2BV6A 1E3HA 2E19A 3LSKA 3MFKA 2ETHA 4J00A 4GCVA 5D4SA 4U5CE 2YL7A 1STZA 3FX3A 2CW0F 2LREA 2EB7A 2Z2SB 4ZZLA 5K5RA 5CJ9A 3ZP5A 1QU3A 3JTLO 4A3MJ 2YKZA 1YIJI 3O39A 3SNHA 3HYIA 3FAJA 3PSFA 3US6A 1D0ZA 4MVZA 3RQEA 3EG9B 1WJBA 1MMNA 2KFDA 2ZJQF 2ZMEC 1VMAA 1U2WA 1ZU4A 4HLYA 4ZTJA 3LA7A 1IG7A 3KYCB 4XLPF 4KNWA 2RD9A 1Z7UA 1TWAJ 2RAEA 2QA4I 2VJJA 1FMWA 2J0XA 2GBYA 3LQQA 2KGOA 2KZGA 3H5RA 4IHYA 4EBJA 5GTHC 4N06A 4HW0A 3DBRB 5C4XJ 1I3QJ 2GOMA 5CVRA 1U3EM 3I4MJ 4XTKA 2P6VA 4C2UA 2YLGA 2L5QA 5TRDA 1U9OA 2VBYA 1HQCA 3N05A 4NY3A 1K79A 1D0XA 1WH7A 3MYFA 2LVSA 4II3A 1U5TA 5FKMA 4BQOA 4QPQA 1BW6A 1QZZA 3BTLA 4RDAA 4CICA 1D5VA 5GP9A 3DCFA 1H89C 4CSAA 4HNTA 2ELHA 5GPCA 5BPIA 4B44A 4DRIB 2KNHA 1TWFJ 2YR2A 1YRNA 5HLTA 3DPLC 5JLXA 1GHCA 1K6YA 1ZZPA 4LACB 4HA8A 2XXAB 3RKQA 1YFHA 2J5OA 4XKVA 2E34A 3BTIA 4C9YA 1YI2I 2R02A 2X6XA 5CQGA 1XCBA 3SEZA 5JR3A 4K1OA 5F5HA 4IKFA 2FU4A 2XPWA 1VNDA 2LNBA 1TWHJ 2DJNA 3H3UA 3U2RA 2EPOA 4K7BA 3ZR8X 4EGYA 3IQ5A 2L6GA 3KETA 2G0EA 3HOYJ 4BY1J 2HNHA 1MIJA 3WTWC 2IT0A 4ZDPA 1S8NA 4XKWA 4DW6A 3KCCA 3WTSC 5F08A 4EJWA 1XCVA 3DPTA 2N8GA 3WG7H 4E7LA 5DUIA 1NSGB 2R7FA 5D91A 4G94A 1F43A 1LFUP 4M71A 2LY9A 4B8XA 3WTUC 3IQ6A 1TFKB 4EM1A 1LE8A 3RJPA 4XRSG 2LFBA 1YJ9I 2A6TA 1X1DA 4BKXA 4Y4RA 1HE1A 3HOSA 1XC5A 4E70A 1HW2A 2QY9A 2Z99A 1TBXA 4IOCF 2QSFX 2D2WA 4LLGF 5CQEA 2VC1A 1SR2A 3PQKA 2VJIA 4XRFA 1H8AC 2VT3A 2UWMA 4LG0B 5HLIA 1Z6RA 4DBQA 3OYBA 1Z23A 3RKWA 4EJTA 4OIRF 4NUBA 2KT0A 4UUTA 1OCZC 4KN7X 3BZKA 4E7SA 5EGYA 4LG3A 3H1CA 1QBJA 3RSNA 2L9RA 4B4CA 3TULA 3G4SI 3JAMK 2XF5A 2OTJI 1MZBA 2R5ZA 4GFBA 1DPRA 2XRHA 1V55H 1VQ5I 1NHAA 3QYBA 1LM3B 2IAIA 5DTDA 2GM4A 2GXBA 2WAFA 2Q3TA 5A6KA 5L3GA 1X58A 4UUSB 4LLLA 2P7VA 3E3VA 3S93A 3NWTA 2LP4A 3E7LA 5T3WA 3GANA 4CXFA 1FP2A 4PSXA 3WG7C 4DVYP 1MBFA 1SD5A 4XQFA 3KP4A 4IVNA 1YJWI 5CKTA 2D4UA 3QPTA 2RNJA 2E36A 2Y31A 3GZ5A 2VBXA 1ZK8A 4F3QA 4NB5A 5BS6A 4EATA 1PD0A 3BR3A 1WH5A 2IP2A 3EUAA 1R1VA 2FBKA 3K1NA 2ID6A 2LK4A 5B1AC 4ZLCA 4HAMA 4MHGA 3RKYA 1ZGAA 4EGZA 2QZ8A 3QRFF 5L0IA 3LFUA 3OOPA 1IAWA 3A11A 3S1RJ 2WTEA 1FMVA 1PUFA 2ELKA 2JRTA 1MMAA 1AUEA 1WFXA 1OR3A 2E5ZA 1TNSA 1XGOA 2DO7A 5D6EA 4C7OB 4CCJA 4IRUA 3HTSB 1QVXA 4XMYA 2J9VA 2C03A 2TDXA 3RYPA 1QNTA 3SHFA 2A05A 3GTKJ 3GTGJ 4OU0A 3PO3J 2M7BA 4F92B 2HKOA 3DM5A 2WAQN 4U5GA 4BJ5C 2WL8A 2HU9A 3K4MA 2Q7RA 1O87A 3S9OA 5HDKA 1KU3A 2R5YA 4NC7A 5LLQA 1W7PA 3LJBA 4BGDA 3HXLA 3GFMA 2NSFA 2G3KA 3CQZA 1V55C 1FNTc 2L7KA 4B3XA 2GXGA 3Q0UA 2IS6A 2H09A 1T01A 5BQHA 1ZRFA 4BACA 4N6CA 1SMTA 3ERMA 3ZMTA 2A0BA 2BOLA 3BZCA 4RAZA 5DEQA 5CVIA 3SFIA 5IPAA 1SEUA 2PEXA 1VQLI 1BOAA 5KAFC 2V9VA 4R79A 5B1BC 1NG7A 2IGKA 2KRFA 1JTYA 1FOYA 1SANA 3WG9A 3B9QA 2WC2A 2KSFA 1MBJA 2XLOA 3FVYA 2EPFA 3OOUA 4OIPF 2IVMA 1Y56A 4IEJA 3VODA 1SFUA 2VQLA 4IL6C 2Z9OA 1LIHA 1F36A 2L3DA 1LE2A 2DT6A 1YAUO 3OYEA 3ITFA 2RC4A 3W6VA 2Z15A 2DQLA 1XMKA 2W4BA 3FDQA 3DD7A 2UXNA 3FM3A 3RZOJ 5KCMA 2MFZA 1ZH5A 5EF6A 2VQHA 2X48A 4M6XA 4XSXF 2DODA 3FKIJ 3ISPA 1NH3A 5F0CA 3ZGKA 5CLSA 1UJ8A 2CGPA 2YZSA 3MN2A 5J40A 3TW7A 1I5NA 4XN0A 3GVAA 5HV9A 2DFIA 2LBFB 1C02A 5EK0A 4V2FA 1X4OA 4N0BA 1XTAA 5FCLA 2MA3A 1G5ZA 2JQ7A 4KMFA 1IV6A 2COMA 1A36A 3S17J 1Z6AA 1WRJA 4MGRA 5C3EJ 4JBAA 1R23A 2OCEA 1E85A 4JIOA 2HTJA 3OIOA 1OCOH 2W25A 3CMEI 1WWPA 2HDWA 4Y3OA 2PQ8A 3ZN0A 1YVIA 4D4NA 3Q3SA 3E6DA 2Y69H 2MG4A 3SZPA 2XAFA 1DOWA 3BZ6A 3F21A 2R0QC 4AL0A 1GV5A 5GPAA 2X4HA 5IT9Z 4I09A 2FF4A 4I02A 4DYRA 4DVZA 2HXIA 3OYJA 1XMXA 4M9SA 1D1BA 2QBYA 1LNWA 3U9GA 3GO5A 1M2OA 2F22A 2EFNA 4MVOA 1O4XA 4RAYA 3ABLH 1YRNB 1BN5A 2EZKA 2STTA 2XL8A 4JCHA 1XX5A 4HSTA 5L3FA 3ZN1A 2Z16A 2ZXWH 2K86A 3DKXA 3NYLA 2W9YA 1KU9A 1ZGWA 4RD9A 2LK2A 1U0JA 1WJ5A 4E7KA 5BNGA 4CZCA 3ZPLA 1LFPA 2ZMEA 1LVAA 3L2VA 2R05A 2WB7A 3H92A 3MZHA 1F5TA 5E2QA 5E1XA 2I5UA 1OYWA 3BG9A 4EM2A 2DU9A 4HNVA 2HS5A 4UUVA 3FHDA 5DS9A 4IGGA 2K4JA 3HJEA 2YQYA 3H0GJ 2CW7A 2XL6A 3ZQFA 3JRTA 3GUDA 2DW4A 5F0FA 4JOMA 2ZO4A 3RF3A 3RQFA 3PJRA 1LE8B 2EPNA 3HM5A 4GRIA 4RS8A 4DBRA 4YG2F 1BM9A 4FETA 3H2VA 1JHFA 1S5LC 1YDIA 4RGRA 4XQ1A 3ML6A 4FT8A 1OR7C 4N9HA 2QSHX 2Y69C 2RGVA 1UHSA 2A5WA 2L81A 3LQRA 1A7VA 2E35A 3DJNB 3TQNA 3U21A 3O8HA 2IXPA 3HJCA 1YG2A 3BG6A 3FK7A 3TP3A 3BROA 3DI5A 2VIXA 3F72A 5GPGB 3AG4C 1YYVA 3ONQA 3KP7A 4IAQA 2LCHA 3BR0A 3CLOA 2L9SA 2WZLA 1XSVA 1OR2A 2LG4A 2X6YA 2ZXWC 2CDQA 1LS4A 4BDZA 2J9UA 2M30A 1H6GA 2R5ZB 1FYKA 1AKHA 3RQIA 2LY2A 4EWCA 4XLFA 2F5EA 5ILSA 3KYIA 5TJ5E 3LAPA 1YITI 4FAPB 3KYLA 4BS9A 1REPC 2VPLA 1QVUA 1A5JA 1QRYA 1UB9A 2M8GX 2HVRA 1JRAA 2P7VB 3MX3A 3J7ZI 5K7HA 3T1BA 1ZU5A 4DZPA 1ZARA 1MBKA 1FY7A 2XC7A 4MNUA 4ZZDA 5FO5A 3WTTC 3CC7I 1ORSC 3N2ZB 3I9V2 4WCGA 3COAC 2ZNZA 3TD7A 3RW0A 4ZYEA 4KIBA 4ENKA 3HSFA 4Y13A 4ZDLA 5L3VA 2GAUA 3QP6A 4E18A 2E1OA 5KYUA 3GWNA 2IA2A 1FTTA 4ER9A 4OMZA 4YELA 5T1DB 3LLIA 3W8HA 1TWCA 3LSHA 4BAYA 2PNOA 2R3SA 5D4RA 2ZSHB 1BIAA 2CNWD 2IXNA 4H54A 1X3ZB 2WZFA 3AAFA 3KIOA 3VB2A 1MQVA 3U9JA 5COFA 2CWEA 1ZYRF 3FISA 4IHVA 1Z67A 2VKEA 5F1RA 3K4NA 1OKKA 2XM4A 2R7ZJ 3SZTA 2Y75A 5ED4A 3S1NJ 2QWWA 4I0BA 1AOYA 2XGCA 5E79C 2YWAA 1O7LA 3MKLA 3OWTA 1YARO 3S15J 3HTUA 3GLXA 4A3JJ 3A03A 2HVQA 2PLYA 3RKOF 3CDHA 1W7PB 1XGSA 5LGTA 4IX7A 1VZ0A 1LVKA 1YW8A 1BJAA 3SXZA 4WWCA 1H88C 5EEAA 3ASOH 5DQTA 1Y0NA 2JA8J 3EETA 4BJTA 4P55A 5B3IA 2ZC2A 4JX4A 4ENJA 5M5YJ 3HSEA 5J3LA 3TMOA 1NK2P 4MVQA 2E7WA 4MTFA 1MSEC 3PQJA 3RQGA 3DKYA 4BNCA 1PJRA 2VBZA 3H3VK 2NSGA 3QVZA 3M4OJ 3K10A 1WTYA 3C63A 3IH3A 4LLEA 2KK1A 1U5TC 2FX0A 3OR1C 3W6KB 2LYCA 1E3PA 2K85A 4L9JA 3HHHA 3G1MA 3BQZA 3HNIA 3EHNA 2F6CA 4QSHA 4JP0A 2ZPAA 1GQAA 4CSAC 1VQ6I 4LJZF 1IF1A 2R7OA 2LR8A 4G8XA 3UMIA 2D1HA 2YU3A 2W84A 3SZGA 3MQ0A 1Y8RB 3O2PE 2FJ1A 1P92A 1IN4A 2XM0A 4YL0A 1WJFA 3PHF2 3U5SA 1B68A 4UVAA 5L0FA 3DTIA 3SXMA 3FXHA 1RJ9B 2MC4A 3O6XA 4XLEA 3K69A 1A0BA 4ZDOA 1IZMA 2EIJH 4E4HA 4GQHA 1A7DA 3ABKH 2ID3A 3LS0A 1JJ6C 2OJED 2QVOA 4G78A 2F4MB 2K9SA 2TCTA 3E1SA 5E3OA 2V4JC 3SYNA 5LD2C 3FMQA 1A41A 4MEXF 3ZIBA 4CZZA 4XNFA 3K6GA 2P0NA 1KGSA 1X1CA 4RBOA 2LY1A 1DGWY 1MBEA 1ZRCA 2IBDA 2M64A 3K2ZA 4MQVA 4A3DJ 1YLMA 1TT5B 1PUEE 1A35A 1YW9A 3PFYA 4RGXA 2RNGA 4U5BE 1SVLA 3ASOC 5EYRA 2QBYB 2G62A 2V1NA 4F91B 2CS3A 4NNJA 2JK3A 3JAMZ 5EG0B 5HLHA 1FEXA 1JT0A 4ZLDA 3BG3A 3LSJA 2XKPA 3MKWB 2H7VC 4EUKB 4KMUX 1P4XA 5FRNA 1QSPA 2YS9A 3SJMA 1U78A 1JPJA 3H2UA 3ESWB 5KAIC 2J46A 4DJ9A 2WY7Q 2K9NA 1R5ID 3S1QJ 4I6ZA 1N1CA 1WJCA 2VKHA 3Q9VA 1VQ9I 3S14J 2RVCA 2XRNA 2ZMEB 3HGYA 2FQ4A 3OMYA 4AWXB 2VE9A 4A3IJ 1ETKA 1UCRA 2P0WA 5FB2A 2V79A 4I99C 2AS5F 3NQOA 3I3LA 4L5IA 2LRDA 3MWMA 4FQGA 3KP2A 1WJEA 2XV4S 2AQFA 2NOGA 4EBBA 3BR5A 5JRAA 3K4CA 5E18F 1Z3IX 1WI3A 4RLQA 3D0SA 1TL8A 3CQZJ 3GFLA 2D1VA 4E7HA 1Z3YA 3AKZA 3EZIA 3SZRA 2J5PA 1ERDA 1A6IA 1S7EA 4YFKF 2EFQA 3ABKC 2JMWA 2PJRA 3M8EA 5ICGA 3U9MA 1I27A 3NG1A 2QGUA 3KLOA 3GW2A 3HOZJ 3I59A 3SYTA 1PD1A 1JPNA 3U2LA 2YHSA 2O8KA 3JSOA 4YT2A 1EH6A 2F4OB 2F4IA 2M45A 4RA2A 1V5GA 3OYCA 1UAAA 3O10A 1RNLA 2YU9J 2JJ7A 1GLNA 4CSWA 3OYAA 3U0CA 3X1OA 3P9IA 4J30B 2MWQA 2XB5A 5BUOA 1BBYA 2E2JJ 1P9QC 1R00A 2MH9A 3H5AA 4BE0A 2Q9BA 5DM6F 1ZVZA 3B71A 3JYHA 2Y0SN 4N4OB 2BY1A 1IC8A 3R4KA 4KISA 2Z5UA 4JTDB 1OISA 3D5RC 3FXLA 3L09A 3F8NA 1AKHB 1WJAA 4R32A 4ZC3A 1F1ZA 3FXRA 4W97A 3HOVJ 3F8BA 3KP5A 3IHUA 4UVCA 2WZGA 3GYHX 4CUGA 1R36A 2XPVA 4CYCA 1B8IA 4KJZA 1QLEC 1RKEA 1OYIA 1I6HJ 2I15A 1Z3XA 2YSRA 1IUFA 1YJGA 5JHFA 5E3NA 2HQNA 5ICFA 2R7VA 1Y6DA 4D7NA 3PL8A 1W1WE 3TP0A 3QMKA 2Q9CA 4JRZA 3BLYA 3MAJA 2DK5A 4LERA 3ZMUA 2IGOA 5K5QA 3DM9B 5F04A 3LSPA 2KIFA 2P5VA 1BR4A 3H36A 4HX7A 4BHBA 1PP8F 3I55I 2Z3YA 2HWVA 2HV7A 2X51A 5HS8A 4G7HF 4A5NA 1XPXA 4I3MA 4AE4A 4II2A 2WV0A 2O9XA 4BBRJ 5JVEA 2QLZA 3K4KA 2HJMA 4W8PA 2A61A 2E7XA 4XR6A 2LKPA 2AVKA 5DQZA 5JP7A 1KYWA 3CP2A 4Z9IA 3M3YJ 2KDOA 1BC8C 3NRHA 4UHTA 4CCNA 2VUMJ 3QU3A 3CMYA 3AQCA 4F52A 1SD6A 2HYFA 3UNGC 3DFGA 3ZQYA 2GLOA 2BL2A 1XGNA 3UMKA 2EPMX 3L9FA 3R7CA 1YYJA 1TKNA 3ECSA 1P6RA 1I5ZA 3VYTB 3J80K 1SAXA 5GAHJ 3ZTZA 2EJRA 5AONA 2HKVA 3H35A 3EPVA 1BI2A 3JRCA 4JVSA 3EZHA 4E7JA 4JKVA 1Z5ZA 2J7PA 3L34A 2H8AA 3S16J 1BIBA 1I4ZA 3CLQA 5F0HA 4YIIA 3GWLA 2WY8Q 4E17A 3WHCA 3FDYA 1HKSA 5LEJA 3P9KA 2DA6A 5TJJA 3IH2A 2OJQA 2ZSIB 2WA0A 4ZYAA 1A31A 1G8XA 1G4DA 3O6BB 3K4JA 4G9YA 4LLNA 2JN6A 2KHMA 3T8TA 3V42A 2JD3A 2OQGA 1WHUA 2KPMA 1RKWA 2AP3A 3J7AO 5D6FA 4EM0B 3X2QC 1A7EA 3DPUA 3EH1A 4A93J 2R93J 2OOCA 5HDNA 3CCVI 3CDIA 5F1JA 4GYTA 2MHRA 3GEIA 3Q6MA 1TW2A 4M3FA 4I1MA 2GWRA 1MDMB 1XD7A 2KZVA 2A69F 3ABTA 3CDLA 1F4KA 5FGMA 3G73A 2A07F 2CG4A 2XAJA 2VI6A 2DK8A 5E33A 3ZDLA 1TWGA 3TOMA 1IDZA 1ZN2A 5JVTA 3TQOA 2X85A 3M1CA 2XLHA 4V19K 4M3EA 3W2AA 2KL4A 2B7EA 1VQOI 3T5XA 4CDGA 3WHNA 2IJLA 2L0KA 3C18A 1Z0XA 1NG6A 1WATA 5D5VB 1Y1WJ 4RGUA 4BE1A 1PCXA 3OS0A 2KQRA 4XKBA 2HZTA 1XN7A 4JK1X 2TMVP 3EUHA 5L0CA 1UELB 5LHGA 3ZTMA 4PACA 1NLXA 1TWCJ 1ETOA 3JRGA 5A6BD 3RPUA 4IHSA 3J7AY 4LDRA 2LKSA 1YZCA 3C8GA 2KRCA 3JSPA 2ADUA 1WASA 1W4MA 2WBMA 1UFMA 2VCBA 5D5UB 3NMJA 3TK0A 2XAQA 2QQAA 3MMYB 3KZZA 1MNEA 2FD5A 5DDGA 2NVUB 2QE9A 4ANJA 4BQNA 3GF2A 4YK5A 2L9JA 3LOCA 5KYXA 5ICCA 1FBUA 4PJLA 2YLIA 3SEQA 1E84A 1FR0A 1QQIA 2LFFA 3CCYA 2DMQA 1QZEA 3HHGA 3MCZA 1A6QA 1UHWA 4P6IC 2PJPA 1R1UA 3LFKA 3ZMZA 4ESJA 3AOUA 1J8YF 3N0TA 2LP0A 3UMHA 3NYMA 2IGNA 4NQWA 4U0YA 2FRHA 3KZYA 5E20A 2YX7A 4BHPA 1K05A 3NMIA 4M9ZA 5F64A 4CBEA 3BJ6A 5JLWA 3UKGA 1D8JA 2H8RA 4GGGA 1YTYA 1GS9A 3A9CA 1HCRA 3I59B 1MMSA 4KN4X 4U7DA 4PGHA 3U2MA 3R6SA 1QGPA 4BDYA 5J4VA 4WGZA 4CDVA 4D5FA 3JSZA 3SFZA 1VTNC 1GXPA 4HZFA 5DCMA 2XLEA 2R7WA 2K9QA 4EKWA 2L02A 1IUYA 1JTXA 1K83J 4LITA 2JSPA 4U0WA 2A68F 2JPBA 2LD6A 4XN3A 2X9DA 3DBLB 3PUFA 3N4MA 5CI9A 3DF8A 2X6WA 2QENA 4QTRA 2R25A 1T9KA 3E70C 2QSGX 5E3LA 5IYDJ 3JTGA 2ZFUA 3OL4A 2CH0A 1IN8A 2W85A 3BG7A 5ICEA 2XL4A 3HLZA 4DZJA 5J8CA 1S05A 2ISYA 2QM3A 4BXUA 3K6BA 3OYIA 4XIDA 3S28A 4C3DA 3S3MA 1FNNA 5J1YA 4FX4A 1RKEB 1OCTC 5HS7A 3GTPJ 1WI9A 3B0VC 3JZ0A 1LKXA 3QQAA 2CCYA 1IXCA 2LIGA 3FIWA 3OY9A 2QUFA 3L1MA 1S29A 3FWEA 4ZJZA 4G7OF 2G3VA 4UDVA 3SXYA 4HG2A 4EQQA 3RYLA 2Y39A 1R4TA 4HQMA 5DUKA 2XDVA 5EZGA 1T38A 4UV8A 4XRMA 4NTAA 2ZKZA 4NDLA 2H7OA 2OBPA 4WX9A 1SVOA 2XROA 5E3CA 1OW8A 1OCCH 1VF9A 4OAZA 2K4BA 4AE4B 5T3TA 2M0CA 3LA3A 4E0HA 2JVHA 4UB8C 5L3BA 2X6OA 2DI3A 4XORA 2FA5A 3CTAA 3R60A 2BY0A 4B48A 5FLMJ 3HOUJ 1NFNA 2BC5A 1ZREA 2KQ9A 3HTKC 4Z9JA 1CGPA 4WXDA 4O79A 5HODA 1LI5A 3HKKA 4L0YB 2WVQA 3C2BA 5JI6A 1HY5A 3WGHA 2IW5A 4RGSA 3S90A 1FLIA 1AA7A 4C3HJ 2V6CA 4EEFG 2KLOA 1GUUA 3GBGA 5HVQC 1J59A 2H6BA 4JTAB 2NUPB 3KX2A 3RTRA 3HRUA 1CGOA 2KMUA 2DOEA 1NU9C 5IOYA 1L0OC 2W4SA 5F5FA 1HDPA 3ABMH 1N25A 3WGGA 3QW1A 4IARA 5AIQA 4A3FJ 3LSGA 4GYIA 1YA9A 1KA8A 4EMSA 5C4JJ 3SP1A 1V4RA 4Y15A 2COBA 3MZ8A 3QU6A 1OCRH 2K02A 2MC3A 1W0UA 2VLAA 4YL3A 1U9NA 2FAPB 3SEOA 5ILUA 2XSDC 1J75A 2JT1A 1IN7A 2P5LC 4CCOA 1LPEA 3J06A 2AQEA 4XPYA 1RR7A 2RSEB 1I4YA 1TFOB 2HOSA 3ECOA 3TJ6A 4L9NA 3M4CA 1FT9A 3FXQA 2HPMA 3CF5F 2UUZA 4D7MA
chains in the Genus database with same CATH topology
4BS9A 3I5PA 4G7ZF 1Z21A 2VPLA 2M7AA 3G2BA 3H9QA 4E7ZA 2HVRA 1D1CA 3DZAA 3A2KA 3MX3A 2W45A 3UGPA 3S3NA 3S29A 2FFHA 1ZU5A 4F4BA 3CJRB 1JI8A 4GEHA 2FUG2 2JUGA 3CF2A 3EFOB 2XC7A 4RLFA 4Y33A 4QPOA 1VYIA 1Y6IA 3N2ZB 3I9V2 2V9KA 2PX0A 3TD7A 3S0XA 4BJ6A 2I8DA 4ZDLA 3HL2A 5L3VA 4IWBA 3Q7LA 4LIVA 3VYSB 3VWBA 5KYUA 2ZXHA 4YELA 3PNVA 4PJNA 3LLIA 5T1DB 3W8HA 2QTVA 4ZTFA 1TWCA 2LBFA 3DLAA 1S9HA 3DU6A 3LSHA 4PK4A 1NG1A 2IYLD 3M1CB 4QI0A 3CJQB 3RH3A 4YWQA 2ZSHB 2HPIA 1BOBA 3OYGA 3HOTA 2IGMA 2CNWD 3VSLA 1D1AA 2IXNA 2PJRB 3A4CA 2WZFA 2W82A 3PNTA 4CCLA 4RMNA 4CIHA 4OIQF 2ZXOA 4XOTA 2CV2A 1VYKA 4FESA 1OCRC 4HSRA 1ZYRF 3FBNB 3W2VA 1OKKA 3K4NA 2V26A 2Q1ZB 3K7DA 4B43A 3S27A 5DS5A 4YT8A 2LC2A 3AQBA 3OA1A 4JURI 3K70C 4B6IA 3OWTA 2WADA 2CV1A 3WODF 4OINF 3IEEA 2HZDA 4PFOA 3S3OA 2HVQA 3RKOF 2E87A 4IJJA 1UG0A 4IX7A 1VZ0A 4CH7A 3ZCOA 2ZXIA 2OUMA 1LVKA 2WAQA 4E6KG 1J8MF 2Y3GA 4PJJA 2DXIA 2ZXRA 4CS9C 4H4KC 2LSEA 2WAEA 3VYUB 3QYEA 5DQTA 2M3AA 4Q5SF 1SF8A 3L0IA 2W1OA 4BJTA 4BE2A 5B3SC 1SAUA 3W2WA 3EUKL 3DAFA 2MD0A 3H0DA 4AK9A 5KYYB 2IOQA 2R4GA 4PFPA 1YE9A 2WB1A 4OAYA 4C30A 3TMOA 4CA0A 1IW7F 2YEVA 3K33A 3MD2A 3DKYA 3LSIA 3HPGA 4LIUA 1PJRA 4I44A 1X19A 2R7SA 3B0PA 4C3BA 3OIPA 2W7NA 3K10A 3LL7A 5FRMA 3I5QA 3K66A 4DJAA 4LLEA 3QODA 3OR1C 3S32A 3K4BA 2LYCA 4DOZA 3K1IC 2NOJB 5KYWA 4KITB 5DLJA 4IQ4A 3EHNA 2F6CA 1IRXA 2JA2A 3PMRA 2ZPAA 2MABA 2VQCA 3OIQA 2PMZA 3OL3A 4JQFA 4CSAC 1EA3A 4G0HA 2R7OA 3UMIA 2VXZA 2Y3BA 3SZGA 4IQJA 1DGRM 2XF6A 4PUSA 2Y3DA 4U5HA 1WJFA 2W00A 3LSMA 3PHF2 3NKDA 3T6JA 3HPHA 5EHHA 1NZEA 3DTIA 1ZHXA 2NUPA 4KBLA 4O7GA 1RJ9B 2MC4A 4X0GA 2EIKC 4XLEA 1OKKD 3H65A 3O6XA 3EJNA 4ZDOA 1IZMA 3KL4A 4E4HA 3LMMA 3LAYA 3FHNA 4CS7A 4ITVA 5KNLA 3VYWA 2L9NA 1FTSA 3LS0A 4U5FE 3HG9A 1V5FA 1T0FC 2B0JA 3IUOA 4RM3A 3PUBA 3RCOA 3E1SA 4HFKB 2V4JC 3SYNA 5LD2C 2LH9A 2X1EA 1MMDA 3F9KA 4HPQA 4XNFA 4BEHA 2KW3C 3K6GA 3MLGA 3W3CA 1X1CA 1NU7D 3ASNC 2LY1A 1DGWY 5HOOA 1M57C 2PF4E 4JZAA 4JJFA 3D5LA 4XONA 3PFYA 3L2RA 2RNGA 4U5BE 3ASOC 3T6BA 1OCOC 4YEJA 5HNHA 2G62A 1X4PA 2V1NA 4F91B 2CS3A 4NNJA 1E0EA 1HA8A 4ZLDA 3C2GA 3EGDB 2KJGA 2H7VC 3MKWB 1J09A 4AVZA 5HSWA 3EH2A 4BUPA 2Q2EB 5FRNA 2OG2A 1JPJA 4XLCA 5KHDA 4KT6A 2NUTB 3DXJF 1SFKA 2J46A 2WY7Q 5FROA 2A6HF 3F46A 1N1CA 3LESA 4J32B 4YT4A 1WJCA 2VKHA 4CCKA 1TR2A 3ABLC 3QZCA 2CUZA 3CESA 2IS1A 4QI2A 3OMYA 3DAGA 3LSKA 2P0WA 4J00A 2E60A 4U5CE 3NWSA 5KYNA 3I3LA 2CFOA 2LRDA 3TBIA 3L2WA 1WGWA 2CW0F 2LREA 1QU3A 2Z2SB 1WJEA 4Q4ZF 2AQFA 1LS1A 1OCCC 4KI2A 4EBBA 3O39A 3SNHA 3K4CA 1Z3IX 3FAJA 3PSFA 2V6EA 2L2OA 1D0ZA 4RLQA 4OD4A 3EG9B 1WJBA 3RFYA 1MMNA 1VMAA 3VYRB 3EZIA 4E7HA 1BR2A 1Z3YA 3AKZA 1ZU4A 4ZTJA 3SZRA 5D92A 3C2HA 4MQ9F 2A6EF 2XAUA 1ERDA 4XLPF 1M2VB 1QHHD 4KNWA 4HEA2 3ABKC 4OIOF 4O6NA 2PJRA 2VJJA 3AFHA 3NG1A 1FMWA 4I1OB 4ULWA 2J0XA 2FGYA 2KGOA 4CS9A 3H5RA 4XOPA 3SYTA 3OYKA 1JPNA 1O5HA 1PD1A 2IXMA 2YHSA 4N06A 2DCEA 4YT2A 2HV6A 5L3QA 2F4IA 3QYFA 2GOMA 4XKCA 3EGXA 3F47A 1V5GA 3HKZA 2VL8A 3OS2A 3OYCA 1UAAA 4XTKA 3T4RA 2M4GA 2P6VA 4C2UA 3IAS2 1GLNA 2L5QA 2E1MB 4CSWA 3OYAA 2BW3A 4QDLA 4J30B 2MWQA 3N05A 3X1OA 4NY3A 5BUOA 1D0XA 1P9QC 4BE0A 2Q9BA 3H5AA 2DT7B 5CPRB 2VH3A 3JYHA 2CV0A 4N4OB 1VK5A 2O5RA 1ZELA 4KISA 4II3A 3PSIA 2UV1A 3D5RC 2DJIA 2M4KA 2RREA 1TWAA 2J9WA 4PJMA 4QPQA 4BQOA 3KEYA 4XLAA 4MNDA 4RDAA 1WJAA 2DYSC 4ZC3A 2E1MC 2F5VA 2DGJA 4CSAA 2ZXPA 4HNTA 4P1WA 1LDKB 1YX5A 3DWLE 2WZGA 4CUGA 2CW8A 4KJZA 3ZRGA 4B44A 1QLEC 4D1QA 1Z3XA 2KNHA 5JHFA 1WJDA 3LEVA 2V3CC 2HVSA 4HEAJ 2V7FA 3H9GA 3DPLC 5HLTA 2R7VA 3SDBA 1SMYF 1K6YA 2PFDA 4LACB 1T95A 3PL8A 4CS8C 3EUHC 3QMKA 5KYXB 2XXAB 2Q9CA 3BLYA 4XKVA 4C9YA 3E9VA 4LERA 3K70D 2IGOA 4KC9A 2X6XA 5CQGA 1N78A 3SEZA 1S7ZA 3DM9B 5F5HA 4IKFA 1BR4A 3ABMC 3H5NA 2HV7A 4K7BA 4O6YA 2X51A 3ZR8X 4G7HF 1X1BA 1ZHWA 4I3MA 4AE4A 3QOEA 2HNHA 4II2A 2O9XA 4AYBA 4NQWB 2DOAA 1RJ9A 3K4KA 4ZDPA 3DJUB 4XKWA 1QHGA 4U5DE 4XR6A 3DPTA 3VDXA 4AU7A 4BJ6C 3JT1A 5DQZA 3POVA 4E7LA 2W4MA 3FKJA 2QKMB 3CP2A 2IS2A 5D91A 2KDOA 3NRHA 4HE8D 2IXSA 3OR2C 4CCNA 3LS1A 3AQCA 2Y0SA 3ZIBA 2PP4A 4F52A 1FFTC 3UNGC 2M4EA 3K1HA 3V7OA 3IP4B 3GODA 2A6TA 1ZHZA 1X1DA 4Y4RA 4M63A 3UMKA 3HOSA 2J45A 2QY9A 2VJ4A 1VOMA 1TKNA 3ECSA 4DGWB 1ST6A 3VYTB 2H7BA 5CQEA 3B0UX 3CSKA 3VSKA 3H35A 2VJIA 2OV7A 2UWMA 3EPVA 4JVSA 3NYJA 3EZHA 4E7JA 4K0DA 4BQQA 1Z5ZA 3FBIB 4DBQA 1Z23A 3OYBA 2J7PA 3L34A 5DVWA 4BEJA 3NKEA 3UR3C 1DQUA 4CCMA 4OIRF 4NUBA 4FWVA 2WY8Q 1OCZC 1ZHTA 3Q6NA 2XF7A 4E7SA 3FDYA 2K9MA 4LG3A 5EGYA 3RSNA 2KRHA 3BCBA 4OD5A 4A2NB 2ZSIB 2WA0A 2XF5A 4ZYAA 2X1CA 1G8XA 1W2WA 3K4JA 2JD3A 2XRHA 2KHMA 4Q7CA 3V42A 3LNRA 3L2UA 3DU5A 5KYWB 2A1DD 2NG1A 3QYBA 4W8KA 3N24A 5TGTA 2KPMA 2WAFA 2CGEA 2Q3TA 2P7VA 4U7BA 3DPUA 3NWTA 3S93A 5T3WA 3GANA 4FX5A 3EH1A 4PSXA 3WG7C 3EFOA 4DVYP 3H9JA 4XQFA 5CKTA 3W8IA 4GYTA 3Q6MA 4I1MA 2KZVA 1W36C 2A69F 4F3QA 4EATA 2VXDA 1PD0A 3E0JB 3EUAA 2BE5F 1Z63A 5E33A 5B1AC 3AG1C 4ZLCA 1TWGA 2R7RA 2OCCC 2X85A 3LFUA 1D0YA 2X1DA 3M1CA 4BEHB 2EIJC 3VAYA 3W2AA 2KL4A 1FMVA 1BR1A 4PSWA 3RIPA 1MMAA 1WFXA 2E5ZA 2OC6A 3ZQQA 4C7OB 1NG6A 5IY5C 2VASA 4CCJA 2BVMA 2Z1DA 1SZIA 4IRUA 2CUJA 4XMYA 2J9VA 2QKLB 4BE1A 1PCXA 2C03A 3HUGB 4HFFB 3OS0A 2R7UA 2KQRA 4AX2A 4XKBA 2J7PD 2M7BA 4F92B 4CS8A 1UELB 3PNYA 3DM5A 4U5GA 4BJ5C 3EPZA 2JVGA 2WL8A 2HU9A 3DEEA 3K4MA 3J7AY 1O87A 3NDBB 4RM2A 1FFHA 2KRCA 2GFHA 1TT0A 5LFAA 4NC7A 3ZXSA 1PYVA 4BGDA 2E5NA 3HXLA 3MKZA 2G3KA 2WBMA 1V55C 3CQZA 3LJBA 2L7KA 4B3XA 3HC7A 2IS6A 3AG2C 3MMYB 4BXFA 4BACA 1MNEA 4X0RA 2BOLA 3JCUQ 4ANJA 1OLTA 4BQNA 5KYXA 2L9JA 2XXAA 3S8PA 1KU2A 4R79A 1Z7LA 4PJLA 3DQVC 2VJ5A 3SEQA 1NG7A 2ELJA 2IGKA 5B1BC 3EHMA 5KYYA 3B9QA 2EINC 3FVYA 4P6IC 4WJ0A 3K4LA 3OOUA 3ZSUA 4OIPF 3TL4X 1Y56A 1J8YF 1ZHYA 1N75A 3N0TA 3UMHA 2VQLA 4XLNF 3CMMA 3AL0B 3NYMA 2IGNA 2DT6A 3BC8A 4N4NB 4XM3A 3OYEA 1G59A 1V54C 3ITFA 4CBEA 2Z15A 4YRVA 3OYHA 3EQLF 3I4UA 2W4BA 1KONA 3ZVRA 3DD7A 3FDQA 4U5EE 5KCMA 2MFZA 4MLOA 4OWRB 2VQHA 1V5EA 2HQAA 3ZGKA 3EGXB 2Y3HA 2XSJC 4XWJA 3ZC4A 2YZSA 5HNFA 5KYUB 2I8BA 3AL0C 4XN0A 4BDYA 2R7QA 2K9LA 3JSZA 2LBFB 2BW3B 2Q9AA 1R6RA 1X4OA 2C04A 2EIMC 3OYDA 2WVNA 5FCLA 2R7WA 3M8JA 4DIQA 4BG0A 2MYSA 3MKYB 4F55A 1Z6AA 4LITA 2WVOA 2JSPA 2IS4A 4XLHA 2A68F 4XN3A 3OYFA 3RPUD 4JW1A 1N77A 3KKBA 5CI9A 2XSEA 2X6WA 4IAOA 1MNDA 2HDWA 4Y3OA 3E70C 1YX3A 3OYNA 2ZFUA 3OL4A 2CH0A 2XL4A 4YN0B 3BG7A 3HLZA 2R7TA 2J0WA 4G6TB 3DMDA 1DP3A 3K6BA 3OYIA 4C3DA 3S28A 4DVZA 3L2QA 3OYJA 2VB6A 3S3MA 4U87A 1TWHA 4XL9A 1D1BA 1M2OA 3KH2A 3RQ4A 4B47A 3B0VC 1LKXA 3EGDA 3IAM2 3OY9A 4JCHA 4HSTA 4ZJZA 4FASD 2G3VA 3CP8A 4KNVA 4HG2A 4G7OF 3KMIA 2Z16A 2NUTA 3RYLA 2LOOA 2RQQA 3DKXA 4E7IA 2Y39A 3NYLA 4O6MA 2XDVA 3OS1A 2W9YA 1QZXA 4RD9A 3X2QC 2KP6A 1MMGA 1U0JA 2H7OA 1WJ5A 4E7KA 5E3CA 3AG3C 4HNUA 4CZCA 1LFPA 3CZ6A 4OAZA 4YJWA 3L2VA 2WB7A 4AE4B 5T3TA 3LLKA 5E2QA 1X1AA 5E3AA 2JVHA 3OYMA 4XORA 3FHDA 4BU2A 4F93B 4B48A 2KQ9A 3HTKC 2CW7A 1M56C 3DTKA 3JRTA 4BL0B 4O79A 3EG9A 2EILC 2WVQA 4D9JA 4JOMA 4BJ5A 2BVLA 3PJRA 4GRIA 4NC8A 4DBRA 2R7XA 1M2VA 1AA7A 4FETA 4RBNA 2KLOA 4C3EA 4C7OA 3GBGA 5HVQC 2NUPB 3A1YA 2VKDA 2CMPA 3KX2A 3RTRA 4JJGA 4HRIA 2KMUA 4J01A 1NU9C 3D5SC 1OR7C 2K5CA 4BJ1A 2W4SA 2Y69C 2A5WA 3OYLA 1MW7A 2L81A 3Q7GA 2CNWA 5F5FA 3DJNB 2GOXB 3U21A 3LSGA 2IXPA 3HJCA 1TZLA 3BG6A 2PX3A 3SP1A 5CI8A 2VIXA 3OEOA 2IXOA 3AG4C 2VLAA 3ONQA 2DYRC 3SEOA 4C2TA 4YT5A 2VQGA 5DS4A 3UGOA 2L9SA 4CCOA 2WZLA 2AQEA 2LG4A 2X6YA 2ZXWC 2CDQA 1W36D 2M0MA 4P5OA 2J9UA 4BDZA 3ZG1A 5DS6A 3DTEA 4LLCA 3BCAA 2HPMA 2D5RB 2LY2A 4EWCA 4XLFA 2K3PA 2UUZA 4IZZA 3KYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  3CZ6 A;  4BJ6 C;  3OWT A;  4BJT A;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 1GV2 A;  3I5P A;  3GTM J;  5CVJ A;  3B29 A;  4BYY A;  4LDQ A;  3BJA A;  5FKL A;  3UGP A;  1YA7 O;  1X2M A;  1ZW2 A;  3S3N A;  5B3S H;  2FFH A;  4AC0 A;  4H0E A;  1SC7 A;  2MH2 A;  2JUG A;  3A01 B;  2QNL A;  4RLF A;  3GFI A;  1MJA A;  1Q0K A;  4BBS J;  1VYI A;  4NQF A;  1T08 B;  4JX6 A;  4ESB A;  5EGO A;  4J19 A;  2F5C A;  2V9K A;  2PX0 A;  4O3M A;  3V5Z A;  2I8D A;  1KU7 A;  2YL1 A;  1B59 A;  1BZ4 A;  1B1B A;  2PG4 A;  2EH3 A;  5JLI A;  4LIV A;  2R9R B;  3VYS B;  2EV5 A;  2ZXH A;  4D0P A;  2L7F P;  1ORK A;  5ILV A;  1T6I A;  3DLL F;  4PK4 A;  3M1C B;  3S2D J;  1EI7 A;  1S7O A;  3CJQ B;  1FTZ A;  3W4Y A;  4HQE A;  2HPI A;  3OYG A;  3ABM C;  2IGM A;  3VSL A;  3IWZ A;  4CCL A;  1U8B A;  2X0L A;  4XOT A;  2CV2 A;  1VYK A;  3IC7 A;  2YX4 A;  1OCR C;  3FBN B;  3W2V A;  2G7U A;  2V26 A;  1BDJ B;  1UFB A;  3F6V A;  3T9O A;  2BY2 A;  5F27 A;  1R4M B;  4L0Z B;  3K70 C;  3B02 A;  1YQA A;  4HDU A;  2AU5 A;  4D4X A;  3FAP B;  3PIP F;  2HZD A;  4A3G J;  3GEE A;  3ZQ7 A;  3C8G B;  3GZN B;  1RKC A;  3HNK A;  2E87 A;  3GME A;  2X0C A;  2E1N A;  1J8M F;  3ZCO A;  2ZXI A;  2OUM A;  4ETS A;  5IP9 J;  5A6A A;  4PJJ A;  4HF1 A;  2IPQ X;  1PV3 A;  2HYG D;  1ZKG A;  4DXW A;  2KIS A;  4JYK A;  1U5T B;  3WTV C;  4Q5S F;  1SF8 A;  2W57 A;  4FE7 A;  3L0I A;  5J1U A;  1WQ2 A;  3KYJ A;  4WAB A;  5B3S C;  3EUK L;  4A0X A;  3DAF A;  4KIC A;  3H0D A;  4LB6 B;  1FBQ A;  3GM1 A;  2WB1 A;  2JWT A;  9ANT A;  1IW7 F;  2LDU A;  2YEV A;  5AIP A;  4XPX A;  4IRI A;  3V5Y A;  1EH7 A;  4I44 A;  2R7S A;  3L1P A;  3CO6 C;  5JHU A;  1YIO A;  3LL7 A;  4HLX A;  4IJA A;  2ESN A;  4KIT B;  1C0W A;  5DLJ A;  4IQ4 A;  4U9E A;  1ONV A;  2PMZ A;  2EZL A;  5IOZ A;  1DGR M;  1BW5 A;  3VF0 A;  2NVQ J;  2MLK A;  2XGX A;  4KBL A;  3T6G B;  1Q0M A;  3BPX A;  5DCM B;  4EJU A;  5IYC J;  1GVJ A;  3H65 A;  3EJN A;  4X1E A;  5CIV A;  1AEP A;  1MBG A;  3LMM A;  4CS7 A;  5KNL A;  1MH4 A;  3J80 Z;  2L9N A;  3M9A A;  4U5F E;  3HG9 A;  1V5F A;  3MZY A;  3MVP A;  4RM3 A;  1DPU A;  2EFO A;  2X1E A;  2KW3 C;  3HOW J;  1AWC A;  1NU7 D;  5HOO A;  5EEG A;  1M57 C;  2PF4 E;  5JFR A;  4JJF A;  1LB2 A;  1KYZ A;  1WWX A;  3D5L A;  1OMI A;  3L2R A;  3PCV A;  2L4M A;  2VBW A;  1OCO C;  1H7I A;  1X4P A;  3TO9 A;  4N6H A;  2O03 A;  1TTY A;  3IV5 A;  3HUG A;  2Y3B A;  2H94 A;  2IRF G;  2LF7 A;  1R49 A;  2VON A;  1J09 A;  1G4W R;  4AVZ A;  3GXO A;  3EH2 A;  5HSW A;  1B72 A;  5E17 F;  1TWG J;  4XLC A;  4KDP A;  1ZR4 A;  1HOM A;  4MTG A;  2LLK A;  4HDV A;  5FRO A;  2A6H F;  4YFN F;  4NC6 A;  2EA4 A;  4HBL A;  5FD5 A;  1WZ2 A;  5BOX A;  1HMD A;  1TR2 A;  2DYS H;  2L6H A;  3ABL C;  3QZC A;  4S04 A;  3DEU A;  3CES A;  2IS1 A;  1LDD A;  3FXM A;  5DM7 F;  1YHQ I;  3LUT B;  1JMW A;  3G1O A;  2E60 A;  4I98 B;  3NWS A;  3ZMS A;  5KYN A;  4HF2 A;  2CFO A;  3L2W A;  2K3F A;  4EBK A;  3WTZ A;  1UST A;  2D5V A;  1IN6 A;  2H6C A;  3BPV A;  3GTL J;  5COG A;  2YL3 A;  1K04 A;  1FBS A;  2P4W A;  4OD4 A;  3RFY A;  5AC4 A;  2FE3 A;  1J0R A;  1R4N B;  2ESH A;  3JRA A;  4MTO A;  5LGU A;  3BT9 A;  3TKY A;  1QHH D;  1DU0 A;  4HEA 2;  2ECB A;  3REO A;  3RDI A;  1EJ9 A;  4IHX A;  3PO2 J;  1HKT A;  3CAX A;  3AFH A;  2HQR A;  5IP6 A;  4I1O B;  4WXC A;  4U0V A;  4CS9 A;  4XOP A;  3OYK A;  2EIM H;  2IXM A;  5LGN A;  2BGC A;  2HV6 A;  3QYF A;  4XKC A;  3EGX A;  2K40 A;  1GT0 C;  3WHB A;  1RUN A;  3TJ5 A;  2GZW A;  3OS2 A;  3HKZ A;  2VL8 A;  2M34 A;  3SQN A;  3V8L A;  1OFC X;  3T4R A;  1LEA A;  1ENH A;  2ZD9 A;  3IWF A;  3TO7 A;  3KLN A;  2ZB9 A;  3F8F A;  3Q0V A;  2NXN B;  1PUF B;  1U0B B;  1MKM A;  1Q1H A;  3CCM I;  4UXN A;  3U1K A;  4IQJ A;  2FSW A;  3PSI A;  4WK8 F;  1E17 A;  3I58 A;  2M4K A;  1TWA A;  2J9W A;  4PJM A;  1T6S A;  1J9I A;  3KEY A;  4XLA A;  4ZYD A;  1H9G A;  1JAF A;  4MND A;  5GAD J;  2DYS C;  5BQG A;  2CO5 A;  1E86 A;  1HST A;  2XAH A;  2E1M C;  2F5V A;  5DYM A;  3J81 K;  1RCP A;  2DGJ A;  3HDD A;  2ZXP A;  4LOC A;  3DEW A;  1GGQ A;  3DWL E;  3P7N A;  2R5Y B;  1EQ1 A;  2W24 A;  3O3K A;  4D1Q A;  4M74 A;  1X2N A;  2HVS A;  4HEA J;  4P9T A;  2DN0 A;  3H9G A;  1J2X A;  5F28 E;  3SDB A;  2CQX A;  2OQM A;  2PFD A;  4XEV A;  5EGO B;  3EUH C;  1EH8 A;  3E9V A;  3ZWI A;  1H9T A;  3BWG A;  4MTE A;  5KYW B;  1T0F A;  1T8I A;  2P6S A;  2XS1 A;  3H5N A;  4O6Y A;  3RIR A;  3E6B A;  2HUJ A;  1X1B A;  3CCQ I;  3QOE A;  1HXD A;  1IDY A;  3DJU B;  2AXL A;  4BJ6 C;  2WV1 A;  4GDF A;  1HW5 A;  3JRH A;  4XSZ F;  4KIF A;  2O3F A;  4A2U A;  2GAQ A;  1U6H A;  3FKJ A;  2IS2 A;  2DA4 A;  1QPI A;  5FKO A;  5GAG J;  1P7J A;  2XGE A;  3F6O A;  4HE8 D;  2IXS A;  3OR2 C;  3RPQ A;  5A2Q K;  2M87 A;  1FWZ A;  3ROU A;  2P81 A;  1X3W B;  3K1H A;  1RUO A;  3IP4 B;  2HQ5 A;  1MH3 A;  2QCO A;  5KVR A;  1Z05 A;  3KEQ A;  3DWW A;  1XDS A;  1XMA A;  2M9H A;  4A4A A;  1EV7 A;  4M63 A;  2J45 A;  4M3D A;  2NRA C;  4TV7 A;  4A6E A;  2VJ4 A;  4BH9 A;  4C3I J;  2ASR A;  4MS2 A;  4ZYH A;  2F48 A;  4LMY A;  2HSQ A;  2Q2E A;  5L3E A;  1ST6 A;  4BHC A;  4DRH B;  5IY5 H;  3B0U X;  1DP7 P;  1WN0 A;  1Q0F A;  3F8M A;  3NYJ A;  2JPU A;  3E6C C;  4BEJ A;  2YL0 A;  4IF4 A;  5DVW A;  3NKE A;  3UR3 C;  1W5S A;  1DQU A;  5K7F A;  4JTC B;  2H8W A;  3KZI C;  5DCF A;  1ZHT A;  1QPM A;  3Q6N A;  2XF7 A;  4HV5 A;  3S2W A;  2K9M A;  2KC3 A;  1T2K A;  3IPM O;  1RIO H;  4JX5 A;  2KRH A;  4X6A J;  4OD5 A;  2J8W A;  1X3U A;  2RV8 A;  3PM1 A;  2OD5 A;  1W2W A;  3DKW A;  3F22 A;  2ISZ A;  1LUJ B;  2CUE A;  3LNR A;  2M1B A;  3BY6 A;  5GAE J;  2CSO A;  1IRG A;  4W8K A;  1R1T A;  5TGT A;  1S72 I;  1ZRD A;  3TOL A;  1Y39 A;  2CGE A;  3B73 A;  3L00 A;  4U7B A;  2VCC A;  1R5G A;  1SFX A;  1R7J A;  3RYR A;  1ZQ3 P;  5L3C A;  4FX5 A;  2IBF A;  4UY8 I;  3WU2 C;  3GWZ A;  3M15 A;  3HOX J;  3LNQ A;  2K27 A;  3FM5 A;  4PGG A;  4OMY A;  3F3X A;  2KIM A;  3O55 A;  2HOE A;  1HF0 A;  1W36 C;  1LE4 A;  2Y2Z A;  4CJO A;  4JE9 A;  1OQY A;  1ORJ A;  4L9T A;  3WTX C;  4E0I A;  3E0J B;  2OTL I;  2MD5 A;  1BC7 C;  2JA5 J;  1JGS A;  4I0A A;  4B09 A;  1D0Y A;  2X1D A;  2EIJ C;  2A5Y B;  4ENM A;  1BR1 A;  2PBI A;  3RIP A;  1OQC A;  3G50 A;  3ZQQ A;  2OC6 A;  3IKT A;  2E71 A;  2HEO A;  2VC9 A;  2VAS A;  3CC4 I;  5IY5 C;  2BHY A;  2Z1D A;  2PBE A;  1ZG1 A;  2Q8K A;  3VOE A;  4C2M J;  4MFD A;  3HUG B;  4NCQ A;  2V1U A;  2R7U A;  1T6Q A;  1M1E B;  1LI7 A;  4QWQ A;  4J7T A;  5FLV A;  3EYI A;  4CS8 A;  3C8Z A;  4IPA A;  3NDB B;  2GFH A;  4HX4 A;  1PYV A;  1VTM P;  2E5N A;  2QLA A;  5M5W J;  1D5Y A;  3MFN A;  2XS8 A;  4GO1 A;  3HC7 A;  4G12 A;  1R58 A;  2QQ9 A;  2WB1 N;  3HNJ A;  3V5X A;  1OJL A;  3D1N I;  2XXA A;  2DFH A;  4D5C A;  1Z7L A;  1V4A A;  3DQV C;  2ELJ A;  1JKQ C;  4QIW N;  3RKX A;  1RPW A;  1O3U A;  2NNN A;  4DNC A;  5KYY A;  3E6M A;  1ETV A;  3A02 A;  3K4L A;  3ZSU A;  2XB0 X;  1N75 A;  3BP8 A;  3X2Q H;  2I10 A;  3V7R A;  1FSH A;  3LST A;  1OYY A;  4L5E A;  4N4N B;  5H20 A;  1G59 A;  2OEX A;  3LNM B;  4CJG A;  1ON1 A;  3OYH A;  3DV8 A;  2W48 A;  3GEH A;  2LF8 A;  3I4U A;  1KON A;  3M4B A;  3GTJ J;  3CO7 C;  3TOA A;  4MLO A;  3E5Q A;  3SXK A;  2Y48 A;  3JRI A;  3QOP A;  3TW6 A;  1DDN A;  3JCU C;  2DMT A;  3EGX B;  2XSJ C;  3ZC4 A;  2EV6 A;  5KYU B;  5HNF A;  1M6T A;  3AL0 C;  2HFI A;  3L8J A;  4ASN A;  1FX7 A;  2R7Q A;  1QVT A;  1U6G A;  1QA6 A;  2B0H A;  1HLV A;  3EYY A;  2DPD A;  2XLM A;  2FOW A;  3WTY C;  2V9P A;  1R6R A;  1O3R A;  3S2H J;  2EIL H;  5FZT A;  2WVN A;  4M6Y A;  4DIQ A;  1ETW A;  3MKY B;  2WVO A;  2KKO A;  1RZ4 A;  1USS A;  3DP7 A;  1RES A;  2JA7 J;  4JW1 A;  1N77 A;  1S3J A;  2LD5 A;  2XSE A;  1MND A;  2G9W A;  2OZ6 A;  2NVT J;  4M73 A;  1W7P D;  5B66 C;  2XAS A;  4A12 A;  4I01 A;  5BPD A;  2R7T A;  2J0W A;  4G6T B;  1DP3 A;  1IO2 A;  3G71 I;  2FEZ A;  2VB6 A;  4W1U A;  5FJ8 J;  2HGC A;  4XL9 A;  3A0H C;  4KYW A;  1EKY A;  3U3F A;  1EF4 A;  2DYR H;  4CYD A;  3IRR A;  4YIR X;  3NRV A;  3DKA A;  4KNV A;  4FAS D;  3CP8 A;  3R0J A;  3KMI A;  2ZCW A;  5EEH A;  3FXJ A;  4J7Y A;  2LOO A;  2RQQ A;  2V1D A;  4E7I A;  1LDJ A;  3OS1 A;  2DFE A;  2VPR A;  3A0B C;  2EV0 A;  3CJN A;  2LFD A;  4NTB A;  4EJO A;  1MMG A;  1Z9C A;  3VRC A;  4JC7 A;  2L4A A;  3B6C A;  4A3L J;  1DU6 A;  4EIY A;  3KFW X;  1O3Q A;  4PDK A;  4M3G A;  2AHQ A;  3CZ6 A;  3TDZ C;  2GA0 A;  3I54 A;  1ZG3 A;  5J1R A;  4YJW A;  3FOP A;  3LLK A;  5JS5 A;  1ZLK A;  1P4W A;  3OYM A;  1YZA A;  4BU2 A;  2FOK A;  2AWY A;  5C44 J;  2VOO A;  2PN6 A;  4MTD A;  3KP6 A;  1O3T A;  3ECH A;  3QPS A;  5L0D A;  2BEO A;  4BL0 B;  2AWC A;  1JKP C;  2EIL C;  1JUM A;  4D9J A;  1C17 M;  3HNL A;  4AL1 A;  5AC5 A;  5L0J A;  2CQN A;  2AXT C;  4NC8 A;  4EJV A;  2R7X A;  1M2V A;  5M5X J;  4RBN A;  4C3E A;  4O6J A;  1VI0 A;  1VLS A;  2MW8 A;  3BRJ A;  3JYY A;  4BPM A;  3PDM P;  3HKZ N;  4C7O A;  2AO9 A;  3A1Y A;  1QZY A;  1QQ3 A;  3V4G A;  1ULY A;  4J01 A;  1P7I A;  3D5S C;  1XS9 A;  1AU7 A;  5FLX K;  3CUQ C;  4BJ1 A;  3OYL A;  1MW7 A;  2C6Y A;  2CNW A;  2ZJP F;  1TZL A;  1JUS A;  5E3M A;  5CI8 A;  3OEO A;  2DBB A;  4WXH A;  2GWW A;  2DYR C;  5DS4 A;  2CUF A;  1TNT A;  3WE2 A;  3UGO A;  2O8X A;  3Q0W A;  4AIK A;  2KIQ A;  4YFX F;  2CQ7 A;  3MYI A;  3ABU A;  2EPK X;  4HOB A;  2TRT A;  5DS6 A;  3HEF A;  4DQ2 A;  3DTE A;  1AVO B;  2CFX A;  2P7C B;  4IHW A;  2D5R B;  5BMZ A;  4IZZ A;  4MVU A;  3NAR A;  2DPU A;  256B A;  2KDZ A;  2M7A A;  3G2B A;  1FZP B;  2HOT A;  3H9Q A;  2STW A;  5JUA A;  5EZH A;  4E7Z A;  3Q5F A;  2XHK A;  1D1C A;  3KEO A;  4LFU A;  3A2K A;  2W45 A;  3C62 A;  3RVZ A;  3FXO A;  3CJR B;  2ME6 A;  1JI8 A;  1XSD A;  2FUG 2;  2Q00 A;  4MVM A;  2UZK A;  1YO5 C;  4Y33 A;  2QF7 A;  2F5F A;  1XG1 A;  5TIS C;  1X1P A;  1Y6I A;  2FQ3 A;  4M3B A;  2EQR A;  2GA2 A;  4HF0 A;  4ONS A;  4BJ6 A;  3BJO A;  3HL2 A;  4RAG A;  4IWB A;  3FHZ A;  3LAJ A;  3PIO F;  3Q7L A;  3F23 A;  3E5U A;  4KUM A;  2HKX A;  3VWB A;  5K7Z A;  3PNV A;  4PJN A;  2QTV A;  3L2C A;  2MLG A;  4C3J J;  2LBF A;  3DLA A;  5FD6 A;  3DU6 A;  3HZJ A;  4YIF A;  3RH3 A;  3BG5 A;  5B5E C;  4DYC A;  2HYJ A;  3HOT A;  2HOA A;  3GX4 X;  3M1E A;  4KT5 C;  1FIA A;  2PJR B;  3A4C A;  1VLT A;  3I4N J;  2W82 A;  3PNT A;  3BEH A;  1KQ9 A;  3BDD A;  1OKR A;  4AM3 A;  2HSB A;  1JUP A;  4FES A;  4M72 A;  3MBG A;  3I56 I;  2DB4 A;  5JSL A;  2EIK H;  5E1W A;  3K7D A;  1UZC A;  4B43 A;  1NFO A;  3J81 Z;  2DLL A;  2V1X A;  4JUR I;  4B6I A;  4ON0 A;  5J4Y A;  1D8K A;  3TOB A;  4OIN F;  4XPW A;  5A6J A;  4PFO A;  1SFE A;  2A3S A;  3FXU A;  4IJJ A;  2JSC A;  4R1H A;  4BQA A;  2HJ3 A;  3LWF A;  2BXY A;  3ASN H;  4CH7 A;  2Y3G A;  2ZXR A;  1APL C;  5J47 A;  4CS9 C;  2DXI A;  4H4K C;  1MGT A;  1OCZ H;  1Z77 A;  1LFB A;  3QYE A;  5J6X A;  2QQB A;  1ZG5 A;  1I1G A;  2FMY A;  2OPT A;  1G3T A;  2L54 A;  3ZQV A;  3GEZ A;  2MD0 A;  4UB6 C;  4IXA A;  4AK9 A;  2IOQ A;  2R4G A;  4PFP A;  5KYY B;  1J7K A;  4C30 A;  1E3O C;  1FIP A;  1B8I B;  1R5H A;  3HPG A;  3LSI A;  4LIU A;  4CYC B;  3TED A;  2EZH A;  1X19 A;  4NTF A;  2JZY A;  3OIP A;  2W7N A;  1ITY A;  3I5Q A;  3V7S A;  4RDU A;  3K66 A;  4ENN A;  1B4A A;  3K1M A;  1MBH A;  3K4B A;  3S32 A;  3TO6 A;  1XWJ A;  1B9M A;  2NOJ B;  5KYW A;  1PDN C;  3MEX A;  2HFH A;  2ZJ2 A;  4S0H B;  1HC8 A;  1IRX A;  1XZP A;  4MVR A;  2M8E A;  2JA2 A;  4MW3 A;  3G3Z A;  3VFZ A;  2MAB A;  2DA3 A;  1P4A A;  2VQC A;  3OIQ A;  1O57 A;  1EA3 A;  5A2Q Z;  1NTC A;  1CQT A;  1G3W A;  4G0H A;  2VXZ A;  5IYB J;  1ZAO A;  3K0L A;  2XF6 A;  1RRJ A;  4U5H A;  2Y3D A;  3WAQ A;  3AGU A;  1G3S A;  5DV5 A;  4FX0 A;  4XEK A;  3T6J A;  3HPH A;  1Y4C A;  2JUC A;  5B1A H;  3JRM O;  2DDA A;  2EIK C;  1OKK D;  1OXB A;  3G4Z A;  3L8I A;  2GIZ A;  2QEX I;  4JCZ A;  4ITV A;  4AVP A;  3VYW A;  2ME0 A;  3IKV A;  4NC3 A;  2KJB A;  1T0F C;  1BBH A;  4G6D A;  4AIJ A;  3IUO A;  5ERI A;  3L7W A;  4IRG A;  1G6N A;  3WE3 A;  4CHU A;  4WGY A;  1GM5 A;  3F9K A;  3MLG A;  2FBI A;  4BEH A;  3FMR A;  3K7A J;  2P61 A;  2DA2 A;  3ASN C;  3QTH A;  4FIS A;  4LGW A;  1U89 A;  5M3F J;  1POG A;  5KK1 A;  4XON A;  3I53 A;  4Z2Y A;  1BI3 A;  3B6A A;  1R71 A;  1B6A A;  5HNH A;  3U3B A;  4M6V A;  1E0E A;  2JPC A;  3GM3 A;  4U9D A;  1BI1 A;  1XDU A;  3OSG A;  2KJG A;  1EKE A;  2F2E A;  1GDT A;  2G7H A;  2PMH A;  4AUX A;  4F7Z A;  2OG2 A;  4IB4 A;  4KT6 A;  3ZQH A;  1O7F A;  4FCY A;  5CYV A;  3LES A;  4YT4 A;  2DDB A;  1IXS B;  2IA0 A;  5B1B H;  5D8K B;  1TC3 C;  1XSX A;  3I64 A;  5LHI A;  1XB4 A;  3SDG A;  2HR3 A;  2NAZ A;  2MSY A;  2M5W A;  3BTC A;  4XBF A;  1Y0U A;  1HSJ A;  1Z6T A;  3DAG A;  1OCP A;  4FE4 A;  4UNO A;  3HIF A;  1G4U S;  2OQR A;  3HSR A;  3TBI A;  1R22 A;  1WGW A;  3CCU I;  4Q4Z F;  1LS1 A;  1OCC C;  4KI2 A;  2HZ8 A;  3E5X A;  2V6E A;  2L2O A;  1K78 A;  2O0Y A;  1VQP I;  3VYR B;  1BR2 A;  5D92 A;  1BA5 A;  3C2H A;  4MQ9 F;  2A6E F;  2XAU A;  2PFB A;  1M2V B;  4A3B J;  4OIO F;  1LEB A;  2NS8 A;  3JW4 A;  3KE2 A;  3ULQ B;  4O6N A;  3C7J A;  4ULW A;  2FGY A;  3CCS I;  1O5H A;  3BOQ A;  3U1D A;  1K7A A;  1AHD P;  2EPL X;  2DCE A;  1CPR A;  3JRD A;  4K2E A;  3F47 A;  2FNA A;  1GXQ A;  5L3D A;  4IRH A;  4L5J A;  3RZD J;  3HBL A;  4Y7N J;  4I2O A;  2ECC A;  2M4G A;  2H1K A;  1GVD A;  3IAS 2;  3WGI A;  2E1M B;  3BR6 A;  4QDL A;  2BW3 A;  3N97 A;  2GDC A;  1F9N A;  2L9V A;  1JJ8 C;  3ERE D;  5GTI C;  2VH3 A;  3BR2 A;  5CPR B;  2DT7 B;  3T8R A;  1JXS A;  3RVY A;  4RB1 A;  2CV0 A;  4RAF A;  1T5O A;  1VK5 A;  4MVS A;  2O5R A;  1ZEL A;  4PJ0 C;  3RI4 A;  2ZNY A;  3AGT A;  1UG2 A;  2UV1 A;  2DJI A;  3QWL A;  2RRE A;  2CU7 A;  4Z6Y A;  2EK5 A;  1SD7 A;  3K1I A;  1FPQ A;  3KP3 A;  4Y17 A;  5LHH A;  1FYL A;  5DS5 A;  3JTH A;  4XRS A;  4HX8 A;  2H1L A;  4CGZ A;  1YS7 A;  4P1W A;  1LDK B;  1YX5 A;  1ETQ A;  2CW8 A;  4RB0 A;  3ZRG A;  2OEV A;  1CF7 A;  1WJD A;  3ZOB A;  3QPL A;  3JRF A;  2HDC A;  3LEV A;  3NEU A;  2V3C C;  5FFX A;  1W5C C;  2V7F A;  2DMN A;  3FXK A;  1SMY F;  4KNY A;  4ULV A;  3WU1 B;  1T95 A;  3U8V A;  4CS8 C;  1V3F A;  1I50 J;  2NVX J;  5KYX B;  1JR8 A;  2CQQ A;  2R92 J;  1RR8 C;  3K70 D;  4KC9 A;  3V7C A;  1S7Z A;  1N78 A;  3G4X A;  2F5D A;  1HE9 A;  3M7G A;  4NBQ A;  4AID A;  2JTV A;  1ZHW A;  2NPU A;  2VOP A;  4AYB A;  4NQW B;  2DOA A;  1RJ9 A;  4LK1 F;  3QAH A;  1QHG A;  4UV9 A;  1IZ1 A;  3VDX A;  3C3W A;  4AU7 A;  3JT1 A;  1E83 A;  3POV A;  2PX9 A;  3CUQ A;  2DFF A;  1QO0 D;  2W4M A;  2DMP A;  2QKM B;  4A5M A;  4P96 A;  1NK3 P;  2P5K A;  1UHM A;  2M2E A;  1YYX A;  2VKV A;  4KFC A;  3LS1 A;  2EFW A;  2Y0S A;  2PP4 A;  1ON2 A;  5LBQ A;  1LPQ A;  1FFT C;  2M4E A;  1SFO J;  3V7O A;  3GOD A;  2VN2 A;  2PMU A;  1L7C A;  4PCQ A;  3ZMD A;  2IEK A;  3AG1 H;  5D8L B;  1PP7 U;  1ZHZ A;  2OCC H;  1Z7Q c;  3ZQG A;  1Y1V J;  4IAO A;  4MIM A;  5EG0 A;  3AG4 H;  3S1M J;  1Q1V A;  4ESF A;  2GXA A;  1Q0G A;  1VOM A;  3CD6 I;  4DGW B;  2D45 A;  2H7B A;  2IM8 A;  3CUO A;  2WWY A;  3CSK A;  2BBY A;  3VSK A;  4ABZ A;  1JE8 A;  1D3Y A;  4CDA A;  2OV7 A;  3M07 A;  1FAP B;  5DD4 A;  4K0D A;  4BQQ A;  2RKH A;  3FBI B;  5HLG A;  1RKT A;  1CGM E;  4CCM A;  2XLV A;  4B3A A;  1DOV A;  2KYH A;  4FWV A;  5A6B A;  1JGG A;  3BCB A;  4A2N B;  2ICW G;  2X1C A;  2NYX A;  1SD4 A;  5M3M J;  4Q7C A;  2DMU A;  1XZQ A;  3L2U A;  3DU5 A;  3GTO J;  3T0Y A;  2A1D D;  1OXK A;  1RI7 A;  3AG2 H;  2NG1 A;  2YLD A;  3N24 A;  5EJC A;  4CO8 A;  4EVI A;  2L7Z A;  5FKN A;  1T98 A;  1HMO A;  2A0U A;  3HB9 A;  2BYV E;  1WKM A;  3KPH A;  3I5U A;  2QQ8 A;  4A3K J;  2XIG A;  2EIN H;  3EFO A;  3H9J A;  3GTQ J;  3I71 A;  2FBH A;  3W8I A;  4M9X A;  5FLX Z;  6PAX A;  4Z9H A;  2QYO A;  2DA1 A;  4RB3 C;  5DD8 A;  4HYE A;  3R61 A;  1V54 H;  2BZT A;  2NVY J;  2VXD A;  1FOW A;  2VE8 A;  1IXR C;  4BY7 J;  2BE5 F;  1Z63 A;  3ZQL A;  3AG1 C;  2R7R A;  2OCC C;  3ZQC A;  4P9F A;  4BEH B;  3VAY A;  2FML A;  4GXO A;  2O61 A;  1BI0 A;  4PSW A;  4R8H A;  1NBB A;  4LDK A;  4OOI A;  4DYQ A;  2OU2 A;  3Q9S A;  1FC3 A;  1UMQ A;  2BHZ A;  2BVM A;  1SZI A;  2CUJ A;  2UUI A;  4PR9 A;  4A0Y A;  2QKL B;  4HFF B;  2XUB A;  1VQM I;  4MEY F;  2J7P D;  1WGX A;  5D5W B;  3PNY A;  2OKU A;  3NMK A;  1WOL A;  5EDN A;  3CCE I;  3EPZ A;  2JVG A;  2J9B A;  3DEE A;  2KJC A;  4RM2 A;  1FFH A;  1TQI A;  1TT0 A;  5LFA A;  1FJL A;  3ZXS A;  4AX2 A;  3MKZ A;  1B9N A;  5HDG A;  2OZU A;  1CGN A;  2GA1 A;  2ZJR F;  1ZR2 A;  3AG2 C;  4BXF A;  2HDD A;  2Z33 A;  4X0R A;  3R2P A;  3F0C A;  3JCU Q;  1OLT A;  2Y0M A;  2RQP A;  2XRL A;  3S8P A;  1KU2 A;  1V74 B;  1TQG A;  2MBF A;  2VJ5 A;  4XK4 A;  2E1C A;  1T33 A;  3EHM A;  4MO7 A;  1W0T A;  2EIN C;  5CVU A;  5L0H A;  4WJ0 A;  1K78 B;  3DE9 A;  1LJ9 A;  3TL4 X;  4B1R A;  2OU6 A;  1UG7 A;  1ZHY A;  2VOD A;  3JSE O;  4XLN F;  3CMM A;  3JRE A;  3AL0 B;  2UXX A;  3BC8 A;  4XM3 A;  3AG3 H;  2H27 A;  1V54 C;  4YRV A;  4MW8 A;  3EQL F;  1IRZ A;  3ZVR A;  4AIH A;  1WVR A;  2DA5 A;  4HV6 A;  4U5E E;  2UUH A;  4OWR B;  1K6O A;  1V5E A;  2HQA A;  1SYQ A;  1P2F A;  3FZV A;  2Y3H A;  4XWJ A;  2ZFW A;  1YJN I;  1DUX C;  2I8B A;  2CRG A;  1PVE A;  2L01 A;  2K9L A;  1Z91 A;  2BW3 B;  1FSE A;  4ZH4 F;  2C04 A;  2Q9A A;  1KNY A;  2EIM C;  1VQK I;  3OYD A;  4BG0 A;  3M8J A;  4ZYG A;  2MYS A;  4F55 A;  2E2H J;  2IS4 A;  4XLH A;  4Q48 A;  1RXQ A;  5BQI A;  4XIC A;  3RPU D;  3OYF A;  3KKB A;  3C8G D;  1W5T A;  2L7A A;  3IQT A;  1YX3 A;  3OYN A;  3O8G A;  4YN0 B;  3QPH A;  1T56 A;  1TP4 A;  2OAZ A;  3C1D A;  2NS0 A;  2GIV A;  2P8T A;  2NNY A;  4L18 B;  3GFJ A;  4KA4 A;  3DMD A;  4CX9 A;  1VQN I;  2OA4 A;  4MFE A;  3L2Q A;  1HBX G;  4U87 A;  1TWH A;  3KH2 A;  3P5J A;  3RQ4 A;  4B47 A;  3ELK A;  2VC0 A;  3JRB A;  4IOA F;  1CF7 B;  5K0I A;  3EGD A;  3IAM 2;  2XAG A;  2GQQ A;  3G6E I;  4G6Q A;  5A69 A;  1MSF C;  2ZBK A;  2NUT A;  4O6M A;  3VPR A;  1T6U A;  4QLC U;  3HRM A;  1KZH A;  1IN5 A;  1TQP A;  1QZX A;  2KP6 A;  5K1Y A;  2DQR A;  3FMS A;  3CC2 I;  2L6F A;  3QW0 A;  3AG3 C;  4HNU A;  5IP7 J;  5LEK A;  3VM6 A;  4LB5 A;  2KIU A;  5H6Q A;  4EHP A;  4A69 C;  4DRJ B;  4GYG A;  3OSF A;  4XEF A;  4L6R A;  5AGF A;  1X1A A;  5E3A A;  2RN7 A;  2OF7 A;  1MDM A;  3K9T A;  3K2A A;  2LTP A;  4F93 B;  3GCM A;  1TLH B;  3HRS A;  1RC9 A;  2HI3 A;  4FHT A;  3P9C A;  3CCR I;  2P6T A;  3CUQ B;  1G2H A;  1M56 C;  3DTK A;  2XLD A;  2PI0 A;  3QVY A;  2EBI A;  4I7H A;  2E2I J;  1BJZ A;  3EG9 A;  3CCL I;  2HTS A;  2CQK A;  3ATP A;  1I3A A;  5HS9 A;  2LKX A;  1JOG A;  1XGM A;  4IHT A;  2BVL A;  3IRQ A;  4BJ5 A;  1T39 A;  4LK0 F;  5JT4 A;  3JR9 A;  4Y52 J;  1JHH A;  1EA8 A;  2FNP A;  5FFZ A;  1K61 A;  2ACJ A;  4JJG A;  2VKD A;  2CMP A;  2LMD A;  1TW3 A;  4WF2 A;  1MNM C;  4HRI A;  2VCA A;  4CIP A;  2K5C A;  3CJT B;  2YUS A;  3Q7G A;  2GOX B;  2EZI A;  2JX0 A;  3BR1 A;  3DBH B;  3R0A A;  4A6D A;  2PX3 A;  2B0L A;  4N4W A;  2IXO A;  4PZJ A;  1J5Y A;  4C2T A;  4YT5 A;  2VQG A;  1IV8 A;  2Q0O A;  1IGN A;  5E8I A;  2O6G E;  2CYY A;  2JA6 J;  4U88 A;  5LRR A;  1FYM A;  1YOV B;  2DTZ A;  5IT3 A;  3J7Y J;  1W36 D;  2M0M A;  4P5O A;  3ZG1 A;  1KTM A;  2LQG A;  4A3E J;  1S7A A;  1VB5 A;  3GOR A;  1OW6 A;  2EWN A;  3BCA A;  1FOX A;  3CMA I;  4LLC A;  4Q47 A;  1VQ4 I;  2K3P A;  1B72 B;  4G7Z F;  1L3P A;  1Z21 A;  1I1S A;  3GZ6 A;  3M8F A;  1MJ9 A;  3DZA A;  1MJB A;  3S29 A;  4F4B A;  4GEH A;  3NAU A;  1JKO C;  3CF2 A;  5E1Z B;  3EFO B;  1Z1D A;  1RMV A;  4QPO A;  2Y9Y A;  1ZTR A;  2YPR A;  4A0Z A;  5J8F A;  1RET A;  3HGG A;  5COM A;  2ETS A;  3S0X A;  1HW1 A;  1F1M A;  1HKQ A;  3BQY A;  4AYB N;  4A3C J;  5H6R A;  4S05 A;  3F8C A;  2CJJ A;  1TQM A;  4V2G A;  1OW7 A;  4ZTF A;  1KQ8 A;  1S9H A;  3IH4 A;  2IYL D;  1NG1 A;  2PMZ N;  2P1A A;  4QI0 A;  4YWQ A;  3LA2 A;  2IA1 A;  1BOB A;  1CPQ A;  2CYD A;  1IRF A;  1D1A A;  3HRT A;  2VT2 A;  2Y9Z A;  2L7M P;  3WU0 A;  4RMN A;  4OIQ F;  4CIH A;  1L3L A;  2ZXO A;  3TDU C;  1QPU A;  1C03 A;  2JRM A;  4HSR A;  5K5O A;  3S27 A;  2Q1Z B;  5LRS A;  3GM2 A;  3W6J B;  4CDY A;  3GLL A;  4YT8 A;  2LC2 A;  4RB2 C;  3AQB A;  3OA1 A;  4I76 A;  1APC A;  2WAD A;  3WOD F;  3LSR A;  1K4S A;  2CV1 A;  3IEE A;  3S84 A;  3QP5 A;  5H2F C;  3S3O A;  4YL1 A;  5CVV A;  2YVK A;  1UG0 A;  1FOK A;  1K40 A;  3PFI A;  4P9U A;  4E6K G;  2WAQ A;  2MGQ A;  3VEP A;  2NS7 A;  2LSE A;  2WAE A;  3VYU B;  4KIG A;  2M3A A;  2DTR A;  5FKK A;  2W1O A;  2HXO A;  4BE2 A;  1SAU A;  4LG0 A;  3W2W A;  1U8R A;  1WPK A;  2Q4F A;  1KQ0 A;  1H0M A;  2YRF A;  4BEM J;  2Y30 A;  1YE9 A;  4OAY A;  4CA0 A;  3K33 A;  3EDP A;  3MD2 A;  2DAO A;  2EA2 A;  3OV8 A;  5IT9 K;  3AJM A;  3ZMV A;  2XKO A;  2XVC A;  3M79 A;  2DA7 A;  3B0P A;  4C3B A;  2ZXJ A;  3I0T A;  5FRM A;  5E8G A;  1JT6 A;  3QOD A;  4DJA A;  2XLW A;  3H3Z A;  4DOZ A;  3K1I C;  3CCJ I;  2FXA A;  1HDD C;  4BXX J;  1OR7 A;  1VFC A;  3E97 A;  4LD5 A;  3PMR A;  4JQF A;  1ZLJ A;  3OL3 A;  1YLF A;  4IO9 F;  4UUS A;  2R03 A;  2R7D A;  5L0G A;  1ETX A;  1G3Y A;  3KYD B;  1QKR A;  1Y8Q B;  1ETY A;  2DOF A;  1OPC A;  1A04 A;  3FF5 A;  4N9I A;  4PUS A;  2DT5 A;  3V8K A;  3TGN A;  3IL2 A;  1R9T J;  1LQ1 A;  2W00 A;  3LSM A;  3NKD A;  2EFP A;  5EHH A;  1NZE A;  1ZHX A;  1VQ8 I;  2NUP A;  4O7G A;  4X0G A;  1ORY A;  1K4T A;  3KL4 A;  4JEA A;  2BXZ A;  1ZW3 A;  3LAY A;  2K7L A;  3FHN A;  2LSO A;  5BQT A;  1S6L A;  1ZGJ A;  3U8P A;  2B9S A;  1FTS A;  1MD0 A;  3BTJ A;  1BL0 A;  2HMZ A;  2RDP A;  2B0J A;  3CEX A;  3RCO A;  3PUB A;  4HFK B;  2LH9 A;  2B63 J;  1MMD A;  1ODD A;  4HPQ A;  4U5D E;  5L3Q A;  1I6X A;  3V8J A;  3W3C A;  1I39 A;  4JZA A;  1E2X A;  3LEO A;  3FK6 A;  1IJW C;  1JKR C;  3FOO A;  1FP1 D;  3T6B A;  1YS6 A;  4YEJ A;  3DE8 A;  4UVB A;  4NHJ A;  1ACI A;  4L9V A;  1HA8 A;  3C2G A;  2QUP A;  2O9L A;  1Q0D A;  3EGD B;  5D5X B;  2XGD A;  4O5V A;  2Q2E B;  4BUP A;  4EV0 A;  3K1P A;  3I4P A;  3DXJ F;  5KHD A;  2NUT B;  2O7O A;  1SFK A;  2XPU A;  3IQC A;  4JEB A;  5JVG F;  2BY3 A;  4J32 B;  1VQ7 I;  2HMQ A;  3F46 A;  4CCK A;  5F6F A;  1O3S A;  4AD9 A;  4FTH A;  1YW7 A;  1WSU A;  2CUZ A;  1ZHF A;  1SVM A;  3G1L A;  3ZQI A;  1WCM J;  3A01 A;  4QI2 A;  2BV6 A;  1E3H A;  2E19 A;  3LSK A;  3MFK A;  2ETH A;  4J00 A;  4GCV A;  5D4S A;  4U5C E;  2YL7 A;  1STZ A;  3FX3 A;  2CW0 F;  2LRE A;  2EB7 A;  2Z2S B;  4ZZL A;  5K5R A;  5CJ9 A;  3ZP5 A;  1QU3 A;  3JTL O;  4A3M J;  2YKZ A;  1YIJ I;  3O39 A;  3SNH A;  3HYI A;  3FAJ A;  3PSF A;  3US6 A;  1D0Z A;  4MVZ A;  3RQE A;  3EG9 B;  1WJB A;  1MMN A;  2KFD A;  2ZJQ F;  2ZME C;  1VMA A;  1U2W A;  1ZU4 A;  4HLY A;  4ZTJ A;  3LA7 A;  1IG7 A;  3KYC B;  4XLP F;  4KNW A;  2RD9 A;  1Z7U A;  1TWA J;  2RAE A;  2QA4 I;  2VJJ A;  1FMW A;  2J0X A;  2GBY A;  3LQQ A;  2KGO A;  2KZG A;  3H5R A;  4IHY A;  4EBJ A;  5GTH C;  4N06 A;  4HW0 A;  3DBR B;  5C4X J;  1I3Q J;  2GOM A;  5CVR A;  1U3E M;  3I4M J;  4XTK A;  2P6V A;  4C2U A;  2YLG A;  2L5Q A;  5TRD A;  1U9O A;  2VBY A;  1HQC A;  3N05 A;  4NY3 A;  1K79 A;  1D0X A;  1WH7 A;  3MYF A;  2LVS A;  4II3 A;  1U5T A;  5FKM A;  4BQO A;  4QPQ A;  1BW6 A;  1QZZ A;  3BTL A;  4RDA A;  4CIC A;  1D5V A;  5GP9 A;  3DCF A;  1H89 C;  4CSA A;  4HNT A;  2ELH A;  5GPC A;  5BPI A;  4B44 A;  4DRI B;  2KNH A;  1TWF J;  2YR2 A;  1YRN A;  5HLT A;  3DPL C;  5JLX A;  1GHC A;  1K6Y A;  1ZZP A;  4LAC B;  4HA8 A;  2XXA B;  3RKQ A;  1YFH A;  2J5O A;  4XKV A;  2E34 A;  3BTI A;  4C9Y A;  1YI2 I;  2R02 A;  2X6X A;  5CQG A;  1XCB A;  3SEZ A;  5JR3 A;  4K1O A;  5F5H A;  4IKF A;  2FU4 A;  2XPW A;  1VND A;  2LNB A;  1TWH J;  2DJN A;  3H3U A;  3U2R A;  2EPO A;  4K7B A;  3ZR8 X;  4EGY A;  3IQ5 A;  2L6G A;  3KET A;  2G0E A;  3HOY J;  4BY1 J;  2HNH A;  1MIJ A;  3WTW C;  2IT0 A;  4ZDP A;  1S8N A;  4XKW A;  4DW6 A;  3KCC A;  3WTS C;  5F08 A;  4EJW A;  1XCV A;  3DPT A;  2N8G A;  3WG7 H;  4E7L A;  5DUI A;  1NSG B;  2R7F A;  5D91 A;  4G94 A;  1F43 A;  1LFU P;  4M71 A;  2LY9 A;  4B8X A;  3WTU C;  3IQ6 A;  1TFK B;  4EM1 A;  1LE8 A;  3RJP A;  4XRS G;  2LFB A;  1YJ9 I;  2A6T A;  1X1D A;  4BKX A;  4Y4R A;  1HE1 A;  3HOS A;  1XC5 A;  4E70 A;  1HW2 A;  2QY9 A;  2Z99 A;  1TBX A;  4IOC F;  2QSF X;  2D2W A;  4LLG F;  5CQE A;  2VC1 A;  1SR2 A;  3PQK A;  2VJI A;  4XRF A;  1H8A C;  2VT3 A;  2UWM A;  4LG0 B;  5HLI A;  1Z6R A;  4DBQ A;  3OYB A;  1Z23 A;  3RKW A;  4EJT A;  4OIR F;  4NUB A;  2KT0 A;  4UUT A;  1OCZ C;  4KN7 X;  3BZK A;  4E7S A;  5EGY A;  4LG3 A;  3H1C A;  1QBJ A;  3RSN A;  2L9R A;  4B4C A;  3TUL A;  3G4S I;  3JAM K;  2XF5 A;  2OTJ I;  1MZB A;  2R5Z A;  4GFB A;  1DPR A;  2XRH A;  1V55 H;  1VQ5 I;  1NHA A;  3QYB A;  1LM3 B;  2IAI A;  5DTD A;  2GM4 A;  2GXB A;  2WAF A;  2Q3T A;  5A6K A;  5L3G A;  1X58 A;  4UUS B;  4LLL A;  2P7V A;  3E3V A;  3S93 A;  3NWT A;  2LP4 A;  3E7L A;  5T3W A;  3GAN A;  4CXF A;  1FP2 A;  4PSX A;  3WG7 C;  4DVY P;  1MBF A;  1SD5 A;  4XQF A;  3KP4 A;  4IVN A;  1YJW I;  5CKT A;  2D4U A;  3QPT A;  2RNJ A;  2E36 A;  2Y31 A;  3GZ5 A;  2VBX A;  1ZK8 A;  4F3Q A;  4NB5 A;  5BS6 A;  4EAT A;  1PD0 A;  3BR3 A;  1WH5 A;  2IP2 A;  3EUA A;  1R1V A;  2FBK A;  3K1N A;  2ID6 A;  2LK4 A;  5B1A C;  4ZLC A;  4HAM A;  4MHG A;  3RKY A;  1ZGA A;  4EGZ A;  2QZ8 A;  3QRF F;  5L0I A;  3LFU A;  3OOP A;  1IAW A;  3A11 A;  3S1R J;  2WTE A;  1FMV A;  1PUF A;  2ELK A;  2JRT A;  1MMA A;  1AUE A;  1WFX A;  1OR3 A;  2E5Z A;  1TNS A;  1XGO A;  2DO7 A;  5D6E A;  4C7O B;  4CCJ A;  4IRU A;  3HTS B;  1QVX A;  4XMY A;  2J9V A;  2C03 A;  2TDX A;  3RYP A;  1QNT A;  3SHF A;  2A05 A;  3GTK J;  3GTG J;  4OU0 A;  3PO3 J;  2M7B A;  4F92 B;  2HKO A;  3DM5 A;  2WAQ N;  4U5G A;  4BJ5 C;  2WL8 A;  2HU9 A;  3K4M A;  2Q7R A;  1O87 A;  3S9O A;  5HDK A;  1KU3 A;  2R5Y A;  4NC7 A;  5LLQ A;  1W7P A;  3LJB A;  4BGD A;  3HXL A;  3GFM A;  2NSF A;  2G3K A;  3CQZ A;  1V55 C;  1FNT c;  2L7K A;  4B3X A;  2GXG A;  3Q0U A;  2IS6 A;  2H09 A;  1T01 A;  5BQH A;  1ZRF A;  4BAC A;  4N6C A;  1SMT A;  3ERM A;  3ZMT A;  2A0B A;  2BOL A;  3BZC A;  4RAZ A;  5DEQ A;  5CVI A;  3SFI A;  5IPA A;  1SEU A;  2PEX A;  1VQL I;  1BOA A;  5KAF C;  2V9V A;  4R79 A;  5B1B C;  1NG7 A;  2IGK A;  2KRF A;  1JTY A;  1FOY A;  1SAN A;  3WG9 A;  3B9Q A;  2WC2 A;  2KSF A;  1MBJ A;  2XLO A;  3FVY A;  2EPF A;  3OOU A;  4OIP F;  2IVM A;  1Y56 A;  4IEJ A;  3VOD A;  1SFU A;  2VQL A;  4IL6 C;  2Z9O A;  1LIH A;  1F36 A;  2L3D A;  1LE2 A;  2DT6 A;  1YAU O;  3OYE A;  3ITF A;  2RC4 A;  3W6V A;  2Z15 A;  2DQL A;  1XMK A;  2W4B A;  3FDQ A;  3DD7 A;  2UXN A;  3FM3 A;  3RZO J;  5KCM A;  2MFZ A;  1ZH5 A;  5EF6 A;  2VQH A;  2X48 A;  4M6X A;  4XSX F;  2DOD A;  3FKI J;  3ISP A;  1NH3 A;  5F0C A;  3ZGK A;  5CLS A;  1UJ8 A;  2CGP A;  2YZS A;  3MN2 A;  5J40 A;  3TW7 A;  1I5N A;  4XN0 A;  3GVA A;  5HV9 A;  2DFI A;  2LBF B;  1C02 A;  5EK0 A;  4V2F A;  1X4O A;  4N0B A;  1XTA A;  5FCL A;  2MA3 A;  1G5Z A;  2JQ7 A;  4KMF A;  1IV6 A;  2COM A;  1A36 A;  3S17 J;  1Z6A A;  1WRJ A;  4MGR A;  5C3E J;  4JBA A;  1R23 A;  2OCE A;  1E85 A;  4JIO A;  2HTJ A;  3OIO A;  1OCO H;  2W25 A;  3CME I;  1WWP A;  2HDW A;  4Y3O A;  2PQ8 A;  3ZN0 A;  1YVI A;  4D4N A;  3Q3S A;  3E6D A;  2Y69 H;  2MG4 A;  3SZP A;  2XAF A;  1DOW A;  3BZ6 A;  3F21 A;  2R0Q C;  4AL0 A;  1GV5 A;  5GPA A;  2X4H A;  5IT9 Z;  4I09 A;  2FF4 A;  4I02 A;  4DYR A;  4DVZ A;  2HXI A;  3OYJ A;  1XMX A;  4M9S A;  1D1B A;  2QBY A;  1LNW A;  3U9G A;  3GO5 A;  1M2O A;  2F22 A;  2EFN A;  4MVO A;  1O4X A;  4RAY A;  3ABL H;  1YRN B;  1BN5 A;  2EZK A;  2STT A;  2XL8 A;  4JCH A;  1XX5 A;  4HST A;  5L3F A;  3ZN1 A;  2Z16 A;  2ZXW H;  2K86 A;  3DKX A;  3NYL A;  2W9Y A;  1KU9 A;  1ZGW A;  4RD9 A;  2LK2 A;  1U0J A;  1WJ5 A;  4E7K A;  5BNG A;  4CZC A;  3ZPL A;  1LFP A;  2ZME A;  1LVA A;  3L2V A;  2R05 A;  2WB7 A;  3H92 A;  3MZH A;  1F5T A;  5E2Q A;  5E1X A;  2I5U A;  1OYW A;  3BG9 A;  4EM2 A;  2DU9 A;  4HNV A;  2HS5 A;  4UUV A;  3FHD A;  5DS9 A;  4IGG A;  2K4J A;  3HJE A;  2YQY A;  3H0G J;  2CW7 A;  2XL6 A;  3ZQF A;  3JRT A;  3GUD A;  2DW4 A;  5F0F A;  4JOM A;  2ZO4 A;  3RF3 A;  3RQF A;  3PJR A;  1LE8 B;  2EPN A;  3HM5 A;  4GRI A;  4RS8 A;  4DBR A;  4YG2 F;  1BM9 A;  4FET A;  3H2V A;  1JHF A;  1S5L C;  1YDI A;  4RGR A;  4XQ1 A;  3ML6 A;  4FT8 A;  1OR7 C;  4N9H A;  2QSH X;  2Y69 C;  2RGV A;  1UHS A;  2A5W A;  2L81 A;  3LQR A;  1A7V A;  2E35 A;  3DJN B;  3TQN A;  3U21 A;  3O8H A;  2IXP A;  3HJC A;  1YG2 A;  3BG6 A;  3FK7 A;  3TP3 A;  3BRO A;  3DI5 A;  2VIX A;  3F72 A;  5GPG B;  3AG4 C;  1YYV A;  3ONQ A;  3KP7 A;  4IAQ A;  2LCH A;  3BR0 A;  3CLO A;  2L9S A;  2WZL A;  1XSV A;  1OR2 A;  2LG4 A;  2X6Y A;  2ZXW C;  2CDQ A;  1LS4 A;  4BDZ A;  2J9U A;  2M30 A;  1H6G A;  2R5Z B;  1FYK A;  1AKH A;  3RQI A;  2LY2 A;  4EWC A;  4XLF A;  2F5E A;  5ILS A;  3KYI A;  5TJ5 E;  3LAP A;  1YIT I;  4FAP B;  3KYL A;  4BS9 A;  1REP C;  2VPL A;  1QVU A;  1A5J A;  1QRY A;  1UB9 A;  2M8G X;  2HVR A;  1JRA A;  2P7V B;  3MX3 A;  3J7Z I;  5K7H A;  3T1B A;  1ZU5 A;  4DZP A;  1ZAR A;  1MBK A;  1FY7 A;  2XC7 A;  4MNU A;  4ZZD A;  5FO5 A;  3WTT C;  3CC7 I;  1ORS C;  3N2Z B;  3I9V 2;  4WCG A;  3COA C;  2ZNZ A;  3TD7 A;  3RW0 A;  4ZYE A;  4KIB A;  4ENK A;  3HSF A;  4Y13 A;  4ZDL A;  5L3V A;  2GAU A;  3QP6 A;  4E18 A;  2E1O A;  5KYU A;  3GWN A;  2IA2 A;  1FTT A;  4ER9 A;  4OMZ A;  4YEL A;  5T1D B;  3LLI A;  3W8H A;  1TWC A;  3LSH A;  4BAY A;  2PNO A;  2R3S A;  5D4R A;  2ZSH B;  1BIA A;  2CNW D;  2IXN A;  4H54 A;  1X3Z B;  2WZF A;  3AAF A;  3KIO A;  3VB2 A;  1MQV A;  3U9J A;  5COF A;  2CWE A;  1ZYR F;  3FIS A;  4IHV A;  1Z67 A;  2VKE A;  5F1R A;  3K4N A;  1OKK A;  2XM4 A;  2R7Z J;  3SZT A;  2Y75 A;  5ED4 A;  3S1N J;  2QWW A;  4I0B A;  1AOY A;  2XGC A;  5E79 C;  2YWA A;  1O7L A;  3MKL A;  3OWT A;  1YAR O;  3S15 J;  3HTU A;  3GLX A;  4A3J J;  3A03 A;  2HVQ A;  2PLY A;  3RKO F;  3CDH A;  1W7P B;  1XGS A;  5LGT A;  4IX7 A;  1VZ0 A;  1LVK A;  1YW8 A;  1BJA A;  3SXZ A;  4WWC A;  1H88 C;  5EEA A;  3ASO H;  5DQT A;  1Y0N A;  2JA8 J;  3EET A;  4BJT A;  4P55 A;  5B3I A;  2ZC2 A;  4JX4 A;  4ENJ A;  5M5Y J;  3HSE A;  5J3L A;  3TMO A;  1NK2 P;  4MVQ A;  2E7W A;  4MTF A;  1MSE C;  3PQJ A;  3RQG A;  3DKY A;  4BNC A;  1PJR A;  2VBZ A;  3H3V K;  2NSG A;  3QVZ A;  3M4O J;  3K10 A;  1WTY A;  3C63 A;  3IH3 A;  4LLE A;  2KK1 A;  1U5T C;  2FX0 A;  3OR1 C;  3W6K B;  2LYC A;  1E3P A;  2K85 A;  4L9J A;  3HHH A;  3G1M A;  3BQZ A;  3HNI A;  3EHN A;  2F6C A;  4QSH A;  4JP0 A;  2ZPA A;  1GQA A;  4CSA C;  1VQ6 I;  4LJZ F;  1IF1 A;  2R7O A;  2LR8 A;  4G8X A;  3UMI A;  2D1H A;  2YU3 A;  2W84 A;  3SZG A;  3MQ0 A;  1Y8R B;  3O2P E;  2FJ1 A;  1P92 A;  1IN4 A;  2XM0 A;  4YL0 A;  1WJF A;  3PHF 2;  3U5S A;  1B68 A;  4UVA A;  5L0F A;  3DTI A;  3SXM A;  3FXH A;  1RJ9 B;  2MC4 A;  3O6X A;  4XLE A;  3K69 A;  1A0B A;  4ZDO A;  1IZM A;  2EIJ H;  4E4H A;  4GQH A;  1A7D A;  3ABK H;  2ID3 A;  3LS0 A;  1JJ6 C;  2OJE D;  2QVO A;  4G78 A;  2F4M B;  2K9S A;  2TCT A;  3E1S A;  5E3O A;  2V4J C;  3SYN A;  5LD2 C;  3FMQ A;  1A41 A;  4MEX F;  3ZIB A;  4CZZ A;  4XNF A;  3K6G A;  2P0N A;  1KGS A;  1X1C A;  4RBO A;  2LY1 A;  1DGW Y;  1MBE A;  1ZRC A;  2IBD A;  2M64 A;  3K2Z A;  4MQV A;  4A3D J;  1YLM A;  1TT5 B;  1PUE E;  1A35 A;  1YW9 A;  3PFY A;  4RGX A;  2RNG A;  4U5B E;  1SVL A;  3ASO C;  5EYR A;  2QBY B;  2G62 A;  2V1N A;  4F91 B;  2CS3 A;  4NNJ A;  2JK3 A;  3JAM Z;  5EG0 B;  5HLH A;  1FEX A;  1JT0 A;  4ZLD A;  3BG3 A;  3LSJ A;  2XKP A;  3MKW B;  2H7V C;  4EUK B;  4KMU X;  1P4X A;  5FRN A;  1QSP A;  2YS9 A;  3SJM A;  1U78 A;  1JPJ A;  3H2U A;  3ESW B;  5KAI C;  2J46 A;  4DJ9 A;  2WY7 Q;  2K9N A;  1R5I D;  3S1Q J;  4I6Z A;  1N1C A;  1WJC A;  2VKH A;  3Q9V A;  1VQ9 I;  3S14 J;  2RVC A;  2XRN A;  2ZME B;  3HGY A;  2FQ4 A;  3OMY A;  4AWX B;  2VE9 A;  4A3I J;  1ETK A;  1UCR A;  2P0W A;  5FB2 A;  2V79 A;  4I99 C;  2AS5 F;  3NQO A;  3I3L A;  4L5I A;  2LRD A;  3MWM A;  4FQG A;  3KP2 A;  1WJE A;  2XV4 S;  2AQF A;  2NOG A;  4EBB A;  3BR5 A;  5JRA A;  3K4C A;  5E18 F;  1Z3I X;  1WI3 A;  4RLQ A;  3D0S A;  1TL8 A;  3CQZ J;  3GFL A;  2D1V A;  4E7H A;  1Z3Y A;  3AKZ A;  3EZI A;  3SZR A;  2J5P A;  1ERD A;  1A6I A;  1S7E A;  4YFK F;  2EFQ A;  3ABK C;  2JMW A;  2PJR A;  3M8E A;  5ICG A;  3U9M A;  1I27 A;  3NG1 A;  2QGU A;  3KLO A;  3GW2 A;  3HOZ J;  3I59 A;  3SYT A;  1PD1 A;  1JPN A;  3U2L A;  2YHS A;  2O8K A;  3JSO A;  4YT2 A;  1EH6 A;  2F4O B;  2F4I A;  2M45 A;  4RA2 A;  1V5G A;  3OYC A;  1UAA A;  3O10 A;  1RNL A;  2YU9 J;  2JJ7 A;  1GLN A;  4CSW A;  3OYA A;  3U0C A;  3X1O A;  3P9I A;  4J30 B;  2MWQ A;  2XB5 A;  5BUO A;  1BBY A;  2E2J J;  1P9Q C;  1R00 A;  2MH9 A;  3H5A A;  4BE0 A;  2Q9B A;  5DM6 F;  1ZVZ A;  3B71 A;  3JYH A;  2Y0S N;  4N4O B;  2BY1 A;  1IC8 A;  3R4K A;  4KIS A;  2Z5U A;  4JTD B;  1OIS A;  3D5R C;  3FXL A;  3L09 A;  3F8N A;  1AKH B;  1WJA A;  4R32 A;  4ZC3 A;  1F1Z A;  3FXR A;  4W97 A;  3HOV J;  3F8B A;  3KP5 A;  3IHU A;  4UVC A;  2WZG A;  3GYH X;  4CUG A;  1R36 A;  2XPV A;  4CYC A;  1B8I A;  4KJZ A;  1QLE C;  1RKE A;  1OYI A;  1I6H J;  2I15 A;  1Z3X A;  2YSR A;  1IUF A;  1YJG A;  5JHF A;  5E3N A;  2HQN A;  5ICF A;  2R7V A;  1Y6D A;  4D7N A;  3PL8 A;  1W1W E;  3TP0 A;  3QMK A;  2Q9C A;  4JRZ A;  3BLY A;  3MAJ A;  2DK5 A;  4LER A;  3ZMU A;  2IGO A;  5K5Q A;  3DM9 B;  5F04 A;  3LSP A;  2KIF A;  2P5V A;  1BR4 A;  3H36 A;  4HX7 A;  4BHB A;  1PP8 F;  3I55 I;  2Z3Y A;  2HWV A;  2HV7 A;  2X51 A;  5HS8 A;  4G7H F;  4A5N A;  1XPX A;  4I3M A;  4AE4 A;  4II2 A;  2WV0 A;  2O9X A;  4BBR J;  5JVE A;  2QLZ A;  3K4K A;  2HJM A;  4W8P A;  2A61 A;  2E7X A;  4XR6 A;  2LKP A;  2AVK A;  5DQZ A;  5JP7 A;  1KYW A;  3CP2 A;  4Z9I A;  3M3Y J;  2KDO A;  1BC8 C;  3NRH A;  4UHT A;  4CCN A;  2VUM J;  3QU3 A;  3CMY A;  3AQC A;  4F52 A;  1SD6 A;  2HYF A;  3UNG C;  3DFG A;  3ZQY A;  2GLO A;  2BL2 A;  1XGN A;  3UMK A;  2EPM X;  3L9F A;  3R7C A;  1YYJ A;  1TKN A;  3ECS A;  1P6R A;  1I5Z A;  3VYT B;  3J80 K;  1SAX A;  5GAH J;  3ZTZ A;  2EJR A;  5AON A;  2HKV A;  3H35 A;  3EPV A;  1BI2 A;  3JRC A;  4JVS A;  3EZH A;  4E7J A;  4JKV A;  1Z5Z A;  2J7P A;  3L34 A;  2H8A A;  3S16 J;  1BIB A;  1I4Z A;  3CLQ A;  5F0H A;  4YII A;  3GWL A;  2WY8 Q;  4E17 A;  3WHC A;  3FDY A;  1HKS A;  5LEJ A;  3P9K A;  2DA6 A;  5TJJ A;  3IH2 A;  2OJQ A;  2ZSI B;  2WA0 A;  4ZYA A;  1A31 A;  1G8X A;  1G4D A;  3O6B B;  3K4J A;  4G9Y A;  4LLN A;  2JN6 A;  2KHM A;  3T8T A;  3V42 A;  2JD3 A;  2OQG A;  1WHU A;  2KPM A;  1RKW A;  2AP3 A;  3J7A O;  5D6F A;  4EM0 B;  3X2Q C;  1A7E A;  3DPU A;  3EH1 A;  4A93 J;  2R93 J;  2OOC A;  5HDN A;  3CCV I;  3CDI A;  5F1J A;  4GYT A;  2MHR A;  3GEI A;  3Q6M A;  1TW2 A;  4M3F A;  4I1M A;  2GWR A;  1MDM B;  1XD7 A;  2KZV A;  2A69 F;  3ABT A;  3CDL A;  1F4K A;  5FGM A;  3G73 A;  2A07 F;  2CG4 A;  2XAJ A;  2VI6 A;  2DK8 A;  5E33 A;  3ZDL A;  1TWG A;  3TOM A;  1IDZ A;  1ZN2 A;  5JVT A;  3TQO A;  2X85 A;  3M1C A;  2XLH A;  4V19 K;  4M3E A;  3W2A A;  2KL4 A;  2B7E A;  1VQO I;  3T5X A;  4CDG A;  3WHN A;  2IJL A;  2L0K A;  3C18 A;  1Z0X A;  1NG6 A;  1WAT A;  5D5V B;  1Y1W J;  4RGU A;  4BE1 A;  1PCX A;  3OS0 A;  2KQR A;  4XKB A;  2HZT A;  1XN7 A;  4JK1 X;  2TMV P;  3EUH A;  5L0C A;  1UEL B;  5LHG A;  3ZTM A;  4PAC A;  1NLX A;  1TWC J;  1ETO A;  3JRG A;  5A6B D;  3RPU A;  4IHS A;  3J7A Y;  4LDR A;  2LKS A;  1YZC A;  3C8G A;  2KRC A;  3JSP A;  2ADU A;  1WAS A;  1W4M A;  2WBM A;  1UFM A;  2VCB A;  5D5U B;  3NMJ A;  3TK0 A;  2XAQ A;  2QQA A;  3MMY B;  3KZZ A;  1MNE A;  2FD5 A;  5DDG A;  2NVU B;  2QE9 A;  4ANJ A;  4BQN A;  3GF2 A;  4YK5 A;  2L9J A;  3LOC A;  5KYX A;  5ICC A;  1FBU A;  4PJL A;  2YLI A;  3SEQ A;  1E84 A;  1FR0 A;  1QQI A;  2LFF A;  3CCY A;  2DMQ A;  1QZE A;  3HHG A;  3MCZ A;  1A6Q A;  1UHW A;  4P6I C;  2PJP A;  1R1U A;  3LFK A;  3ZMZ A;  4ESJ A;  3AOU A;  1J8Y F;  3N0T A;  2LP0 A;  3UMH A;  3NYM A;  2IGN A;  4NQW A;  4U0Y A;  2FRH A;  3KZY A;  5E20 A;  2YX7 A;  4BHP A;  1K05 A;  3NMI A;  4M9Z A;  5F64 A;  4CBE A;  3BJ6 A;  5JLW A;  3UKG A;  1D8J A;  2H8R A;  4GGG A;  1YTY A;  1GS9 A;  3A9C A;  1HCR A;  3I59 B;  1MMS A;  4KN4 X;  4U7D A;  4PGH A;  3U2M A;  3R6S A;  1QGP A;  4BDY A;  5J4V A;  4WGZ A;  4CDV A;  4D5F A;  3JSZ A;  3SFZ A;  1VTN C;  1GXP A;  4HZF A;  5DCM A;  2XLE A;  2R7W A;  2K9Q A;  4EKW A;  2L02 A;  1IUY A;  1JTX A;  1K83 J;  4LIT A;  2JSP A;  4U0W A;  2A68 F;  2JPB A;  2LD6 A;  4XN3 A;  2X9D A;  3DBL B;  3PUF A;  3N4M A;  5CI9 A;  3DF8 A;  2X6W A;  2QEN A;  4QTR A;  2R25 A;  1T9K A;  3E70 C;  2QSG X;  5E3L A;  5IYD J;  3JTG A;  2ZFU A;  3OL4 A;  2CH0 A;  1IN8 A;  2W85 A;  3BG7 A;  5ICE A;  2XL4 A;  3HLZ A;  4DZJ A;  5J8C A;  1S05 A;  2ISY A;  2QM3 A;  4BXU A;  3K6B A;  3OYI A;  4XID A;  3S28 A;  4C3D A;  3S3M A;  1FNN A;  5J1Y A;  4FX4 A;  1RKE B;  1OCT C;  5HS7 A;  3GTP J;  1WI9 A;  3B0V C;  3JZ0 A;  1LKX A;  3QQA A;  2CCY A;  1IXC A;  2LIG A;  3FIW A;  3OY9 A;  2QUF A;  3L1M A;  1S29 A;  3FWE A;  4ZJZ A;  4G7O F;  2G3V A;  4UDV A;  3SXY A;  4HG2 A;  4EQQ A;  3RYL A;  2Y39 A;  1R4T A;  4HQM A;  5DUK A;  2XDV A;  5EZG A;  1T38 A;  4UV8 A;  4XRM A;  4NTA A;  2ZKZ A;  4NDL A;  2H7O A;  2OBP A;  4WX9 A;  1SVO A;  2XRO A;  5E3C A;  1OW8 A;  1OCC H;  1VF9 A;  4OAZ A;  2K4B A;  4AE4 B;  5T3T A;  2M0C A;  3LA3 A;  4E0H A;  2JVH A;  4UB8 C;  5L3B A;  2X6O A;  2DI3 A;  4XOR A;  2FA5 A;  3CTA A;  3R60 A;  2BY0 A;  4B48 A;  5FLM J;  3HOU J;  1NFN A;  2BC5 A;  1ZRE A;  2KQ9 A;  3HTK C;  4Z9J A;  1CGP A;  4WXD A;  4O79 A;  5HOD A;  1LI5 A;  3HKK A;  4L0Y B;  2WVQ A;  3C2B A;  5JI6 A;  1HY5 A;  3WGH A;  2IW5 A;  4RGS A;  3S90 A;  1FLI A;  1AA7 A;  4C3H J;  2V6C A;  4EEF G;  2KLO A;  1GUU A;  3GBG A;  5HVQ C;  1J59 A;  2H6B A;  4JTA B;  2NUP B;  3KX2 A;  3RTR A;  3HRU A;  1CGO A;  2KMU A;  2DOE A;  1NU9 C;  5IOY A;  1L0O C;  2W4S A;  5F5F A;  1HDP A;  3ABM H;  1N25 A;  3WGG A;  3QW1 A;  4IAR A;  5AIQ A;  4A3F J;  3LSG A;  4GYI A;  1YA9 A;  1KA8 A;  4EMS A;  5C4J J;  3SP1 A;  1V4R A;  4Y15 A;  2COB A;  3MZ8 A;  3QU6 A;  1OCR H;  2K02 A;  2MC3 A;  1W0U A;  2VLA A;  4YL3 A;  1U9N A;  2FAP B;  3SEO A;  5ILU A;  2XSD C;  1J75 A;  2JT1 A;  1IN7 A;  2P5L C;  4CCO A;  1LPE A;  3J06 A;  2AQE A;  4XPY A;  1RR7 A;  2RSE B;  1I4Y A;  1TFO B;  2HOS A;  3ECO A;  3TJ6 A;  4L9N A;  3M4C A;  1FT9 A;  3FXQ A;  2HPM A;  3CF5 F;  2UUZ A;  4D7M A; 
#chains in the Genus database with same CATH homology
 4BS9 A;  3I5P A;  4G7Z F;  1Z21 A;  2VPL A;  2M7A A;  3G2B A;  3H9Q A;  4E7Z A;  2HVR A;  1D1C A;  3DZA A;  3A2K A;  3MX3 A;  2W45 A;  3UGP A;  3S3N A;  3S29 A;  2FFH A;  1ZU5 A;  4F4B A;  3CJR B;  1JI8 A;  4GEH A;  2FUG 2;  2JUG A;  3CF2 A;  3EFO B;  2XC7 A;  4RLF A;  4Y33 A;  4QPO A;  1VYI A;  1Y6I A;  3N2Z B;  3I9V 2;  2V9K A;  2PX0 A;  3TD7 A;  3S0X A;  4BJ6 A;  2I8D A;  4ZDL A;  3HL2 A;  5L3V A;  4IWB A;  3Q7L A;  4LIV A;  3VYS B;  3VWB A;  5KYU A;  2ZXH A;  4YEL A;  3PNV A;  4PJN A;  3LLI A;  5T1D B;  3W8H A;  2QTV A;  4ZTF A;  1TWC A;  2LBF A;  3DLA A;  1S9H A;  3DU6 A;  3LSH A;  4PK4 A;  1NG1 A;  2IYL D;  3M1C B;  4QI0 A;  3CJQ B;  3RH3 A;  4YWQ A;  2ZSH B;  2HPI A;  1BOB A;  3OYG A;  3HOT A;  2IGM A;  2CNW D;  3VSL A;  1D1A A;  2IXN A;  2PJR B;  3A4C A;  2WZF A;  2W82 A;  3PNT A;  4CCL A;  4RMN A;  4CIH A;  4OIQ F;  2ZXO A;  4XOT A;  2CV2 A;  1VYK A;  4FES A;  1OCR C;  4HSR A;  1ZYR F;  3FBN B;  3W2V A;  1OKK A;  3K4N A;  2V26 A;  2Q1Z B;  3K7D A;  4B43 A;  3S27 A;  5DS5 A;  4YT8 A;  2LC2 A;  3AQB A;  3OA1 A;  4JUR I;  3K70 C;  4B6I A;  3OWT A;  2WAD A;  2CV1 A;  3WOD F;  4OIN F;  3IEE A;  2HZD A;  4PFO A;  3S3O A;  2HVQ A;  3RKO F;  2E87 A;  4IJJ A;  1UG0 A;  4IX7 A;  1VZ0 A;  4CH7 A;  3ZCO A;  2ZXI A;  2OUM A;  1LVK A;  2WAQ A;  4E6K G;  1J8M F;  2Y3G A;  4PJJ A;  2DXI A;  2ZXR A;  4CS9 C;  4H4K C;  2LSE A;  2WAE A;  3VYU B;  3QYE A;  5DQT A;  2M3A A;  4Q5S F;  1SF8 A;  3L0I A;  2W1O A;  4BJT A;  4BE2 A;  5B3S C;  1SAU A;  3W2W A;  3EUK L;  3DAF A;  2MD0 A;  3H0D A;  4AK9 A;  5KYY B;  2IOQ A;  2R4G A;  4PFP A;  1YE9 A;  2WB1 A;  4OAY A;  4C30 A;  3TMO A;  4CA0 A;  1IW7 F;  2YEV A;  3K33 A;  3MD2 A;  3DKY A;  3LSI A;  3HPG A;  4LIU A;  1PJR A;  4I44 A;  1X19 A;  2R7S A;  3B0P A;  4C3B A;  3OIP A;  2W7N A;  3K10 A;  3LL7 A;  5FRM A;  3I5Q A;  3K66 A;  4DJA A;  4LLE A;  3QOD A;  3OR1 C;  3S32 A;  3K4B A;  2LYC A;  4DOZ A;  3K1I C;  2NOJ B;  5KYW A;  4KIT B;  5DLJ A;  4IQ4 A;  3EHN A;  2F6C A;  1IRX A;  2JA2 A;  3PMR A;  2ZPA A;  2MAB A;  2VQC A;  3OIQ A;  2PMZ A;  3OL3 A;  4JQF A;  4CSA C;  1EA3 A;  4G0H A;  2R7O A;  3UMI A;  2VXZ A;  2Y3B A;  3SZG A;  4IQJ A;  1DGR M;  2XF6 A;  4PUS A;  2Y3D A;  4U5H A;  1WJF A;  2W00 A;  3LSM A;  3PHF 2;  3NKD A;  3T6J A;  3HPH A;  5EHH A;  1NZE A;  3DTI A;  1ZHX A;  2NUP A;  4KBL A;  4O7G A;  1RJ9 B;  2MC4 A;  4X0G A;  2EIK C;  4XLE A;  1OKK D;  3H65 A;  3O6X A;  3EJN A;  4ZDO A;  1IZM A;  3KL4 A;  4E4H A;  3LMM A;  3LAY A;  3FHN A;  4CS7 A;  4ITV A;  5KNL A;  3VYW A;  2L9N A;  1FTS A;  3LS0 A;  4U5F E;  3HG9 A;  1V5F A;  1T0F C;  2B0J A;  3IUO A;  4RM3 A;  3PUB A;  3RCO A;  3E1S A;  4HFK B;  2V4J C;  3SYN A;  5LD2 C;  2LH9 A;  2X1E A;  1MMD A;  3F9K A;  4HPQ A;  4XNF A;  4BEH A;  2KW3 C;  3K6G A;  3MLG A;  3W3C A;  1X1C A;  1NU7 D;  3ASN C;  2LY1 A;  1DGW Y;  5HOO A;  1M57 C;  2PF4 E;  4JZA A;  4JJF A;  3D5L A;  4XON A;  3PFY A;  3L2R A;  2RNG A;  4U5B E;  3ASO C;  3T6B A;  1OCO C;  4YEJ A;  5HNH A;  2G62 A;  1X4P A;  2V1N A;  4F91 B;  2CS3 A;  4NNJ A;  1E0E A;  1HA8 A;  4ZLD A;  3C2G A;  3EGD B;  2KJG A;  2H7V C;  3MKW B;  1J09 A;  4AVZ A;  5HSW A;  3EH2 A;  4BUP A;  2Q2E B;  5FRN A;  2OG2 A;  1JPJ A;  4XLC A;  5KHD A;  4KT6 A;  2NUT B;  3DXJ F;  1SFK A;  2J46 A;  2WY7 Q;  5FRO A;  2A6H F;  3F46 A;  1N1C A;  3LES A;  4J32 B;  4YT4 A;  1WJC A;  2VKH A;  4CCK A;  1TR2 A;  3ABL C;  3QZC A;  2CUZ A;  3CES A;  2IS1 A;  4QI2 A;  3OMY A;  3DAG A;  3LSK A;  2P0W A;  4J00 A;  2E60 A;  4U5C E;  3NWS A;  5KYN A;  3I3L A;  2CFO A;  2LRD A;  3TBI A;  3L2W A;  1WGW A;  2CW0 F;  2LRE A;  1QU3 A;  2Z2S B;  1WJE A;  4Q4Z F;  2AQF A;  1LS1 A;  1OCC C;  4KI2 A;  4EBB A;  3O39 A;  3SNH A;  3K4C A;  1Z3I X;  3FAJ A;  3PSF A;  2V6E A;  2L2O A;  1D0Z A;  4RLQ A;  4OD4 A;  3EG9 B;  1WJB A;  3RFY A;  1MMN A;  1VMA A;  3VYR B;  3EZI A;  4E7H A;  1BR2 A;  1Z3Y A;  3AKZ A;  1ZU4 A;  4ZTJ A;  3SZR A;  5D92 A;  3C2H A;  4MQ9 F;  2A6E F;  2XAU A;  1ERD A;  4XLP F;  1M2V B;  1QHH D;  4KNW A;  4HEA 2;  3ABK C;  4OIO F;  4O6N A;  2PJR A;  2VJJ A;  3AFH A;  3NG1 A;  1FMW A;  4I1O B;  4ULW A;  2J0X A;  2FGY A;  2KGO A;  4CS9 A;  3H5R A;  4XOP A;  3SYT A;  3OYK A;  1JPN A;  1O5H A;  1PD1 A;  2IXM A;  2YHS A;  4N06 A;  2DCE A;  4YT2 A;  2HV6 A;  5L3Q A;  2F4I A;  3QYF A;  2GOM A;  4XKC A;  3EGX A;  3F47 A;  1V5G A;  3HKZ A;  2VL8 A;  3OS2 A;  3OYC A;  1UAA A;  4XTK A;  3T4R A;  2M4G A;  2P6V A;  4C2U A;  3IAS 2;  1GLN A;  2L5Q A;  2E1M B;  4CSW A;  3OYA A;  2BW3 A;  4QDL A;  4J30 B;  2MWQ A;  3N05 A;  3X1O A;  4NY3 A;  5BUO A;  1D0X A;  1P9Q C;  4BE0 A;  2Q9B A;  3H5A A;  2DT7 B;  5CPR B;  2VH3 A;  3JYH A;  2CV0 A;  4N4O B;  1VK5 A;  2O5R A;  1ZEL A;  4KIS A;  4II3 A;  3PSI A;  2UV1 A;  3D5R C;  2DJI A;  2M4K A;  2RRE A;  1TWA A;  2J9W A;  4PJM A;  4QPQ A;  4BQO A;  3KEY A;  4XLA A;  4MND A;  4RDA A;  1WJA A;  2DYS C;  4ZC3 A;  2E1M C;  2F5V A;  2DGJ A;  4CSA A;  2ZXP A;  4HNT A;  4P1W A;  1LDK B;  1YX5 A;  3DWL E;  2WZG A;  4CUG A;  2CW8 A;  4KJZ A;  3ZRG A;  4B44 A;  1QLE C;  4D1Q A;  1Z3X A;  2KNH A;  5JHF A;  1WJD A;  3LEV A;  2V3C C;  2HVS A;  4HEA J;  2V7F A;  3H9G A;  3DPL C;  5HLT A;  2R7V A;  3SDB A;  1SMY F;  1K6Y A;  2PFD A;  4LAC B;  1T95 A;  3PL8 A;  4CS8 C;  3EUH C;  3QMK A;  5KYX B;  2XXA B;  2Q9C A;  3BLY A;  4XKV A;  4C9Y A;  3E9V A;  4LER A;  3K70 D;  2IGO A;  4KC9 A;  2X6X A;  5CQG A;  1N78 A;  3SEZ A;  1S7Z A;  3DM9 B;  5F5H A;  4IKF A;  1BR4 A;  3ABM C;  3H5N A;  2HV7 A;  4K7B A;  4O6Y A;  2X51 A;  3ZR8 X;  4G7H F;  1X1B A;  1ZHW A;  4I3M A;  4AE4 A;  3QOE A;  2HNH A;  4II2 A;  2O9X A;  4AYB A;  4NQW B;  2DOA A;  1RJ9 A;  3K4K A;  4ZDP A;  3DJU B;  4XKW A;  1QHG A;  4U5D E;  4XR6 A;  3DPT A;  3VDX A;  4AU7 A;  4BJ6 C;  3JT1 A;  5DQZ A;  3POV A;  4E7L A;  2W4M A;  3FKJ A;  2QKM B;  3CP2 A;  2IS2 A;  5D91 A;  2KDO A;  3NRH A;  4HE8 D;  2IXS A;  3OR2 C;  4CCN A;  3LS1 A;  3AQC A;  2Y0S A;  3ZIB A;  2PP4 A;  4F52 A;  1FFT C;  3UNG C;  2M4E A;  3K1H A;  3V7O A;  3IP4 B;  3GOD A;  2A6T A;  1ZHZ A;  1X1D A;  4Y4R A;  4M63 A;  3UMK A;  3HOS A;  2J45 A;  2QY9 A;  2VJ4 A;  1VOM A;  1TKN A;  3ECS A;  4DGW B;  1ST6 A;  3VYT B;  2H7B A;  5CQE A;  3B0U X;  3CSK A;  3VSK A;  3H35 A;  2VJI A;  2OV7 A;  2UWM A;  3EPV A;  4JVS A;  3NYJ A;  3EZH A;  4E7J A;  4K0D A;  4BQQ A;  1Z5Z A;  3FBI B;  4DBQ A;  1Z23 A;  3OYB A;  2J7P A;  3L34 A;  5DVW A;  4BEJ A;  3NKE A;  3UR3 C;  1DQU A;  4CCM A;  4OIR F;  4NUB A;  4FWV A;  2WY8 Q;  1OCZ C;  1ZHT A;  3Q6N A;  2XF7 A;  4E7S A;  3FDY A;  2K9M A;  4LG3 A;  5EGY A;  3RSN A;  2KRH A;  3BCB A;  4OD5 A;  4A2N B;  2ZSI B;  2WA0 A;  2XF5 A;  4ZYA A;  2X1C A;  1G8X A;  1W2W A;  3K4J A;  2JD3 A;  2XRH A;  2KHM A;  4Q7C A;  3V42 A;  3LNR A;  3L2U A;  3DU5 A;  5KYW B;  2A1D D;  2NG1 A;  3QYB A;  4W8K A;  3N24 A;  5TGT A;  2KPM A;  2WAF A;  2CGE A;  2Q3T A;  2P7V A;  4U7B A;  3DPU A;  3NWT A;  3S93 A;  5T3W A;  3GAN A;  4FX5 A;  3EH1 A;  4PSX A;  3WG7 C;  3EFO A;  4DVY P;  3H9J A;  4XQF A;  5CKT A;  3W8I A;  4GYT A;  3Q6M A;  4I1M A;  2KZV A;  1W36 C;  2A69 F;  4F3Q A;  4EAT A;  2VXD A;  1PD0 A;  3E0J B;  3EUA A;  2BE5 F;  1Z63 A;  5E33 A;  5B1A C;  3AG1 C;  4ZLC A;  1TWG A;  2R7R A;  2OCC C;  2X85 A;  3LFU A;  1D0Y A;  2X1D A;  3M1C A;  4BEH B;  2EIJ C;  3VAY A;  3W2A A;  2KL4 A;  1FMV A;  1BR1 A;  4PSW A;  3RIP A;  1MMA A;  1WFX A;  2E5Z A;  2OC6 A;  3ZQQ A;  4C7O B;  1NG6 A;  5IY5 C;  2VAS A;  4CCJ A;  2BVM A;  2Z1D A;  1SZI A;  4IRU A;  2CUJ A;  4XMY A;  2J9V A;  2QKL B;  4BE1 A;  1PCX A;  2C03 A;  3HUG B;  4HFF B;  3OS0 A;  2R7U A;  2KQR A;  4AX2 A;  4XKB A;  2J7P D;  2M7B A;  4F92 B;  4CS8 A;  1UEL B;  3PNY A;  3DM5 A;  4U5G A;  4BJ5 C;  3EPZ A;  2JVG A;  2WL8 A;  2HU9 A;  3DEE A;  3K4M A;  3J7A Y;  1O87 A;  3NDB B;  4RM2 A;  1FFH A;  2KRC A;  2GFH A;  1TT0 A;  5LFA A;  4NC7 A;  3ZXS A;  1PYV A;  4BGD A;  2E5N A;  3HXL A;  3MKZ A;  2G3K A;  2WBM A;  1V55 C;  3CQZ A;  3LJB A;  2L7K A;  4B3X A;  3HC7 A;  2IS6 A;  3AG2 C;  3MMY B;  4BXF A;  4BAC A;  1MNE A;  4X0R A;  2BOL A;  3JCU Q;  4ANJ A;  1OLT A;  4BQN A;  5KYX A;  2L9J A;  2XXA A;  3S8P A;  1KU2 A;  4R79 A;  1Z7L A;  4PJL A;  3DQV C;  2VJ5 A;  3SEQ A;  1NG7 A;  2ELJ A;  2IGK A;  5B1B C;  3EHM A;  5KYY A;  3B9Q A;  2EIN C;  3FVY A;  4P6I C;  4WJ0 A;  3K4L A;  3OOU A;  3ZSU A;  4OIP F;  3TL4 X;  1Y56 A;  1J8Y F;  1ZHY A;  1N75 A;  3N0T A;  3UMH A;  2VQL A;  4XLN F;  3CMM A;  3AL0 B;  3NYM A;  2IGN A;  2DT6 A;  3BC8 A;  4N4N B;  4XM3 A;  3OYE A;  1G59 A;  1V54 C;  3ITF A;  4CBE A;  2Z15 A;  4YRV A;  3OYH A;  3EQL F;  3I4U A;  2W4B A;  1KON A;  3ZVR A;  3DD7 A;  3FDQ A;  4U5E E;  5KCM A;  2MFZ A;  4MLO A;  4OWR B;  2VQH A;  1V5E A;  2HQA A;  3ZGK A;  3EGX B;  2Y3H A;  2XSJ C;  4XWJ A;  3ZC4 A;  2YZS A;  5HNF A;  5KYU B;  2I8B A;  3AL0 C;  4XN0 A;  4BDY A;  2R7Q A;  2K9L A;  3JSZ A;  2LBF B;  2BW3 B;  2Q9A A;  1R6R A;  1X4O A;  2C04 A;  2EIM C;  3OYD A;  2WVN A;  5FCL A;  2R7W A;  3M8J A;  4DIQ A;  4BG0 A;  2MYS A;  3MKY B;  4F55 A;  1Z6A A;  4LIT A;  2WVO A;  2JSP A;  2IS4 A;  4XLH A;  2A68 F;  4XN3 A;  3OYF A;  3RPU D;  4JW1 A;  1N77 A;  3KKB A;  5CI9 A;  2XSE A;  2X6W A;  4IAO A;  1MND A;  2HDW A;  4Y3O A;  3E70 C;  1YX3 A;  3OYN A;  2ZFU A;  3OL4 A;  2CH0 A;  2XL4 A;  4YN0 B;  3BG7 A;  3HLZ A;  2R7T A;  2J0W A;  4G6T B;  3DMD A;  1DP3 A;  3K6B A;  3OYI A;  4C3D A;  3S28 A;  4DVZ A;  3L2Q A;  3OYJ A;  2VB6 A;  3S3M A;  4U87 A;  1TWH A;  4XL9 A;  1D1B A;  1M2O A;  3KH2 A;  3RQ4 A;  4B47 A;  3B0V C;  1LKX A;  3EGD A;  3IAM 2;  3OY9 A;  4JCH A;  4HST A;  4ZJZ A;  4FAS D;  2G3V A;  3CP8 A;  4KNV A;  4HG2 A;  4G7O F;  3KMI A;  2Z16 A;  2NUT A;  3RYL A;  2LOO A;  2RQQ A;  3DKX A;  4E7I A;  2Y39 A;  3NYL A;  4O6M A;  2XDV A;  3OS1 A;  2W9Y A;  1QZX A;  4RD9 A;  3X2Q C;  2KP6 A;  1MMG A;  1U0J A;  2H7O A;  1WJ5 A;  4E7K A;  5E3C A;  3AG3 C;  4HNU A;  4CZC A;  1LFP A;  3CZ6 A;  4OAZ A;  4YJW A;  3L2V A;  2WB7 A;  4AE4 B;  5T3T A;  3LLK A;  5E2Q A;  1X1A A;  5E3A A;  2JVH A;  3OYM A;  4XOR A;  3FHD A;  4BU2 A;  4F93 B;  4B48 A;  2KQ9 A;  3HTK C;  2CW7 A;  1M56 C;  3DTK A;  3JRT A;  4BL0 B;  4O79 A;  3EG9 A;  2EIL C;  2WVQ A;  4D9J A;  4JOM A;  4BJ5 A;  2BVL A;  3PJR A;  4GRI A;  4NC8 A;  4DBR A;  2R7X A;  1M2V A;  1AA7 A;  4FET A;  4RBN A;  2KLO A;  4C3E A;  4C7O A;  3GBG A;  5HVQ C;  2NUP B;  3A1Y A;  2VKD A;  2CMP A;  3KX2 A;  3RTR A;  4JJG A;  4HRI A;  2KMU A;  4J01 A;  1NU9 C;  3D5S C;  1OR7 C;  2K5C A;  4BJ1 A;  2W4S A;  2Y69 C;  2A5W A;  3OYL A;  1MW7 A;  2L81 A;  3Q7G A;  2CNW A;  5F5F A;  3DJN B;  2GOX B;  3U21 A;  3LSG A;  2IXP A;  3HJC A;  1TZL A;  3BG6 A;  2PX3 A;  3SP1 A;  5CI8 A;  2VIX A;  3OEO A;  2IXO A;  3AG4 C;  2VLA A;  3ONQ A;  2DYR C;  3SEO A;  4C2T A;  4YT5 A;  2VQG A;  5DS4 A;  3UGO A;  2L9S A;  4CCO A;  2WZL A;  2AQE A;  2LG4 A;  2X6Y A;  2ZXW C;  2CDQ A;  1W36 D;  2M0M A;  4P5O A;  2J9U A;  4BDZ A;  3ZG1 A;  5DS6 A;  3DTE A;  4LLC A;  3BCA A;  2HPM A;  2D5R B;  2LY2 A;  4EWC A;  4XLF A;  2K3P A;  2UUZ A;  4IZZ A;  3KYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...