3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords DNA-binding protein RAP1
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
3CZ6A 4BJTA 4BJ5C 3OWTA 3K6GA 4BJ6C
chains in the Genus database with same CATH superfamily
4ENKA 2E35A 1O3QA 3F72A 4EWCA 3GBGA 3SZPA 4YT5A 3FXJA 2DT5A 5L0GA 5HNFA 4DYCA 3FMRA 3CQZJ 3JR9A 1E83A 1CGME 4MQ9F 4UVCA 2R7OA 4E17A 5DV5A 2LFDA 5ILUA 1FSHA 4CHUA 3ZQVA 1MMAA 2M64A 2XGEA 2L9SA 1LPQA 3DCFA 3GFJA 4XL9A 4R8HA 1B72B 2XLDA 3C8GB 3MWMA 1BZ4A 4ON0A 2V1XA 2EV0A 4PSWA 4WGYA 4ZC3A 1TC3C 5B1BH 4QPOA 1BJZA 2V3CC 2RVCA 2XLHA 2LIGA 4LLGF 3DKYA 2L2OA 1RIOH 5FD6A 4HSTA 2LY2A 2Z3YA 5FKNA 1EH8A 2VC0A 2WVQA 2EFWA 3MX3A 1FYMA 5K1YA 2BC5A 3CLQA 1RCPA 4Q48A 3QYBA 2K4BA 4P5OA 4C30A 2EB7A 2YSRA 3TW7A 3QU3A 4CCJA 1ULYA 1HMOA 2LSEA 1LI7A 4M6XA 2GFHA 3K1IA 4P9FA 2D1HA 2VUMJ 2L4AA 4L5JA 1YZCA 1ETKA 5IP9J 4RD9A 2NVXJ 1M1EB 3CCQI 4MEXF 3FXOA 5F6FA 1AKHA 3GLXA 3WU1B 2BW3A 3EHNA 5GAEJ 3GTKJ 2LSOA 4CICA 3M3YJ 2OBPA 4Y52J 1BM9A 4JW1A 2L3DA 2M0CA 5D91A 5TJ5E 1D8KA 2P61A 2OPTA 2VT3A 3MAJA 3BZ6A 2KRHA 2TDXA 4PR9A 5D4SA 2HQRA 5F5FA 4U9EA 1TWHJ 1LKXA 2O8KA 2EV5A 2QLZA 3OIOA 3GWNA 2KRCA 1G4DA 4BKXA 2H6CA 2HFHA 2M1BA 4E7IA 2IVMA 1VZ0A 4XSXF 1VYKA 3EFOB 2BY1A 2UV1A 1Z7Qc 4Z9HA 1J9IA 3JW4A 2O7OA 4QDLA 5D6EA 2HXIA 2EA4A 2DT7B 5DYMA 2M87A 3BP8A 4ER9A 2XSJC 3IL2A 1HKQA 5TRDA 2I10A 4FE4A 4MVRA 2E36A 1A7EA 2VE9A 1MJAA 2EQRA 3T9OA 2IRFG 3NYJA 1NH3A 2P6TA 2QBYA 3TK0A 2ELHA 3TP3A 1ZW2A 5DD4A 2HDWA 3CAXA 1X58A 3GYHX 1AU7A 4JRZA 1SD5A 5FZTA 3VYTB 3RI4A 4YT8A 3HBLA 1YE9A 4HX4A 4ESFA 1MSEC 1BI2A 1LFPA 3KL4A 2QA4I 2X6XA 5JVEA 1M56C 4PCQA 4C9YA 4Z2YA 1B8IA 3HRTA 3EG9B 4Z9IA 4ZH4F 1MJ9A 2J7PD 3DKWA 5CJ9A 1R4TA 2H94A 1W5TA 1ZRDA 2D5RB 4ANJA 2KQRA 4Y33A 2RGVA 1YIJI 2K9SA 2J45A 3FM5A 3ABMC 2J9BA 3HJEA 4HAMA 1XMAA 3FDYA 4C3JJ 2JA2A 2Y31A 1VTNC 3HGYA 3U9MA 1IRGA 4CYDA 4ONSA 1O5HA 4KT5C 3L8JA 3WODF 1R00A 3E5QA 4ZLDA 1KTMA 3H2UA 3OS1A 3FHDA 3P9CA 2FE3A 2IXNA 1JHFA 4Q7CA 4ZYEA 3S15J 2A6HF 4LLNA 1X4OA 1E84A 3G4SI 1B68A 3R0AA 1UFBA 4DNCA 1NFOA 4KBLA 3CO7C 3QPSA 4D0PA 1A41A 4IQ4A 1WGXA 3DPLC 4MVMA 2CV2A 1JGSA 3FXHA 3JCUQ 2MD0A 3CMAI 4G9YA 2NXNB 3IAS2 3BR0A 1SFXA 3OL4A 4CCOA 5JHUA 4DYRA 4ZYDA 4IHTA 4BEJA 1OCOH 2CCYA 3HOTA 2VOOA 1Z3XA 2EIJC 4XWJA 1IN4A 4HV6A 2A07F 2YL3A 3HYIA 5LFAA 4EJWA 5HLGA 2DJNA 2C03A 1R23A 2XROA 2CNWA 3FKJA 5BQGA 4CS8C 2Z99A 3EGXB 2OC6A 4AYBA 5D4RA 4E7SA 3IRRA 1IV6A 3EUAA 1T98A 2ZCWA 3QPHA 2HUJA 1TWFJ 1LI5A 3RVYA 5FLXK 4J19A 1DP3A 1TNSA 4BEHA 4BXXJ 3RSNA 2ELJA 2KJBA 3VWBA 4KFCA 1VB5A 1RKTA 3Q6NA 4NBQA 1CGPA 4I01A 3BZCA 5LHHA 4ENJA 3H3ZA 3CF5F 2LK2A 3GW2A 1QO0D 5M3MJ 4A0ZA 1OR2A 4GCVA 1S29A 2GWRA 2X85A 1WI9A 2P0NA 4FESA 4HYEA 2M45A 2WBMA 2GXBA 2EZKA 2KNHA 1D1AA 4NC3A 3VRCA 2CFXA 3TO6A 2QCOA 4C3EA 4YFXF 3CJQB 3NEUA 1OYWA 2Z9OA 3GTLJ 2R05A 4S0HB 3F22A 4D4XA 4B8XA 5KVRA 4XKWA 3I9V2 2FX0A 3M1CA 2NPUA 3H3UA 3OR2C 3DQVC 3DF8A 2XC7A 3KMIA 3WE2A 4FE7A 2NUTA 1I3AA 4A4AA 2R5ZB 1VF9A 4XONA 4CJGA 3H5RA 4I99C 1YQAA 2CMPA 2QY9A 3HUGB 1IAWA 2DO7A 5J1YA 1Y39A 2J46A 1BA5A 3F8NA 2VH3A 5E1WA 1OXBA 4RAGA 1YVIA 1WVRA 1SF8A 3C8ZA 2PN6A 5J4YA 3W6JB 4A5MA 4BJ6A 1FWZA 1I39A 4HFKB 4KYWA 4A3IJ 1ZW3A 1E86A 4N0BA 2GOMA 3EUHA 3ONQA 4UV9A 2YLIA 3QPTA 1X3ZB 3LNRA 3LS1A 3QZCA 4AWXB 3WTVC 1JKPC 1U0JA 2OCCC 4MW8A 1MMDA 2JUCA 4Y17A 3EZHA 3HB9A 2AS5F 4NC8A 4PFOA 2XB5A 4JCHA 4E18A 1VQMI 2MW8A 2KLOA 3OL3A 4U5EE 3ZOBA 4LB5A 3FBIB 4EJTA 4A0XA 3SQNA 1IN6A 3P7NA 5FD5A 1LS4A 2B0JA 3AG2C 3HPHA 2M7BA 4FISA 3CSKA 1IN5A 4EMSA 3MQ0A 3KETA 2JA8J 2A5YB 2ESNA 1DP7P 4XSZF 4J7TA 1TFKB 1GM5A 4RMNA 3B6AA 3S3NA 5KYUB 4M74A 3ECOA 4L9NA 2COBA 4KUMA 4HQMA 1P9QC 2L02A 1W7PA 1SMTA 4KIBA 1J0RA 4QLCU 2QENA 1A6IA 4LG3A 2HSBA 4XLEA 1XDSA 2E7WA 3L1MA 4NQWA 4I02A 2OAZA 4M6VA 5F08A 4RM2A 2Q3TA 3G4XA 3FMSA 2LD5A 1Z7LA 1JOGA 2IPQX 2ZJRF 4L5IA 1Z6AA 3TOLA 4UVBA 5LLQA 1OCTC 1BI3A 3BTIA 3N05A 1I5NA 2X9DA 1U6GA 2DA7A 3FOOA 2RAEA 3CUQC 3FF5A 1VQ9I 3A1YA 2JPCA 4OAYA 2OJED 2QZ8A 1FP2A 1FZPB 4ZLCA 1T01A 3VYWA 2X0LA 1MNEA 2J5OA 4XRFA 1S3JA 4BJTA 4D5FA 2W24A 3OYFA 4YEJA 3QPLA 2HTSA 2F5EA 3OSFA 2IW5A 5EHHA 2PMZN 3NYMA 4C3BA 1BJAA 1T2KA 2DA3A 3M1EA 3QAHA 4D5CA 5BQTA 1RJ9A 1Y8RB 4NC7A 1GUUA 3ZQHA 1FFTC 4IRGA 5ICFA 4BAYA 3ABUA 2JA7J 1MMSA 5J47A 2L7AA 4EEFG 2V6CA 3H1CA 1BW6A 3IH4A 3KYDB 3L1PA 3S0XA 1TQIA 3EUKL 2HDDA 2GAUA 3LSHA 1JE8A 2NYXA 1RUNA 5L0DA 3F8BA 2XRHA 2G7UA 3WAQA 3LOCA 1BOAA 2BY3A 3L2QA 4X1EA 2BY2A 2M2EA 2Z16A 2E60A 1T8IA 4BXUA 1IGNA 3ZQYA 2CO5A 2FSWA 4XIDA 2L9RA 2WZFA 4IAOA 4XEVA 4N9IA 1K04A 3ZMSA 1Y0NA 4I1OB 3LUTB 2CGEA 5FFZA 4UY8I 2OZUA 2QUFA 3H0DA 1HW2A 4F92B 2P7CB 2GXGA 2VT2A 3UGPA 3F8FA 3M8JA 2JSPA 1XDUA 4CO8A 3ASOH 3K1MA 4RB0A 1Y1VJ 1DDNA 2R7SA 4J7YA 2M5WA 2XIGA 4A3FJ 4F55A 4RB3C 5JLXA 5LBQA 3LSMA 2PEXA 5FB2A 4G7HF 5DUKA 4BACA 1XG1A 2DPDA 3OIPA 2ISZA 4XEKA 1FC3A 2DFIA 2Y39A 1WOLA 4CSAC 3PUFA 2LKSA 3K4MA 2GWWA 2ESHA 2WADA 3HSFA 1CF7A 2R3SA 4IKFA 2FGYA 2LOOA 1ZN2A 3IQ5A 2P5VA 3RYLA 3SXZA 5B1AH 2HGCA 2ZXJA 4EJVA 1YIOA 2R4GA 1MH3A 3JSPA 3VDXA 1SEUA 1B9MA 2LC2A 3WTXC 3J80K 1A7DA 3JSEO 2PLYA 4AIJA 3D5LA 4N9HA 1GLNA 3M4CA 1ZREA 3J7ZI 3W6KB 3ZC4A 2LRDA 3K4NA 2C6YA 3EPVA 4IB4A 2ZFUA 4IWBA 2Y48A 4DBQA 4W97A 4BJ1A 3LSKA 3OOUA 4KN4X 1FBSA 5CQEA 3WTZA 3HRMA 4FTHA 2R92J 1HSJA 3UMHA 4AVZA 3LAPA 1MNMC 2OD5A 3SDBA 3GCMA 4CDGA 1YX5A 3TL4X 4BL0B 1MJBA 3DPTA 2CSOA 3MVPA 5IYBJ 2M8EA 1NG6A 1CGNA 4QSHA 2HVQA 4HLYA 3CD6I 3G4ZA 3IRQA 3GFLA 3KP7A 5J3LA 3K2AA 3J81Z 4KA4A 3PNVA 1A35A 4EBKA 2O0YA 5E8GA 5IP6A 3JRAA 1P2FA 3ZDLA 4BGDA 2E2JJ 5HS8A 5DM7F 4KDPA 4CXFA 1YX3A 3VFZA 3CJRB 3PNTA 1R1VA 1OCPA 4MVUA 3K1IC 1XN7A 5FKKA 2Q9CA 3SFIA 2ZNYA 1NSGB 4JIOA 2CUZA 4A3EJ 1K6YA 2EIMH 3K70C 4IGGA 3U9GA 4CIPA 3M9AA 1APLC 1UG7A 2HSQA 3LSRA 1KZHA 3GFIA 3LS0A 2OKUA 4YWQA 2JK3A 2FJ1A 2LNBA 1Z63A 5K0IA 1W7PB 2NS7A 2XAFA 1LE8A 1RUOA 2LR8A 3BJOA 4NHJA 1R5ID 4HW0A 5D5XB 2VKVA 3ABTA 3TULA 1WPKA 5JVTA 1K05A 2R7VA 1A5JA 2QGUA 3KZYA 4IHXA 3B02A 2HZ8A 1V55H 2OOCA 4MTGA 2Q9BA 4XTKA 2OTJI 3H36A 3E70C 2ZC2A 1OCZC 1QPIA 4NB5A 1SFUA 3I59A 1YLFA 1DU0A 2CJJA 1BBHA 3RPUD 3CCLI 2OCEA 3I5UA 1W36C 4A6DA 2CYDA 1RKEA 4Z6YA 1IV8A 5T3WA 2DODA 3M8FA 2ZXPA 1W7PD 3WTSC 3TO7A 3FXKA 2XS1A 5FLMJ 1MD0A 2KFDA 4EM1A 2Z33A 2JD3A 1QSPA 3HNIA 2HQNA 3HTUA 3HRUA 4GO1A 4JK1X 2EPNA 5KYNA 3SXKA 5L3BA 1ZGAA 5FKMA 1DUXC 2DMTA 2ME6A 4R1HA 2BV6A 3NKEA 2CYYA 3ZQQA 3WG7C 4XM3A 1UAAA 1O3UA 3CMYA 1MIJA 1Q0KA 3K69A 5F04A 4A5NA 4C2UA 1XWJA 4LACB 1WJAA 1MBHA 1F43A 3N2ZB 2LY9A 2DBBA 1ZQ3P 3NAUA 3N97A 3JRCA 2PMZA 2YU9J 4C7OA 1ETXA 4KIGA 4IARA 1WFXA 2K86A 4L9JA 4BHBA 3JREA 4M6YA 3SYTA 1LQ1A 2A6TA 4A3CJ 3CLOA 1TWCJ 3EJNA 2A5WA 3LEVA 1T6QA 2IP2A 2EFQA 3HLZA 5L0CA 2ZJPF 2VBXA 2BXYA 1RMVA 1TNTA 5CI9A 2QLAA 2IS2A 1YJ9I 4Y3OA 3M4OJ 3NG1A 1FP1D 1EJ9A 1SMYF 4IRHA 4BY7J 5F28E 3J7YJ 4HBLA 5A6JA 3I5QA 2RQQA 4CSAA 5J40A 3TJ5A 2VBZA 3FXQA 3RKWA 4LB6B 4II3A 3ZWIA 1XCVA 3WHNA 4DZJA 1EKYA 4ZYGA 3WTYC 3SEOA 1OCRH 3SP1A 5AC5A 4PJMA 4HFFB 3BT9A 2JWTA 4YG2F 4AVPA 1J09A 5DM6F 1TBXA 3ERMA 5KHDA 2AQEA 3MZHA 1SVOA 4GGGA 2LFBA 4II2A 1R9TJ 3AG1C 3DWLE 1TTYA 3R7CA 2V1UA 3EGXA 4GEHA 1USTA 5GADJ 2IT0A 1FPQA 2WA0A 2KSFA 3GORA 3H0GJ 1V5EA 4P6IC 1AHDP 3V7OA 3TDUC 1MW7A 2DW4A 1ZR4A 2Y75A 3DPUA 2CQKA 3B0VC 2VBWA 2CFOA 2RD9A 4BHPA 3U21A 4CX9A 2HWVA 3HEFA 2NVQJ 3BLYA 2PFDA 2Y9ZA 1LEAA 4JTDB 4N6HA 1IUYA 2AWYA 2OZ6A 4U5DE 5T1DB 1HMDA 1NLXA 2AXLA 2XLEA 3C2HA 2LD6A 3HTKC 4ZZLA 5AIQA 3V7SA 2D5VA 3AOUA 3EHMA 4LDKA 2M8GX 2VKHA 3A01A 1WJCA 2IM8A 2J9WA 3ML6A 1R1UA 2W4SA 1LS1A 1NBBA 5F0CA 2PF4E 4CZCA 3K1PA 3WU0A 4I44A 2PJPA 5K5OA 2R5YA 5FRMA 3G73A 3AQCA 2ZO4A 1QPUA 1E3PA 4PGGA 4XLFA 4CA0A 1UHSA 5A2QZ 2LTPA 3TW6A 3ZQ7A 3JSOA 1IZMA 4BDZA 4OIQF 2G3KA 1ORKA 2XV4S 1JPJA 2WY8Q 3HG9A 2NVUB 5D5VB 5BPIA 3EG9A 4MVZA 1VQ7I 3HSEA 2K9NA 2O6GE 3E6MA 1RC9A 3KX2A 3AG3H 3PQJA 1POGA 3RQGA 3DZAA 2KIMA 3QP6A 5HDGA 2FOKA 1NFNA 2ZBKA 4JQFA 1BC8C 4FX0A 3GFMA 5A69A 2L6GA 2FOWA 2A69F 3E3VA 3JTGA 1LJ9A 2BHYA 2YU3A 1ZVZA 1W1WE 2Y0MA 2KIUA 4ULWA 2NAZA 1PVEA 2DFHA 2JZYA 3PO2J 5C4JJ 2MHRA 1YDIA 2IXMA 1E3HA 3LESA 4E0HA 4R79A 4XKBA 1QRYA 3E6BA 4I76A 2PJRB 5TJJA 1UCRA 2IAIA 2P8TA 2XB0X 1SD7A 4RLQA 4ESBA 1BDJB 4DYQA 1ZG5A 2GA0A 5ICCA 2XKPA 5CVJA 1Q0FA 2VL8A 5CYVA 4RBOA 2CU7A 2VASA 3CCVI 1K61A 3N4MA 3QRFF 2DCEA 1TQGA 1ETVA 3S27A 3CJTB 3BG9A 2NNNA 5BPDA 2YL1A 3GTMJ 3C1DA 1FX7A 4CH7A 3DJUB 3TDZC 3Q7GA 4M3GA 1XC5A 2ZJQF 5IOYA 1Z3IX 1B1BA 1G3YA 1K78A 1IXRC 2O3FA 4PJ0C 4IJAA 1O3RA 5F1RA 1T5OA 2O9XA 2PNOA 4WJ0A 3MKZA 5E3AA 3BPVA 3VYUB 3KZIC 5B3SC 4HDVA 3MBGA 2NNYA 1OQYA 4I6ZA 1H9TA 2FBHA 2ELKA 3O8GA 1TR2A 3BRJA 3PUBA 5LGTA 4JEBA 5E1XA 4KC9A 4HA8A 3V8JA 3S2HJ 4U9DA 4XMYA 2W48A 5J6XA 1LNWA 1G3SA 4TV7A 1A6QA 4FASD 3AGUA 4UB6C 1NTCA 3PO3J 4RGUA 5B66C 3GX4X 1H8AC 4DRHB 4HV5A 3E97A 2ZPAA 3A2KA 5KYYB 4B44A 3ZVRA 1TT0A 2DOFA 1WJ5A 2ZMEB 4Y15A 1T33A 2H1KA 2OV7A 4CCKA 2W1OA 3JT1A 2LG4A 3I71A 2R7QA 3VB2A 3TMOA 2WAQA 2R5ZA 1WCMJ 2LP0A 1PP7U 3NWSA 4HF2A 1VQ5I 2DMPA 2HTJA 4E4HA 1H88C 2V7FA 3HZJA 5C4XJ 2KDOA 3GEZA 1K83J 3FZVA 2JVHA 4PZJA 5LHGA 3JRHA 1OKKA 2PX3A 5T3TA 2PP4A 2VQCA 5H6RA 5BMZA 2UUZA 4LIVA 1EA8A 1P6RA 1UG0A 3L9FA 3S1MJ 4FETA 3WU2C 1VQ8I 1M2OA 4NTBA 1JPNA 2PFBA 4CGZA 3ZTZA 2EINH 5DCFA 2CQXA 2Z2SB 1YOVB 2XSDC 3H3VK 4HNUA 3KEYA 1OW8A 1J8YF 3MFNA 5ILSA 1AWCA 5JVGF 1IG7A 2WV1A 3WE3A 3OYNA 3EPZA 2W4BA 3FXRA 4G78A 5HS9A 2ZJ2A 3CC7I 2KDZA 4NC6A 3RIRA 2VJ4A 4MNDA 1U78A 3GTQJ 2V9KA 2CNWD 4MTFA 5B1AC 1I4YA 4LDRA 5E8IA 3RH3A 4B3XA 3OYIA 4LDQA 3P9IA 4HNVA 1O87A 3CDLA 5B3IA 1IZ1A 3COAC 2O8XA 5E3NA 1OYYA 2UUIA 4P55A 1R4NB 5IP7J 1XMKA 3K2ZA 2CV1A 1VFCA 1PUFB 3S1RJ 3QYFA 4M9XA 1GV5A 1SFEA 1I5ZA 2JPBA 2KP6A 5ERIA 3JRDA 3KH2A 1DU6A 2W84A 1HCRA 1TL8A 2Z5UA 3K1HA 2CH0A 2EIJH 4CIHA 3LWFA 4AX2A 5K7FA 2DTZA 3FK7A 1WH7A 2Q1ZB 2NVYJ 2CW8A 4MW3A 1JKOC 2L7ZA 5LGUA 4ASNA 1YS6A 3T8RA 4U87A 3F8CA 3MKYB 1FR0A 4FCYA 4K1OA 2HKXA 5A6AA 5EZGA 2PI0A 1VQPI 4CYCB 2H27A 2R02A 1R36A 1JTXA 3QW0A 4XEFA 1WQ2A 5CPRB 4YL1A 2P6VA 2ZKZA 3DXJF 4MVQA 4NCQA 3DTIA 2X51A 4M9ZA 3CDHA 3C3WA 1OR7A 1XD7A 1S5LC 4XLCA 5J8CA 2WV0A 2H7VC 1Y0UA 3A02A 3CUOA 1R4MB 3HKKA 1WGWA 3KEQA 1U8RA 5FKLA 3WG7H 1ZG3A 3H92A 1F1MA 5FCLA 2G7HA 2H6BA 1W5SA 2GLOA 2LMDA 1UZCA 3AQBA 2O03A 3R2PA 4U5HA 3QTHA 4JP0A 5BOXA 3UR3C 3S93A 1B8IB 5LRSA 2HPMA 4XPXA 3ABKH 1WI3A 2CDQA 4UUSA 4QPQA 3L34A 2EPOA 3IQCA 3F6VA 2FBIA 2ZMEA 3I54A 4WXDA 2WVOA 4K7BA 2CW0F 3W2AA 2QWWA 2HYGD 5GPCA 3I64A 3UGOA 2MABA 3K70D 1DPUA 4B09A 3GZ5A 4W8PA 3MN2A 1YYXA 4AM3A 1ON1A 1WHUA 4GYIA 4XRSA 2DA6A 1SAXA 1VQ6I 1X1AA 3KP4A 3F23A 2K5CA 1A36A 1WJEA 1ZZPA 3TEDA 5E1ZB 2BXZA 5HVQC 1S6LA 3PNYA 4OOIA 3IV5A 4P9UA 4X0GA 3ZQIA 2R7WA 2NS0A 2E1CA 2QNLA 3FX3A 3KP5A 3CCEI 4EATA 3OR1C 4RAYA 5CVRA 4D9JA 2VPLA 4NQFA 3ASNH 1TWCA 2QQ8A 1L3LA 1QQ3A 4N4WA 1YTYA 1Z91A 3GTGJ 3CP8A 4B6IA 2A05A 2Q8KA 2P5LC 3S8PA 3C63A 2BVLA 2P4WA 3CC4I 1YZAA 2WY7Q 1WH5A 2JA5J 3L2WA 4RDAA 2LBFB 3DBHB 1FTTA 5HV9A 2DT6A 3A0HC 2AO9A 1HBXG 3ZP5A 2W00A 1ETOA 2ASRA 5ILVA 1CF7B 3AAFA 2L7FP 2BYVE 3B0UX 2HS5A 4GFBA 3RJPA 3Q3SA 3H5NA 3TQNA 2KQ9A 3T1BA 4UVAA 2DOEA 2F5DA 2IBDA 2YVKA 2KHMA 4A3KJ 3M4BA 1DGWY 2PJRA 1MH4A 5GPGB 2ZXOA 3U3FA 2KKOA 2NOJB 2F6CA 1YJGA 4U5FE 1NU9C 1H0MA 3Q0VA 4QWQA 3SYNA 2RN7A 4IXAA 5HODA 2J5PA 3OYJA 1Q0MA 2QYOA 4CJOA 2JQ7A 3RQFA 1NG1A 2XGXA 4I09A 3E5UA 3VPRA 2HV6A 4Q47A 3RKXA 1QZEA 1XCBA 1KONA 2QQAA 4KMUX 3T6GB 1JUPA 4XLPF 3KYJA 1G4WR 2L0KA 4ZDPA 4JTCB 2Q2EA 2JRMA 3C2GA 3CESA 3ROUA 4XN3A 4G6QA 1HW5A 1EA3A 4AC0A 1R71A 4XQFA 2CG4A 3H9QA 1LVAA 3TQOA 3GZNB 2G3VA 2QSHX 4ZDLA 1S05A 2GOXB 2F4MB 3Q0WA 3DI5A 3S2WA 2FA5A 2E19A 1E2XA 3LA7A 3P5JA 4WXCA 1BI0A 5BNGA 4XPWA 2ME0A 3SZRA 1ZELA 2E1NA 2J8WA 1ZGJA 2M34A 1ENHA 3PL8A 3AG4H 3CCRI 2HDCA 2WZLA 3FHNA 1UELB 4JYKA 2AXTC 1V54H 5DCMB 1Q1VA 1NZEA 2J0WA 2Q4FA 3ZPLA 2W9YA 3IEEA 1R1TA 3LNMB 3IKVA 4F91B 2H1LA 4H0EA 1KU9A 2EV6A 1R5GA 3QQAA 1VI0A 4HLXA 4ESJA 1J7KA 1W0TA 2L4MA 2XDVA 2YRFA 3JRBA 4LOCA 1NHAA 3KLOA 1B4AA 3RKQA 1MSFC 2IJLA 2VKEA 2X4HA 3HL2A 1LM3B 2H09A 3FISA 1FAPB 2XGDA 4GYGA 2Y0SN 1MBGA 4JKVA 4IHYA 3PSIA 3PHF2 1YS7A 2WVNA 3CZ6A 1GXQA 3B0PA 2KISA 3BG5A 2HYJA 2GZWA 2WAEA 3OYGA 1K6OA 3CUQA 2MBFA 2ZXHA 3D1NI 4IO9F 4EGZA 3NQOA 1ORYA 3QVZA 2XSEA 4LG0B 4WXHA 1BR1A 4BBRJ 1SC7A 2R9RB 3PMRA 1F9NA 1UHMA 5DS4A 3ZSUA 4EIYA 2K9LA 2WAFA 2KW3C 4UUTA 4UXNA 4QIWN 2DAOA 4HX7A 6PAXA 3ESWB 1E0EA 2JRTA 4MNUA 2Y3HA 3EFOA 4AIDA 4CBEA 1FJLA 1J5YA 2IEKA 4BDYA 4A3LJ 2HKOA 2QVOA 4DOZA 2VODA 2LBFA 4EGYA 1ORSC 3DEWA 3JZ0A 2GDCA 3ZN0A 3WTTC 3I3LA 4JX6A 2E2IJ 2WB7A 3RVZA 4PJLA 2FD5A 3ABMH 1JRAA 2LKPA 3M15A 5EGYA 1JJ6C 2QE9A 1I6XA 3IP4B 2ACJA 2M3AA 3FDQA 1ZLKA 2H7BA 1Y4CA 3LFUA 3B9QA 4F3QA 5L3EA 3K6GA 3U2LA 2Z1DA 3BQZA 2K27A 1Z23A 2BW3B 3ZMTA 3US6A 4HEA2 1CPQA 2LH9A 4U5GA 3ZIBA 3RPUA 4X6AJ 5COGA 4N06A 5L3GA 5J8FA 2JA6J 1ON2A 1APCA 3R4KA 1YA7O 3L0IA 4A0YA 3GLLA 4OU0A 1QA6A 1SZIA 2VCAA 2FRHA 2GM4A 2OUMA 2YL0A 2DN0A 5H20A 3F21A 1FMWA 2Q0OA 1LDJA 2JJ7A 2XPVA 3BR6A 3IC7A 4BH9A 2WAQN 5M5WJ 2IOQA 2EZLA 1G4US 4BBSJ 2XUBA 3GANA 2JT1A 1KQ0A 3HUGA 2EPKX 2KZGA 4JJFA 2MH9A 4BE1A 3MYFA 5L0IA 1ZHXA 4PUSA 3SFZA 4YIRX 4IHWA 1WKMA 1SVLA 1T6IA 1X1CA 2ZXIA 5GAGJ 4UUSB 2IGMA 1BR2A 2HPIA 1QU3A 2AWCA 2V6EA 2DYRH 1MGTA 4I98B 3C2BA 2YR2A 2L9VA 5EF6A 3QODA 1JJ8C 3ZTMA 3IHUA 1AA7A 2A61A 4A3MJ 2XF5A 3C18A 5EEGA 3DBLB 1G3TA 4XOTA 2ECCA 3G50A 4PACA 2D45A 4PGHA 2EPMX 3LA2A 2E34A 3A0BC 1K78B 1I1SA 1T0FA 1FLIA 3L2CA 2AU5A 3U0CA 3ZXSA 1GDTA 3E5XA 2KL4A 3MLGA 1SAUA 3H35A 1MNDA 4S04A 2EFPA 3HNKA 1ZRCA 3MKLA 3KP3A 3OOPA 2KGOA 4CYCA 4EJUA 1V55C 5J4VA 2VCBA 2ZXWC 1XPXA 5FO5A 1TZLA 3HC7A 3ZRGA 1JUMA 2STWA 3HOZJ 3FVYA 4PFPA 4P1WA 4AU7A 1J2XA 3VEPA 3J06A 3D5SC 4IRIA 4D7MA 3DE9A 4DRIB 3IWFA 3QMKA 3S90A 4CCNA 3RYPA 2LKXA 4KNYA 4V19K 1KU2A 3SZTA 1HQCA 4FQGA 4QTRA 3IH3A 3O8HA 3QU6A 4Y7NJ 4BNCA 2OQGA 2WWYA 4PJJA 2DYSH 4OMYA 1WTYA 4MO7A 2KYHA 1P92A 2LK4A 2EK5A 4DGWB 4N4OB 5L3FA 5KNLA 3GTOJ 4H54A 3OMYA 1RPWA 1ZLJA 4O79A 1FY7A 2MYSA 5LGNA 4UNOA 2EIKC 2X1CA 1L7CA 2OCCH 1IC8A 5J1UA 5ED4A 3BG6A 1KA8A 2XGCA 3MCZA 3OEOA 1T9KA 3L7WA 1HXDA 2P81A 1JMWA 3E9VA 1Y8QB 4M3BA 3M07A 3LNQA 1ST6A 1Q0GA 2V79A 4IL6C 3AG2H 3F9KA 1Q0DA 3NMJA 1WWPA 1WATA 1AVOB 5IY5C 3FIWA 2MSYA 3L2RA 1UMQA 1YYVA 4BY1J 1MBKA 3HTSB 1VLTA 3K10A 4NDLA 3ELKA 1YYJA 1R58A 2BBYA 2VE8A 4E6KG 2HOTA 1V5FA 4BS9A 3OYCA 3KEOA 1JI8A 3OIQA 1I4ZA 5JRAA 3P9KA 4ZYAA 3W8IA 1VOMA 2Q2EB 3ZQCA 3FOPA 2FNAA 3CDIA 5K5QA 4YL3A 2Y3GA 3JRMO 3G2BA 1QNTA 3QOPA 4LLLA 5IOZA 2AQFA 2X48A 2E5ZA 3AL0C 4OD5A 4BU2A 4CZZA 2QBYB 3FK6A 3LMMA 4F4BA 2HQAA 4JC7A 3PFIA 4C3HJ 4AK9A 1DOVA 1KYWA 3TJ6A 1D0ZA 3BWGA 3DM5A 3NMIA 2R7FA 2XLVA 2Y69H 3HGGA 5HDNA 2YUSA 2Y2ZA 1TWGJ 3VYSB 1QZZA 1ZKGA 2ZSHB 3VYRB 3ABKC 3Q6MA 1TWAJ 1C0WA 2DJIA 1FMVA 1ZU4A 3LSGA 3K4KA 2YPRA 1VTMP 5EG0A 2LF8A 1K40A 3W8HA 5JS5A 2HNHA 1XX5A 4JCZA 1IRZA 4XQ1A 1Z6RA 2COMA 3O10A 2A1DD 3LFKA 4ZTFA 1VQ4I 1U89A 4A6EA 3CTAA 5DUIA 4A3DJ 4NNJA 3LLKA 4G6TB 3RZDJ 1Y1WJ 1BIAA 2V1DA 5BS6A 2B7EA 4U5BE 2FNPA 4ZYHA 3I4PA 1RNLA 2E71A 2F5VA 1LE2A 2VPRA 1P4XA 2VC1A 3WG9A 1S8NA 1YI2I 2VJIA 3RIPA 1TWAA 3HM5A 1YA9A 3GUDA 4E70A 3MZYA 3HOYJ 2X6OA 4L0ZB 3T6BA 3F0CA 1JT0A 3H5AA 3OYEA 3LEOA 3QOEA 1T0FC 1FIAA 1HKSA 2OU2A 2XM4A 1N75A 1REPC 3CQZA 2DMUA 2VBYA 2MC3A 4QI2A 3GWZA 1V54C 3L2UA 2Y3DA 4YJWA 1G6NA 3REOA 3V7RA 1H89C 1RR7A 1W36D 1C17M 3BR5A 3ASOC 4BQNA 3MFKA 3BY6A 3KP6A 3U3BA 3HXLA 3GWLA 3EDPA 3NARA 1F36A 4XBFA 1S7ZA 5JUAA 4KITB 5EGOB 1HA8A 3SZGA 2A6EF 1LFBA 4I7HA 4DW6A 2R93J 4AD9A 2KMUA 1O57A 1C03A 2OQRA 3DFGA 4RB2C 1RKEB 2I8BA 4I3MA 2F5FA 1YO5C 2YLDA 3I59B 1HDDC 3RFYA 3PIOF 1X4PA 3UMIA 4JVSA 1X1DA 2ZSIB 3ZR8X 3B29A 1RKWA 3TBIA 1IN7A 3T0YA 2HEOA 1KQ9A 2JMWA 5KYYA 1FYLA 4MTDA 1MDMA 3LAYA 3ZG1A 3HKZN 2XRNA 2GXAA 1V3FA 2AP3A 2EJRA 1XGNA 2RREA 4JURI 2W45A 1XSXA 4WX9A 3LQRA 1N77A 1R6RA 2C04A 5B1BC 4A3BJ 3E7LA 1S9HA 2HZTA 4DZPA 1MKMA 1FT9A 1A0BA 2HMZA 2UXNA 4XLNF 5KYWA 3JRTA 2YHSA 1I1GA 1WRJA 1QVXA 1ZHZA 4LLEA 4D4NA 4DJAA 3S2DJ 1PUFA 3DKXA 4BEMJ 2VQLA 3HIFA 3K1NA 4YRVA 1YITI 4LK1F 1AOYA 4RGSA 4A69C 5LD2C 1K79A 1YW9A 1ERDA 1HDPA 2XF6A 3F6OA 5H6QA 2XAHA 4HQEA 4IRUA 1U2WA 1YW8A 2VN2A 1TLHB 1X2MA 3EUHC 2I8DA 5KK1A 4AL0A 1LIHA 3E6CC 4K0DA 2IGNA 3M7GA 4KJZA 4FHTA 3UKGA 2BHZA 2JUGA 5FRNA 4GQHA 4QI0A 2NUTB 4GYTA 1BI1A 2EFNA 3GM1A 3GM2A 2O61A 4V2GA 4U88A 2XVCA 3MMYB 1OW6A 3G71I 2CUJA 3ULQB 5B5EC 1XGOA 1GGQA 1IW7F 4RGRA 1QGPA 4CS7A 4HEAJ 1YRNA 1DQUA 4M72A 2AVKA 1VQLI 1X2NA 3B73A 5M3FJ 5E3CA 5JLIA 2IYLD 4C7OB 4RB1A 3WHCA 4DJ9A 2KC3A 1SANA 5D5UB 2E7XA 5M5YJ 2L9JA 4LFUA 2RNGA 5F1JA 1A04A 4YIFA 4M9SA 2O5RA 2A3SA 2MG4A 2XXAB 1KYZA 5DS9A 3S3OA 3TKYA 2G62A 3IQTA 5L0JA 1CGOA 2KPMA 3HDDA 4A93J 1O3SA 2K3PA 5EK0A 5E18F 3DV8A 2BEOA 2X1EA 2MFZA 4H4KC 2EFOA 4I0AA 3ZN1A 1R5HA 2IA2A 2LREA 3RDIA 4F93B 1U3EM 4A3GJ 4CS9A 4MVOA 2OQMA 1O3TA 1XB4A 3V42A 2PBEA 3A11A 3I55I 2E1OA 2LLKA 2D1VA 4UV8A 1YAUO 4R32A 3RKOF 2DMQA 1OW7A 1XZQA 1BN5A 2DXIA 4O5VA 3W6VA 2ID3A 4PK4A 5FFXA 5AGFA 3MD2A 1ZK8A 3OS2A 1KGSA 3V7CA 1V4AA 4U7BA 1YJNI 4M3FA 1TWGA 5KAFC 4B43A 5CVVA 2X6YA 5IT3A 5C44J 5COMA 2JN6A 3HNJA 3JAMK 3UNGC 2IBFA 2I5UA 3GO5A 3AKZA 4LLCA 3BG7A 1X3WB 3G1MA 3A03A 1BBYA 4HX8A 2PMHA 4LK0F 4XICA 3OYAA 1D5VA 2WL8A 2K7LA 4ENNA 5A2QK 2K4JA 1PP8F 3BEHA 2IA0A 1VMAA 2DGJA 3HOSA 3M79A 4YL0A 3IAM2 1SVMA 3U2RA 4Z9JA 3S16J 2I15A 4ETSA 2HR3A 1LE8B 4RDUA 4BJ5A 4L9VA 2UZKA 2V26A 4XRMA 1E3OC 1ONVA 1N1CA 1XTAA 2K02A 3GZ6A 1U0BB 5D92A 2MH2A 1MBEA 1IDYA 3W3CA 3POVA 3EGDB 2QKLB 3EZIA 3ZQFA 2MA3A 3DBRB 3D0SA 4KIFA 4FX4A 4N6CA 2K9MA 3U2MA 1OISA 2YL7A 2YQYA 1W5CC 1P7IA 2ZB9A 5HOOA 3AJMA 2STTA 3DTKA 1U8BA 1EI7A 3EQLF 5EZHA 4CDYA 4FAPB 3S3MA 1OCCH 1OCOC 3EYIA 4M73A 3QVYA 3MEXA 5H2FC 3W2VA 2DDBA 1XGSA 3AG1H 5L3QA 3HHGA 2DOAA 5DTDA 1YARO 3HNLA 5L3DA 4J00A 4KMFA 2LCHA 4UHTA 1W2WA 2ISYA 1LVKA 2ZXWH 4AIHA 4D1QA 2IS4A 1B59A 4CSWA 4KN7X 1GV2A 2OEVA 3B71A 3BR3A 2R7UA 1BC7C 2XLWA 5AIPA 3DLAA 3IWZA 1JT6A 1TQMA 2M30A 3OYHA 3SJMA 1NG7A 4MFDA 3ABLC 3I4UA 1YLMA 4DVZA 1VQNI 4OMZA 1HLVA 2RSEB 4MLOA 1FOYA 5DQZA 2XAQA 4NQWB 5EDNA 3C8GD 1W4MA 1MMGA 3GEHA 5CLSA 3BROA 4MS2A 2R5YB 3H65A 3O55A 3O3KA 2OJQA 1FOKA 3DMDA 4OAZA 4U0VA 4HRIA 1FEXA 4HF0A 4HOBA 3WTWC 4IZZA 4EBJA 2XPWA 5KYUA 3ASNC 5A6BD 5A6BA 2NS8A 3JTHA 2Y69C 4UB8C 2ECBA 3HPGA 1BR4A 3V5YA 3RW0A 3I53A 3A01B 2K3FA 4M3DA 1HOMA 2NSFA 3T4RA 1OKRA 1OKKD 1Z3YA 2D2WA 2VQHA 1L3PA 1OMIA 2XRLA 3HSRA 1FOXA 3BTLA 2NSGA 4BQQA 3KE2A 1IXSB 1NK3P 1U6HA 2UUHA 1H6GA 2VXDA 2YWAA 3L2VA 2NUPA 3AG3C 3FM3A 1WJDA 2WB1A 5M5XJ 4U0WA 3Q0UA 2R7ZJ 1OFCX 2JTVA 4XOPA 4L0YB 1XSDA 5IY5H 3AL0B 2ZMEC 1U5TB 2VQGA 3E0JB 5F0HA 4KNVA 4JZAA 1T95A 1ZR2A 2KK1A 3EYYA 3CCYA 1J59A 3DD7A 1QHGA 3F8MA 3WHBA 4B47A 4YT4A 2DU9A 3G3ZA 3JYYA 2JSCA 2DA4A 3I5PA 5KYXA 2UXXA 3KFWX 3U8PA 1ODDA 2W57A 4EHPA 1J75A 4IOAF 3F46A 3KPHA 3LL7A 2CRGA 2HYFA 1V5GA 2P0WA 2EPFA 1X1PA 2H8WA 3BPXA 3ZQLA 1SFOJ 4EUKB 2CV0A 2HOAA 5K5RA 4G8XA 1Z5ZA 3TD7A 1TQPA 2F4OB 3H9JA 3EH1A 1QKRA 1B9NA 3BR2A 2OU6A 3TOAA 2XXAA 3JCUC 4FX5A 4G7OF 1GVJA 2AHQA 3GMEA 3OYDA 3KYCB 5L3VA 1P7JA 4XRSG 4I1MA 4K2EA 3TGNA 2K85A 2KJCA 4RGXA 2D4UA 2FUG2 3L09A 1HW1A 1H7IA 2EH3A 4J32B 2WC2A 2CQQA 2OEXA 4O7GA 2RKHA 1V74B 1XZPA 3AG4C 3DEUA 4JX4A 2VONA 2R7XA 2P7VA 1RJ9B 1IRFA 3VM6A 2W82A 3F47A 4G0HA 4HG2A 2GIVA 3TOBA 5DS5A 3BJ6A 4OD4A 1IO2A 5FLXZ 2VB6A 1KU7A 3LSTA 3V4GA 2PQ8A 4YT2A 5TISC 1WJBA 1PYVA 4BEHB 1WJFA 3SHFA 2DDAA 2QKMB 4IF4A 2HVSA 2IXSA 4O3MA 1YG2A 2NVTJ 1DOWA 2DB4A 3SXMA 1JUSA 4EJOA 3T6JA 3S1QJ 1F1ZA 2PX0A 2ZNZA 3QW1A 1Y6DA 5GP9A 5EEHA 3CCMI 1FSEA 1YHQI 1MBFA 2PMUA 4E7KA 3EETA 3U1KA 5HLTA 2B9SA 2XHKA 4EQQA 5FGMA 4CCLA 3JSZA 2NG1A 3L00A 1I3QJ 2TRTA 5L0FA 3GF2A 3S32A 2XL8A 2HMQA 4BXFA 4WF2A 1A31A 4IQJA 5DVWA 4KI2A 3ZMUA 3KYLA 1UHWA 1D0YA 2XPUA 4W1UA 1LDKB 2BE5F 3QYEA 5C3EJ 3IPMO 5DS6A 2VJJA 5TGTA 5GTHC 1ZU5A 3K4JA 4IVNA 3TOMA 3ECHA 1JKRC 2E5NA 3K4CA 4CCMA 4MHGA 5COFA 5E3LA 1YFHA 3GXOA 1ZHFA 3BTJA 1KNYA 1GHCA 5HSWA 2WB1N 2GAQA 2E87A 5IPAA 3VODA 3BC8A 2EINC 1D3YA 1G5ZA 4HDUA 3DU6A 3QWLA 2IXPA 1OR7C 5CKTA 2EA2A 1OJLA 3VOEA 1DPRA 5LRRA 4E0IA 4HZFA 4AUXA 3JRIA 3ECSA 1EF4A 4BG0A 4EVIA 4M63A 2HVRA 2FFHA 2P5KA 5HS7A 1IXCA 4O6YA 2FEZA 1Z7UA 1WSUA 4LD5A 5FROA 3CF2A 1IN8A 1I50J 3T8TA 5E17F 2YX4A 1D0XA 2HJMA 2EIKH 1I6HJ 4BPMA 4MTEA 1K7AA 3BZKA 4RAZA 2L7KA 3WTUC 4ABZA 2L6FA 3H2VA 2IS1A 2M9HA 1IRXA 4J30B 2XKOA 1ZGWA 1S7AA 4IHSA 3K66A 5JLWA 2XLOA 4LITA 3M1CB 4HE8D 4JJGA 4CUGA 4YFNF 2MGQA 1M2VB 5E2QA 2P7VB 5D8KB 3VSLA 4MVSA 3ZMZA 5AONA 2L81A 3KZZA 2QSFX 3EGDA 4Q4ZF 5D6FA 1D1BA 3KP2A 1M6TA 1VQOI 1G59A 2L6HA 2M4EA 3RCOA 3O39A 3LLIA 4RBNA 1RZ4A 2QTVA 4A2NB 2ETSA 3GODA 5IT9K 1QHHD 1VNDA 4A3JJ 1AUEA 1EH7A 2YEVA 3WGGA 3JRGA 3FXUA 4WCGA 1PJRA 2VKDA 4G12A 3HOXJ 1LB2A 1ETYA 2O9LA 1JXSA 2V4JC 1VLSA 4LERA 5D5WB 4RS8A 2MWQA 3BCBA 4YIIA 2EILH 2H7OA 4XPYA 1FNTc 2M4KA 2CQNA 2DA5A 2L54A 3BTCA 1E85A 4WABA 2X1DA 3DLLF 2L01A 5KYXB 1RETA 1HF0A 3ZMVA 5E3MA 2CGPA 2MLKA 1RR8C 1MBJA 4NTAA 1EQ1A 5IYDJ 4Y4RA 1SFKA 4W8KA 2G9WA 1GXPA 3DAFA 4ZJZA 1WZ2A 2BZTA 1BW5A 3O6XA 1PD1A 5D8LB 3CEXA 1T56A 4ZDOA 4ULVA 2MD5A 3SEZA 1KU3A 2M4GA 1QBJA 5A6KA 2NUPB 1TP4A 4IAQA 5LEJA 3W4YA 1CPRA 1Z9CA 2DYSC 2W4MA 3EH2A 5K7HA 2R0QC 1ORJA 2QQ9A 4BHCA 2J9VA 2FQ4A 4C3IJ 2K40A 4DXWA 2A68F 4GXOA 4V2FA 2DA1A 2XL6A 1OCCC 3G1LA 2IS6A 1STZA 1RI7A 4XK4A 3D5RC 2UWMA 3KYIA 3JYHA 1LPEA 1D8JA 1QZYA 1Z0XA 4BUPA 1XS9A 1B72A 1IDZA 4I2OA 1YW7A 2IXOA 2IGKA 3LJBA 1ETWA 1OPCA 3I56I 1QVTA 4C2MJ 1WASA 3S17J 2R03A 1OYIA 1JR8A 2FXAA 1IUFA 1HE1A 3S84A 4IPAA 2J9UA 4OIPF 2DQRA 2HFIA 3Q9SA 1ZYRF 2M7AA 5JR3A 3ABLH 1M2VA 3HKZA 1O4XA 4OINF 5E79C 2YKZA 1U5TC 3PCVA 2VOPA 4HNTA 1LDDA 3OYLA 3X2QC 3RPQA 1GVDA 4MEYF 1IJWC 3NYLA 2ETHA 1OLTA 3J7AY 3A9CA 4DRJB 4G7ZF 3M8EA 1X1BA 3RKYA 3OSGA 4YFKF 2QEXI 3CC2I 1Z1DA 2ADUA 3B6CA 1VQKI 1BL0A 1D5YA 2FMLA 2LY1A 4FT8A 3BR1A 3C7JA 1T38A 1T6SA 4AE4A 4KICA 1IF1A 3PSFA 2K9QA 1TW3A 4BE0A 1LFUP 1QQIA 4EBBA 5FKOA 3I0TA 1K4TA 1B6AA 4CDAA 2FAPB 1NU7D 3KKBA 2L5QA 1TKNA 3GTJJ 5LHIA 1ZHTA 2JX0A 2EZHA 4CS9C 3S1NJ 5DLJA 2GQQA 4AIKA 1T39A 4L9TA 4A2UA 4M71A 2V9VA 5L0HA 5GAHJ 3PIPF 2J0XA 4BQOA 2XF7A 1NK2P 1A7VA 1Z77A 5HDKA 2E1MB 3K7DA 4L6RA 2MC4A 4IOCF 2PBIA 4MQVA 3LSIA 4HPQA 3FAPB 2CW7A 2FBKA 2ZD9A 3FWEA 4LMYA 1N78A 3K7AJ 3ZCOA 3ZGKA 3Q7LA 3FHZA 1JTYA 2HKVA 4DIQA 2TCTA 2LQGA 4Y13A 3ZMDA 1ZG1A 3HRSA 3GTPJ 1CQTA 3FAJA 3OYBA 1ZRFA 3R61A 1M57C 3TO9A 3OS0A 2DMNA 3IH2A 3CP2A 1AKHB 3VSKA 1Y56A 5AC4A 2P1AA 2GIZA 4MGRA 2B63J 2H8AA 3RF3A 1XGMA 3DE8A 5KAIC 3J7AO 3MYIA 1L0OC 2W25A 3GVAA 3E1SA 2J7PA 1HSTA 4G6DA 1Z67A 3U8VA 4GRIA 3CO6C 3PQKA 2GBYA 1FBQA 3DU5A 4RA2A 3PDMP 3KCCA 2XLMA 1S72I 3NKDA 1G8XA 1LE4A 4C2TA 5CVIA 4L18B 3ZQGA 2Z15A 2HU9A 5F64A 5J1RA 2W85A 1PUEE 1X19A 2Y3BA 5BQIA 2F4IA 3CMEI 3VF0A 5K7ZA 4XKCA 1G2HA 2HZDA 3K0LA 2KZVA 5F27A 3KIOA 5HLHA 3L8IA 3C8GA 3HOUJ 2DK5A 2ZFWA 2XM0A 1Z05A 4MFEA 4XLHA 3FXLA 1FYKA 1ZHWA 1PD0A 1XSVA 2LFFA 3T5XA 2DA2A 2HI3A 3MZ8A 4P96A 2KT0A 2IGOA 2HOEA 1FTSA 4KT6A 2NOGA 1DGRM 3JTLO 3V5XA 5E20A 3GEIA 2XAUA 2QSGX 4PJNA 2F5CA 3CJNA 4IJJA 3UMKA 4GDFA 2A0UA 3S9OA 4MIMA 3HOWJ 5EG0B 2V1NA 2WZGA 3NMKA 4P9TA 3FMQA 3SEQA 5FJ8J 4NTFA 1FOWA 3Q5FA 4U0YA 3Q9VA 1SYQA 4AYBN 4ZZDA 2V9PA 2XAGA 3CMMA 2XS8A 3K9TA 1SD6A 2PX9A 1PCXA 4X0RA 4IHVA 3ISPA 3I4NJ 1FIPA 1BIBA 2R7DA 3BOQA 5ICEA 3G6EI 1P4AA 1ACIA 2A0BA 3S29A 4CS8A 3I4MJ 1U5TA 2BVMA 4UUVA 5CIVA 3SNHA 3E6DA 3C62A 3F3XA 3JAMZ 3OV8A 1QZXA 4JTAB 5F5HA 5KYWB 2EWNA 1PDNC 2Q00A 4JEAA 4NY3A 4AL1A 3RQ4A 2ZXRA 5JP7A 3DAGA 1USSA 2ICWG 4WWCA 3PFYA 4KNWA 3JRFA 2JVGA 4ENMA 4PDKA 1ITYA 3H9GA 5DQTA 2G0EA 2DYRC 1T08B 3RQEA 2M0MA 4RAFA 1EV7A 1GT0C 4EM2A 1WWXA 1VK5A 2XASA 4ZTJA 256BA 1UG2A 4EV0A 1MZBA 4B48A 4C3DA 2X0CA 1SD4A 2QM3A 2CS3A 1ZARA 2YX7A 1MDMB 2ID6A 1P4WA 3OA1A 2EBIA 5DD8A 1U9OA 3LA3A 5DCMA 3SDGA 2DFEA 1R49A 3DTEA 4S05A 2NRAC 1PV3A 2FMYA 2GA1A 3HOVJ 5LEKA 5JSLA 1F4KA 3IUOA 1MQVA 4PSXA 4CDVA 2PG4A 3R6SA 2FQ3A 3DEEA 5B3SH 5HNHA 3PM1A 3K4LA 4U5CE 2VIXA 3U1DA 2CUFA 3K33A 3U5SA 3V5ZA 1UJ8A 2LF7A 3ERED 5BQHA 1S7EA 5EGOA 2CUEA 1V4RA 1ZH5A 5E33A 2VLAA 5E3OA 4WGZA 5FLVA 1OXKA 3OYMA 9ANTA 2LVSA 2Y9YA 4EM0B 4BJ6C 3LSPA 2HOSA 2QUPA 4E7JA 3N0TA 4IX7A 1TFOB 1FNNA 2EZIA 3O6BB 4XN0A 2CQ7A 3BJAA 4IEJA 1S7OA 1TW2A 2Y0SA 4N4NB 1LUJB 1HE9A 5CQGA 1Z21A 3R0JA 5IT9Z 2F2EA 3I58A 2EIMC 2BGCA 2L9NA 2EILC 2F22A 3DP7A 1SR2A 2R7RA 1W0UA 4OWRB 4B4CA 2FF4A 4JX5A 4EKWA 3BDDA 4OIRF 4XKVA 2X6WA 3WGIA 1RXQA 1Q1HA 3RTRA 1R7JA 1Z6TA 3GM3A 2EPLX 2YS9A 2BY0A 1EH6A 1FBUA 4XNFA 4E7LA 3J80Z 3RZOJ 1HY5A 2QF7A 3IQ6A 2OF7A 5CI8A 2MLGA 4BQAA 4KISA 4YN0B 4HSRA 1TT5B 4M3EA 2IA1A 4UDVA 2HV7A 3ITFA 3TP0A 4I0BA 1TWHA 3RQIA 3DWWA 4DVYP 1OCZH 2DFFA 4DBRA 3HHHA 3NRVA 3OYKA 1ETQA 2RQPA 4JBAA 1H9GA 5JFRA 1OR3A 2YLGA 2DI3A 5KCMA 3K4BA 1Y6IA 5HLIA 3QP5A 1XMXA 4D7NA 3CCJI 4YELA 3S28A 1I27A 1LEBA 1KQ8A 1RKCA 1ZAOA 1QLEC 4XR6A 1MMNA 1QVUA 3LSJA 5ICGA 5GPAA 3J81K 1O7LA 4U7DA 2N8GA 1J8MF 1ZHYA 4BYYA 4BE2A 5IYCJ 1WN0A 2RNJA 2HXOA 3VAYA 4FWVA 2B0HA 3A4CA 3AFHA 2YZSA 4NUBA 1VYIA 4F7ZA 4O6NA 3DM9B 2TMVP 1GS9A 5BUOA 2CWEA 1G3WA 4G94A 2LP4A 4F52A 2HJ3A 4Q5SF 5JT4A 2DK8A 2JPUA 2VXZA 2E1MC 2HQ5A 4A12A 1HKTA 3GEEA 4RM3A 2VC9A 3V8LA 2KIFA 4B3AA 2WTEA 3IKTA 3PJRA 2QQBA 3WGHA 1UFMA 2FU4A 4LJZF 3V8KA 3MKWB 1GQAA 4YK5A 1C02A 1R22A 4RLFA 2E2HJ 1FFHA 3R60A 2KJGA 2DTRA 2OG2A 1JKQC 2KRFA 5JHFA 2RDPA 5F0FA 4ITVA 2DPUA 2BL2A 5EEAA 1RESA 1F5TA 3G1OA 3SXYA 3CCUI 4MTOA 1BOBA 1YRNB 3KLNA 3K6BA 3S14J 2P6SA 3FKIJ 5L3CA 2KIQA 2OA4A 1D1CA 1JAFA 4BJ5C 1RRJA 5EYRA 4JOMA 4JE9A 3DKAA 4HF1A 3BQYA 5JI6A 4E7HA 1OCRC 3HJCA 4B1RA 2VI6A 2GA2A 3AGTA 3OY9A 3NWTA 2RV8A 4L5EA 2Q9AA 1QPMA 2B0LA 3DJNB 2R25A 2XL4A 4O6MA 5EJCA 2XAJA 3OWTA 4LIUA 2DQLA 1JGGA 3X1OA 4LG0A 3N24A 2F48A 1OQCA 2VCCA 1K4SA 1U9NA 1O7FA 1JHHA 4DQ2A 1E17A 2LDUA 3CUQB 4OIOF 1HC8A 1YJWI 4E7ZA 3BG3A 4J01A 2Q7RA 2OTLI 4XORA 4AE4B 4WK8F 3W2WA 2BOLA 3O2PE 1UB9A 3X2QH 1FTZA 1X3UA 3U9JA 2VJ5A 2LYCA 3ATPA 1N25A 3NRHA 1AEPA 2Y30A 3BCAA 2H8RA 1T6UA 2L7MP 5DEQA 3RYRA 2R7TA 4XLAA 3LAJA 4O6JA 2RC4A 3NDBB 1ZTRA 3FXMA 4LGWA 5CVUA 2DLLA 2W7NA 3CCSI 3FBNB 5DDGA 5GTIC 3LQQA 1EKEA
chains in the Genus database with same CATH topology
2XF5A 3KYLA 4EWCA 1D0YA 3GBGA 2PMZA 4XOTA 5DS6A 1LDKB 2BE5F 3QYEA 4YT5A 4C7OA 1WFXA 2VJJA 5TGTA 5HNFA 3SYTA 1ZU5A 3K4JA 2A6TA 3EJNA 3LEVA 2A5WA 3ZXSA 3HLZA 4MQ9F 2R7OA 2E5NA 2KL4A 3K4CA 4CCMA 3MLGA 1SAUA 5CI9A 3H35A 2IS2A 1MNDA 4Y3OA 3NG1A 1MMAA 2L9SA 1SMYF 5HSWA 4XL9A 2KGOA 2E87A 3BC8A 2EINC 3I5QA 4PSWA 3DU6A 2RQQA 1V55C 2IXPA 2ZXWC 4CSAA 1OR7C 5CKTA 4ZC3A 1TZLA 4II3A 3HC7A 4QPOA 3ZRGA 2V3CC 3DKYA 3FVYA 4PFPA 4P1WA 2L2OA 4AU7A 3SEOA 3SP1A 4HSTA 2LY2A 4PJMA 4HFFB 3D5SC 3ECSA 4BG0A 2WVQA 1J09A 3MX3A 5KHDA 3QMKA 2AQEA 4CCNA 3AG1C 4JW1A 4M63A 4II2A 2HVRA 5KYYA 3DWLE 1KU2A 2FFHA 3EGXA 4GEHA 2WA0A 4O6YA 3QYBA 4CCJA 1V5EA 4P5OA 4C30A 4P6IC 3V7OA 5FROA 3CF2A 2LSEA 1MW7A 3DPUA 4PJJA 2GFHA 1D0XA 3B0VC 2CFOA 4DGWB 3U21A 4RD9A 2L7KA 4N4OB 5KNLA 3BLYA 3OMYA 2IS1A 2PFDA 4O79A 1IRXA 4J30B 3K66A 2MYSA 4HE8D 4LITA 2X1CA 2BW3A 3M1CB 4CUGA 4JJGA 3EHNA 4U5DE 5T1DB 1M2VB 5E2QA 3HTKC 3BG6A 3C2HA 3VSLA 2L81A 3EHMA 3OEOA 3EGDA 2VKHA 4Q4ZF 1WJCA 1D1BA 2J9WA 5D91A 1LS1A 2W4SA 1G59A 3E9VA 2M4EA 3RCOA 1ST6A 2KRHA 3O39A 3F9KA 3LLIA 2PF4E 4CZCA 2QTVA 4RBNA 4A2NB 3GODA 5F5FA 1QHHD 5IY5C 4I44A 2YEVA 1LKXA 3L2RA 5FRMA 3AQCA 1PJRA 2VKDA 2KRCA 4XLFA 4CA0A 1IZMA 4LERA 2V4JC 4E7IA 1VYKA 1VZ0A 3EFOB 3K10A 4BDZA 2G3KA 4OIQF 2UV1A 2WY8Q 1JPJA 3HG9A 3LNRA 3EG9A 2MWQA 3BCBA 4E6KG 2H7OA 1V5FA 4BS9A 2M4KA 3OYCA 3KX2A 4QDLA 1JI8A 3OIQA 2X1DA 4ZYAA 3W8IA 1VOMA 3DZAA 2Q2EB 2DT7B 5KYXB 2PX3A 2XSJC 2Y3GA 3G2BA 4JQFA 2AQFA 2E5ZA 4Y4RA 1SFKA 3AL0C 4W8KA 4OD5A 4BU2A 3NYJA 2A69F 4ZJZA 3LMMA 3DAFA 4F4BA 2HQAA 3O6XA 1PD1A 4AK9A 4ZDOA 1D0ZA 3SEZA 3DM5A 2HDWA 4ULWA 2M4GA 2NUPB 3VYSB 2ZSHB 3VYRB 3VYTB 2IXMA 3ABKC 3Q6MA 3LESA 4YT8A 1YE9A 2DYSC 2W4MA 2DJIA 3EH2A 1FMVA 1LFPA 4XKBA 4R79A 1ZU4A 3KL4A 2J9VA 3LSGA 2PJRB 2X6XA 3K4KA 1M56C 4C9YA 4RLQA 2A68F 3W8HA 1OCCC 2IS6A 3EG9B 2VL8A 2UWMA 3D5RC 2HNHA 2VASA 2J7PD 3JYHA 2DCEA 3N2ZB 3S27A 4BUPA 2D5RB 4ANJA 2KQRA 4Y33A 2IXOA 2A1DD 2J45A 2IGKA 4CH7A 4ZTFA 3ABMC 3LJBA 3DJUB 3LLKA 3Q7GA 4NNJA 3FDYA 4G6TB 2JA2A 1Z3IX 4U5BE 1O5HA 2J9UA 4OIPF 3WODF 1ZYRF 2F5VA 2M7AA 4ZLDA 1M2VA 3HKZA 3OS1A 3FHDA 4OINF 3RIPA 2VJIA 2IXNA 1TWAA 4WJ0A 2O9XA 4HNTA 4Q7CA 3OYLA 3MKZA 2A6HF 5E3AA 1X4OA 3X2QC 3VYUB 3J7AY 1OLTA 3NYLA 3T6BA 5B3SC 1TR2A 3H5AA 4G7ZF 1X1BA 4KC9A 3OYEA 3PUBA 3QOEA 4KBLA 4IQ4A 1T0FC 3DPLC 2CV2A 4XMYA 3JCUQ 2MD0A 1N75A 3CQZA 4QI2A 3IAS2 3OL4A 4CCOA 1V54C 3L2UA 4FASD 2Y3DA 4BEJA 4XWJA 2LY1A 3HOTA 2EIJC 1Z3XA 4YJWA 4AE4A 1W36D 3ASOC 3PSFA 5LFAA 4BQNA 3A2KA 2C03A 2ZPAA 5KYYB 4CS8C 3HXLA 3FKJA 4BE0A 2CNWA 4B44A 3EGXB 2OC6A 4AYBA 3ZVRA 4E7SA 4EBBA 1S7ZA 1TT0A 3EUAA 4KITB 1HA8A 1WJ5A 3SZGA 1NU7D 2L5QA 1TKNA 1ZHTA 2A6EF 2KMUA 2OV7A 4CCKA 2W1OA 1DP3A 2LG4A 4BEHA 3RSNA 2ELJA 3VWBA 2I8BA 4I3MA 5DLJA 4CS9C 2R7QA 3Q6NA 3TMOA 2WAQA 3NWSA 2J0XA 4E4HA 4BQOA 2XF7A 3RFYA 1X4PA 2E1MB 2V7FA 3K7DA 2KDOA 3UMIA 4JVSA 1X1DA 2JVHA 2MC4A 2ZSIB 3ZR8X 1OKKA 3LSIA 4HPQA 3TBIA 2PP4A 2CW7A 2VQCA 5T3TA 2X85A 2UUZA 4LIVA 1N78A 4FESA 1UG0A 3ZCOA 3ZGKA 2WBMA 3LAYA 3Q7LA 3ZG1A 4FETA 2KNHA 1D1AA 4DIQA 1M2OA 4JURI 2RREA 1JPNA 4C3EA 2W45A 3CJQB 1N77A 1R6RA 2Z2SB 4HNUA 3KEYA 2C04A 1J8YF 5B1BC 4XKWA 3I9V2 3FAJA 3OYBA 3M1CA 1M57C 1S9HA 3OYNA 3OS0A 3OR2C 3EPZA 3CP2A 2W4BA 3DQVC 3VSKA 1Y56A 2XC7A 3KMIA 2NUTA 4XLNF 4XONA 4MNDA 2VJ4A 5B1AC 2V9KA 2CNWD 5KYWA 3H5RA 3JRTA 3RH3A 2CMPA 2QY9A 4B3XA 3OYIA 2YHSA 3E1SA 1O87A 3HUGB 1ZHZA 2J7PA 4LLEA 2J46A 2VH3A 4GRIA 4DJAA 1SF8A 5DVWA 3DU5A 3DKXA 2CV1A 3NKDA 1G8XA 2VQLA 3QYFA 4YRVA 4BJ6A 4C2TA 4HFKB 2KP6A 5LD2C 5CI8A 3KH2A 3K1HA 2Z15A 2CH0A 2GOMA 2HU9A 3ONQA 1ERDA 2XF6A 4IRUA 4AX2A 2Q1ZB 3EUHC 1X19A 2I8DA 2Y3BA 2CW8A 1U0JA 2F4IA 2OCCC 1MMDA 3QZCA 4K0DA 2IGNA 4KJZA 3EZHA 4XKCA 5FRNA 2HZDA 2JUGA 4U87A 2KZVA 3MKYB 4NC8A 4PFOA 2NUTB 4GYTA 4JCHA 2KLOA 3OL3A 4U5EE 3MMYB 5CPRB 3FBIB 2P6VA 4XLHA 1ZHWA 2CUJA 2B0JA 3AG2C 3DXJF 3DTIA 2X51A 1PD0A 3HPHA 2M7BA 1IW7F 3CSKA 4CS7A 4HEAJ 1DQUA 4XLCA 2H7VC 4RMNA 5E3CA 3S3NA 5KYUB 4C7OB 2IGOA 2IYLD 1FTSA 1WGWA 4KT6A 1DGRM 1P9QC 2L9JA 2RNGA 5FCLA 2O5RA 2XAUA 4LG3A 3AQBA 2XXAB 4PJNA 3UMKA 4XLEA 4IJJA 4U5HA 3S3OA 3UR3C 3S93A 2HPMA 2V1NA 2G62A 4RM2A 2Q3TA 2WZGA 2CDQA 3SEQA 1Z7LA 4QPQA 3L34A 2KPMA 1Z6AA 2K3PA 3CMMA 2X1EA 2MFZA 4H4KC 2WVOA 4K7BA 2CW0F 1PCXA 4X0RA 2LREA 4F93B 3W2AA 3N05A 3UGOA 2MABA 3K70D 4CS8A 4CS9A 3S29A 3A1YA 2BVMA 4OAYA 4ZLCA 3V42A 3SNHA 3VYWA 3JT1A 1MNEA 3RKOF 1QZXA 4BJTA 5F5HA 5KYWB 2DXIA 3OYFA 4PK4A 1X1AA 4YEJA 4NY3A 2K5CA 3MD2A 3RQ4A 1WJEA 2ZXRA 3OS2A 3DAGA 5HVQC 5EHHA 3NYMA 3PFYA 3PNYA 4U7BA 1TWGA 4KNWA 2JVGA 4B43A 4C3BA 2X6YA 4X0GA 2R7WA 3H9GA 3UNGC 5DQTA 2DYRC 4EATA 3AKZA 3BG7A 1RJ9A 2M0MA 3OR1C 4NC7A 4D9JA 2VPLA 4LLCA 1FFTC 3OYAA 1TWCA 1VK5A 4ZTJA 2WL8A 3KKBA 3CP8A 4B48A 4B6IA 4C3DA 1VMAA 3S0XA 2CS3A 3S8PA 3EUKL 2BVLA 3HOSA 2DGJA 3OA1A 3IAM2 2WY7Q 3LSHA 2EIKC 3L2WA 4RDAA 2LBFB 3DTEA 2XRHA 4BJ5A 2DT6A 4QI0A 2V26A 3L2QA 2W00A 1N1CA 2Z16A 3IUOA 2E60A 5D92A 3B0UX 3W3CA 4PSXA 3POVA 3EGDB 2QKLB 3H5NA 5HNHA 3DEEA 2KQ9A 2WZFA 3EZIA 3K4LA 3LS1A 2VIXA 3K33A 4IAOA 2K9MA 3WG7C 4I1OB 2KHMA 2CGEA 5E33A 1DGWY 2PJRA 2ZXOA 5HOOA 2VLAA 2NOJB 2F6CA 4U5FE 3DTKA 3OYMA 3H0DA 1NU9C 3EQLF 3SYNA 4F92B 3OYJA 3S3MA 4BJ6C 1OCOC 3M8JA 3UGPA 2JSPA 1NG1A 3W2VA 3N0TA 4E7JA 4IX7A 5L3QA 2R7SA 2DOAA 4XN0A 2HV6A 4F55A 4J00A 1KONA 2Y0SA 4N4NB 4U5CE 5CQGA 1W2WA 1LVKA 1Z21A 3LSMA 4D1QA 2IS4A 4XLPF 4G7HF 4CSWA 4ZDPA 2EIMC 3C2GA 3CESA 4BACA 4XN3A 2R7UA 2L9NA 2EILC 2R7RA 1EA3A 4OWRB 3DLAA 3OYHA 3OIPA 4XQFA 1NG7A 3H9QA 3ABLC 3I4UA 4XKVA 4OIRF 2Y39A 2X6WA 4DVZA 4MLOA 2G3VA 3RTRA 4CSAC 3K4MA 5DQZA 4NQWB 4ZDLA 4IKFA 2WADA 2FGYA 1MMGA 4E7LA 2GOXB 4XNFA 2LOOA 3H65A 3RYLA 4KISA 4YN0B 3DMDA 4HSRA 4OAZA 4HRIA 3SZRA 1ZELA 4IZZA 2HV7A 3ITFA 3PL8A 1TWHA 2R4GA 2WZLA 3ASNC 5KYUA 4DVYP 3FHNA 1UELB 3VDXA 3IEEA 2J0WA 2Y69C 1NZEA 4DBRA 2LC2A 1BR4A 3HPGA 3OYKA 2W9YA 4F91B 3T4RA 3D5LA 1GLNA 5KCMA 3K4BA 1Y6IA 3ZC4A 1OKKD 1Z3YA 2LRDA 3K4NA 4YELA 3S28A 2VQHA 3EPVA 2XDVA 2ZFUA 1QLEC 4IWBA 4DBQA 4XR6A 1MMNA 4BJ1A 4BQQA 3LSKA 3OOUA 3UMHA 5CQEA 3HL2A 4AVZA 1J8MF 2VXDA 1ZHYA 3L2VA 3SDBA 2NUPA 3AG3C 1YX5A 3TL4X 4BL0B 4BE2A 1WJDA 2WB1A 3DPTA 4XOPA 1NG6A 3PSIA 4FWVA 3VAYA 3A4CA 3AL0B 2HVQA 3AFHA 3PHF2 2VQGA 3E0JB 4NUBA 1VYIA 3CZ6A 2WVNA 2YZSA 3B0PA 3DM9B 4KNVA 4JZAA 4O6NA 5BUOA 1T95A 3PNVA 4F52A 2WAEA 3OYGA 3DD7A 4Q5SF 1QHGA 2VXZA 2ZXHA 4B47A 4YT4A 4BGDA 2E1MC 5KYXA 3I5PA 2XSEA 1YX3A 1BR1A 3PMRA 3CJRB 3F46A 3LL7A 3PNTA 4RM3A 3ZSUA 5DS4A 2K9LA 1V5GA 2P0WA 2WAFA 2KW3C 2Q9CA 3K1IC 3PJRA 3MKWB 2CUZA 4CIHA 1K6YA 3K70C 1E0EA 2KJGA 2CV0A 4RLFA 1FFHA 1Z5ZA 2Y3HA 2OG2A 3TD7A 3EFOA 3H9JA 3EH1A 3LS0A 4YWQA 4BDYA 5JHFA 2XXAA 4FX5A 4ITVA 1Z63A 4DOZA 4G7OF 2LBFA 3OYDA 5L3VA 3I3LA 4I1MA 1BOBA 3K6BA 2WB7A 2R7VA 2FUG2 4PJLA 3NRHA 4J32B 5EGYA 4O7GA 3FDQA 4XTKA 3IP4B 2Q9BA 2M3AA 1D1CA 3AG4C 2H7BA 2R7XA 3LFUA 3B9QA 4BJ5C 4F3QA 1OCZC 4JOMA 1RJ9B 2P7VA 3K6GA 2W82A 3E70C 2Z1DA 1Z23A 1OCRC 3F47A 4E7HA 4G0HA 2BW3B 3HJCA 4HG2A 4HEA2 5DS5A 4U5GA 2LH9A 4OD4A 3RPUD 2VB6A 1W36C 3ZIBA 3OY9A 3NWTA 2Q9AA 4N06A 4YT2A 1WJBA 3DJNB 1PYVA 4BEHB 1WJFA 2XL4A 4O6MA 5T3WA 3L0IA 3OWTA 2ZXPA 4LIUA 2QKMB 2HVSA 1SZIA 2IXSA 3X1OA 3N24A 2OUMA 2JD3A 1FMWA 3T6JA 2IOQA 2PX0A 4OIOF 5KYNA 4E7ZA 3GANA 4J01A 4AE4B 4XORA 3W2WA 4JJFA 2BOLA 4BE1A 1ZHXA 4PUSA 2VJ5A 3NKEA 4E7KA 5HLTA 1X1CA 2LYCA 2ZXIA 3ZQQA 4XM3A 2IGMA 2HPIA 1BR2A 1UAAA 3BCAA 4CCLA 2V6EA 1QU3A 3JSZA 2NG1A 4C2UA 4XLAA 2R7TA 3S32A 4LACB 3NDBB 1WJAA 3QODA 2W7NA 4BXFA 3FBNB 4IQJA 4KI2A 1AA7A 4CBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ6 A;  4BJT A;  4BJ5 C;  3OWT A;  3K6G A;  4BJ6 C; 
#chains in the Genus database with same CATH topology
 4ENK A;  2E35 A;  1O3Q A;  3F72 A;  4EWC A;  3GBG A;  3SZP A;  4YT5 A;  3FXJ A;  2DT5 A;  5L0G A;  5HNF A;  4DYC A;  3FMR A;  3CQZ J;  3JR9 A;  1E83 A;  1CGM E;  4MQ9 F;  4UVC A;  2R7O A;  4E17 A;  5DV5 A;  2LFD A;  5ILU A;  1FSH A;  4CHU A;  3ZQV A;  1MMA A;  2M64 A;  2XGE A;  2L9S A;  1LPQ A;  3DCF A;  3GFJ A;  4XL9 A;  4R8H A;  1B72 B;  2XLD A;  3C8G B;  3MWM A;  1BZ4 A;  4ON0 A;  2V1X A;  2EV0 A;  4PSW A;  4WGY A;  4ZC3 A;  1TC3 C;  5B1B H;  4QPO A;  1BJZ A;  2V3C C;  2RVC A;  2XLH A;  2LIG A;  4LLG F;  3DKY A;  2L2O A;  1RIO H;  5FD6 A;  4HST A;  2LY2 A;  2Z3Y A;  5FKN A;  1EH8 A;  2VC0 A;  2WVQ A;  2EFW A;  3MX3 A;  1FYM A;  5K1Y A;  2BC5 A;  3CLQ A;  1RCP A;  4Q48 A;  3QYB A;  2K4B A;  4P5O A;  4C30 A;  2EB7 A;  2YSR A;  3TW7 A;  3QU3 A;  4CCJ A;  1ULY A;  1HMO A;  2LSE A;  1LI7 A;  4M6X A;  2GFH A;  3K1I A;  4P9F A;  2D1H A;  2VUM J;  2L4A A;  4L5J A;  1YZC A;  1ETK A;  5IP9 J;  4RD9 A;  2NVX J;  1M1E B;  3CCQ I;  4MEX F;  3FXO A;  5F6F A;  1AKH A;  3GLX A;  3WU1 B;  2BW3 A;  3EHN A;  5GAE J;  3GTK J;  2LSO A;  4CIC A;  3M3Y J;  2OBP A;  4Y52 J;  1BM9 A;  4JW1 A;  2L3D A;  2M0C A;  5D91 A;  5TJ5 E;  1D8K A;  2P61 A;  2OPT A;  2VT3 A;  3MAJ A;  3BZ6 A;  2KRH A;  2TDX A;  4PR9 A;  5D4S A;  2HQR A;  5F5F A;  4U9E A;  1TWH J;  1LKX A;  2O8K A;  2EV5 A;  2QLZ A;  3OIO A;  3GWN A;  2KRC A;  1G4D A;  4BKX A;  2H6C A;  2HFH A;  2M1B A;  4E7I A;  2IVM A;  1VZ0 A;  4XSX F;  1VYK A;  3EFO B;  2BY1 A;  2UV1 A;  1Z7Q c;  4Z9H A;  1J9I A;  3JW4 A;  2O7O A;  4QDL A;  5D6E A;  2HXI A;  2EA4 A;  2DT7 B;  5DYM A;  2M87 A;  3BP8 A;  4ER9 A;  2XSJ C;  3IL2 A;  1HKQ A;  5TRD A;  2I10 A;  4FE4 A;  4MVR A;  2E36 A;  1A7E A;  2VE9 A;  1MJA A;  2EQR A;  3T9O A;  2IRF G;  3NYJ A;  1NH3 A;  2P6T A;  2QBY A;  3TK0 A;  2ELH A;  3TP3 A;  1ZW2 A;  5DD4 A;  2HDW A;  3CAX A;  1X58 A;  3GYH X;  1AU7 A;  4JRZ A;  1SD5 A;  5FZT A;  3VYT B;  3RI4 A;  4YT8 A;  3HBL A;  1YE9 A;  4HX4 A;  4ESF A;  1MSE C;  1BI2 A;  1LFP A;  3KL4 A;  2QA4 I;  2X6X A;  5JVE A;  1M56 C;  4PCQ A;  4C9Y A;  4Z2Y A;  1B8I A;  3HRT A;  3EG9 B;  4Z9I A;  4ZH4 F;  1MJ9 A;  2J7P D;  3DKW A;  5CJ9 A;  1R4T A;  2H94 A;  1W5T A;  1ZRD A;  2D5R B;  4ANJ A;  2KQR A;  4Y33 A;  2RGV A;  1YIJ I;  2K9S A;  2J45 A;  3FM5 A;  3ABM C;  2J9B A;  3HJE A;  4HAM A;  1XMA A;  3FDY A;  4C3J J;  2JA2 A;  2Y31 A;  1VTN C;  3HGY A;  3U9M A;  1IRG A;  4CYD A;  4ONS A;  1O5H A;  4KT5 C;  3L8J A;  3WOD F;  1R00 A;  3E5Q A;  4ZLD A;  1KTM A;  3H2U A;  3OS1 A;  3FHD A;  3P9C A;  2FE3 A;  2IXN A;  1JHF A;  4Q7C A;  4ZYE A;  3S15 J;  2A6H F;  4LLN A;  1X4O A;  1E84 A;  3G4S I;  1B68 A;  3R0A A;  1UFB A;  4DNC A;  1NFO A;  4KBL A;  3CO7 C;  3QPS A;  4D0P A;  1A41 A;  4IQ4 A;  1WGX A;  3DPL C;  4MVM A;  2CV2 A;  1JGS A;  3FXH A;  3JCU Q;  2MD0 A;  3CMA I;  4G9Y A;  2NXN B;  3IAS 2;  3BR0 A;  1SFX A;  3OL4 A;  4CCO A;  5JHU A;  4DYR A;  4ZYD A;  4IHT A;  4BEJ A;  1OCO H;  2CCY A;  3HOT A;  2VOO A;  1Z3X A;  2EIJ C;  4XWJ A;  1IN4 A;  4HV6 A;  2A07 F;  2YL3 A;  3HYI A;  5LFA A;  4EJW A;  5HLG A;  2DJN A;  2C03 A;  1R23 A;  2XRO A;  2CNW A;  3FKJ A;  5BQG A;  4CS8 C;  2Z99 A;  3EGX B;  2OC6 A;  4AYB A;  5D4R A;  4E7S A;  3IRR A;  1IV6 A;  3EUA A;  1T98 A;  2ZCW A;  3QPH A;  2HUJ A;  1TWF J;  1LI5 A;  3RVY A;  5FLX K;  4J19 A;  1DP3 A;  1TNS A;  4BEH A;  4BXX J;  3RSN A;  2ELJ A;  2KJB A;  3VWB A;  4KFC A;  1VB5 A;  1RKT A;  3Q6N A;  4NBQ A;  1CGP A;  4I01 A;  3BZC A;  5LHH A;  4ENJ A;  3H3Z A;  3CF5 F;  2LK2 A;  3GW2 A;  1QO0 D;  5M3M J;  4A0Z A;  1OR2 A;  4GCV A;  1S29 A;  2GWR A;  2X85 A;  1WI9 A;  2P0N A;  4FES A;  4HYE A;  2M45 A;  2WBM A;  2GXB A;  2EZK A;  2KNH A;  1D1A A;  4NC3 A;  3VRC A;  2CFX A;  3TO6 A;  2QCO A;  4C3E A;  4YFX F;  3CJQ B;  3NEU A;  1OYW A;  2Z9O A;  3GTL J;  2R05 A;  4S0H B;  3F22 A;  4D4X A;  4B8X A;  5KVR A;  4XKW A;  3I9V 2;  2FX0 A;  3M1C A;  2NPU A;  3H3U A;  3OR2 C;  3DQV C;  3DF8 A;  2XC7 A;  3KMI A;  3WE2 A;  4FE7 A;  2NUT A;  1I3A A;  4A4A A;  2R5Z B;  1VF9 A;  4XON A;  4CJG A;  3H5R A;  4I99 C;  1YQA A;  2CMP A;  2QY9 A;  3HUG B;  1IAW A;  2DO7 A;  5J1Y A;  1Y39 A;  2J46 A;  1BA5 A;  3F8N A;  2VH3 A;  5E1W A;  1OXB A;  4RAG A;  1YVI A;  1WVR A;  1SF8 A;  3C8Z A;  2PN6 A;  5J4Y A;  3W6J B;  4A5M A;  4BJ6 A;  1FWZ A;  1I39 A;  4HFK B;  4KYW A;  4A3I J;  1ZW3 A;  1E86 A;  4N0B A;  2GOM A;  3EUH A;  3ONQ A;  4UV9 A;  2YLI A;  3QPT A;  1X3Z B;  3LNR A;  3LS1 A;  3QZC A;  4AWX B;  3WTV C;  1JKP C;  1U0J A;  2OCC C;  4MW8 A;  1MMD A;  2JUC A;  4Y17 A;  3EZH A;  3HB9 A;  2AS5 F;  4NC8 A;  4PFO A;  2XB5 A;  4JCH A;  4E18 A;  1VQM I;  2MW8 A;  2KLO A;  3OL3 A;  4U5E E;  3ZOB A;  4LB5 A;  3FBI B;  4EJT A;  4A0X A;  3SQN A;  1IN6 A;  3P7N A;  5FD5 A;  1LS4 A;  2B0J A;  3AG2 C;  3HPH A;  2M7B A;  4FIS A;  3CSK A;  1IN5 A;  4EMS A;  3MQ0 A;  3KET A;  2JA8 J;  2A5Y B;  2ESN A;  1DP7 P;  4XSZ F;  4J7T A;  1TFK B;  1GM5 A;  4RMN A;  3B6A A;  3S3N A;  5KYU B;  4M74 A;  3ECO A;  4L9N A;  2COB A;  4KUM A;  4HQM A;  1P9Q C;  2L02 A;  1W7P A;  1SMT A;  4KIB A;  1J0R A;  4QLC U;  2QEN A;  1A6I A;  4LG3 A;  2HSB A;  4XLE A;  1XDS A;  2E7W A;  3L1M A;  4NQW A;  4I02 A;  2OAZ A;  4M6V A;  5F08 A;  4RM2 A;  2Q3T A;  3G4X A;  3FMS A;  2LD5 A;  1Z7L A;  1JOG A;  2IPQ X;  2ZJR F;  4L5I A;  1Z6A A;  3TOL A;  4UVB A;  5LLQ A;  1OCT C;  1BI3 A;  3BTI A;  3N05 A;  1I5N A;  2X9D A;  1U6G A;  2DA7 A;  3FOO A;  2RAE A;  3CUQ C;  3FF5 A;  1VQ9 I;  3A1Y A;  2JPC A;  4OAY A;  2OJE D;  2QZ8 A;  1FP2 A;  1FZP B;  4ZLC A;  1T01 A;  3VYW A;  2X0L A;  1MNE A;  2J5O A;  4XRF A;  1S3J A;  4BJT A;  4D5F A;  2W24 A;  3OYF A;  4YEJ A;  3QPL A;  2HTS A;  2F5E A;  3OSF A;  2IW5 A;  5EHH A;  2PMZ N;  3NYM A;  4C3B A;  1BJA A;  1T2K A;  2DA3 A;  3M1E A;  3QAH A;  4D5C A;  5BQT A;  1RJ9 A;  1Y8R B;  4NC7 A;  1GUU A;  3ZQH A;  1FFT C;  4IRG A;  5ICF A;  4BAY A;  3ABU A;  2JA7 J;  1MMS A;  5J47 A;  2L7A A;  4EEF G;  2V6C A;  3H1C A;  1BW6 A;  3IH4 A;  3KYD B;  3L1P A;  3S0X A;  1TQI A;  3EUK L;  2HDD A;  2GAU A;  3LSH A;  1JE8 A;  2NYX A;  1RUN A;  5L0D A;  3F8B A;  2XRH A;  2G7U A;  3WAQ A;  3LOC A;  1BOA A;  2BY3 A;  3L2Q A;  4X1E A;  2BY2 A;  2M2E A;  2Z16 A;  2E60 A;  1T8I A;  4BXU A;  1IGN A;  3ZQY A;  2CO5 A;  2FSW A;  4XID A;  2L9R A;  2WZF A;  4IAO A;  4XEV A;  4N9I A;  1K04 A;  3ZMS A;  1Y0N A;  4I1O B;  3LUT B;  2CGE A;  5FFZ A;  4UY8 I;  2OZU A;  2QUF A;  3H0D A;  1HW2 A;  4F92 B;  2P7C B;  2GXG A;  2VT2 A;  3UGP A;  3F8F A;  3M8J A;  2JSP A;  1XDU A;  4CO8 A;  3ASO H;  3K1M A;  4RB0 A;  1Y1V J;  1DDN A;  2R7S A;  4J7Y A;  2M5W A;  2XIG A;  4A3F J;  4F55 A;  4RB3 C;  5JLX A;  5LBQ A;  3LSM A;  2PEX A;  5FB2 A;  4G7H F;  5DUK A;  4BAC A;  1XG1 A;  2DPD A;  3OIP A;  2ISZ A;  4XEK A;  1FC3 A;  2DFI A;  2Y39 A;  1WOL A;  4CSA C;  3PUF A;  2LKS A;  3K4M A;  2GWW A;  2ESH A;  2WAD A;  3HSF A;  1CF7 A;  2R3S A;  4IKF A;  2FGY A;  2LOO A;  1ZN2 A;  3IQ5 A;  2P5V A;  3RYL A;  3SXZ A;  5B1A H;  2HGC A;  2ZXJ A;  4EJV A;  1YIO A;  2R4G A;  1MH3 A;  3JSP A;  3VDX A;  1SEU A;  1B9M A;  2LC2 A;  3WTX C;  3J80 K;  1A7D A;  3JSE O;  2PLY A;  4AIJ A;  3D5L A;  4N9H A;  1GLN A;  3M4C A;  1ZRE A;  3J7Z I;  3W6K B;  3ZC4 A;  2LRD A;  3K4N A;  2C6Y A;  3EPV A;  4IB4 A;  2ZFU A;  4IWB A;  2Y48 A;  4DBQ A;  4W97 A;  4BJ1 A;  3LSK A;  3OOU A;  4KN4 X;  1FBS A;  5CQE A;  3WTZ A;  3HRM A;  4FTH A;  2R92 J;  1HSJ A;  3UMH A;  4AVZ A;  3LAP A;  1MNM C;  2OD5 A;  3SDB A;  3GCM A;  4CDG A;  1YX5 A;  3TL4 X;  4BL0 B;  1MJB A;  3DPT A;  2CSO A;  3MVP A;  5IYB J;  2M8E A;  1NG6 A;  1CGN A;  4QSH A;  2HVQ A;  4HLY A;  3CD6 I;  3G4Z A;  3IRQ A;  3GFL A;  3KP7 A;  5J3L A;  3K2A A;  3J81 Z;  4KA4 A;  3PNV A;  1A35 A;  4EBK A;  2O0Y A;  5E8G A;  5IP6 A;  3JRA A;  1P2F A;  3ZDL A;  4BGD A;  2E2J J;  5HS8 A;  5DM7 F;  4KDP A;  4CXF A;  1YX3 A;  3VFZ A;  3CJR B;  3PNT A;  1R1V A;  1OCP A;  4MVU A;  3K1I C;  1XN7 A;  5FKK A;  2Q9C A;  3SFI A;  2ZNY A;  1NSG B;  4JIO A;  2CUZ A;  4A3E J;  1K6Y A;  2EIM H;  3K70 C;  4IGG A;  3U9G A;  4CIP A;  3M9A A;  1APL C;  1UG7 A;  2HSQ A;  3LSR A;  1KZH A;  3GFI A;  3LS0 A;  2OKU A;  4YWQ A;  2JK3 A;  2FJ1 A;  2LNB A;  1Z63 A;  5K0I A;  1W7P B;  2NS7 A;  2XAF A;  1LE8 A;  1RUO A;  2LR8 A;  3BJO A;  4NHJ A;  1R5I D;  4HW0 A;  5D5X B;  2VKV A;  3ABT A;  3TUL A;  1WPK A;  5JVT A;  1K05 A;  2R7V A;  1A5J A;  2QGU A;  3KZY A;  4IHX A;  3B02 A;  2HZ8 A;  1V55 H;  2OOC A;  4MTG A;  2Q9B A;  4XTK A;  2OTJ I;  3H36 A;  3E70 C;  2ZC2 A;  1OCZ C;  1QPI A;  4NB5 A;  1SFU A;  3I59 A;  1YLF A;  1DU0 A;  2CJJ A;  1BBH A;  3RPU D;  3CCL I;  2OCE A;  3I5U A;  1W36 C;  4A6D A;  2CYD A;  1RKE A;  4Z6Y A;  1IV8 A;  5T3W A;  2DOD A;  3M8F A;  2ZXP A;  1W7P D;  3WTS C;  3TO7 A;  3FXK A;  2XS1 A;  5FLM J;  1MD0 A;  2KFD A;  4EM1 A;  2Z33 A;  2JD3 A;  1QSP A;  3HNI A;  2HQN A;  3HTU A;  3HRU A;  4GO1 A;  4JK1 X;  2EPN A;  5KYN A;  3SXK A;  5L3B A;  1ZGA A;  5FKM A;  1DUX C;  2DMT A;  2ME6 A;  4R1H A;  2BV6 A;  3NKE A;  2CYY A;  3ZQQ A;  3WG7 C;  4XM3 A;  1UAA A;  1O3U A;  3CMY A;  1MIJ A;  1Q0K A;  3K69 A;  5F04 A;  4A5N A;  4C2U A;  1XWJ A;  4LAC B;  1WJA A;  1MBH A;  1F43 A;  3N2Z B;  2LY9 A;  2DBB A;  1ZQ3 P;  3NAU A;  3N97 A;  3JRC A;  2PMZ A;  2YU9 J;  4C7O A;  1ETX A;  4KIG A;  4IAR A;  1WFX A;  2K86 A;  4L9J A;  4BHB A;  3JRE A;  4M6Y A;  3SYT A;  1LQ1 A;  2A6T A;  4A3C J;  3CLO A;  1TWC J;  3EJN A;  2A5W A;  3LEV A;  1T6Q A;  2IP2 A;  2EFQ A;  3HLZ A;  5L0C A;  2ZJP F;  2VBX A;  2BXY A;  1RMV A;  1TNT A;  5CI9 A;  2QLA A;  2IS2 A;  1YJ9 I;  4Y3O A;  3M4O J;  3NG1 A;  1FP1 D;  1EJ9 A;  1SMY F;  4IRH A;  4BY7 J;  5F28 E;  3J7Y J;  4HBL A;  5A6J A;  3I5Q A;  2RQQ A;  4CSA A;  5J40 A;  3TJ5 A;  2VBZ A;  3FXQ A;  3RKW A;  4LB6 B;  4II3 A;  3ZWI A;  1XCV A;  3WHN A;  4DZJ A;  1EKY A;  4ZYG A;  3WTY C;  3SEO A;  1OCR H;  3SP1 A;  5AC5 A;  4PJM A;  4HFF B;  3BT9 A;  2JWT A;  4YG2 F;  4AVP A;  1J09 A;  5DM6 F;  1TBX A;  3ERM A;  5KHD A;  2AQE A;  3MZH A;  1SVO A;  4GGG A;  2LFB A;  4II2 A;  1R9T J;  3AG1 C;  3DWL E;  1TTY A;  3R7C A;  2V1U A;  3EGX A;  4GEH A;  1UST A;  5GAD J;  2IT0 A;  1FPQ A;  2WA0 A;  2KSF A;  3GOR A;  3H0G J;  1V5E A;  4P6I C;  1AHD P;  3V7O A;  3TDU C;  1MW7 A;  2DW4 A;  1ZR4 A;  2Y75 A;  3DPU A;  2CQK A;  3B0V C;  2VBW A;  2CFO A;  2RD9 A;  4BHP A;  3U21 A;  4CX9 A;  2HWV A;  3HEF A;  2NVQ J;  3BLY A;  2PFD A;  2Y9Z A;  1LEA A;  4JTD B;  4N6H A;  1IUY A;  2AWY A;  2OZ6 A;  4U5D E;  5T1D B;  1HMD A;  1NLX A;  2AXL A;  2XLE A;  3C2H A;  2LD6 A;  3HTK C;  4ZZL A;  5AIQ A;  3V7S A;  2D5V A;  3AOU A;  3EHM A;  4LDK A;  2M8G X;  2VKH A;  3A01 A;  1WJC A;  2IM8 A;  2J9W A;  3ML6 A;  1R1U A;  2W4S A;  1LS1 A;  1NBB A;  5F0C A;  2PF4 E;  4CZC A;  3K1P A;  3WU0 A;  4I44 A;  2PJP A;  5K5O A;  2R5Y A;  5FRM A;  3G73 A;  3AQC A;  2ZO4 A;  1QPU A;  1E3P A;  4PGG A;  4XLF A;  4CA0 A;  1UHS A;  5A2Q Z;  2LTP A;  3TW6 A;  3ZQ7 A;  3JSO A;  1IZM A;  4BDZ A;  4OIQ F;  2G3K A;  1ORK A;  2XV4 S;  1JPJ A;  2WY8 Q;  3HG9 A;  2NVU B;  5D5V B;  5BPI A;  3EG9 A;  4MVZ A;  1VQ7 I;  3HSE A;  2K9N A;  2O6G E;  3E6M A;  1RC9 A;  3KX2 A;  3AG3 H;  3PQJ A;  1POG A;  3RQG A;  3DZA A;  2KIM A;  3QP6 A;  5HDG A;  2FOK A;  1NFN A;  2ZBK A;  4JQF A;  1BC8 C;  4FX0 A;  3GFM A;  5A69 A;  2L6G A;  2FOW A;  2A69 F;  3E3V A;  3JTG A;  1LJ9 A;  2BHY A;  2YU3 A;  1ZVZ A;  1W1W E;  2Y0M A;  2KIU A;  4ULW A;  2NAZ A;  1PVE A;  2DFH A;  2JZY A;  3PO2 J;  5C4J J;  2MHR A;  1YDI A;  2IXM A;  1E3H A;  3LES A;  4E0H A;  4R79 A;  4XKB A;  1QRY A;  3E6B A;  4I76 A;  2PJR B;  5TJJ A;  1UCR A;  2IAI A;  2P8T A;  2XB0 X;  1SD7 A;  4RLQ A;  4ESB A;  1BDJ B;  4DYQ A;  1ZG5 A;  2GA0 A;  5ICC A;  2XKP A;  5CVJ A;  1Q0F A;  2VL8 A;  5CYV A;  4RBO A;  2CU7 A;  2VAS A;  3CCV I;  1K61 A;  3N4M A;  3QRF F;  2DCE A;  1TQG A;  1ETV A;  3S27 A;  3CJT B;  3BG9 A;  2NNN A;  5BPD A;  2YL1 A;  3GTM J;  3C1D A;  1FX7 A;  4CH7 A;  3DJU B;  3TDZ C;  3Q7G A;  4M3G A;  1XC5 A;  2ZJQ F;  5IOY A;  1Z3I X;  1B1B A;  1G3Y A;  1K78 A;  1IXR C;  2O3F A;  4PJ0 C;  4IJA A;  1O3R A;  5F1R A;  1T5O A;  2O9X A;  2PNO A;  4WJ0 A;  3MKZ A;  5E3A A;  3BPV A;  3VYU B;  3KZI C;  5B3S C;  4HDV A;  3MBG A;  2NNY A;  1OQY A;  4I6Z A;  1H9T A;  2FBH A;  2ELK A;  3O8G A;  1TR2 A;  3BRJ A;  3PUB A;  5LGT A;  4JEB A;  5E1X A;  4KC9 A;  4HA8 A;  3V8J A;  3S2H J;  4U9D A;  4XMY A;  2W48 A;  5J6X A;  1LNW A;  1G3S A;  4TV7 A;  1A6Q A;  4FAS D;  3AGU A;  4UB6 C;  1NTC A;  3PO3 J;  4RGU A;  5B66 C;  3GX4 X;  1H8A C;  4DRH B;  4HV5 A;  3E97 A;  2ZPA A;  3A2K A;  5KYY B;  4B44 A;  3ZVR A;  1TT0 A;  2DOF A;  1WJ5 A;  2ZME B;  4Y15 A;  1T33 A;  2H1K A;  2OV7 A;  4CCK A;  2W1O A;  3JT1 A;  2LG4 A;  3I71 A;  2R7Q A;  3VB2 A;  3TMO A;  2WAQ A;  2R5Z A;  1WCM J;  2LP0 A;  1PP7 U;  3NWS A;  4HF2 A;  1VQ5 I;  2DMP A;  2HTJ A;  4E4H A;  1H88 C;  2V7F A;  3HZJ A;  5C4X J;  2KDO A;  3GEZ A;  1K83 J;  3FZV A;  2JVH A;  4PZJ A;  5LHG A;  3JRH A;  1OKK A;  2PX3 A;  5T3T A;  2PP4 A;  2VQC A;  5H6R A;  5BMZ A;  2UUZ A;  4LIV A;  1EA8 A;  1P6R A;  1UG0 A;  3L9F A;  3S1M J;  4FET A;  3WU2 C;  1VQ8 I;  1M2O A;  4NTB A;  1JPN A;  2PFB A;  4CGZ A;  3ZTZ A;  2EIN H;  5DCF A;  2CQX A;  2Z2S B;  1YOV B;  2XSD C;  3H3V K;  4HNU A;  3KEY A;  1OW8 A;  1J8Y F;  3MFN A;  5ILS A;  1AWC A;  5JVG F;  1IG7 A;  2WV1 A;  3WE3 A;  3OYN A;  3EPZ A;  2W4B A;  3FXR A;  4G78 A;  5HS9 A;  2ZJ2 A;  3CC7 I;  2KDZ A;  4NC6 A;  3RIR A;  2VJ4 A;  4MND A;  1U78 A;  3GTQ J;  2V9K A;  2CNW D;  4MTF A;  5B1A C;  1I4Y A;  4LDR A;  5E8I A;  3RH3 A;  4B3X A;  3OYI A;  4LDQ A;  3P9I A;  4HNV A;  1O87 A;  3CDL A;  5B3I A;  1IZ1 A;  3COA C;  2O8X A;  5E3N A;  1OYY A;  2UUI A;  4P55 A;  1R4N B;  5IP7 J;  1XMK A;  3K2Z A;  2CV1 A;  1VFC A;  1PUF B;  3S1R J;  3QYF A;  4M9X A;  1GV5 A;  1SFE A;  1I5Z A;  2JPB A;  2KP6 A;  5ERI A;  3JRD A;  3KH2 A;  1DU6 A;  2W84 A;  1HCR A;  1TL8 A;  2Z5U A;  3K1H A;  2CH0 A;  2EIJ H;  4CIH A;  3LWF A;  4AX2 A;  5K7F A;  2DTZ A;  3FK7 A;  1WH7 A;  2Q1Z B;  2NVY J;  2CW8 A;  4MW3 A;  1JKO C;  2L7Z A;  5LGU A;  4ASN A;  1YS6 A;  3T8R A;  4U87 A;  3F8C A;  3MKY B;  1FR0 A;  4FCY A;  4K1O A;  2HKX A;  5A6A A;  5EZG A;  2PI0 A;  1VQP I;  4CYC B;  2H27 A;  2R02 A;  1R36 A;  1JTX A;  3QW0 A;  4XEF A;  1WQ2 A;  5CPR B;  4YL1 A;  2P6V A;  2ZKZ A;  3DXJ F;  4MVQ A;  4NCQ A;  3DTI A;  2X51 A;  4M9Z A;  3CDH A;  3C3W A;  1OR7 A;  1XD7 A;  1S5L C;  4XLC A;  5J8C A;  2WV0 A;  2H7V C;  1Y0U A;  3A02 A;  3CUO A;  1R4M B;  3HKK A;  1WGW A;  3KEQ A;  1U8R A;  5FKL A;  3WG7 H;  1ZG3 A;  3H92 A;  1F1M A;  5FCL A;  2G7H A;  2H6B A;  1W5S A;  2GLO A;  2LMD A;  1UZC A;  3AQB A;  2O03 A;  3R2P A;  4U5H A;  3QTH A;  4JP0 A;  5BOX A;  3UR3 C;  3S93 A;  1B8I B;  5LRS A;  2HPM A;  4XPX A;  3ABK H;  1WI3 A;  2CDQ A;  4UUS A;  4QPQ A;  3L34 A;  2EPO A;  3IQC A;  3F6V A;  2FBI A;  2ZME A;  3I54 A;  4WXD A;  2WVO A;  4K7B A;  2CW0 F;  3W2A A;  2QWW A;  2HYG D;  5GPC A;  3I64 A;  3UGO A;  2MAB A;  3K70 D;  1DPU A;  4B09 A;  3GZ5 A;  4W8P A;  3MN2 A;  1YYX A;  4AM3 A;  1ON1 A;  1WHU A;  4GYI A;  4XRS A;  2DA6 A;  1SAX A;  1VQ6 I;  1X1A A;  3KP4 A;  3F23 A;  2K5C A;  1A36 A;  1WJE A;  1ZZP A;  3TED A;  5E1Z B;  2BXZ A;  5HVQ C;  1S6L A;  3PNY A;  4OOI A;  3IV5 A;  4P9U A;  4X0G A;  3ZQI A;  2R7W A;  2NS0 A;  2E1C A;  2QNL A;  3FX3 A;  3KP5 A;  3CCE I;  4EAT A;  3OR1 C;  4RAY A;  5CVR A;  4D9J A;  2VPL A;  4NQF A;  3ASN H;  1TWC A;  2QQ8 A;  1L3L A;  1QQ3 A;  4N4W A;  1YTY A;  1Z91 A;  3GTG J;  3CP8 A;  4B6I A;  2A05 A;  2Q8K A;  2P5L C;  3S8P A;  3C63 A;  2BVL A;  2P4W A;  3CC4 I;  1YZA A;  2WY7 Q;  1WH5 A;  2JA5 J;  3L2W A;  4RDA A;  2LBF B;  3DBH B;  1FTT A;  5HV9 A;  2DT6 A;  3A0H C;  2AO9 A;  1HBX G;  3ZP5 A;  2W00 A;  1ETO A;  2ASR A;  5ILV A;  1CF7 B;  3AAF A;  2L7F P;  2BYV E;  3B0U X;  2HS5 A;  4GFB A;  3RJP A;  3Q3S A;  3H5N A;  3TQN A;  2KQ9 A;  3T1B A;  4UVA A;  2DOE A;  2F5D A;  2IBD A;  2YVK A;  2KHM A;  4A3K J;  3M4B A;  1DGW Y;  2PJR A;  1MH4 A;  5GPG B;  2ZXO A;  3U3F A;  2KKO A;  2NOJ B;  2F6C A;  1YJG A;  4U5F E;  1NU9 C;  1H0M A;  3Q0V A;  4QWQ A;  3SYN A;  2RN7 A;  4IXA A;  5HOD A;  2J5P A;  3OYJ A;  1Q0M A;  2QYO A;  4CJO A;  2JQ7 A;  3RQF A;  1NG1 A;  2XGX A;  4I09 A;  3E5U A;  3VPR A;  2HV6 A;  4Q47 A;  3RKX A;  1QZE A;  1XCB A;  1KON A;  2QQA A;  4KMU X;  3T6G B;  1JUP A;  4XLP F;  3KYJ A;  1G4W R;  2L0K A;  4ZDP A;  4JTC B;  2Q2E A;  2JRM A;  3C2G A;  3CES A;  3ROU A;  4XN3 A;  4G6Q A;  1HW5 A;  1EA3 A;  4AC0 A;  1R71 A;  4XQF A;  2CG4 A;  3H9Q A;  1LVA A;  3TQO A;  3GZN B;  2G3V A;  2QSH X;  4ZDL A;  1S05 A;  2GOX B;  2F4M B;  3Q0W A;  3DI5 A;  3S2W A;  2FA5 A;  2E19 A;  1E2X A;  3LA7 A;  3P5J A;  4WXC A;  1BI0 A;  5BNG A;  4XPW A;  2ME0 A;  3SZR A;  1ZEL A;  2E1N A;  2J8W A;  1ZGJ A;  2M34 A;  1ENH A;  3PL8 A;  3AG4 H;  3CCR I;  2HDC A;  2WZL A;  3FHN A;  1UEL B;  4JYK A;  2AXT C;  1V54 H;  5DCM B;  1Q1V A;  1NZE A;  2J0W A;  2Q4F A;  3ZPL A;  2W9Y A;  3IEE A;  1R1T A;  3LNM B;  3IKV A;  4F91 B;  2H1L A;  4H0E A;  1KU9 A;  2EV6 A;  1R5G A;  3QQA A;  1VI0 A;  4HLX A;  4ESJ A;  1J7K A;  1W0T A;  2L4M A;  2XDV A;  2YRF A;  3JRB A;  4LOC A;  1NHA A;  3KLO A;  1B4A A;  3RKQ A;  1MSF C;  2IJL A;  2VKE A;  2X4H A;  3HL2 A;  1LM3 B;  2H09 A;  3FIS A;  1FAP B;  2XGD A;  4GYG A;  2Y0S N;  1MBG A;  4JKV A;  4IHY A;  3PSI A;  3PHF 2;  1YS7 A;  2WVN A;  3CZ6 A;  1GXQ A;  3B0P A;  2KIS A;  3BG5 A;  2HYJ A;  2GZW A;  2WAE A;  3OYG A;  1K6O A;  3CUQ A;  2MBF A;  2ZXH A;  3D1N I;  4IO9 F;  4EGZ A;  3NQO A;  1ORY A;  3QVZ A;  2XSE A;  4LG0 B;  4WXH A;  1BR1 A;  4BBR J;  1SC7 A;  2R9R B;  3PMR A;  1F9N A;  1UHM A;  5DS4 A;  3ZSU A;  4EIY A;  2K9L A;  2WAF A;  2KW3 C;  4UUT A;  4UXN A;  4QIW N;  2DAO A;  4HX7 A;  6PAX A;  3ESW B;  1E0E A;  2JRT A;  4MNU A;  2Y3H A;  3EFO A;  4AID A;  4CBE A;  1FJL A;  1J5Y A;  2IEK A;  4BDY A;  4A3L J;  2HKO A;  2QVO A;  4DOZ A;  2VOD A;  2LBF A;  4EGY A;  1ORS C;  3DEW A;  3JZ0 A;  2GDC A;  3ZN0 A;  3WTT C;  3I3L A;  4JX6 A;  2E2I J;  2WB7 A;  3RVZ A;  4PJL A;  2FD5 A;  3ABM H;  1JRA A;  2LKP A;  3M15 A;  5EGY A;  1JJ6 C;  2QE9 A;  1I6X A;  3IP4 B;  2ACJ A;  2M3A A;  3FDQ A;  1ZLK A;  2H7B A;  1Y4C A;  3LFU A;  3B9Q A;  4F3Q A;  5L3E A;  3K6G A;  3U2L A;  2Z1D A;  3BQZ A;  2K27 A;  1Z23 A;  2BW3 B;  3ZMT A;  3US6 A;  4HEA 2;  1CPQ A;  2LH9 A;  4U5G A;  3ZIB A;  3RPU A;  4X6A J;  5COG A;  4N06 A;  5L3G A;  5J8F A;  2JA6 J;  1ON2 A;  1APC A;  3R4K A;  1YA7 O;  3L0I A;  4A0Y A;  3GLL A;  4OU0 A;  1QA6 A;  1SZI A;  2VCA A;  2FRH A;  2GM4 A;  2OUM A;  2YL0 A;  2DN0 A;  5H20 A;  3F21 A;  1FMW A;  2Q0O A;  1LDJ A;  2JJ7 A;  2XPV A;  3BR6 A;  3IC7 A;  4BH9 A;  2WAQ N;  5M5W J;  2IOQ A;  2EZL A;  1G4U S;  4BBS J;  2XUB A;  3GAN A;  2JT1 A;  1KQ0 A;  3HUG A;  2EPK X;  2KZG A;  4JJF A;  2MH9 A;  4BE1 A;  3MYF A;  5L0I A;  1ZHX A;  4PUS A;  3SFZ A;  4YIR X;  4IHW A;  1WKM A;  1SVL A;  1T6I A;  1X1C A;  2ZXI A;  5GAG J;  4UUS B;  2IGM A;  1BR2 A;  2HPI A;  1QU3 A;  2AWC A;  2V6E A;  2DYR H;  1MGT A;  4I98 B;  3C2B A;  2YR2 A;  2L9V A;  5EF6 A;  3QOD A;  1JJ8 C;  3ZTM A;  3IHU A;  1AA7 A;  2A61 A;  4A3M J;  2XF5 A;  3C18 A;  5EEG A;  3DBL B;  1G3T A;  4XOT A;  2ECC A;  3G50 A;  4PAC A;  2D45 A;  4PGH A;  2EPM X;  3LA2 A;  2E34 A;  3A0B C;  1K78 B;  1I1S A;  1T0F A;  1FLI A;  3L2C A;  2AU5 A;  3U0C A;  3ZXS A;  1GDT A;  3E5X A;  2KL4 A;  3MLG A;  1SAU A;  3H35 A;  1MND A;  4S04 A;  2EFP A;  3HNK A;  1ZRC A;  3MKL A;  3KP3 A;  3OOP A;  2KGO A;  4CYC A;  4EJU A;  1V55 C;  5J4V A;  2VCB A;  2ZXW C;  1XPX A;  5FO5 A;  1TZL A;  3HC7 A;  3ZRG A;  1JUM A;  2STW A;  3HOZ J;  3FVY A;  4PFP A;  4P1W A;  4AU7 A;  1J2X A;  3VEP A;  3J06 A;  3D5S C;  4IRI A;  4D7M A;  3DE9 A;  4DRI B;  3IWF A;  3QMK A;  3S90 A;  4CCN A;  3RYP A;  2LKX A;  4KNY A;  4V19 K;  1KU2 A;  3SZT A;  1HQC A;  4FQG A;  4QTR A;  3IH3 A;  3O8H A;  3QU6 A;  4Y7N J;  4BNC A;  2OQG A;  2WWY A;  4PJJ A;  2DYS H;  4OMY A;  1WTY A;  4MO7 A;  2KYH A;  1P92 A;  2LK4 A;  2EK5 A;  4DGW B;  4N4O B;  5L3F A;  5KNL A;  3GTO J;  4H54 A;  3OMY A;  1RPW A;  1ZLJ A;  4O79 A;  1FY7 A;  2MYS A;  5LGN A;  4UNO A;  2EIK C;  2X1C A;  1L7C A;  2OCC H;  1IC8 A;  5J1U A;  5ED4 A;  3BG6 A;  1KA8 A;  2XGC A;  3MCZ A;  3OEO A;  1T9K A;  3L7W A;  1HXD A;  2P81 A;  1JMW A;  3E9V A;  1Y8Q B;  4M3B A;  3M07 A;  3LNQ A;  1ST6 A;  1Q0G A;  2V79 A;  4IL6 C;  3AG2 H;  3F9K A;  1Q0D A;  3NMJ A;  1WWP A;  1WAT A;  1AVO B;  5IY5 C;  3FIW A;  2MSY A;  3L2R A;  1UMQ A;  1YYV A;  4BY1 J;  1MBK A;  3HTS B;  1VLT A;  3K10 A;  4NDL A;  3ELK A;  1YYJ A;  1R58 A;  2BBY A;  2VE8 A;  4E6K G;  2HOT A;  1V5F A;  4BS9 A;  3OYC A;  3KEO A;  1JI8 A;  3OIQ A;  1I4Z A;  5JRA A;  3P9K A;  4ZYA A;  3W8I A;  1VOM A;  2Q2E B;  3ZQC A;  3FOP A;  2FNA A;  3CDI A;  5K5Q A;  4YL3 A;  2Y3G A;  3JRM O;  3G2B A;  1QNT A;  3QOP A;  4LLL A;  5IOZ A;  2AQF A;  2X48 A;  2E5Z A;  3AL0 C;  4OD5 A;  4BU2 A;  4CZZ A;  2QBY B;  3FK6 A;  3LMM A;  4F4B A;  2HQA A;  4JC7 A;  3PFI A;  4C3H J;  4AK9 A;  1DOV A;  1KYW A;  3TJ6 A;  1D0Z A;  3BWG A;  3DM5 A;  3NMI A;  2R7F A;  2XLV A;  2Y69 H;  3HGG A;  5HDN A;  2YUS A;  2Y2Z A;  1TWG J;  3VYS B;  1QZZ A;  1ZKG A;  2ZSH B;  3VYR B;  3ABK C;  3Q6M A;  1TWA J;  1C0W A;  2DJI A;  1FMV A;  1ZU4 A;  3LSG A;  3K4K A;  2YPR A;  1VTM P;  5EG0 A;  2LF8 A;  1K40 A;  3W8H A;  5JS5 A;  2HNH A;  1XX5 A;  4JCZ A;  1IRZ A;  4XQ1 A;  1Z6R A;  2COM A;  3O10 A;  2A1D D;  3LFK A;  4ZTF A;  1VQ4 I;  1U89 A;  4A6E A;  3CTA A;  5DUI A;  4A3D J;  4NNJ A;  3LLK A;  4G6T B;  3RZD J;  1Y1W J;  1BIA A;  2V1D A;  5BS6 A;  2B7E A;  4U5B E;  2FNP A;  4ZYH A;  3I4P A;  1RNL A;  2E71 A;  2F5V A;  1LE2 A;  2VPR A;  1P4X A;  2VC1 A;  3WG9 A;  1S8N A;  1YI2 I;  2VJI A;  3RIP A;  1TWA A;  3HM5 A;  1YA9 A;  3GUD A;  4E70 A;  3MZY A;  3HOY J;  2X6O A;  4L0Z B;  3T6B A;  3F0C A;  1JT0 A;  3H5A A;  3OYE A;  3LEO A;  3QOE A;  1T0F C;  1FIA A;  1HKS A;  2OU2 A;  2XM4 A;  1N75 A;  1REP C;  3CQZ A;  2DMU A;  2VBY A;  2MC3 A;  4QI2 A;  3GWZ A;  1V54 C;  3L2U A;  2Y3D A;  4YJW A;  1G6N A;  3REO A;  3V7R A;  1H89 C;  1RR7 A;  1W36 D;  1C17 M;  3BR5 A;  3ASO C;  4BQN A;  3MFK A;  3BY6 A;  3KP6 A;  3U3B A;  3HXL A;  3GWL A;  3EDP A;  3NAR A;  1F36 A;  4XBF A;  1S7Z A;  5JUA A;  4KIT B;  5EGO B;  1HA8 A;  3SZG A;  2A6E F;  1LFB A;  4I7H A;  4DW6 A;  2R93 J;  4AD9 A;  2KMU A;  1O57 A;  1C03 A;  2OQR A;  3DFG A;  4RB2 C;  1RKE B;  2I8B A;  4I3M A;  2F5F A;  1YO5 C;  2YLD A;  3I59 B;  1HDD C;  3RFY A;  3PIO F;  1X4P A;  3UMI A;  4JVS A;  1X1D A;  2ZSI B;  3ZR8 X;  3B29 A;  1RKW A;  3TBI A;  1IN7 A;  3T0Y A;  2HEO A;  1KQ9 A;  2JMW A;  5KYY A;  1FYL A;  4MTD A;  1MDM A;  3LAY A;  3ZG1 A;  3HKZ N;  2XRN A;  2GXA A;  1V3F A;  2AP3 A;  2EJR A;  1XGN A;  2RRE A;  4JUR I;  2W45 A;  1XSX A;  4WX9 A;  3LQR A;  1N77 A;  1R6R A;  2C04 A;  5B1B C;  4A3B J;  3E7L A;  1S9H A;  2HZT A;  4DZP A;  1MKM A;  1FT9 A;  1A0B A;  2HMZ A;  2UXN A;  4XLN F;  5KYW A;  3JRT A;  2YHS A;  1I1G A;  1WRJ A;  1QVX A;  1ZHZ A;  4LLE A;  4D4N A;  4DJA A;  3S2D J;  1PUF A;  3DKX A;  4BEM J;  2VQL A;  3HIF A;  3K1N A;  4YRV A;  1YIT I;  4LK1 F;  1AOY A;  4RGS A;  4A69 C;  5LD2 C;  1K79 A;  1YW9 A;  1ERD A;  1HDP A;  2XF6 A;  3F6O A;  5H6Q A;  2XAH A;  4HQE A;  4IRU A;  1U2W A;  1YW8 A;  2VN2 A;  1TLH B;  1X2M A;  3EUH C;  2I8D A;  5KK1 A;  4AL0 A;  1LIH A;  3E6C C;  4K0D A;  2IGN A;  3M7G A;  4KJZ A;  4FHT A;  3UKG A;  2BHZ A;  2JUG A;  5FRN A;  4GQH A;  4QI0 A;  2NUT B;  4GYT A;  1BI1 A;  2EFN A;  3GM1 A;  3GM2 A;  2O61 A;  4V2G A;  4U88 A;  2XVC A;  3MMY B;  1OW6 A;  3G71 I;  2CUJ A;  3ULQ B;  5B5E C;  1XGO A;  1GGQ A;  1IW7 F;  4RGR A;  1QGP A;  4CS7 A;  4HEA J;  1YRN A;  1DQU A;  4M72 A;  2AVK A;  1VQL I;  1X2N A;  3B73 A;  5M3F J;  5E3C A;  5JLI A;  2IYL D;  4C7O B;  4RB1 A;  3WHC A;  4DJ9 A;  2KC3 A;  1SAN A;  5D5U B;  2E7X A;  5M5Y J;  2L9J A;  4LFU A;  2RNG A;  5F1J A;  1A04 A;  4YIF A;  4M9S A;  2O5R A;  2A3S A;  2MG4 A;  2XXA B;  1KYZ A;  5DS9 A;  3S3O A;  3TKY A;  2G62 A;  3IQT A;  5L0J A;  1CGO A;  2KPM A;  3HDD A;  4A93 J;  1O3S A;  2K3P A;  5EK0 A;  5E18 F;  3DV8 A;  2BEO A;  2X1E A;  2MFZ A;  4H4K C;  2EFO A;  4I0A A;  3ZN1 A;  1R5H A;  2IA2 A;  2LRE A;  3RDI A;  4F93 B;  1U3E M;  4A3G J;  4CS9 A;  4MVO A;  2OQM A;  1O3T A;  1XB4 A;  3V42 A;  2PBE A;  3A11 A;  3I55 I;  2E1O A;  2LLK A;  2D1V A;  4UV8 A;  1YAU O;  4R32 A;  3RKO F;  2DMQ A;  1OW7 A;  1XZQ A;  1BN5 A;  2DXI A;  4O5V A;  3W6V A;  2ID3 A;  4PK4 A;  5FFX A;  5AGF A;  3MD2 A;  1ZK8 A;  3OS2 A;  1KGS A;  3V7C A;  1V4A A;  4U7B A;  1YJN I;  4M3F A;  1TWG A;  5KAF C;  4B43 A;  5CVV A;  2X6Y A;  5IT3 A;  5C44 J;  5COM A;  2JN6 A;  3HNJ A;  3JAM K;  3UNG C;  2IBF A;  2I5U A;  3GO5 A;  3AKZ A;  4LLC A;  3BG7 A;  1X3W B;  3G1M A;  3A03 A;  1BBY A;  4HX8 A;  2PMH A;  4LK0 F;  4XIC A;  3OYA A;  1D5V A;  2WL8 A;  2K7L A;  4ENN A;  5A2Q K;  2K4J A;  1PP8 F;  3BEH A;  2IA0 A;  1VMA A;  2DGJ A;  3HOS A;  3M79 A;  4YL0 A;  3IAM 2;  1SVM A;  3U2R A;  4Z9J A;  3S16 J;  2I15 A;  4ETS A;  2HR3 A;  1LE8 B;  4RDU A;  4BJ5 A;  4L9V A;  2UZK A;  2V26 A;  4XRM A;  1E3O C;  1ONV A;  1N1C A;  1XTA A;  2K02 A;  3GZ6 A;  1U0B B;  5D92 A;  2MH2 A;  1MBE A;  1IDY A;  3W3C A;  3POV A;  3EGD B;  2QKL B;  3EZI A;  3ZQF A;  2MA3 A;  3DBR B;  3D0S A;  4KIF A;  4FX4 A;  4N6C A;  2K9M A;  3U2M A;  1OIS A;  2YL7 A;  2YQY A;  1W5C C;  1P7I A;  2ZB9 A;  5HOO A;  3AJM A;  2STT A;  3DTK A;  1U8B A;  1EI7 A;  3EQL F;  5EZH A;  4CDY A;  4FAP B;  3S3M A;  1OCC H;  1OCO C;  3EYI A;  4M73 A;  3QVY A;  3MEX A;  5H2F C;  3W2V A;  2DDB A;  1XGS A;  3AG1 H;  5L3Q A;  3HHG A;  2DOA A;  5DTD A;  1YAR O;  3HNL A;  5L3D A;  4J00 A;  4KMF A;  2LCH A;  4UHT A;  1W2W A;  2ISY A;  1LVK A;  2ZXW H;  4AIH A;  4D1Q A;  2IS4 A;  1B59 A;  4CSW A;  4KN7 X;  1GV2 A;  2OEV A;  3B71 A;  3BR3 A;  2R7U A;  1BC7 C;  2XLW A;  5AIP A;  3DLA A;  3IWZ A;  1JT6 A;  1TQM A;  2M30 A;  3OYH A;  3SJM A;  1NG7 A;  4MFD A;  3ABL C;  3I4U A;  1YLM A;  4DVZ A;  1VQN I;  4OMZ A;  1HLV A;  2RSE B;  4MLO A;  1FOY A;  5DQZ A;  2XAQ A;  4NQW B;  5EDN A;  3C8G D;  1W4M A;  1MMG A;  3GEH A;  5CLS A;  3BRO A;  4MS2 A;  2R5Y B;  3H65 A;  3O55 A;  3O3K A;  2OJQ A;  1FOK A;  3DMD A;  4OAZ A;  4U0V A;  4HRI A;  1FEX A;  4HF0 A;  4HOB A;  3WTW C;  4IZZ A;  4EBJ A;  2XPW A;  5KYU A;  3ASN C;  5A6B D;  5A6B A;  2NS8 A;  3JTH A;  2Y69 C;  4UB8 C;  2ECB A;  3HPG A;  1BR4 A;  3V5Y A;  3RW0 A;  3I53 A;  3A01 B;  2K3F A;  4M3D A;  1HOM A;  2NSF A;  3T4R A;  1OKR A;  1OKK D;  1Z3Y A;  2D2W A;  2VQH A;  1L3P A;  1OMI A;  2XRL A;  3HSR A;  1FOX A;  3BTL A;  2NSG A;  4BQQ A;  3KE2 A;  1IXS B;  1NK3 P;  1U6H A;  2UUH A;  1H6G A;  2VXD A;  2YWA A;  3L2V A;  2NUP A;  3AG3 C;  3FM3 A;  1WJD A;  2WB1 A;  5M5X J;  4U0W A;  3Q0U A;  2R7Z J;  1OFC X;  2JTV A;  4XOP A;  4L0Y B;  1XSD A;  5IY5 H;  3AL0 B;  2ZME C;  1U5T B;  2VQG A;  3E0J B;  5F0H A;  4KNV A;  4JZA A;  1T95 A;  1ZR2 A;  2KK1 A;  3EYY A;  3CCY A;  1J59 A;  3DD7 A;  1QHG A;  3F8M A;  3WHB A;  4B47 A;  4YT4 A;  2DU9 A;  3G3Z A;  3JYY A;  2JSC A;  2DA4 A;  3I5P A;  5KYX A;  2UXX A;  3KFW X;  3U8P A;  1ODD A;  2W57 A;  4EHP A;  1J75 A;  4IOA F;  3F46 A;  3KPH A;  3LL7 A;  2CRG A;  2HYF A;  1V5G A;  2P0W A;  2EPF A;  1X1P A;  2H8W A;  3BPX A;  3ZQL A;  1SFO J;  4EUK B;  2CV0 A;  2HOA A;  5K5R A;  4G8X A;  1Z5Z A;  3TD7 A;  1TQP A;  2F4O B;  3H9J A;  3EH1 A;  1QKR A;  1B9N A;  3BR2 A;  2OU6 A;  3TOA A;  2XXA A;  3JCU C;  4FX5 A;  4G7O F;  1GVJ A;  2AHQ A;  3GME A;  3OYD A;  3KYC B;  5L3V A;  1P7J A;  4XRS G;  4I1M A;  4K2E A;  3TGN A;  2K85 A;  2KJC A;  4RGX A;  2D4U A;  2FUG 2;  3L09 A;  1HW1 A;  1H7I A;  2EH3 A;  4J32 B;  2WC2 A;  2CQQ A;  2OEX A;  4O7G A;  2RKH A;  1V74 B;  1XZP A;  3AG4 C;  3DEU A;  4JX4 A;  2VON A;  2R7X A;  2P7V A;  1RJ9 B;  1IRF A;  3VM6 A;  2W82 A;  3F47 A;  4G0H A;  4HG2 A;  2GIV A;  3TOB A;  5DS5 A;  3BJ6 A;  4OD4 A;  1IO2 A;  5FLX Z;  2VB6 A;  1KU7 A;  3LST A;  3V4G A;  2PQ8 A;  4YT2 A;  5TIS C;  1WJB A;  1PYV A;  4BEH B;  1WJF A;  3SHF A;  2DDA A;  2QKM B;  4IF4 A;  2HVS A;  2IXS A;  4O3M A;  1YG2 A;  2NVT J;  1DOW A;  2DB4 A;  3SXM A;  1JUS A;  4EJO A;  3T6J A;  3S1Q J;  1F1Z A;  2PX0 A;  2ZNZ A;  3QW1 A;  1Y6D A;  5GP9 A;  5EEH A;  3CCM I;  1FSE A;  1YHQ I;  1MBF A;  2PMU A;  4E7K A;  3EET A;  3U1K A;  5HLT A;  2B9S A;  2XHK A;  4EQQ A;  5FGM A;  4CCL A;  3JSZ A;  2NG1 A;  3L00 A;  1I3Q J;  2TRT A;  5L0F A;  3GF2 A;  3S32 A;  2XL8 A;  2HMQ A;  4BXF A;  4WF2 A;  1A31 A;  4IQJ A;  5DVW A;  4KI2 A;  3ZMU A;  3KYL A;  1UHW A;  1D0Y A;  2XPU A;  4W1U A;  1LDK B;  2BE5 F;  3QYE A;  5C3E J;  3IPM O;  5DS6 A;  2VJJ A;  5TGT A;  5GTH C;  1ZU5 A;  3K4J A;  4IVN A;  3TOM A;  3ECH A;  1JKR C;  2E5N A;  3K4C A;  4CCM A;  4MHG A;  5COF A;  5E3L A;  1YFH A;  3GXO A;  1ZHF A;  3BTJ A;  1KNY A;  1GHC A;  5HSW A;  2WB1 N;  2GAQ A;  2E87 A;  5IPA A;  3VOD A;  3BC8 A;  2EIN C;  1D3Y A;  1G5Z A;  4HDU A;  3DU6 A;  3QWL A;  2IXP A;  1OR7 C;  5CKT A;  2EA2 A;  1OJL A;  3VOE A;  1DPR A;  5LRR A;  4E0I A;  4HZF A;  4AUX A;  3JRI A;  3ECS A;  1EF4 A;  4BG0 A;  4EVI A;  4M63 A;  2HVR A;  2FFH A;  2P5K A;  5HS7 A;  1IXC A;  4O6Y A;  2FEZ A;  1Z7U A;  1WSU A;  4LD5 A;  5FRO A;  3CF2 A;  1IN8 A;  1I50 J;  3T8T A;  5E17 F;  2YX4 A;  1D0X A;  2HJM A;  2EIK H;  1I6H J;  4BPM A;  4MTE A;  1K7A A;  3BZK A;  4RAZ A;  2L7K A;  3WTU C;  4ABZ A;  2L6F A;  3H2V A;  2IS1 A;  2M9H A;  1IRX A;  4J30 B;  2XKO A;  1ZGW A;  1S7A A;  4IHS A;  3K66 A;  5JLW A;  2XLO A;  4LIT A;  3M1C B;  4HE8 D;  4JJG A;  4CUG A;  4YFN F;  2MGQ A;  1M2V B;  5E2Q A;  2P7V B;  5D8K B;  3VSL A;  4MVS A;  3ZMZ A;  5AON A;  2L81 A;  3KZZ A;  2QSF X;  3EGD A;  4Q4Z F;  5D6F A;  1D1B A;  3KP2 A;  1M6T A;  1VQO I;  1G59 A;  2L6H A;  2M4E A;  3RCO A;  3O39 A;  3LLI A;  4RBN A;  1RZ4 A;  2QTV A;  4A2N B;  2ETS A;  3GOD A;  5IT9 K;  1QHH D;  1VND A;  4A3J J;  1AUE A;  1EH7 A;  2YEV A;  3WGG A;  3JRG A;  3FXU A;  4WCG A;  1PJR A;  2VKD A;  4G12 A;  3HOX J;  1LB2 A;  1ETY A;  2O9L A;  1JXS A;  2V4J C;  1VLS A;  4LER A;  5D5W B;  4RS8 A;  2MWQ A;  3BCB A;  4YII A;  2EIL H;  2H7O A;  4XPY A;  1FNT c;  2M4K A;  2CQN A;  2DA5 A;  2L54 A;  3BTC A;  1E85 A;  4WAB A;  2X1D A;  3DLL F;  2L01 A;  5KYX B;  1RET A;  1HF0 A;  3ZMV A;  5E3M A;  2CGP A;  2MLK A;  1RR8 C;  1MBJ A;  4NTA A;  1EQ1 A;  5IYD J;  4Y4R A;  1SFK A;  4W8K A;  2G9W A;  1GXP A;  3DAF A;  4ZJZ A;  1WZ2 A;  2BZT A;  1BW5 A;  3O6X A;  1PD1 A;  5D8L B;  3CEX A;  1T56 A;  4ZDO A;  4ULV A;  2MD5 A;  3SEZ A;  1KU3 A;  2M4G A;  1QBJ A;  5A6K A;  2NUP B;  1TP4 A;  4IAQ A;  5LEJ A;  3W4Y A;  1CPR A;  1Z9C A;  2DYS C;  2W4M A;  3EH2 A;  5K7H A;  2R0Q C;  1ORJ A;  2QQ9 A;  4BHC A;  2J9V A;  2FQ4 A;  4C3I J;  2K40 A;  4DXW A;  2A68 F;  4GXO A;  4V2F A;  2DA1 A;  2XL6 A;  1OCC C;  3G1L A;  2IS6 A;  1STZ A;  1RI7 A;  4XK4 A;  3D5R C;  2UWM A;  3KYI A;  3JYH A;  1LPE A;  1D8J A;  1QZY A;  1Z0X A;  4BUP A;  1XS9 A;  1B72 A;  1IDZ A;  4I2O A;  1YW7 A;  2IXO A;  2IGK A;  3LJB A;  1ETW A;  1OPC A;  3I56 I;  1QVT A;  4C2M J;  1WAS A;  3S17 J;  2R03 A;  1OYI A;  1JR8 A;  2FXA A;  1IUF A;  1HE1 A;  3S84 A;  4IPA A;  2J9U A;  4OIP F;  2DQR A;  2HFI A;  3Q9S A;  1ZYR F;  2M7A A;  5JR3 A;  3ABL H;  1M2V A;  3HKZ A;  1O4X A;  4OIN F;  5E79 C;  2YKZ A;  1U5T C;  3PCV A;  2VOP A;  4HNT A;  1LDD A;  3OYL A;  3X2Q C;  3RPQ A;  1GVD A;  4MEY F;  1IJW C;  3NYL A;  2ETH A;  1OLT A;  3J7A Y;  3A9C A;  4DRJ B;  4G7Z F;  3M8E A;  1X1B A;  3RKY A;  3OSG A;  4YFK F;  2QEX I;  3CC2 I;  1Z1D A;  2ADU A;  3B6C A;  1VQK I;  1BL0 A;  1D5Y A;  2FML A;  2LY1 A;  4FT8 A;  3BR1 A;  3C7J A;  1T38 A;  1T6S A;  4AE4 A;  4KIC A;  1IF1 A;  3PSF A;  2K9Q A;  1TW3 A;  4BE0 A;  1LFU P;  1QQI A;  4EBB A;  5FKO A;  3I0T A;  1K4T A;  1B6A A;  4CDA A;  2FAP B;  1NU7 D;  3KKB A;  2L5Q A;  1TKN A;  3GTJ J;  5LHI A;  1ZHT A;  2JX0 A;  2EZH A;  4CS9 C;  3S1N J;  5DLJ A;  2GQQ A;  4AIK A;  1T39 A;  4L9T A;  4A2U A;  4M71 A;  2V9V A;  5L0H A;  5GAH J;  3PIP F;  2J0X A;  4BQO A;  2XF7 A;  1NK2 P;  1A7V A;  1Z77 A;  5HDK A;  2E1M B;  3K7D A;  4L6R A;  2MC4 A;  4IOC F;  2PBI A;  4MQV A;  3LSI A;  4HPQ A;  3FAP B;  2CW7 A;  2FBK A;  2ZD9 A;  3FWE A;  4LMY A;  1N78 A;  3K7A J;  3ZCO A;  3ZGK A;  3Q7L A;  3FHZ A;  1JTY A;  2HKV A;  4DIQ A;  2TCT A;  2LQG A;  4Y13 A;  3ZMD A;  1ZG1 A;  3HRS A;  3GTP J;  1CQT A;  3FAJ A;  3OYB A;  1ZRF A;  3R61 A;  1M57 C;  3TO9 A;  3OS0 A;  2DMN A;  3IH2 A;  3CP2 A;  1AKH B;  3VSK A;  1Y56 A;  5AC4 A;  2P1A A;  2GIZ A;  4MGR A;  2B63 J;  2H8A A;  3RF3 A;  1XGM A;  3DE8 A;  5KAI C;  3J7A O;  3MYI A;  1L0O C;  2W25 A;  3GVA A;  3E1S A;  2J7P A;  1HST A;  4G6D A;  1Z67 A;  3U8V A;  4GRI A;  3CO6 C;  3PQK A;  2GBY A;  1FBQ A;  3DU5 A;  4RA2 A;  3PDM P;  3KCC A;  2XLM A;  1S72 I;  3NKD A;  1G8X A;  1LE4 A;  4C2T A;  5CVI A;  4L18 B;  3ZQG A;  2Z15 A;  2HU9 A;  5F64 A;  5J1R A;  2W85 A;  1PUE E;  1X19 A;  2Y3B A;  5BQI A;  2F4I A;  3CME I;  3VF0 A;  5K7Z A;  4XKC A;  1G2H A;  2HZD A;  3K0L A;  2KZV A;  5F27 A;  3KIO A;  5HLH A;  3L8I A;  3C8G A;  3HOU J;  2DK5 A;  2ZFW A;  2XM0 A;  1Z05 A;  4MFE A;  4XLH A;  3FXL A;  1FYK A;  1ZHW A;  1PD0 A;  1XSV A;  2LFF A;  3T5X A;  2DA2 A;  2HI3 A;  3MZ8 A;  4P96 A;  2KT0 A;  2IGO A;  2HOE A;  1FTS A;  4KT6 A;  2NOG A;  1DGR M;  3JTL O;  3V5X A;  5E20 A;  3GEI A;  2XAU A;  2QSG X;  4PJN A;  2F5C A;  3CJN A;  4IJJ A;  3UMK A;  4GDF A;  2A0U A;  3S9O A;  4MIM A;  3HOW J;  5EG0 B;  2V1N A;  2WZG A;  3NMK A;  4P9T A;  3FMQ A;  3SEQ A;  5FJ8 J;  4NTF A;  1FOW A;  3Q5F A;  4U0Y A;  3Q9V A;  1SYQ A;  4AYB N;  4ZZD A;  2V9P A;  2XAG A;  3CMM A;  2XS8 A;  3K9T A;  1SD6 A;  2PX9 A;  1PCX A;  4X0R A;  4IHV A;  3ISP A;  3I4N J;  1FIP A;  1BIB A;  2R7D A;  3BOQ A;  5ICE A;  3G6E I;  1P4A A;  1ACI A;  2A0B A;  3S29 A;  4CS8 A;  3I4M J;  1U5T A;  2BVM A;  4UUV A;  5CIV A;  3SNH A;  3E6D A;  3C62 A;  3F3X A;  3JAM Z;  3OV8 A;  1QZX A;  4JTA B;  5F5H A;  5KYW B;  2EWN A;  1PDN C;  2Q00 A;  4JEA A;  4NY3 A;  4AL1 A;  3RQ4 A;  2ZXR A;  5JP7 A;  3DAG A;  1USS A;  2ICW G;  4WWC A;  3PFY A;  4KNW A;  3JRF A;  2JVG A;  4ENM A;  4PDK A;  1ITY A;  3H9G A;  5DQT A;  2G0E A;  2DYR C;  1T08 B;  3RQE A;  2M0M A;  4RAF A;  1EV7 A;  1GT0 C;  4EM2 A;  1WWX A;  1VK5 A;  2XAS A;  4ZTJ A;  256B A;  1UG2 A;  4EV0 A;  1MZB A;  4B48 A;  4C3D A;  2X0C A;  1SD4 A;  2QM3 A;  2CS3 A;  1ZAR A;  2YX7 A;  1MDM B;  2ID6 A;  1P4W A;  3OA1 A;  2EBI A;  5DD8 A;  1U9O A;  3LA3 A;  5DCM A;  3SDG A;  2DFE A;  1R49 A;  3DTE A;  4S05 A;  2NRA C;  1PV3 A;  2FMY A;  2GA1 A;  3HOV J;  5LEK A;  5JSL A;  1F4K A;  3IUO A;  1MQV A;  4PSX A;  4CDV A;  2PG4 A;  3R6S A;  2FQ3 A;  3DEE A;  5B3S H;  5HNH A;  3PM1 A;  3K4L A;  4U5C E;  2VIX A;  3U1D A;  2CUF A;  3K33 A;  3U5S A;  3V5Z A;  1UJ8 A;  2LF7 A;  3ERE D;  5BQH A;  1S7E A;  5EGO A;  2CUE A;  1V4R A;  1ZH5 A;  5E33 A;  2VLA A;  5E3O A;  4WGZ A;  5FLV A;  1OXK A;  3OYM A;  9ANT A;  2LVS A;  2Y9Y A;  4EM0 B;  4BJ6 C;  3LSP A;  2HOS A;  2QUP A;  4E7J A;  3N0T A;  4IX7 A;  1TFO B;  1FNN A;  2EZI A;  3O6B B;  4XN0 A;  2CQ7 A;  3BJA A;  4IEJ A;  1S7O A;  1TW2 A;  2Y0S A;  4N4N B;  1LUJ B;  1HE9 A;  5CQG A;  1Z21 A;  3R0J A;  5IT9 Z;  2F2E A;  3I58 A;  2EIM C;  2BGC A;  2L9N A;  2EIL C;  2F22 A;  3DP7 A;  1SR2 A;  2R7R A;  1W0U A;  4OWR B;  4B4C A;  2FF4 A;  4JX5 A;  4EKW A;  3BDD A;  4OIR F;  4XKV A;  2X6W A;  3WGI A;  1RXQ A;  1Q1H A;  3RTR A;  1R7J A;  1Z6T A;  3GM3 A;  2EPL X;  2YS9 A;  2BY0 A;  1EH6 A;  1FBU A;  4XNF A;  4E7L A;  3J80 Z;  3RZO J;  1HY5 A;  2QF7 A;  3IQ6 A;  2OF7 A;  5CI8 A;  2MLG A;  4BQA A;  4KIS A;  4YN0 B;  4HSR A;  1TT5 B;  4M3E A;  2IA1 A;  4UDV A;  2HV7 A;  3ITF A;  3TP0 A;  4I0B A;  1TWH A;  3RQI A;  3DWW A;  4DVY P;  1OCZ H;  2DFF A;  4DBR A;  3HHH A;  3NRV A;  3OYK A;  1ETQ A;  2RQP A;  4JBA A;  1H9G A;  5JFR A;  1OR3 A;  2YLG A;  2DI3 A;  5KCM A;  3K4B A;  1Y6I A;  5HLI A;  3QP5 A;  1XMX A;  4D7N A;  3CCJ I;  4YEL A;  3S28 A;  1I27 A;  1LEB A;  1KQ8 A;  1RKC A;  1ZAO A;  1QLE C;  4XR6 A;  1MMN A;  1QVU A;  3LSJ A;  5ICG A;  5GPA A;  3J81 K;  1O7L A;  4U7D A;  2N8G A;  1J8M F;  1ZHY A;  4BYY A;  4BE2 A;  5IYC J;  1WN0 A;  2RNJ A;  2HXO A;  3VAY A;  4FWV A;  2B0H A;  3A4C A;  3AFH A;  2YZS A;  4NUB A;  1VYI A;  4F7Z A;  4O6N A;  3DM9 B;  2TMV P;  1GS9 A;  5BUO A;  2CWE A;  1G3W A;  4G94 A;  2LP4 A;  4F52 A;  2HJ3 A;  4Q5S F;  5JT4 A;  2DK8 A;  2JPU A;  2VXZ A;  2E1M C;  2HQ5 A;  4A12 A;  1HKT A;  3GEE A;  4RM3 A;  2VC9 A;  3V8L A;  2KIF A;  4B3A A;  2WTE A;  3IKT A;  3PJR A;  2QQB A;  3WGH A;  1UFM A;  2FU4 A;  4LJZ F;  3V8K A;  3MKW B;  1GQA A;  4YK5 A;  1C02 A;  1R22 A;  4RLF A;  2E2H J;  1FFH A;  3R60 A;  2KJG A;  2DTR A;  2OG2 A;  1JKQ C;  2KRF A;  5JHF A;  2RDP A;  5F0F A;  4ITV A;  2DPU A;  2BL2 A;  5EEA A;  1RES A;  1F5T A;  3G1O A;  3SXY A;  3CCU I;  4MTO A;  1BOB A;  1YRN B;  3KLN A;  3K6B A;  3S14 J;  2P6S A;  3FKI J;  5L3C A;  2KIQ A;  2OA4 A;  1D1C A;  1JAF A;  4BJ5 C;  1RRJ A;  5EYR A;  4JOM A;  4JE9 A;  3DKA A;  4HF1 A;  3BQY A;  5JI6 A;  4E7H A;  1OCR C;  3HJC A;  4B1R A;  2VI6 A;  2GA2 A;  3AGT A;  3OY9 A;  3NWT A;  2RV8 A;  4L5E A;  2Q9A A;  1QPM A;  2B0L A;  3DJN B;  2R25 A;  2XL4 A;  4O6M A;  5EJC A;  2XAJ A;  3OWT A;  4LIU A;  2DQL A;  1JGG A;  3X1O A;  4LG0 A;  3N24 A;  2F48 A;  1OQC A;  2VCC A;  1K4S A;  1U9N A;  1O7F A;  1JHH A;  4DQ2 A;  1E17 A;  2LDU A;  3CUQ B;  4OIO F;  1HC8 A;  1YJW I;  4E7Z A;  3BG3 A;  4J01 A;  2Q7R A;  2OTL I;  4XOR A;  4AE4 B;  4WK8 F;  3W2W A;  2BOL A;  3O2P E;  1UB9 A;  3X2Q H;  1FTZ A;  1X3U A;  3U9J A;  2VJ5 A;  2LYC A;  3ATP A;  1N25 A;  3NRH A;  1AEP A;  2Y30 A;  3BCA A;  2H8R A;  1T6U A;  2L7M P;  5DEQ A;  3RYR A;  2R7T A;  4XLA A;  3LAJ A;  4O6J A;  2RC4 A;  3NDB B;  1ZTR A;  3FXM A;  4LGW A;  5CVU A;  2DLL A;  2W7N A;  3CCS I;  3FBN B;  5DDG A;  5GTI C;  3LQQ A;  1EKE A; 
#chains in the Genus database with same CATH homology
 2XF5 A;  3KYL A;  4EWC A;  1D0Y A;  3GBG A;  2PMZ A;  4XOT A;  5DS6 A;  1LDK B;  2BE5 F;  3QYE A;  4YT5 A;  4C7O A;  1WFX A;  2VJJ A;  5TGT A;  5HNF A;  3SYT A;  1ZU5 A;  3K4J A;  2A6T A;  3EJN A;  3LEV A;  2A5W A;  3ZXS A;  3HLZ A;  4MQ9 F;  2R7O A;  2E5N A;  2KL4 A;  3K4C A;  4CCM A;  3MLG A;  1SAU A;  5CI9 A;  3H35 A;  2IS2 A;  1MND A;  4Y3O A;  3NG1 A;  1MMA A;  2L9S A;  1SMY F;  5HSW A;  4XL9 A;  2KGO A;  2E87 A;  3BC8 A;  2EIN C;  3I5Q A;  4PSW A;  3DU6 A;  2RQQ A;  1V55 C;  2IXP A;  2ZXW C;  4CSA A;  1OR7 C;  5CKT A;  4ZC3 A;  1TZL A;  4II3 A;  3HC7 A;  4QPO A;  3ZRG A;  2V3C C;  3DKY A;  3FVY A;  4PFP A;  4P1W A;  2L2O A;  4AU7 A;  3SEO A;  3SP1 A;  4HST A;  2LY2 A;  4PJM A;  4HFF B;  3D5S C;  3ECS A;  4BG0 A;  2WVQ A;  1J09 A;  3MX3 A;  5KHD A;  3QMK A;  2AQE A;  4CCN A;  3AG1 C;  4JW1 A;  4M63 A;  4II2 A;  2HVR A;  5KYY A;  3DWL E;  1KU2 A;  2FFH A;  3EGX A;  4GEH A;  2WA0 A;  4O6Y A;  3QYB A;  4CCJ A;  1V5E A;  4P5O A;  4C30 A;  4P6I C;  3V7O A;  5FRO A;  3CF2 A;  2LSE A;  1MW7 A;  3DPU A;  4PJJ A;  2GFH A;  1D0X A;  3B0V C;  2CFO A;  4DGW B;  3U21 A;  4RD9 A;  2L7K A;  4N4O B;  5KNL A;  3BLY A;  3OMY A;  2IS1 A;  2PFD A;  4O79 A;  1IRX A;  4J30 B;  3K66 A;  2MYS A;  4HE8 D;  4LIT A;  2X1C A;  2BW3 A;  3M1C B;  4CUG A;  4JJG A;  3EHN A;  4U5D E;  5T1D B;  1M2V B;  5E2Q A;  3HTK C;  3BG6 A;  3C2H A;  3VSL A;  2L81 A;  3EHM A;  3OEO A;  3EGD A;  2VKH A;  4Q4Z F;  1WJC A;  1D1B A;  2J9W A;  5D91 A;  1LS1 A;  2W4S A;  1G59 A;  3E9V A;  2M4E A;  3RCO A;  1ST6 A;  2KRH A;  3O39 A;  3F9K A;  3LLI A;  2PF4 E;  4CZC A;  2QTV A;  4RBN A;  4A2N B;  3GOD A;  5F5F A;  1QHH D;  5IY5 C;  4I44 A;  2YEV A;  1LKX A;  3L2R A;  5FRM A;  3AQC A;  1PJR A;  2VKD A;  2KRC A;  4XLF A;  4CA0 A;  1IZM A;  4LER A;  2V4J C;  4E7I A;  1VYK A;  1VZ0 A;  3EFO B;  3K10 A;  4BDZ A;  2G3K A;  4OIQ F;  2UV1 A;  2WY8 Q;  1JPJ A;  3HG9 A;  3LNR A;  3EG9 A;  2MWQ A;  3BCB A;  4E6K G;  2H7O A;  1V5F A;  4BS9 A;  2M4K A;  3OYC A;  3KX2 A;  4QDL A;  1JI8 A;  3OIQ A;  2X1D A;  4ZYA A;  3W8I A;  1VOM A;  3DZA A;  2Q2E B;  2DT7 B;  5KYX B;  2PX3 A;  2XSJ C;  2Y3G A;  3G2B A;  4JQF A;  2AQF A;  2E5Z A;  4Y4R A;  1SFK A;  3AL0 C;  4W8K A;  4OD5 A;  4BU2 A;  3NYJ A;  2A69 F;  4ZJZ A;  3LMM A;  3DAF A;  4F4B A;  2HQA A;  3O6X A;  1PD1 A;  4AK9 A;  4ZDO A;  1D0Z A;  3SEZ A;  3DM5 A;  2HDW A;  4ULW A;  2M4G A;  2NUP B;  3VYS B;  2ZSH B;  3VYR B;  3VYT B;  2IXM A;  3ABK C;  3Q6M A;  3LES A;  4YT8 A;  1YE9 A;  2DYS C;  2W4M A;  2DJI A;  3EH2 A;  1FMV A;  1LFP A;  4XKB A;  4R79 A;  1ZU4 A;  3KL4 A;  2J9V A;  3LSG A;  2PJR B;  2X6X A;  3K4K A;  1M56 C;  4C9Y A;  4RLQ A;  2A68 F;  3W8H A;  1OCC C;  2IS6 A;  3EG9 B;  2VL8 A;  2UWM A;  3D5R C;  2HNH A;  2VAS A;  2J7P D;  3JYH A;  2DCE A;  3N2Z B;  3S27 A;  4BUP A;  2D5R B;  4ANJ A;  2KQR A;  4Y33 A;  2IXO A;  2A1D D;  2J45 A;  2IGK A;  4CH7 A;  4ZTF A;  3ABM C;  3LJB A;  3DJU B;  3LLK A;  3Q7G A;  4NNJ A;  3FDY A;  4G6T B;  2JA2 A;  1Z3I X;  4U5B E;  1O5H A;  2J9U A;  4OIP F;  3WOD F;  1ZYR F;  2F5V A;  2M7A A;  4ZLD A;  1M2V A;  3HKZ A;  3OS1 A;  3FHD A;  4OIN F;  3RIP A;  2VJI A;  2IXN A;  1TWA A;  4WJ0 A;  2O9X A;  4HNT A;  4Q7C A;  3OYL A;  3MKZ A;  2A6H F;  5E3A A;  1X4O A;  3X2Q C;  3VYU B;  3J7A Y;  1OLT A;  3NYL A;  3T6B A;  5B3S C;  1TR2 A;  3H5A A;  4G7Z F;  1X1B A;  4KC9 A;  3OYE A;  3PUB A;  3QOE A;  4KBL A;  4IQ4 A;  1T0F C;  3DPL C;  2CV2 A;  4XMY A;  3JCU Q;  2MD0 A;  1N75 A;  3CQZ A;  4QI2 A;  3IAS 2;  3OL4 A;  4CCO A;  1V54 C;  3L2U A;  4FAS D;  2Y3D A;  4BEJ A;  4XWJ A;  2LY1 A;  3HOT A;  2EIJ C;  1Z3X A;  4YJW A;  4AE4 A;  1W36 D;  3ASO C;  3PSF A;  5LFA A;  4BQN A;  3A2K A;  2C03 A;  2ZPA A;  5KYY B;  4CS8 C;  3HXL A;  3FKJ A;  4BE0 A;  2CNW A;  4B44 A;  3EGX B;  2OC6 A;  4AYB A;  3ZVR A;  4E7S A;  4EBB A;  1S7Z A;  1TT0 A;  3EUA A;  4KIT B;  1HA8 A;  1WJ5 A;  3SZG A;  1NU7 D;  2L5Q A;  1TKN A;  1ZHT A;  2A6E F;  2KMU A;  2OV7 A;  4CCK A;  2W1O A;  1DP3 A;  2LG4 A;  4BEH A;  3RSN A;  2ELJ A;  3VWB A;  2I8B A;  4I3M A;  5DLJ A;  4CS9 C;  2R7Q A;  3Q6N A;  3TMO A;  2WAQ A;  3NWS A;  2J0X A;  4E4H A;  4BQO A;  2XF7 A;  3RFY A;  1X4P A;  2E1M B;  2V7F A;  3K7D A;  2KDO A;  3UMI A;  4JVS A;  1X1D A;  2JVH A;  2MC4 A;  2ZSI B;  3ZR8 X;  1OKK A;  3LSI A;  4HPQ A;  3TBI A;  2PP4 A;  2CW7 A;  2VQC A;  5T3T A;  2X85 A;  2UUZ A;  4LIV A;  1N78 A;  4FES A;  1UG0 A;  3ZCO A;  3ZGK A;  2WBM A;  3LAY A;  3Q7L A;  3ZG1 A;  4FET A;  2KNH A;  1D1A A;  4DIQ A;  1M2O A;  4JUR I;  2RRE A;  1JPN A;  4C3E A;  2W45 A;  3CJQ B;  1N77 A;  1R6R A;  2Z2S B;  4HNU A;  3KEY A;  2C04 A;  1J8Y F;  5B1B C;  4XKW A;  3I9V 2;  3FAJ A;  3OYB A;  3M1C A;  1M57 C;  1S9H A;  3OYN A;  3OS0 A;  3OR2 C;  3EPZ A;  3CP2 A;  2W4B A;  3DQV C;  3VSK A;  1Y56 A;  2XC7 A;  3KMI A;  2NUT A;  4XLN F;  4XON A;  4MND A;  2VJ4 A;  5B1A C;  2V9K A;  2CNW D;  5KYW A;  3H5R A;  3JRT A;  3RH3 A;  2CMP A;  2QY9 A;  4B3X A;  3OYI A;  2YHS A;  3E1S A;  1O87 A;  3HUG B;  1ZHZ A;  2J7P A;  4LLE A;  2J46 A;  2VH3 A;  4GRI A;  4DJA A;  1SF8 A;  5DVW A;  3DU5 A;  3DKX A;  2CV1 A;  3NKD A;  1G8X A;  2VQL A;  3QYF A;  4YRV A;  4BJ6 A;  4C2T A;  4HFK B;  2KP6 A;  5LD2 C;  5CI8 A;  3KH2 A;  3K1H A;  2Z15 A;  2CH0 A;  2GOM A;  2HU9 A;  3ONQ A;  1ERD A;  2XF6 A;  4IRU A;  4AX2 A;  2Q1Z B;  3EUH C;  1X19 A;  2I8D A;  2Y3B A;  2CW8 A;  1U0J A;  2F4I A;  2OCC C;  1MMD A;  3QZC A;  4K0D A;  2IGN A;  4KJZ A;  3EZH A;  4XKC A;  5FRN A;  2HZD A;  2JUG A;  4U87 A;  2KZV A;  3MKY B;  4NC8 A;  4PFO A;  2NUT B;  4GYT A;  4JCH A;  2KLO A;  3OL3 A;  4U5E E;  3MMY B;  5CPR B;  3FBI B;  2P6V A;  4XLH A;  1ZHW A;  2CUJ A;  2B0J A;  3AG2 C;  3DXJ F;  3DTI A;  2X51 A;  1PD0 A;  3HPH A;  2M7B A;  1IW7 F;  3CSK A;  4CS7 A;  4HEA J;  1DQU A;  4XLC A;  2H7V C;  4RMN A;  5E3C A;  3S3N A;  5KYU B;  4C7O B;  2IGO A;  2IYL D;  1FTS A;  1WGW A;  4KT6 A;  1DGR M;  1P9Q C;  2L9J A;  2RNG A;  5FCL A;  2O5R A;  2XAU A;  4LG3 A;  3AQB A;  2XXA B;  4PJN A;  3UMK A;  4XLE A;  4IJJ A;  4U5H A;  3S3O A;  3UR3 C;  3S93 A;  2HPM A;  2V1N A;  2G62 A;  4RM2 A;  2Q3T A;  2WZG A;  2CDQ A;  3SEQ A;  1Z7L A;  4QPQ A;  3L34 A;  2KPM A;  1Z6A A;  2K3P A;  3CMM A;  2X1E A;  2MFZ A;  4H4K C;  2WVO A;  4K7B A;  2CW0 F;  1PCX A;  4X0R A;  2LRE A;  4F93 B;  3W2A A;  3N05 A;  3UGO A;  2MAB A;  3K70 D;  4CS8 A;  4CS9 A;  3S29 A;  3A1Y A;  2BVM A;  4OAY A;  4ZLC A;  3V42 A;  3SNH A;  3VYW A;  3JT1 A;  1MNE A;  3RKO F;  1QZX A;  4BJT A;  5F5H A;  5KYW B;  2DXI A;  3OYF A;  4PK4 A;  1X1A A;  4YEJ A;  4NY3 A;  2K5C A;  3MD2 A;  3RQ4 A;  1WJE A;  2ZXR A;  3OS2 A;  3DAG A;  5HVQ C;  5EHH A;  3NYM A;  3PFY A;  3PNY A;  4U7B A;  1TWG A;  4KNW A;  2JVG A;  4B43 A;  4C3B A;  2X6Y A;  4X0G A;  2R7W A;  3H9G A;  3UNG C;  5DQT A;  2DYR C;  4EAT A;  3AKZ A;  3BG7 A;  1RJ9 A;  2M0M A;  3OR1 C;  4NC7 A;  4D9J A;  2VPL A;  4LLC A;  1FFT C;  3OYA A;  1TWC A;  1VK5 A;  4ZTJ A;  2WL8 A;  3KKB A;  3CP8 A;  4B48 A;  4B6I A;  4C3D A;  1VMA A;  3S0X A;  2CS3 A;  3S8P A;  3EUK L;  2BVL A;  3HOS A;  2DGJ A;  3OA1 A;  3IAM 2;  2WY7 Q;  3LSH A;  2EIK C;  3L2W A;  4RDA A;  2LBF B;  3DTE A;  2XRH A;  4BJ5 A;  2DT6 A;  4QI0 A;  2V26 A;  3L2Q A;  2W00 A;  1N1C A;  2Z16 A;  3IUO A;  2E60 A;  5D92 A;  3B0U X;  3W3C A;  4PSX A;  3POV A;  3EGD B;  2QKL B;  3H5N A;  5HNH A;  3DEE A;  2KQ9 A;  2WZF A;  3EZI A;  3K4L A;  3LS1 A;  2VIX A;  3K33 A;  4IAO A;  2K9M A;  3WG7 C;  4I1O B;  2KHM A;  2CGE A;  5E33 A;  1DGW Y;  2PJR A;  2ZXO A;  5HOO A;  2VLA A;  2NOJ B;  2F6C A;  4U5F E;  3DTK A;  3OYM A;  3H0D A;  1NU9 C;  3EQL F;  3SYN A;  4F92 B;  3OYJ A;  3S3M A;  4BJ6 C;  1OCO C;  3M8J A;  3UGP A;  2JSP A;  1NG1 A;  3W2V A;  3N0T A;  4E7J A;  4IX7 A;  5L3Q A;  2R7S A;  2DOA A;  4XN0 A;  2HV6 A;  4F55 A;  4J00 A;  1KON A;  2Y0S A;  4N4N B;  4U5C E;  5CQG A;  1W2W A;  1LVK A;  1Z21 A;  3LSM A;  4D1Q A;  2IS4 A;  4XLP F;  4G7H F;  4CSW A;  4ZDP A;  2EIM C;  3C2G A;  3CES A;  4BAC A;  4XN3 A;  2R7U A;  2L9N A;  2EIL C;  2R7R A;  1EA3 A;  4OWR B;  3DLA A;  3OYH A;  3OIP A;  4XQF A;  1NG7 A;  3H9Q A;  3ABL C;  3I4U A;  4XKV A;  4OIR F;  2Y39 A;  2X6W A;  4DVZ A;  4MLO A;  2G3V A;  3RTR A;  4CSA C;  3K4M A;  5DQZ A;  4NQW B;  4ZDL A;  4IKF A;  2WAD A;  2FGY A;  1MMG A;  4E7L A;  2GOX B;  4XNF A;  2LOO A;  3H65 A;  3RYL A;  4KIS A;  4YN0 B;  3DMD A;  4HSR A;  4OAZ A;  4HRI A;  3SZR A;  1ZEL A;  4IZZ A;  2HV7 A;  3ITF A;  3PL8 A;  1TWH A;  2R4G A;  2WZL A;  3ASN C;  5KYU A;  4DVY P;  3FHN A;  1UEL B;  3VDX A;  3IEE A;  2J0W A;  2Y69 C;  1NZE A;  4DBR A;  2LC2 A;  1BR4 A;  3HPG A;  3OYK A;  2W9Y A;  4F91 B;  3T4R A;  3D5L A;  1GLN A;  5KCM A;  3K4B A;  1Y6I A;  3ZC4 A;  1OKK D;  1Z3Y A;  2LRD A;  3K4N A;  4YEL A;  3S28 A;  2VQH A;  3EPV A;  2XDV A;  2ZFU A;  1QLE C;  4IWB A;  4DBQ A;  4XR6 A;  1MMN A;  4BJ1 A;  4BQQ A;  3LSK A;  3OOU A;  3UMH A;  5CQE A;  3HL2 A;  4AVZ A;  1J8M F;  2VXD A;  1ZHY A;  3L2V A;  3SDB A;  2NUP A;  3AG3 C;  1YX5 A;  3TL4 X;  4BL0 B;  4BE2 A;  1WJD A;  2WB1 A;  3DPT A;  4XOP A;  1NG6 A;  3PSI A;  4FWV A;  3VAY A;  3A4C A;  3AL0 B;  2HVQ A;  3AFH A;  3PHF 2;  2VQG A;  3E0J B;  4NUB A;  1VYI A;  3CZ6 A;  2WVN A;  2YZS A;  3B0P A;  3DM9 B;  4KNV A;  4JZA A;  4O6N A;  5BUO A;  1T95 A;  3PNV A;  4F52 A;  2WAE A;  3OYG A;  3DD7 A;  4Q5S F;  1QHG A;  2VXZ A;  2ZXH A;  4B47 A;  4YT4 A;  4BGD A;  2E1M C;  5KYX A;  3I5P A;  2XSE A;  1YX3 A;  1BR1 A;  3PMR A;  3CJR B;  3F46 A;  3LL7 A;  3PNT A;  4RM3 A;  3ZSU A;  5DS4 A;  2K9L A;  1V5G A;  2P0W A;  2WAF A;  2KW3 C;  2Q9C A;  3K1I C;  3PJR A;  3MKW B;  2CUZ A;  4CIH A;  1K6Y A;  3K70 C;  1E0E A;  2KJG A;  2CV0 A;  4RLF A;  1FFH A;  1Z5Z A;  2Y3H A;  2OG2 A;  3TD7 A;  3EFO A;  3H9J A;  3EH1 A;  3LS0 A;  4YWQ A;  4BDY A;  5JHF A;  2XXA A;  4FX5 A;  4ITV A;  1Z63 A;  4DOZ A;  4G7O F;  2LBF A;  3OYD A;  5L3V A;  3I3L A;  4I1M A;  1BOB A;  3K6B A;  2WB7 A;  2R7V A;  2FUG 2;  4PJL A;  3NRH A;  4J32 B;  5EGY A;  4O7G A;  3FDQ A;  4XTK A;  3IP4 B;  2Q9B A;  2M3A A;  1D1C A;  3AG4 C;  2H7B A;  2R7X A;  3LFU A;  3B9Q A;  4BJ5 C;  4F3Q A;  1OCZ C;  4JOM A;  1RJ9 B;  2P7V A;  3K6G A;  2W82 A;  3E70 C;  2Z1D A;  1Z23 A;  1OCR C;  3F47 A;  4E7H A;  4G0H A;  2BW3 B;  3HJC A;  4HG2 A;  4HEA 2;  5DS5 A;  4U5G A;  2LH9 A;  4OD4 A;  3RPU D;  2VB6 A;  1W36 C;  3ZIB A;  3OY9 A;  3NWT A;  2Q9A A;  4N06 A;  4YT2 A;  1WJB A;  3DJN B;  1PYV A;  4BEH B;  1WJF A;  2XL4 A;  4O6M A;  5T3W A;  3L0I A;  3OWT A;  2ZXP A;  4LIU A;  2QKM B;  2HVS A;  1SZI A;  2IXS A;  3X1O A;  3N24 A;  2OUM A;  2JD3 A;  1FMW A;  3T6J A;  2IOQ A;  2PX0 A;  4OIO F;  5KYN A;  4E7Z A;  3GAN A;  4J01 A;  4AE4 B;  4XOR A;  3W2W A;  4JJF A;  2BOL A;  4BE1 A;  1ZHX A;  4PUS A;  2VJ5 A;  3NKE A;  4E7K A;  5HLT A;  1X1C A;  2LYC A;  2ZXI A;  3ZQQ A;  4XM3 A;  2IGM A;  2HPI A;  1BR2 A;  1UAA A;  3BCA A;  4CCL A;  2V6E A;  1QU3 A;  3JSZ A;  2NG1 A;  4C2U A;  4XLA A;  2R7T A;  3S32 A;  4LAC B;  3NDB B;  1WJA A;  3QOD A;  2W7N A;  4BXF A;  3FBN B;  4IQJ A;  4KI2 A;  1AA7 A;  4CBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...