3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords DNA-binding protein RAP1
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
3K6GA 4BJTA 3CZ6A 4BJ6C 3OWTA 4BJ5C
chains in the Genus database with same CATH superfamily
2VT2A 1NH3A 4V2FA 2Z5UA 5HVQC 1XGSA 1FX7A 3A1YA 4MQ9F 1VF9A 4NDLA 1JTXA 5IP9J 4G7HF 2ICWG 3FOOA 1PYVA 3K4CA 4HQMA 2LK4A 4IHXA 3WTSC 1KONA 4L6RA 3ZWIA 2Y9YA 3Q6MA 3EZHA 3N24A 1FOYA 3BLYA 2DA4A 2IGNA 2L01A 1TWHA 4CS9C 2P6TA 2X4HA 1SAUA 3COAC 1G3YA 4PFOA 3HXLA 1ERDA 4NB5A 1T6IA 3ZTMA 4N6CA 1T9KA 2XAHA 3BWGA 5GPAA 1AOYA 4EKWA 2DMTA 2EILC 4BEHA 2O9LA 2H7OA 5DVWA 1T56A 4EMSA 1APLC 2Q1ZB 2VL8A 1D5VA 3OV8A 4KITB 4E18A 2OBPA 3M1EA 3V7RA 2DXIA 2XM4A 1OCRC 3FHDA 1XSVA 1WWPA 2M5WA 3SZPA 1F1ZA 3HL2A 3CF5F 3JAMZ 4I2OA 3QQAA 3EFOB 1UG2A 5GTIC 1P4WA 1QLEC 2L9SA 4I3MA 5BQTA 3L8IA 1Q0GA 4N4WA 5LHIA 2NSGA 5B1BH 1HSTA 1VYKA 2XSEA 3IQ5A 4DJAA 2R5ZA 4U9DA 3CMYA 2EK5A 4EM2A 3H92A 3KH2A 4UXNA 4F91B 5CVVA 2M0CA 2DFIA 4M3BA 2L4MA 2XGCA 1Z7Qc 4WCGA 2DOFA 2E7WA 3KEQA 4BQOA 4KIFA 5B1AC 2VBYA 4EEFG 3I3LA 4ONSA 2DFFA 1NLXA 1JOGA 1P9QC 4U0VA 4ZYAA 4EJUA 3W3CA 3GM1A 2IXPA 1KU2A 1FTZA 5T1DB 3ZXSA 1AA7A 3S3MA 1A7DA 1XZPA 1N75A 2H94A 4AL0A 3HSEA 1VQ4I 2L7KA 3BTIA 1XMKA 3LSPA 3CO7C 1OCZH 4B4CA 1AU7A 4MVUA 2HQRA 2X51A 3ZQGA 1E17A 2DOAA 1ZARA 3E6BA 3V8LA 1QNTA 4ULWA 3PDMP 4D7MA 3DTEA 3ZP5A 1BC8C 1X4PA 4ZJZA 3GTLJ 1IRGA 1QVUA 4OIOF 3QOPA 3U3FA 1OR2A 1OXBA 2XDVA 2LVSA 2ACJA 3EUHC 3O6XA 2V4JC 2A6EF 2Y2ZA 3GANA 1UHMA 3GODA 4LOCA 4I1OB 2DFHA 3S9OA 1VQLI 3TJ5A 1YITI 3OYCA 1SFUA 2P1AA 4KC9A 1V74B 4PCQA 1XTAA 2J9WA 4HF2A 6PAXA 3TQOA 3LNRA 5D6EA 3D1NI 4RMNA 3IUOA 4PGHA 3REOA 1SD5A 2VI6A 1QZZA 4IB4A 4IAOA 2LFFA 1TTYA 2XC7A 3BY6A 1NZEA 2OD5A 3QYFA 3EPVA 3W6KB 1O7LA 1MBFA 2EBIA 3H9QA 5EEGA 4L0ZB 5KNLA 2YLDA 2YEVA 4I0AA 1QVTA 2V1NA 3JW4A 5M3MJ 5L0GA 1GT0C 3S27A 3E70C 1G8XA 4HW0A 2P61A 3ML6A 4XEVA 4E4HA 2EWNA 3K1MA 2CYYA 4PZJA 1YJ9I 3FMSA 9ANTA 3AG3H 5HDNA 2CNWD 2Y75A 1O4XA 2R03A 3L0IA 1U8RA 2KJBA 2CQKA 4AYBN 2LP4A 3S3OA 2HZ8A 5TGTA 1ETXA 3C62A 3V5XA 3GWZA 1TT0A 1XN7A 4CZZA 1TWAA 2PFDA 3D5LA 2OU2A 2STTA 3BR5A 1LDKB 4D4NA 1FYMA 1XZQA 5D5VB 4ZZLA 1YO5C 2PX3A 2RNGA 4CJOA 1I1GA 5ED4A 4XQ1A 2RGVA 3G71I 4G94A 3I56I 1FNNA 1P92A 2ZMEB 1YQAA 2DT7B 3DP7A 4QPOA 4C3JJ 2ZXOA 5L3FA 2Z15A 4ER9A 1TP4A 3FAPB 1V4RA 3DU5A 3ZQFA 2L5QA 4M6YA 4JQFA 2O3FA 2Q9AA 5J8CA 1Z91A 4MVOA 5E1ZB 2KHMA 4XOTA 1J0RA 2E7XA 3M9AA 2KW3C 3DU6A 4KN4X 4DJ9A 1ZGWA 1JKOC 3L2WA 3SXKA 2PMZN 4RB1A 3ABUA 4F93B 5ILUA 3S2HJ 2TDXA 3PCVA 3FWEA 1GVJA 1R6RA 1BJAA 4ZC3A 1R5GA 4WGYA 3TOMA 5KVRA 4IPAA 5B5EC 4N9HA 4B44A 2IM8A 1F1MA 4O6NA 1YX5A 1OCOC 2O03A 2R7FA 1E3HA 1ZG1A 2Y48A 1FSEA 2JWTA 1XDSA 4OU0A 4XM3A 4OIPF 4EUKB 1E84A 3PO3J 2W25A 2ETHA 2JPCA 4IWBA 1BW5A 1Q1HA 4ASNA 2FBKA 2JSPA 1C0WA 4ULVA 2B0JA 5C3EJ 3KETA 3FVYA 4Z9JA 3A2KA 4KBLA 4LB6B 2RC4A 1GXQA 4IJAA 1O87A 1TFKB 1F4KA 4ENNA 3NG1A 2VCCA 3JRTA 1FBQA 3M8EA 1IF1A 3K70C 1I4YA 2HXOA 5EZHA 5T3WA 2XPUA 3HKZA 2NVYJ 3DE9A 1JHFA 2RAEA 2L6HA 4CH7A 3OL3A 4YFXF 2RDPA 3F0CA 3AG1C 5F64A 2IP2A 4Y4RA 3J81K 2O0YA 4RDAA 1R4NB 1YW7A 1MSFC 3AOUA 2V1DA 3C7JA 2EFPA 2BVLA 4C30A 1QA6A 3N0TA 1Z9CA 1JPJA 3BCAA 3VYUB 5A6AA 3U1DA 4JJGA 3V42A 2YL1A 3JZ0A 2CUZA 4LMYA 1X3UA 2M7BA 3BQYA 1IRXA 3HNJA 3G4SI 3C2HA 1KNYA 3MZHA 2LRDA 3LS0A 1E2XA 1TQIA 2EZLA 4HSTA 1ULYA 4Q5SF 4HFFB 2GOMA 3LSGA 2JA2A 1ZREA 2JA6J 1OCRH 4K7BA 4UVAA 2GA1A 2HVQA 5LGTA 2WL8A 1FR0A 1NFNA 3H2UA 2PFBA 2X6XA 4KT5C 1ZVZA 4XL9A 3LSTA 2VPLA 4LDQA 2K86A 3RF3A 3ERMA 3TD7A 4BXUA 5ICGA 2JSCA 2A5YB 1D0YA 5H6QA 2BHYA 2J5OA 3AKZA 2ISYA 3QPLA 2X85A 2D1HA 2GFHA 1HA8A 2XGDA 2EPKX 3ZMSA 2MG4A 3JSZA 4RGUA 4A3LJ 2EINC 2F5DA 1CF7A 3GUDA 3W2WA 3SDGA 4QWQA 1S7OA 3ABLH 2GAUA 2JK3A 2HOEA 4RGRA 3SEQA 4XBFA 1MSEC 3CMEI 3S1MJ 4MO7A 3BR3A 4E17A 3IP4B 3EGDA 3LEOA 2R7RA 5LLQA 2J9BA 3R60A 1AHDP 4KIGA 3F23A 2NAZA 3L09A 3T6BA 2BYVE 2LSEA 3L2CA 4XONA 1CGPA 3MAJA 4IJJA 3AG2H 4C2MJ 4RA2A 1Y8QB 3T1BA 1QQIA 3RPUD 4QPQA 4BJ5A 2CV0A 2E35A 2WAEA 3TO7A 3C3WA 4Z6YA 3R6SA 4PJMA 1NG6A 2IPQX 2XLHA 2EINH 2AQFA 1RETA 2WA0A 1TWFJ 1VQ9I 1LFPA 1B72B 5KYUB 4Y17A 4HLYA 1XG1A 4NQFA 1IXSB 2Y39A 2KL4A 3SEZA 1MGTA 3CCLI 2WY8Q 2LC2A 1OW6A 2L9JA 4DW6A 4JZAA 3K33A 2P7VA 4KMFA 4Z9HA 5EEAA 5JUAA 2WZFA 3CCJI 1MNMC 1PUFA 4UHTA 5E3NA 1HDDC 1STZA 2W7NA 4KT6A 1A0BA 2HTSA 3GORA 1J75A 1ZR2A 2R25A 4M3FA 5CVUA 1SD7A 3DKYA 2IGMA 5H2FC 3N4MA 2RQPA 3CCYA 5CYVA 5KK1A 1W36C 3LSHA 1SFXA 4EQQA 2NS8A 3HOTA 4KFCA 2CQQA 3M15A 1T0FA 1JJ6C 1H7IA 4OD4A 1WGXA 2FU4A 4C3EA 2F4IA 1MBEA 2OTJI 1C02A 3V4GA 1WZ2A 1TWGJ 1WSUA 4I01A 4LIVA 2GDCA 3JT1A 4CCMA 2XROA 1OW8A 3HNKA 4NBQA 4WJ0A 2VKVA 3KYCB 3JYHA 3K1IC 2LR8A 1TLHB 2COBA 2NUTB 3I54A 2YU9J 3K1NA 1GV2A 5DS9A 2Y0SN 1LE8B 1AUEA 3DFGA 4GFBA 4D9JA 1S5LC 2BY3A 1D8KA 2RV8A 3EHMA 1YG2A 5AIQA 1GUUA 3R4KA 1V55H 5EGOA 5JLIA 5CVIA 1ZHFA 5F0HA 2HMZA 2FBHA 4FESA 1UMQA 2CO5A 3PQJA 3NEUA 2YKZA 4EGYA 3PFYA 2Z9OA 4A2UA 3I4MJ 4EJVA 4U5HA 4YK5A 1VTMP 3NDBB 3GFLA 3GW2A 4RB2C 2GAQA 2K9MA 2O7OA 4A3CJ 2EV5A 1H8AC 2F4MB 3S29A 2K7LA 2G7HA 3OIOA 2XPWA 2IXOA 4JURI 4A3GJ 1MBGA 1X3WB 1QSPA 2FBIA 5HLIA 2D4UA 4MTGA 4ZZDA 2DJIA 4LACB 1YS6A 2KLOA 2R9RB 4UY8I 3SHFA 1WVRA 4MS2A 1H6GA 3CCSI 4RAZA 5TJJA 1X19A 3H3VK 1OLTA 4JCZA 4CHUA 2HV6A 4D4XA 3J7AO 3E7LA 3SXYA 2HYFA 2HNHA 1YLMA 3M3YJ 3WTYC 2P7VB 4XRMA 2AXTC 2M45A 2F4OB 3DKXA 2JTVA 3LQRA 1R1VA 3OOPA 3WTZA 3MFNA 3VYWA 1QZYA 4HV5A 2FQ3A 3K4LA 3PUBA 2V1UA 2W9YA 3AGUA 4E7IA 1HQCA 4U0WA 3F8FA 1FYLA 5BQHA 3GVAA 3A0HC 2K4BA 4D1QA 4C7OA 2UV1A 1D1BA 2OAZA 3EFOA 2A68F 2ISZA 4AX2A 3BR0A 1JRAA 4S0HB 2H1LA 2ECCA 5CIVA 1BN5A 4CX9A 4GRIA 3M4OJ 2M7AA 1MH4A 1K40A 2YQYA 2CG4A 4XOPA 1MDMB 2L7ZA 3C2GA 2VKEA 5HLGA 5JHFA 4B1RA 4JTDB 2OOCA 3UGOA 4F55A 2NOJB 3U2LA 3IWFA 2UUZA 2M2EA 3ZMVA 1DOWA 1Y4CA 1MJBA 3KP5A 2RREA 3GTGJ 3JSOA 4XIDA 4ZTFA 3T9OA 3MZ8A 4UDVA 2AWCA 1G4WR 1JR8A 3QYEA 4LLGF 3GEHA 2XLEA 2R7UA 3LEVA 1R1UA 3ZMUA 1VYIA 4JYKA 5D4RA 2XL6A 3AL0C 4J32B 4J30B 3OYHA 2HOSA 2H6CA 2E1NA 3LSMA 5HNHA 5CJ9A 3RVZA 3I55I 3B02A 1B8IA 5M5XJ 2DO7A 3E5UA 3AQCA 1YAUO 4KN7X 4G9YA 2H8WA 4GQHA 1MMGA 3KL4A 1Y8RB 1MJ9A 4CA0A 1X58A 4AE4B 1D3YA 3BG3A 2KRHA 1W7PA 3CLQA 4LJZF 2D45A 2M8GX 2KISA 4ZTJA 2CCYA 3FOPA 2CQXA 3DZAA 2JVHA 4ZYGA 3WE2A 3UGPA 2YX7A 3KP7A 3JTGA 3H1CA 4CS7A 1UG7A 1PD1A 1JGSA 2VXDA 2L9RA 2X48A 2EZKA 1AKHA 3OEOA 3O10A 1Z77A 4MLOA 4ZDPA 2V6EA 2P6SA 4NHJA 2ZC2A 3KYJA 3NYMA 4YL1A 4EWCA 3OR2C 1MMSA 4JX5A 1RKTA 3E9VA 1RR8C 2L9NA 3IRRA 2DPDA 3EGXA 1UHWA 3H5NA 3HTUA 3C1DA 4LLNA 4MNDA 3FM3A 3UMKA 1SANA 3FBIB 2XLMA 2ADUA 2O9XA 3TBIA 2DT6A 1VQ6I 3B73A 1U3EM 4ZYDA 1ZRDA 1B59A 1R58A 2P5KA 4IO9F 3UR3C 4BAYA 3JR9A 3TOBA 1ETWA 3QOEA 2JMWA 3D5SC 3DTIA 2HQ5A 4DYCA 5DM7F 1HMDA 2FJ1A 5A6BA 2JA8J 1NSGB 3F8NA 3OS1A 2XLVA 2M1BA 1R1TA 1VFCA 1XMAA 2DTZA 3FXOA 3K9TA 4OWRB 2ZKZA 5FLVA 3ASNC 2KDZA 1V5EA 2NYXA 4LG0B 1BBYA 3NYJA 3DLAA 4U7DA 3LAPA 3QW1A 1FIPA 1OISA 4M6XA 1Y0UA 2K9QA 3M8FA 2LKXA 2LK2A 3FBNB 4H4KC 3RPQA 3TOAA 4O6YA 4YT5A 1XGMA 3U2RA 4F7ZA 5E79C 1TT5B 2NUPB 4O3MA 2UZKA 3W8HA 4IRUA 5KYXB 1A6IA 1JUSA 3RZDJ 1YVIA 4M63A 4ENKA 2VQLA 2EA2A 2X6WA 4XLPF 4MTDA 3VEPA 5JVGF 3DD7A 3QZCA 3FXJA 1HW2A 3H5AA 5HNFA 3WG7C 1CPQA 3MKLA 2WVOA 2ZPAA 4O6JA 4NC6A 3KEOA 4DVYP 5H20A 2AQEA 1BBHA 3E6DA 5JP7A 1K83J 1OYIA 4XWJA 4CCKA 3ZIBA 2X1DA 2NXNB 3EHNA 5CKTA 3NAUA 2JJ7A 1K05A 2A0UA 3RH3A 3K7AJ 2DOEA 3EG9B 2ZXHA 4N9IA 2YL7A 4EVIA 2KIMA 1R71A 1T33A 4IL6C 3BR2A 2JA5J 4I0BA 2LCHA 3H9JA 4JTAB 3X2QC 5GPCA 3GF2A 1GHCA 4PJJA 2H27A 2VC1A 2PP4A 3F6VA 3TDUC 2COMA 3E1SA 4MTOA 1FOKA 2JRMA 2CV1A 5DQZA 4IXAA 4K1OA 2XB0X 4L5EA 1ZHYA 3G1MA 1FC3A 5KYYB 3VPRA 2DAOA 2D5RB 3O8GA 2P0NA 5L3QA 4Q4ZF 3SXMA 4X6AJ 3CP2A 2HTJA 2VH3A 4AU7A 1ZLJA 1OKKD 4Y3OA 4DZPA 4GCVA 3ZQHA 4BKXA 1TC3C 5CQGA 2O5RA 1ETYA 5E3OA 1QO0D 3ZGKA 2C6YA 1OKKA 4QSHA 4NNJA 4B09A 3I4PA 2KRFA 3FXUA 4E7JA 3POVA 3ABKC 3AGTA 1LEBA 2Y9ZA 2ZCWA 3BTLA 5E8GA 3ROUA 3A02A 5LHHA 3HKZN 1T8IA 1OQCA 3R7CA 1NBBA 3KKBA 3HUGB 3LSIA 4LG3A 3RYLA 5F27A 3R0AA 3QVYA 2JUCA 1YJNI 3JRMO 4PSXA 1SR2A 2IS1A 1ZHTA 2L81A 3BDDA 2G3VA 3ZTZA 3RQFA 4CO8A 2AP3A 4EM0B 2KP6A 4CYCA 1CQTA 1I3AA 1FYKA 5F28E 1CGNA 1IXRC 3PJRA 1JT0A 5LHGA 4BDZA 1JT6A 1SD6A 5D91A 2VN2A 4PR9A 2BV6A 4BHPA 2RVCA 4FQGA 3K70D 1M2VB 4F92B 2J7PA 3A9CA 1SAXA 4GXOA 4A0ZA 2W1OA 2E36A 4UB8C 2BY0A 4WWCA 2KT0A 2IS2A 4YT4A 5A6BD 4X0GA 3AG4C 5JHUA 1YZCA 4IHYA 3VB2A 4R79A 3DTKA 2L02A 4PGGA 2R5YB 2XHKA 4U5FE 1YIOA 2L9VA 1ZQ3P 1U2WA 2E71A 1F36A 1X2NA 3FXMA 3DEUA 2AXLA 5LEJA 4CJGA 1S29A 3WU0A 3JAMK 3ZCOA 2BBYA 2QGUA 2LY9A 4KICA 2H7BA 2Z16A 1NG7A 2A05A 2FAPB 3KLOA 1WFXA 5HLTA 4EJTA 1P6RA 2Q9CA 2X9DA 3GM3A 3VRCA 1FTSA 2DK8A 1D1AA 1OJLA 2QBYB 3RKOF 2I8DA 1IDZA 1SMYF 2E5NA 4IEJA 1XSDA 3CCEI 3TEDA 2ZB9A 4DZJA 1VOMA 2I5UA 2BW3B 4IRGA 3DE8A 3JYYA 3HOXJ 5ICCA 4DRHB 1FFHA 1Z3IX 1MZBA 2QM3A 2OZUA 4Y13A 3DCFA 4NTFA 2IRFG 1IDYA 2Q00A 2W24A 3HRUA 4OIQF 3MD2A 4A3BJ 2LD6A 3V7SA 2R7QA 4KA4A 2KK1A 1L7CA 1TWCJ 2X6YA 1C03A 1K61A 4RM3A 4BJ6C 1Y1WJ 1NK2P 1YYXA 2F2EA 3TP3A 3FM5A 2LOOA 3CEXA 1JAFA 2PN6A 4I02A 3VWBA 2CYDA 1CGME 2EIKC 4EBKA 2FX0A 5FZTA 3ZR8X 3F8MA 4G6DA 1F9NA 4AL1A 1MMAA 3ULQB 2VQCA 4ZYHA 4ON0A 3K4BA 2XF7A 4EIYA 2CH0A 2WZGA 2LTPA 3ELKA 5D8LB 3H5RA 2M8EA 3EYIA 2M4KA 2QY9A 3WG9A 2BE5F 2ZJQF 2Q8KA 1I6XA 1FMVA 5LGNA 2HQNA 1VQ7I 5FLXK 2X0LA 3CQZJ 1UELB 2KFDA 4U5CE 3ZQ7A 2YVKA 3G73A 2QA4I 4DRIB 3ABLC 2YWAA 2J8WA 1G3WA 5ILSA 3CF2A 2K85A 1HXDA 2QEXI 3BJAA 1M6TA 2M4EA 4GO1A 3FXKA 2PMUA 1POGA 1FP2A 1ZTRA 2IT0A 2WWYA 3LLKA 2ZMEC 5DUIA 4IHTA 3KYIA 5JS5A 4EJWA 2W4BA 3OYIA 3C63A 2YSRA 5ICFA 3U2MA 1JMWA 4JX4A 3CCMI 2EPMX 5LD2C 4K2EA 1VB5A 3TP0A 2WZLA 3Q9VA 5DCFA 4XRSG 3T6GB 1QRYA 4J7YA 1J9IA 1MBKA 2AWYA 5F08A 5DYMA 2H7VC 5JLWA 2ECBA 4LIUA 2KPMA 4BPMA 4BY7J 5IP7J 4M71A 5DD8A 1LE8A 2XAFA 4F3QA 4JW1A 2FE3A 1W5CC 4P96A 1UFBA 3SZRA 5KYYA 2V26A 2BEOA 3OL4A 2M9HA 3Q0WA 1E83A 1S9HA 1T01A 1FOXA 2OJQA 1IJWC 4IOCF 2VCAA 1IXCA 2A6TA 2BC5A 2DW4A 3GFJA 1V54C 4CICA 4E70A 4M3EA 2QKLB 5AC5A 1ONVA 4RD9A 3E97A 1IO2A 1ZELA 4CBEA 3SNHA 1XGNA 3OYAA 1ST6A 1H88C 2FMYA 5LGUA 1MJAA 3ZQCA 1K6OA 1ZRFA 2DQLA 3H36A 3RQGA 5E2QA 2JRTA 4UVCA 1ZLKA 2HKXA 3T6JA 5CQEA 2KMUA 3WTVC 1RESA 4DVZA 1FT9A 2DMUA 5TJ5E 1X1AA 3RSNA 4R1HA 2LQGA 4FX0A 1KQ9A 2NUPA 3NYLA 2ELHA 3JRIA 4ZYEA 5EDNA 4LLEA 2GBYA 2YRFA 3SFZA 2CU7A 1ACIA 1I1SA 3DLLF 3IKVA 1Z21A 4A2NB 2YPRA 2F5FA 1OCOH 1M2OA 4M9XA 3DJNB 3IWZA 1FFTC 2DMNA 5D4SA 4XNFA 4L5JA 5IY5H 2HDDA 2PLYA 3W4YA 2EPFA 5DDGA 4RB3C 1N77A 1TZLA 1W0TA 3RIPA 2L54A 2NVXJ 4C3DA 4F4BA 1IN7A 1HW5A 1IN5A 5L3DA 1YDIA 2MC3A 3BG6A 1ZAOA 1BR4A 3CJQB 1ZGJA 4HAMA 4G7OF 4B48A 2EQRA 1O57A 1ON2A 4A69C 3AG4H 4D7NA 4XKWA 4Y15A 3WGIA 1W5SA 3OSFA 1YHQI 3RDIA 1NG1A 1W5TA 3KEYA 1Q0DA 4EJOA 3MMYB 5IOYA 1DU0A 2H8AA 3GX4X 2MWQA 1BI0A 1BI1A 1ZGAA 2HKOA 1VZ0A 3WODF 2WVQA 4E6KG 4YIIA 3G2BA 2VB6A 4IHWA 2LFBA 4BXXJ 4NTBA 1VQMI 4HFKB 4AK9A 2G0EA 3D5RC 5J47A 4A5MA 3TW6A 4ZDOA 3V5ZA 3GTJJ 1FTTA 1TFOB 1BR1A 2KSFA 5IOZA 1R4MB 1U8BA 3GLXA 2F5EA 2OQRA 3TO9A 2DMPA 3CJRB 3E3VA 3R0JA 2QKMB 3IH2A 3L2RA 1YW9A 4A6EA 3UKGA 3VODA 3S17J 1SMTA 1OXKA 1SYQA 5FCLA 1KU7A 5FD6A 3L00A 3VF0A 2E5ZA 1OFCX 3Q0VA 4J19A 3PNYA 2DA1A 2D2WA 4KDPA 1BC7C 3U1KA 2DA2A 4XRSA 3RI4A 4MVZA 5IT9K 5CLSA 1UCRA 2XGXA 2ZSIB 2X0CA 1I39A 3LS1A 4Q7CA 3S2WA 2GLOA 3HOYJ 5T3TA 3K6BA 4Q48A 1I50J 3CCQI 5FRMA 1TKNA 3S93A 1SFKA 2QQBA 2HOAA 5J1RA 2HJ3A 1M57C 3FHZA 2JT1A 4I09A 5D8KB 1WN0A 3HSFA 4LLCA 1WJFA 3VAYA 2M30A 1DUXC 1QGPA 1XCVA 3RPUA 1TNSA 1USSA 2OZ6A 2NG1A 4G6TB 3DBRB 3NQOA 5FFXA 2ZNYA 4XN0A 3JSPA 4IHVA 4YT8A 3K2ZA 2GZWA 4Q47A 3QW0A 1WRJA 5FROA 1HF0A 5JRAA 1UJ8A 4XORA 3ESWB 1VQKI 2CSOA 4MVMA 5JSLA 3SXZA 3CESA 1HKTA 4A3DJ 5L0IA 2A69F 3WTWC 4EGZA 4CIPA 3BPVA 1SVOA 5JT4A 3FHNA 4XQFA 4NC8A 5GAEJ 5A6JA 3BTJA 5LRSA 1OKRA 4KNYA 4IGGA 3FZVA 3S84A 2MD0A 3I64A 2FD5A 2KJGA 3I9V2 5C4XJ 2J9UA 2GIZA 3ZQIA 4AIKA 5COFA 3O39A 2GXGA 3WHCA 2A5WA 2WTEA 1TWCA 1QZEA 2OEXA 1U5TA 1WJAA 3OR1C 5FLMJ 1BZ4A 3LLIA 2LLKA 1GXPA 1OCTC 3HHHA 1ORJA 1KU3A 1LQ1A 1KTMA 4FCYA 1O3TA 5EGOB 2K4JA 1YX3A 2W85A 4L5IA 4V2GA 2QVOA 2VJ4A 3QTHA 3I4NJ 1XS9A 1OR7A 4U5EE 3ASNH 4LK1F 2DYRC 4BBRJ 1S72I 5B1BC 1S05A 2WV0A 1BI3A 2OCCH 3ZQYA 5EJCA 3V8KA 3ISPA 1L3LA 1J7KA 2EIKH 2EB7A 2Y3HA 4LITA 5F6FA 1U9NA 4JCHA 3EUHA 4B3XA 3CC2I 2HSBA 3K0LA 2BZTA 2RD9A 1MW7A 2XVCA 3GLLA 1ZN2A 2X1CA 3HRTA 1GLNA 3KYLA 3SP1A 3IH4A 2HUJA 3C8GB 4WXHA 4IRHA 2CUJA 1HBXG 3U9MA 4CSAC 2HU9A 4BNCA 3KCCA 3U9GA 1W36D 2A3SA 4NCQA 3B6CA 4YRVA 1PJRA 1PV3A 2HV7A 5AGFA 2IAIA 4XPWA 3V5YA 4P9FA 1K4SA 2R05A 5K7FA 1E85A 1TW3A 1DU6A 2W45A 1K6YA 5C44J 2R3SA 2CW8A 1EH6A 1WPKA 5EEHA 4U0YA 1A36A 5J1YA 1WTYA 3OMYA 3GFMA 2ME6A 3DEWA 1U5TB 4Y52J 3H2VA 2V6CA 4WK8F 4TV7A 3GTKJ 2OEVA 4FE7A 2LKSA 4OIRF 3O3KA 4I76A 4OAYA 1F5TA 3BTCA 2EA4A 1ZU5A 2JD3A 3J06A 2FXAA 2VC9A 3QMKA 4LFUA 3CD6I 2R7WA 5FFZA 3LNMB 5HDKA 4XLHA 3ZMTA 2FUG2 2P81A 4KJZA 1P7JA 4QLCU 3M1CB 4ESFA 2EFWA 2DB4A 4P5OA 4BE0A 1MNEA 2C03A 3VOEA 3OIPA 4BDYA 2K3PA 1YIJI 1HE1A 2IYLD 3K1HA 2DFEA 3HHGA 4RS8A 2M3AA 2A0BA 3A0BC 4JK1X 3OY9A 3BC8A 1UZCA 3DBHB 2YR2A 3SDBA 3EJNA 2E2JJ 3FMRA 4YWQA 3NRVA 2AO9A 3GO5A 1RCPA 1X3ZB 1IZ1A 5K7HA 3CC7I 2MA3A 1FJLA 5L3VA 2LF8A 1SEUA 2MSYA 2Q2EA 1RC9A 4XSZF 2OCEA 4J01A 4NC3A 3RQIA 5E1WA 1RR7A 4ABZA 4D5FA 4BGDA 3SYNA 3CMMA 2QNLA 1IV6A 1TNTA 3C2BA 1LUJB 3J7YJ 2R92J 2YZSA 1CGOA 3B29A 3CZ6A 3JRBA 2NS0A 1Z3YA 4KMUX 3KMIA 5KHDA 4XPXA 2BY1A 5IPAA 4G0HA 2XXAB 2PNOA 2PEXA 5L3EA 2ZFUA 2BXZA 5JI6A 5HLHA 4RBNA 1OPCA 1VTNC 5TISC 1Z1DA 4CS8C 2GIVA 5IT3A 1D0ZA 1JI8A 2JPUA 4RM2A 2ZD9A 1K78B 3ZPLA 3AG3C 1FLIA 3BRJA 1T6UA 3H0GJ 4CCJA 2ESNA 2Y0SA 1VNDA 1ZZPA 3FDYA 4LDKA 2R7XA 1XD7A 1X1BA 2DPUA 1X2MA 2MC4A 3DPLC 2FFHA 2XLOA 5FKNA 2XGEA 3PUFA 4M73A 3T8RA 3GTMJ 1K4TA 4HNUA 3MKWB 3BCBA 5EZGA 2LSOA 3F72A 4D5CA 5M5YJ 4RB0A 2DN0A 1CF7B 2CGPA 2DYSC 2LDUA 1IUFA 1I3QJ 2XF6A 2BOLA 4IHSA 2HR3A 3B9QA 1OCCC 1IV8A 3FXRA 2VBXA 1AKHB 1DPUA 1S7ZA 4J00A 3NMKA 3ZC4A 2G7UA 5JLXA 2H8RA 4HBLA 2BW3A 2G3KA 3B0VC 2IW5A 3BR6A 3J81Z 4BG0A 2EIJC 2OTLI 2PF4E 1FSHA 5B3SC 1KYWA 2B63J 1ZK8A 1RUNA 4UVBA 5DCMB 4AE4A 2B7EA 3NARA 1EH7A 3GWLA 4MHGA 5EGYA 3TGNA 3IKTA 4XLNF 5E3AA 2KDOA 2IA1A 2ELKA 3EUKL 2EFOA 1M2VA 1NFOA 4MFEA 2QE9A 2XLDA 3LA3A 2J7PD 3I5PA 1BW6A 4ZLCA 3PQKA 1OCZC 5K5QA 2KIQA 3US6A 5A69A 2L7FP 5J6XA 4PK4A 3VFZA 2KYHA 3G3ZA 3LSJA 2V1XA 2EPOA 1JGGA 2DI3A 3GMEA 2HWVA 2VKDA 4CUGA 1Y0NA 2EV6A 3L2UA 5DTDA 4E7LA 1RKEA 4BE1A 4BUPA 3FXLA 3BT9A 1PP7U 1YARO 2IXNA 1EKYA 1YLFA 2OA4A 1DP3A 1LS4A 4P55A 1BA5A 2ELJA 3F47A 3ABMC 2UXXA 4HX7A 3LAJA 3H9GA 1RMVA 3HC7A 3E6CC 2DBBA 3CJTB 4IKFA 1TR2A 5IYDJ 3LMMA 4W8KA 5E18F 1QQ3A 3DI5A 3W8IA 3RZOJ 2MLKA 1IRFA 1KZHA 2I15A 1G59A 1T2KA 1K04A 1UB9A 2OF7A 3HBLA 2M87A 3VDXA 1A31A 1OMIA 1XMXA 2Y30A 2Q0OA 5FKKA 2DA5A 1ZW3A 2PJPA 3ABMH 3MZYA 3PHF2 4WF2A 1NHAA 4AYBA 1Z05A 1SFOJ 3DM5A 5HOOA 4FWVA 4WGZA 2JVGA 4MQVA 3DBLB 1SVLA 4OAZA 1LI7A 3M79A 5D92A 1HKQA 4QI0A 5HODA 3GTQJ 1JTYA 3ZDLA 2G9WA 2EILH 3LL7A 4GYGA 5K5RA 3WGHA 2HEOA 1WQ2A 1XPXA 4OMYA 2CUEA 1Z6TA 3AFHA 3S3NA 5BUOA 3HEFA 3O6BB 5IYCJ 4Y33A 2LFDA 5GAHJ 4NQWA 4EBJA 1YW8A 1ZRCA 3J80Z 3WU2C 2R0QC 2IXSA 1QU3A 2EFQA 5BNGA 1XCBA 4A3JJ 1XX5A 2VIXA 4DGWB 2JA7J 1W7PD 5KAIC 5HSWA 2Q3TA 1R36A 1C17M 2YX4A 1TBXA 5CPRB 5FGMA 1HSJA 4PSWA 2I8BA 3VSLA 2MLGA 2HSQA 1QKRA 1X1CA 3BG5A 1NU7D 1RXQA 1WOLA 1U89A 5K0IA 2LH9A 1O3RA 2IGOA 3HOUJ 5EHHA 4S05A 3IC7A 4UNOA 1MIJA 1RPWA 3B0UX 3GEEA 1ZKGA 2STWA 2FRHA 1MBHA 3LNQA 4RLFA 3I4UA 1PUEE 1YS7A 5J4YA 3ATPA 3TO6A 4LB5A 3RFYA 3B0PA 4ZDLA 2R7OA 2UWMA 1I27A 4XKVA 4ZH4F 2EH3A 1AWCA 1WATA 1U0JA 2K3FA 1USTA 2FNAA 3HGYA 1BIBA 4YG2F 3OYDA 2NS7A 3F6OA 2J45A 3U8PA 3TKYA 2MFZA 3MYIA 1T95A 1L3PA 4CYDA 1KQ0A 3RKQA 1MMNA 3V7CA 4YL0A 5KYXA 1T0FC 2IA2A 2CQNA 1QHHD 3W2VA 1ZH5A 5F1JA 3RYRA 2XF5A 3VSKA 2IBFA 4EHPA 1UFMA 2L4AA 5IYBJ 5EG0A 3K66A 4XR6A 1A5JA 1J8YF 2ETSA 3EGXB 3LAYA 2LNBA 4YIRX 4G12A 3ECHA 4HF1A 2WADA 1REPC 2FEZA 2PBIA 2RKHA 2VONA 3K1IA 3HTKC 1JJ8C 1S7AA 3AQBA 5L0FA 2VXZA 2CGEA 4XLFA 4JX6A 4U88A 3VYTB 2MBFA 3ABTA 1FAPB 1DGRM 3HOWJ 3FKIJ 2A6HF 2RNJA 2XASA 3GZNB 4EATA 1IZMA 3GYHX 2HJMA 3O55A 5AC4A 1JHHA 4BHCA 2E1CA 2AU5A 1U0BB 4FASD 2Q7RA 3TJ6A 3FISA 4WXDA 4JEAA 4XLAA 3G1LA 2RSEB 1D1CA 5A2QZ 3OYFA 3FXQA 3KLNA 1YA7O 5E17F 3SYTA 2K40A 1P7IA 1G6NA 3PL8A 3HB9A 3KZYA 3TMOA 4RAYA 4KISA 1CPRA 3QP5A 2P0WA 3CUQA 4BH9A 2LREA 3U9JA 2LKPA 3KIOA 3MEXA 3MCZA 3GFIA 1HOMA 1GM5A 1Z6RA 1ORKA 1TWAJ 3EQLF 3HYIA 2R5YA 4AUXA 2XIGA 3JSEO 2TCTA 1BIAA 4LERA 2VJJA 2XRHA 2VODA 5FJ8J 2EPLX 2VUMJ 3N97A 1R4TA 3A11A 4WX9A 2EJRA 3HNIA 5B3SH 3PM1A 4BEHB 1IW7F 1QPIA 2J9VA 4CIHA 1IAWA 3EYYA 2DU9A 1Z63A 5B3IA 2JN6A 1H0MA 2BHZA 1BOAA 3EGDB 5DM6F 5K1YA 1R49A 4MTFA 4ITVA 1MH3A 4AIJA 4X0RA 1QBJA 4II3A 3JRFA 4JBAA 3QWLA 2V7FA 1S7EA 3AL0B 5J4VA 4CXFA 4AIHA 5LFAA 4DYRA 4MW3A 5DEQA 5F0CA 3V7OA 4C2UA 1V54H 3DXJF 3HJCA 1FMWA 3JRDA 2IS4A 2DA7A 4MEYF 1HKSA 2KZGA 2R7VA 1N1CA 2OCCC 2W84A 1QVXA 1BM9A 2WVNA 3CAXA 1MDMA 3A4CA 3K10A 5AONA 1LDJA 4C3IJ 3OYJA 3KPHA 4AVPA 2QLAA 5DS4A 3OYEA 2VCBA 1VK5A 1R23A 4AWXB 4ESBA 4Y7NJ 4OINF 4NY3A 2UUIA 3K4MA 4Z2YA 1IRZA 3C8ZA 2WV1A 4Z9IA 1MQVA 2ID6A 3HPGA 2W57A 1LVAA 2I10A 2XV4S 2CW7A 1Y56A 3CCRI 1ENHA 1YRNA 3GTOJ 4F52A 2Q2EB 4A93J 2BXYA 4XLEA 1RKEB 5HS9A 3MLGA 1I6HJ 3H3UA 4L9VA 1FOWA 2CFOA 2BVMA 4YEJA 1GVDA 2HQAA 1WJCA 1H9TA 4L18B 3DWWA 1Z5ZA 1X1DA 3ECSA 3R61A 3TL4X 2HKVA 4QI2A 5FKLA 1DP7P 3LFUA 3T0YA 5COMA 1RUOA 4CGZA 2XL4A 3S90A 2R7ZJ 5GAGJ 4M72A 2KIFA 2CJJA 1GQAA 4H54A 1GGQA 2KGOA 4HE8D 2XUBA 1LFBA 1YJGA 4HX4A 1T6QA 2N8GA 4PJNA 1RKWA 5EF6A 3N2ZB 4FX5A 3K1PA 3L34A 3BZ6A 5HS8A 2XKOA 3SZGA 3DPTA 3EDPA 4FT8A 1ORSC 3OIQA 2LBFB 3CLOA 3UNGC 5FKOA 1VQOI 2AVKA 4EM1A 1X4OA 1IGNA 4MVRA 4MW8A 2R7SA 3QVZA 3PFIA 3ASOC 4HYEA 3RJPA 1BJZA 2HOTA 3ZQQA 1DQUA 1U6GA 2VBWA 2HXIA 1VQNI 1R22A 1MKMA 4IQ4A 3DAGA 4HX8A 4C9YA 1D0XA 2ZJRF 1KQ8A 3RCOA 1MD0A 4KNVA 4BHBA 1EF4A 4N4NB 4GYIA 4MNUA 3D0SA 3FX3A 3NWSA 5J40A 2QQ8A 3FMQA 3OYGA 2NUTA 3O2PE 4CCLA 3ZQLA 1K78A 3HTSB 5L0DA 3QPHA 4E7SA 5DV5A 1WGWA 3M4CA 4MVQA 4N6HA 5E3CA 1LS1A 3X1OA 2KC3A 2A07F 4HOBA 3LJBA 2YS9A 1PUFB 2XXAA 2E1MC 3QAHA 4I99C 3MQ0A 5J3LA 4BJ5C 4GDFA 5B1AH 4HLXA 1KA8A 2FMLA 3Q0UA 4CDYA 3PSFA 2L6GA 2NPUA 3EH2A 1FNTc 4QIWN 3G4XA 1WWXA 3LSRA 5BQGA 2O61A 3F46A 1G3SA 3CUOA 1HW1A 4DYQA 4YFKF 1YYVA 3OYNA 1S3JA 2DCEA 5FKMA 1Z7UA 2IXMA 4IRIA 2IS6A 2EIMC 5K5OA 3HKKA 2ZXJA 1VQ8I 2ME0A 4BXFA 1VLTA 4CDVA 2PMHA 3FF5A 5EYRA 4H0EA 3I59A 3JCUQ 2DYRH 2E2IJ 2LY2A 2HPIA 2EPNA 3GZ6A 3DF8A 4JOMA 3K6GA 4JE9A 3K69A 3GCMA 2LD5A 1LEAA 3KP3A 4LGWA 2M0MA 3PNTA 5J1UA 1SVMA 2PMZA 3AG1H 3CDLA 3KZZA 3CCUI 4KIBA 1J8MF 3ZSUA 2ZO4A 4N0BA 2VT3A 2BGCA 4M9ZA 3K7DA 3I71A 4XN3A 2KJCA 5GADJ 3Q6NA 2ID3A 5IY5C 2V9KA 3MWMA 2CQ7A 3DPUA 3N05A 5KYNA 1LVKA 1Q0MA 1JUPA 3LA7A 2OKUA 2FQ4A 2KQRA 4UUTA 4I44A 1V5FA 2TRTA 2QCOA 1VQPI 1TQGA 3W2AA 1UHSA 3G6EI 2H1KA 2GXAA 3HG9A 3GZ5A 1G3TA 2MH9A 3SJMA 1R5ID 3IAM2 4HPQA 4ZLDA 3A03A 2H09A 4M3DA 3HSRA 1ON1A 3BPXA 3MN2A 5F5HA 1LJ9A 2CWEA 4KUMA 3S28A 2CRGA 1JKRC 2B9SA 2PJRB 3S14J 4G6QA 2R93J 4BJTA 1FY7A 1IG7A 3I59B 1XDUA 2E19A 3JTHA 2OC6A 4A0YA 4IOAF 2IEKA 1OYYA 5F0FA 1FPQA 2CV2A 2DYSH 4DBQA 4WABA 2YUSA 1GDTA 1HE9A 256BA 4MVSA 5F5FA 3K4KA 2WB1N 4RGSA 3KYDB 3V8JA 3E5QA 1W4MA 1BOBA 1EA3A 3CMAI 3H65A 4JRZA 4A3KJ 1YZAA 3VYSB 3BQZA 1RIOH 1T98A 4IX7A 4CDAA 2VJ5A 3CP8A 2DODA 3L9FA 2GWWA 4O79A 5JR3A 3KP2A 4XSXF 4QDLA 1ZYRF 2XLWA 3J7ZI 1O5HA 3BG7A 3F9KA 4B8XA 4P6IC 2V9PA 1P4AA 2A1DD 5L0JA 2KZVA 5M3FJ 2Y3GA 2O8XA 5E33A 2XSDC 2CMPA 4OMZA 3BZCA 3ZOBA 3KP4A 4U9EA 4PJLA 1WCMJ 3ERED 5BQIA 4PACA 4RLQA 3JTLO 4RAGA 3ZQVA 4KI2A 2HZDA 4DNCA 3HOZJ 2JUGA 2OUMA 4LD5A 5F04A 2EFNA 1ZR4A 1HC8A 1FBSA 3S1NJ 1HY5A 2KRCA 4U87A 2VE8A 4L9TA 1Q0FA 1VLSA 2Y31A 4PDKA 2J46A 4UUSB 3P5JA 3IQTA 1EV7A 1X1PA 2HYGD 2V9VA 3WG7H 4UUVA 1Y1VJ 4FE4A 2F22A 2ZXRA 3W6VA 5JVTA 4E7HA 2HYJA 3E0JB 4AC0A 5BMZA 5DLJA 2VASA 2XS1A 4B6IA 5KYWA 4MIMA 2NNYA 2VOOA 2E34A 3PSIA 1AEPA 5GTHC 1Z6AA 1YRNB 3OSGA 3HOVJ 4BACA 1GS9A 2PG4A 3IRQA 3JRHA 3SEOA 1TL8A 5CI8A 2L0KA 4A3MJ 1J59A 4N4OB 1WASA 2VKHA 4PFPA 4YJWA 2OQGA 5HDGA 3JRCA 4KNWA 3U21A 2F48A 3ZN1A 1Q1VA 1J5YA 2XAQA 2D5VA 3GTPJ 2CNWA 4YN0B 3ZG1A 3GM2A 4DBRA 3RQ4A 3WTTC 2PQ8A 3M8JA 1E3OC 2VOPA 4C3HJ 2MHRA 3GEIA 2JZYA 1XSXA 4K0DA 5EK0A 2R4GA 1N78A 3MX3A 4BU2A 2VLAA 1WH5A 3LSKA 3OS2A 4BJ6A 1O3QA 1PD0A 1Y6DA 3GEZA 1HDPA 1J09A 1J2XA 3I0TA 3G50A 2QSGX 1A6QA 3RKYA 2M34A 3FKJA 3BOQA 1K7AA 1BL0A 1S8NA 3P9IA 4CSWA 2NVQJ 2O8KA 1R7JA 1XGOA 2DA6A 1T38A 2L6FA 1A35A 2MW8A 1EH8A 2XSJC 1ETQA 1LB2A 2P8TA 1DPRA 2QENA 1FP1D 3RKXA 4B47A 2P7CB 1B68A 4YT2A 3LA2A 1W0UA 4KYWA 2MGQA 2OV7A 1PVEA 2EZIA 2XAGA 1MBJA 3GBGA 3OYKA 2NVTJ 4HEA2 2OU6A 3DAFA 3BROA 3SFIA 1JXSA 1QHGA 5CVRA 3CC4I 3BR1A 4E0HA 1G2HA 2XKPA 3VM6A 3PNVA 2DK5A 3HPHA 4YELA 4HDUA 4JC7A 3S15J 2DTRA 3WE3A 4GGGA 2H6BA 2QBYA 3RW0A 2LMDA 4BEJA 3L2QA 3ZMDA 1JKQC 4IVNA 2IJLA 3ONQA 2ZMEA 2DJNA 1JPNA 2G62A 4M6VA 3BJ6A 3H35A 2YL0A 2GQQA 5BPIA 1VMAA 5KYUA 2XS8A 1RJ9B 2EV0A 2QZ8A 2Q4FA 1RI7A 4I6ZA 1Z7LA 4D0PA 1YE9A 3LFKA 4HNVA 2DDAA 2Y3DA 2K02A 3RQEA 3KX2A 1M1EB 1RZ4A 5AIPA 4CCOA 4CS8A 3BEHA 1N25A 3CDIA 3UMIA 1RNLA 2K9LA 2UUHA 4G7ZF 1ZHXA 3M7GA 1WH7A 2W00A 2Z2SB 4BY1J 2XL8A 3BP8A 2WY7Q 3GXOA 2Q9BA 3DJUB 5M5WJ 1K79A 2LP0A 4DRJB 2LF7A 3CO6C 5D5WB 3M07A 3CSKA 4PUSA 2J0XA 2YLIA 4JJFA 1ETVA 2Y0MA 1O3UA 1KGSA 1V5GA 2HDWA 1E0EA 3ZVRA 2NNNA 4CYCB 1JKPC 4HRIA 2PBEA 4W8PA 2ZXPA 1SF8A 2NSFA 3BZKA 5DS5A 4FAPB 2QF7A 5LEKA 2L7AA 5H6RA 3RIRA 1S6LA 4OOIA 3W6JB 4RDUA 4HDVA 3T8TA 3LWFA 1TWGA 2KKOA 3LUTB 4IF4A 3QODA 2FA5A 2ZXWC 3CCVI 1T5OA 4ENJA 3IQ6A 2K5CA 1IC8A 2FF4A 3ABKH 2DGJA 1M56C 1DGWY 1L0OC 2CS3A 4BQQA 4RBOA 3HGGA 1EKEA 2XB5A 3J80K 3F8BA 3S0XA 3TULA 4RGXA 5A6KA 4S04A 2HFHA 4I7HA 4W97A 4UV8A 5L3BA 1B1BA 5BPDA 1ITYA 1DOVA 2E1OA 5CI9A 3WAQA 2VJIA 2V79A 3L1PA 3S1RJ 1LPQA 1XWJA 3IH3A 1SD4A 3PIPF 1Z3XA 2ZBKA 5ILVA 2WBMA 4HSRA 3Q3SA 1T39A 2OQMA 3AJMA 2K27A 5E1XA 3S8PA 5E3LA 2JX0A 4FISA 2Z33A 2NRAC 5D6FA 2VQGA 3E5XA 2MABA 3LQQA 1B6AA 1TWHJ 3B71A 3X2QH 5GPGB 2HZTA 3AAFA 2V3CC 1G4DA 2MYSA 3EETA 3SZTA 1G5ZA 4MFDA 3Q7LA 3KFWX 2K9SA 1OYWA 2P5VA 4A0XA 2CUFA 1V55C 2GA2A 1IN8A 3VYRB 1FIAA 3IAS2 1WJ5A 3RKWA 1VI0A 5D5UB 4JTCB 3LESA 4XRFA 3RVYA 3OOUA 3S16J 2D1VA 5DUKA 1MNDA 5KCMA 2Y3BA 2R02A 2R5ZB 2AS5F 4AD9A 1ZW2A 2YLGA 1B9NA 4BS9A 3L8JA 4OD5A 3K4NA 3HRSA 3F21A 5FLXZ 3FDQA 3TQNA 2NVUB 2OPTA 2YL3A 1LI5A 1ZG3A 4O7GA 4R32A 1KU9A 3KZIC 3GWNA 4XMYA 3F3XA 1SFEA 2O6GE 4HEAJ 3JRAA 4HZFA 4BJ1A 3B6AA 5KAFC 2TMVP 2ZFWA 2XPVA 2X1EA 2ZJPF 1RRJA 4XEKA 2XRNA 5LRRA 1LE2A 4ETSA 1PCXA 1ZG5A 2F6CA 4AIDA 1O7FA 4HF0A 1SC7A 3DWLE 2YHSA 3CQZA 3HJEA 4NTAA 2FSWA 2LG4A 4B43A 2EZHA 1D5YA 1F43A 2QUFA 3TDZC 4CDGA 4DXWA 3WTXC 3U5SA 3M4BA 2EIMH 1MMDA 5ERIA 3F22A 3J7AY 3P7NA 2R7DA 3OYBA 3DM9B 4BQAA 3H0DA 2W48A 5LBQA 4XEFA 4XLCA 4UB6C 2W82A 1WJBA 3RYPA 3ECOA 2UXNA 5CVJA 4B3AA 1IN4A 4FX4A 1U6HA 1WJDA 4BEMJ 1LM3B 4I1MA 2IVMA 2HFIA 1FBUA 1QPMA 3F8CA 3U8VA 1LNWA 4XK4A 3EPZA 4FETA 5BS6A 3T5XA 1LPEA 1RKCA 4P9UA 4I98B 2E1MB 4UUSA 4II2A 3IL2A 2C04A 5HV9A 1KYZA 2IA0A 5J8FA 1YYJA 1ZHWA 3ZRGA 2XAUA 4M74A 1T6SA 4RAFA 5HS7A 3OYLA 3A01B 3NMIA 3DKWA 1H89C 1QPUA 5FB2A 1YTYA 4XKCA 1EJ9A 2L3DA 2Z99A 4BL0B 4JIOA 1R5HA 3BG9A 1E3PA 1NU9C 2GXBA 4NUBA 3WGGA 5DCMA 5A2QK 2ZJ2A 3ZN0A 2VC0A 3MFKA 4EBBA 2MH2A 1W7PB 2J5PA 3A01A 3HNLA 4GYTA 1W1WE 2PX0A 3WHNA 1T08B 2DT5A 3IPMO 3AG2C 3ASOH 1OW7A 3Q5FA 3KP6A 2M64A 2WB7A 5L0HA 4DQ2A 2WC2A 3C8GD 4DOZA 1GV5A 1A04A 1Z67A 5D5XB 2HVRA 3MKZA 3CDHA 3Q7GA 1P4XA 3HRMA 2GWRA 1UAAA 2BL2A 4AM3A 3I5QA 1U5TC 3CJNA 2E60A 4FHTA 1O3SA 1ZHZA 2Y69C 2QQ9A 5DS6A 3HZJA 2OJED 3H3ZA 3FAJA 4C2TA 1LIHA 4O5VA 3TW7A 2ASRA 3NKEA 3QU6A 2KIUA 2ZNZA 3K4JA 4ENMA 3EZIA 3KE2A 1WI3A 1IN6A 2HVSA 3EH1A 1OR7C 1TQMA 2VE9A 3S32A 2OG2A 3HLZA 4MTEA 1B9MA 2IGKA 3JCUC 4BQNA 1HLVA 1FWZA 2GM4A 4U7BA 2DQRA 4IQJA 3NWTA 2Z3YA 4JVSA 1I5ZA 4JP0A 1WI9A 3EUAA 1BI2A 1WHUA 2JPBA 1YI2I 5IT9Z 2E2HJ 4A12A 1V4AA 2CDQA 1EQ1A 5JVEA 3PMRA 3ZMZA 5JFRA 3TOLA 4A5NA 3CUQC 4XTKA 2P4WA 3QU3A 2WAQA 1I4ZA 5EG0B 4BE2A 1A41A 4HA8A 3TK0A 4L9NA 2K9NA 2W4MA 4YFNF 4CZCA 2FOWA 2Y69H 4HNTA 1YA9A 1P2FA 3HIFA 4HG2A 4PJ0C 4C7OB 3RTRA 3L2VA 3HUGA 3CUQB 3OYMA 1HMOA 1WJEA 3IHUA 4ANJA 1W2WA 4CSAA 1BR2A 5DQTA 1OQYA 1V3FA 2VBZA 5L3CA 2QQAA 2E87A 4LK0F 2KQ9A 4W1UA 2PJRA 2CW0F 3UMHA 4HV6A 5F1RA 1SZIA 3WHBA 3U3BA 4GEHA 3HM5A 3I5UA 5E8IA 4IARA 4A3FJ 2B0LA 2HS5A 3G4ZA 4WXCA 2RN7A 3DMDA 1JE8A 3T4RA 4A3IJ 3O8HA 2XAJA 4IAQA 2FNPA 1Z0XA 4FTHA 3DQVC 2HDCA 4XKBA 1G4US 3OWTA 2A61A 5E20A 5ICEA 3WTUC 1Y39A 3ITFA 5L3GA 1LDDA 3M1CA 1YFHA 3MYFA 3P9CA 3S1QJ 5FRNA 4DIQA 2MD5A 2WB1A 1LFUP 1A7VA 1TW2A 2LY1A 1PP8F 2QLZA 1R00A 1VQ5I 1ODDA 4G8XA 2ZXIA 5C4JJ 1PDNC 1ORYA 1QZXA 2W4SA 4CS9A 5FD5A 3PO2J 2IBDA 3G1OA 1U9OA 3CTAA 3I53A 4NC7A 2YU3A 2QTVA 1NTCA 3MVPA 3EG9A 2EIJH 3K2AA 2CFXA 5IP6A 2JQ7A 2XM0A 4M9SA 3QYBA 3IV5A 1ZU4A 2QWWA 4UV9A 4NQWB 1B8IB 4U5DE 3IQCA 4L9JA 4IZZA 2DMQA 1WKMA 2BY2A 1OCCH 2QSHX 4BBSJ 4G78A 4JEBA 4BYYA 3NKDA 1NK3P 5BOXA 3NMJA 3QPTA 3C8GA 1YJWI 4E7KA 2ESHA 4ESJA 4L0YB 1A7EA 1JUMA 2RQQA 4U5GA 4J7TA 2QUPA 5K7ZA 4X1EA 4AVZA 4MEXF 5L0CA 2GA0A 3E6MA 4R8HA 4A3EJ 1LKXA 4XICA 2IOQA 3C18A 2FOKA 5FO5A 3S2DJ 2R7TA 4XPYA 4LG0A 4A6DA 4C3BA 1U78A 3JRGA 1DDNA 4E0IA 3MKYB 1IUYA 2HI3A 2VQHA 2P6VA 3L7WA 2PX9A 3JREA 1EA8A 4JKVA 4N06A 4V19K 1AVOB 3PIOF 2QSFX 4MGRA 1XC5A 1ETOA 3HOSA 2DA3A 3QRFF 3P9KA 3Q9SA 4A4AA 2LIGA 4E7ZA 3OS0A 3DKAA 4LDRA 2ZSHB 1Y6IA 4O6MA 2L7MP 2F5CA 1RJ9A 4CCNA 3FK6A 1YOVB 1B4AA 2GOXB 5COGA 2NOGA 1FEXA 2WAQN 1OCPA 5DD4A 2QYOA 4HQEA 3FIWA 3LOCA 1R9TJ 1FZPB 1BDJB 3FXHA 1Z23A 2LBFA 3HDDA 3FK7A 2M4GA 1UG0A 2DLLA 2L2OA 3I58A 3QPSA 1OR3A 2VPRA 3SQNA 5B66C 3L1MA 4YL3A 5GP9A 2P5LC 1B72A 2XRLA 3OA1A 2HMQA 1TQPA 3DV8A 2HPMA 4P1WA 3QP6A 5TRDA 2F5VA 2KNHA 2LYCA 3BJOA 2DDBA 3R2PA 1LE4A 1XB4A 1D8JA 2HGCA 2FGYA 1E86A 2B0HA 2PI0A 2J0WA 3NRHA 3MBGA 4M3GA 3DEEA 2AHQA 4P9TA 1HCRA 3IEEA 5KYWB 1APCA 1I5NA 1EI7A 2WAFA 4EV0A 4LLLA 4YIFA 1Q0KA 3U0CA 4U5BE 1ETKA 3WU1B 1H9GA 5E3MA 2Z1DA 2X6OA 2ZXWH 4QTRA
chains in the Genus database with same CATH topology
3NYMA 3H65A 4OIRF 4EWCA 4OAYA 3VYSB 3OR2C 1ZU5A 5HVQC 2JD3A 3E9VA 3A1YA 2L9NA 4MNDA 3QMKA 4IX7A 3H5NA 3EGXA 2VJ5A 4MQ9F 3CP8A 3UMKA 4G7HF 2R7WA 4O79A 3FBIB 4XLHA 1PYVA 3K4CA 2O9XA 4QDLA 1ZYRF 2FUG2 1O5HA 3TBIA 2DT6A 1KONA 3BG7A 3F9KA 4KJZA 3M1CB 4P6IC 3Q6MA 3EZHA 3N24A 2A1DD 3BLYA 2KZVA 2IGNA 4P5OA 3UR3C 2Y3GA 1TWHA 1NZEA 3QOEA 4BE0A 3D5SC 3DTIA 1MNEA 1SAUA 2CMPA 4PFOA 2C03A 3OIPA 4BDYA 2K3PA 3HXLA 1ERDA 2IYLD 4PJLA 3K1HA 4RLQA 4KI2A 2HZDA 2M3AA 3OS1A 2H7OA 2EILC 4BEHA 5DVWA 2JUGA 2OUMA 3OY9A 3BC8A 4OWRB 3RH3A 2Q1ZB 2VL8A 3SDBA 3ASNC 3EJNA 4KITB 1V5EA 2KRCA 4YWQA 2DXIA 4U87A 3NYJA 1OCRC 3DLAA 3FHDA 3HL2A 2J46A 5L3VA 3FBNB 4H4KC 3EFOB 4O6YA 4YT5A 1QLEC 4J01A 2L9SA 2ZXRA 3DJNB 4I3MA 4YN0B 4E7HA 4BGDA 3E0JB 2NUPB 5DLJA 2VASA 2XSEA 3SYNA 1VYKA 3W8HA 3CMMA 4DJAA 2YZSA 4IRUA 4B6IA 4M63A 5KYWA 5KYXB 2VQLA 2X6WA 4XLPF 3PSIA 3CZ6A 3DD7A 3KH2A 3QZCA 1Z3YA 4F91B 3KMIA 3H5AA 5KHDA 5HNFA 1Z6AA 2ZPAA 2WVOA 4G0HA 3WG7C 4BACA 3SEOA 2XXAB 4DVYP 2ZFUA 5CI8A 2AQEA 4BQOA 4CS8C 4N4OB 1JI8A 1D0ZA 5B1AC 4RM2A 3I3LA 4XWJA 2VKHA 4PFPA 2X1DA 4CCKA 4YJWA 1P9QC 3AG3C 5CKTA 3EHNA 4ZYAA 4KNWA 3W3CA 3U21A 2IXPA 4CCJA 1KU2A 2Y0SA 3EG9B 5T1DB 3ZXSA 3ZG1A 2CNWA 2ZXHA 1AA7A 3S3MA 3FDYA 3RQ4A 1N75A 3M8JA 4DBRA 2R7XA 1X1BA 2MC4A 2L7KA 3DPLC 3H9JA 2FFHA 4K0DA 3X2QC 2R4GA 4PJJA 1N78A 3MX3A 2X51A 4BU2A 2VLAA 2PP4A 2DOAA 3LSKA 4HNUA 3OS2A 4BJ6A 3MKWB 3BCBA 4ULWA 1PD0A 3E1SA 3DTEA 1X4PA 1J09A 4ZJZA 2DYSC 2CV1A 5DQZA 4OIOF 2XF6A 3FKJA 2BOLA 3B9QA 1OCCC 1ZHYA 5KYYB 4CSWA 2XDVA 2D5RB 3EUHC 5L3QA 1S7ZA 3O6XA 4Q4ZF 2V4JC 4J00A 2A6EF 3GANA 3CP2A 3GODA 2VH3A 4AU7A 2XSJC 4I1OB 2G3KA 3ZC4A 4YT2A 2BW3A 4B47A 1OKKD 3B0VC 4Y3OA 4BG0A 2EIJC 3OYCA 4KC9A 2PF4E 5B3SC 2OV7A 2O5RA 3GBGA 5CQGA 3ZGKA 3OYKA 2J9WA 4HEA2 3DAFA 1OKKA 3LNRA 4AE4A 1QHGA 4NNJA 4RMNA 3IUOA 5EGYA 4E7JA 4XLNF 5E3AA 3POVA 2KDOA 3PNVA 3HPHA 3EUKL 4YELA 1M2VA 2XC7A 3ABKC 4IAOA 3EPVA 3QYFA 2J7PD 3I5PA 4ZLCA 1OCZC 3KKBA 4BEJA 3H9QA 3L2QA 3HUGB 5KNLA 2YEVA 3LSIA 2V1NA 4LG3A 3ONQA 3RYLA 1JPNA 3S27A 2G62A 3E70C 1G8XA 4PK4A 3H35A 4PSXA 4E4HA 2IS1A 1ZHTA 2L81A 2G3VA 1VMAA 5KYUA 1RJ9B 2VKDA 4CUGA 4E7LA 2CNWD 3LESA 3L2UA 2KP6A 4BE1A 4BUPA 1Z7LA 2IXNA 3L0IA 1YE9A 1DP3A 3S3OA 2Y3DA 2ELJA 3PJRA 3F47A 3ABMC 4BDZA 4CS8A 3KX2A 5D91A 5TGTA 4CCOA 3H9GA 3HC7A 4IKFA 3UMIA 1TT0A 2K9LA 3LMMA 4F92B 3K70D 1M2VB 3D5LA 1TR2A 1TWAA 2J7PA 2PFDA 1ZHXA 4W8KA 1LDKB 3W8IA 4G7ZF 1G59A 2W00A 2Z2SB 2W1OA 3DJUB 2WY7Q 3VDXA 2Q9BA 2IS2A 2RNGA 2PX3A 4X0GA 3AG4C 4YT4A 3CSKA 4PUSA 2J0XA 4JJFA 3PHF2 4R79A 3DTKA 4U5FE 4AYBA 3DM5A 5HOOA 4FWVA 2ZXOA 1V5GA 2DT7B 2JVGA 4QPOA 2HDWA 1E0EA 3ZVRA 4OAZA 4HRIA 2Z15A 5D92A 4QI0A 2ZXPA 1SF8A 3DU5A 3LL7A 5DS5A 3ZCOA 2L5QA 4JQFA 2Q9AA 3AFHA 2H7BA 2Z16A 3S3NA 1TWGA 5BUOA 1NG7A 2KHMA 4XOTA 3QODA 1WFXA 4Y33A 3DU6A 5HLTA 2KW3C 2Q9CA 2ZXWC 2K5CA 1FTSA 1D1AA 3L2WA 3RKOF 2I8DA 2E5NA 1SMYF 4F93B 2DGJA 2IXSA 1QU3A 1DGWY 1M56C 1R6RA 1VOMA 2BW3B 2CS3A 4ZC3A 4BQQA 1FFHA 4B44A 1Z3IX 4O6NA 3S0XA 2VIXA 4DGWB 1YX5A 1OCOC 5HSWA 2Q3TA 5CI9A 5CPRB 2VJIA 4PSWA 2I8BA 4OIQF 3MD2A 4XM3A 3VSLA 4OIPF 2R7QA 1X1CA 1NU7D 4IWBA 2X6YA 1Z3XA 2LH9A 2IGOA 4RM3A 2WBMA 4HSRA 5EHHA 2JSPA 4BJ6C 2B0JA 3S8PA 3FVYA 3B0UX 2LOOA 3A2KA 4KBLA 5E33A 3VWBA 1O87A 2VQGA 2EIKC 2MABA 3NG1A 3ZR8X 4RLFA 3JRTA 3I4UA 3RFYA 1MMAA 2VQCA 3K70C 2V3CC 3K4BA 2XF7A 2MYSA 2CH0A 4ZDLA 3B0PA 2WZGA 2R7OA 3HKZA 2UWMA 3Q7LA 4XKVA 5T3WA 3H5RA 4CH7A 1U0JA 2M4KA 2QY9A 3OL3A 1V55C 3VYRB 2BE5F 3AG1C 3IAS2 1WJ5A 4Y4RA 3OYDA 2J45A 1FMVA 2MFZA 1T95A 3OOUA 4RDAA 1UELB 1MNDA 5KCMA 2Y3BA 1MMNA 4U5CE 5KYXA 1T0FC 4OD5A 4BS9A 1QHHD 4C30A 2BVLA 3K4NA 3W2VA 3ABLC 3N0TA 3FDQA 2XF5A 3CF2A 3VSKA 1JPJA 3BCAA 3VYUB 2M4EA 4JJGA 3V42A 4O7GA 2CUZA 3LLKA 2M7BA 1IRXA 4XMYA 3K66A 4XR6A 4HEAJ 3EGXB 1J8YF 4BJ1A 3C2HA 3LAYA 2W4BA 2LRDA 2WADA 2X1EA 3OYIA 3LS0A 4Q5SF 4HSTA 1PCXA 4HFFB 2GOMA 3LSGA 2JA2A 5LD2C 3AQBA 3HTKC 2VXZA 2CGEA 4K7BA 2HVQA 2F6CA 4XLFA 2WL8A 3CQZA 3DWLE 3VYTB 2WZLA 2YHSA 1DGRM 2X6XA 4XL9A 2LG4A 4B43A 2VPLA 3TD7A 2A6HF 4EATA 1D0YA 1IZMA 2H7VC 5DS4A 1MMDA 4LIUA 3AKZA 3J7AY 2KPMA 2X85A 4FASD 2GFHA 4F3QA 3OYBA 1HA8A 3DM9B 4JW1A 3H0DA 4XLAA 3SZRA 5KYYA 4XLCA 3JSZA 1D1CA 2V26A 2W82A 1WJBA 3OYFA 2EINC 3OL4A 3SYTA 3PL8A 3W2WA 1WJDA 1S9HA 3TMOA 4KISA 3ZIBA 4I1MA 2P0WA 2LREA 2A6TA 3SEQA 1V54C 3EPZA 4FETA 2QKLB 3EQLF 2E1MB 4RD9A 4II2A 2C04A 1ZELA 3IP4B 4LERA 2VJJA 2XRHA 1ZHWA 3ZRGA 2XAUA 3EGDA 2R7RA 3OYLA 4CBEA 3SNHA 3OYAA 1ST6A 3T6BA 4XKCA 4BEHB 2LSEA 4XONA 1IW7F 2J9VA 4BL0B 4IJJA 5E2QA 4CIHA 1Z63A 1NU9C 3T6JA 4NUBA 4EBBA 5CQEA 3RPUD 4QPQA 2KMUA 3EGDB 4GYTA 4BJ5A 2CV0A 2PX0A 2WAEA 3AG2C 4DVZA 4X0RA 4ITVA 1X1AA 3RSNA 2WB7A 4II3A 4PJMA 4DOZA 1NG6A 2AQFA 2V7FA 2NUPA 3NYLA 2WA0A 2HVRA 3AL0B 5KYUB 1LFPA 3MKZA 3Q7GA 4LLEA 5LFAA 1UAAA 2Y39A 2KL4A 3SEZA 3I5QA 2Y69C 2E60A 1ZHZA 1Z21A 2WY8Q 4C2UA 3V7OA 1M2OA 4A2NB 5DS6A 2LC2A 1FFTC 2L9JA 3DXJF 3FAJA 4C2TA 1FMWA 2IS4A 4XNFA 3HJCA 3K33A 4JZAA 2R7VA 2P7VA 3NKEA 1N1CA 3K4JA 2OCCC 1N77A 1TZLA 2WVNA 2WZFA 3EZIA 3RIPA 3A4CA 3K10A 4C3DA 4F4BA 3OYJA 2HVSA 3EH1A 1OR7C 3BG6A 2W7NA 3S32A 3CJQB 1BR4A 4KT6A 3OYEA 2OG2A 2IGKA 4BQNA 1VK5A 4B48A 4G7OF 4NY3A 4OINF 3K4MA 4XKWA 4U7BA 4IQJA 3NWTA 1NG1A 4JVSA 2IGMA 3DKYA 3HPGA 3KEYA 3EUAA 2CW7A 1Y56A 3MMYB 3LSHA 1W36C 2CDQA 2MWQA 4CS9C 3HOTA 3PMRA 4F52A 2Q2EB 4XLEA 1VZ0A 4XTKA 3MLGA 2WAQA 4OD4A 2WVQA 4BE2A 4E6KG 3WODF 4C3EA 2CFOA 2BVMA 4YEJA 2W4MA 3G2BA 2F4IA 2HQAA 1WJCA 2VB6A 4CZCA 4AK9A 4HFKB 4HNTA 3D5RC 4HG2A 1Z5ZA 1X1DA 3ECSA 4C7OB 1BOBA 3RTRA 3TL4X 3L2VA 4ZDOA 4LIVA 3OYMA 4QI2A 3JT1A 1WJEA 4ANJA 1BR1A 3LFUA 4CCMA 1BR2A 1W2WA 2XL4A 5DQTA 4CSAA 4WJ0A 2E87A 3CJRB 2KQ9A 2QKMB 3L2RA 3JYHA 2PJRA 2CW0F 5FCLA 3K1IC 2NUTB 3UMHA 1SZIA 2KGOA 4HE8D 2E5ZA 4GEHA 4D9JA 3PNYA 3DMDA 4PJNA 3EHMA 3N2ZB 4FX5A 3L34A 3T4RA 3SZGA 3DPTA 3DQVC 4XKBA 2ZSIB 3OIQA 3OWTA 4FESA 2LBFB 3PFYA 3UNGC 3ITFA 3LS1A 4Q7CA 4U5HA 3M1CA 5T3TA 3K6BA 3NDBB 1X4OA 2R7SA 5FRMA 5FRNA 3ASOC 1TKNA 4DIQA 3S93A 1SFKA 2WB1A 2K9MA 3ZQQA 1M57C 1DQUA 3HLZA 4LLCA 1WJFA 2LY1A 3VAYA 3S29A 4IQ4A 2IXOA 3DAGA 4C9YA 4JURI 1D0XA 2ZXIA 3RCOA 1QZXA 4KNVA 2NG1A 2W4SA 4G6TB 4N4NB 4CS9A 2DJIA 3NWSA 4LACB 2KLOA 4NC7A 4XN0A 2QTVA 3OYGA 2NUTA 3EG9A 1X19A 4YT8A 1OLTA 4CCLA 3QYBA 2HV6A 5FROA 4E7SA 1WGWA 1ZU4A 4NQWB 4U5DE 2HNHA 4XORA 5E3CA 1LS1A 4IZZA 3X1OA 3CESA 3LJBA 2A69F 3NKDA 2XXAA 2E1MC 3DKXA 3FHNA 4XQFA 4BJ5C 3VYWA 4NC8A 3K4LA 3PUBA 3PSFA 2W9YA 4E7KA 2MD0A 3EH2A 4E7IA 3F46A 2KJGA 3I9V2 2J9UA 2RQQA 4D1QA 3O39A 3OYNA 4U5GA 2DCEA 2IXMA 4C7OA 2EIMC 2A5WA 2IS6A 2UV1A 1TWCA 4AVZA 4BXFA 1D1BA 3EFOA 2A68F 1LKXA 1WJAA 3OR1C 4AX2A 2IOQA 3JCUQ 3LLIA 2R7TA 2LY2A 2HPIA 4C3BA 4JOMA 3K6GA 1YX3A 4GRIA 3MKYB 2M7AA 4XOPA 2VQHA 2P6VA 4N06A 2M0MA 3C2GA 3PNTA 2VJ4A 5JHFA 2PMZA 3UGOA 4U5EE 4F55A 3HOSA 2NOJB 2DYRC 1J8MF 2UUZA 3ZSUA 2RREA 4E7ZA 3OS0A 4ZTFA 3K7DA 3Q6NA 5B1BC 4XN3A 4O6MA 2ZSHB 1Y6IA 5IY5C 2V9KA 3DPUA 3N05A 4CCNA 1RJ9A 5KYNA 1LVKA 3QYEA 2GOXB 2KQRA 3LEVA 2R7UA 1V5FA 2Y3HA 4I44A 4LITA 1VYIA 3W2AA 4J32B 4JCHA 3AL0C 1Z23A 2LBFA 4B3XA 4J30B 3OYHA 2M4GA 1UG0A 2L2OA 1MW7A 3LSMA 5HNHA 2X1CA 3KYLA 1GLNA 3SP1A 3AQCA 3HG9A 3OA1A 4HPQA 3IAM2 2CUJA 2HPMA 4ZLDA 4P1WA 1MMGA 4CSAC 2HU9A 1W36D 2F5VA 3KL4A 5F5HA 4CA0A 4AE4B 4YRVA 2KNHA 1PJRA 2LYCA 3S28A 2KRHA 2PJRB 2HV7A 2FGYA 4BJTA 2J0WA 4ZTJA 3NRHA 2W45A 1K6YA 3DEEA 2JVHA 3DZAA 2OC6A 3IEEA 5KYWB 2CW8A 2CV2A 3UGPA 4CS7A 4DBQA 2WAFA 1PD1A 2VXDA 3OMYA 4U5BE 5F5FA 3OEOA 3K4KA 2Z1DA 4MLOA 2V6EA 4ZDPA 4RBNA 1EA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJT A;  3CZ6 A;  4BJ6 C;  3OWT A;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 2VT2 A;  1NH3 A;  4V2F A;  2Z5U A;  5HVQ C;  1XGS A;  1FX7 A;  3A1Y A;  4MQ9 F;  1VF9 A;  4NDL A;  1JTX A;  5IP9 J;  4G7H F;  2ICW G;  3FOO A;  1PYV A;  3K4C A;  4HQM A;  2LK4 A;  4IHX A;  3WTS C;  1KON A;  4L6R A;  3ZWI A;  2Y9Y A;  3Q6M A;  3EZH A;  3N24 A;  1FOY A;  3BLY A;  2DA4 A;  2IGN A;  2L01 A;  1TWH A;  4CS9 C;  2P6T A;  2X4H A;  1SAU A;  3COA C;  1G3Y A;  4PFO A;  3HXL A;  1ERD A;  4NB5 A;  1T6I A;  3ZTM A;  4N6C A;  1T9K A;  2XAH A;  3BWG A;  5GPA A;  1AOY A;  4EKW A;  2DMT A;  2EIL C;  4BEH A;  2O9L A;  2H7O A;  5DVW A;  1T56 A;  4EMS A;  1APL C;  2Q1Z B;  2VL8 A;  1D5V A;  3OV8 A;  4KIT B;  4E18 A;  2OBP A;  3M1E A;  3V7R A;  2DXI A;  2XM4 A;  1OCR C;  3FHD A;  1XSV A;  1WWP A;  2M5W A;  3SZP A;  1F1Z A;  3HL2 A;  3CF5 F;  3JAM Z;  4I2O A;  3QQA A;  3EFO B;  1UG2 A;  5GTI C;  1P4W A;  1QLE C;  2L9S A;  4I3M A;  5BQT A;  3L8I A;  1Q0G A;  4N4W A;  5LHI A;  2NSG A;  5B1B H;  1HST A;  1VYK A;  2XSE A;  3IQ5 A;  4DJA A;  2R5Z A;  4U9D A;  3CMY A;  2EK5 A;  4EM2 A;  3H92 A;  3KH2 A;  4UXN A;  4F91 B;  5CVV A;  2M0C A;  2DFI A;  4M3B A;  2L4M A;  2XGC A;  1Z7Q c;  4WCG A;  2DOF A;  2E7W A;  3KEQ A;  4BQO A;  4KIF A;  5B1A C;  2VBY A;  4EEF G;  3I3L A;  4ONS A;  2DFF A;  1NLX A;  1JOG A;  1P9Q C;  4U0V A;  4ZYA A;  4EJU A;  3W3C A;  3GM1 A;  2IXP A;  1KU2 A;  1FTZ A;  5T1D B;  3ZXS A;  1AA7 A;  3S3M A;  1A7D A;  1XZP A;  1N75 A;  2H94 A;  4AL0 A;  3HSE A;  1VQ4 I;  2L7K A;  3BTI A;  1XMK A;  3LSP A;  3CO7 C;  1OCZ H;  4B4C A;  1AU7 A;  4MVU A;  2HQR A;  2X51 A;  3ZQG A;  1E17 A;  2DOA A;  1ZAR A;  3E6B A;  3V8L A;  1QNT A;  4ULW A;  3PDM P;  4D7M A;  3DTE A;  3ZP5 A;  1BC8 C;  1X4P A;  4ZJZ A;  3GTL J;  1IRG A;  1QVU A;  4OIO F;  3QOP A;  3U3F A;  1OR2 A;  1OXB A;  2XDV A;  2LVS A;  2ACJ A;  3EUH C;  3O6X A;  2V4J C;  2A6E F;  2Y2Z A;  3GAN A;  1UHM A;  3GOD A;  4LOC A;  4I1O B;  2DFH A;  3S9O A;  1VQL I;  3TJ5 A;  1YIT I;  3OYC A;  1SFU A;  2P1A A;  4KC9 A;  1V74 B;  4PCQ A;  1XTA A;  2J9W A;  4HF2 A;  6PAX A;  3TQO A;  3LNR A;  5D6E A;  3D1N I;  4RMN A;  3IUO A;  4PGH A;  3REO A;  1SD5 A;  2VI6 A;  1QZZ A;  4IB4 A;  4IAO A;  2LFF A;  1TTY A;  2XC7 A;  3BY6 A;  1NZE A;  2OD5 A;  3QYF A;  3EPV A;  3W6K B;  1O7L A;  1MBF A;  2EBI A;  3H9Q A;  5EEG A;  4L0Z B;  5KNL A;  2YLD A;  2YEV A;  4I0A A;  1QVT A;  2V1N A;  3JW4 A;  5M3M J;  5L0G A;  1GT0 C;  3S27 A;  3E70 C;  1G8X A;  4HW0 A;  2P61 A;  3ML6 A;  4XEV A;  4E4H A;  2EWN A;  3K1M A;  2CYY A;  4PZJ A;  1YJ9 I;  3FMS A;  9ANT A;  3AG3 H;  5HDN A;  2CNW D;  2Y75 A;  1O4X A;  2R03 A;  3L0I A;  1U8R A;  2KJB A;  2CQK A;  4AYB N;  2LP4 A;  3S3O A;  2HZ8 A;  5TGT A;  1ETX A;  3C62 A;  3V5X A;  3GWZ A;  1TT0 A;  1XN7 A;  4CZZ A;  1TWA A;  2PFD A;  3D5L A;  2OU2 A;  2STT A;  3BR5 A;  1LDK B;  4D4N A;  1FYM A;  1XZQ A;  5D5V B;  4ZZL A;  1YO5 C;  2PX3 A;  2RNG A;  4CJO A;  1I1G A;  5ED4 A;  4XQ1 A;  2RGV A;  3G71 I;  4G94 A;  3I56 I;  1FNN A;  1P92 A;  2ZME B;  1YQA A;  2DT7 B;  3DP7 A;  4QPO A;  4C3J J;  2ZXO A;  5L3F A;  2Z15 A;  4ER9 A;  1TP4 A;  3FAP B;  1V4R A;  3DU5 A;  3ZQF A;  2L5Q A;  4M6Y A;  4JQF A;  2O3F A;  2Q9A A;  5J8C A;  1Z91 A;  4MVO A;  5E1Z B;  2KHM A;  4XOT A;  1J0R A;  2E7X A;  3M9A A;  2KW3 C;  3DU6 A;  4KN4 X;  4DJ9 A;  1ZGW A;  1JKO C;  3L2W A;  3SXK A;  2PMZ N;  4RB1 A;  3ABU A;  4F93 B;  5ILU A;  3S2H J;  2TDX A;  3PCV A;  3FWE A;  1GVJ A;  1R6R A;  1BJA A;  4ZC3 A;  1R5G A;  4WGY A;  3TOM A;  5KVR A;  4IPA A;  5B5E C;  4N9H A;  4B44 A;  2IM8 A;  1F1M A;  4O6N A;  1YX5 A;  1OCO C;  2O03 A;  2R7F A;  1E3H A;  1ZG1 A;  2Y48 A;  1FSE A;  2JWT A;  1XDS A;  4OU0 A;  4XM3 A;  4OIP F;  4EUK B;  1E84 A;  3PO3 J;  2W25 A;  2ETH A;  2JPC A;  4IWB A;  1BW5 A;  1Q1H A;  4ASN A;  2FBK A;  2JSP A;  1C0W A;  4ULV A;  2B0J A;  5C3E J;  3KET A;  3FVY A;  4Z9J A;  3A2K A;  4KBL A;  4LB6 B;  2RC4 A;  1GXQ A;  4IJA A;  1O87 A;  1TFK B;  1F4K A;  4ENN A;  3NG1 A;  2VCC A;  3JRT A;  1FBQ A;  3M8E A;  1IF1 A;  3K70 C;  1I4Y A;  2HXO A;  5EZH A;  5T3W A;  2XPU A;  3HKZ A;  2NVY J;  3DE9 A;  1JHF A;  2RAE A;  2L6H A;  4CH7 A;  3OL3 A;  4YFX F;  2RDP A;  3F0C A;  3AG1 C;  5F64 A;  2IP2 A;  4Y4R A;  3J81 K;  2O0Y A;  4RDA A;  1R4N B;  1YW7 A;  1MSF C;  3AOU A;  2V1D A;  3C7J A;  2EFP A;  2BVL A;  4C30 A;  1QA6 A;  3N0T A;  1Z9C A;  1JPJ A;  3BCA A;  3VYU B;  5A6A A;  3U1D A;  4JJG A;  3V42 A;  2YL1 A;  3JZ0 A;  2CUZ A;  4LMY A;  1X3U A;  2M7B A;  3BQY A;  1IRX A;  3HNJ A;  3G4S I;  3C2H A;  1KNY A;  3MZH A;  2LRD A;  3LS0 A;  1E2X A;  1TQI A;  2EZL A;  4HST A;  1ULY A;  4Q5S F;  4HFF B;  2GOM A;  3LSG A;  2JA2 A;  1ZRE A;  2JA6 J;  1OCR H;  4K7B A;  4UVA A;  2GA1 A;  2HVQ A;  5LGT A;  2WL8 A;  1FR0 A;  1NFN A;  3H2U A;  2PFB A;  2X6X A;  4KT5 C;  1ZVZ A;  4XL9 A;  3LST A;  2VPL A;  4LDQ A;  2K86 A;  3RF3 A;  3ERM A;  3TD7 A;  4BXU A;  5ICG A;  2JSC A;  2A5Y B;  1D0Y A;  5H6Q A;  2BHY A;  2J5O A;  3AKZ A;  2ISY A;  3QPL A;  2X85 A;  2D1H A;  2GFH A;  1HA8 A;  2XGD A;  2EPK X;  3ZMS A;  2MG4 A;  3JSZ A;  4RGU A;  4A3L J;  2EIN C;  2F5D A;  1CF7 A;  3GUD A;  3W2W A;  3SDG A;  4QWQ A;  1S7O A;  3ABL H;  2GAU A;  2JK3 A;  2HOE A;  4RGR A;  3SEQ A;  4XBF A;  1MSE C;  3CME I;  3S1M J;  4MO7 A;  3BR3 A;  4E17 A;  3IP4 B;  3EGD A;  3LEO A;  2R7R A;  5LLQ A;  2J9B A;  3R60 A;  1AHD P;  4KIG A;  3F23 A;  2NAZ A;  3L09 A;  3T6B A;  2BYV E;  2LSE A;  3L2C A;  4XON A;  1CGP A;  3MAJ A;  4IJJ A;  3AG2 H;  4C2M J;  4RA2 A;  1Y8Q B;  3T1B A;  1QQI A;  3RPU D;  4QPQ A;  4BJ5 A;  2CV0 A;  2E35 A;  2WAE A;  3TO7 A;  3C3W A;  4Z6Y A;  3R6S A;  4PJM A;  1NG6 A;  2IPQ X;  2XLH A;  2EIN H;  2AQF A;  1RET A;  2WA0 A;  1TWF J;  1VQ9 I;  1LFP A;  1B72 B;  5KYU B;  4Y17 A;  4HLY A;  1XG1 A;  4NQF A;  1IXS B;  2Y39 A;  2KL4 A;  3SEZ A;  1MGT A;  3CCL I;  2WY8 Q;  2LC2 A;  1OW6 A;  2L9J A;  4DW6 A;  4JZA A;  3K33 A;  2P7V A;  4KMF A;  4Z9H A;  5EEA A;  5JUA A;  2WZF A;  3CCJ I;  1MNM C;  1PUF A;  4UHT A;  5E3N A;  1HDD C;  1STZ A;  2W7N A;  4KT6 A;  1A0B A;  2HTS A;  3GOR A;  1J75 A;  1ZR2 A;  2R25 A;  4M3F A;  5CVU A;  1SD7 A;  3DKY A;  2IGM A;  5H2F C;  3N4M A;  2RQP A;  3CCY A;  5CYV A;  5KK1 A;  1W36 C;  3LSH A;  1SFX A;  4EQQ A;  2NS8 A;  3HOT A;  4KFC A;  2CQQ A;  3M15 A;  1T0F A;  1JJ6 C;  1H7I A;  4OD4 A;  1WGX A;  2FU4 A;  4C3E A;  2F4I A;  1MBE A;  2OTJ I;  1C02 A;  3V4G A;  1WZ2 A;  1TWG J;  1WSU A;  4I01 A;  4LIV A;  2GDC A;  3JT1 A;  4CCM A;  2XRO A;  1OW8 A;  3HNK A;  4NBQ A;  4WJ0 A;  2VKV A;  3KYC B;  3JYH A;  3K1I C;  2LR8 A;  1TLH B;  2COB A;  2NUT B;  3I54 A;  2YU9 J;  3K1N A;  1GV2 A;  5DS9 A;  2Y0S N;  1LE8 B;  1AUE A;  3DFG A;  4GFB A;  4D9J A;  1S5L C;  2BY3 A;  1D8K A;  2RV8 A;  3EHM A;  1YG2 A;  5AIQ A;  1GUU A;  3R4K A;  1V55 H;  5EGO A;  5JLI A;  5CVI A;  1ZHF A;  5F0H A;  2HMZ A;  2FBH A;  4FES A;  1UMQ A;  2CO5 A;  3PQJ A;  3NEU A;  2YKZ A;  4EGY A;  3PFY A;  2Z9O A;  4A2U A;  3I4M J;  4EJV A;  4U5H A;  4YK5 A;  1VTM P;  3NDB B;  3GFL A;  3GW2 A;  4RB2 C;  2GAQ A;  2K9M A;  2O7O A;  4A3C J;  2EV5 A;  1H8A C;  2F4M B;  3S29 A;  2K7L A;  2G7H A;  3OIO A;  2XPW A;  2IXO A;  4JUR I;  4A3G J;  1MBG A;  1X3W B;  1QSP A;  2FBI A;  5HLI A;  2D4U A;  4MTG A;  4ZZD A;  2DJI A;  4LAC B;  1YS6 A;  2KLO A;  2R9R B;  4UY8 I;  3SHF A;  1WVR A;  4MS2 A;  1H6G A;  3CCS I;  4RAZ A;  5TJJ A;  1X19 A;  3H3V K;  1OLT A;  4JCZ A;  4CHU A;  2HV6 A;  4D4X A;  3J7A O;  3E7L A;  3SXY A;  2HYF A;  2HNH A;  1YLM A;  3M3Y J;  3WTY C;  2P7V B;  4XRM A;  2AXT C;  2M45 A;  2F4O B;  3DKX A;  2JTV A;  3LQR A;  1R1V A;  3OOP A;  3WTZ A;  3MFN A;  3VYW A;  1QZY A;  4HV5 A;  2FQ3 A;  3K4L A;  3PUB A;  2V1U A;  2W9Y A;  3AGU A;  4E7I A;  1HQC A;  4U0W A;  3F8F A;  1FYL A;  5BQH A;  3GVA A;  3A0H C;  2K4B A;  4D1Q A;  4C7O A;  2UV1 A;  1D1B A;  2OAZ A;  3EFO A;  2A68 F;  2ISZ A;  4AX2 A;  3BR0 A;  1JRA A;  4S0H B;  2H1L A;  2ECC A;  5CIV A;  1BN5 A;  4CX9 A;  4GRI A;  3M4O J;  2M7A A;  1MH4 A;  1K40 A;  2YQY A;  2CG4 A;  4XOP A;  1MDM B;  2L7Z A;  3C2G A;  2VKE A;  5HLG A;  5JHF A;  4B1R A;  4JTD B;  2OOC A;  3UGO A;  4F55 A;  2NOJ B;  3U2L A;  3IWF A;  2UUZ A;  2M2E A;  3ZMV A;  1DOW A;  1Y4C A;  1MJB A;  3KP5 A;  2RRE A;  3GTG J;  3JSO A;  4XID A;  4ZTF A;  3T9O A;  3MZ8 A;  4UDV A;  2AWC A;  1G4W R;  1JR8 A;  3QYE A;  4LLG F;  3GEH A;  2XLE A;  2R7U A;  3LEV A;  1R1U A;  3ZMU A;  1VYI A;  4JYK A;  5D4R A;  2XL6 A;  3AL0 C;  4J32 B;  4J30 B;  3OYH A;  2HOS A;  2H6C A;  2E1N A;  3LSM A;  5HNH A;  5CJ9 A;  3RVZ A;  3I55 I;  3B02 A;  1B8I A;  5M5X J;  2DO7 A;  3E5U A;  3AQC A;  1YAU O;  4KN7 X;  4G9Y A;  2H8W A;  4GQH A;  1MMG A;  3KL4 A;  1Y8R B;  1MJ9 A;  4CA0 A;  1X58 A;  4AE4 B;  1D3Y A;  3BG3 A;  2KRH A;  1W7P A;  3CLQ A;  4LJZ F;  2D45 A;  2M8G X;  2KIS A;  4ZTJ A;  2CCY A;  3FOP A;  2CQX A;  3DZA A;  2JVH A;  4ZYG A;  3WE2 A;  3UGP A;  2YX7 A;  3KP7 A;  3JTG A;  3H1C A;  4CS7 A;  1UG7 A;  1PD1 A;  1JGS A;  2VXD A;  2L9R A;  2X48 A;  2EZK A;  1AKH A;  3OEO A;  3O10 A;  1Z77 A;  4MLO A;  4ZDP A;  2V6E A;  2P6S A;  4NHJ A;  2ZC2 A;  3KYJ A;  3NYM A;  4YL1 A;  4EWC A;  3OR2 C;  1MMS A;  4JX5 A;  1RKT A;  3E9V A;  1RR8 C;  2L9N A;  3IRR A;  2DPD A;  3EGX A;  1UHW A;  3H5N A;  3HTU A;  3C1D A;  4LLN A;  4MND A;  3FM3 A;  3UMK A;  1SAN A;  3FBI B;  2XLM A;  2ADU A;  2O9X A;  3TBI A;  2DT6 A;  1VQ6 I;  3B73 A;  1U3E M;  4ZYD A;  1ZRD A;  1B59 A;  1R58 A;  2P5K A;  4IO9 F;  3UR3 C;  4BAY A;  3JR9 A;  3TOB A;  1ETW A;  3QOE A;  2JMW A;  3D5S C;  3DTI A;  2HQ5 A;  4DYC A;  5DM7 F;  1HMD A;  2FJ1 A;  5A6B A;  2JA8 J;  1NSG B;  3F8N A;  3OS1 A;  2XLV A;  2M1B A;  1R1T A;  1VFC A;  1XMA A;  2DTZ A;  3FXO A;  3K9T A;  4OWR B;  2ZKZ A;  5FLV A;  3ASN C;  2KDZ A;  1V5E A;  2NYX A;  4LG0 B;  1BBY A;  3NYJ A;  3DLA A;  4U7D A;  3LAP A;  3QW1 A;  1FIP A;  1OIS A;  4M6X A;  1Y0U A;  2K9Q A;  3M8F A;  2LKX A;  2LK2 A;  3FBN B;  4H4K C;  3RPQ A;  3TOA A;  4O6Y A;  4YT5 A;  1XGM A;  3U2R A;  4F7Z A;  5E79 C;  1TT5 B;  2NUP B;  4O3M A;  2UZK A;  3W8H A;  4IRU A;  5KYX B;  1A6I A;  1JUS A;  3RZD J;  1YVI A;  4M63 A;  4ENK A;  2VQL A;  2EA2 A;  2X6W A;  4XLP F;  4MTD A;  3VEP A;  5JVG F;  3DD7 A;  3QZC A;  3FXJ A;  1HW2 A;  3H5A A;  5HNF A;  3WG7 C;  1CPQ A;  3MKL A;  2WVO A;  2ZPA A;  4O6J A;  4NC6 A;  3KEO A;  4DVY P;  5H20 A;  2AQE A;  1BBH A;  3E6D A;  5JP7 A;  1K83 J;  1OYI A;  4XWJ A;  4CCK A;  3ZIB A;  2X1D A;  2NXN B;  3EHN A;  5CKT A;  3NAU A;  2JJ7 A;  1K05 A;  2A0U A;  3RH3 A;  3K7A J;  2DOE A;  3EG9 B;  2ZXH A;  4N9I A;  2YL7 A;  4EVI A;  2KIM A;  1R71 A;  1T33 A;  4IL6 C;  3BR2 A;  2JA5 J;  4I0B A;  2LCH A;  3H9J A;  4JTA B;  3X2Q C;  5GPC A;  3GF2 A;  1GHC A;  4PJJ A;  2H27 A;  2VC1 A;  2PP4 A;  3F6V A;  3TDU C;  2COM A;  3E1S A;  4MTO A;  1FOK A;  2JRM A;  2CV1 A;  5DQZ A;  4IXA A;  4K1O A;  2XB0 X;  4L5E A;  1ZHY A;  3G1M A;  1FC3 A;  5KYY B;  3VPR A;  2DAO A;  2D5R B;  3O8G A;  2P0N A;  5L3Q A;  4Q4Z F;  3SXM A;  4X6A J;  3CP2 A;  2HTJ A;  2VH3 A;  4AU7 A;  1ZLJ A;  1OKK D;  4Y3O A;  4DZP A;  4GCV A;  3ZQH A;  4BKX A;  1TC3 C;  5CQG A;  2O5R A;  1ETY A;  5E3O A;  1QO0 D;  3ZGK A;  2C6Y A;  1OKK A;  4QSH A;  4NNJ A;  4B09 A;  3I4P A;  2KRF A;  3FXU A;  4E7J A;  3POV A;  3ABK C;  3AGT A;  1LEB A;  2Y9Z A;  2ZCW A;  3BTL A;  5E8G A;  3ROU A;  3A02 A;  5LHH A;  3HKZ N;  1T8I A;  1OQC A;  3R7C A;  1NBB A;  3KKB A;  3HUG B;  3LSI A;  4LG3 A;  3RYL A;  5F27 A;  3R0A A;  3QVY A;  2JUC A;  1YJN I;  3JRM O;  4PSX A;  1SR2 A;  2IS1 A;  1ZHT A;  2L81 A;  3BDD A;  2G3V A;  3ZTZ A;  3RQF A;  4CO8 A;  2AP3 A;  4EM0 B;  2KP6 A;  4CYC A;  1CQT A;  1I3A A;  1FYK A;  5F28 E;  1CGN A;  1IXR C;  3PJR A;  1JT0 A;  5LHG A;  4BDZ A;  1JT6 A;  1SD6 A;  5D91 A;  2VN2 A;  4PR9 A;  2BV6 A;  4BHP A;  2RVC A;  4FQG A;  3K70 D;  1M2V B;  4F92 B;  2J7P A;  3A9C A;  1SAX A;  4GXO A;  4A0Z A;  2W1O A;  2E36 A;  4UB8 C;  2BY0 A;  4WWC A;  2KT0 A;  2IS2 A;  4YT4 A;  5A6B D;  4X0G A;  3AG4 C;  5JHU A;  1YZC A;  4IHY A;  3VB2 A;  4R79 A;  3DTK A;  2L02 A;  4PGG A;  2R5Y B;  2XHK A;  4U5F E;  1YIO A;  2L9V A;  1ZQ3 P;  1U2W A;  2E71 A;  1F36 A;  1X2N A;  3FXM A;  3DEU A;  2AXL A;  5LEJ A;  4CJG A;  1S29 A;  3WU0 A;  3JAM K;  3ZCO A;  2BBY A;  2QGU A;  2LY9 A;  4KIC A;  2H7B A;  2Z16 A;  1NG7 A;  2A05 A;  2FAP B;  3KLO A;  1WFX A;  5HLT A;  4EJT A;  1P6R A;  2Q9C A;  2X9D A;  3GM3 A;  3VRC A;  1FTS A;  2DK8 A;  1D1A A;  1OJL A;  2QBY B;  3RKO F;  2I8D A;  1IDZ A;  1SMY F;  2E5N A;  4IEJ A;  1XSD A;  3CCE I;  3TED A;  2ZB9 A;  4DZJ A;  1VOM A;  2I5U A;  2BW3 B;  4IRG A;  3DE8 A;  3JYY A;  3HOX J;  5ICC A;  4DRH B;  1FFH A;  1Z3I X;  1MZB A;  2QM3 A;  2OZU A;  4Y13 A;  3DCF A;  4NTF A;  2IRF G;  1IDY A;  2Q00 A;  2W24 A;  3HRU A;  4OIQ F;  3MD2 A;  4A3B J;  2LD6 A;  3V7S A;  2R7Q A;  4KA4 A;  2KK1 A;  1L7C A;  1TWC J;  2X6Y A;  1C03 A;  1K61 A;  4RM3 A;  4BJ6 C;  1Y1W J;  1NK2 P;  1YYX A;  2F2E A;  3TP3 A;  3FM5 A;  2LOO A;  3CEX A;  1JAF A;  2PN6 A;  4I02 A;  3VWB A;  2CYD A;  1CGM E;  2EIK C;  4EBK A;  2FX0 A;  5FZT A;  3ZR8 X;  3F8M A;  4G6D A;  1F9N A;  4AL1 A;  1MMA A;  3ULQ B;  2VQC A;  4ZYH A;  4ON0 A;  3K4B A;  2XF7 A;  4EIY A;  2CH0 A;  2WZG A;  2LTP A;  3ELK A;  5D8L B;  3H5R A;  2M8E A;  3EYI A;  2M4K A;  2QY9 A;  3WG9 A;  2BE5 F;  2ZJQ F;  2Q8K A;  1I6X A;  1FMV A;  5LGN A;  2HQN A;  1VQ7 I;  5FLX K;  2X0L A;  3CQZ J;  1UEL B;  2KFD A;  4U5C E;  3ZQ7 A;  2YVK A;  3G73 A;  2QA4 I;  4DRI B;  3ABL C;  2YWA A;  2J8W A;  1G3W A;  5ILS A;  3CF2 A;  2K85 A;  1HXD A;  2QEX I;  3BJA A;  1M6T A;  2M4E A;  4GO1 A;  3FXK A;  2PMU A;  1POG A;  1FP2 A;  1ZTR A;  2IT0 A;  2WWY A;  3LLK A;  2ZME C;  5DUI A;  4IHT A;  3KYI A;  5JS5 A;  4EJW A;  2W4B A;  3OYI A;  3C63 A;  2YSR A;  5ICF A;  3U2M A;  1JMW A;  4JX4 A;  3CCM I;  2EPM X;  5LD2 C;  4K2E A;  1VB5 A;  3TP0 A;  2WZL A;  3Q9V A;  5DCF A;  4XRS G;  3T6G B;  1QRY A;  4J7Y A;  1J9I A;  1MBK A;  2AWY A;  5F08 A;  5DYM A;  2H7V C;  5JLW A;  2ECB A;  4LIU A;  2KPM A;  4BPM A;  4BY7 J;  5IP7 J;  4M71 A;  5DD8 A;  1LE8 A;  2XAF A;  4F3Q A;  4JW1 A;  2FE3 A;  1W5C C;  4P96 A;  1UFB A;  3SZR A;  5KYY A;  2V26 A;  2BEO A;  3OL4 A;  2M9H A;  3Q0W A;  1E83 A;  1S9H A;  1T01 A;  1FOX A;  2OJQ A;  1IJW C;  4IOC F;  2VCA A;  1IXC A;  2A6T A;  2BC5 A;  2DW4 A;  3GFJ A;  1V54 C;  4CIC A;  4E70 A;  4M3E A;  2QKL B;  5AC5 A;  1ONV A;  4RD9 A;  3E97 A;  1IO2 A;  1ZEL A;  4CBE A;  3SNH A;  1XGN A;  3OYA A;  1ST6 A;  1H88 C;  2FMY A;  5LGU A;  1MJA A;  3ZQC A;  1K6O A;  1ZRF A;  2DQL A;  3H36 A;  3RQG A;  5E2Q A;  2JRT A;  4UVC A;  1ZLK A;  2HKX A;  3T6J A;  5CQE A;  2KMU A;  3WTV C;  1RES A;  4DVZ A;  1FT9 A;  2DMU A;  5TJ5 E;  1X1A A;  3RSN A;  4R1H A;  2LQG A;  4FX0 A;  1KQ9 A;  2NUP A;  3NYL A;  2ELH A;  3JRI A;  4ZYE A;  5EDN A;  4LLE A;  2GBY A;  2YRF A;  3SFZ A;  2CU7 A;  1ACI A;  1I1S A;  3DLL F;  3IKV A;  1Z21 A;  4A2N B;  2YPR A;  2F5F A;  1OCO H;  1M2O A;  4M9X A;  3DJN B;  3IWZ A;  1FFT C;  2DMN A;  5D4S A;  4XNF A;  4L5J A;  5IY5 H;  2HDD A;  2PLY A;  3W4Y A;  2EPF A;  5DDG A;  4RB3 C;  1N77 A;  1TZL A;  1W0T A;  3RIP A;  2L54 A;  2NVX J;  4C3D A;  4F4B A;  1IN7 A;  1HW5 A;  1IN5 A;  5L3D A;  1YDI A;  2MC3 A;  3BG6 A;  1ZAO A;  1BR4 A;  3CJQ B;  1ZGJ A;  4HAM A;  4G7O F;  4B48 A;  2EQR A;  1O57 A;  1ON2 A;  4A69 C;  3AG4 H;  4D7N A;  4XKW A;  4Y15 A;  3WGI A;  1W5S A;  3OSF A;  1YHQ I;  3RDI A;  1NG1 A;  1W5T A;  3KEY A;  1Q0D A;  4EJO A;  3MMY B;  5IOY A;  1DU0 A;  2H8A A;  3GX4 X;  2MWQ A;  1BI0 A;  1BI1 A;  1ZGA A;  2HKO A;  1VZ0 A;  3WOD F;  2WVQ A;  4E6K G;  4YII A;  3G2B A;  2VB6 A;  4IHW A;  2LFB A;  4BXX J;  4NTB A;  1VQM I;  4HFK B;  4AK9 A;  2G0E A;  3D5R C;  5J47 A;  4A5M A;  3TW6 A;  4ZDO A;  3V5Z A;  3GTJ J;  1FTT A;  1TFO B;  1BR1 A;  2KSF A;  5IOZ A;  1R4M B;  1U8B A;  3GLX A;  2F5E A;  2OQR A;  3TO9 A;  2DMP A;  3CJR B;  3E3V A;  3R0J A;  2QKM B;  3IH2 A;  3L2R A;  1YW9 A;  4A6E A;  3UKG A;  3VOD A;  3S17 J;  1SMT A;  1OXK A;  1SYQ A;  5FCL A;  1KU7 A;  5FD6 A;  3L00 A;  3VF0 A;  2E5Z A;  1OFC X;  3Q0V A;  4J19 A;  3PNY A;  2DA1 A;  2D2W A;  4KDP A;  1BC7 C;  3U1K A;  2DA2 A;  4XRS A;  3RI4 A;  4MVZ A;  5IT9 K;  5CLS A;  1UCR A;  2XGX A;  2ZSI B;  2X0C A;  1I39 A;  3LS1 A;  4Q7C A;  3S2W A;  2GLO A;  3HOY J;  5T3T A;  3K6B A;  4Q48 A;  1I50 J;  3CCQ I;  5FRM A;  1TKN A;  3S93 A;  1SFK A;  2QQB A;  2HOA A;  5J1R A;  2HJ3 A;  1M57 C;  3FHZ A;  2JT1 A;  4I09 A;  5D8K B;  1WN0 A;  3HSF A;  4LLC A;  1WJF A;  3VAY A;  2M30 A;  1DUX C;  1QGP A;  1XCV A;  3RPU A;  1TNS A;  1USS A;  2OZ6 A;  2NG1 A;  4G6T B;  3DBR B;  3NQO A;  5FFX A;  2ZNY A;  4XN0 A;  3JSP A;  4IHV A;  4YT8 A;  3K2Z A;  2GZW A;  4Q47 A;  3QW0 A;  1WRJ A;  5FRO A;  1HF0 A;  5JRA A;  1UJ8 A;  4XOR A;  3ESW B;  1VQK I;  2CSO A;  4MVM A;  5JSL A;  3SXZ A;  3CES A;  1HKT A;  4A3D J;  5L0I A;  2A69 F;  3WTW C;  4EGZ A;  4CIP A;  3BPV A;  1SVO A;  5JT4 A;  3FHN A;  4XQF A;  4NC8 A;  5GAE J;  5A6J A;  3BTJ A;  5LRS A;  1OKR A;  4KNY A;  4IGG A;  3FZV A;  3S84 A;  2MD0 A;  3I64 A;  2FD5 A;  2KJG A;  3I9V 2;  5C4X J;  2J9U A;  2GIZ A;  3ZQI A;  4AIK A;  5COF A;  3O39 A;  2GXG A;  3WHC A;  2A5W A;  2WTE A;  1TWC A;  1QZE A;  2OEX A;  1U5T A;  1WJA A;  3OR1 C;  5FLM J;  1BZ4 A;  3LLI A;  2LLK A;  1GXP A;  1OCT C;  3HHH A;  1ORJ A;  1KU3 A;  1LQ1 A;  1KTM A;  4FCY A;  1O3T A;  5EGO B;  2K4J A;  1YX3 A;  2W85 A;  4L5I A;  4V2G A;  2QVO A;  2VJ4 A;  3QTH A;  3I4N J;  1XS9 A;  1OR7 A;  4U5E E;  3ASN H;  4LK1 F;  2DYR C;  4BBR J;  1S72 I;  5B1B C;  1S05 A;  2WV0 A;  1BI3 A;  2OCC H;  3ZQY A;  5EJC A;  3V8K A;  3ISP A;  1L3L A;  1J7K A;  2EIK H;  2EB7 A;  2Y3H A;  4LIT A;  5F6F A;  1U9N A;  4JCH A;  3EUH A;  4B3X A;  3CC2 I;  2HSB A;  3K0L A;  2BZT A;  2RD9 A;  1MW7 A;  2XVC A;  3GLL A;  1ZN2 A;  2X1C A;  3HRT A;  1GLN A;  3KYL A;  3SP1 A;  3IH4 A;  2HUJ A;  3C8G B;  4WXH A;  4IRH A;  2CUJ A;  1HBX G;  3U9M A;  4CSA C;  2HU9 A;  4BNC A;  3KCC A;  3U9G A;  1W36 D;  2A3S A;  4NCQ A;  3B6C A;  4YRV A;  1PJR A;  1PV3 A;  2HV7 A;  5AGF A;  2IAI A;  4XPW A;  3V5Y A;  4P9F A;  1K4S A;  2R05 A;  5K7F A;  1E85 A;  1TW3 A;  1DU6 A;  2W45 A;  1K6Y A;  5C44 J;  2R3S A;  2CW8 A;  1EH6 A;  1WPK A;  5EEH A;  4U0Y A;  1A36 A;  5J1Y A;  1WTY A;  3OMY A;  3GFM A;  2ME6 A;  3DEW A;  1U5T B;  4Y52 J;  3H2V A;  2V6C A;  4WK8 F;  4TV7 A;  3GTK J;  2OEV A;  4FE7 A;  2LKS A;  4OIR F;  3O3K A;  4I76 A;  4OAY A;  1F5T A;  3BTC A;  2EA4 A;  1ZU5 A;  2JD3 A;  3J06 A;  2FXA A;  2VC9 A;  3QMK A;  4LFU A;  3CD6 I;  2R7W A;  5FFZ A;  3LNM B;  5HDK A;  4XLH A;  3ZMT A;  2FUG 2;  2P81 A;  4KJZ A;  1P7J A;  4QLC U;  3M1C B;  4ESF A;  2EFW A;  2DB4 A;  4P5O A;  4BE0 A;  1MNE A;  2C03 A;  3VOE A;  3OIP A;  4BDY A;  2K3P A;  1YIJ I;  1HE1 A;  2IYL D;  3K1H A;  2DFE A;  3HHG A;  4RS8 A;  2M3A A;  2A0B A;  3A0B C;  4JK1 X;  3OY9 A;  3BC8 A;  1UZC A;  3DBH B;  2YR2 A;  3SDB A;  3EJN A;  2E2J J;  3FMR A;  4YWQ A;  3NRV A;  2AO9 A;  3GO5 A;  1RCP A;  1X3Z B;  1IZ1 A;  5K7H A;  3CC7 I;  2MA3 A;  1FJL A;  5L3V A;  2LF8 A;  1SEU A;  2MSY A;  2Q2E A;  1RC9 A;  4XSZ F;  2OCE A;  4J01 A;  4NC3 A;  3RQI A;  5E1W A;  1RR7 A;  4ABZ A;  4D5F A;  4BGD A;  3SYN A;  3CMM A;  2QNL A;  1IV6 A;  1TNT A;  3C2B A;  1LUJ B;  3J7Y J;  2R92 J;  2YZS A;  1CGO A;  3B29 A;  3CZ6 A;  3JRB A;  2NS0 A;  1Z3Y A;  4KMU X;  3KMI A;  5KHD A;  4XPX A;  2BY1 A;  5IPA A;  4G0H A;  2XXA B;  2PNO A;  2PEX A;  5L3E A;  2ZFU A;  2BXZ A;  5JI6 A;  5HLH A;  4RBN A;  1OPC A;  1VTN C;  5TIS C;  1Z1D A;  4CS8 C;  2GIV A;  5IT3 A;  1D0Z A;  1JI8 A;  2JPU A;  4RM2 A;  2ZD9 A;  1K78 B;  3ZPL A;  3AG3 C;  1FLI A;  3BRJ A;  1T6U A;  3H0G J;  4CCJ A;  2ESN A;  2Y0S A;  1VND A;  1ZZP A;  3FDY A;  4LDK A;  2R7X A;  1XD7 A;  1X1B A;  2DPU A;  1X2M A;  2MC4 A;  3DPL C;  2FFH A;  2XLO A;  5FKN A;  2XGE A;  3PUF A;  4M73 A;  3T8R A;  3GTM J;  1K4T A;  4HNU A;  3MKW B;  3BCB A;  5EZG A;  2LSO A;  3F72 A;  4D5C A;  5M5Y J;  4RB0 A;  2DN0 A;  1CF7 B;  2CGP A;  2DYS C;  2LDU A;  1IUF A;  1I3Q J;  2XF6 A;  2BOL A;  4IHS A;  2HR3 A;  3B9Q A;  1OCC C;  1IV8 A;  3FXR A;  2VBX A;  1AKH B;  1DPU A;  1S7Z A;  4J00 A;  3NMK A;  3ZC4 A;  2G7U A;  5JLX A;  2H8R A;  4HBL A;  2BW3 A;  2G3K A;  3B0V C;  2IW5 A;  3BR6 A;  3J81 Z;  4BG0 A;  2EIJ C;  2OTL I;  2PF4 E;  1FSH A;  5B3S C;  1KYW A;  2B63 J;  1ZK8 A;  1RUN A;  4UVB A;  5DCM B;  4AE4 A;  2B7E A;  3NAR A;  1EH7 A;  3GWL A;  4MHG A;  5EGY A;  3TGN A;  3IKT A;  4XLN F;  5E3A A;  2KDO A;  2IA1 A;  2ELK A;  3EUK L;  2EFO A;  1M2V A;  1NFO A;  4MFE A;  2QE9 A;  2XLD A;  3LA3 A;  2J7P D;  3I5P A;  1BW6 A;  4ZLC A;  3PQK A;  1OCZ C;  5K5Q A;  2KIQ A;  3US6 A;  5A69 A;  2L7F P;  5J6X A;  4PK4 A;  3VFZ A;  2KYH A;  3G3Z A;  3LSJ A;  2V1X A;  2EPO A;  1JGG A;  2DI3 A;  3GME A;  2HWV A;  2VKD A;  4CUG A;  1Y0N A;  2EV6 A;  3L2U A;  5DTD A;  4E7L A;  1RKE A;  4BE1 A;  4BUP A;  3FXL A;  3BT9 A;  1PP7 U;  1YAR O;  2IXN A;  1EKY A;  1YLF A;  2OA4 A;  1DP3 A;  1LS4 A;  4P55 A;  1BA5 A;  2ELJ A;  3F47 A;  3ABM C;  2UXX A;  4HX7 A;  3LAJ A;  3H9G A;  1RMV A;  3HC7 A;  3E6C C;  2DBB A;  3CJT B;  4IKF A;  1TR2 A;  5IYD J;  3LMM A;  4W8K A;  5E18 F;  1QQ3 A;  3DI5 A;  3W8I A;  3RZO J;  2MLK A;  1IRF A;  1KZH A;  2I15 A;  1G59 A;  1T2K A;  1K04 A;  1UB9 A;  2OF7 A;  3HBL A;  2M87 A;  3VDX A;  1A31 A;  1OMI A;  1XMX A;  2Y30 A;  2Q0O A;  5FKK A;  2DA5 A;  1ZW3 A;  2PJP A;  3ABM H;  3MZY A;  3PHF 2;  4WF2 A;  1NHA A;  4AYB A;  1Z05 A;  1SFO J;  3DM5 A;  5HOO A;  4FWV A;  4WGZ A;  2JVG A;  4MQV A;  3DBL B;  1SVL A;  4OAZ A;  1LI7 A;  3M79 A;  5D92 A;  1HKQ A;  4QI0 A;  5HOD A;  3GTQ J;  1JTY A;  3ZDL A;  2G9W A;  2EIL H;  3LL7 A;  4GYG A;  5K5R A;  3WGH A;  2HEO A;  1WQ2 A;  1XPX A;  4OMY A;  2CUE A;  1Z6T A;  3AFH A;  3S3N A;  5BUO A;  3HEF A;  3O6B B;  5IYC J;  4Y33 A;  2LFD A;  5GAH J;  4NQW A;  4EBJ A;  1YW8 A;  1ZRC A;  3J80 Z;  3WU2 C;  2R0Q C;  2IXS A;  1QU3 A;  2EFQ A;  5BNG A;  1XCB A;  4A3J J;  1XX5 A;  2VIX A;  4DGW B;  2JA7 J;  1W7P D;  5KAI C;  5HSW A;  2Q3T A;  1R36 A;  1C17 M;  2YX4 A;  1TBX A;  5CPR B;  5FGM A;  1HSJ A;  4PSW A;  2I8B A;  3VSL A;  2MLG A;  2HSQ A;  1QKR A;  1X1C A;  3BG5 A;  1NU7 D;  1RXQ A;  1WOL A;  1U89 A;  5K0I A;  2LH9 A;  1O3R A;  2IGO A;  3HOU J;  5EHH A;  4S05 A;  3IC7 A;  4UNO A;  1MIJ A;  1RPW A;  3B0U X;  3GEE A;  1ZKG A;  2STW A;  2FRH A;  1MBH A;  3LNQ A;  4RLF A;  3I4U A;  1PUE E;  1YS7 A;  5J4Y A;  3ATP A;  3TO6 A;  4LB5 A;  3RFY A;  3B0P A;  4ZDL A;  2R7O A;  2UWM A;  1I27 A;  4XKV A;  4ZH4 F;  2EH3 A;  1AWC A;  1WAT A;  1U0J A;  2K3F A;  1UST A;  2FNA A;  3HGY A;  1BIB A;  4YG2 F;  3OYD A;  2NS7 A;  3F6O A;  2J45 A;  3U8P A;  3TKY A;  2MFZ A;  3MYI A;  1T95 A;  1L3P A;  4CYD A;  1KQ0 A;  3RKQ A;  1MMN A;  3V7C A;  4YL0 A;  5KYX A;  1T0F C;  2IA2 A;  2CQN A;  1QHH D;  3W2V A;  1ZH5 A;  5F1J A;  3RYR A;  2XF5 A;  3VSK A;  2IBF A;  4EHP A;  1UFM A;  2L4A A;  5IYB J;  5EG0 A;  3K66 A;  4XR6 A;  1A5J A;  1J8Y F;  2ETS A;  3EGX B;  3LAY A;  2LNB A;  4YIR X;  4G12 A;  3ECH A;  4HF1 A;  2WAD A;  1REP C;  2FEZ A;  2PBI A;  2RKH A;  2VON A;  3K1I A;  3HTK C;  1JJ8 C;  1S7A A;  3AQB A;  5L0F A;  2VXZ A;  2CGE A;  4XLF A;  4JX6 A;  4U88 A;  3VYT B;  2MBF A;  3ABT A;  1FAP B;  1DGR M;  3HOW J;  3FKI J;  2A6H F;  2RNJ A;  2XAS A;  3GZN B;  4EAT A;  1IZM A;  3GYH X;  2HJM A;  3O55 A;  5AC4 A;  1JHH A;  4BHC A;  2E1C A;  2AU5 A;  1U0B B;  4FAS D;  2Q7R A;  3TJ6 A;  3FIS A;  4WXD A;  4JEA A;  4XLA A;  3G1L A;  2RSE B;  1D1C A;  5A2Q Z;  3OYF A;  3FXQ A;  3KLN A;  1YA7 O;  5E17 F;  3SYT A;  2K40 A;  1P7I A;  1G6N A;  3PL8 A;  3HB9 A;  3KZY A;  3TMO A;  4RAY A;  4KIS A;  1CPR A;  3QP5 A;  2P0W A;  3CUQ A;  4BH9 A;  2LRE A;  3U9J A;  2LKP A;  3KIO A;  3MEX A;  3MCZ A;  3GFI A;  1HOM A;  1GM5 A;  1Z6R A;  1ORK A;  1TWA J;  3EQL F;  3HYI A;  2R5Y A;  4AUX A;  2XIG A;  3JSE O;  2TCT A;  1BIA A;  4LER A;  2VJJ A;  2XRH A;  2VOD A;  5FJ8 J;  2EPL X;  2VUM J;  3N97 A;  1R4T A;  3A11 A;  4WX9 A;  2EJR A;  3HNI A;  5B3S H;  3PM1 A;  4BEH B;  1IW7 F;  1QPI A;  2J9V A;  4CIH A;  1IAW A;  3EYY A;  2DU9 A;  1Z63 A;  5B3I A;  2JN6 A;  1H0M A;  2BHZ A;  1BOA A;  3EGD B;  5DM6 F;  5K1Y A;  1R49 A;  4MTF A;  4ITV A;  1MH3 A;  4AIJ A;  4X0R A;  1QBJ A;  4II3 A;  3JRF A;  4JBA A;  3QWL A;  2V7F A;  1S7E A;  3AL0 B;  5J4V A;  4CXF A;  4AIH A;  5LFA A;  4DYR A;  4MW3 A;  5DEQ A;  5F0C A;  3V7O A;  4C2U A;  1V54 H;  3DXJ F;  3HJC A;  1FMW A;  3JRD A;  2IS4 A;  2DA7 A;  4MEY F;  1HKS A;  2KZG A;  2R7V A;  1N1C A;  2OCC C;  2W84 A;  1QVX A;  1BM9 A;  2WVN A;  3CAX A;  1MDM A;  3A4C A;  3K10 A;  5AON A;  1LDJ A;  4C3I J;  3OYJ A;  3KPH A;  4AVP A;  2QLA A;  5DS4 A;  3OYE A;  2VCB A;  1VK5 A;  1R23 A;  4AWX B;  4ESB A;  4Y7N J;  4OIN F;  4NY3 A;  2UUI A;  3K4M A;  4Z2Y A;  1IRZ A;  3C8Z A;  2WV1 A;  4Z9I A;  1MQV A;  2ID6 A;  3HPG A;  2W57 A;  1LVA A;  2I10 A;  2XV4 S;  2CW7 A;  1Y56 A;  3CCR I;  1ENH A;  1YRN A;  3GTO J;  4F52 A;  2Q2E B;  4A93 J;  2BXY A;  4XLE A;  1RKE B;  5HS9 A;  3MLG A;  1I6H J;  3H3U A;  4L9V A;  1FOW A;  2CFO A;  2BVM A;  4YEJ A;  1GVD A;  2HQA A;  1WJC A;  1H9T A;  4L18 B;  3DWW A;  1Z5Z A;  1X1D A;  3ECS A;  3R61 A;  3TL4 X;  2HKV A;  4QI2 A;  5FKL A;  1DP7 P;  3LFU A;  3T0Y A;  5COM A;  1RUO A;  4CGZ A;  2XL4 A;  3S90 A;  2R7Z J;  5GAG J;  4M72 A;  2KIF A;  2CJJ A;  1GQA A;  4H54 A;  1GGQ A;  2KGO A;  4HE8 D;  2XUB A;  1LFB A;  1YJG A;  4HX4 A;  1T6Q A;  2N8G A;  4PJN A;  1RKW A;  5EF6 A;  3N2Z B;  4FX5 A;  3K1P A;  3L34 A;  3BZ6 A;  5HS8 A;  2XKO A;  3SZG A;  3DPT A;  3EDP A;  4FT8 A;  1ORS C;  3OIQ A;  2LBF B;  3CLO A;  3UNG C;  5FKO A;  1VQO I;  2AVK A;  4EM1 A;  1X4O A;  1IGN A;  4MVR A;  4MW8 A;  2R7S A;  3QVZ A;  3PFI A;  3ASO C;  4HYE A;  3RJP A;  1BJZ A;  2HOT A;  3ZQQ A;  1DQU A;  1U6G A;  2VBW A;  2HXI A;  1VQN I;  1R22 A;  1MKM A;  4IQ4 A;  3DAG A;  4HX8 A;  4C9Y A;  1D0X A;  2ZJR F;  1KQ8 A;  3RCO A;  1MD0 A;  4KNV A;  4BHB A;  1EF4 A;  4N4N B;  4GYI A;  4MNU A;  3D0S A;  3FX3 A;  3NWS A;  5J40 A;  2QQ8 A;  3FMQ A;  3OYG A;  2NUT A;  3O2P E;  4CCL A;  3ZQL A;  1K78 A;  3HTS B;  5L0D A;  3QPH A;  4E7S A;  5DV5 A;  1WGW A;  3M4C A;  4MVQ A;  4N6H A;  5E3C A;  1LS1 A;  3X1O A;  2KC3 A;  2A07 F;  4HOB A;  3LJB A;  2YS9 A;  1PUF B;  2XXA A;  2E1M C;  3QAH A;  4I99 C;  3MQ0 A;  5J3L A;  4BJ5 C;  4GDF A;  5B1A H;  4HLX A;  1KA8 A;  2FML A;  3Q0U A;  4CDY A;  3PSF A;  2L6G A;  2NPU A;  3EH2 A;  1FNT c;  4QIW N;  3G4X A;  1WWX A;  3LSR A;  5BQG A;  2O61 A;  3F46 A;  1G3S A;  3CUO A;  1HW1 A;  4DYQ A;  4YFK F;  1YYV A;  3OYN A;  1S3J A;  2DCE A;  5FKM A;  1Z7U A;  2IXM A;  4IRI A;  2IS6 A;  2EIM C;  5K5O A;  3HKK A;  2ZXJ A;  1VQ8 I;  2ME0 A;  4BXF A;  1VLT A;  4CDV A;  2PMH A;  3FF5 A;  5EYR A;  4H0E A;  3I59 A;  3JCU Q;  2DYR H;  2E2I J;  2LY2 A;  2HPI A;  2EPN A;  3GZ6 A;  3DF8 A;  4JOM A;  3K6G A;  4JE9 A;  3K69 A;  3GCM A;  2LD5 A;  1LEA A;  3KP3 A;  4LGW A;  2M0M A;  3PNT A;  5J1U A;  1SVM A;  2PMZ A;  3AG1 H;  3CDL A;  3KZZ A;  3CCU I;  4KIB A;  1J8M F;  3ZSU A;  2ZO4 A;  4N0B A;  2VT3 A;  2BGC A;  4M9Z A;  3K7D A;  3I71 A;  4XN3 A;  2KJC A;  5GAD J;  3Q6N A;  2ID3 A;  5IY5 C;  2V9K A;  3MWM A;  2CQ7 A;  3DPU A;  3N05 A;  5KYN A;  1LVK A;  1Q0M A;  1JUP A;  3LA7 A;  2OKU A;  2FQ4 A;  2KQR A;  4UUT A;  4I44 A;  1V5F A;  2TRT A;  2QCO A;  1VQP I;  1TQG A;  3W2A A;  1UHS A;  3G6E I;  2H1K A;  2GXA A;  3HG9 A;  3GZ5 A;  1G3T A;  2MH9 A;  3SJM A;  1R5I D;  3IAM 2;  4HPQ A;  4ZLD A;  3A03 A;  2H09 A;  4M3D A;  3HSR A;  1ON1 A;  3BPX A;  3MN2 A;  5F5H A;  1LJ9 A;  2CWE A;  4KUM A;  3S28 A;  2CRG A;  1JKR C;  2B9S A;  2PJR B;  3S14 J;  4G6Q A;  2R93 J;  4BJT A;  1FY7 A;  1IG7 A;  3I59 B;  1XDU A;  2E19 A;  3JTH A;  2OC6 A;  4A0Y A;  4IOA F;  2IEK A;  1OYY A;  5F0F A;  1FPQ A;  2CV2 A;  2DYS H;  4DBQ A;  4WAB A;  2YUS A;  1GDT A;  1HE9 A;  256B A;  4MVS A;  5F5F A;  3K4K A;  2WB1 N;  4RGS A;  3KYD B;  3V8J A;  3E5Q A;  1W4M A;  1BOB A;  1EA3 A;  3CMA I;  3H65 A;  4JRZ A;  4A3K J;  1YZA A;  3VYS B;  3BQZ A;  1RIO H;  1T98 A;  4IX7 A;  4CDA A;  2VJ5 A;  3CP8 A;  2DOD A;  3L9F A;  2GWW A;  4O79 A;  5JR3 A;  3KP2 A;  4XSX F;  4QDL A;  1ZYR F;  2XLW A;  3J7Z I;  1O5H A;  3BG7 A;  3F9K A;  4B8X A;  4P6I C;  2V9P A;  1P4A A;  2A1D D;  5L0J A;  2KZV A;  5M3F J;  2Y3G A;  2O8X A;  5E33 A;  2XSD C;  2CMP A;  4OMZ A;  3BZC A;  3ZOB A;  3KP4 A;  4U9E A;  4PJL A;  1WCM J;  3ERE D;  5BQI A;  4PAC A;  4RLQ A;  3JTL O;  4RAG A;  3ZQV A;  4KI2 A;  2HZD A;  4DNC A;  3HOZ J;  2JUG A;  2OUM A;  4LD5 A;  5F04 A;  2EFN A;  1ZR4 A;  1HC8 A;  1FBS A;  3S1N J;  1HY5 A;  2KRC A;  4U87 A;  2VE8 A;  4L9T A;  1Q0F A;  1VLS A;  2Y31 A;  4PDK A;  2J46 A;  4UUS B;  3P5J A;  3IQT A;  1EV7 A;  1X1P A;  2HYG D;  2V9V A;  3WG7 H;  4UUV A;  1Y1V J;  4FE4 A;  2F22 A;  2ZXR A;  3W6V A;  5JVT A;  4E7H A;  2HYJ A;  3E0J B;  4AC0 A;  5BMZ A;  5DLJ A;  2VAS A;  2XS1 A;  4B6I A;  5KYW A;  4MIM A;  2NNY A;  2VOO A;  2E34 A;  3PSI A;  1AEP A;  5GTH C;  1Z6A A;  1YRN B;  3OSG A;  3HOV J;  4BAC A;  1GS9 A;  2PG4 A;  3IRQ A;  3JRH A;  3SEO A;  1TL8 A;  5CI8 A;  2L0K A;  4A3M J;  1J59 A;  4N4O B;  1WAS A;  2VKH A;  4PFP A;  4YJW A;  2OQG A;  5HDG A;  3JRC A;  4KNW A;  3U21 A;  2F48 A;  3ZN1 A;  1Q1V A;  1J5Y A;  2XAQ A;  2D5V A;  3GTP J;  2CNW A;  4YN0 B;  3ZG1 A;  3GM2 A;  4DBR A;  3RQ4 A;  3WTT C;  2PQ8 A;  3M8J A;  1E3O C;  2VOP A;  4C3H J;  2MHR A;  3GEI A;  2JZY A;  1XSX A;  4K0D A;  5EK0 A;  2R4G A;  1N78 A;  3MX3 A;  4BU2 A;  2VLA A;  1WH5 A;  3LSK A;  3OS2 A;  4BJ6 A;  1O3Q A;  1PD0 A;  1Y6D A;  3GEZ A;  1HDP A;  1J09 A;  1J2X A;  3I0T A;  3G50 A;  2QSG X;  1A6Q A;  3RKY A;  2M34 A;  3FKJ A;  3BOQ A;  1K7A A;  1BL0 A;  1S8N A;  3P9I A;  4CSW A;  2NVQ J;  2O8K A;  1R7J A;  1XGO A;  2DA6 A;  1T38 A;  2L6F A;  1A35 A;  2MW8 A;  1EH8 A;  2XSJ C;  1ETQ A;  1LB2 A;  2P8T A;  1DPR A;  2QEN A;  1FP1 D;  3RKX A;  4B47 A;  2P7C B;  1B68 A;  4YT2 A;  3LA2 A;  1W0U A;  4KYW A;  2MGQ A;  2OV7 A;  1PVE A;  2EZI A;  2XAG A;  1MBJ A;  3GBG A;  3OYK A;  2NVT J;  4HEA 2;  2OU6 A;  3DAF A;  3BRO A;  3SFI A;  1JXS A;  1QHG A;  5CVR A;  3CC4 I;  3BR1 A;  4E0H A;  1G2H A;  2XKP A;  3VM6 A;  3PNV A;  2DK5 A;  3HPH A;  4YEL A;  4HDU A;  4JC7 A;  3S15 J;  2DTR A;  3WE3 A;  4GGG A;  2H6B A;  2QBY A;  3RW0 A;  2LMD A;  4BEJ A;  3L2Q A;  3ZMD A;  1JKQ C;  4IVN A;  2IJL A;  3ONQ A;  2ZME A;  2DJN A;  1JPN A;  2G62 A;  4M6V A;  3BJ6 A;  3H35 A;  2YL0 A;  2GQQ A;  5BPI A;  1VMA A;  5KYU A;  2XS8 A;  1RJ9 B;  2EV0 A;  2QZ8 A;  2Q4F A;  1RI7 A;  4I6Z A;  1Z7L A;  4D0P A;  1YE9 A;  3LFK A;  4HNV A;  2DDA A;  2Y3D A;  2K02 A;  3RQE A;  3KX2 A;  1M1E B;  1RZ4 A;  5AIP A;  4CCO A;  4CS8 A;  3BEH A;  1N25 A;  3CDI A;  3UMI A;  1RNL A;  2K9L A;  2UUH A;  4G7Z F;  1ZHX A;  3M7G A;  1WH7 A;  2W00 A;  2Z2S B;  4BY1 J;  2XL8 A;  3BP8 A;  2WY7 Q;  3GXO A;  2Q9B A;  3DJU B;  5M5W J;  1K79 A;  2LP0 A;  4DRJ B;  2LF7 A;  3CO6 C;  5D5W B;  3M07 A;  3CSK A;  4PUS A;  2J0X A;  2YLI A;  4JJF A;  1ETV A;  2Y0M A;  1O3U A;  1KGS A;  1V5G A;  2HDW A;  1E0E A;  3ZVR A;  2NNN A;  4CYC B;  1JKP C;  4HRI A;  2PBE A;  4W8P A;  2ZXP A;  1SF8 A;  2NSF A;  3BZK A;  5DS5 A;  4FAP B;  2QF7 A;  5LEK A;  2L7A A;  5H6R A;  3RIR A;  1S6L A;  4OOI A;  3W6J B;  4RDU A;  4HDV A;  3T8T A;  3LWF A;  1TWG A;  2KKO A;  3LUT B;  4IF4 A;  3QOD A;  2FA5 A;  2ZXW C;  3CCV I;  1T5O A;  4ENJ A;  3IQ6 A;  2K5C A;  1IC8 A;  2FF4 A;  3ABK H;  2DGJ A;  1M56 C;  1DGW Y;  1L0O C;  2CS3 A;  4BQQ A;  4RBO A;  3HGG A;  1EKE A;  2XB5 A;  3J80 K;  3F8B A;  3S0X A;  3TUL A;  4RGX A;  5A6K A;  4S04 A;  2HFH A;  4I7H A;  4W97 A;  4UV8 A;  5L3B A;  1B1B A;  5BPD A;  1ITY A;  1DOV A;  2E1O A;  5CI9 A;  3WAQ A;  2VJI A;  2V79 A;  3L1P A;  3S1R J;  1LPQ A;  1XWJ A;  3IH3 A;  1SD4 A;  3PIP F;  1Z3X A;  2ZBK A;  5ILV A;  2WBM A;  4HSR A;  3Q3S A;  1T39 A;  2OQM A;  3AJM A;  2K27 A;  5E1X A;  3S8P A;  5E3L A;  2JX0 A;  4FIS A;  2Z33 A;  2NRA C;  5D6F A;  2VQG A;  3E5X A;  2MAB A;  3LQQ A;  1B6A A;  1TWH J;  3B71 A;  3X2Q H;  5GPG B;  2HZT A;  3AAF A;  2V3C C;  1G4D A;  2MYS A;  3EET A;  3SZT A;  1G5Z A;  4MFD A;  3Q7L A;  3KFW X;  2K9S A;  1OYW A;  2P5V A;  4A0X A;  2CUF A;  1V55 C;  2GA2 A;  1IN8 A;  3VYR B;  1FIA A;  3IAS 2;  1WJ5 A;  3RKW A;  1VI0 A;  5D5U B;  4JTC B;  3LES A;  4XRF A;  3RVY A;  3OOU A;  3S16 J;  2D1V A;  5DUK A;  1MND A;  5KCM A;  2Y3B A;  2R02 A;  2R5Z B;  2AS5 F;  4AD9 A;  1ZW2 A;  2YLG A;  1B9N A;  4BS9 A;  3L8J A;  4OD5 A;  3K4N A;  3HRS A;  3F21 A;  5FLX Z;  3FDQ A;  3TQN A;  2NVU B;  2OPT A;  2YL3 A;  1LI5 A;  1ZG3 A;  4O7G A;  4R32 A;  1KU9 A;  3KZI C;  3GWN A;  4XMY A;  3F3X A;  1SFE A;  2O6G E;  4HEA J;  3JRA A;  4HZF A;  4BJ1 A;  3B6A A;  5KAF C;  2TMV P;  2ZFW A;  2XPV A;  2X1E A;  2ZJP F;  1RRJ A;  4XEK A;  2XRN A;  5LRR A;  1LE2 A;  4ETS A;  1PCX A;  1ZG5 A;  2F6C A;  4AID A;  1O7F A;  4HF0 A;  1SC7 A;  3DWL E;  2YHS A;  3CQZ A;  3HJE A;  4NTA A;  2FSW A;  2LG4 A;  4B43 A;  2EZH A;  1D5Y A;  1F43 A;  2QUF A;  3TDZ C;  4CDG A;  4DXW A;  3WTX C;  3U5S A;  3M4B A;  2EIM H;  1MMD A;  5ERI A;  3F22 A;  3J7A Y;  3P7N A;  2R7D A;  3OYB A;  3DM9 B;  4BQA A;  3H0D A;  2W48 A;  5LBQ A;  4XEF A;  4XLC A;  4UB6 C;  2W82 A;  1WJB A;  3RYP A;  3ECO A;  2UXN A;  5CVJ A;  4B3A A;  1IN4 A;  4FX4 A;  1U6H A;  1WJD A;  4BEM J;  1LM3 B;  4I1M A;  2IVM A;  2HFI A;  1FBU A;  1QPM A;  3F8C A;  3U8V A;  1LNW A;  4XK4 A;  3EPZ A;  4FET A;  5BS6 A;  3T5X A;  1LPE A;  1RKC A;  4P9U A;  4I98 B;  2E1M B;  4UUS A;  4II2 A;  3IL2 A;  2C04 A;  5HV9 A;  1KYZ A;  2IA0 A;  5J8F A;  1YYJ A;  1ZHW A;  3ZRG A;  2XAU A;  4M74 A;  1T6S A;  4RAF A;  5HS7 A;  3OYL A;  3A01 B;  3NMI A;  3DKW A;  1H89 C;  1QPU A;  5FB2 A;  1YTY A;  4XKC A;  1EJ9 A;  2L3D A;  2Z99 A;  4BL0 B;  4JIO A;  1R5H A;  3BG9 A;  1E3P A;  1NU9 C;  2GXB A;  4NUB A;  3WGG A;  5DCM A;  5A2Q K;  2ZJ2 A;  3ZN0 A;  2VC0 A;  3MFK A;  4EBB A;  2MH2 A;  1W7P B;  2J5P A;  3A01 A;  3HNL A;  4GYT A;  1W1W E;  2PX0 A;  3WHN A;  1T08 B;  2DT5 A;  3IPM O;  3AG2 C;  3ASO H;  1OW7 A;  3Q5F A;  3KP6 A;  2M64 A;  2WB7 A;  5L0H A;  4DQ2 A;  2WC2 A;  3C8G D;  4DOZ A;  1GV5 A;  1A04 A;  1Z67 A;  5D5X B;  2HVR A;  3MKZ A;  3CDH A;  3Q7G A;  1P4X A;  3HRM A;  2GWR A;  1UAA A;  2BL2 A;  4AM3 A;  3I5Q A;  1U5T C;  3CJN A;  2E60 A;  4FHT A;  1O3S A;  1ZHZ A;  2Y69 C;  2QQ9 A;  5DS6 A;  3HZJ A;  2OJE D;  3H3Z A;  3FAJ A;  4C2T A;  1LIH A;  4O5V A;  3TW7 A;  2ASR A;  3NKE A;  3QU6 A;  2KIU A;  2ZNZ A;  3K4J A;  4ENM A;  3EZI A;  3KE2 A;  1WI3 A;  1IN6 A;  2HVS A;  3EH1 A;  1OR7 C;  1TQM A;  2VE9 A;  3S32 A;  2OG2 A;  3HLZ A;  4MTE A;  1B9M A;  2IGK A;  3JCU C;  4BQN A;  1HLV A;  1FWZ A;  2GM4 A;  4U7B A;  2DQR A;  4IQJ A;  3NWT A;  2Z3Y A;  4JVS A;  1I5Z A;  4JP0 A;  1WI9 A;  3EUA A;  1BI2 A;  1WHU A;  2JPB A;  1YI2 I;  5IT9 Z;  2E2H J;  4A12 A;  1V4A A;  2CDQ A;  1EQ1 A;  5JVE A;  3PMR A;  3ZMZ A;  5JFR A;  3TOL A;  4A5N A;  3CUQ C;  4XTK A;  2P4W A;  3QU3 A;  2WAQ A;  1I4Z A;  5EG0 B;  4BE2 A;  1A41 A;  4HA8 A;  3TK0 A;  4L9N A;  2K9N A;  2W4M A;  4YFN F;  4CZC A;  2FOW A;  2Y69 H;  4HNT A;  1YA9 A;  1P2F A;  3HIF A;  4HG2 A;  4PJ0 C;  4C7O B;  3RTR A;  3L2V A;  3HUG A;  3CUQ B;  3OYM A;  1HMO A;  1WJE A;  3IHU A;  4ANJ A;  1W2W A;  4CSA A;  1BR2 A;  5DQT A;  1OQY A;  1V3F A;  2VBZ A;  5L3C A;  2QQA A;  2E87 A;  4LK0 F;  2KQ9 A;  4W1U A;  2PJR A;  2CW0 F;  3UMH A;  4HV6 A;  5F1R A;  1SZI A;  3WHB A;  3U3B A;  4GEH A;  3HM5 A;  3I5U A;  5E8I A;  4IAR A;  4A3F J;  2B0L A;  2HS5 A;  3G4Z A;  4WXC A;  2RN7 A;  3DMD A;  1JE8 A;  3T4R A;  4A3I J;  3O8H A;  2XAJ A;  4IAQ A;  2FNP A;  1Z0X A;  4FTH A;  3DQV C;  2HDC A;  4XKB A;  1G4U S;  3OWT A;  2A61 A;  5E20 A;  5ICE A;  3WTU C;  1Y39 A;  3ITF A;  5L3G A;  1LDD A;  3M1C A;  1YFH A;  3MYF A;  3P9C A;  3S1Q J;  5FRN A;  4DIQ A;  2MD5 A;  2WB1 A;  1LFU P;  1A7V A;  1TW2 A;  2LY1 A;  1PP8 F;  2QLZ A;  1R00 A;  1VQ5 I;  1ODD A;  4G8X A;  2ZXI A;  5C4J J;  1PDN C;  1ORY A;  1QZX A;  2W4S A;  4CS9 A;  5FD5 A;  3PO2 J;  2IBD A;  3G1O A;  1U9O A;  3CTA A;  3I53 A;  4NC7 A;  2YU3 A;  2QTV A;  1NTC A;  3MVP A;  3EG9 A;  2EIJ H;  3K2A A;  2CFX A;  5IP6 A;  2JQ7 A;  2XM0 A;  4M9S A;  3QYB A;  3IV5 A;  1ZU4 A;  2QWW A;  4UV9 A;  4NQW B;  1B8I B;  4U5D E;  3IQC A;  4L9J A;  4IZZ A;  2DMQ A;  1WKM A;  2BY2 A;  1OCC H;  2QSH X;  4BBS J;  4G78 A;  4JEB A;  4BYY A;  3NKD A;  1NK3 P;  5BOX A;  3NMJ A;  3QPT A;  3C8G A;  1YJW I;  4E7K A;  2ESH A;  4ESJ A;  4L0Y B;  1A7E A;  1JUM A;  2RQQ A;  4U5G A;  4J7T A;  2QUP A;  5K7Z A;  4X1E A;  4AVZ A;  4MEX F;  5L0C A;  2GA0 A;  3E6M A;  4R8H A;  4A3E J;  1LKX A;  4XIC A;  2IOQ A;  3C18 A;  2FOK A;  5FO5 A;  3S2D J;  2R7T A;  4XPY A;  4LG0 A;  4A6D A;  4C3B A;  1U78 A;  3JRG A;  1DDN A;  4E0I A;  3MKY B;  1IUY A;  2HI3 A;  2VQH A;  2P6V A;  3L7W A;  2PX9 A;  3JRE A;  1EA8 A;  4JKV A;  4N06 A;  4V19 K;  1AVO B;  3PIO F;  2QSF X;  4MGR A;  1XC5 A;  1ETO A;  3HOS A;  2DA3 A;  3QRF F;  3P9K A;  3Q9S A;  4A4A A;  2LIG A;  4E7Z A;  3OS0 A;  3DKA A;  4LDR A;  2ZSH B;  1Y6I A;  4O6M A;  2L7M P;  2F5C A;  1RJ9 A;  4CCN A;  3FK6 A;  1YOV B;  1B4A A;  2GOX B;  5COG A;  2NOG A;  1FEX A;  2WAQ N;  1OCP A;  5DD4 A;  2QYO A;  4HQE A;  3FIW A;  3LOC A;  1R9T J;  1FZP B;  1BDJ B;  3FXH A;  1Z23 A;  2LBF A;  3HDD A;  3FK7 A;  2M4G A;  1UG0 A;  2DLL A;  2L2O A;  3I58 A;  3QPS A;  1OR3 A;  2VPR A;  3SQN A;  5B66 C;  3L1M A;  4YL3 A;  5GP9 A;  2P5L C;  1B72 A;  2XRL A;  3OA1 A;  2HMQ A;  1TQP A;  3DV8 A;  2HPM A;  4P1W A;  3QP6 A;  5TRD A;  2F5V A;  2KNH A;  2LYC A;  3BJO A;  2DDB A;  3R2P A;  1LE4 A;  1XB4 A;  1D8J A;  2HGC A;  2FGY A;  1E86 A;  2B0H A;  2PI0 A;  2J0W A;  3NRH A;  3MBG A;  4M3G A;  3DEE A;  2AHQ A;  4P9T A;  1HCR A;  3IEE A;  5KYW B;  1APC A;  1I5N A;  1EI7 A;  2WAF A;  4EV0 A;  4LLL A;  4YIF A;  1Q0K A;  3U0C A;  4U5B E;  1ETK A;  3WU1 B;  1H9G A;  5E3M A;  2Z1D A;  2X6O A;  2ZXW H;  4QTR A; 
#chains in the Genus database with same CATH homology
 3NYM A;  3H65 A;  4OIR F;  4EWC A;  4OAY A;  3VYS B;  3OR2 C;  1ZU5 A;  5HVQ C;  2JD3 A;  3E9V A;  3A1Y A;  2L9N A;  4MND A;  3QMK A;  4IX7 A;  3H5N A;  3EGX A;  2VJ5 A;  4MQ9 F;  3CP8 A;  3UMK A;  4G7H F;  2R7W A;  4O79 A;  3FBI B;  4XLH A;  1PYV A;  3K4C A;  2O9X A;  4QDL A;  1ZYR F;  2FUG 2;  1O5H A;  3TBI A;  2DT6 A;  1KON A;  3BG7 A;  3F9K A;  4KJZ A;  3M1C B;  4P6I C;  3Q6M A;  3EZH A;  3N24 A;  2A1D D;  3BLY A;  2KZV A;  2IGN A;  4P5O A;  3UR3 C;  2Y3G A;  1TWH A;  1NZE A;  3QOE A;  4BE0 A;  3D5S C;  3DTI A;  1MNE A;  1SAU A;  2CMP A;  4PFO A;  2C03 A;  3OIP A;  4BDY A;  2K3P A;  3HXL A;  1ERD A;  2IYL D;  4PJL A;  3K1H A;  4RLQ A;  4KI2 A;  2HZD A;  2M3A A;  3OS1 A;  2H7O A;  2EIL C;  4BEH A;  5DVW A;  2JUG A;  2OUM A;  3OY9 A;  3BC8 A;  4OWR B;  3RH3 A;  2Q1Z B;  2VL8 A;  3SDB A;  3ASN C;  3EJN A;  4KIT B;  1V5E A;  2KRC A;  4YWQ A;  2DXI A;  4U87 A;  3NYJ A;  1OCR C;  3DLA A;  3FHD A;  3HL2 A;  2J46 A;  5L3V A;  3FBN B;  4H4K C;  3EFO B;  4O6Y A;  4YT5 A;  1QLE C;  4J01 A;  2L9S A;  2ZXR A;  3DJN B;  4I3M A;  4YN0 B;  4E7H A;  4BGD A;  3E0J B;  2NUP B;  5DLJ A;  2VAS A;  2XSE A;  3SYN A;  1VYK A;  3W8H A;  3CMM A;  4DJA A;  2YZS A;  4IRU A;  4B6I A;  4M63 A;  5KYW A;  5KYX B;  2VQL A;  2X6W A;  4XLP F;  3PSI A;  3CZ6 A;  3DD7 A;  3KH2 A;  3QZC A;  1Z3Y A;  4F91 B;  3KMI A;  3H5A A;  5KHD A;  5HNF A;  1Z6A A;  2ZPA A;  2WVO A;  4G0H A;  3WG7 C;  4BAC A;  3SEO A;  2XXA B;  4DVY P;  2ZFU A;  5CI8 A;  2AQE A;  4BQO A;  4CS8 C;  4N4O B;  1JI8 A;  1D0Z A;  5B1A C;  4RM2 A;  3I3L A;  4XWJ A;  2VKH A;  4PFP A;  2X1D A;  4CCK A;  4YJW A;  1P9Q C;  3AG3 C;  5CKT A;  3EHN A;  4ZYA A;  4KNW A;  3W3C A;  3U21 A;  2IXP A;  4CCJ A;  1KU2 A;  2Y0S A;  3EG9 B;  5T1D B;  3ZXS A;  3ZG1 A;  2CNW A;  2ZXH A;  1AA7 A;  3S3M A;  3FDY A;  3RQ4 A;  1N75 A;  3M8J A;  4DBR A;  2R7X A;  1X1B A;  2MC4 A;  2L7K A;  3DPL C;  3H9J A;  2FFH A;  4K0D A;  3X2Q C;  2R4G A;  4PJJ A;  1N78 A;  3MX3 A;  2X51 A;  4BU2 A;  2VLA A;  2PP4 A;  2DOA A;  3LSK A;  4HNU A;  3OS2 A;  4BJ6 A;  3MKW B;  3BCB A;  4ULW A;  1PD0 A;  3E1S A;  3DTE A;  1X4P A;  1J09 A;  4ZJZ A;  2DYS C;  2CV1 A;  5DQZ A;  4OIO F;  2XF6 A;  3FKJ A;  2BOL A;  3B9Q A;  1OCC C;  1ZHY A;  5KYY B;  4CSW A;  2XDV A;  2D5R B;  3EUH C;  5L3Q A;  1S7Z A;  3O6X A;  4Q4Z F;  2V4J C;  4J00 A;  2A6E F;  3GAN A;  3CP2 A;  3GOD A;  2VH3 A;  4AU7 A;  2XSJ C;  4I1O B;  2G3K A;  3ZC4 A;  4YT2 A;  2BW3 A;  4B47 A;  1OKK D;  3B0V C;  4Y3O A;  4BG0 A;  2EIJ C;  3OYC A;  4KC9 A;  2PF4 E;  5B3S C;  2OV7 A;  2O5R A;  3GBG A;  5CQG A;  3ZGK A;  3OYK A;  2J9W A;  4HEA 2;  3DAF A;  1OKK A;  3LNR A;  4AE4 A;  1QHG A;  4NNJ A;  4RMN A;  3IUO A;  5EGY A;  4E7J A;  4XLN F;  5E3A A;  3POV A;  2KDO A;  3PNV A;  3HPH A;  3EUK L;  4YEL A;  1M2V A;  2XC7 A;  3ABK C;  4IAO A;  3EPV A;  3QYF A;  2J7P D;  3I5P A;  4ZLC A;  1OCZ C;  3KKB A;  4BEJ A;  3H9Q A;  3L2Q A;  3HUG B;  5KNL A;  2YEV A;  3LSI A;  2V1N A;  4LG3 A;  3ONQ A;  3RYL A;  1JPN A;  3S27 A;  2G62 A;  3E70 C;  1G8X A;  4PK4 A;  3H35 A;  4PSX A;  4E4H A;  2IS1 A;  1ZHT A;  2L81 A;  2G3V A;  1VMA A;  5KYU A;  1RJ9 B;  2VKD A;  4CUG A;  4E7L A;  2CNW D;  3LES A;  3L2U A;  2KP6 A;  4BE1 A;  4BUP A;  1Z7L A;  2IXN A;  3L0I A;  1YE9 A;  1DP3 A;  3S3O A;  2Y3D A;  2ELJ A;  3PJR A;  3F47 A;  3ABM C;  4BDZ A;  4CS8 A;  3KX2 A;  5D91 A;  5TGT A;  4CCO A;  3H9G A;  3HC7 A;  4IKF A;  3UMI A;  1TT0 A;  2K9L A;  3LMM A;  4F92 B;  3K70 D;  1M2V B;  3D5L A;  1TR2 A;  1TWA A;  2J7P A;  2PFD A;  1ZHX A;  4W8K A;  1LDK B;  3W8I A;  4G7Z F;  1G59 A;  2W00 A;  2Z2S B;  2W1O A;  3DJU B;  2WY7 Q;  3VDX A;  2Q9B A;  2IS2 A;  2RNG A;  2PX3 A;  4X0G A;  3AG4 C;  4YT4 A;  3CSK A;  4PUS A;  2J0X A;  4JJF A;  3PHF 2;  4R79 A;  3DTK A;  4U5F E;  4AYB A;  3DM5 A;  5HOO A;  4FWV A;  2ZXO A;  1V5G A;  2DT7 B;  2JVG A;  4QPO A;  2HDW A;  1E0E A;  3ZVR A;  4OAZ A;  4HRI A;  2Z15 A;  5D92 A;  4QI0 A;  2ZXP A;  1SF8 A;  3DU5 A;  3LL7 A;  5DS5 A;  3ZCO A;  2L5Q A;  4JQF A;  2Q9A A;  3AFH A;  2H7B A;  2Z16 A;  3S3N A;  1TWG A;  5BUO A;  1NG7 A;  2KHM A;  4XOT A;  3QOD A;  1WFX A;  4Y33 A;  3DU6 A;  5HLT A;  2KW3 C;  2Q9C A;  2ZXW C;  2K5C A;  1FTS A;  1D1A A;  3L2W A;  3RKO F;  2I8D A;  2E5N A;  1SMY F;  4F93 B;  2DGJ A;  2IXS A;  1QU3 A;  1DGW Y;  1M56 C;  1R6R A;  1VOM A;  2BW3 B;  2CS3 A;  4ZC3 A;  4BQQ A;  1FFH A;  4B44 A;  1Z3I X;  4O6N A;  3S0X A;  2VIX A;  4DGW B;  1YX5 A;  1OCO C;  5HSW A;  2Q3T A;  5CI9 A;  5CPR B;  2VJI A;  4PSW A;  2I8B A;  4OIQ F;  3MD2 A;  4XM3 A;  3VSL A;  4OIP F;  2R7Q A;  1X1C A;  1NU7 D;  4IWB A;  2X6Y A;  1Z3X A;  2LH9 A;  2IGO A;  4RM3 A;  2WBM A;  4HSR A;  5EHH A;  2JSP A;  4BJ6 C;  2B0J A;  3S8P A;  3FVY A;  3B0U X;  2LOO A;  3A2K A;  4KBL A;  5E33 A;  3VWB A;  1O87 A;  2VQG A;  2EIK C;  2MAB A;  3NG1 A;  3ZR8 X;  4RLF A;  3JRT A;  3I4U A;  3RFY A;  1MMA A;  2VQC A;  3K70 C;  2V3C C;  3K4B A;  2XF7 A;  2MYS A;  2CH0 A;  4ZDL A;  3B0P A;  2WZG A;  2R7O A;  3HKZ A;  2UWM A;  3Q7L A;  4XKV A;  5T3W A;  3H5R A;  4CH7 A;  1U0J A;  2M4K A;  2QY9 A;  3OL3 A;  1V55 C;  3VYR B;  2BE5 F;  3AG1 C;  3IAS 2;  1WJ5 A;  4Y4R A;  3OYD A;  2J45 A;  1FMV A;  2MFZ A;  1T95 A;  3OOU A;  4RDA A;  1UEL B;  1MND A;  5KCM A;  2Y3B A;  1MMN A;  4U5C E;  5KYX A;  1T0F C;  4OD5 A;  4BS9 A;  1QHH D;  4C30 A;  2BVL A;  3K4N A;  3W2V A;  3ABL C;  3N0T A;  3FDQ A;  2XF5 A;  3CF2 A;  3VSK A;  1JPJ A;  3BCA A;  3VYU B;  2M4E A;  4JJG A;  3V42 A;  4O7G A;  2CUZ A;  3LLK A;  2M7B A;  1IRX A;  4XMY A;  3K66 A;  4XR6 A;  4HEA J;  3EGX B;  1J8Y F;  4BJ1 A;  3C2H A;  3LAY A;  2W4B A;  2LRD A;  2WAD A;  2X1E A;  3OYI A;  3LS0 A;  4Q5S F;  4HST A;  1PCX A;  4HFF B;  2GOM A;  3LSG A;  2JA2 A;  5LD2 C;  3AQB A;  3HTK C;  2VXZ A;  2CGE A;  4K7B A;  2HVQ A;  2F6C A;  4XLF A;  2WL8 A;  3CQZ A;  3DWL E;  3VYT B;  2WZL A;  2YHS A;  1DGR M;  2X6X A;  4XL9 A;  2LG4 A;  4B43 A;  2VPL A;  3TD7 A;  2A6H F;  4EAT A;  1D0Y A;  1IZM A;  2H7V C;  5DS4 A;  1MMD A;  4LIU A;  3AKZ A;  3J7A Y;  2KPM A;  2X85 A;  4FAS D;  2GFH A;  4F3Q A;  3OYB A;  1HA8 A;  3DM9 B;  4JW1 A;  3H0D A;  4XLA A;  3SZR A;  5KYY A;  4XLC A;  3JSZ A;  1D1C A;  2V26 A;  2W82 A;  1WJB A;  3OYF A;  2EIN C;  3OL4 A;  3SYT A;  3PL8 A;  3W2W A;  1WJD A;  1S9H A;  3TMO A;  4KIS A;  3ZIB A;  4I1M A;  2P0W A;  2LRE A;  2A6T A;  3SEQ A;  1V54 C;  3EPZ A;  4FET A;  2QKL B;  3EQL F;  2E1M B;  4RD9 A;  4II2 A;  2C04 A;  1ZEL A;  3IP4 B;  4LER A;  2VJJ A;  2XRH A;  1ZHW A;  3ZRG A;  2XAU A;  3EGD A;  2R7R A;  3OYL A;  4CBE A;  3SNH A;  3OYA A;  1ST6 A;  3T6B A;  4XKC A;  4BEH B;  2LSE A;  4XON A;  1IW7 F;  2J9V A;  4BL0 B;  4IJJ A;  5E2Q A;  4CIH A;  1Z63 A;  1NU9 C;  3T6J A;  4NUB A;  4EBB A;  5CQE A;  3RPU D;  4QPQ A;  2KMU A;  3EGD B;  4GYT A;  4BJ5 A;  2CV0 A;  2PX0 A;  2WAE A;  3AG2 C;  4DVZ A;  4X0R A;  4ITV A;  1X1A A;  3RSN A;  2WB7 A;  4II3 A;  4PJM A;  4DOZ A;  1NG6 A;  2AQF A;  2V7F A;  2NUP A;  3NYL A;  2WA0 A;  2HVR A;  3AL0 B;  5KYU B;  1LFP A;  3MKZ A;  3Q7G A;  4LLE A;  5LFA A;  1UAA A;  2Y39 A;  2KL4 A;  3SEZ A;  3I5Q A;  2Y69 C;  2E60 A;  1ZHZ A;  1Z21 A;  2WY8 Q;  4C2U A;  3V7O A;  1M2O A;  4A2N B;  5DS6 A;  2LC2 A;  1FFT C;  2L9J A;  3DXJ F;  3FAJ A;  4C2T A;  1FMW A;  2IS4 A;  4XNF A;  3HJC A;  3K33 A;  4JZA A;  2R7V A;  2P7V A;  3NKE A;  1N1C A;  3K4J A;  2OCC C;  1N77 A;  1TZL A;  2WVN A;  2WZF A;  3EZI A;  3RIP A;  3A4C A;  3K10 A;  4C3D A;  4F4B A;  3OYJ A;  2HVS A;  3EH1 A;  1OR7 C;  3BG6 A;  2W7N A;  3S32 A;  3CJQ B;  1BR4 A;  4KT6 A;  3OYE A;  2OG2 A;  2IGK A;  4BQN A;  1VK5 A;  4B48 A;  4G7O F;  4NY3 A;  4OIN F;  3K4M A;  4XKW A;  4U7B A;  4IQJ A;  3NWT A;  1NG1 A;  4JVS A;  2IGM A;  3DKY A;  3HPG A;  3KEY A;  3EUA A;  2CW7 A;  1Y56 A;  3MMY B;  3LSH A;  1W36 C;  2CDQ A;  2MWQ A;  4CS9 C;  3HOT A;  3PMR A;  4F52 A;  2Q2E B;  4XLE A;  1VZ0 A;  4XTK A;  3MLG A;  2WAQ A;  4OD4 A;  2WVQ A;  4BE2 A;  4E6K G;  3WOD F;  4C3E A;  2CFO A;  2BVM A;  4YEJ A;  2W4M A;  3G2B A;  2F4I A;  2HQA A;  1WJC A;  2VB6 A;  4CZC A;  4AK9 A;  4HFK B;  4HNT A;  3D5R C;  4HG2 A;  1Z5Z A;  1X1D A;  3ECS A;  4C7O B;  1BOB A;  3RTR A;  3TL4 X;  3L2V A;  4ZDO A;  4LIV A;  3OYM A;  4QI2 A;  3JT1 A;  1WJE A;  4ANJ A;  1BR1 A;  3LFU A;  4CCM A;  1BR2 A;  1W2W A;  2XL4 A;  5DQT A;  4CSA A;  4WJ0 A;  2E87 A;  3CJR B;  2KQ9 A;  2QKM B;  3L2R A;  3JYH A;  2PJR A;  2CW0 F;  5FCL A;  3K1I C;  2NUT B;  3UMH A;  1SZI A;  2KGO A;  4HE8 D;  2E5Z A;  4GEH A;  4D9J A;  3PNY A;  3DMD A;  4PJN A;  3EHM A;  3N2Z B;  4FX5 A;  3L34 A;  3T4R A;  3SZG A;  3DPT A;  3DQV C;  4XKB A;  2ZSI B;  3OIQ A;  3OWT A;  4FES A;  2LBF B;  3PFY A;  3UNG C;  3ITF A;  3LS1 A;  4Q7C A;  4U5H A;  3M1C A;  5T3T A;  3K6B A;  3NDB B;  1X4O A;  2R7S A;  5FRM A;  5FRN A;  3ASO C;  1TKN A;  4DIQ A;  3S93 A;  1SFK A;  2WB1 A;  2K9M A;  3ZQQ A;  1M57 C;  1DQU A;  3HLZ A;  4LLC A;  1WJF A;  2LY1 A;  3VAY A;  3S29 A;  4IQ4 A;  2IXO A;  3DAG A;  4C9Y A;  4JUR I;  1D0X A;  2ZXI A;  3RCO A;  1QZX A;  4KNV A;  2NG1 A;  2W4S A;  4G6T B;  4N4N B;  4CS9 A;  2DJI A;  3NWS A;  4LAC B;  2KLO A;  4NC7 A;  4XN0 A;  2QTV A;  3OYG A;  2NUT A;  3EG9 A;  1X19 A;  4YT8 A;  1OLT A;  4CCL A;  3QYB A;  2HV6 A;  5FRO A;  4E7S A;  1WGW A;  1ZU4 A;  4NQW B;  4U5D E;  2HNH A;  4XOR A;  5E3C A;  1LS1 A;  4IZZ A;  3X1O A;  3CES A;  3LJB A;  2A69 F;  3NKD A;  2XXA A;  2E1M C;  3DKX A;  3FHN A;  4XQF A;  4BJ5 C;  3VYW A;  4NC8 A;  3K4L A;  3PUB A;  3PSF A;  2W9Y A;  4E7K A;  2MD0 A;  3EH2 A;  4E7I A;  3F46 A;  2KJG A;  3I9V 2;  2J9U A;  2RQQ A;  4D1Q A;  3O39 A;  3OYN A;  4U5G A;  2DCE A;  2IXM A;  4C7O A;  2EIM C;  2A5W A;  2IS6 A;  2UV1 A;  1TWC A;  4AVZ A;  4BXF A;  1D1B A;  3EFO A;  2A68 F;  1LKX A;  1WJA A;  3OR1 C;  4AX2 A;  2IOQ A;  3JCU Q;  3LLI A;  2R7T A;  2LY2 A;  2HPI A;  4C3B A;  4JOM A;  3K6G A;  1YX3 A;  4GRI A;  3MKY B;  2M7A A;  4XOP A;  2VQH A;  2P6V A;  4N06 A;  2M0M A;  3C2G A;  3PNT A;  2VJ4 A;  5JHF A;  2PMZ A;  3UGO A;  4U5E E;  4F55 A;  3HOS A;  2NOJ B;  2DYR C;  1J8M F;  2UUZ A;  3ZSU A;  2RRE A;  4E7Z A;  3OS0 A;  4ZTF A;  3K7D A;  3Q6N A;  5B1B C;  4XN3 A;  4O6M A;  2ZSH B;  1Y6I A;  5IY5 C;  2V9K A;  3DPU A;  3N05 A;  4CCN A;  1RJ9 A;  5KYN A;  1LVK A;  3QYE A;  2GOX B;  2KQR A;  3LEV A;  2R7U A;  1V5F A;  2Y3H A;  4I44 A;  4LIT A;  1VYI A;  3W2A A;  4J32 B;  4JCH A;  3AL0 C;  1Z23 A;  2LBF A;  4B3X A;  4J30 B;  3OYH A;  2M4G A;  1UG0 A;  2L2O A;  1MW7 A;  3LSM A;  5HNH A;  2X1C A;  3KYL A;  1GLN A;  3SP1 A;  3AQC A;  3HG9 A;  3OA1 A;  4HPQ A;  3IAM 2;  2CUJ A;  2HPM A;  4ZLD A;  4P1W A;  1MMG A;  4CSA C;  2HU9 A;  1W36 D;  2F5V A;  3KL4 A;  5F5H A;  4CA0 A;  4AE4 B;  4YRV A;  2KNH A;  1PJR A;  2LYC A;  3S28 A;  2KRH A;  2PJR B;  2HV7 A;  2FGY A;  4BJT A;  2J0W A;  4ZTJ A;  3NRH A;  2W45 A;  1K6Y A;  3DEE A;  2JVH A;  3DZA A;  2OC6 A;  3IEE A;  5KYW B;  2CW8 A;  2CV2 A;  3UGP A;  4CS7 A;  4DBQ A;  2WAF A;  1PD1 A;  2VXD A;  3OMY A;  4U5B E;  5F5F A;  3OEO A;  3K4K A;  2Z1D A;  4MLO A;  2V6E A;  4ZDP A;  4RBN A;  1EA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...