3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords DNA-binding protein RAP1
publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
3CZ6A 4BJ6C 4BJTA 3OWTA 4BJ5C 3K6GA
chains in the Genus database with same CATH superfamily
1FSEA 4XLPF 1NG6A 4IHTA 3I71A 1T6UA 3BTIA 5B1BH 3W6JB 3Q0WA 5B1BC 4A69C 2E1NA 4LDQA 2MFZA 5T1DB 1S6LA 1OCZH 3M8JA 2HDCA 5BQGA 2L7AA 5JLXA 4BE1A 4QI0A 5BUOA 3GTMJ 4K2EA 2XRNA 1P6RA 1O3SA 3H5AA 5F28E 3KYLA 1A31A 3VPRA 4RBOA 2JJ7A 4AC0A 4F3QA 4YT2A 3QPLA 5EYRA 2WB7A 3HOVJ 4NC6A 3JSPA 1DP7P 3U2MA 2EV5A 3KIOA 3K1PA 4PR9A 3FM3A 2FOWA 5IP9J 5HS7A 2HNHA 3JCUQ 1G4US 1AHDP 4CS8A 2Y9ZA 1MH3A 1M56C 1BI2A 4ON0A 1K78B 4D9JA 4EGZA 1LB2A 1I4YA 4MTOA 1Z63A 5FLXK 1OW6A 3KE2A 4JC7A 1TQIA 4EM1A 4ZLCA 2GA2A 1BBHA 4AE4B 4UV9A 3K1IC 3M7GA 3H9GA 3N4MA 3A0BC 4DYCA 4FAPB 2KIFA 2PFBA 2XPWA 3I58A 4F55A 5FD6A 5FLMJ 1AKHB 1RPWA 1FYMA 2HKXA 2RNJA 1HE1A 3WHBA 3GFMA 4CSAA 4I7HA 4XLEA 2CNWA 1MGTA 2AQFA 1VB5A 2J7PA 2L6FA 3C62A 4WABA 2OZUA 3GTPJ 1RZ4A 1JKPC 1OYIA 3TOAA 1F36A 2L7ZA 4A3EJ 3S14J 2VXDA 2XLHA 1FZPB 2CYDA 2WWYA 5E79C 2EPKX 3SXYA 4H0EA 2EFQA 4PK4A 4HDUA 1FTTA 4C30A 1XG1A 2BY2A 2RAEA 2RDPA 1J75A 1KU7A 4CH7A 2DYRH 4GFBA 2VBWA 2PLYA 4NC3A 4EV0A 1EH8A 3TW6A 4MEXF 3EUHA 4HEA2 1U2WA 4BQOA 1WZ2A 4BY7J 4HPQA 3HIFA 3ZQHA 2VJ4A 3S2DJ 3RQGA 2HOTA 1I1SA 2W85A 2ZXRA 3TD7A 1E86A 2VJJA 1K79A 3DBHB 1ORYA 3ABTA 5EGYA 3U0CA 3V4GA 4RGSA 2JRTA 4L0YB 5KYUA 4XKBA 2BL2A 4IL6C 4OU0A 2GXAA 3JRGA 3FIWA 4QPOA 1G59A 4J30B 3WAQA 4BJ5A 3C2HA 1M2VB 4JOMA 2DPDA 1WGWA 2B7EA 3CC7I 1AOYA 2BXZA 1ACIA 5E3OA 2IM8A 5BPDA 4DZPA 4NY3A 1SVLA 1ZAOA 2VH3A 5KYNA 1MNDA 4RAZA 1YI2I 2VKEA 1K4TA 1NBBA 2L6GA 3LNMB 1IN4A 3TW7A 3DJUB 2YL7A 1E85A 2Y75A 5HS9A 1MKMA 3V7RA 2QY9A 3IEEA 2GXGA 3C7JA 3JREA 4N0BA 1J8MF 2YRFA 1T8IA 2DMQA 1N25A 3VODA 2CJJA 3FXOA 5GPGB 1EA3A 3KEQA 5C4JJ 2XSEA 9ANTA 3FXJA 3CMMA 2BEOA 2EIJH 2LYCA 1SFXA 2EIJC 1ZELA 2W4BA 1SMYF 4HQEA 5L0IA 1V4AA 1KU2A 2VJ5A 3KCCA 2DB4A 4CDVA 2JSCA 4LFUA 1E84A 1GV5A 1ERDA 4KNYA 4Z6YA 2OU2A 3HGYA 3O8GA 1STZA 3HB9A 2XS8A 1IXRC 2WZFA 3VYTB 4BS9A 5F6FA 3OOUA 3CO6C 2A5YB 4MQVA 4CS7A 4I0BA 1A35A 1S05A 1YYJA 2NXNB 3LOCA 3FK7A 5AGFA 1ZN2A 2F5CA 3D5LA 4DGWB 3MKZA 2R5YB 2ZFUA 4U5HA 1A7EA 4B6IA 1RKEA 3GCMA 2TMVP 5H2FC 4MNDA 3RJPA 3LA7A 4Y17A 4UHTA 3DKAA 1BI0A 1D5VA 1SZIA 5COFA 1LDDA 1APCA 3HLZA 2CMPA 4E7LA 1ETVA 4ENMA 5EF6A 4N4OB 3POVA 4JCZA 1REPC 1A04A 2OPTA 1S5LC 3NYJA 3EG9A 4I3MA 4H4KC 1XCBA 1K61A 1V3FA 1I50J 2VKVA 3IV5A 2EPLX 1WJCA 3SFIA 1ZG1A 2DMTA 3F8FA 2LBFB 2XHKA 1IGNA 1F43A 5CI9A 2E2HJ 1VMAA 3GTLJ 4EQQA 4U88A 1YARO 1U8BA 3OYFA 1X19A 3L2CA 3V5YA 1BR1A 5HVQC 2XGEA 4C7OA 1V74B 4KICA 4BJ1A 3L09A 1LEAA 2CDQA 4KIFA 1Y56A 3J7AY 1Z7Qc 1UHWA 1U5TA 2F22A 4BL0B 2ZXOA 4ER9A 4W8PA 1NHAA 5B3SC 1KA8A 2NAZA 2Q9CA 2HUJA 5E3LA 3MKWB 1TWHA 1LM3B 2WA0A 2IBDA 3GTOJ 5DM7F 1WVRA 2KZGA 2HSQA 2IXPA 3S28A 4RM2A 1HXDA 3J81Z 1YE9A 1TL8A 2ID3A 4IHVA 3DTEA 5BS6A 2CW7A 2RQQA 3D5RC 1O3RA 2YR2A 2YU9J 1UJ8A 2ICWG 3FM5A 1Y4CA 1JT6A 3ABLC 4JTDB 1WI9A 3K66A 3WG7C 1N77A 1CGOA 5D5UB 3A4CA 3O6XA 3PO2J 1VFCA 4OMZA 1T98A 1ZR4A 3FXQA 2P4WA 4C2TA 4PJMA 5GPAA 1EV7A 3KEYA 1I3QJ 1YG2A 4BU2A 2DA3A 4DYQA 3H65A 2GAQA 2QSGX 1D1CA 4HV5A 3RH3A 3ZTMA 3ERED 4IRIA 4ASNA 3AQBA 4Z9JA 4U5DE 2R7DA 1RCPA 4D4NA 1XDUA 4HF2A 1NK2P 3H9QA 4GYGA 3I4UA 1ORJA 3BTCA 2OCEA 1HKQA 1BW6A 4IHWA 2QCOA 3V7OA 2Q00A 2XASA 4YFNF 3C18A 4PZJA 4D7NA 2COBA 1Q0KA 5M3MJ 2VLAA 3BPXA 1JUPA 4FX0A 5K5OA 3WTXC 2ZKZA 3ASOH 2LFFA 3CDHA 1VYIA 3ASOC 4A5NA 5A6JA 3LEOA 3FVYA 2WB1N 2ZXJA 3BCAA 4A3IJ 4BYYA 1UG0A 3EUHC 2YLDA 2L0KA 3L9FA 5TGTA 3M1EA 4PFOA 2B9SA 2I5UA 3RSNA 1Z3YA 3A9CA 2IP2A 2DW4A 3MVPA 1CPRA 2YS9A 2DOEA 3CCYA 4A0ZA 3BZCA 5IP6A 4XICA 3QTHA 1V55H 3VAYA 3M8EA 3BR5A 2DPUA 3KP4A 4O79A 4LB5A 1FEXA 2WL8A 2AU5A 4BJ5C 4KITB 1IRFA 2I15A 2L7MP 4XR6A 1HW1A 1QVXA 2Q0OA 1OQCA 1UCRA 1DGWY 3HTUA 2JA2A 3CCUI 1ZW3A 4MO7A 1BC7C 2XLVA 1PJRA 1MMAA 1P4AA 1JUMA 2KIUA 3HNKA 2ZMEC 4CXFA 1GXPA 3OSFA 5HLIA 1SD7A 1G5ZA 2O9XA 3DBRB 2DFHA 4JX5A 2PQ8A 1M1EB 1JAFA 5TRDA 2N8GA 3Q3SA 4XNFA 2LREA 1QU3A 1Z9CA 3HTSB 4YWQA 1W5TA 4A2UA 3CTAA 4L9NA 4UV8A 3CCSI 4IKFA 3NDBB 1ZHYA 2OCCH 3T5XA 3DE8A 2ESNA 4CCMA 2M5WA 2Q9BA 2L9SA 1Z05A 5E1XA 3FAJA 2H8RA 2D2WA 2Z9OA 4MLOA 2XGXA 4EBKA 1TQGA 3ZQGA 1IUYA 3FXRA 1R5HA 1HW2A 1VQ9I 1YIOA 4RB2C 4OMYA 1RXQA 1X1PA 1ULYA 3R6SA 4OAYA 2E5ZA 3JTHA 2OTLI 2LD6A 3BJAA 5AIPA 1RKEB 3GEHA 5JLWA 4KFCA 1WCMJ 4F7ZA 1O7FA 3ZQCA 2VQGA 3Q5FA 4Z2YA 5L3GA 3PUFA 4PJNA 1TNSA 2Y2ZA 2RV8A 4D5CA 5K7ZA 5M5YJ 1JR8A 2E36A 4XIDA 1MW7A 2FXAA 2NYXA 4CDYA 2R02A 1A6QA 4D0PA 4P9FA 4C2UA 1PDNC 3EG9B 3U2LA 2P5VA 4I01A 3CDLA 2MLKA 4XONA 4AWXB 2OKUA 3RPUD 3KETA 3J7AO 5IYDJ 3U5SA 1ON1A 4YN0B 1O4XA 5L3EA 1IRXA 3FZVA 1OKKA 2I8DA 2W00A 2IS6A 4BGDA 4C7OB 1W0TA 4KIBA 4FESA 2IGOA 1W1WE 4W97A 1KNYA 3W4YA 3MN2A 4IOAF 4IHYA 1U5TB 1HDDC 1EKYA 2XGDA 2K4JA 3GWZA 1VQ6I 4G6QA 2Y48A 3HGGA 1JKRC 4BEMJ 2TRTA 1LEBA 2YVKA 2Q7RA 3TO7A 3U2RA 4RD9A 2G3KA 1G4WR 2QQAA 3ZIBA 2LLKA 3OS1A 3N24A 2O7OA 2V1DA 2DFEA 4HZFA 1OJLA 1FBUA 3PIPF 1GUUA 2K4BA 3FBIB 1E3PA 2VXZA 1HA8A 4B4CA 2CV2A 2CFOA 2IEKA 5B66C 4HF0A 1GHCA 4LG3A 1GVJA 1YRNA 5CQGA 1Z7LA 3K69A 3KX2A 2IXSA 2QSHX 3M8FA 2JT1A 3ECOA 3AG1H 5JVGF 2E1CA 2HEOA 5DTDA 4XSXF 2GXBA 3F8CA 5LEKA 5CVRA 1LS4A 4CCLA 4B3XA 2XLDA 4Y52J 3OIQA 3G1LA 4L5IA 1MBFA 1QVUA 2R93J 3AOUA 3C63A 5JP7A 4UUTA 4RMNA 3SXMA 4I99C 1GT0C 2ZCWA 1DPUA 1P92A 2HYGD 3PL8A 3HEFA 4U5BE 2LDUA 2F5FA 2G0EA 3QOEA 3FOPA 4XRMA 4FWVA 1Y6IA 4X0GA 2D5RB 3S3MA 1YX5A 4CCNA 2G7HA 1JUSA 4Y7NJ 1C03A 3T0YA 2VOPA 2EIKH 1SVOA 3RKXA 3T6JA 3ZPLA 1LE8A 2QYOA 4EBJA 4XOPA 4RAYA 1MMNA 2EIMC 1XZQA 1WHUA 3DXJF 3M4BA 3PNYA 4KYWA 4NTBA 1FOYA 1GVDA 5J8FA 2XGCA 1Z6RA 4WJ0A 1XGOA 3ROUA 2D45A 4IPAA 3L1PA 1LKXA 2GOMA 5CVVA 4JYKA 4M9XA 4N6CA 1AA7A 4JVSA 3C3WA 4BXFA 3C2GA 1D8KA 3BG6A 4LERA 3OEOA 4AIJA 4X6AJ 2DGJA 3JZ0A 1SFUA 4W1UA 2H27A 3KP5A 3AKZA 5T3TA 3TQOA 3ZN1A 2OC6A 2XAQA 2XB0X 4WF2A 4F92B 3D5SC 2ELJA 3CCRI 3CD6I 2CUZA 3HOUJ 3H2UA 2NUPA 4LB6B 5DVWA 2M30A 3NYMA 4L9VA 3AJMA 4ZYHA 2MD5A 4PSWA 3F72A 1LVAA 1OQYA 3T8RA 2F6CA 2M4EA 5E3NA 1TWGJ 1CQTA 1BOBA 1Z6TA 1ITYA 1H7IA 1PCXA 5AONA 2GA1A 1FOWA 2YPRA 4FE4A 2FJ1A 3GBGA 4YG2F 1TWCJ 3KP6A 4HSTA 3HRTA 2VC0A 3IRQA 3C8GA 4OIOF 2HR3A 2UXNA 3I4MJ 2DDBA 2G9WA 4L9JA 1IF1A 2CO5A 2COMA 4HSRA 2JX0A 1YYVA 4J01A 2VCAA 2GIZA 4XLCA 2ZNYA 3P7NA 1SYQA 1G8XA 4BXUA 2JTVA 1WASA 4P5OA 4U0VA 3N97A 4ABZA 4YRVA 2FNPA 3IP4B 3G71I 3BCBA 3EGXA 2IW5A 1LI5A 1OCOC 4AD9A 1JMWA 5FZTA 3WGHA 1LPQA 2C6YA 2IA2A 3HUGA 1DPRA 2AS5F 5K7HA 5EDNA 2EK5A 2LC2A 2QEXI 1DDNA 5ICCA 3LSJA 5ICEA 3HOWJ 3TBIA 5LGNA 3S3NA 2DU9A 1VQOI 2EBIA 5J6XA 2X0LA 1JJ8C 2HVRA 4BH9A 2LD5A 3KPHA 1IG7A 2R7VA 2YEVA 4EMSA 2ECBA 2XAGA 1BR4A 2LQGA 3QVZA 2KKOA 5H6RA 3GUDA 4P6IC 3U9JA 3DPUA 2P7CB 3QODA 2KISA 2WB1A 4XPYA 1WJFA 2QBYB 2CGEA 3ZTZA 1FYLA 3GZ6A 4PGGA 4A3BJ 5L3CA 1YLFA 2A68F 1FY7A 1KQ9A 1SF8A 3MZ8A 1W5CC 2ME0A 1YIJI 1ST6A 2R7RA 4WXHA 3ABMC 1R00A 3BOQA 3W8IA 1EA8A 3OS2A 2WAFA 3PSIA 5GAGJ 1AWCA 1APLC 3ZQYA 1IV8A 5A2QK 2LY9A 5LD2C 2B0HA 3GFIA 3GM2A 2OZ6A 3O6BB 2YX4A 1JPJA 4L5JA 2XKPA 3AG4H 4JKVA 3WU0A 2I10A 2HXIA 1SVMA 4KIGA 2LIGA 2PX0A 4V2FA 3OOPA 5F27A 5CYVA 4CYDA 2QUFA 3JRBA 5CJ9A 2RKHA 2FAPB 3G4XA 3TEDA 3MYIA 2DT5A 5F64A 1VQKI 4Q4ZF 1T56A 4E7IA 5EHHA 2XF7A 1YRNB 3CF2A 4KDPA 2DT7B 5EEGA 3NWSA 3PJRA 3S9OA 5DD8A 3AQCA 3HL2A 3JAMK 2WC2A 4FQGA 3DKXA 2BGCA 5J47A 2F5VA 4JW1A 3QP6A 3LUTB 2KJCA 3F8BA 3X2QH 3JSOA 3NG1A 5JRAA 3X2QC 1X2NA 5IT9K 1AUEA 2LP0A 2J9VA 3LSHA 2VPLA 4RB1A 2QKLB 2M7BA 3TDZC 2VUMJ 2XAJA 4E0IA 3K2ZA 1VYKA 3QW1A 2WVQA 2E1OA 1V5FA 3GLXA 2A6TA 1T2KA 1RUOA 3OYHA 2IXOA 3PIOF 1LE8B 2KK1A 4JX6A 2J0WA 3FHZA 3H3ZA 2DOFA 1ZU4A 4U5FE 2P1AA 2HFHA 3RCOA 4KA4A 1Y39A 3JRIA 2XLEA 3S1NJ 3S90A 1D0YA 1RJ9B 1RR8C 3MFNA 3X1OA 4G6TB 3WE3A 2P7VA 3I5QA 2Z15A 5CVIA 1PD1A 4A0XA 2R05A 4XBFA 1OR2A 4G94A 3VB2A 2ZPAA 5IOZA 1A7VA 4JE9A 3CQZJ 2HU9A 5A6BA 5KYYB 5BQIA 3DPLC 1D0ZA 2KIMA 5IP7J 3M9AA 1UG2A 1TWAA 3V5ZA 2KJBA 4WXDA 2XL8A 2YLIA 2DYSH 3GFLA 4JP0A 4CIPA 3U1KA 3T8TA 2PJRA 3G1OA 1Y1VJ 2BBYA 2B63J 4I6ZA 4P96A 3RYRA 5LGUA 1R6RA 2NUPB 1PP8F 2MD0A 3E3VA 5HOOA 5HNFA 1VTMP 4E18A 4E6KG 2PF4E 2K85A 1OCTC 2PX3A 3PNTA 1R1TA 3TOBA 2VASA 1ZG5A 4RGUA 2J7PD 1TW3A 1KYZA 5EG0A 3ML6A 2EINC 2HV6A 3P9IA 3SQNA 3EGDB 4MQ9F 4DRHB 2A1DD 3RZDJ 3DCFA 1MNMC 1W36C 4IB4A 3L2WA 2F2EA 3RW0A 3BG3A 2UUIA 3U9GA 5C3EJ 4OIPF 2A6EF 4PACA 3F23A 3FK6A 2EWNA 3V8LA 1X1AA 4U0YA 1OR3A 4FE7A 1Y1WJ 1QA6A 2X51A 1H0MA 2KRFA 2IA0A 1D5YA 3EGXB 2CV1A 4I2OA 4PFPA 1TT0A 4CICA 1M57C 1WKMA 1BI1A 1ETKA 5DYMA 3R61A 3HUGB 1IDZA 5D5VB 3OMYA 2XPVA 1RKTA 2FA5A 2OEVA 4Q7CA 4KMFA 4CS9A 4OAZA 1OMIA 2V9VA 4XKCA 3I9V2 4GCVA 2BY1A 1OCZC 5BNGA 1MMDA 4M9ZA 2GDCA 5JLIA 2LTPA 1WRJA 1XN7A 2BVMA 2CW8A 2MWQA 3SDBA 1ZGAA 1EQ1A 4XSZF 4UUSA 5J40A 4MVUA 3LWFA 5GPCA 5EEAA 4IAOA 3NWTA 1BC8C 1XMAA 2W57A 2X9DA 1WJAA 3RQIA 3CCEI 2J9UA 4YK5A 4XQFA 2BVLA 1V5GA 1SR2A 3CLOA 2O03A 2PJPA 5L3VA 2ZJ2A 4G12A 3ZRGA 1QHGA 5A69A 4FTHA 1V5EA 1FTZA 4U9DA 3TULA 4RB0A 2YWAA 1R22A 1WPKA 4MTFA 1UHMA 4GGGA 1I1GA 5D5WB 1YZAA 3OYGA 3QMKA 4UXNA 2OEXA 3E6CC 3WTSC 4NUBA 4AIHA 4HDVA 1TQPA 2W9YA 4GQHA 4X1EA 4HX4A 3WU2C 2W24A 1FP1D 3DWLE 5L3QA 2DTRA 1HKSA 2OJQA 3IHUA 3AG2H 2QKMB 3CO7C 4M72A 3JAMZ 3S84A 3U8PA 3BROA 2MW8A 1U6HA 1O57A 1R5GA 2JWTA 2WVOA 3CSKA 4EVIA 1YA9A 2OG2A 3KZYA 5IT9Z 4HFKB 2R0QC 2J5PA 1H89C 4V2GA 3DEWA 3QPHA 2JK3A 3NARA 3GX4X 1DUXC 2DYRC 3M15A 3DD7A 4ULWA 4CJOA 5E17F 3FDYA 4I02A 4I98B 4I1MA 5EJCA 4BKXA 2DCEA 3I64A 1O3QA 1SFEA 2VKDA 2R7SA 3B73A 1YVIA 2P61A 2R25A 3CJTB 2FSWA 2PBEA 3LNQA 4HV6A 2J9BA 3FXMA 3IRRA 2Q4FA 1XS9A 4Z9HA 5A6KA 3BR0A 3ZDLA 2IPQX 3F8NA 2RREA 3EYIA 1FT9A 3OWTA 2NSFA 1RUNA 2WAQN 1R4NB 2K3PA 1TKNA 3QQAA 3ECSA 3KYCB 4ESBA 4JTAB 5FKNA 2GWRA 2O0YA 4UVCA 1FOXA 4BJTA 1W4MA 2XXAB 3OYIA 2O9LA 2BXYA 2FMLA 4UB8C 2VKHA 5M3FJ 4HBLA 2L4AA 3ZG1A 4NC7A 4A3DJ 1HF0A 2KHMA 4G78A 4RB3C 3TP3A 5FRNA 3CCJI 1SFKA 2P7VB 2LSEA 4RLFA 1Z5ZA 2DA6A 3ZR8X 2XL4A 2VI6A 2K9LA 1KYWA 4A12A 4ETSA 2IBFA 2L3DA 3FAPB 2LF8A 4ITVA 3UR3C 3VSLA 1FFTC 1B8IA 2NVYJ 1NSGB 2WAEA 3EZIA 4OD4A 4BBRJ 3ISPA 1QVTA 2RNGA 2PJRB 3CP8A 2VBYA 2V6EA 1OR7C 1R23A 3WHCA 2KMUA 2BOLA 3VEPA 3WGGA 4NDLA 2NS8A 3FKIJ 2CQQA 3ZWIA 3PQKA 3O2PE 2ADUA 4XRSA 2EV6A 2M8EA 2Y0SN 1IRZA 3OYNA 3Q7GA 3LESA 1J7KA 2QQBA 4DNCA 1MBEA 5EG0B 2IRFG 3ABKH 2F48A 1QLEC 3HBLA 4BG0A 1Z1DA 3DU5A 1K83J 4QPQA 3P5JA 3CJRB 2ACJA 1C02A 3GZ5A 2R7TA 2AP3A 1FNNA 3EPVA 3H0GJ 1LFBA 5BOXA 1TC3C 3B0PA 5M5WJ 1ZG3A 1LE2A 2FE3A 4LJZF 4DQ2A 1CGPA 2FMYA 3E5XA 3KZIC 3ZQLA 2LR8A 2Z33A 3C2BA 4ZTJA 2DMPA 3RQ4A 3TOMA 2EPMX 1OISA 2RN7A 1JTYA 2A3SA 1KQ0A 3VRCA 4R8HA 1YITI 3FISA 3FOOA 2MH2A 4PJLA 1RKCA 1VK5A 1YJGA 2W4SA 3FX3A 4IAQA 1JT0A 4AL0A 4B1RA 1S7AA 1LS1A 1XDSA 2B0LA 4XL9A 1MD0A 3E5QA 2R92J 2EZLA 4JQFA 5HDNA 3H3VK 2QLAA 5F0HA 1BW5A 1UZCA 5D8KB 1KU3A 3RI4A 5C4XJ 2HPMA 4CX9A 3S17J 5LRSA 3B6AA 1NFOA 3WTTC 2BHZA 5BPIA 2KYHA 4E7HA 1IO2A 5F1JA 2FX0A 1UG7A 4C3HJ 3EFOA 3W2VA 4CS9C 2MBFA 4UUSB 5FLXZ 4U5GA 2L9VA 4YL1A 3TL4X 2XLOA 3FF5A 3IAS2 2DI3A 3CDIA 4A6DA 3HOXJ 1F1MA 4HA8A 1X2MA 2DQRA 4MTDA 3R7CA 1WJBA 3DBLB 1AEPA 1HBXG 1J5YA 3VYRB 3DM9B 3BR2A 2CG4A 3VYUB 2FF4A 3A0HC 3BQYA 3G73A 4J19A 1RMVA 3HKKA 2E60A 3BTLA 4HQMA 3K1NA 2MSYA 2RGVA 2HJMA 3E9VA 1FPQA 2GZWA 4CS8C 1QRYA 4AVZA 4F4BA 5CPRB 4QTRA 3F21A 4ZJZA 4HNVA 2YL3A 3GWLA 5KCMA 4N9IA 5E1ZB 1VLSA 3ZQVA 1XC5A 4V19K 1XCVA 5JFRA 4E70A 5CQEA 4BQQA 4P1WA 3WE2A 1NZEA 4NC8A 3ZQIA 1ETXA 5IPAA 1U6GA 4IRGA 5HLHA 3W8HA 3UNGC 5HDKA 2BY0A 4CSAC 2H6CA 4EIYA 4U7DA 3W6VA 2W45A 3QAHA 2H94A 3CMEI 3S1RJ 4G6DA 3NMIA 1R58A 2E1MB 3LAYA 2HDWA 2WBMA 3D0SA 1XX5A 1TWFJ 1SAXA 3AG3H 1MBGA 1S9HA 2ZXIA 1EH7A 3R0JA 3REOA 3TQNA 1E0EA 2M64A 4HAMA 1BBYA 3G50A 2Q1ZB 1A36A 3ATPA 4IJJA 4S05A 2IGKA 5T3WA 3CC4I 1OKKD 2QQ9A 4IO9F 1E17A 2XF5A 5F5HA 2QLZA 4Y15A 2IXNA 2WVNA 1PD0A 2CH0A 3LFUA 3G3ZA 1YW8A 2D4UA 3GEIA 1V55C 4ZC3A 3EZHA 2XSJC 3IH3A 4ZDOA 4U87A 5L0HA 2Q2EA 1QPUA 4FETA 2G3VA 1ETOA 4BEHA 1FTSA 4M6VA 2YSRA 4CDAA 2BYVE 2ECCA 5HV9A 2ZXWH 2D1HA 4MTEA 4XM3A 4DJAA 4LDKA 3MEXA 2DDAA 3EPZA 3K10A 4AIDA 2BE5F 1KQ8A 1GM5A 1IJWC 2L81A 1VLTA 3J7ZI 1LE4A 3F47A 2F5EA 4HX8A 4MNUA 3RVYA 3N0TA 2XROA 3JYHA 3TOLA 1LFPA 1B8IB 1JPNA 2X1DA 5DQZA 2DA4A 1TQMA 2P0NA 2VBXA 5BMZA 3O10A 2PMZN 4U7BA 2HSBA 3K4CA 1I39A 5E8IA 3GEEA 1W7PD 1MJBA 4M3GA 2OCCC 2XAUA 3IWFA 3W2AA 1HKTA 3G2BA 2E2JJ 2L54A 4OWRB 4MVSA 3QYEA 3ZSUA 1P7JA 3MAJA 1QGPA 2IYLD 4AK9A 4O7GA 2XPUA 3KZZA 4LLCA 5IOYA 1Y0NA 4N9HA 1WI3A 3WGIA 1U89A 2D1VA 1G4DA 2JD3A 4LDRA 3R2PA 2R03A 4ZDLA 3KP2A 1TT5B 3B02A 4U9EA 5E33A 4A93J 3A03A 2K9MA 4RS8A 3DKWA 2Y31A 4A0YA 3T6GB 4J7YA 3F46A 2ZB9A 2FOKA 3GFJA 4OIRF 5DLJA 1S7OA 4M9SA 3DTKA 3L2VA 4YL0A 4UVBA 1OW8A 3L2QA 5B1AH 3PDMP 4D1QA 1EI7A 2ESHA 2MA3A 5B1AC 1MSEC 4N4NB 1XSVA 3HPHA 1SANA 2ZXPA 2JSPA 4L0ZB 2QBYA 2BZTA 1HOMA 3MX3A 4XEFA 3JRAA 2V1UA 2JZYA 2EFPA 1GS9A 3TGNA 1EH6A 1IN5A 3ZMSA 4JRZA 4CZZA 1UMQA 3K4NA 2P81A 5GP9A 4A3LJ 1SD6A 3DM5A 2WAQA 1R4TA 4ZYGA 2DT6A 2F5DA 2Z16A 2A05A 4M3EA 1QBJA 4JX4A 1BL0A 4DZJA 1P2FA 3NKDA 1JKQC 3MYFA 2J9WA 2ZFWA 3DF8A 1Q1VA 4XRSG 5DD4A 1FIAA 2NUTA 2JA6J 1IN8A 1A0BA 2MGQA 4KNWA 2KRCA 4B8XA 1R71A 3EFOB 4DVZA 1W36D 2J45A 1FYKA 3L00A 3RDIA 5JVTA 3K7DA 4LLGF 1ZRDA 3V5XA 1FC3A 1U5TC 2ZJRF 3IQ6A 5TJ5E 4ZZDA 2PMUA 3R4KA 2VONA 2NVUB 5EK0A 1IW7F 2VT3A 3RZOJ 3US6A 2K9SA 3H5NA 2KZVA 2QGUA 3QPSA 4U0WA 3L2UA 1O7LA 1WJ5A 2QVOA 3GLLA 3C8GD 3LMMA 3ZCOA 4AX2A 2I8BA 3WTWC 2XVCA 2AVKA 3BT9A 5CIVA 4BHPA 3NMJA 3AG1C 3HOSA 1JHFA 1JGSA 2CUFA 5K5RA 5EEHA 2CQXA 1VQ4I 2XM0A 3A11A 1S29A 3PNVA 3LA3A 1MJAA 2BHYA 3PSFA 1E3HA 2Y0SA 3SHFA 3PFYA 4C3IJ 1USTA 3MKLA 4WCGA 3CCLI 1VI0A 1R1VA 4EM0B 1I5NA 2IA1A 2KSFA 2KIQA 3A02A 2WV0A 3EETA 2XAFA 3FKJA 3LQQA 1RNLA 3TO6A 1YS6A 1B6AA 3WTUC 1H8AC 2FGYA 2VB6A 5LFAA 1WH5A 2EIKC 1VNDA 2VCBA 5LBQA 4E7KA 3DKYA 2XF6A 4AU7A 1NH3A 1XGNA 1BDJB 2GA0A 1RKWA 5B3IA 1BN5A 3W3CA 2OTJI 2OBPA 4I76A 4FASD 4UB6C 4D7MA 1HDPA 2XS1A 4N4WA 4BE2A 1RJ9A 1TFKB 2KC3A 5ERIA 3F9KA 3L2RA 4Y13A 1IN6A 5IYBJ 3VOEA 1VQ8I 4YELA 3DE9A 2QWWA 1HC8A 3K4LA 3FXHA 3LSIA 2K40A 1BR2A 1C17M 4L6RA 4NNJA 2W25A 3A2KA 4LITA 3QYFA 5JI6A 3D1NI 5KYYA 2E71A 2L01A 2CW0F 4KC9A 1VQ5I 3G6EI 3OSGA 1AU7A 2EFNA 2V26A 3WU1B 2VE9A 1SC7A 3G4SI 2BW3A 1SD4A 2X6YA 3E1SA 3I5UA 5J3LA 5H6QA 2ELKA 2H8WA 4JURI 2M8GX 2RC4A 1FBQA 2HQ5A 3OIPA 5DS5A 4IQ4A 4M3BA 2HTSA 2Q2EB 3IKTA 3CZ6A 1QPMA 2P5LC 4JTCB 4XPWA 4BDYA 4BEHB 3OA1A 1U0JA 3K4MA 2Y3BA 2LVSA 4LIVA 3ZMUA 2A0UA 2PN6A 5LHGA 3RYPA 1J9IA 2P0WA 3QWLA 3W6KB 1C0WA 4NTFA 2JVHA 2OQMA 3EGDA 5JVEA 5IT3A 1YYXA 3H0DA 2P6VA 4JEAA 4JCHA 4MS2A 1ZZPA 5F0CA 4XEVA 2HXOA 4CCKA 5K5QA 2AWCA 2ASRA 3ZMTA 1Q0MA 1ODDA 1V54H 2ID6A 1MBJA 2DMNA 1OXKA 3M79A 1V54C 2YZSA 5FO5A 2R7XA 1DP3A 3TMOA 4L18B 3WODF 1L3PA 2YHSA 1H88C 2JPCA 4XLAA 5DCFA 2RQPA 4HYEA 3HDDA 5ILVA 5FKOA 3S15J 3MKYB 1IZ1A 2V4JC 5FFZA 1J0RA 3M3YJ 4KN7X 1TWGA 2KQ9A 2YKZA 1ON2A 2LKPA 3BZ6A 5FJ8J 1YAUO 2HWVA 3S3OA 2B0JA 3FHDA 5L0CA 3FMSA 1ZW2A 1EF4A 3VSKA 2L7KA 1TWCA 4G8XA 1OCCH 5DS9A 4CJGA 3GVAA 4Q5SF 5JUAA 5FKKA 3EJNA 3HG9A 1OLTA 1LIHA 3OIOA 2NNNA 4GYIA 2XLWA 2KRHA 1JHHA 3Q9SA 2LH9A 4O6MA 4A3FJ 4PSXA 4BACA 1ENHA 1ZQ3P 3GO5A 5CKTA 2Y30A 2LF7A 3PUBA 2YLGA 1BJZA 2K9QA 3FHNA 2Q9AA 4HOBA 1Z77A 3SFZA 2QENA 3SZGA 4BE0A 1T33A 3JR9A 1Y6DA 1FBSA 1YDIA 3NKEA 2CUEA 2BV6A 5FLVA 5IYCJ 3LS0A 1D0XA 1GV2A 3E6BA 1ETYA 4YEJA 3FXUA 5H20A 4CCOA 3LSPA 5A6BD 2KL4A 3WTZA 3SEQA 2FNAA 2R7OA 1RI7A 2QA4I 2L9NA 1XGSA 2L6HA 3EDPA 3H9JA 3Q9VA 4MEYF 2A6HF 2CU7A 1B59A 4YIIA 1B9MA 4ZTFA 4FX4A 1DQUA 3V8KA 2IGNA 2WV1A 3DP7A 1T9KA 5FFXA 2ZO4A 2NUTB 3QP5A 5D91A 3O39A 2E7XA 1QSPA 3GWNA 2DA2A 3S1MJ 3OYJA 3DI5A 3IQTA 5HLTA 3TJ5A 2LK2A 1TLHB 1PVEA 2DODA 3IC7A 4F91B 4J00A 1G3TA 2FBIA 4PDKA 2MHRA 3AG4C 1FWZA 3SEZA 1HW5A 3RYLA 4GO1A 3JRMO 4FISA 2DA5A 2FD5A 2NOGA 1R36A 1S8NA 1A41A 1N75A 3F8MA 1LUJB 2PBIA 3JRTA 4BEJA 3RPQA 4YT4A 4QDLA 5KYXB 1A6IA 1OPCA 1USSA 3EH1A 2HQRA 2NOJB 2XDVA 4LD5A 3M4CA 2PMZA 5F5FA 3CEXA 1U78A 3LSGA 2FFHA 2K27A 4CUGA 3SYNA 4IEJA 2HMZA 2LMDA 2LY1A 3OYDA 2BY3A 3KEOA 1YZCA 4OD5A 3VF0A 1MZBA 2Z3YA 1KZHA 5K1YA 4A6EA 2HOAA 4IGGA 3IQCA 3TJ6A 4AM3A 2E7WA 2XRLA 1O87A 3UMIA 3J06A 1B68A 4JEBA 5DUKA 1KU9A 3CUQB 1DOVA 1WN0A 256BA 2XM4A 2XXAA 4UUVA 2HYJA 3UKGA 2DJNA 1PUFA 1VQMI 2EFWA 3JYYA 5DS4A 3GF2A 3F3XA 3LSKA 4EGYA 1E2XA 4LK1F 4QSHA 1GDTA 1CGME 3ZN0A 2X48A 4HEAJ 2A0BA 2R5ZB 2EB7A 4CCJA 2OQRA 3FMRA 3RFYA 2R9RB 1R1UA 2X85A 2V1XA 1R49A 5LHIA 2AHQA 2DBBA 3CC2I 5LGTA 4O5VA 2LNBA 4YL3A 4WX9A 3HM5A 1Z91A 5HSWA 1J59A 2PMHA 3VYSB 1YO5C 3S27A 4BHBA 3O3KA 4NQWA 2DMUA 1D1AA 2HDDA 4CZCA 3ZP5A 2DYSC 2MC3A 2BW3B 5K7FA 3RKWA 4BUPA 1R4MB 5J1RA 3BJ6A 2L9JA 2M0MA 5FGMA 1IV6A 2JN6A 4RAFA 2EZHA 2HVSA 3ABUA 3SYTA 3GXOA 5DUIA 3JSZA 4XK4A 2CNWD 3ERMA 1ZH5A 3BPVA 3IAM2 1G2HA 1IN7A 3U9MA 1XWJA 2R7ZJ 2DXIA 2MC4A 1BM9A 3CQZA 3IKVA 3B6CA 4A5MA 2J46A 4ENKA 5DS6A 3HOYJ 4NQFA 2OV7A 1Z21A 1BA5A 3I0TA 4Y4RA 1ZR2A 3GYHX 1H6GA 1ZGWA 1B9NA 4FHTA 1JKOC 1HCRA 3OR2C 4KN4X 2LKSA 2VOOA 3MMYB 3ZQ7A 3RKQA 4O3MA 1S3JA 3HSFA 2YL1A 3DAGA 4MVZA 4XEKA 2JPUA 1TW2A 3GTKJ 3K6BA 1S7EA 3I56I 2X6OA 2EPOA 1UAAA 3ZMDA 5DDGA 4CHUA 2OU6A 5EGOB 3VWBA 3U21A 4X0RA 5ILSA 3WG9A 1SMTA 2Y3HA 4J7TA 5JSLA 3DEEA 1VQ7I 1FAPB 3GORA 2LOOA 2FEZA 1WSUA 2KT0A 2LFBA 4JBAA 3SJMA 2NVTJ 3AFHA 1S72I 4IRHA 3PO3J 5E20A 5EZGA 1WWPA 2X0CA 3DLLF 3FBNB 1BJAA 1RC9A 5E3MA 4KI2A 3B9QA 5FD5A 1WATA 2O5RA 2OF7A 2X4HA 4Q48A 1DU0A 3RVZA 1R5ID 3P9CA 3CCVI 2K02A 1J2XA 3FXKA 2EPNA 1MDMA 1XD7A 2DK5A 2NPUA 4PJ0C 5HDGA 3DEUA 5DM6F 5A2QZ 3L34A 5L3BA 3KLNA 5KYWA 2ETHA 1IC8A 2HKOA 1FOKA 2O8XA 1QZEA 1SAUA 2QQ8A 1T01A 2HV7A 1F4KA 1WOLA 4ONSA 5J4YA 3NYLA 2V6CA 1IXCA 1VZ0A 2E2IJ 2K3FA 4A3KJ 5COGA 4AL1A 3HSEA 3NAUA 2VODA 2QTVA 3E70C 2TDXA 5KNLA 2JQ7A 2HJ3A 3LL7A 1OW7A 3B71A 3I54A 3LLIA 2V9KA 4OINF 4MIMA 3DLAA 4FT8A 4YT5A 4P9TA 4IJAA 1OCPA 4BQNA 3AG2C 1I4ZA 2AWYA 1PV3A 2J0XA 1FIPA 2PEXA 5LEJA 1ZRFA 4LLEA 2XLMA 1JGGA 4JZAA 2LFDA 2W84A 3HNIA 1EJ9A 3K6GA 2YU3A 1FMVA 3MFKA 3RKYA 4YT8A 3OL4A 2CSOA 2GOXB 3K9TA 1HMOA 3J81K 1FNTc 4LLNA 4JK1X 3K1MA 2J5OA 3OL3A 5E1WA 2DQLA 4ZYAA 2WZLA 1LDKB 2X1CA 3ONQA 3SXZA 4C3EA 2Q3TA 1HE9A 4I44A 3W2WA 3ECHA 1OFCX 2EJRA 3LJBA 3QZCA 1YHQI 1JXSA 3K4JA 2UV1A 3OS0A 4G7ZF 1F9NA 1Z7UA 2K5CA 2HYFA 2XAHA 4BHCA 4IARA 2M1BA 5HLGA 1GXQA 1YW7A 2Y69H 3EH2A 2GWWA 2LRDA 1PUFB 2GFHA 4YJWA 2Y69C 2CRGA 3H36A 1FR0A 1MJ9A 4A3GJ 5HNHA 3H5RA 3H3UA 5JHFA 1QO0D 4EJOA 1JTXA 3BR3A 2P8TA 1WJEA 1YOVB 2JRMA 2VQHA 4IOCF 1ZHZA 2EA4A 1B1BA 1DGRM 2XIGA 2PFDA 3QOPA 4XTKA 4WGZA 5GADJ 5F08A 3ZOBA 3EUKL 3MZHA 1V4RA 4XN0A 5FKLA 2OD5A 1ZYRF 4MTGA 4NQWB 3JRHA 2ME6A 3AAFA 2ZMEA 3Q0UA 1L7CA 4PUSA 2Y3DA 1LJ9A 2VC9A 1FSHA 1XMXA 4TV7A 3J80K 2M3AA 1OXBA 2M34A 5J8CA 3HZJA 1WQ2A 2AO9A 3DFGA 2ZNZA 5LRRA 3KP7A 2ELHA 2HQAA 4RLQA 1J09A 2QNLA 3GTJJ 5L0JA 4F52A 5BQHA 3OV8A 4HF1A 4IRUA 2M87A 3LAJA 3MLGA 1ZHFA 4C3DA 4XLHA 3ABKC 5L3FA 3CLQA 4LK0F 4C9YA 1P9QC 2QZ8A 1O3TA 4DXWA 2FUG2 3EUAA 5KVRA 4EJTA 2VQLA 3LNRA 1W0UA 3S0XA 4Y3OA 2XRHA 2YL0A 1CF7A 1T6QA 2F4IA 4NBQA 3CMYA 2JA8J 2HPIA 2UUZA 5D6EA 4E7ZA 4HX7A 2RSEB 2DTZA 1XB4A 4B3AA 2DFIA 1NU7D 2JA5J 4DYRA 1I6XA 3TP0A 3DV8A 1HMDA 2XB5A 2ETSA 2E34A 2GBYA 3BP8A 2FQ3A 2V1NA 5E18F 1YJNI 2KW3C 3V7SA 2GM4A 3KH2A 3KP3A 3L8JA 1ONVA 2L7FP 1MMGA 2M0CA 4EJVA 1QKRA 1RETA 2J8WA 1Y8QB 5ICFA 2WADA 1MSFC 2ZD9A 2DA1A 5GTIC 1EKEA 2QUPA 1FP2A 4KISA 1KONA 5L3DA 3U3FA 1X4PA 4IXAA 5FCLA 4QLCU 2LP4A 2JA7J 4C3BA 3OR1C 5JS5A 5L0DA 4EBBA 3DWWA 1X1DA 4G7HF 1JE8A 4MW3A 3NRVA 2VE8A 1X3ZB 2LG4A 3FMQA 2BC5A 2D5VA 1ZTRA 1TWHJ 1Z0XA 2EFOA 3KYDB 2JVGA 4KUMA 1YX3A 4B48A 4BAYA 3CF5F 4MVOA 1MDMB 5FKMA 2KFDA 2CQNA 1UELB 4ZH4F 1B72A 4UY8I 3BZKA 1SD5A 4IWBA 4XPXA 4W8KA 4CIHA 4L5EA 5KYWB 2WY8Q 3EHNA 4PGHA 5FRMA 5GTHC 1E83A 3QW0A 4MGRA 1LNWA 5J1UA 2HTJA 1AVOB 4LMYA 1TR2A 1XMKA 3WTYC 1G3YA 2VJIA 3HJEA 2KGOA 5B3SH 4PJJA 1I6HJ 2FQ4A 3S8PA 4E17A 4IF4A 2MLGA 2LCHA 2XV4S 1VQNI 3RTRA 4CA0A 1ORSC 1O5HA 4GYTA 4YIFA 3T9OA 3WTVC 2QE9A 3HHHA 4M74A 1ZHTA 5DQTA 2UUHA 1QPIA 4A2NB 5KHDA 3GM1A 3KYJA 4O6NA 3DZAA 5HS8A 4KMUX 5ILUA 2X6XA 2Y0MA 3ABLH 2MH9A 1MNEA 1Z67A 3WG7H 3BR1A 5F0FA 3RIPA 4EWCA 4RDAA 2DOAA 1VOMA 5COMA 2QF7A 4ENJA 1X3WB 2LKXA 1VQPI 1Q0DA 3F6VA 3IPMO 2K7LA 2OAZA 3HHGA 4DJ9A 1OCRH 2LK4A 2C03A 3CESA 2STWA 3E7LA 4MW8A 4F93B 1OCRC 4B43A 2IVMA 3A1YA 3OYKA 3CCMI 3KFWX 2NG1A 2OUMA 3AG3C 1TFOB 5AC4A 6PAXA 3IL2A 2E1MC 2VL8A 3BWGA 5D5XB 3IQ5A 4DIQA 2MABA 3JW4A 5J1YA 3RQFA 2IJLA 2VBZA 4LG0A 3EYYA 1JI8A 1GLNA 2VQCA 3LFKA 1U9NA 1I3AA 3CJQB 2H6BA 4S0HB 4DOZA 1XSDA 1WGXA 3CUOA 3HKZN 3SXKA 2PG4A 4UVAA 4KT6A 3QU6A 4LGWA 2IOQA 2ZSIB 5F04A 3K70C 4AYBN 2O8KA 2MYSA 1JRAA 3GTQJ 1T0FA 3VYWA 4MVMA 2M2EA 5KYUB 4K0DA 1KGSA 2E35A 2HOSA 3B0UX 2ZXWC 1LFUP 2FBKA 3ESWB 3TK0A 1VF9A 3J80Z 2DO7A 3KYIA 2ZSHB 2M4GA 4XQ1A 1NTCA 1TTYA 2DK8A 5JT4A 4I0AA 4XKVA 4JJGA 3N2ZB 2V9PA 1UHSA 3JRDA 5KAIC 4YFXF 3AGUA 3M07A 4EM2A 2QSFX 4NHJA 4BDZA 2G7UA 2HVQA 1PP7U 5TJJA 4MFDA 1L3LA 4M3DA 2IS1A 3C1DA 2UWMA 3JTLO 5DCMA 2ZMEB 3RQEA 3ZGKA 3F6OA 3SNHA 2A5WA 4PCQA 3MCZA 4ESFA 3F0CA 2AXLA 3CMAI 3AL0B 5K0IA 3IH4A 3MWMA 1G3WA 1K4SA 4O6YA 4BPMA 1DU6A 3P9KA 4R32A 1P4XA 1R7JA 1X3UA 4N6HA 2TCTA 2M4KA 1LPEA 2XC7A 3JSEO 2KQRA 4DBQA 2CCYA 4EJUA 3ZMVA 2PNOA 1K6OA 3I59A 3AL0C 2CQKA 2HI3A 3ZQQA 3DTIA 3EQLF 4RM3A 3UMKA 1LDJA 4Y33A 1NG7A 4HW0A 3L1MA 4BJ6A 2CYYA 5J4VA 3N05A 4E0HA 1IDYA 1MMSA 4II3A 1WWXA 4IVNA 3HTKC 4BXXJ 1DOWA 4JIOA 1B4AA 1CF7B 2NS0A 3V42A 2L4MA 2VPRA 2Z2SB 3M1CA 4AVPA 1G6NA 2NSGA 3DMDA 4KBLA 4S04A 4DRJB 4K1OA 3HYIA 2IS2A 2VCCA 1XSXA 2M7AA 5D4SA 2UXXA 5L0GA 4DVYP 1ETWA 1ZGJA 3K7AJ 2DJIA 3O8HA 3MZYA 2Q8KA 1M6TA 2W1OA 4R1HA 4LLLA 2CGPA 4GRIA 1ZARA 1Q1HA 5D8LB 2Z1DA 3AGTA 1RR7A 2L02A 2UZKA 1CPQA 1YLMA 3DPTA 3HSRA 3I3LA 4YFKF 3OYLA 4MFEA 4E4HA 3E6MA 4II2A 1X1CA 1ZK8A 4CDGA 4EATA 5HODA 1ZHXA 3KL4A 4LOCA 4MHGA 5C44J 2DFFA 3BDDA 3R60A 4QIWN 2PI0A 1L0OC 4IHXA 4JJFA 3UGOA 4HLXA 5AIQA 3RF3A 5LLQA 4ENNA 1TNTA 2O3FA 3PMRA 5AC5A 1YJ9I 5BQTA 3NEUA 3S93A 4XOTA 1WJDA 2KJGA 1B72B 1J8YF 1LQ1A 3E6DA 2DLLA 4P55A 4C3JJ 4NCQA 2X6WA 1F5TA 3BC8A 1TP4A 2E19A 4G9YA 1GGQA 5KYXA 3IH2A 2H7BA 1I5ZA 1GQAA 3S32A 3VFZA 3ELKA 1ZRCA 2K9NA 4UNOA 1OKRA 1SEUA 1SFOJ 4N06A 2O6GE 3DAFA 5ED4A 1BOAA 1H9GA 2P6SA 2NVQJ 4B09A 4OIQF 1QHHD 3E5UA 3BR6A 4NTAA 4CBEA 3A01A 2KDZA 2R4GA 4G0HA 1RRJA 2M9HA 1D8JA 1T6SA 5FROA 1WH7A 3SP1A 3DQVC 4IX7A 4M71A 4IZZA 3GMEA 1YJWI 3OYCA 3CUQA 5JR3A 1QQIA 4XN3A 4B44A 1T95A 1R9TJ 4CSWA 1NFNA 4OOIA 2KDOA 4ZYDA 2L9RA 1W7PA 1YFHA 2NRAC 4BY1J 1K04A 4C2MJ 1Z3IX 1BIAA 3JRCA 3GTGJ 3LLKA 2R5ZA 1K7AA 2WZGA 1D1BA 2IXMA 2CWEA 5DEQA 4ULVA 3M4OJ 2E5NA 1M2OA 3LQRA 2H7VC 2AQEA 3ULQB 3L8IA 2DA7A 3KMIA 2W4MA 1MH4A 4K7BA 2MG4A 1YTYA 1QZYA 2Z99A 4M73A 1YS7A 4XKWA 3ZC4A 2EIMH 2H09A 4LG0B 2HZDA 3L0IA 3LSRA 3CJNA 3I55I 1X4OA 4QWQA 5CLSA 3U1DA 2RVCA 3K4KA 3MD2A 3HXLA 2K86A 2EPFA 4CYCA 1HLVA 2EILH 1ZVZA 3K4BA 3SZTA 4BQAA 3COAC 2EILC 4RGXA 3SZPA 2CV0A 1ZHWA 4EKWA 3PQJA 3RPUA 3KKBA 1A7DA 3GZNB 2OQGA 4ESJA 2V79A 2A69F 3FXLA 4L9TA 4HG2A 2R7WA 3TO9A 3C8ZA 4M6XA 1NLXA 4A3CJ 3K1HA 4RDUA 2KLOA 3BG5A 2HOEA 1T0FC 2P5KA 2X1EA 3BG9A 4KNVA 5E3AA 2JUGA 3JRFA 4D4XA 3I4NJ 3TDUC 3DU6A 1ORKA 3NMKA 2FBHA 1NU9C 4ZLDA 5DCMB 1CGNA 4WK8F 1IAWA 3OYEA 2RD9A 1HY5A 1XGMA 3GEZA 4CGZA 2ZC2A 5D4RA 1JJ6C 1T08B 3FWEA 1TZLA 4AUXA 2OOCA 4EUKB 2ZBKA 1YQAA 3WHNA 5EZHA 2M45A 1HSTA 5EGOA 2H1KA 4RA2A 4XORA 3S1QJ 1ZU5A 2STTA 1QQ3A 1WTYA 3ZVRA 1A5JA 2IGMA 2VN2A 3I59B 4HNTA 1OCCC 3HRSA 3E0JB 3G1MA 2LY2A 2KP6A 3T4RA 2FRHA 5E2QA 1QZXA 1Y0UA 4ZDPA 3S2HJ 3ASNH 4DW6A 1OCOH 1WFXA 2EQRA 1XPXA 3HNLA 2E87A 3EHMA 2H8AA 3ASNC 2VT2A 3LEVA 3H1CA 3M1CB 3U8VA 4BBSJ 5M5XJ 2AXTC 2EH3A 5JHUA 4XRFA 4E7JA 2IAIA 4BJ6C 2L2OA 3HRMA 3U3BA 1IXSB 3I4PA 4YIRX 5GAHJ 2P6TA 5CVUA 3TKYA 1FMWA 4DRIB 2NNYA 1OYYA 4A4AA 1Q0GA 3ITFA 3ZMZA 2F4MB 2W48A 4D5FA 3LAPA 1T39A 3J7YJ 1FX7A 2FU4A 2CQ7A 3JTGA 1TBXA 2XUBA 2WTEA 4A3MJ 2PX9A 2R3SA 4Q47A 5L0FA 3V7CA 3HKZA 3SEOA 2JMWA 2DAOA 1G3SA 1UB9A 2XL6A 4I09A 2Y39A 1QZZA 4AYBA 3RKOF 2CUJA 3PHF2 4E7SA 2OJED 4MVQA 4A3JJ 3SDGA 4ZYEA 2KNHA 2WY7Q 1LVKA 1W5SA 4KT5C 4EJWA 1FFHA 3K1IA 1T5OA 1K40A 1BZ4A 4I1OB 4BNCA 2JPBA 3BQZA 1FJLA 1XTAA 2ISZA 1K78A 2HGCA 4G7OF 4WWCA 2H7OA 3GODA 3NRHA 1U8RA 1MBHA 2G62A 1Z3XA 1S7ZA 3ABMH 3OY9A 1ZREA 5D92A 4AE4A 4B47A 2Z5UA 3LS1A 3PCVA 3BTJA 3BG7A 5E8GA 3GW2A 1O3UA 2C04A 2HS5A 2Y3GA 5CI8A 3I53A 1AKHA 1IUFA 5FB2A 3G4ZA 3H92A 5TISC 1IRGA 1X1BA 3JCUC 5D6FA 1E3OC 2HZTA 5E3CA 1K05A 1F1ZA 3LSMA 3MBGA 1ZKGA 1U0BB 2YUSA 2EA2A 4RBNA 5KAFC 3JT1A 2YQYA 1ZLJA 2GAUA 4NB5A 1H9TA 5F1RA 1HSJA 2LSOA 3IUOA 2HQNA 3A01B 2IT0A 2NVXJ 2O61A 2ZJQF 1XZPA 3QRFF 3ZXSA 4H54A 1FLIA 4HLYA 4U5CE 4XWJA 2EZKA 5ICGA 4HRIA 1MIJA 1OYWA 3GANA 3FDQA 3QPTA 1N1CA 3T1BA 4UDVA 4EHPA 4IHSA 2W82A 1W7PB 3HNJA 1LI7A 3HOZJ 3Q6MA 4P9UA 2HKVA 3HOTA 3HRUA 3Q0VA 2ZXHA 1PUEE 2R7FA 3I5PA 3CUQC 3BJOA 4M3FA 1QNTA 1M2VA 2L5QA 2A07F 4GDFA 2HFIA 2QM3A 3PFIA 2CS3A 2GIVA 2GQQA 1I27A 3KLOA 4KJZA 4HNUA 5B5EC 1TWAJ 4QI2A 3B0VC 1HQCA 3V8JA 3B29A 1ETQA 1D3YA 3PM1A 5IY5H 2PP4A 3HJCA 4LIUA 2IS4A 4ZZLA 2HZ8A 3QU3A 5IY5C 2F4OB 4CYCB 3K0LA 5KK1A 2CFXA 1VQLI 3BY6A 5A6AA 2ZJPF 3OYMA 3HPGA 3UMHA 1VTNC 1Q0FA 4R79A 2VC1A 4ANJA 1BI3A 4HE8D 3R0AA 3BLYA 1POGA 3ZQFA 4GXOA 4WXCA 4M63A 3VM6A 1RESA 3HC7A 3F22A 2V7FA 1X58A 1T6IA 1OR7A 1PYVA 1RIOH 2R7UA 1MQVA 1T38A 3S16J 1MBKA 4EEFG 1ZLKA 3CCQI 1UFBA 3Q7LA 2ISYA 1IZMA 5LHHA 5DV5A 1W2WA 2V3CC 4RAGA 2GLOA 3DJNB 2HMQA 2W7NA 1P4WA 4GEHA 2OA4A 2A61A 3OYAA 1N78A 3QVYA 3E97A 4O6JA 3H2VA 2YX7A 1P7IA 1U9OA 3S2WA 4CO8A 3S29A 4RGRA 2EZIA 3CP2A 4DBRA 4AIKA 4FCYA 4XLFA 3K33A 4MVRA 1KTMA 2EINH 2R7QA 2EV0A 1UFMA 3BRJA 3RIRA 4U5EE 2R5YA 2DN0A 3MQ0A 3SZRA 1YW9A 3LA2A 5GAEJ 1JOGA 3K2AA 4LACB 2Y9YA 3OYBA 5CVJA 3K70D 3CAXA 2NS7A 1YA7O 4HFFB 2KPMA 3Q6NA 1BIBA 1Z6AA 3H35A 4M6YA 2XKOA 1NK3P 3C8GB 3NQOA 2XSDC 3O55A 3GM3A 3UGPA 3LSTA 3QYBA 3T6BA 4XMYA 4FX5A 1NG1A 4J32B 3IWZA 4Z9IA 4IQJA 1Y8RB 4XLNF 1U3EM 2JUCA 1K6YA 3L7WA 2H1LA 3VDXA 1Z23A 4WGYA 3BEHA 2LBFA 2VIXA
chains in the Genus database with same CATH topology
4XLPF 1NG6A 4KISA 1KONA 3MX3A 1X4PA 5FCLA 2R7VA 2YEVA 4C3BA 5B1BC 3OR1C 2MFZA 5T1DB 1BR4A 4EBBA 3K4NA 3M8JA 1X1DA 3DM5A 5BUOA 4BE1A 2WAQA 4QI0A 4G7HF 4P6IC 2DT6A 2LG4A 2Z16A 3DPUA 2WB1A 3QODA 3H5AA 1WJFA 2CGEA 3KYLA 5DS5A 4B48A 2JVGA 3NKDA 1YX3A 4F3QA 2J9WA 4YT2A 2WB7A 1UELB 2A68F 2NUTA 1SF8A 4IWBA 4KNWA 4W8KA 4CIHA 2KRCA 4DVZA 3EFOB 5KYWB 2WY8Q 1W36D 2J45A 3EHNA 5FRMA 2R7RA 1ST6A 3ABMC 2HNHA 3JCUQ 3K7DA 1TR2A 3W8IA 4CS8A 3OS2A 2WAFA 3PSIA 2VJIA 1M56C 2KGOA 4PJJA 4D9JA 1IW7F 3S8PA 3H5NA 2KZVA 5LD2C 3L2UA 1Z63A 1WJ5A 4AX2A 3LMMA 3ZCOA 2I8BA 4ZLCA 3RTRA 4CA0A 1JPJA 4AE4B 4GYTA 1O5HA 3K1IC 3H9GA 3AG1C 3HOSA 1ZHTA 4F55A 2PX0A 5DQTA 4A2NB 5KHDA 4CSAA 4O6NA 3DZAA 4XLEA 3PNVA 2CNWA 4Q4ZF 2AQFA 4E7IA 2J7PA 2X6XA 5EHHA 2XF7A 3PSFA 3CF2A 1MNEA 2DT7B 2Y0SA 3PFYA 3NWSA 3PJRA 4EWCA 3RIPA 3AQCA 3HL2A 2VXDA 3DKXA 4RDAA 2F5VA 4JW1A 3FKJA 4PK4A 2DOAA 1VOMA 2FGYA 4C30A 3NG1A 2VB6A 5LFAA 4CH7A 2EIKC 3X2QC 2C03A 3CESA 4F93B 1OCRC 4B43A 2J9VA 4E7KA 3DKYA 2XF6A 3A1YA 3LSHA 4HEA2 4AU7A 4BQOA 2OUMA 2M7BA 2QKLB 4HPQA 2VJ4A 2NG1A 3AG3C 4MQ9F 3TD7A 3W3CA 2E1MC 2VL8A 2ZXRA 1VYKA 2VJJA 4DIQA 2MABA 4FASD 2WVQA 1V5FA 5EGYA 4BE2A 1RJ9A 1JI8A 2A6TA 3F9KA 1GLNA 3OYHA 2VQCA 3L2RA 4XKBA 2IXOA 3CJQB 5KYUA 4YELA 3K4LA 3LSIA 4DOZA 2J0WA 1BR2A 4QPOA 4NNJA 1G59A 4J30B 1ZU4A 4U5FE 3C2HA 4BJ5A 3A2KA 1M2VB 4KT6A 4JOMA 4LITA 3QYFA 3RCOA 1WGWA 2ZSIB 2IOQA 3K70C 5KYYA 1D0YA 2CW0F 2MYSA 4KC9A 3VYWA 1RJ9B 4NY3A 5KYUB 3X1OA 4K0DA 2V26A 4G6TB 2P7VA 2VH3A 3I5QA 1MNDA 2Z15A 2ZXWC 5KYNA 2BW3A 1PD1A 3B0UX 2X6YA 3E1SA 3DJUB 4JURI 2ZSHB 2M4GA 2ZPAA 2HU9A 3OIPA 5KYYB 3IEEA 3DPLC 1D0ZA 4IQ4A 2Q2EB 4XKVA 3CZ6A 1J8MF 2QY9A 3N2ZB 4BDYA 4BEHB 3OA1A 1U0JA 1TWAA 3K4MA 2Y3BA 4LIVA 4BDZA 2HVQA 1EA3A 2XSEA 2UWMA 2IS1A 2PJRA 2P0WA 3CMMA 2JVHA 2LYCA 1R6RA 3ZGKA 3EGDA 3SNHA 2EIJC 2NUPB 1ZELA 2A5WA 2MD0A 5HOOA 3H0DA 1SMYF 5HNFA 3AL0B 2P6VA 4E6KG 2PF4E 2W4BA 4JCHA 4JJGA 2PX3A 3PNTA 4O6YA 4CCKA 2VJ5A 2VASA 1KU2A 2J7PD 1ERDA 2EINC 2M4KA 2HV6A 2XC7A 2KQRA 4DBQA 3EGDB 1V54C 2WZFA 2A1DD 3VYTB 2YZSA 4BS9A 3AL0C 3TMOA 2R7XA 1DP3A 3ZQQA 3OOUA 2YHSA 3WODF 4CS7A 3DTIA 3EQLF 4RM3A 4XLAA 1W36C 3L2WA 4Y33A 3UMKA 1NG7A 4BJ6A 4OIPF 2A6EF 3MKYB 3N05A 2V4JC 2KQ9A 3D5LA 4DGWB 1TWGA 2B0JA 1X1AA 4II3A 3MKZA 3HTKC 3S3OA 2ZFUA 3FHDA 4U5HA 3VSKA 2L7KA 3V42A 2X51A 1TWCA 3M1CA 2Z2SB 3DMDA 3ZIBA 4B6IA 4MNDA 4KBLA 4Q5SF 2IS2A 2M7AA 3EJNA 3HG9A 1OLTA 1SZIA 3EGXB 2CV1A 4PFPA 1TT0A 1M57C 2KRHA 3HLZA 2CMPA 2LH9A 4E7LA 4O6MA 4DVYP 4PSXA 2DJIA 3HUGB 3OMYA 4BACA 2W1OA 4N4OB 3POVA 4GRIA 2Z1DA 5CKTA 4Q7CA 4I3MA 3PUBA 4OAZA 3EG9A 3FHNA 3NYJA 4XKCA 4H4KC 2Q9AA 3I9V2 1WJCA 3DPTA 3SZGA 4BE0A 1OCZC 2LBFB 3I3LA 3NKEA 1MMDA 3OYLA 5CI9A 1VMAA 3LS0A 4E4HA 1D0XA 4II2A 1X1CA 4EATA 2BVMA 2CW8A 1X19A 3OYFA 1ZHXA 3SDBA 4YEJA 4CCOA 2MWQA 1BR1A 3KL4A 5HVQC 2KL4A 3UGOA 4C7OA 4JJFA 4IAOA 3NWTA 4BJ1A 3SEQA 2R7OA 2J9UA 1WJAA 2CDQA 2L9NA 1Y56A 3J7AY 3H9JA 4XQFA 2BVLA 1V5GA 2A6HF 5L3VA 4BL0B 2ZXOA 3ZRGA 3PMRA 1QHGA 4ZTFA 1V5EA 1DQUA 3S93A 4XOTA 2IGNA 1WJDA 2KJGA 5B3SC 1J8YF 2NUTB 2Q9CA 5D91A 2X6WA 3MKWB 3BC8A 3O39A 1TWHA 5KYXA 2WA0A 2H7BA 3S32A 3OYJA 3OYGA 3QMKA 5HLTA 4F91B 2IXPA 4J00A 3AG4C 4N06A 3S28A 4RM2A 3SEZA 4NUBA 3DAFA 3RYLA 2W9YA 1YE9A 1N75A 3DWLE 2Y3DA 3JRTA 4OIQF 1QHHD 3DTEA 4BEJA 5L3QA 4YT4A 2CW7A 4QDLA 2RQQA 3D5RC 4CBEA 5KYXB 2QKMB 3EH1A 3ABLC 2NOJB 2R4GA 2XDVA 3K66A 1N77A 2PMZA 4G0HA 3WG7C 5F5FA 3A4CA 3O6XA 5FROA 3LSGA 2FFHA 2WVOA 4CUGA 3CSKA 2OG2A 4C2TA 3DQVC 4PJMA 3SP1A 4HFKB 3KEYA 4IX7A 3SYNA 4IZZA 2LY1A 4BU2A 3OYCA 3H65A 3OYDA 3RH3A 1D1CA 4XN3A 2DYRC 4B44A 1T95A 3AQBA 4CSWA 3DD7A 4ULWA 3OYKA 4U5DE 2KDOA 3FDYA 4OD5A 3H9QA 3I4UA 4I1MA 1Z3IX 2DCEA 2VKDA 2R7SA 3V7OA 3LLKA 2WZGA 1D1BA 2IXMA 1O87A 3UMIA 2LBFA 2E5NA 1M2OA 2XXAA 2H7VC 2VLAA 2AQEA 5DS4A 2RREA 3KMIA 2W4MA 3LSKA 4K7BA 1VYIA 3OWTA 3ASOC 4XKWA 3ZC4A 4HEAJ 3L0IA 2HZDA 2K3PA 4CCJA 1TKNA 3FVYA 3ECSA 3BCAA 3RFYA 1X4OA 2X85A 4BJTA 3K4KA 2XXAB 1UG0A 3EUHC 3MD2A 3OYIA 3HXLA 5TGTA 4PFOA 3RSNA 1Z3YA 2VKHA 3K4BA 3ZG1A 4NC7A 2EILC 2KHMA 5HSWA 3VYSB 2CV0A 3S27A 1ZHWA 3KKBA 3VAYA 1D1AA 5FRNA 4CZCA 1SFKA 2LSEA 4O79A 4RLFA 1Z5ZA 2DYSC 2A69F 2BW3B 3ZR8X 2WL8A 2XL4A 4BJ5C 4KITB 4BUPA 4HG2A 2R7WA 4XR6A 2ZXPA 2K9LA 2L9JA 2M0MA 2HVSA 3K1HA 2KLOA 1DGWY 4ITVA 2JA2A 3SYTA 3UR3C 1T0FC 3VSLA 1FFTC 2X1EA 2CNWD 4KNVA 5E3AA 2JUGA 1PJRA 2WAEA 3EZIA 4OD4A 1MMAA 3IAM2 3DU6A 4ZLDA 2RNGA 2DXIA 2MC4A 2PJRB 1NU9C 3CQZA 3CP8A 3OYEA 2O9XA 2J46A 2V6EA 1OR7C 2KMUA 2BOLA 5DS6A 2OV7A 1Z21A 1TZLA 1QU3A 4XNFA 2LREA 4Y4RA 4YWQA 3OYNA 3Q7GA 3LESA 3OR2C 4IKFA 1ZU5A 3NDBB 3MMYB 4XORA 1ZHYA 3DAGA 1QLEC 4CCMA 4BG0A 3DU5A 4QPQA 2Q9BA 3CJRB 2L9SA 3ZVRA 2R7TA 2IGMA 3EPVA 3FAJA 4HNTA 3K6BA 1OCCC 3B0PA 4MLOA 3E0JB 2LY2A 2KP6A 3T4RA 1UAAA 5E2QA 4ZTJA 3VWBA 4OAYA 3RQ4A 2E5ZA 4ZDPA 3U21A 1QZXA 4X0RA 1WFXA 2Y3HA 2E87A 3EHMA 3ASNC 3M1CB 3DEEA 3LEVA 2VQGA 2LOOA 4PJNA 4E7JA 4BJ6C 2L2OA 4PJLA 3AFHA 1VK5A 3JSZA 2W4SA 1FMWA 1LS1A 4XL9A 3ITFA 1MW7A 3FBNB 4JQFA 4KI2A 3B9QA 4C2UA 2O5RA 3EG9B 4XONA 3RPUD 2HPMA 3HKZA 3SEOA 4YN0B 4E7HA 1OKKA 1IRXA 2Y39A 3L34A 2I8DA 2W00A 3EFOA 4AYBA 2IS6A 3RKOF 2CUJA 3W2VA 4E7SA 4BGDA 4CS9C 4U5GA 3PHF2 2KNHA 4C7OB 3TL4X 2WY7Q 4FESA 1LVKA 2IGOA 1FFHA 3IAS2 4I1OB 1SAUA 2HV7A 4G7OF 3NYLA 2H7OA 3GODA 1VZ0A 3NRHA 2G62A 1WJBA 1Z3XA 1S7ZA 3E70C 2QTVA 4RD9A 2G3KA 3VYRB 5KNLA 3OY9A 3VYUB 3DM9B 3OS1A 3N24A 3LL7A 5D92A 4AE4A 4B47A 3LS1A 3LLIA 2V9KA 2Y3GA 3BG7A 5CI8A 2C04A 3DLAA 2E60A 4YT5A 4OINF 3FBIB 4BQNA 3AG2C 3E9VA 4CS8C 4AVZA 4F4BA 2VXZA 5CPRB 1HA8A 2J0XA 2CV2A 1X1BA 4ZJZA 2CFOA 5E3CA 5KCMA 3LSMA 4LG3A 5CQGA 1Z7LA 4LLEA 3KX2A 4RBNA 2IXSA 3JT1A 2VPLA 4JZAA 5CQEA 4BQQA 4P1WA 1NZEA 3K6GA 3IUOA 4NC8A 1FMVA 4CCLA 4B3XA 4YT8A 3OIQA 3OL4A 3UNGC 3W8HA 2GOXB 3ZXSA 4RMNA 4ZYAA 3OL3A 4CSAC 4U5CE 2WZLA 4XWJA 4HRIA 1LDKB 2X1CA 3ONQA 3PL8A 4U5BE 2Q3TA 4C3EA 2W45A 4I44A 3GANA 3FDQA 3QOEA 3W2WA 1N1CA 3LJBA 3QZCA 4FWVA 1Y6IA 2E1MB 4X0GA 3K4JA 2UV1A 1YX5A 4CCNA 3OS0A 3S3MA 2W82A 2D5RB 2K5CA 3LAYA 2HDWA 4G7ZF 2WBMA 3Q6MA 3T6JA 3HOTA 4XOPA 1S9HA 1MMNA 2ZXHA 2ZXIA 1E0EA 2EIMC 3I5PA 1M2VA 3DXJF 2Q1ZB 3EH2A 2L5QA 2LRDA 2GFHA 4IJJA 4YJWA 3PNYA 2IGKA 2Y69C 1OKKD 5T3WA 5HNHA 3H5RA 2CS3A 5JHFA 2XF5A 5F5HA 2IXNA 4KJZA 4HNUA 2WVNA 1WJEA 1ZHZA 1PD0A 4WJ0A 2CH0A 2VQHA 5KYWA 4QI2A 3LFUA 1DGRM 3B0VC 2PFDA 1LKXA 1V55C 2GOMA 4ZC3A 3EZHA 4XTKA 2XSJC 4ZDOA 2PP4A 3HJCA 1AA7A 4LIUA 4U87A 2IS4A 5IY5C 4JVSA 4FETA 4BXFA 2G3VA 3EUKL 3C2GA 3BG6A 4BEHA 1FTSA 4LERA 3OYMA 3OEOA 3HPGA 3UMHA 2DGJA 4R79A 4XN0A 4XM3A 4ANJA 4DJAA 4NQWB 3AKZA 1ZYRF 4HE8D 5T3TA 2OC6A 3BLYA 3EPZA 4PUSA 4F92B 3D5SC 2ELJA 3K10A 3HC7A 2CUZA 2BE5F 2V7FA 2NUPA 2L81A 5DVWA 1PYVA 3NYMA 2R7UA 2M3AA 4PSWA 3F47A 3Q7LA 2HQAA 4RLQA 1J09A 3N0TA 1IZMA 3JYHA 1W2WA 2V3CC 3DJNB 1LFPA 2F6CA 1JPNA 2X1DA 2W7NA 4F52A 2M4EA 5DQZA 4GEHA 4IRUA 1BOBA 3OYAA 1N78A 4U7BA 1PCXA 3K4CA 3MLGA 4C3DA 3GBGA 4XLHA 3ABKC 2OCCC 4HSTA 2JSPA 2XAUA 3W2AA 3S29A 3ZSUA 3G2BA 3CP2A 4OWRB 4C9YA 4DBRA 1P9QC 3QYEA 4XLFA 3K33A 2FUG2 3EUAA 4OIOF 2VQLA 2R7QA 2IYLD 4U5EE 4HSRA 3LNRA 4AK9A 4J01A 4O7GA 4LLCA 3S0XA 4Y3OA 4XLCA 2XRHA 3SZRA 2F4IA 1G8XA 4LACB 3OYBA 4CS9A 4P5OA 2HPIA 2UUZA 4E7ZA 3K70D 4M63A 2JD3A 4YRVA 3IP4B 3EGXA 2KPMA 3BCBA 3Q6NA 1Z6AA 4HFFB 1OCOC 3H35A 1NU7D 4ZDLA 5E33A 3UGPA 2K9MA 3QYBA 3T6BA 4XMYA 3F46A 4FX5A 1NG1A 2V1NA 4J32B 5DLJA 4OIRF 2LC2A 2KW3C 3DTKA 3L2VA 3KH2A 4IQJA 3L2QA 4XLNF 1MMGA 1K6YA 3TBIA 3VDXA 4D1QA 3S3NA 1Z23A 5B1AC 4N4NB 3HPHA 2WADA 2HVRA 2VIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ6 A;  4BJ6 C;  4BJT A;  3OWT A;  4BJ5 C;  3K6G A; 
#chains in the Genus database with same CATH topology
 1FSE A;  4XLP F;  1NG6 A;  4IHT A;  3I71 A;  1T6U A;  3BTI A;  5B1B H;  3W6J B;  3Q0W A;  5B1B C;  4A69 C;  2E1N A;  4LDQ A;  2MFZ A;  5T1D B;  1S6L A;  1OCZ H;  3M8J A;  2HDC A;  5BQG A;  2L7A A;  5JLX A;  4BE1 A;  4QI0 A;  5BUO A;  3GTM J;  4K2E A;  2XRN A;  1P6R A;  1O3S A;  3H5A A;  5F28 E;  3KYL A;  1A31 A;  3VPR A;  4RBO A;  2JJ7 A;  4AC0 A;  4F3Q A;  4YT2 A;  3QPL A;  5EYR A;  2WB7 A;  3HOV J;  4NC6 A;  3JSP A;  1DP7 P;  3U2M A;  2EV5 A;  3KIO A;  3K1P A;  4PR9 A;  3FM3 A;  2FOW A;  5IP9 J;  5HS7 A;  2HNH A;  3JCU Q;  1G4U S;  1AHD P;  4CS8 A;  2Y9Z A;  1MH3 A;  1M56 C;  1BI2 A;  4ON0 A;  1K78 B;  4D9J A;  4EGZ A;  1LB2 A;  1I4Y A;  4MTO A;  1Z63 A;  5FLX K;  1OW6 A;  3KE2 A;  4JC7 A;  1TQI A;  4EM1 A;  4ZLC A;  2GA2 A;  1BBH A;  4AE4 B;  4UV9 A;  3K1I C;  3M7G A;  3H9G A;  3N4M A;  3A0B C;  4DYC A;  4FAP B;  2KIF A;  2PFB A;  2XPW A;  3I58 A;  4F55 A;  5FD6 A;  5FLM J;  1AKH B;  1RPW A;  1FYM A;  2HKX A;  2RNJ A;  1HE1 A;  3WHB A;  3GFM A;  4CSA A;  4I7H A;  4XLE A;  2CNW A;  1MGT A;  2AQF A;  1VB5 A;  2J7P A;  2L6F A;  3C62 A;  4WAB A;  2OZU A;  3GTP J;  1RZ4 A;  1JKP C;  1OYI A;  3TOA A;  1F36 A;  2L7Z A;  4A3E J;  3S14 J;  2VXD A;  2XLH A;  1FZP B;  2CYD A;  2WWY A;  5E79 C;  2EPK X;  3SXY A;  4H0E A;  2EFQ A;  4PK4 A;  4HDU A;  1FTT A;  4C30 A;  1XG1 A;  2BY2 A;  2RAE A;  2RDP A;  1J75 A;  1KU7 A;  4CH7 A;  2DYR H;  4GFB A;  2VBW A;  2PLY A;  4NC3 A;  4EV0 A;  1EH8 A;  3TW6 A;  4MEX F;  3EUH A;  4HEA 2;  1U2W A;  4BQO A;  1WZ2 A;  4BY7 J;  4HPQ A;  3HIF A;  3ZQH A;  2VJ4 A;  3S2D J;  3RQG A;  2HOT A;  1I1S A;  2W85 A;  2ZXR A;  3TD7 A;  1E86 A;  2VJJ A;  1K79 A;  3DBH B;  1ORY A;  3ABT A;  5EGY A;  3U0C A;  3V4G A;  4RGS A;  2JRT A;  4L0Y B;  5KYU A;  4XKB A;  2BL2 A;  4IL6 C;  4OU0 A;  2GXA A;  3JRG A;  3FIW A;  4QPO A;  1G59 A;  4J30 B;  3WAQ A;  4BJ5 A;  3C2H A;  1M2V B;  4JOM A;  2DPD A;  1WGW A;  2B7E A;  3CC7 I;  1AOY A;  2BXZ A;  1ACI A;  5E3O A;  2IM8 A;  5BPD A;  4DZP A;  4NY3 A;  1SVL A;  1ZAO A;  2VH3 A;  5KYN A;  1MND A;  4RAZ A;  1YI2 I;  2VKE A;  1K4T A;  1NBB A;  2L6G A;  3LNM B;  1IN4 A;  3TW7 A;  3DJU B;  2YL7 A;  1E85 A;  2Y75 A;  5HS9 A;  1MKM A;  3V7R A;  2QY9 A;  3IEE A;  2GXG A;  3C7J A;  3JRE A;  4N0B A;  1J8M F;  2YRF A;  1T8I A;  2DMQ A;  1N25 A;  3VOD A;  2CJJ A;  3FXO A;  5GPG B;  1EA3 A;  3KEQ A;  5C4J J;  2XSE A;  9ANT A;  3FXJ A;  3CMM A;  2BEO A;  2EIJ H;  2LYC A;  1SFX A;  2EIJ C;  1ZEL A;  2W4B A;  1SMY F;  4HQE A;  5L0I A;  1V4A A;  1KU2 A;  2VJ5 A;  3KCC A;  2DB4 A;  4CDV A;  2JSC A;  4LFU A;  1E84 A;  1GV5 A;  1ERD A;  4KNY A;  4Z6Y A;  2OU2 A;  3HGY A;  3O8G A;  1STZ A;  3HB9 A;  2XS8 A;  1IXR C;  2WZF A;  3VYT B;  4BS9 A;  5F6F A;  3OOU A;  3CO6 C;  2A5Y B;  4MQV A;  4CS7 A;  4I0B A;  1A35 A;  1S05 A;  1YYJ A;  2NXN B;  3LOC A;  3FK7 A;  5AGF A;  1ZN2 A;  2F5C A;  3D5L A;  4DGW B;  3MKZ A;  2R5Y B;  2ZFU A;  4U5H A;  1A7E A;  4B6I A;  1RKE A;  3GCM A;  2TMV P;  5H2F C;  4MND A;  3RJP A;  3LA7 A;  4Y17 A;  4UHT A;  3DKA A;  1BI0 A;  1D5V A;  1SZI A;  5COF A;  1LDD A;  1APC A;  3HLZ A;  2CMP A;  4E7L A;  1ETV A;  4ENM A;  5EF6 A;  4N4O B;  3POV A;  4JCZ A;  1REP C;  1A04 A;  2OPT A;  1S5L C;  3NYJ A;  3EG9 A;  4I3M A;  4H4K C;  1XCB A;  1K61 A;  1V3F A;  1I50 J;  2VKV A;  3IV5 A;  2EPL X;  1WJC A;  3SFI A;  1ZG1 A;  2DMT A;  3F8F A;  2LBF B;  2XHK A;  1IGN A;  1F43 A;  5CI9 A;  2E2H J;  1VMA A;  3GTL J;  4EQQ A;  4U88 A;  1YAR O;  1U8B A;  3OYF A;  1X19 A;  3L2C A;  3V5Y A;  1BR1 A;  5HVQ C;  2XGE A;  4C7O A;  1V74 B;  4KIC A;  4BJ1 A;  3L09 A;  1LEA A;  2CDQ A;  4KIF A;  1Y56 A;  3J7A Y;  1Z7Q c;  1UHW A;  1U5T A;  2F22 A;  4BL0 B;  2ZXO A;  4ER9 A;  4W8P A;  1NHA A;  5B3S C;  1KA8 A;  2NAZ A;  2Q9C A;  2HUJ A;  5E3L A;  3MKW B;  1TWH A;  1LM3 B;  2WA0 A;  2IBD A;  3GTO J;  5DM7 F;  1WVR A;  2KZG A;  2HSQ A;  2IXP A;  3S28 A;  4RM2 A;  1HXD A;  3J81 Z;  1YE9 A;  1TL8 A;  2ID3 A;  4IHV A;  3DTE A;  5BS6 A;  2CW7 A;  2RQQ A;  3D5R C;  1O3R A;  2YR2 A;  2YU9 J;  1UJ8 A;  2ICW G;  3FM5 A;  1Y4C A;  1JT6 A;  3ABL C;  4JTD B;  1WI9 A;  3K66 A;  3WG7 C;  1N77 A;  1CGO A;  5D5U B;  3A4C A;  3O6X A;  3PO2 J;  1VFC A;  4OMZ A;  1T98 A;  1ZR4 A;  3FXQ A;  2P4W A;  4C2T A;  4PJM A;  5GPA A;  1EV7 A;  3KEY A;  1I3Q J;  1YG2 A;  4BU2 A;  2DA3 A;  4DYQ A;  3H65 A;  2GAQ A;  2QSG X;  1D1C A;  4HV5 A;  3RH3 A;  3ZTM A;  3ERE D;  4IRI A;  4ASN A;  3AQB A;  4Z9J A;  4U5D E;  2R7D A;  1RCP A;  4D4N A;  1XDU A;  4HF2 A;  1NK2 P;  3H9Q A;  4GYG A;  3I4U A;  1ORJ A;  3BTC A;  2OCE A;  1HKQ A;  1BW6 A;  4IHW A;  2QCO A;  3V7O A;  2Q00 A;  2XAS A;  4YFN F;  3C18 A;  4PZJ A;  4D7N A;  2COB A;  1Q0K A;  5M3M J;  2VLA A;  3BPX A;  1JUP A;  4FX0 A;  5K5O A;  3WTX C;  2ZKZ A;  3ASO H;  2LFF A;  3CDH A;  1VYI A;  3ASO C;  4A5N A;  5A6J A;  3LEO A;  3FVY A;  2WB1 N;  2ZXJ A;  3BCA A;  4A3I J;  4BYY A;  1UG0 A;  3EUH C;  2YLD A;  2L0K A;  3L9F A;  5TGT A;  3M1E A;  4PFO A;  2B9S A;  2I5U A;  3RSN A;  1Z3Y A;  3A9C A;  2IP2 A;  2DW4 A;  3MVP A;  1CPR A;  2YS9 A;  2DOE A;  3CCY A;  4A0Z A;  3BZC A;  5IP6 A;  4XIC A;  3QTH A;  1V55 H;  3VAY A;  3M8E A;  3BR5 A;  2DPU A;  3KP4 A;  4O79 A;  4LB5 A;  1FEX A;  2WL8 A;  2AU5 A;  4BJ5 C;  4KIT B;  1IRF A;  2I15 A;  2L7M P;  4XR6 A;  1HW1 A;  1QVX A;  2Q0O A;  1OQC A;  1UCR A;  1DGW Y;  3HTU A;  2JA2 A;  3CCU I;  1ZW3 A;  4MO7 A;  1BC7 C;  2XLV A;  1PJR A;  1MMA A;  1P4A A;  1JUM A;  2KIU A;  3HNK A;  2ZME C;  4CXF A;  1GXP A;  3OSF A;  5HLI A;  1SD7 A;  1G5Z A;  2O9X A;  3DBR B;  2DFH A;  4JX5 A;  2PQ8 A;  1M1E B;  1JAF A;  5TRD A;  2N8G A;  3Q3S A;  4XNF A;  2LRE A;  1QU3 A;  1Z9C A;  3HTS B;  4YWQ A;  1W5T A;  4A2U A;  3CTA A;  4L9N A;  4UV8 A;  3CCS I;  4IKF A;  3NDB B;  1ZHY A;  2OCC H;  3T5X A;  3DE8 A;  2ESN A;  4CCM A;  2M5W A;  2Q9B A;  2L9S A;  1Z05 A;  5E1X A;  3FAJ A;  2H8R A;  2D2W A;  2Z9O A;  4MLO A;  2XGX A;  4EBK A;  1TQG A;  3ZQG A;  1IUY A;  3FXR A;  1R5H A;  1HW2 A;  1VQ9 I;  1YIO A;  4RB2 C;  4OMY A;  1RXQ A;  1X1P A;  1ULY A;  3R6S A;  4OAY A;  2E5Z A;  3JTH A;  2OTL I;  2LD6 A;  3BJA A;  5AIP A;  1RKE B;  3GEH A;  5JLW A;  4KFC A;  1WCM J;  4F7Z A;  1O7F A;  3ZQC A;  2VQG A;  3Q5F A;  4Z2Y A;  5L3G A;  3PUF A;  4PJN A;  1TNS A;  2Y2Z A;  2RV8 A;  4D5C A;  5K7Z A;  5M5Y J;  1JR8 A;  2E36 A;  4XID A;  1MW7 A;  2FXA A;  2NYX A;  4CDY A;  2R02 A;  1A6Q A;  4D0P A;  4P9F A;  4C2U A;  1PDN C;  3EG9 B;  3U2L A;  2P5V A;  4I01 A;  3CDL A;  2MLK A;  4XON A;  4AWX B;  2OKU A;  3RPU D;  3KET A;  3J7A O;  5IYD J;  3U5S A;  1ON1 A;  4YN0 B;  1O4X A;  5L3E A;  1IRX A;  3FZV A;  1OKK A;  2I8D A;  2W00 A;  2IS6 A;  4BGD A;  4C7O B;  1W0T A;  4KIB A;  4FES A;  2IGO A;  1W1W E;  4W97 A;  1KNY A;  3W4Y A;  3MN2 A;  4IOA F;  4IHY A;  1U5T B;  1HDD C;  1EKY A;  2XGD A;  2K4J A;  3GWZ A;  1VQ6 I;  4G6Q A;  2Y48 A;  3HGG A;  1JKR C;  4BEM J;  2TRT A;  1LEB A;  2YVK A;  2Q7R A;  3TO7 A;  3U2R A;  4RD9 A;  2G3K A;  1G4W R;  2QQA A;  3ZIB A;  2LLK A;  3OS1 A;  3N24 A;  2O7O A;  2V1D A;  2DFE A;  4HZF A;  1OJL A;  1FBU A;  3PIP F;  1GUU A;  2K4B A;  3FBI B;  1E3P A;  2VXZ A;  1HA8 A;  4B4C A;  2CV2 A;  2CFO A;  2IEK A;  5B66 C;  4HF0 A;  1GHC A;  4LG3 A;  1GVJ A;  1YRN A;  5CQG A;  1Z7L A;  3K69 A;  3KX2 A;  2IXS A;  2QSH X;  3M8F A;  2JT1 A;  3ECO A;  3AG1 H;  5JVG F;  2E1C A;  2HEO A;  5DTD A;  4XSX F;  2GXB A;  3F8C A;  5LEK A;  5CVR A;  1LS4 A;  4CCL A;  4B3X A;  2XLD A;  4Y52 J;  3OIQ A;  3G1L A;  4L5I A;  1MBF A;  1QVU A;  2R93 J;  3AOU A;  3C63 A;  5JP7 A;  4UUT A;  4RMN A;  3SXM A;  4I99 C;  1GT0 C;  2ZCW A;  1DPU A;  1P92 A;  2HYG D;  3PL8 A;  3HEF A;  4U5B E;  2LDU A;  2F5F A;  2G0E A;  3QOE A;  3FOP A;  4XRM A;  4FWV A;  1Y6I A;  4X0G A;  2D5R B;  3S3M A;  1YX5 A;  4CCN A;  2G7H A;  1JUS A;  4Y7N J;  1C03 A;  3T0Y A;  2VOP A;  2EIK H;  1SVO A;  3RKX A;  3T6J A;  3ZPL A;  1LE8 A;  2QYO A;  4EBJ A;  4XOP A;  4RAY A;  1MMN A;  2EIM C;  1XZQ A;  1WHU A;  3DXJ F;  3M4B A;  3PNY A;  4KYW A;  4NTB A;  1FOY A;  1GVD A;  5J8F A;  2XGC A;  1Z6R A;  4WJ0 A;  1XGO A;  3ROU A;  2D45 A;  4IPA A;  3L1P A;  1LKX A;  2GOM A;  5CVV A;  4JYK A;  4M9X A;  4N6C A;  1AA7 A;  4JVS A;  3C3W A;  4BXF A;  3C2G A;  1D8K A;  3BG6 A;  4LER A;  3OEO A;  4AIJ A;  4X6A J;  2DGJ A;  3JZ0 A;  1SFU A;  4W1U A;  2H27 A;  3KP5 A;  3AKZ A;  5T3T A;  3TQO A;  3ZN1 A;  2OC6 A;  2XAQ A;  2XB0 X;  4WF2 A;  4F92 B;  3D5S C;  2ELJ A;  3CCR I;  3CD6 I;  2CUZ A;  3HOU J;  3H2U A;  2NUP A;  4LB6 B;  5DVW A;  2M30 A;  3NYM A;  4L9V A;  3AJM A;  4ZYH A;  2MD5 A;  4PSW A;  3F72 A;  1LVA A;  1OQY A;  3T8R A;  2F6C A;  2M4E A;  5E3N A;  1TWG J;  1CQT A;  1BOB A;  1Z6T A;  1ITY A;  1H7I A;  1PCX A;  5AON A;  2GA1 A;  1FOW A;  2YPR A;  4FE4 A;  2FJ1 A;  3GBG A;  4YG2 F;  1TWC J;  3KP6 A;  4HST A;  3HRT A;  2VC0 A;  3IRQ A;  3C8G A;  4OIO F;  2HR3 A;  2UXN A;  3I4M J;  2DDB A;  2G9W A;  4L9J A;  1IF1 A;  2CO5 A;  2COM A;  4HSR A;  2JX0 A;  1YYV A;  4J01 A;  2VCA A;  2GIZ A;  4XLC A;  2ZNY A;  3P7N A;  1SYQ A;  1G8X A;  4BXU A;  2JTV A;  1WAS A;  4P5O A;  4U0V A;  3N97 A;  4ABZ A;  4YRV A;  2FNP A;  3IP4 B;  3G71 I;  3BCB A;  3EGX A;  2IW5 A;  1LI5 A;  1OCO C;  4AD9 A;  1JMW A;  5FZT A;  3WGH A;  1LPQ A;  2C6Y A;  2IA2 A;  3HUG A;  1DPR A;  2AS5 F;  5K7H A;  5EDN A;  2EK5 A;  2LC2 A;  2QEX I;  1DDN A;  5ICC A;  3LSJ A;  5ICE A;  3HOW J;  3TBI A;  5LGN A;  3S3N A;  2DU9 A;  1VQO I;  2EBI A;  5J6X A;  2X0L A;  1JJ8 C;  2HVR A;  4BH9 A;  2LD5 A;  3KPH A;  1IG7 A;  2R7V A;  2YEV A;  4EMS A;  2ECB A;  2XAG A;  1BR4 A;  2LQG A;  3QVZ A;  2KKO A;  5H6R A;  3GUD A;  4P6I C;  3U9J A;  3DPU A;  2P7C B;  3QOD A;  2KIS A;  2WB1 A;  4XPY A;  1WJF A;  2QBY B;  2CGE A;  3ZTZ A;  1FYL A;  3GZ6 A;  4PGG A;  4A3B J;  5L3C A;  1YLF A;  2A68 F;  1FY7 A;  1KQ9 A;  1SF8 A;  3MZ8 A;  1W5C C;  2ME0 A;  1YIJ I;  1ST6 A;  2R7R A;  4WXH A;  3ABM C;  1R00 A;  3BOQ A;  3W8I A;  1EA8 A;  3OS2 A;  2WAF A;  3PSI A;  5GAG J;  1AWC A;  1APL C;  3ZQY A;  1IV8 A;  5A2Q K;  2LY9 A;  5LD2 C;  2B0H A;  3GFI A;  3GM2 A;  2OZ6 A;  3O6B B;  2YX4 A;  1JPJ A;  4L5J A;  2XKP A;  3AG4 H;  4JKV A;  3WU0 A;  2I10 A;  2HXI A;  1SVM A;  4KIG A;  2LIG A;  2PX0 A;  4V2F A;  3OOP A;  5F27 A;  5CYV A;  4CYD A;  2QUF A;  3JRB A;  5CJ9 A;  2RKH A;  2FAP B;  3G4X A;  3TED A;  3MYI A;  2DT5 A;  5F64 A;  1VQK I;  4Q4Z F;  1T56 A;  4E7I A;  5EHH A;  2XF7 A;  1YRN B;  3CF2 A;  4KDP A;  2DT7 B;  5EEG A;  3NWS A;  3PJR A;  3S9O A;  5DD8 A;  3AQC A;  3HL2 A;  3JAM K;  2WC2 A;  4FQG A;  3DKX A;  2BGC A;  5J47 A;  2F5V A;  4JW1 A;  3QP6 A;  3LUT B;  2KJC A;  3F8B A;  3X2Q H;  3JSO A;  3NG1 A;  5JRA A;  3X2Q C;  1X2N A;  5IT9 K;  1AUE A;  2LP0 A;  2J9V A;  3LSH A;  2VPL A;  4RB1 A;  2QKL B;  2M7B A;  3TDZ C;  2VUM J;  2XAJ A;  4E0I A;  3K2Z A;  1VYK A;  3QW1 A;  2WVQ A;  2E1O A;  1V5F A;  3GLX A;  2A6T A;  1T2K A;  1RUO A;  3OYH A;  2IXO A;  3PIO F;  1LE8 B;  2KK1 A;  4JX6 A;  2J0W A;  3FHZ A;  3H3Z A;  2DOF A;  1ZU4 A;  4U5F E;  2P1A A;  2HFH A;  3RCO A;  4KA4 A;  1Y39 A;  3JRI A;  2XLE A;  3S1N J;  3S90 A;  1D0Y A;  1RJ9 B;  1RR8 C;  3MFN A;  3X1O A;  4G6T B;  3WE3 A;  2P7V A;  3I5Q A;  2Z15 A;  5CVI A;  1PD1 A;  4A0X A;  2R05 A;  4XBF A;  1OR2 A;  4G94 A;  3VB2 A;  2ZPA A;  5IOZ A;  1A7V A;  4JE9 A;  3CQZ J;  2HU9 A;  5A6B A;  5KYY B;  5BQI A;  3DPL C;  1D0Z A;  2KIM A;  5IP7 J;  3M9A A;  1UG2 A;  1TWA A;  3V5Z A;  2KJB A;  4WXD A;  2XL8 A;  2YLI A;  2DYS H;  3GFL A;  4JP0 A;  4CIP A;  3U1K A;  3T8T A;  2PJR A;  3G1O A;  1Y1V J;  2BBY A;  2B63 J;  4I6Z A;  4P96 A;  3RYR A;  5LGU A;  1R6R A;  2NUP B;  1PP8 F;  2MD0 A;  3E3V A;  5HOO A;  5HNF A;  1VTM P;  4E18 A;  4E6K G;  2PF4 E;  2K85 A;  1OCT C;  2PX3 A;  3PNT A;  1R1T A;  3TOB A;  2VAS A;  1ZG5 A;  4RGU A;  2J7P D;  1TW3 A;  1KYZ A;  5EG0 A;  3ML6 A;  2EIN C;  2HV6 A;  3P9I A;  3SQN A;  3EGD B;  4MQ9 F;  4DRH B;  2A1D D;  3RZD J;  3DCF A;  1MNM C;  1W36 C;  4IB4 A;  3L2W A;  2F2E A;  3RW0 A;  3BG3 A;  2UUI A;  3U9G A;  5C3E J;  4OIP F;  2A6E F;  4PAC A;  3F23 A;  3FK6 A;  2EWN A;  3V8L A;  1X1A A;  4U0Y A;  1OR3 A;  4FE7 A;  1Y1W J;  1QA6 A;  2X51 A;  1H0M A;  2KRF A;  2IA0 A;  1D5Y A;  3EGX B;  2CV1 A;  4I2O A;  4PFP A;  1TT0 A;  4CIC A;  1M57 C;  1WKM A;  1BI1 A;  1ETK A;  5DYM A;  3R61 A;  3HUG B;  1IDZ A;  5D5V B;  3OMY A;  2XPV A;  1RKT A;  2FA5 A;  2OEV A;  4Q7C A;  4KMF A;  4CS9 A;  4OAZ A;  1OMI A;  2V9V A;  4XKC A;  3I9V 2;  4GCV A;  2BY1 A;  1OCZ C;  5BNG A;  1MMD A;  4M9Z A;  2GDC A;  5JLI A;  2LTP A;  1WRJ A;  1XN7 A;  2BVM A;  2CW8 A;  2MWQ A;  3SDB A;  1ZGA A;  1EQ1 A;  4XSZ F;  4UUS A;  5J40 A;  4MVU A;  3LWF A;  5GPC A;  5EEA A;  4IAO A;  3NWT A;  1BC8 C;  1XMA A;  2W57 A;  2X9D A;  1WJA A;  3RQI A;  3CCE I;  2J9U A;  4YK5 A;  4XQF A;  2BVL A;  1V5G A;  1SR2 A;  3CLO A;  2O03 A;  2PJP A;  5L3V A;  2ZJ2 A;  4G12 A;  3ZRG A;  1QHG A;  5A69 A;  4FTH A;  1V5E A;  1FTZ A;  4U9D A;  3TUL A;  4RB0 A;  2YWA A;  1R22 A;  1WPK A;  4MTF A;  1UHM A;  4GGG A;  1I1G A;  5D5W B;  1YZA A;  3OYG A;  3QMK A;  4UXN A;  2OEX A;  3E6C C;  3WTS C;  4NUB A;  4AIH A;  4HDV A;  1TQP A;  2W9Y A;  4GQH A;  4X1E A;  4HX4 A;  3WU2 C;  2W24 A;  1FP1 D;  3DWL E;  5L3Q A;  2DTR A;  1HKS A;  2OJQ A;  3IHU A;  3AG2 H;  2QKM B;  3CO7 C;  4M72 A;  3JAM Z;  3S84 A;  3U8P A;  3BRO A;  2MW8 A;  1U6H A;  1O57 A;  1R5G A;  2JWT A;  2WVO A;  3CSK A;  4EVI A;  1YA9 A;  2OG2 A;  3KZY A;  5IT9 Z;  4HFK B;  2R0Q C;  2J5P A;  1H89 C;  4V2G A;  3DEW A;  3QPH A;  2JK3 A;  3NAR A;  3GX4 X;  1DUX C;  2DYR C;  3M15 A;  3DD7 A;  4ULW A;  4CJO A;  5E17 F;  3FDY A;  4I02 A;  4I98 B;  4I1M A;  5EJC A;  4BKX A;  2DCE A;  3I64 A;  1O3Q A;  1SFE A;  2VKD A;  2R7S A;  3B73 A;  1YVI A;  2P61 A;  2R25 A;  3CJT B;  2FSW A;  2PBE A;  3LNQ A;  4HV6 A;  2J9B A;  3FXM A;  3IRR A;  2Q4F A;  1XS9 A;  4Z9H A;  5A6K A;  3BR0 A;  3ZDL A;  2IPQ X;  3F8N A;  2RRE A;  3EYI A;  1FT9 A;  3OWT A;  2NSF A;  1RUN A;  2WAQ N;  1R4N B;  2K3P A;  1TKN A;  3QQA A;  3ECS A;  3KYC B;  4ESB A;  4JTA B;  5FKN A;  2GWR A;  2O0Y A;  4UVC A;  1FOX A;  4BJT A;  1W4M A;  2XXA B;  3OYI A;  2O9L A;  2BXY A;  2FML A;  4UB8 C;  2VKH A;  5M3F J;  4HBL A;  2L4A A;  3ZG1 A;  4NC7 A;  4A3D J;  1HF0 A;  2KHM A;  4G78 A;  4RB3 C;  3TP3 A;  5FRN A;  3CCJ I;  1SFK A;  2P7V B;  2LSE A;  4RLF A;  1Z5Z A;  2DA6 A;  3ZR8 X;  2XL4 A;  2VI6 A;  2K9L A;  1KYW A;  4A12 A;  4ETS A;  2IBF A;  2L3D A;  3FAP B;  2LF8 A;  4ITV A;  3UR3 C;  3VSL A;  1FFT C;  1B8I A;  2NVY J;  1NSG B;  2WAE A;  3EZI A;  4OD4 A;  4BBR J;  3ISP A;  1QVT A;  2RNG A;  2PJR B;  3CP8 A;  2VBY A;  2V6E A;  1OR7 C;  1R23 A;  3WHC A;  2KMU A;  2BOL A;  3VEP A;  3WGG A;  4NDL A;  2NS8 A;  3FKI J;  2CQQ A;  3ZWI A;  3PQK A;  3O2P E;  2ADU A;  4XRS A;  2EV6 A;  2M8E A;  2Y0S N;  1IRZ A;  3OYN A;  3Q7G A;  3LES A;  1J7K A;  2QQB A;  4DNC A;  1MBE A;  5EG0 B;  2IRF G;  3ABK H;  2F48 A;  1QLE C;  3HBL A;  4BG0 A;  1Z1D A;  3DU5 A;  1K83 J;  4QPQ A;  3P5J A;  3CJR B;  2ACJ A;  1C02 A;  3GZ5 A;  2R7T A;  2AP3 A;  1FNN A;  3EPV A;  3H0G J;  1LFB A;  5BOX A;  1TC3 C;  3B0P A;  5M5W J;  1ZG3 A;  1LE2 A;  2FE3 A;  4LJZ F;  4DQ2 A;  1CGP A;  2FMY A;  3E5X A;  3KZI C;  3ZQL A;  2LR8 A;  2Z33 A;  3C2B A;  4ZTJ A;  2DMP A;  3RQ4 A;  3TOM A;  2EPM X;  1OIS A;  2RN7 A;  1JTY A;  2A3S A;  1KQ0 A;  3VRC A;  4R8H A;  1YIT I;  3FIS A;  3FOO A;  2MH2 A;  4PJL A;  1RKC A;  1VK5 A;  1YJG A;  2W4S A;  3FX3 A;  4IAQ A;  1JT0 A;  4AL0 A;  4B1R A;  1S7A A;  1LS1 A;  1XDS A;  2B0L A;  4XL9 A;  1MD0 A;  3E5Q A;  2R92 J;  2EZL A;  4JQF A;  5HDN A;  3H3V K;  2QLA A;  5F0H A;  1BW5 A;  1UZC A;  5D8K B;  1KU3 A;  3RI4 A;  5C4X J;  2HPM A;  4CX9 A;  3S17 J;  5LRS A;  3B6A A;  1NFO A;  3WTT C;  2BHZ A;  5BPI A;  2KYH A;  4E7H A;  1IO2 A;  5F1J A;  2FX0 A;  1UG7 A;  4C3H J;  3EFO A;  3W2V A;  4CS9 C;  2MBF A;  4UUS B;  5FLX Z;  4U5G A;  2L9V A;  4YL1 A;  3TL4 X;  2XLO A;  3FF5 A;  3IAS 2;  2DI3 A;  3CDI A;  4A6D A;  3HOX J;  1F1M A;  4HA8 A;  1X2M A;  2DQR A;  4MTD A;  3R7C A;  1WJB A;  3DBL B;  1AEP A;  1HBX G;  1J5Y A;  3VYR B;  3DM9 B;  3BR2 A;  2CG4 A;  3VYU B;  2FF4 A;  3A0H C;  3BQY A;  3G73 A;  4J19 A;  1RMV A;  3HKK A;  2E60 A;  3BTL A;  4HQM A;  3K1N A;  2MSY A;  2RGV A;  2HJM A;  3E9V A;  1FPQ A;  2GZW A;  4CS8 C;  1QRY A;  4AVZ A;  4F4B A;  5CPR B;  4QTR A;  3F21 A;  4ZJZ A;  4HNV A;  2YL3 A;  3GWL A;  5KCM A;  4N9I A;  5E1Z B;  1VLS A;  3ZQV A;  1XC5 A;  4V19 K;  1XCV A;  5JFR A;  4E70 A;  5CQE A;  4BQQ A;  4P1W A;  3WE2 A;  1NZE A;  4NC8 A;  3ZQI A;  1ETX A;  5IPA A;  1U6G A;  4IRG A;  5HLH A;  3W8H A;  3UNG C;  5HDK A;  2BY0 A;  4CSA C;  2H6C A;  4EIY A;  4U7D A;  3W6V A;  2W45 A;  3QAH A;  2H94 A;  3CME I;  3S1R J;  4G6D A;  3NMI A;  1R58 A;  2E1M B;  3LAY A;  2HDW A;  2WBM A;  3D0S A;  1XX5 A;  1TWF J;  1SAX A;  3AG3 H;  1MBG A;  1S9H A;  2ZXI A;  1EH7 A;  3R0J A;  3REO A;  3TQN A;  1E0E A;  2M64 A;  4HAM A;  1BBY A;  3G50 A;  2Q1Z B;  1A36 A;  3ATP A;  4IJJ A;  4S05 A;  2IGK A;  5T3W A;  3CC4 I;  1OKK D;  2QQ9 A;  4IO9 F;  1E17 A;  2XF5 A;  5F5H A;  2QLZ A;  4Y15 A;  2IXN A;  2WVN A;  1PD0 A;  2CH0 A;  3LFU A;  3G3Z A;  1YW8 A;  2D4U A;  3GEI A;  1V55 C;  4ZC3 A;  3EZH A;  2XSJ C;  3IH3 A;  4ZDO A;  4U87 A;  5L0H A;  2Q2E A;  1QPU A;  4FET A;  2G3V A;  1ETO A;  4BEH A;  1FTS A;  4M6V A;  2YSR A;  4CDA A;  2BYV E;  2ECC A;  5HV9 A;  2ZXW H;  2D1H A;  4MTE A;  4XM3 A;  4DJA A;  4LDK A;  3MEX A;  2DDA A;  3EPZ A;  3K10 A;  4AID A;  2BE5 F;  1KQ8 A;  1GM5 A;  1IJW C;  2L81 A;  1VLT A;  3J7Z I;  1LE4 A;  3F47 A;  2F5E A;  4HX8 A;  4MNU A;  3RVY A;  3N0T A;  2XRO A;  3JYH A;  3TOL A;  1LFP A;  1B8I B;  1JPN A;  2X1D A;  5DQZ A;  2DA4 A;  1TQM A;  2P0N A;  2VBX A;  5BMZ A;  3O10 A;  2PMZ N;  4U7B A;  2HSB A;  3K4C A;  1I39 A;  5E8I A;  3GEE A;  1W7P D;  1MJB A;  4M3G A;  2OCC C;  2XAU A;  3IWF A;  3W2A A;  1HKT A;  3G2B A;  2E2J J;  2L54 A;  4OWR B;  4MVS A;  3QYE A;  3ZSU A;  1P7J A;  3MAJ A;  1QGP A;  2IYL D;  4AK9 A;  4O7G A;  2XPU A;  3KZZ A;  4LLC A;  5IOY A;  1Y0N A;  4N9H A;  1WI3 A;  3WGI A;  1U89 A;  2D1V A;  1G4D A;  2JD3 A;  4LDR A;  3R2P A;  2R03 A;  4ZDL A;  3KP2 A;  1TT5 B;  3B02 A;  4U9E A;  5E33 A;  4A93 J;  3A03 A;  2K9M A;  4RS8 A;  3DKW A;  2Y31 A;  4A0Y A;  3T6G B;  4J7Y A;  3F46 A;  2ZB9 A;  2FOK A;  3GFJ A;  4OIR F;  5DLJ A;  1S7O A;  4M9S A;  3DTK A;  3L2V A;  4YL0 A;  4UVB A;  1OW8 A;  3L2Q A;  5B1A H;  3PDM P;  4D1Q A;  1EI7 A;  2ESH A;  2MA3 A;  5B1A C;  1MSE C;  4N4N B;  1XSV A;  3HPH A;  1SAN A;  2ZXP A;  2JSP A;  4L0Z B;  2QBY A;  2BZT A;  1HOM A;  3MX3 A;  4XEF A;  3JRA A;  2V1U A;  2JZY A;  2EFP A;  1GS9 A;  3TGN A;  1EH6 A;  1IN5 A;  3ZMS A;  4JRZ A;  4CZZ A;  1UMQ A;  3K4N A;  2P81 A;  5GP9 A;  4A3L J;  1SD6 A;  3DM5 A;  2WAQ A;  1R4T A;  4ZYG A;  2DT6 A;  2F5D A;  2Z16 A;  2A05 A;  4M3E A;  1QBJ A;  4JX4 A;  1BL0 A;  4DZJ A;  1P2F A;  3NKD A;  1JKQ C;  3MYF A;  2J9W A;  2ZFW A;  3DF8 A;  1Q1V A;  4XRS G;  5DD4 A;  1FIA A;  2NUT A;  2JA6 J;  1IN8 A;  1A0B A;  2MGQ A;  4KNW A;  2KRC A;  4B8X A;  1R71 A;  3EFO B;  4DVZ A;  1W36 D;  2J45 A;  1FYK A;  3L00 A;  3RDI A;  5JVT A;  3K7D A;  4LLG F;  1ZRD A;  3V5X A;  1FC3 A;  1U5T C;  2ZJR F;  3IQ6 A;  5TJ5 E;  4ZZD A;  2PMU A;  3R4K A;  2VON A;  2NVU B;  5EK0 A;  1IW7 F;  2VT3 A;  3RZO J;  3US6 A;  2K9S A;  3H5N A;  2KZV A;  2QGU A;  3QPS A;  4U0W A;  3L2U A;  1O7L A;  1WJ5 A;  2QVO A;  3GLL A;  3C8G D;  3LMM A;  3ZCO A;  4AX2 A;  2I8B A;  3WTW C;  2XVC A;  2AVK A;  3BT9 A;  5CIV A;  4BHP A;  3NMJ A;  3AG1 C;  3HOS A;  1JHF A;  1JGS A;  2CUF A;  5K5R A;  5EEH A;  2CQX A;  1VQ4 I;  2XM0 A;  3A11 A;  1S29 A;  3PNV A;  3LA3 A;  1MJA A;  2BHY A;  3PSF A;  1E3H A;  2Y0S A;  3SHF A;  3PFY A;  4C3I J;  1UST A;  3MKL A;  4WCG A;  3CCL I;  1VI0 A;  1R1V A;  4EM0 B;  1I5N A;  2IA1 A;  2KSF A;  2KIQ A;  3A02 A;  2WV0 A;  3EET A;  2XAF A;  3FKJ A;  3LQQ A;  1RNL A;  3TO6 A;  1YS6 A;  1B6A A;  3WTU C;  1H8A C;  2FGY A;  2VB6 A;  5LFA A;  1WH5 A;  2EIK C;  1VND A;  2VCB A;  5LBQ A;  4E7K A;  3DKY A;  2XF6 A;  4AU7 A;  1NH3 A;  1XGN A;  1BDJ B;  2GA0 A;  1RKW A;  5B3I A;  1BN5 A;  3W3C A;  2OTJ I;  2OBP A;  4I76 A;  4FAS D;  4UB6 C;  4D7M A;  1HDP A;  2XS1 A;  4N4W A;  4BE2 A;  1RJ9 A;  1TFK B;  2KC3 A;  5ERI A;  3F9K A;  3L2R A;  4Y13 A;  1IN6 A;  5IYB J;  3VOE A;  1VQ8 I;  4YEL A;  3DE9 A;  2QWW A;  1HC8 A;  3K4L A;  3FXH A;  3LSI A;  2K40 A;  1BR2 A;  1C17 M;  4L6R A;  4NNJ A;  2W25 A;  3A2K A;  4LIT A;  3QYF A;  5JI6 A;  3D1N I;  5KYY A;  2E71 A;  2L01 A;  2CW0 F;  4KC9 A;  1VQ5 I;  3G6E I;  3OSG A;  1AU7 A;  2EFN A;  2V26 A;  3WU1 B;  2VE9 A;  1SC7 A;  3G4S I;  2BW3 A;  1SD4 A;  2X6Y A;  3E1S A;  3I5U A;  5J3L A;  5H6Q A;  2ELK A;  2H8W A;  4JUR I;  2M8G X;  2RC4 A;  1FBQ A;  2HQ5 A;  3OIP A;  5DS5 A;  4IQ4 A;  4M3B A;  2HTS A;  2Q2E B;  3IKT A;  3CZ6 A;  1QPM A;  2P5L C;  4JTC B;  4XPW A;  4BDY A;  4BEH B;  3OA1 A;  1U0J A;  3K4M A;  2Y3B A;  2LVS A;  4LIV A;  3ZMU A;  2A0U A;  2PN6 A;  5LHG A;  3RYP A;  1J9I A;  2P0W A;  3QWL A;  3W6K B;  1C0W A;  4NTF A;  2JVH A;  2OQM A;  3EGD A;  5JVE A;  5IT3 A;  1YYX A;  3H0D A;  2P6V A;  4JEA A;  4JCH A;  4MS2 A;  1ZZP A;  5F0C A;  4XEV A;  2HXO A;  4CCK A;  5K5Q A;  2AWC A;  2ASR A;  3ZMT A;  1Q0M A;  1ODD A;  1V54 H;  2ID6 A;  1MBJ A;  2DMN A;  1OXK A;  3M79 A;  1V54 C;  2YZS A;  5FO5 A;  2R7X A;  1DP3 A;  3TMO A;  4L18 B;  3WOD F;  1L3P A;  2YHS A;  1H88 C;  2JPC A;  4XLA A;  5DCF A;  2RQP A;  4HYE A;  3HDD A;  5ILV A;  5FKO A;  3S15 J;  3MKY B;  1IZ1 A;  2V4J C;  5FFZ A;  1J0R A;  3M3Y J;  4KN7 X;  1TWG A;  2KQ9 A;  2YKZ A;  1ON2 A;  2LKP A;  3BZ6 A;  5FJ8 J;  1YAU O;  2HWV A;  3S3O A;  2B0J A;  3FHD A;  5L0C A;  3FMS A;  1ZW2 A;  1EF4 A;  3VSK A;  2L7K A;  1TWC A;  4G8X A;  1OCC H;  5DS9 A;  4CJG A;  3GVA A;  4Q5S F;  5JUA A;  5FKK A;  3EJN A;  3HG9 A;  1OLT A;  1LIH A;  3OIO A;  2NNN A;  4GYI A;  2XLW A;  2KRH A;  1JHH A;  3Q9S A;  2LH9 A;  4O6M A;  4A3F J;  4PSX A;  4BAC A;  1ENH A;  1ZQ3 P;  3GO5 A;  5CKT A;  2Y30 A;  2LF7 A;  3PUB A;  2YLG A;  1BJZ A;  2K9Q A;  3FHN A;  2Q9A A;  4HOB A;  1Z77 A;  3SFZ A;  2QEN A;  3SZG A;  4BE0 A;  1T33 A;  3JR9 A;  1Y6D A;  1FBS A;  1YDI A;  3NKE A;  2CUE A;  2BV6 A;  5FLV A;  5IYC J;  3LS0 A;  1D0X A;  1GV2 A;  3E6B A;  1ETY A;  4YEJ A;  3FXU A;  5H20 A;  4CCO A;  3LSP A;  5A6B D;  2KL4 A;  3WTZ A;  3SEQ A;  2FNA A;  2R7O A;  1RI7 A;  2QA4 I;  2L9N A;  1XGS A;  2L6H A;  3EDP A;  3H9J A;  3Q9V A;  4MEY F;  2A6H F;  2CU7 A;  1B59 A;  4YII A;  1B9M A;  4ZTF A;  4FX4 A;  1DQU A;  3V8K A;  2IGN A;  2WV1 A;  3DP7 A;  1T9K A;  5FFX A;  2ZO4 A;  2NUT B;  3QP5 A;  5D91 A;  3O39 A;  2E7X A;  1QSP A;  3GWN A;  2DA2 A;  3S1M J;  3OYJ A;  3DI5 A;  3IQT A;  5HLT A;  3TJ5 A;  2LK2 A;  1TLH B;  1PVE A;  2DOD A;  3IC7 A;  4F91 B;  4J00 A;  1G3T A;  2FBI A;  4PDK A;  2MHR A;  3AG4 C;  1FWZ A;  3SEZ A;  1HW5 A;  3RYL A;  4GO1 A;  3JRM O;  4FIS A;  2DA5 A;  2FD5 A;  2NOG A;  1R36 A;  1S8N A;  1A41 A;  1N75 A;  3F8M A;  1LUJ B;  2PBI A;  3JRT A;  4BEJ A;  3RPQ A;  4YT4 A;  4QDL A;  5KYX B;  1A6I A;  1OPC A;  1USS A;  3EH1 A;  2HQR A;  2NOJ B;  2XDV A;  4LD5 A;  3M4C A;  2PMZ A;  5F5F A;  3CEX A;  1U78 A;  3LSG A;  2FFH A;  2K27 A;  4CUG A;  3SYN A;  4IEJ A;  2HMZ A;  2LMD A;  2LY1 A;  3OYD A;  2BY3 A;  3KEO A;  1YZC A;  4OD5 A;  3VF0 A;  1MZB A;  2Z3Y A;  1KZH A;  5K1Y A;  4A6E A;  2HOA A;  4IGG A;  3IQC A;  3TJ6 A;  4AM3 A;  2E7W A;  2XRL A;  1O87 A;  3UMI A;  3J06 A;  1B68 A;  4JEB A;  5DUK A;  1KU9 A;  3CUQ B;  1DOV A;  1WN0 A;  256B A;  2XM4 A;  2XXA A;  4UUV A;  2HYJ A;  3UKG A;  2DJN A;  1PUF A;  1VQM I;  2EFW A;  3JYY A;  5DS4 A;  3GF2 A;  3F3X A;  3LSK A;  4EGY A;  1E2X A;  4LK1 F;  4QSH A;  1GDT A;  1CGM E;  3ZN0 A;  2X48 A;  4HEA J;  2A0B A;  2R5Z B;  2EB7 A;  4CCJ A;  2OQR A;  3FMR A;  3RFY A;  2R9R B;  1R1U A;  2X85 A;  2V1X A;  1R49 A;  5LHI A;  2AHQ A;  2DBB A;  3CC2 I;  5LGT A;  4O5V A;  2LNB A;  4YL3 A;  4WX9 A;  3HM5 A;  1Z91 A;  5HSW A;  1J59 A;  2PMH A;  3VYS B;  1YO5 C;  3S27 A;  4BHB A;  3O3K A;  4NQW A;  2DMU A;  1D1A A;  2HDD A;  4CZC A;  3ZP5 A;  2DYS C;  2MC3 A;  2BW3 B;  5K7F A;  3RKW A;  4BUP A;  1R4M B;  5J1R A;  3BJ6 A;  2L9J A;  2M0M A;  5FGM A;  1IV6 A;  2JN6 A;  4RAF A;  2EZH A;  2HVS A;  3ABU A;  3SYT A;  3GXO A;  5DUI A;  3JSZ A;  4XK4 A;  2CNW D;  3ERM A;  1ZH5 A;  3BPV A;  3IAM 2;  1G2H A;  1IN7 A;  3U9M A;  1XWJ A;  2R7Z J;  2DXI A;  2MC4 A;  1BM9 A;  3CQZ A;  3IKV A;  3B6C A;  4A5M A;  2J46 A;  4ENK A;  5DS6 A;  3HOY J;  4NQF A;  2OV7 A;  1Z21 A;  1BA5 A;  3I0T A;  4Y4R A;  1ZR2 A;  3GYH X;  1H6G A;  1ZGW A;  1B9N A;  4FHT A;  1JKO C;  1HCR A;  3OR2 C;  4KN4 X;  2LKS A;  2VOO A;  3MMY B;  3ZQ7 A;  3RKQ A;  4O3M A;  1S3J A;  3HSF A;  2YL1 A;  3DAG A;  4MVZ A;  4XEK A;  2JPU A;  1TW2 A;  3GTK J;  3K6B A;  1S7E A;  3I56 I;  2X6O A;  2EPO A;  1UAA A;  3ZMD A;  5DDG A;  4CHU A;  2OU6 A;  5EGO B;  3VWB A;  3U21 A;  4X0R A;  5ILS A;  3WG9 A;  1SMT A;  2Y3H A;  4J7T A;  5JSL A;  3DEE A;  1VQ7 I;  1FAP B;  3GOR A;  2LOO A;  2FEZ A;  1WSU A;  2KT0 A;  2LFB A;  4JBA A;  3SJM A;  2NVT J;  3AFH A;  1S72 I;  4IRH A;  3PO3 J;  5E20 A;  5EZG A;  1WWP A;  2X0C A;  3DLL F;  3FBN B;  1BJA A;  1RC9 A;  5E3M A;  4KI2 A;  3B9Q A;  5FD5 A;  1WAT A;  2O5R A;  2OF7 A;  2X4H A;  4Q48 A;  1DU0 A;  3RVZ A;  1R5I D;  3P9C A;  3CCV I;  2K02 A;  1J2X A;  3FXK A;  2EPN A;  1MDM A;  1XD7 A;  2DK5 A;  2NPU A;  4PJ0 C;  5HDG A;  3DEU A;  5DM6 F;  5A2Q Z;  3L34 A;  5L3B A;  3KLN A;  5KYW A;  2ETH A;  1IC8 A;  2HKO A;  1FOK A;  2O8X A;  1QZE A;  1SAU A;  2QQ8 A;  1T01 A;  2HV7 A;  1F4K A;  1WOL A;  4ONS A;  5J4Y A;  3NYL A;  2V6C A;  1IXC A;  1VZ0 A;  2E2I J;  2K3F A;  4A3K J;  5COG A;  4AL1 A;  3HSE A;  3NAU A;  2VOD A;  2QTV A;  3E70 C;  2TDX A;  5KNL A;  2JQ7 A;  2HJ3 A;  3LL7 A;  1OW7 A;  3B71 A;  3I54 A;  3LLI A;  2V9K A;  4OIN F;  4MIM A;  3DLA A;  4FT8 A;  4YT5 A;  4P9T A;  4IJA A;  1OCP A;  4BQN A;  3AG2 C;  1I4Z A;  2AWY A;  1PV3 A;  2J0X A;  1FIP A;  2PEX A;  5LEJ A;  1ZRF A;  4LLE A;  2XLM A;  1JGG A;  4JZA A;  2LFD A;  2W84 A;  3HNI A;  1EJ9 A;  3K6G A;  2YU3 A;  1FMV A;  3MFK A;  3RKY A;  4YT8 A;  3OL4 A;  2CSO A;  2GOX B;  3K9T A;  1HMO A;  3J81 K;  1FNT c;  4LLN A;  4JK1 X;  3K1M A;  2J5O A;  3OL3 A;  5E1W A;  2DQL A;  4ZYA A;  2WZL A;  1LDK B;  2X1C A;  3ONQ A;  3SXZ A;  4C3E A;  2Q3T A;  1HE9 A;  4I44 A;  3W2W A;  3ECH A;  1OFC X;  2EJR A;  3LJB A;  3QZC A;  1YHQ I;  1JXS A;  3K4J A;  2UV1 A;  3OS0 A;  4G7Z F;  1F9N A;  1Z7U A;  2K5C A;  2HYF A;  2XAH A;  4BHC A;  4IAR A;  2M1B A;  5HLG A;  1GXQ A;  1YW7 A;  2Y69 H;  3EH2 A;  2GWW A;  2LRD A;  1PUF B;  2GFH A;  4YJW A;  2Y69 C;  2CRG A;  3H36 A;  1FR0 A;  1MJ9 A;  4A3G J;  5HNH A;  3H5R A;  3H3U A;  5JHF A;  1QO0 D;  4EJO A;  1JTX A;  3BR3 A;  2P8T A;  1WJE A;  1YOV B;  2JRM A;  2VQH A;  4IOC F;  1ZHZ A;  2EA4 A;  1B1B A;  1DGR M;  2XIG A;  2PFD A;  3QOP A;  4XTK A;  4WGZ A;  5GAD J;  5F08 A;  3ZOB A;  3EUK L;  3MZH A;  1V4R A;  4XN0 A;  5FKL A;  2OD5 A;  1ZYR F;  4MTG A;  4NQW B;  3JRH A;  2ME6 A;  3AAF A;  2ZME A;  3Q0U A;  1L7C A;  4PUS A;  2Y3D A;  1LJ9 A;  2VC9 A;  1FSH A;  1XMX A;  4TV7 A;  3J80 K;  2M3A A;  1OXB A;  2M34 A;  5J8C A;  3HZJ A;  1WQ2 A;  2AO9 A;  3DFG A;  2ZNZ A;  5LRR A;  3KP7 A;  2ELH A;  2HQA A;  4RLQ A;  1J09 A;  2QNL A;  3GTJ J;  5L0J A;  4F52 A;  5BQH A;  3OV8 A;  4HF1 A;  4IRU A;  2M87 A;  3LAJ A;  3MLG A;  1ZHF A;  4C3D A;  4XLH A;  3ABK C;  5L3F A;  3CLQ A;  4LK0 F;  4C9Y A;  1P9Q C;  2QZ8 A;  1O3T A;  4DXW A;  2FUG 2;  3EUA A;  5KVR A;  4EJT A;  2VQL A;  3LNR A;  1W0U A;  3S0X A;  4Y3O A;  2XRH A;  2YL0 A;  1CF7 A;  1T6Q A;  2F4I A;  4NBQ A;  3CMY A;  2JA8 J;  2HPI A;  2UUZ A;  5D6E A;  4E7Z A;  4HX7 A;  2RSE B;  2DTZ A;  1XB4 A;  4B3A A;  2DFI A;  1NU7 D;  2JA5 J;  4DYR A;  1I6X A;  3TP0 A;  3DV8 A;  1HMD A;  2XB5 A;  2ETS A;  2E34 A;  2GBY A;  3BP8 A;  2FQ3 A;  2V1N A;  5E18 F;  1YJN I;  2KW3 C;  3V7S A;  2GM4 A;  3KH2 A;  3KP3 A;  3L8J A;  1ONV A;  2L7F P;  1MMG A;  2M0C A;  4EJV A;  1QKR A;  1RET A;  2J8W A;  1Y8Q B;  5ICF A;  2WAD A;  1MSF C;  2ZD9 A;  2DA1 A;  5GTI C;  1EKE A;  2QUP A;  1FP2 A;  4KIS A;  1KON A;  5L3D A;  3U3F A;  1X4P A;  4IXA A;  5FCL A;  4QLC U;  2LP4 A;  2JA7 J;  4C3B A;  3OR1 C;  5JS5 A;  5L0D A;  4EBB A;  3DWW A;  1X1D A;  4G7H F;  1JE8 A;  4MW3 A;  3NRV A;  2VE8 A;  1X3Z B;  2LG4 A;  3FMQ A;  2BC5 A;  2D5V A;  1ZTR A;  1TWH J;  1Z0X A;  2EFO A;  3KYD B;  2JVG A;  4KUM A;  1YX3 A;  4B48 A;  4BAY A;  3CF5 F;  4MVO A;  1MDM B;  5FKM A;  2KFD A;  2CQN A;  1UEL B;  4ZH4 F;  1B72 A;  4UY8 I;  3BZK A;  1SD5 A;  4IWB A;  4XPX A;  4W8K A;  4CIH A;  4L5E A;  5KYW B;  2WY8 Q;  3EHN A;  4PGH A;  5FRM A;  5GTH C;  1E83 A;  3QW0 A;  4MGR A;  1LNW A;  5J1U A;  2HTJ A;  1AVO B;  4LMY A;  1TR2 A;  1XMK A;  3WTY C;  1G3Y A;  2VJI A;  3HJE A;  2KGO A;  5B3S H;  4PJJ A;  1I6H J;  2FQ4 A;  3S8P A;  4E17 A;  4IF4 A;  2MLG A;  2LCH A;  2XV4 S;  1VQN I;  3RTR A;  4CA0 A;  1ORS C;  1O5H A;  4GYT A;  4YIF A;  3T9O A;  3WTV C;  2QE9 A;  3HHH A;  4M74 A;  1ZHT A;  5DQT A;  2UUH A;  1QPI A;  4A2N B;  5KHD A;  3GM1 A;  3KYJ A;  4O6N A;  3DZA A;  5HS8 A;  4KMU X;  5ILU A;  2X6X A;  2Y0M A;  3ABL H;  2MH9 A;  1MNE A;  1Z67 A;  3WG7 H;  3BR1 A;  5F0F A;  3RIP A;  4EWC A;  4RDA A;  2DOA A;  1VOM A;  5COM A;  2QF7 A;  4ENJ A;  1X3W B;  2LKX A;  1VQP I;  1Q0D A;  3F6V A;  3IPM O;  2K7L A;  2OAZ A;  3HHG A;  4DJ9 A;  1OCR H;  2LK4 A;  2C03 A;  3CES A;  2STW A;  3E7L A;  4MW8 A;  4F93 B;  1OCR C;  4B43 A;  2IVM A;  3A1Y A;  3OYK A;  3CCM I;  3KFW X;  2NG1 A;  2OUM A;  3AG3 C;  1TFO B;  5AC4 A;  6PAX A;  3IL2 A;  2E1M C;  2VL8 A;  3BWG A;  5D5X B;  3IQ5 A;  4DIQ A;  2MAB A;  3JW4 A;  5J1Y A;  3RQF A;  2IJL A;  2VBZ A;  4LG0 A;  3EYY A;  1JI8 A;  1GLN A;  2VQC A;  3LFK A;  1U9N A;  1I3A A;  3CJQ B;  2H6B A;  4S0H B;  4DOZ A;  1XSD A;  1WGX A;  3CUO A;  3HKZ N;  3SXK A;  2PG4 A;  4UVA A;  4KT6 A;  3QU6 A;  4LGW A;  2IOQ A;  2ZSI B;  5F04 A;  3K70 C;  4AYB N;  2O8K A;  2MYS A;  1JRA A;  3GTQ J;  1T0F A;  3VYW A;  4MVM A;  2M2E A;  5KYU B;  4K0D A;  1KGS A;  2E35 A;  2HOS A;  3B0U X;  2ZXW C;  1LFU P;  2FBK A;  3ESW B;  3TK0 A;  1VF9 A;  3J80 Z;  2DO7 A;  3KYI A;  2ZSH B;  2M4G A;  4XQ1 A;  1NTC A;  1TTY A;  2DK8 A;  5JT4 A;  4I0A A;  4XKV A;  4JJG A;  3N2Z B;  2V9P A;  1UHS A;  3JRD A;  5KAI C;  4YFX F;  3AGU A;  3M07 A;  4EM2 A;  2QSF X;  4NHJ A;  4BDZ A;  2G7U A;  2HVQ A;  1PP7 U;  5TJJ A;  4MFD A;  1L3L A;  4M3D A;  2IS1 A;  3C1D A;  2UWM A;  3JTL O;  5DCM A;  2ZME B;  3RQE A;  3ZGK A;  3F6O A;  3SNH A;  2A5W A;  4PCQ A;  3MCZ A;  4ESF A;  3F0C A;  2AXL A;  3CMA I;  3AL0 B;  5K0I A;  3IH4 A;  3MWM A;  1G3W A;  1K4S A;  4O6Y A;  4BPM A;  1DU6 A;  3P9K A;  4R32 A;  1P4X A;  1R7J A;  1X3U A;  4N6H A;  2TCT A;  2M4K A;  1LPE A;  2XC7 A;  3JSE O;  2KQR A;  4DBQ A;  2CCY A;  4EJU A;  3ZMV A;  2PNO A;  1K6O A;  3I59 A;  3AL0 C;  2CQK A;  2HI3 A;  3ZQQ A;  3DTI A;  3EQL F;  4RM3 A;  3UMK A;  1LDJ A;  4Y33 A;  1NG7 A;  4HW0 A;  3L1M A;  4BJ6 A;  2CYY A;  5J4V A;  3N05 A;  4E0H A;  1IDY A;  1MMS A;  4II3 A;  1WWX A;  4IVN A;  3HTK C;  4BXX J;  1DOW A;  4JIO A;  1B4A A;  1CF7 B;  2NS0 A;  3V42 A;  2L4M A;  2VPR A;  2Z2S B;  3M1C A;  4AVP A;  1G6N A;  2NSG A;  3DMD A;  4KBL A;  4S04 A;  4DRJ B;  4K1O A;  3HYI A;  2IS2 A;  2VCC A;  1XSX A;  2M7A A;  5D4S A;  2UXX A;  5L0G A;  4DVY P;  1ETW A;  1ZGJ A;  3K7A J;  2DJI A;  3O8H A;  3MZY A;  2Q8K A;  1M6T A;  2W1O A;  4R1H A;  4LLL A;  2CGP A;  4GRI A;  1ZAR A;  1Q1H A;  5D8L B;  2Z1D A;  3AGT A;  1RR7 A;  2L02 A;  2UZK A;  1CPQ A;  1YLM A;  3DPT A;  3HSR A;  3I3L A;  4YFK F;  3OYL A;  4MFE A;  4E4H A;  3E6M A;  4II2 A;  1X1C A;  1ZK8 A;  4CDG A;  4EAT A;  5HOD A;  1ZHX A;  3KL4 A;  4LOC A;  4MHG A;  5C44 J;  2DFF A;  3BDD A;  3R60 A;  4QIW N;  2PI0 A;  1L0O C;  4IHX A;  4JJF A;  3UGO A;  4HLX A;  5AIQ A;  3RF3 A;  5LLQ A;  4ENN A;  1TNT A;  2O3F A;  3PMR A;  5AC5 A;  1YJ9 I;  5BQT A;  3NEU A;  3S93 A;  4XOT A;  1WJD A;  2KJG A;  1B72 B;  1J8Y F;  1LQ1 A;  3E6D A;  2DLL A;  4P55 A;  4C3J J;  4NCQ A;  2X6W A;  1F5T A;  3BC8 A;  1TP4 A;  2E19 A;  4G9Y A;  1GGQ A;  5KYX A;  3IH2 A;  2H7B A;  1I5Z A;  1GQA A;  3S32 A;  3VFZ A;  3ELK A;  1ZRC A;  2K9N A;  4UNO A;  1OKR A;  1SEU A;  1SFO J;  4N06 A;  2O6G E;  3DAF A;  5ED4 A;  1BOA A;  1H9G A;  2P6S A;  2NVQ J;  4B09 A;  4OIQ F;  1QHH D;  3E5U A;  3BR6 A;  4NTA A;  4CBE A;  3A01 A;  2KDZ A;  2R4G A;  4G0H A;  1RRJ A;  2M9H A;  1D8J A;  1T6S A;  5FRO A;  1WH7 A;  3SP1 A;  3DQV C;  4IX7 A;  4M71 A;  4IZZ A;  3GME A;  1YJW I;  3OYC A;  3CUQ A;  5JR3 A;  1QQI A;  4XN3 A;  4B44 A;  1T95 A;  1R9T J;  4CSW A;  1NFN A;  4OOI A;  2KDO A;  4ZYD A;  2L9R A;  1W7P A;  1YFH A;  2NRA C;  4BY1 J;  1K04 A;  4C2M J;  1Z3I X;  1BIA A;  3JRC A;  3GTG J;  3LLK A;  2R5Z A;  1K7A A;  2WZG A;  1D1B A;  2IXM A;  2CWE A;  5DEQ A;  4ULV A;  3M4O J;  2E5N A;  1M2O A;  3LQR A;  2H7V C;  2AQE A;  3ULQ B;  3L8I A;  2DA7 A;  3KMI A;  2W4M A;  1MH4 A;  4K7B A;  2MG4 A;  1YTY A;  1QZY A;  2Z99 A;  4M73 A;  1YS7 A;  4XKW A;  3ZC4 A;  2EIM H;  2H09 A;  4LG0 B;  2HZD A;  3L0I A;  3LSR A;  3CJN A;  3I55 I;  1X4O A;  4QWQ A;  5CLS A;  3U1D A;  2RVC A;  3K4K A;  3MD2 A;  3HXL A;  2K86 A;  2EPF A;  4CYC A;  1HLV A;  2EIL H;  1ZVZ A;  3K4B A;  3SZT A;  4BQA A;  3COA C;  2EIL C;  4RGX A;  3SZP A;  2CV0 A;  1ZHW A;  4EKW A;  3PQJ A;  3RPU A;  3KKB A;  1A7D A;  3GZN B;  2OQG A;  4ESJ A;  2V79 A;  2A69 F;  3FXL A;  4L9T A;  4HG2 A;  2R7W A;  3TO9 A;  3C8Z A;  4M6X A;  1NLX A;  4A3C J;  3K1H A;  4RDU A;  2KLO A;  3BG5 A;  2HOE A;  1T0F C;  2P5K A;  2X1E A;  3BG9 A;  4KNV A;  5E3A A;  2JUG A;  3JRF A;  4D4X A;  3I4N J;  3TDU C;  3DU6 A;  1ORK A;  3NMK A;  2FBH A;  1NU9 C;  4ZLD A;  5DCM B;  1CGN A;  4WK8 F;  1IAW A;  3OYE A;  2RD9 A;  1HY5 A;  1XGM A;  3GEZ A;  4CGZ A;  2ZC2 A;  5D4R A;  1JJ6 C;  1T08 B;  3FWE A;  1TZL A;  4AUX A;  2OOC A;  4EUK B;  2ZBK A;  1YQA A;  3WHN A;  5EZH A;  2M45 A;  1HST A;  5EGO A;  2H1K A;  4RA2 A;  4XOR A;  3S1Q J;  1ZU5 A;  2STT A;  1QQ3 A;  1WTY A;  3ZVR A;  1A5J A;  2IGM A;  2VN2 A;  3I59 B;  4HNT A;  1OCC C;  3HRS A;  3E0J B;  3G1M A;  2LY2 A;  2KP6 A;  3T4R A;  2FRH A;  5E2Q A;  1QZX A;  1Y0U A;  4ZDP A;  3S2H J;  3ASN H;  4DW6 A;  1OCO H;  1WFX A;  2EQR A;  1XPX A;  3HNL A;  2E87 A;  3EHM A;  2H8A A;  3ASN C;  2VT2 A;  3LEV A;  3H1C A;  3M1C B;  3U8V A;  4BBS J;  5M5X J;  2AXT C;  2EH3 A;  5JHU A;  4XRF A;  4E7J A;  2IAI A;  4BJ6 C;  2L2O A;  3HRM A;  3U3B A;  1IXS B;  3I4P A;  4YIR X;  5GAH J;  2P6T A;  5CVU A;  3TKY A;  1FMW A;  4DRI B;  2NNY A;  1OYY A;  4A4A A;  1Q0G A;  3ITF A;  3ZMZ A;  2F4M B;  2W48 A;  4D5F A;  3LAP A;  1T39 A;  3J7Y J;  1FX7 A;  2FU4 A;  2CQ7 A;  3JTG A;  1TBX A;  2XUB A;  2WTE A;  4A3M J;  2PX9 A;  2R3S A;  4Q47 A;  5L0F A;  3V7C A;  3HKZ A;  3SEO A;  2JMW A;  2DAO A;  1G3S A;  1UB9 A;  2XL6 A;  4I09 A;  2Y39 A;  1QZZ A;  4AYB A;  3RKO F;  2CUJ A;  3PHF 2;  4E7S A;  2OJE D;  4MVQ A;  4A3J J;  3SDG A;  4ZYE A;  2KNH A;  2WY7 Q;  1LVK A;  1W5S A;  4KT5 C;  4EJW A;  1FFH A;  3K1I A;  1T5O A;  1K40 A;  1BZ4 A;  4I1O B;  4BNC A;  2JPB A;  3BQZ A;  1FJL A;  1XTA A;  2ISZ A;  1K78 A;  2HGC A;  4G7O F;  4WWC A;  2H7O A;  3GOD A;  3NRH A;  1U8R A;  1MBH A;  2G62 A;  1Z3X A;  1S7Z A;  3ABM H;  3OY9 A;  1ZRE A;  5D92 A;  4AE4 A;  4B47 A;  2Z5U A;  3LS1 A;  3PCV A;  3BTJ A;  3BG7 A;  5E8G A;  3GW2 A;  1O3U A;  2C04 A;  2HS5 A;  2Y3G A;  5CI8 A;  3I53 A;  1AKH A;  1IUF A;  5FB2 A;  3G4Z A;  3H92 A;  5TIS C;  1IRG A;  1X1B A;  3JCU C;  5D6F A;  1E3O C;  2HZT A;  5E3C A;  1K05 A;  1F1Z A;  3LSM A;  3MBG A;  1ZKG A;  1U0B B;  2YUS A;  2EA2 A;  4RBN A;  5KAF C;  3JT1 A;  2YQY A;  1ZLJ A;  2GAU A;  4NB5 A;  1H9T A;  5F1R A;  1HSJ A;  2LSO A;  3IUO A;  2HQN A;  3A01 B;  2IT0 A;  2NVX J;  2O61 A;  2ZJQ F;  1XZP A;  3QRF F;  3ZXS A;  4H54 A;  1FLI A;  4HLY A;  4U5C E;  4XWJ A;  2EZK A;  5ICG A;  4HRI A;  1MIJ A;  1OYW A;  3GAN A;  3FDQ A;  3QPT A;  1N1C A;  3T1B A;  4UDV A;  4EHP A;  4IHS A;  2W82 A;  1W7P B;  3HNJ A;  1LI7 A;  3HOZ J;  3Q6M A;  4P9U A;  2HKV A;  3HOT A;  3HRU A;  3Q0V A;  2ZXH A;  1PUE E;  2R7F A;  3I5P A;  3CUQ C;  3BJO A;  4M3F A;  1QNT A;  1M2V A;  2L5Q A;  2A07 F;  4GDF A;  2HFI A;  2QM3 A;  3PFI A;  2CS3 A;  2GIV A;  2GQQ A;  1I27 A;  3KLO A;  4KJZ A;  4HNU A;  5B5E C;  1TWA J;  4QI2 A;  3B0V C;  1HQC A;  3V8J A;  3B29 A;  1ETQ A;  1D3Y A;  3PM1 A;  5IY5 H;  2PP4 A;  3HJC A;  4LIU A;  2IS4 A;  4ZZL A;  2HZ8 A;  3QU3 A;  5IY5 C;  2F4O B;  4CYC B;  3K0L A;  5KK1 A;  2CFX A;  1VQL I;  3BY6 A;  5A6A A;  2ZJP F;  3OYM A;  3HPG A;  3UMH A;  1VTN C;  1Q0F A;  4R79 A;  2VC1 A;  4ANJ A;  1BI3 A;  4HE8 D;  3R0A A;  3BLY A;  1POG A;  3ZQF A;  4GXO A;  4WXC A;  4M63 A;  3VM6 A;  1RES A;  3HC7 A;  3F22 A;  2V7F A;  1X58 A;  1T6I A;  1OR7 A;  1PYV A;  1RIO H;  2R7U A;  1MQV A;  1T38 A;  3S16 J;  1MBK A;  4EEF G;  1ZLK A;  3CCQ I;  1UFB A;  3Q7L A;  2ISY A;  1IZM A;  5LHH A;  5DV5 A;  1W2W A;  2V3C C;  4RAG A;  2GLO A;  3DJN B;  2HMQ A;  2W7N A;  1P4W A;  4GEH A;  2OA4 A;  2A61 A;  3OYA A;  1N78 A;  3QVY A;  3E97 A;  4O6J A;  3H2V A;  2YX7 A;  1P7I A;  1U9O A;  3S2W A;  4CO8 A;  3S29 A;  4RGR A;  2EZI A;  3CP2 A;  4DBR A;  4AIK A;  4FCY A;  4XLF A;  3K33 A;  4MVR A;  1KTM A;  2EIN H;  2R7Q A;  2EV0 A;  1UFM A;  3BRJ A;  3RIR A;  4U5E E;  2R5Y A;  2DN0 A;  3MQ0 A;  3SZR A;  1YW9 A;  3LA2 A;  5GAE J;  1JOG A;  3K2A A;  4LAC B;  2Y9Y A;  3OYB A;  5CVJ A;  3K70 D;  3CAX A;  2NS7 A;  1YA7 O;  4HFF B;  2KPM A;  3Q6N A;  1BIB A;  1Z6A A;  3H35 A;  4M6Y A;  2XKO A;  1NK3 P;  3C8G B;  3NQO A;  2XSD C;  3O55 A;  3GM3 A;  3UGP A;  3LST A;  3QYB A;  3T6B A;  4XMY A;  4FX5 A;  1NG1 A;  4J32 B;  3IWZ A;  4Z9I A;  4IQJ A;  1Y8R B;  4XLN F;  1U3E M;  2JUC A;  1K6Y A;  3L7W A;  2H1L A;  3VDX A;  1Z23 A;  4WGY A;  3BEH A;  2LBF A;  2VIX A; 
#chains in the Genus database with same CATH homology
 4XLP F;  1NG6 A;  4KIS A;  1KON A;  3MX3 A;  1X4P A;  5FCL A;  2R7V A;  2YEV A;  4C3B A;  5B1B C;  3OR1 C;  2MFZ A;  5T1D B;  1BR4 A;  4EBB A;  3K4N A;  3M8J A;  1X1D A;  3DM5 A;  5BUO A;  4BE1 A;  2WAQ A;  4QI0 A;  4G7H F;  4P6I C;  2DT6 A;  2LG4 A;  2Z16 A;  3DPU A;  2WB1 A;  3QOD A;  3H5A A;  1WJF A;  2CGE A;  3KYL A;  5DS5 A;  4B48 A;  2JVG A;  3NKD A;  1YX3 A;  4F3Q A;  2J9W A;  4YT2 A;  2WB7 A;  1UEL B;  2A68 F;  2NUT A;  1SF8 A;  4IWB A;  4KNW A;  4W8K A;  4CIH A;  2KRC A;  4DVZ A;  3EFO B;  5KYW B;  2WY8 Q;  1W36 D;  2J45 A;  3EHN A;  5FRM A;  2R7R A;  1ST6 A;  3ABM C;  2HNH A;  3JCU Q;  3K7D A;  1TR2 A;  3W8I A;  4CS8 A;  3OS2 A;  2WAF A;  3PSI A;  2VJI A;  1M56 C;  2KGO A;  4PJJ A;  4D9J A;  1IW7 F;  3S8P A;  3H5N A;  2KZV A;  5LD2 C;  3L2U A;  1Z63 A;  1WJ5 A;  4AX2 A;  3LMM A;  3ZCO A;  2I8B A;  4ZLC A;  3RTR A;  4CA0 A;  1JPJ A;  4AE4 B;  4GYT A;  1O5H A;  3K1I C;  3H9G A;  3AG1 C;  3HOS A;  1ZHT A;  4F55 A;  2PX0 A;  5DQT A;  4A2N B;  5KHD A;  4CSA A;  4O6N A;  3DZA A;  4XLE A;  3PNV A;  2CNW A;  4Q4Z F;  2AQF A;  4E7I A;  2J7P A;  2X6X A;  5EHH A;  2XF7 A;  3PSF A;  3CF2 A;  1MNE A;  2DT7 B;  2Y0S A;  3PFY A;  3NWS A;  3PJR A;  4EWC A;  3RIP A;  3AQC A;  3HL2 A;  2VXD A;  3DKX A;  4RDA A;  2F5V A;  4JW1 A;  3FKJ A;  4PK4 A;  2DOA A;  1VOM A;  2FGY A;  4C30 A;  3NG1 A;  2VB6 A;  5LFA A;  4CH7 A;  2EIK C;  3X2Q C;  2C03 A;  3CES A;  4F93 B;  1OCR C;  4B43 A;  2J9V A;  4E7K A;  3DKY A;  2XF6 A;  3A1Y A;  3LSH A;  4HEA 2;  4AU7 A;  4BQO A;  2OUM A;  2M7B A;  2QKL B;  4HPQ A;  2VJ4 A;  2NG1 A;  3AG3 C;  4MQ9 F;  3TD7 A;  3W3C A;  2E1M C;  2VL8 A;  2ZXR A;  1VYK A;  2VJJ A;  4DIQ A;  2MAB A;  4FAS D;  2WVQ A;  1V5F A;  5EGY A;  4BE2 A;  1RJ9 A;  1JI8 A;  2A6T A;  3F9K A;  1GLN A;  3OYH A;  2VQC A;  3L2R A;  4XKB A;  2IXO A;  3CJQ B;  5KYU A;  4YEL A;  3K4L A;  3LSI A;  4DOZ A;  2J0W A;  1BR2 A;  4QPO A;  4NNJ A;  1G59 A;  4J30 B;  1ZU4 A;  4U5F E;  3C2H A;  4BJ5 A;  3A2K A;  1M2V B;  4KT6 A;  4JOM A;  4LIT A;  3QYF A;  3RCO A;  1WGW A;  2ZSI B;  2IOQ A;  3K70 C;  5KYY A;  1D0Y A;  2CW0 F;  2MYS A;  4KC9 A;  3VYW A;  1RJ9 B;  4NY3 A;  5KYU B;  3X1O A;  4K0D A;  2V26 A;  4G6T B;  2P7V A;  2VH3 A;  3I5Q A;  1MND A;  2Z15 A;  2ZXW C;  5KYN A;  2BW3 A;  1PD1 A;  3B0U X;  2X6Y A;  3E1S A;  3DJU B;  4JUR I;  2ZSH B;  2M4G A;  2ZPA A;  2HU9 A;  3OIP A;  5KYY B;  3IEE A;  3DPL C;  1D0Z A;  4IQ4 A;  2Q2E B;  4XKV A;  3CZ6 A;  1J8M F;  2QY9 A;  3N2Z B;  4BDY A;  4BEH B;  3OA1 A;  1U0J A;  1TWA A;  3K4M A;  2Y3B A;  4LIV A;  4BDZ A;  2HVQ A;  1EA3 A;  2XSE A;  2UWM A;  2IS1 A;  2PJR A;  2P0W A;  3CMM A;  2JVH A;  2LYC A;  1R6R A;  3ZGK A;  3EGD A;  3SNH A;  2EIJ C;  2NUP B;  1ZEL A;  2A5W A;  2MD0 A;  5HOO A;  3H0D A;  1SMY F;  5HNF A;  3AL0 B;  2P6V A;  4E6K G;  2PF4 E;  2W4B A;  4JCH A;  4JJG A;  2PX3 A;  3PNT A;  4O6Y A;  4CCK A;  2VJ5 A;  2VAS A;  1KU2 A;  2J7P D;  1ERD A;  2EIN C;  2M4K A;  2HV6 A;  2XC7 A;  2KQR A;  4DBQ A;  3EGD B;  1V54 C;  2WZF A;  2A1D D;  3VYT B;  2YZS A;  4BS9 A;  3AL0 C;  3TMO A;  2R7X A;  1DP3 A;  3ZQQ A;  3OOU A;  2YHS A;  3WOD F;  4CS7 A;  3DTI A;  3EQL F;  4RM3 A;  4XLA A;  1W36 C;  3L2W A;  4Y33 A;  3UMK A;  1NG7 A;  4BJ6 A;  4OIP F;  2A6E F;  3MKY B;  3N05 A;  2V4J C;  2KQ9 A;  3D5L A;  4DGW B;  1TWG A;  2B0J A;  1X1A A;  4II3 A;  3MKZ A;  3HTK C;  3S3O A;  2ZFU A;  3FHD A;  4U5H A;  3VSK A;  2L7K A;  3V42 A;  2X51 A;  1TWC A;  3M1C A;  2Z2S B;  3DMD A;  3ZIB A;  4B6I A;  4MND A;  4KBL A;  4Q5S F;  2IS2 A;  2M7A A;  3EJN A;  3HG9 A;  1OLT A;  1SZI A;  3EGX B;  2CV1 A;  4PFP A;  1TT0 A;  1M57 C;  2KRH A;  3HLZ A;  2CMP A;  2LH9 A;  4E7L A;  4O6M A;  4DVY P;  4PSX A;  2DJI A;  3HUG B;  3OMY A;  4BAC A;  2W1O A;  4N4O B;  3POV A;  4GRI A;  2Z1D A;  5CKT A;  4Q7C A;  4I3M A;  3PUB A;  4OAZ A;  3EG9 A;  3FHN A;  3NYJ A;  4XKC A;  4H4K C;  2Q9A A;  3I9V 2;  1WJC A;  3DPT A;  3SZG A;  4BE0 A;  1OCZ C;  2LBF B;  3I3L A;  3NKE A;  1MMD A;  3OYL A;  5CI9 A;  1VMA A;  3LS0 A;  4E4H A;  1D0X A;  4II2 A;  1X1C A;  4EAT A;  2BVM A;  2CW8 A;  1X19 A;  3OYF A;  1ZHX A;  3SDB A;  4YEJ A;  4CCO A;  2MWQ A;  1BR1 A;  3KL4 A;  5HVQ C;  2KL4 A;  3UGO A;  4C7O A;  4JJF A;  4IAO A;  3NWT A;  4BJ1 A;  3SEQ A;  2R7O A;  2J9U A;  1WJA A;  2CDQ A;  2L9N A;  1Y56 A;  3J7A Y;  3H9J A;  4XQF A;  2BVL A;  1V5G A;  2A6H F;  5L3V A;  4BL0 B;  2ZXO A;  3ZRG A;  3PMR A;  1QHG A;  4ZTF A;  1V5E A;  1DQU A;  3S93 A;  4XOT A;  2IGN A;  1WJD A;  2KJG A;  5B3S C;  1J8Y F;  2NUT B;  2Q9C A;  5D91 A;  2X6W A;  3MKW B;  3BC8 A;  3O39 A;  1TWH A;  5KYX A;  2WA0 A;  2H7B A;  3S32 A;  3OYJ A;  3OYG A;  3QMK A;  5HLT A;  4F91 B;  2IXP A;  4J00 A;  3AG4 C;  4N06 A;  3S28 A;  4RM2 A;  3SEZ A;  4NUB A;  3DAF A;  3RYL A;  2W9Y A;  1YE9 A;  1N75 A;  3DWL E;  2Y3D A;  3JRT A;  4OIQ F;  1QHH D;  3DTE A;  4BEJ A;  5L3Q A;  4YT4 A;  2CW7 A;  4QDL A;  2RQQ A;  3D5R C;  4CBE A;  5KYX B;  2QKM B;  3EH1 A;  3ABL C;  2NOJ B;  2R4G A;  2XDV A;  3K66 A;  1N77 A;  2PMZ A;  4G0H A;  3WG7 C;  5F5F A;  3A4C A;  3O6X A;  5FRO A;  3LSG A;  2FFH A;  2WVO A;  4CUG A;  3CSK A;  2OG2 A;  4C2T A;  3DQV C;  4PJM A;  3SP1 A;  4HFK B;  3KEY A;  4IX7 A;  3SYN A;  4IZZ A;  2LY1 A;  4BU2 A;  3OYC A;  3H65 A;  3OYD A;  3RH3 A;  1D1C A;  4XN3 A;  2DYR C;  4B44 A;  1T95 A;  3AQB A;  4CSW A;  3DD7 A;  4ULW A;  3OYK A;  4U5D E;  2KDO A;  3FDY A;  4OD5 A;  3H9Q A;  3I4U A;  4I1M A;  1Z3I X;  2DCE A;  2VKD A;  2R7S A;  3V7O A;  3LLK A;  2WZG A;  1D1B A;  2IXM A;  1O87 A;  3UMI A;  2LBF A;  2E5N A;  1M2O A;  2XXA A;  2H7V C;  2VLA A;  2AQE A;  5DS4 A;  2RRE A;  3KMI A;  2W4M A;  3LSK A;  4K7B A;  1VYI A;  3OWT A;  3ASO C;  4XKW A;  3ZC4 A;  4HEA J;  3L0I A;  2HZD A;  2K3P A;  4CCJ A;  1TKN A;  3FVY A;  3ECS A;  3BCA A;  3RFY A;  1X4O A;  2X85 A;  4BJT A;  3K4K A;  2XXA B;  1UG0 A;  3EUH C;  3MD2 A;  3OYI A;  3HXL A;  5TGT A;  4PFO A;  3RSN A;  1Z3Y A;  2VKH A;  3K4B A;  3ZG1 A;  4NC7 A;  2EIL C;  2KHM A;  5HSW A;  3VYS B;  2CV0 A;  3S27 A;  1ZHW A;  3KKB A;  3VAY A;  1D1A A;  5FRN A;  4CZC A;  1SFK A;  2LSE A;  4O79 A;  4RLF A;  1Z5Z A;  2DYS C;  2A69 F;  2BW3 B;  3ZR8 X;  2WL8 A;  2XL4 A;  4BJ5 C;  4KIT B;  4BUP A;  4HG2 A;  2R7W A;  4XR6 A;  2ZXP A;  2K9L A;  2L9J A;  2M0M A;  2HVS A;  3K1H A;  2KLO A;  1DGW Y;  4ITV A;  2JA2 A;  3SYT A;  3UR3 C;  1T0F C;  3VSL A;  1FFT C;  2X1E A;  2CNW D;  4KNV A;  5E3A A;  2JUG A;  1PJR A;  2WAE A;  3EZI A;  4OD4 A;  1MMA A;  3IAM 2;  3DU6 A;  4ZLD A;  2RNG A;  2DXI A;  2MC4 A;  2PJR B;  1NU9 C;  3CQZ A;  3CP8 A;  3OYE A;  2O9X A;  2J46 A;  2V6E A;  1OR7 C;  2KMU A;  2BOL A;  5DS6 A;  2OV7 A;  1Z21 A;  1TZL A;  1QU3 A;  4XNF A;  2LRE A;  4Y4R A;  4YWQ A;  3OYN A;  3Q7G A;  3LES A;  3OR2 C;  4IKF A;  1ZU5 A;  3NDB B;  3MMY B;  4XOR A;  1ZHY A;  3DAG A;  1QLE C;  4CCM A;  4BG0 A;  3DU5 A;  4QPQ A;  2Q9B A;  3CJR B;  2L9S A;  3ZVR A;  2R7T A;  2IGM A;  3EPV A;  3FAJ A;  4HNT A;  3K6B A;  1OCC C;  3B0P A;  4MLO A;  3E0J B;  2LY2 A;  2KP6 A;  3T4R A;  1UAA A;  5E2Q A;  4ZTJ A;  3VWB A;  4OAY A;  3RQ4 A;  2E5Z A;  4ZDP A;  3U21 A;  1QZX A;  4X0R A;  1WFX A;  2Y3H A;  2E87 A;  3EHM A;  3ASN C;  3M1C B;  3DEE A;  3LEV A;  2VQG A;  2LOO A;  4PJN A;  4E7J A;  4BJ6 C;  2L2O A;  4PJL A;  3AFH A;  1VK5 A;  3JSZ A;  2W4S A;  1FMW A;  1LS1 A;  4XL9 A;  3ITF A;  1MW7 A;  3FBN B;  4JQF A;  4KI2 A;  3B9Q A;  4C2U A;  2O5R A;  3EG9 B;  4XON A;  3RPU D;  2HPM A;  3HKZ A;  3SEO A;  4YN0 B;  4E7H A;  1OKK A;  1IRX A;  2Y39 A;  3L34 A;  2I8D A;  2W00 A;  3EFO A;  4AYB A;  2IS6 A;  3RKO F;  2CUJ A;  3W2V A;  4E7S A;  4BGD A;  4CS9 C;  4U5G A;  3PHF 2;  2KNH A;  4C7O B;  3TL4 X;  2WY7 Q;  4FES A;  1LVK A;  2IGO A;  1FFH A;  3IAS 2;  4I1O B;  1SAU A;  2HV7 A;  4G7O F;  3NYL A;  2H7O A;  3GOD A;  1VZ0 A;  3NRH A;  2G62 A;  1WJB A;  1Z3X A;  1S7Z A;  3E70 C;  2QTV A;  4RD9 A;  2G3K A;  3VYR B;  5KNL A;  3OY9 A;  3VYU B;  3DM9 B;  3OS1 A;  3N24 A;  3LL7 A;  5D92 A;  4AE4 A;  4B47 A;  3LS1 A;  3LLI A;  2V9K A;  2Y3G A;  3BG7 A;  5CI8 A;  2C04 A;  3DLA A;  2E60 A;  4YT5 A;  4OIN F;  3FBI B;  4BQN A;  3AG2 C;  3E9V A;  4CS8 C;  4AVZ A;  4F4B A;  2VXZ A;  5CPR B;  1HA8 A;  2J0X A;  2CV2 A;  1X1B A;  4ZJZ A;  2CFO A;  5E3C A;  5KCM A;  3LSM A;  4LG3 A;  5CQG A;  1Z7L A;  4LLE A;  3KX2 A;  4RBN A;  2IXS A;  3JT1 A;  2VPL A;  4JZA A;  5CQE A;  4BQQ A;  4P1W A;  1NZE A;  3K6G A;  3IUO A;  4NC8 A;  1FMV A;  4CCL A;  4B3X A;  4YT8 A;  3OIQ A;  3OL4 A;  3UNG C;  3W8H A;  2GOX B;  3ZXS A;  4RMN A;  4ZYA A;  3OL3 A;  4CSA C;  4U5C E;  2WZL A;  4XWJ A;  4HRI A;  1LDK B;  2X1C A;  3ONQ A;  3PL8 A;  4U5B E;  2Q3T A;  4C3E A;  2W45 A;  4I44 A;  3GAN A;  3FDQ A;  3QOE A;  3W2W A;  1N1C A;  3LJB A;  3QZC A;  4FWV A;  1Y6I A;  2E1M B;  4X0G A;  3K4J A;  2UV1 A;  1YX5 A;  4CCN A;  3OS0 A;  3S3M A;  2W82 A;  2D5R B;  2K5C A;  3LAY A;  2HDW A;  4G7Z F;  2WBM A;  3Q6M A;  3T6J A;  3HOT A;  4XOP A;  1S9H A;  1MMN A;  2ZXH A;  2ZXI A;  1E0E A;  2EIM C;  3I5P A;  1M2V A;  3DXJ F;  2Q1Z B;  3EH2 A;  2L5Q A;  2LRD A;  2GFH A;  4IJJ A;  4YJW A;  3PNY A;  2IGK A;  2Y69 C;  1OKK D;  5T3W A;  5HNH A;  3H5R A;  2CS3 A;  5JHF A;  2XF5 A;  5F5H A;  2IXN A;  4KJZ A;  4HNU A;  2WVN A;  1WJE A;  1ZHZ A;  1PD0 A;  4WJ0 A;  2CH0 A;  2VQH A;  5KYW A;  4QI2 A;  3LFU A;  1DGR M;  3B0V C;  2PFD A;  1LKX A;  1V55 C;  2GOM A;  4ZC3 A;  3EZH A;  4XTK A;  2XSJ C;  4ZDO A;  2PP4 A;  3HJC A;  1AA7 A;  4LIU A;  4U87 A;  2IS4 A;  5IY5 C;  4JVS A;  4FET A;  4BXF A;  2G3V A;  3EUK L;  3C2G A;  3BG6 A;  4BEH A;  1FTS A;  4LER A;  3OYM A;  3OEO A;  3HPG A;  3UMH A;  2DGJ A;  4R79 A;  4XN0 A;  4XM3 A;  4ANJ A;  4DJA A;  4NQW B;  3AKZ A;  1ZYR F;  4HE8 D;  5T3T A;  2OC6 A;  3BLY A;  3EPZ A;  4PUS A;  4F92 B;  3D5S C;  2ELJ A;  3K10 A;  3HC7 A;  2CUZ A;  2BE5 F;  2V7F A;  2NUP A;  2L81 A;  5DVW A;  1PYV A;  3NYM A;  2R7U A;  2M3A A;  4PSW A;  3F47 A;  3Q7L A;  2HQA A;  4RLQ A;  1J09 A;  3N0T A;  1IZM A;  3JYH A;  1W2W A;  2V3C C;  3DJN B;  1LFP A;  2F6C A;  1JPN A;  2X1D A;  2W7N A;  4F52 A;  2M4E A;  5DQZ A;  4GEH A;  4IRU A;  1BOB A;  3OYA A;  1N78 A;  4U7B A;  1PCX A;  3K4C A;  3MLG A;  4C3D A;  3GBG A;  4XLH A;  3ABK C;  2OCC C;  4HST A;  2JSP A;  2XAU A;  3W2A A;  3S29 A;  3ZSU A;  3G2B A;  3CP2 A;  4OWR B;  4C9Y A;  4DBR A;  1P9Q C;  3QYE A;  4XLF A;  3K33 A;  2FUG 2;  3EUA A;  4OIO F;  2VQL A;  2R7Q A;  2IYL D;  4U5E E;  4HSR A;  3LNR A;  4AK9 A;  4J01 A;  4O7G A;  4LLC A;  3S0X A;  4Y3O A;  4XLC A;  2XRH A;  3SZR A;  2F4I A;  1G8X A;  4LAC B;  3OYB A;  4CS9 A;  4P5O A;  2HPI A;  2UUZ A;  4E7Z A;  3K70 D;  4M63 A;  2JD3 A;  4YRV A;  3IP4 B;  3EGX A;  2KPM A;  3BCB A;  3Q6N A;  1Z6A A;  4HFF B;  1OCO C;  3H35 A;  1NU7 D;  4ZDL A;  5E33 A;  3UGP A;  2K9M A;  3QYB A;  3T6B A;  4XMY A;  3F46 A;  4FX5 A;  1NG1 A;  2V1N A;  4J32 B;  5DLJ A;  4OIR F;  2LC2 A;  2KW3 C;  3DTK A;  3L2V A;  3KH2 A;  4IQJ A;  3L2Q A;  4XLN F;  1MMG A;  1K6Y A;  3TBI A;  3VDX A;  4D1Q A;  3S3N A;  1Z23 A;  5B1A C;  4N4N B;  3HPH A;  2WAD A;  2HVR A;  2VIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...