3OWTA

Crystal structure of s. cerevisiae rap1-sir3 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
148
structure length
148
Chain Sequence
FSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A conserved motif within RAP1 has diversified roles in telomere protection and regulation in different organisms.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords DNA-binding protein RAP1
total genus 55
structure length 148
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3owtA02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3owtA01
4BJ6C 4BJ5C 4BJTA 3CZ6A 3OWTA 3K6GA
chains in the Genus database with same CATH superfamily
5KK1A 4Q5SF 4F55A 1Z6RA 2LKPA 3K4NA 2ETHA 2NVYJ 3LA7A 5D91A 2EINC 3E5UA 3K1IC 2EILC 4KNWA 2K9MA 3G71I 1EH8A 1D3YA 2YU3A 3C2HA 5L0JA 4AD9A 5E1ZB 5EGOA 2HV7A 3CF5F 1SC7A 3C62A 3UGOA 1BIBA 4M71A 1OCRC 2WAFA 2QA4I 3OSGA 2UXNA 4IRIA 4LIVA 3BC8A 3RQIA 2GM4A 4J30B 3DFGA 1BW6A 1OPCA 3HTSB 4IAQA 2KRHA 2WAQA 1X2MA 3A2KA 3M79A 2KIUA 1SAXA 2CGEA 2JSCA 5LHHA 2XXAA 2JPCA 3R6SA 1UZCA 3U1DA 4A5NA 2XSDC 3G4ZA 4HX8A 3TOAA 3IAS2 4ENMA 3FVYA 2XGCA 4A3DJ 2TDXA 2VCCA 1FOYA 5BUOA 2RQQA 4DVZA 1I6XA 3PL8A 1OCOH 3GM3A 2J0XA 4KNYA 3QU6A 4XR6A 4XKBA 2FF4A 2JA6J 2ACJA 1YARO 3CCMI 1VQ8I 3I4PA 4Q4ZF 4ZC3A 5FRNA 3QZCA 2W48A 3A0HC 4XKWA 4S05A 2KJCA 3OL3A 3SP1A 1XSXA 4I0AA 5B1BH 2IGMA 5J6XA 3WU0A 1VI0A 2XS8A 1L7CA 2EPMX 5E33A 4PFOA 2OQRA 3LAYA 3A01B 4A3LJ 1KU9A 1W5SA 1DU0A 1U2WA 3HUGA 1IZ1A 1E3HA 2KIQA 3VYTB 4B4CA 5D8KB 5IP9J 4ZYDA 1F1MA 1RR8C 2Y39A 3KETA 5IY5C 1WVRA 2QM3A 5C3EJ 4YT2A 2GA2A 5HS9A 3ZQ7A 3FXRA 1R4NB 2ZJRF 1QVTA 5COMA 5CQEA 2IP2A 2YLGA 2Q4FA 5HNHA 1IN5A 5L3CA 3U9MA 4LIUA 4AL1A 2Z2SB 1HSTA 2OZ6A 1P4WA 4S0HB 2XAUA 1Y39A 3C1DA 1TWHJ 2IXSA 2UV1A 4EKWA 3F72A 2DA1A 1D0ZA 1WPKA 1LDDA 2F6CA 3NEUA 1Z6TA 2BZTA 1OKKD 2WY7Q 1Z5ZA 2R7WA 5AIPA 4U0VA 3T4RA 3AG3C 2VASA 4LB6B 5E20A 1AKHB 3HNIA 2R7DA 2G7HA 2XGEA 1N75A 1ZLJA 3CMMA 1OW6A 3RI4A 3IH3A 2O61A 1WASA 2NRAC 4M9XA 3DMDA 1C0WA 2EIJC 4GXOA 4A2NB 2Y3HA 3K66A 4DRHB 2VKEA 2A07F 1MKMA 1YX3A 5GADJ 4EMSA 3M4OJ 2DYRC 2M64A 2N8GA 3EG9B 1W7PD 1G8XA 2OC6A 4KIGA 3DD7A 2HQNA 3FXHA 3PHF2 1JJ6C 2CYYA 5D4SA 4ENJA 3LESA 4A3GJ 3KP7A 5C44J 2FOKA 2NVQJ 5IP6A 4L9JA 4RGUA 2HOTA 3GEHA 3NKEA 4CX9A 3TW6A 4ZYEA 1PD1A 4G6TB 2D5VA 4HDUA 2HQRA 3HJCA 3BQZA 1NFOA 3LL7A 4JQFA 4AIHA 3U0CA 2J9VA 5HSWA 1TKNA 1LE8A 3Q0UA 5H6RA 3VYSB 3FXUA 2XS1A 2CCYA 5JHUA 4KMFA 3M4CA 3F8CA 2M0MA 4Y15A 3TQOA 4ZZDA 3PSIA 2WB1N 3FMSA 2XAFA 1QZEA 1PJRA 1FEXA 3BQYA 2L7MP 2RVCA 3J7AO 4GEHA 3CO7C 2XLWA 2E1NA 3S9OA 1DGRM 1ZW3A 3GORA 2XF5A 1Y1WJ 4A3IJ 1WRJA 4AX2A 4FHTA 3QPTA 4HF2A 3X2QC 3WTXC 2NUTB 3I54A 3O8HA 2QNLA 2I8DA 1POGA 5E1XA 2MA3A 2HDCA 1JPNA 3ASNC 3EGXA 2E2HJ 2HS5A 3H3UA 2DMUA 1JHHA 1MBGA 4UDVA 3G2BA 5DUIA 3L2CA 1H8AC 3FBNB 4II3A 4RLQA 3BG3A 4OD5A 2J5OA 5K7FA 4FISA 3EUKL 4HPQA 2VC0A 1O3RA 3KMIA 4BE2A 4GQHA 3MFNA 4IKFA 4EJTA 2Y9YA 3I59B 4CDAA 2HQAA 5L3DA 4IGGA 5KNLA 3Q5FA 2MC4A 4B44A 3PSFA 3ZGKA 3CMEI 2BVLA 1LEBA 1I5NA 2R7VA 1W4MA 1D1BA 4XN3A 2Z5UA 1QBJA 1ZW2A 2EIMC 1MD0A 3CCYA 2W4SA 2DGJA 3IC7A 4YT4A 4BJ6A 1J7KA 3GCMA 2IM8A 4CCLA 2STWA 2EPNA 1B59A 3HOYJ 4XTKA 1T38A 3H2VA 1A36A 5EEGA 3GEZA 3FKJA 3T8RA 2WV0A 1R9TJ 4W8PA 3KP3A 4XOPA 2HZDA 2J9BA 2PMZA 2EQRA 1T8IA 4D7MA 4A6DA 4BY1J 4YEJA 3CJQB 1R1VA 4RB0A 3HZJA 2WVOA 1A7VA 3W4YA 4U88A 3GW2A 3KP2A 4QPQA 4HYEA 4CJGA 1R5GA 4XEVA 4BE0A 2Y69C 1R22A 1DP7P 4CBEA 1U8RA 1AKHA 5KCMA 2ZCWA 1I27A 3O8GA 1W36D 2E1OA 3ITFA 3WHNA 1YFHA 4BXXJ 4YWQA 3RKOF 3DWWA 3LA2A 2BVMA 4M3BA 2R5YA 3E1SA 3EUAA 2CUJA 2EFQA 4DYQA 3FM3A 1HDDC 1YS6A 1NTCA 4N4NB 2CNWD 2Y69H 4IHXA 1J2XA 2H8AA 3IV5A 3LSMA 2VQLA 4E7JA 1LE8B 3GTGJ 5BQIA 5EHHA 3AQCA 4E7KA 5M5WJ 3HRMA 4MQ9F 5F6FA 2LRDA 3GFLA 2X0CA 3V5YA 2DN0A 3ZVRA 5LD2C 4IXAA 4YFXF 1T08B 3WG7H 3IPMO 1U5TC 3CC4I 1YIOA 5DD4A 3CUQA 5JSLA 3S32A 2W57A 5DD8A 2Z16A 2A0UA 4A4AA 4MVSA 4G78A 3M8JA 1ZHWA 2B0LA 1VQPI 5IYCJ 5E17F 4XOTA 1X1BA 4XLFA 4L6RA 1TT0A 1BIAA 2NUTA 3BR5A 1I1GA 5CIVA 3CDIA 1TWAA 1X3WB 2GOXB 1WJ5A 3GFJA 2Y3DA 5DCMA 1IN8A 2X0LA 3OA1A 2OCCH 2LY1A 1H6GA 1YVIA 5M5XJ 1SFKA 3Q9SA 4R32A 2HTJA 1X2NA 4BGDA 3PO2J 1GQAA 2E35A 3S15J 1OQYA 2FOWA 2K4BA 2VN2A 2QWWA 4E6KG 2LKSA 2O9LA 3WAQA 3Q7GA 2XLVA 2R7XA 3AG2H 5J1UA 1G3YA 2AHQA 2ZXWH 4NC8A 1XMKA 3I64A 2MD5A 2YR2A 3IUOA 1VQMI 2H7VC 4ONSA 3SYNA 1V5GA 2OTLI 3LSKA 4OAYA 2E2JJ 4DOZA 3JTGA 5FCLA 2JJ7A 4EJVA 4EM2A 4ASNA 4XN0A 2YLIA 4R8HA 3UGPA 2M7AA 2LBFA 5FFXA 2XRNA 5KAIC 3JRIA 1KQ0A 3WE2A 1JT6A 3GLLA 1OCCC 1UCRA 3CDHA 3IQCA 1TZLA 5E3MA 4LDKA 2Q0OA 3ZC4A 3HXLA 1FMVA 2W24A 4Y3OA 3MCZA 3OIOA 3JRMO 3GTOJ 3AAFA 1YJNI 3EHMA 2A3SA 4EBKA 3H5RA 1XC5A 4BHBA 3HRUA 1IF1A 4PJLA 1EH7A 1UFMA 3LSTA 2ZKZA 3MAJA 4XNFA 2PJRB 1BOBA 2KK1A 1E83A 4M74A 2VC9A 3QRFF 2LCHA 1I3AA 4KC9A 3ZQFA 3WGGA 1MQVA 3GLXA 2NPUA 5FKOA 2H27A 1TW3A 4FCYA 2UZKA 3G4XA 1A6IA 3M9AA 1IDZA 5F08A 4OIPF 1S29A 3ROUA 2IS1A 3CUOA 2JD3A 3N4MA 3HOVJ 1F4KA 1HKSA 2XIGA 1UG0A 2VT3A 4NY3A 2RNGA 4KICA 3ZRGA 5FO5A 3HKKA 3V7SA 1HXDA 1XCBA 1GVDA 1NHAA 2JA2A 2ELJA 2W25A 4E70A 2ZPAA 4I44A 4XQ1A 4HEA2 3GUDA 4MFEA 2DO7A 3M1CA 5ED4A 1R00A 1RETA 2VH3A 2A69F 4CS7A 3IQTA 3GTMJ 4IHVA 5FKNA 5TJ5E 4OIOF 3HG9A 3GZ5A 3MQ0A 4A0XA 1TP4A 4AUXA 4NC3A 4BJ5C 1PCXA 4X6AJ 4U5HA 5HDKA 2KKOA 2WZGA 1OR2A 3ML6A 5HS7A 3LFKA 2OJED 5CVIA 3H1CA 4P1WA 4CO8A 4CGZA 3CCLI 2XSEA 2GIZA 4I02A 4BXUA 3HOUJ 3AKZA 1RJ9A 2LQGA 4PR9A 2XPUA 3EPVA 2OCEA 3K9TA 2P6SA 4E7SA 2EPKX 3A0BC 5A6BD 2QQAA 5BNGA 1PDNC 3GFIA 2GLOA 5ILSA 4J7YA 1VQ6I 2CG4A 2W85A 3AGTA 1FIPA 1T6QA 3CQZJ 4HRIA 3N0TA 3ASOH 5JUAA 2COMA 3US6A 3S0XA 3U2LA 4I98B 4G12A 2W7NA 1V74B 1KONA 5E3OA 1X19A 2B7EA 1QHHD 3LAJA 4A3EJ 4AIJA 2PFBA 1DOWA 3SJMA 2IXMA 3AJMA 2LK4A 5COGA 2HQ5A 4XPXA 1FTSA 1TTYA 2XL8A 2YL0A 4EJOA 2JT1A 1KU7A 1MZBA 2R0QC 2LP0A 4RLFA 4ZTJA 2IT0A 3N2ZB 3EH2A 4ENNA 1O57A 3O6BB 2MFZA 4D5CA 2LIGA 1G3SA 1AWCA 1J8YF 2VPLA 1A31A 1UAAA 3HNLA 3CJTB 2J9WA 1IDYA 2RC4A 2EV5A 1I5ZA 3J80K 4D1QA 4YT5A 1MDMA 1WCMJ 3PCVA 1OCOC 4UUTA 1WJEA 2L7ZA 3LSJA 2W00A 3KYLA 1ENHA 3S3NA 4L0YB 1K40A 3AG4C 3LLIA 3ZXSA 1KTMA 2C6YA 5KYUA 2CUZA 4NB5A 2EJRA 2BHZA 1IUFA 4HLXA 4A0ZA 5B3SH 3R61A 3F21A 5A6KA 3EGXB 3K4BA 3BOQA 3GANA 3QAHA 1M1EB 5FZTA 1R58A 2ZC2A 4HG2A 1FR0A 2LFDA 4I01A 2A68F 1C03A 3F22A 2L0KA 3G6EI 4HSTA 3OYJA 3JW4A 3ABLH 2MGQA 3U2MA 4ZYGA 2DA7A 1GV5A 4A2UA 2ME0A 2R05A 1L3PA 1FOWA 2DQLA 3MMYB 4P96A 1QPIA 2JA7J 4YK5A 2EFNA 3CSKA 4BDYA 3OMYA 1S9HA 4YT8A 3DF8A 4U5CE 3BR6A 3CESA 5BQTA 6PAXA 2BC5A 3ZDLA 1ZAOA 4WXCA 2EBIA 1YLFA 4ZLDA 2EV6A 2W1OA 2CFXA 1GM5A 3VYWA 2AWCA 2R7ZJ 5DS4A 1C17M 3IRQA 3GXOA 2L3DA 3RKYA 3MZ8A 5FLXZ 4JE9A 4BEJA 2F48A 1KYZA 4A0YA 1VNDA 4A6EA 1WJCA 1X1PA 3HOWJ 2V9VA 1B72A 3DKYA 2ASRA 1V5EA 3VSLA 1VF9A 3EPZA 3IH4A 3OYBA 2VLAA 3K2AA 1IRZA 2W45A 4KITB 2KMUA 2EZKA 5H20A 1R23A 1YHQI 3W8IA 1BR4A 4NC7A 4E7IA 3CJRB 4BJ5A 1RUNA 3H3VK 2JA5J 1B6AA 3K4KA 4IRGA 3GMEA 3VYUB 5F0HA 4ZTFA 1HMDA 4WXHA 1LS4A 3MEXA 1VLSA 1YDIA 2P5LC 2LP4A 3ZSUA 2A6EF 2H6BA 3ABTA 1VQ5I 3P5JA 4QDLA 1Z05A 4XSZF 1MBKA 2M1BA 1XSDA 1H9GA 4CYCA 3F8FA 1V4RA 2XAJA 3BROA 1F36A 1HQCA 4GGGA 4IPAA 5F5FA 2O6GE 4NTFA 4EGYA 4A93J 1PVEA 3BT9A 1WGWA 3G1LA 4BAYA 5KYYA 1QZZA 4NTAA 3DLAA 3ECHA 3HPGA 3MLGA 4XEFA 2F4OB 1T33A 3FX3A 4PJJA 4IQ4A 3OL4A 3MD2A 4BY7J 4IO9F 1YW9A 1YW8A 2WB1A 4AM3A 1E0EA 2HXIA 1V3FA 2K9NA 4D4XA 1T6SA 2Y2ZA 3ELKA 2HVSA 4LOCA 3HLZA 3GZ6A 1IW7F 4PACA 3VOEA 3VF0A 4B47A 2L9SA 2HFHA 3T9OA 3FISA 5HLTA 5E3CA 2HXOA 2M4EA 1HKQA 2W4MA 4W97A 4LG0A 1IZMA 3E97A 1REPC 1ITYA 3TK0A 4MVUA 3BRJA 5F04A 2OG2A 2O5RA 3S1NJ 2DBBA 4XM3A 3K1PA 5CI9A 3C3WA 2VI6A 2F5FA 3MYIA 4F3QA 3AG1C 5CVRA 1R36A 3JRAA 2F4IA 3GTJJ 5E18F 1BOAA 1GLNA 5ILUA 3QW0A 2CGPA 4I0BA 2NS8A 4HDVA 3KP5A 2CNWA 1DPRA 5IOZA 1ETKA 2GA1A 1JKRC 3DU5A 2PF4E 1E2XA 4ABZA 1DUXC 1D8KA 2OJQA 1JXSA 4NCQA 4EUKB 2F4MB 4HSRA 1V5FA 5FKMA 4O5VA 1T01A 2ZMEA 2ICWG 2D1VA 1QPMA 1BR2A 3I3LA 1OJLA 3DEEA 1QQIA 4XBFA 1NFNA 2W9YA 5A69A 5AGFA 4BKXA 2YL3A 1VMAA 4XWJA 1MMAA 3L2RA 2DK5A 1YZAA 4E0HA 5EEAA 1RMVA 1V54C 5H6QA 3FAJA 1R7JA 1JUSA 1R49A 1ZK8A 4LGWA 3TO6A 2P7VB 3FHNA 4B8XA 4BQOA 3JRHA 2A5WA 3NWSA 5J1RA 1SFXA 2PP4A 3CCVI 2CUEA 3R2PA 2CV0A 2YL1A 1OYIA 5D4RA 5K0IA 4DYRA 1LPQA 2DTRA 4TV7A 1UELB 5CKTA 3T5XA 4C2MJ 1XB4A 4CCJA 2JQ7A 1MJAA 3PFYA 3W6KB 1JRAA 4BXFA 1ZZPA 2J46A 2P1AA 2DT7B 4Z2YA 1YA9A 2ESNA 5JLWA 2L2OA 4CS8C 4CDGA 5CVVA 4HF1A 1WH5A 4O79A 2YSRA 5LGNA 3K70D 3KYCB 3PMRA 2M2EA 5KYXA 1ZHTA 4BU2A 5FJ8J 2QVOA 2Z1DA 2IS2A 1P7JA 1J0RA 1J59A 4DQ2A 1FP2A 3CUQB 4JIOA 4YIRX 1XG1A 4DJAA 4BH9A 3V7OA 3FXOA 3HNJA 4O3MA 3LS1A 1U0JA 1G2HA 4MHGA 5DCFA 3E5XA 3LSRA 1VQLI 2EA2A 1JT0A 4NNJA 2M87A 3OYEA 2LF7A 4WABA 5M5YJ 2WVQA 1D0YA 2J7PA 4XKVA 3D5RC 4N0BA 3J7YJ 4ZJZA 4N4WA 3EFOB 2V1UA 3L2UA 2JA8J 2CYDA 5T3WA 4EBBA 2WZFA 2FE3A 2KL4A 1FBQA 3P7NA 5DUKA 3S3MA 2R7OA 3SFIA 1OCTC 2G3KA 3ABLC 3DAGA 4J32B 1OCCH 3ABUA 1K7AA 2V26A 4AYBN 3OS2A 2AVKA 4J19A 1H0MA 1QPUA 1RPWA 2WVNA 2JX0A 3DEUA 1ETYA 1KU3A 2P6TA 5TISC 3UMHA 5E3NA 5EG0B 4DRIB 5CI8A 3BTIA 2E1MC 3FZVA 3I5UA 1UG2A 2ECCA 1K04A 1MBHA 1USTA 1ZGJA 3FMQA 3FDYA 4XRSA 2DMPA 3WTTC 1TC3C 3AL0C 4BJ6C 4AE4A 2ZXWC 3RF3A 4UUSB 2DFEA 3AG2C 2DI3A 4W1UA 2YU9J 4HQEA 2Y48A 2ZBKA 3D5SC 3Q6NA 4IF4A 3KH2A 4GFBA 3K10A 4BDZA 1T98A 2PNOA 3JSEO 1HBXG 3ZN0A 1LDJA 4PJ0C 3B6AA 1EH6A 1W36C 2DOFA 4LG0B 3LJBA 2QCOA 3C18A 4HQMA 3KEQA 3REOA 4I1MA 3NMJA 2VIXA 2HPIA 3DTIA 1B8IA 3PDMP 5GPCA 2E19A 2ZMEB 5E79C 4C2TA 3VM6A 1XGSA 2M3AA 3DAFA 4QWQA 5EJCA 4YRVA 4AIDA 4PK4A 2A05A 1ZGWA 2HMZA 1IXCA 3LEOA 2QQ9A 2R3SA 3DBRB 3KX2A 3MKZA 2WZLA 1WOLA 5COFA 4XLAA 5AC5A 4BQAA 2KDZA 4C7OB 1Z3YA 2IBDA 1F9NA 3SYTA 3CCJI 3PUFA 2ZJ2A 3QOEA 1OKRA 3FF5A 4PGGA 2VJIA 4PSXA 4RAGA 3WE3A 4EM1A 1GDTA 5L3BA 3FIWA 5FROA 1BC7C 4L18B 1PYVA 2R7QA 2D45A 2MLGA 3FWEA 5L3QA 1S3JA 5E3AA 1K6YA 2W84A 3EUHC 3JRDA 2PEXA 1N25A 3M07A 3T6GB 1WFXA 2HR3A 3AGUA 2PX3A 3J06A 1Z77A 2XDVA 1SMYF 1Y4CA 3DE8A 1VQ7I 4JCHA 3E5QA 2M45A 1X3ZB 5HLGA 2GA0A 2ZJQF 3W2AA 4D7NA 1GS9A 4JTAB 3GTLJ 4AL0A 1SD6A 3E6DA 5KYXB 4UVCA 2ME6A 5L3GA 2H1LA 4XONA 3J7AY 2AS5F 2XROA 5KVRA 4XRSG 1E3OC 3OYGA 2E5NA 4BYYA 2EA4A 2DYSC 4XLHA 4MTFA 4DNCA 2K9QA 5E8IA 3ZPLA 3ZMUA 4KBLA 2XF6A 4F52A 4F91B 3FXLA 1FPQA 1MBJA 2NOGA 3BWGA 1PUEE 3LAPA 3V8LA 2XL4A 4HOBA 4EGZA 1P6RA 4JJGA 3WGHA 1S6LA 2EIKC 2FMLA 1ETOA 3LNQA 2MSYA 3HB9A 1FTTA 2FAPB 3M1EA 2L9VA 4ZDLA 5A2QK 2J5PA 4HNVA 2ZJPF 1Q0GA 1X4PA 2XKOA 3EQLF 3K2ZA 1K4SA 5GP9A 2XLOA 2YQYA 3EUHA 4C30A 3IWZA 4CSAA 2R5ZA 1KYWA 1JE8A 2EZIA 2X6XA 3KYJA 2GXGA 2OQGA 2Y30A 4Y13A 3V7RA 2EPFA 4MLOA 4YIIA 2L4MA 5EEHA 2L6GA 2QGUA 2K5CA 5LRRA 3VSKA 3ERED 3W6VA 2GXBA 2AWYA 1TWFJ 3V8JA 2JPUA 2IJLA 3A02A 2L6HA 1FC3A 4FESA 5JLIA 1F1ZA 1PV3A 1TFOB 1LI7A 5HVQC 1VQKI 4MEXF 1SD4A 3LQQA 2YL7A 3ESWB 2BY0A 3VDXA 3LLKA 3BJ6A 1Y6IA 2Z15A 3ASNH 5DM6F 2J0WA 3F8BA 1O3TA 2KHMA 2BXZA 3X2QH 3ZQLA 256BA 2IA0A 4AVZA 1HLVA 5LEKA 2OTJI 2DA5A 4P55A 2HYGD 4L5JA 4WWCA 3TJ6A 4JEAA 1BR1A 2X6OA 3H92A 3B0PA 3CLOA 1YITI 1QKRA 1W2WA 2WADA 3O3KA 4LK1F 1CF7A 4IQJA 3V7CA 4GYGA 4ULWA 2QKMB 2CDQA 3POVA 1JJ8C 4M9SA 3V42A 5FKLA 1BBHA 4JZAA 1AU7A 3Q0WA 5IT9K 1EA3A 5EF6A 1ZELA 4H0EA 1LJ9A 2P61A 2GIVA 2OEVA 5DQTA 3C2GA 3CLQA 1BI3A 2LKXA 4IHYA 1ON2A 1OISA 2AQFA 3I4NJ 3ZMSA 3EFOA 4U87A 1QO0D 3MKWB 5HODA 2V9PA 2YX4A 3BTLA 3LSIA 4JYKA 4YELA 4OMYA 1YJ9I 2DYSH 5DS6A 3WG7C 3BR3A 3HOZJ 1XN7A 3E6BA 1BC8C 3FM5A 3EJNA 4Y33A 4LDQA 3KZZA 1E86A 4JOMA 1O7LA 1X1AA 2E34A 2C04A 2HOAA 2PN6A 3NARA 1FYLA 4O6YA 3OOPA 4XQFA 2KNHA 3FXJA 2HVRA 2MABA 3OIQA 3FBIB 4UB6C 3QPLA 2KYHA 5LGUA 1ETVA 2NUPA 2L4AA 2WC2A 5IT3A 3BJOA 4PGHA 1Z91A 3OSFA 1MSFC 3G4SI 2E60A 2VQCA 2EIJH 2E5ZA 4HF0A 1LFBA 3JRTA 3F6OA 2MWQA 2H7OA 3U9GA 2DA3A 5M3FJ 1XSVA 3DBHB 2X1EA 2PMZN 3AG3H 1VZ0A 3DM5A 2RDPA 1OCZC 3GFMA 1O5HA 2GQQA 4HX4A 3LNMB 4E7ZA 1S7ZA 1NG6A 3SQNA 4OINF 1R5ID 3DPLC 2DCEA 1E3PA 5FFZA 4EATA 4KJZA 4MEYF 5HDNA 4CDYA 5L0GA 3LSHA 2VE9A 2OD5A 3HNKA 2LDUA 1BJZA 2P6VA 4EWCA 2HOEA 3EZHA 3LNRA 4LACB 3NYMA 4WF2A 3NYJA 1HE9A 1FP1D 1T9KA 2ZXRA 2KP6A 1A7EA 2DDBA 3DWLE 1ZKGA 1RESA 2GWRA 1Z7Qc 1QVXA 3L1PA 1FTZA 3BEHA 4IEJA 2P4WA 1XWJA 1W0UA 2DPDA 5ICFA 4YFKF 1KQ8A 3KYIA 1K6OA 5B1BC 4HLYA 2VOOA 1JR8A 5DS5A 2O8XA 1GXQA 3GEEA 4BPMA 2R02A 2CJJA 3FKIJ 4IX7A 2IRFG 2CW8A 2DB4A 2PFDA 1D5YA 3JCUC 1DP3A 1ORKA 1SD7A 3CEXA 4U7DA 1OXKA 4Z9IA 4IHTA 3GODA 4M73A 3VYRB 1WATA 1FWZA 2YX7A 1IN6A 1CF7B 4PJMA 1XMXA 4KT5C 2EPOA 3F6VA 2FJ1A 1KNYA 1J5YA 4BG0A 3E0JB 4L9VA 3EH1A 3CQZA 5A6BA 3TD7A 2RSEB 1EI7A 1LUJB 3QMKA 1YX5A 2XXAB 4P9TA 3CC7I 3JTHA 3TULA 2I10A 4PJNA 2NSGA 1SZIA 4LERA 2I15A 2KRCA 1BJAA 1M2VA 2L7KA 4ON0A 3OYHA 3PUBA 2Q7RA 3I4MJ 2D1HA 3OWTA 3JTLO 4D9JA 2HDWA 3K4CA 2TRTA 1ON1A 2I5UA 3DTKA 3S16J 4X0GA 3JRCA 1G4DA 2B0HA 1WQ2A 2IGKA 2BY1A 1FNTc 4KUMA 2XF7A 3DE9A 4A3FJ 2EIKH 3DPTA 1CPRA 5T3TA 3IEEA 1VYIA 9ANTA 4BS9A 3JT1A 2VODA 3H5AA 2EINH 1RKCA 4HA8A 1MSEC 3T6JA 2EZLA 3GWZA 4MFDA 3GTKJ 5GPAA 2BHYA 1OKKA 2O8KA 3ZCOA 4P9UA 4LK0F 4FX5A 5GTIC 1STZA 5J47A 3MKYB 4J7TA 1IRXA 2F5CA 1CGPA 4RS8A 2E1CA 2M8GX 1Z21A 2HSQA 2HJ3A 4LLCA 3I71A 4JVSA 4Z9HA 3G1OA 1MGTA 1Q0MA 3KCCA 4LB5A 2G3VA 1ST6A 1EA8A 3KE2A 2GWWA 4LLGF 3DKWA 1ZYRF 3GYHX 2A0BA 3EG9A 2CS3A 2DFFA 1LM3B 1WHUA 4L9NA 3M3YJ 1ZU4A 2ZXHA 4Q48A 3FHZA 4ZYAA 1HE1A 4M9ZA 3PIPF 2RD9A 3OYIA 4DIQA 3BR1A 1LNWA 3WHCA 3K4JA 1ZLKA 3CC2I 4JEBA 4B48A 3HPHA 2BGCA 3MZHA 1JAFA 3MZYA 3I53A 3UR3C 3I56I 2JZYA 3HSRA 1IRGA 3LMMA 4KMUX 1OCZH 3KEOA 2D4UA 1Q0FA 5IYDJ 4ER9A 3QQAA 2FXAA 2O7OA 1R4TA 1O3UA 2WTEA 2LTPA 1LVAA 3HRTA 2XM4A 1WJDA 3L00A 4II2A 4CICA 1UB9A 5KYWA 4JK1X 1U0BB 3PQKA 1LFPA 3LUTB 3SEOA 5B5EC 5L0DA 1NZEA 4LLEA 3VEPA 1TWGJ 5HDGA 4XLEA 4ETSA 3K6GA 5IY5H 3HSEA 2IPQX 2YS9A 2ZNZA 3LSGA 2Q00A 1WTYA 3S8PA 3L34A 5DS9A 1E85A 1IC8A 4JKVA 2F5EA 1Y8RB 2FUG2 2YLDA 2V79A 5LLQA 3WTSC 3LSPA 4L9TA 1ODDA 2GOMA 1IV8A 4UHTA 3TOBA 3MBGA 1W0TA 4C7OA 1K05A 3ECSA 1OFCX 1WH7A 3LEVA 3OYLA 3DM9B 2P0NA 4MTGA 3RW0A 4UVBA 1K4TA 4Y52J 2X1CA 1RRJA 1B8IB 4NTBA 2Y31A 1M2VB 5F5HA 3Q7LA 2QUFA 3P9CA 3K7DA 2RQPA 1N77A 3NQOA 4C9YA 3S2HJ 1YZCA 3WHBA 1RJ9B 3I9V2 4N9IA 4P5OA 4DXWA 2X85A 3GVAA 1GXPA 2IXOA 1ZHXA 3ZTZA 3RSNA 4UV9A 4M3GA 4CA0A 1WN0A 3PQJA 1KQ9A 3NDBB 2CRGA 3NWTA 1D8JA 1TBXA 3JYHA 1I6HJ 3T8TA 2XAGA 4E7LA 2F22A 2FNAA 4LG3A 1W5TA 3MKLA 1K78B 5FD6A 1B72B 2KRFA 3IKVA 2E87A 2R4GA 2MC3A 3ISPA 1Y8QB 4V2FA 1I1SA 1SR2A 4D4NA 4FAPB 3JAMZ 5D6FA 3NKDA 1YG2A 4AYBA 4UUSA 1Z9CA 2M9HA 3LS0A 2HZTA 1MW7A 5KYUB 4ESBA 4CIHA 4A3MJ 5T1DB 2MH9A 2UWMA 2K9LA 2VT2A 4S04A 4K7BA 4XEKA 3K0LA 1MMGA 2DMTA 2XPWA 1HW5A 2BE5F 4U5GA 2STTA 5JHFA 1ERDA 3H65A 4FETA 3PNVA 4RA2A 1QSPA 4AE4B 3C8GD 2DT6A 4I76A 3D1NI 2VC1A 4LDRA 2X4HA 3VB2A 4XRMA 2UUIA 1NH3A 4CS9C 2V1NA 3T0YA 5E3LA 2Z9OA 1Y1VJ 4WGZA 2FX0A 1I4ZA 1MNDA 1YW7A 1FY7A 1TWHA 4A69C 1N78A 4HV5A 3DZAA 1TL8A 3I5PA 1FBUA 1XGMA 3WTUC 3LWFA 3KKBA 2NVUB 4IOAF 4E7HA 4OWRB 3CCQI 2Y9ZA 3MX3A 3DJUB 3KLNA 2K27A 2DLLA 3EYYA 1WWPA 2OOCA 4ULVA 2H8RA 2K9SA 4C3IJ 2X48A 4QLCU 3OYKA 4ESJA 1IV6A 3O55A 3OY9A 3B0UX 1A35A 4MVMA 1LEAA 3D0SA 2CQXA 1G3TA 5LEJA 5DTDA 2B9SA 5K7ZA 3RKQA 3ZQCA 1VQ9I 3NYLA 3ZTMA 1A7DA 1SVOA 3DLLF 1PUFB 2D5RB 3GEIA 1Q0KA 4CJOA 4DJ9A 3AG4H 2BEOA 4A3JJ 2FFHA 2Q1ZB 2OBPA 3JSPA 2ISZA 1Q0DA 3F8NA 4RBOA 3UNGC 5JS5A 4FE7A 2RNJA 2VONA 3AFHA 4NQWA 3QTHA 1U9OA 1UG7A 3G50A 2L9NA 1JI8A 2VQGA 3GF2A 1CGNA 3E6MA 3KZIC 3IKTA 4LFUA 3DCFA 3ZN1A 4MIMA 1NSGB 1YQAA 4HAMA 2CMPA 1MIJA 3BY6A 4N06A 2ESHA 4CS9A 1I50J 2LR8A 2P8TA 3RPUD 3FK6A 3VRCA 3Q0VA 3MVPA 4MTOA 4JX4A 1O87A 3A11A 4E17A 2FBHA 5K5QA 1CQTA 3OV8A 4MVOA 5D5WB 3H0GJ 1QQ3A 2FBKA 2G0EA 2KZVA 1ZG1A 5HV9A 2XC7A 1U89A 4DBQA 3O10A 2VQHA 1XPXA 5EYRA 1R71A 3FOPA 2TCTA 4U0WA 2FQ3A 2FNPA 4FQGA 2XSJC 1ZN2A 2DW4A 3QODA 3CMYA 2BY2A 5DDGA 1XZPA 3DI5A 2VOPA 3M1CB 1SFOJ 2DOAA 2ETSA 2QF7A 3ASOC 4G0HA 4D5FA 3F23A 1NK2P 2QQBA 4IWBA 2XPVA 1OXBA 5EZHA 2HI3A 2Y3BA 4PFPA 4JTCB 2R7TA 1Y6DA 1K78A 3DXJF 4ITVA 4M6VA 3SFZA 3WTYC 1FLIA 3RFYA 2VXZA 1XZQA 2LG4A 4RAYA 4XKCA 1WJFA 2IYLD 2KQ9A 3IQ5A 3J80Z 2BY3A 3CP2A 1O3QA 3LOCA 1R4MB 4MW3A 2Z99A 2M7BA 3QPSA 3SXKA 3ZG1A 2HU9A 2M4KA 2NNNA 2BBYA 2NNYA 2JPBA 4KFCA 2YRFA 2R5ZB 1YYXA 3COAC 2NUPB 2DA6A 2A6TA 3OR2C 4KN4X 4KA4A 3RQFA 5JI6A 3VPRA 3G3ZA 3R60A 1LFUP 3M15A 2EV0A 2KGOA 4Y17A 4C3EA 1SD5A 5IPAA 1SMTA 2V6EA 5L0HA 4GYIA 1FYMA 2IVMA 2F5DA 3H3ZA 1VFCA 2GZWA 2ELKA 5B66C 2HJMA 2BV6A 1IAWA 4H54A 1WI9A 3R4KA 3AOUA 2XHKA 1ZHFA 1U6GA 1H89C 5HLHA 4A5MA 4KYWA 1APCA 1LDKB 1J75A 4XORA 5BQGA 3KLOA 1HDPA 4XLCA 1J09A 3ERMA 3BPVA 4RAZA 1YAUO 2QTVA 1JTXA 1ETXA 2ELHA 3F0CA 5CVJA 3PFIA 4XLNF 1AVOB 2WBMA 5LHIA 3R0JA 3UMIA 2EFWA 4RM2A 3E9VA 2LD5A 3S27A 3H9JA 3S93A 4JURI 4L0ZB 2HYJA 3K1MA 4PZJA 1BW5A 4EBJA 1NLXA 2L9JA 4MVRA 3MWMA 3CJNA 2EPLX 2YWAA 3CP8A 5HLIA 5JT4A 3CO6C 2PBIA 2QYOA 3SXZA 3PNYA 1YE9A 1QVUA 1OR7A 1TNTA 1JUMA 4G7ZF 1BL0A 3JRGA 2CQ7A 2IS6A 2EWNA 3QWLA 1U3EM 3S14J 2QSHX 1TWCJ 2EH3A 1OLTA 1ZG3A 2JWTA 2VBWA 3IWFA 4NDLA 3BG6A 4BEHA 3JAMK 3EDPA 2GFHA 1S7OA 1ZARA 2FA5A 2YEVA 4IJJA 1CGOA 5JP7A 3D5LA 1T5OA 5D5UB 4JX6A 4Q47A 3KPHA 4P6IC 4X1EA 5M3MJ 1EKYA 4M6YA 3K1HA 1T39A 4U9DA 4V19K 1V54H 4RDUA 2BL2A 2X1DA 1X1CA 4JX5A 3RDIA 4X0RA 4MTDA 2R92J 4V2GA 4IRHA 4IHSA 4WJ0A 4BACA 2ZSIB 2L5QA 2KQRA 3M8FA 3RKWA 4CZZA 4NC6A 5AIQA 4I6ZA 4LJZF 5BOXA 4O7GA 4RM3A 1BZ4A 2DAOA 1S7AA 2PLYA 3CF2A 4RGSA 2XM0A 1W5CC 4LLLA 1USSA 2IEKA 2XRLA 1ZH5A 1H88C 2HSBA 2ID6A 4YN0B 3UMKA 5L0IA 4YJWA 3DTEA 3B9QA 2VJ5A 2Z33A 5DLJA 3W3CA 5DM7F 2IBFA 3F47A 2XLMA 2HYFA 1FIAA 3K1IA 2K7LA 2Y0SN 1E17A 5JR3A 4G8XA 5JRAA 1JTYA 2FMYA 5GTHC 4JC7A 1OW7A 2X6YA 3BZCA 4WX9A 2YZSA 3FMRA 3WU2C 2E2IJ 4M63A 3RCOA 1MH4A 4YL1A 3I59A 2XRHA 5IP7J 4HBLA 1SFEA 2CQKA 3NRVA 1YLMA 2D2WA 2OF7A 4EQQA 3ZOBA 3S90A 2XB0X 3HIFA 3B71A 3N05A 2PG4A 1M6TA 3EHNA 3JSOA 4MVZA 3CTAA 2NG1A 3DKXA 1JUPA 1IG7A 5JVGF 2IXPA 2V1XA 2V1DA 5H2FC 4O6MA 2DA2A 1ZRCA 1WZ2A 1JKOC 3S17J 3IP4B 1O7FA 1IO2A 2ZXJA 3E70C 4QI0A 3TOMA 4H4KC 1HMOA 4CCKA 1TR2A 2R03A 1EKEA 3GTPJ 2V6CA 5TGTA 3I55I 4BNCA 3O39A 3QP6A 5F0FA 1B4AA 1JHFA 2YPRA 5FB2A 1AA7A 3S1RJ 1XX5A 1HF0A 2OA4A 1GVJA 4RBNA 2BOLA 3M8EA 4HZFA 1HA8A 1I3QJ 2PMHA 1Z3IX 1BI1A 3TEDA 4EJUA 1QRYA 3KZYA 3SXYA 2Q9AA 3ZMVA 2XGXA 3HRSA 3S28A 5DV5A 2HNHA 3OYCA 2JUGA 1RC9A 1FT9A 2KIFA 2XVCA 2DQRA 3C2BA 5IOYA 4CCMA 3HOTA 4JJFA 3SDGA 1T95A 1SEUA 2XL6A 2NYXA 2WV1A 2Y75A 2LF8A 1ETWA 5CVUA 3RQ4A 1IN4A 1XTAA 2VBZA 4BL0B 4G7OF 2YKZA 5A6JA 2WY8Q 2EFOA 2V7FA 4XSXF 1LI5A 4ZDPA 3VFZA 1JKPC 4RGRA 4K1OA 3S3OA 4B3XA 3HHHA 5HNFA 3DU6A 4KI2A 2E7XA 1MBEA 2ZO4A 5F1JA 4PCQA 2AU5A 5J8CA 1ACIA 1FX7A 1FSHA 3JCUQ 3K33A 3P9KA 1ZR2A 4B1RA 4IJAA 3H35A 2DFHA 2R7FA 2FSWA 3PJRA 4B3AA 3JZ0A 4MQVA 2LD6A 4YL3A 4E18A 3JYYA 2QBYB 2EK5A 2OV7A 3FXKA 4CIPA 5L0FA 2A6HF 2LC2A 2A5YB 2M4GA 3U2RA 2KFDA 3KIOA 1KGSA 5F1RA 1BBYA 1FFHA 1V4AA 2P81A 4HV6A 3FK7A 3H5NA 3QU3A 1RCPA 5F64A 2P0WA 3KEYA 1LE2A 3H36A 3HOSA 3IQ6A 4XK4A 3ZP5A 1APLC 4ZDOA 4DBRA 4I7HA 2W4BA 3F8MA 3NRHA 3V5XA 1Z0XA 3HGYA 5B3SC 2F2EA 4FASD 4MO7A 4JTDB 2VJ4A 2NXNB 3IH2A 4KN7X 3H9QA 3K70C 4J01A 2NVTJ 2B0JA 3ABKC 3U3FA 1VTMP 3F46A 4YL0A 3WGIA 3HJEA 1S8NA 4QPOA 1VLTA 4QTRA 3PNTA 1AEPA 2MD0A 4G94A 3OIPA 1OR7C 3ULQB 2IOQA 2ZXOA 5F0CA 1Q1HA 3K4MA 4XIDA 3EZIA 2LY2A 2O03A 3ZQIA 4XICA 1U6HA 2HV6A 5KAFC 2LBFB 3TO7A 3WTZA 2HZ8A 5EGOB 1TT5B 1UJ8A 2K86A 1J9IA 2PMUA 4I09A 5BPDA 2GAQA 3HTKC 3BTCA 3BDDA 3C8ZA 1K61A 1HSJA 3CDLA 2BXYA 4FT8A 2UUZA 5J4YA 1W1WE 4A3KJ 3PIOF 4EJWA 4ZYHA 2Q9BA 3FAPB 1G4WR 4LMYA 1FZPB 3PO3J 4A12A 5AC4A 4OIRF 1A6QA 3H2UA 3RKXA 5CQGA 2J45A 4NUBA 4NQFA 4C3JJ 3ZQHA 1X4OA 3V5ZA 2J8WA 4U5EE 2KZGA 1NBBA 5ILVA 3U5SA 3W6JB 1WSUA 5KHDA 4Y7NJ 3CCEI 4UVAA 2IW5A 1ULYA 1Y56A 1YS7A 4OU0A 4FX0A 1YRNA 4NHJA 2H6CA 3QP5A 1YA7O 5ICEA 1XDUA 1NU9C 5J3LA 2MHRA 2DODA 1U5TA 1XDSA 2WAEA 2CFOA 3QVZA 2L7AA 2V4JC 2CWEA 4B09A 2LSEA 2IA2A 4EM0B 1P92A 4O6NA 4PSWA 1R5HA 5CPRB 1T2KA 3A03A 2IXNA 3BCBA 4D0PA 1RIOH 2DJNA 3K69A 3ONQA 4M3DA 3SHFA 2CW7A 2OAZA 5CYVA 1W7PA 5K7HA 4OIQF 1RR7A 3B73A 1ZRDA 4CS8A 1ZQ3P 1YOVB 4FTHA 4MVQA 1D0XA 4YG2F 4G7HF 3L7WA 3HEFA 3TP0A 2XAHA 1QLEC 3J81Z 3HTUA 4GCVA 1YI2I 5TRDA 4BJTA 2JVHA 1YTYA 2EB7A 4M72A 1TW2A 5ICCA 1ORSC 4HEAJ 4PUSA 1X58A 2JTVA 2KW3C 5KYNA 3KL4A 3L2WA 2QE9A 1Z7UA 4Y4RA 4KISA 3TDUC 1M56C 2H7BA 3A1YA 2XLHA 4G6DA 3QVYA 1FMWA 2QBYA 3HKZN 1RKEB 3RH3A 3RIRA 2VUMJ 1FJLA 2J7PD 3GX4X 2LNBA 2WB7A 4RGXA 3MYFA 1D1CA 2KJGA 2OEXA 1VK5A 1HOMA 4U5DE 1ZREA 2R93J 2GAUA 3E6CC 2Q9CA 4JRZA 3CUQC 2PX9A 1B1BA 4AVPA 1Q1VA 1HY5A 1TFKB 3HDDA 1R1UA 5EG0A 3MFKA 3QW1A 3TGNA 2WWYA 1Z1DA 3PM1A 2F5VA 1U8BA 1MBFA 5EZGA 4LLNA 1TWGA 1Z67A 2BW3B 2DJIA 5BPIA 2KPMA 2BYVE 4LD5A 3SEQA 1VTNC 1KZHA 2JVGA 4UUVA 3HL2A 4A3CJ 3BZ6A 5L3EA 1ZR4A 1Z3XA 1DGWY 4N4OB 1RKTA 1AHDP 4Q7CA 5D92A 2W82A 3DPUA 4BUPA 5LGTA 3ZMTA 2XUBA 4A3BJ 5K5RA 2R9RB 1FFTC 1EQ1A 3ZWIA 3JR9A 5J4VA 1UHMA 4UY8I 1JGSA 3BR0A 1I4YA 3I5QA 4DZJA 5FLMJ 5A2QZ 2ZNYA 3B6CA 1OR3A 2EILH 2Q8KA 2DU9A 2AXLA 4HNUA 3ZMDA 2FQ4A 1UHWA 3IHUA 2QLAA 1BI0A 3RQGA 3ZIBA 4U9EA 4U7BA 4RD9A 4RB2C 1VOMA 4CDVA 2R7UA 5HS8A 5J40A 4DGWB 1ZTRA 4JBAA 3RTRA 2Y0SA 2AO9A 2MH2A 3H0DA 2G7UA 2CQQA 1SYQA 2QENA 3O2PE 2V3CC 1JPJA 2EFPA 2FD5A 4YFNF 3TMOA 3FDQA 1WJAA 3FHDA 1DU6A 2LVSA 3BTJA 5FD5A 3W2VA 4IAOA 4IB4A 5ICGA 4PDKA 1VB5A 3U9JA 1HCRA 4CYDA 1Z63A 3IRRA 3NAUA 3ZR8X 5A6AA 5DVWA 1XGNA 3HKZA 2HKXA 3HBLA 3RQEA 2Y0MA 3ZQQA 4RMNA 2MYSA 4JCZA 2L01A 1MDMB 3OS1A 3Q6MA 2Z3YA 5D6EA 3TDZC 2RV8A 1ZRFA 4WGYA 2HTSA 2HFIA 4AC0A 3AG1H 3WG9A 3TJ5A 2HEOA 1W7PB 1LQ1A 5B1AC 3NG1A 3GO5A 2Q2EB 1RI7A 1SF8A 4BHPA 2ECBA 2LY9A 4QI2A 1ZGAA 3V4GA 4K0DA 1GUUA 2HMQA 4N6HA 3RPQA 2ZD9A 2VL8A 3Q3SA 4AWXB 3EGDA 4FX4A 1CPQA 2L81A 2K85A 1OYWA 1OMIA 3I4UA 1B9NA 2QQ8A 3B02A 2RKHA 3S84A 5IYBJ 3HUGB 4KIBA 4L5EA 5BQHA 2DK8A 2CSOA 4AU7A 1BA5A 1PD0A 1NG1A 3DP7A 1T0FA 4XMYA 4BJ1A 1DOVA 5D5VB 4E0IA 2XGDA 3J81K 2QY9A 1JMWA 3B0VC 3L9FA 4AIKA 1VYKA 5DQZA 4M3FA 3I0TA 3ABKH 5CLSA 2EIMH 2X9DA 1QZXA 2E1MB 4UNOA 1SANA 5K1YA 2FGYA 2HKOA 3TO9A 1G4US 3J7ZI 4I3MA 2VJJA 5CJ9A 4J00A 1Z6AA 2VKVA 4ESFA 1X3UA 1DPUA 1RXQA 4GO1A 2H09A 1LPEA 2VB6A 1YJWI 1E84A 2R5YB 1IUYA 3OYNA 3NMIA 2XLEA 3LFUA 2HDDA 3IL2A 4IRUA 3DV8A 1TQIA 2X6WA 5J8FA 1OCRH 4CXFA 1HW1A 2CV1A 1T6UA 1FNNA 4UXNA 4QIWN 2WAQN 3H9GA 2JRMA 3T1BA 1UMQA 3GM1A 5FKKA 2P5KA 1SAUA 2CO5A 1GV2A 1P2FA 4I2OA 3BG9A 2NAZA 3GWNA 3E3VA 1B68A 1JOGA 1OW8A 4F92B 3RIPA 3U3BA 2DDAA 2HKVA 3X1OA 2OU2A 4M3EA 1GHCA 3R0AA 3SNHA 4FE4A 2R7SA 5E1WA 2AXTC 2OPTA 4K2EA 4UV8A 2IA1A 1S5LC 2DA4A 4BBRJ 1ZHZA 1RKEA 2PX0A 3C8GA 3BR2A 2FEZA 2L54A 1FOKA 1S05A 2I8BA 2XAQA 4M6XA 3QOPA 4UB8C 1PUFA 3K6BA 1ORYA 3HYIA 2KLOA 2DT5A 2RGVA 3OYDA 2OU6A 1YO5C 3KP4A 3F3XA 4B43A 4NQWB 1LKXA 1TQMA 5JLXA 1MJBA 4WXDA 2QKLB 3U8VA 3HC7A 2R7RA 4EHPA 3QYBA 1VQOI 3FOOA 3ZQYA 2DFIA 4MNUA 3A01A 4MW8A 2QSGX 2DTZA 2DMNA 1B9MA 3I58A 2PI0A 4EIYA 2CUFA 1BN5A 1OYYA 3L09A 3SEZA 4DZPA 4CCOA 4JW1A 3SXMA 4ZLCA 4NBQA 3CCRI 3G73A 2MW8A 1Y0UA 1CGME 2LLKA 2QZ8A 3TW7A 5TJJA 2LFBA 4B6IA 4IHWA 5C4JJ 3IAM2 5LHGA 4XLPF 1UHSA 1YIJI 4C2UA 3Q9VA 5EDNA 1DQUA 1TQPA 1LB2A 2P7CB 4IZZA 1A5JA 3DJNB 4N6CA 2DYRH 1ZU5A 2KC3A 1XGOA 2HUJA 3LA3A 1QA6A 4OOIA 3RYPA 1OQCA 4I1OB 3EETA 4BE1A 2VCBA 3TOLA 3SDBA 4KIFA 4HW0A 3S1QJ 1WGXA 1ZHYA 3EGDB 2ZXPA 4XPYA 5L0CA 2AQEA 3HHGA 4WK8F 1V55C 4BBSJ 2LREA 2DXIA 4OMZA 3W2WA 2LK2A 3AQBA 2CW0F 3BCAA 3HGGA 1KA8A 2P5VA 2VBYA 5EGYA 4DVYP 4C3HJ 2UXXA 2B63J 2M34A 1FOXA 5JFRA 4XL9A 4XPWA 1R1TA 1IRFA 1T0FC 2HGCA 3VAYA 4CHUA 3SZTA 3SZPA 1HKTA 1YYJA 2P7VA 2UUHA 3JRFA 3OOUA 3QPHA 2AP3A 4DYCA 1O3SA 1HC8A 2K4JA 1F43A 3L0IA 1TNSA 1NU7D 4CSAC 2ZFWA 1ETQA 3LQRA 1WI3A 2L6FA 4C3BA 1H9TA 2CQNA 4CZCA 2M8EA 4C3DA 1WKMA 2LMDA 2QSFX 2NS0A 4HFKB 4U5FE 1WJBA 4RB3C 5F28E 4OAZA 2M0CA 1D1AA 1MJ9A 3TP3A 3W8HA 4U0YA 5JVTA 4HX7A 1XMAA 1IXSB 1T56A 4F4BA 4WCGA 2HPMA 2H94A 5FGMA 2NS7A 3SZGA 2JMWA 2ZXIA 2G9WA 4BQQA 4F93B 2O0YA 4KT6A 4EVIA 1J8MF 4W8KA 3O6XA 2C03A 2IS4A 2GDCA 1R6RA 2LH9A 3WU1B 3F9KA 2NOJB 2JN6A 4LITA 4R1HA 4IVNA 4HNTA 3CD6I 3C8GB 3L8JA 2PQ8A 4MNDA 2Q2EA 3CZ6A 2LYCA 3U21A 4ANJA 3OYMA 1MMSA 4HE8D 4MS2A 3JSZA 5HOOA 1MMDA 1JGGA 3ZQGA 2MLKA 1VQNI 1YYVA 1L0OC 1WWXA 2JSPA 4DW6A 3QYFA 5BS6A 1IGNA 1G59A 4AK9A 3R7CA 1AOYA 4BEMJ 2KSFA 2COBA 3U1KA 2Q3TA 1RZ4A 3C7JA 1GGQA 1A04A 1FBSA 1NK3P 4MGRA 3A9CA 4MTEA 3CMAI 1QGPA 3E7LA 2EZHA 3V8KA 4KDPA 1Z23A 5L3VA 4O6JA 3K7AJ 3N24A 3C63A 3KP6A 3OYFA 3AL0B 2O9XA 4BEHB 5LRSA 2KISA 2ZMEC 3K1NA 2KDOA 1BDJB 1SFUA 3B29A 2K3PA 3FXQA 1DDNA 1SVMA 2Y3GA 5GPGB 2LOOA 2X51A 2ZFUA 3BG7A 1EF4A 1MH3A 2XKPA 3RJPA 3BZKA 1O4XA 1M57C 2QUPA 2YVKA 1PP8F 2OQMA 2LFFA 1TWCA 2RAEA 2R25A 3DBLB 3GM2A 3NMKA 1ZVZA 5DCMB 3KFWX 4CSWA 1I39A 5F27A 1PP7U 1D5VA 2K40A 5LBQA 4QSHA 3WTVC 5GAGJ 1A41A 3CCUI 5EK0A 1MNEA 1RKWA 1IXRC 1U78A 2MBFA 5D8LB 3GWLA 2L7FP 1MMNA 2IGNA 5DEQA 4BHCA 3OS0A 1ZG5A 1LS1A 2JRTA 1N1CA 4IL6C 2YHSA 2V9KA 4KNVA 2XB5A 2K02A 4P9FA 5J1YA 1QNTA 3TL4X 2M30A 3UKGA 3OR1C 3RYRA 1LIHA 2KJBA 5D5XB 1SVLA 2IAIA 4JP0A 2H1KA 1G6NA 3TKYA 3TQNA 1P7IA 1XD7A 3BJAA 3WODF 4EV0A 1EJ9A 5GAHJ 1M2OA 1QZYA 2VE8A 2DPUA 2JK3A 2TMVP 2J9UA 4CUGA 3L2VA 3DQVC 3ABMH 2PJRA 2OUMA 5KYWB 2L9RA 2FRHA 1FYKA 1HW2A 3M4BA 1AUEA 3N97A 1GT0C 2G62A 3QYEA 1U5TB 3L2QA 2HOSA 3HOXJ 5JVEA 1BM9A 2E36A 1Y0NA 3P9IA 1IN7A 2FU4A 2O3FA 2OCCC 4ZZLA 1EV7A 5AONA 1TWAJ 3BG5A 4BQNA 5BMZA 3GTQJ 3RZOJ 4GRIA 2VPRA 2L02A 3DKAA 2A1DD 2ISYA 3BP8A 4RAFA 4XRFA 2E71A 1YRNB 3WTWC 3VWBA 3OEOA 2RREA 2OZUA 2VBXA 2VKDA 4IOCF 2VKHA 2K3FA 2E7WA 4DRJB 4CCNA 1BI2A 3FXMA 2LSOA 3CCSI 2HWVA 5B3IA 2IGOA 2ADUA 3ECOA 1XCVA 4EEFG 1C02A 3GBGA 4GYTA 1RUOA 5IT9Z 2JUCA 1G5ZA 2ZSHB 5C4XJ 2GXAA 2PBEA 2XASA 2XV4S 1XS9A 2A61A 2FBIA 1V55H 3TBIA 1IJWC 2QEXI 1QHGA 5B1AH 5LFAA 1P4AA 2KIMA 3S2WA 1VQ4I 1S7EA 1ONVA 1P4XA 1S72I 4G9YA 3JREA 1FAPB 1ORJA 1FSEA 2NVXJ 1YJGA 4F7ZA 2OKUA 4CYCB 3ZMZA 2RN7A 3S1MJ 1LVKA 2KT0A 4YIFA 1P9QC 1U9NA 3RYLA 1L3LA 2VXDA 1X1DA 2NSFA 2ID3A 1F5TA 5K5OA 3SZRA 5GAEJ 2XLDA 5KYYB 3BPXA 2GBYA 3M7GA 4HFFB 2BW3A 3RZDJ 1JKQC 1LE4A 3HM5A 3RPUA 3A4CA 2HVQA 4G6QA 4FWVA 1NG7A 3T6BA 3L1MA 2VCAA 1T6IA 1QU3A 1TLHB 2H8WA 3VODA 3G1MA 2DMQA 4Z6YA 3CAXA 3OYAA 2CU7A 3DEWA 5FLXK 3L8IA 4ENKA 3ABMC 5E2QA 1K83J 1Z7LA 4ZH4F 2DOEA 4E4HA 5L3FA 5FRMA 4OD4A 4Z9JA 1MNMC 1OCPA 4IARA 4GDFA 2MG4A 2YUSA 5E8GA 1H7IA 3HSFA 2CV2A 1RNLA 4I99C 5FLVA 3MN2A 4L5IA 3S2DJ 2WA0A 3BLYA 4U5BE 4RB1A 1UFBA 2ZB9A 2PJPA 1TQGA 3U8PA 3S29A 3JRBA 1A0BA 5ERIA 2CH0A 4R79A 4CH7A 4RDAA 2WL8A 3RVYA 1KU2A 2M5WA 1K79A 3EYIA 3ATPA 3RVZA 5DYMA 1G3WA 3GZNB 4N9HA 3KYDB 2QLZA 3K4LA 3ZQVA
chains in the Genus database with same CATH topology
4OIQF 4Q5SF 4F55A 3K4NA 5D91A 2EINC 3K1IC 3ZSUA 3LMMA 2A6EF 2EILC 4CS8A 4KNWA 2K9MA 4QDLA 1D0XA 4G7HF 3C2HA 1QLEC 1WJDA 4BJTA 4II2A 2JVHA 2HV7A 4HEAJ 5KYWA 5F5FA 4PUSA 2KW3C 1LFPA 1WGWA 3SEOA 1OCRC 5KYNA 3KL4A 2WAFA 3L2WA 1NZEA 4LLEA 4KISA 4Y4RA 1M56C 4RDAA 5KYYA 2H7BA 3A1YA 4LIVA 3K6GA 4XLEA 3BC8A 3UGOA 1FMWA 3DLAA 3LSGA 3L34A 3S8PA 3HPGA 3MLGA 4J30B 3RH3A 4PJJA 2J7PD 4IQ4A 3OL4A 2FUG2 3MD2A 2WB7A 2KRHA 2WAQA 2WB1A 3A2KA 1D1CA 1E0EA 2KJGA 2CGEA 1VK5A 2XXAA 2GOMA 4U5DE 4C7OA 3ECSA 2Q9CA 2HVSA 3HLZA 3OYLA 3IAS2 3DM9B 1IW7F 3LEVA 4B47A 2L9SA 2X1CA 3FVYA 5HLTA 5E3CA 2M4EA 5BUOA 2RQQA 1M2VB 4DVZA 5F5HA 3Q7LA 2F5VA 2W4MA 3K7DA 1TWGA 1N77A 2BW3B 2DJIA 3PL8A 4C9YA 1IZMA 2KPMA 3SEQA 1RJ9B 3I9V2 2JVGA 4P5OA 2X85A 3HL2A 2OG2A 4XR6A 1ZHXA 2O5RA 1Z3XA 1DGWY 4N4OB 4XKBA 3RSNA 2IXOA 3QZCA 2W82A 4XM3A 3DPUA 5FRNA 4Q7CA 4ZC3A 4BUPA 5CI9A 4Q4ZF 4CS9C 4XKWA 4CA0A 4F3QA 3AG1C 3OL3A 3SP1A 3NDBB 2F4IA 3NWTA 1FFTC 1GLNA 3JYHA 2IGMA 4E7LA 3I5QA 2CNWA 4LG3A 5E33A 4PFOA 3LAYA 3DU5A 2PF4E 3VYTB 2Y39A 2E87A 4HNUA 5IY5C 2R4GA 4HSRA 1V5FA 4YT2A 3NKDA 4AYBA 3ZIBA 5CQEA 1BR2A 3I3LA 3LS0A 5HNHA 5HSWA 3DEEA 4LIUA 1MW7A 4U7BA 2W9YA 4RD9A 5KYUB 2Z2SB 1VOMA 4CIHA 2R7UA 1VMAA 5T1DB 4DGWB 2UWMA 4XWJA 1MMAA 2XAUA 2Y0SA 3RTRA 3L2RA 2IXSA 2K9LA 2UV1A 1V54C 3H0DA 1D0ZA 3FAJA 4K7BA 2F6CA 2V3CC 1OKKD 1JPJA 1MMGA 4BQOA 2VLAA 2WY7Q 3FHNA 1Z5ZA 2J0XA 2PP4A 2BE5F 2A5WA 3NWSA 2R7WA 5JHFA 1ERDA 4U5GA 3H65A 4FETA 2CV0A 3PNVA 3TMOA 3T4RA 1WJAA 3AG3C 2VASA 2DT6A 3FHDA 4AE4B 3FDQA 4IAOA 3W2VA 3CMMA 1N75A 1UELB 2V1NA 5CKTA 4CCJA 3DMDA 4O6MA 4C3DA 3PFYA 4O79A 4BXFA 2J46A 2EIJC 4CS8C 2DT7B 1MNDA 1Z63A 4A2NB 2Y3HA 2L2OA 1TWHA 1N78A 3ZR8X 3DZAA 3K66A 3I5PA 3HKZA 5DVWA 1YX3A 2DYRC 3KKBA 3EG9B 1G8XA 2OC6A 3ZQQA 3K70D 4E7HA 4RMNA 4OWRB 3DD7A 3PMRA 1ZHTA 4BU2A 3DJUB 5KYXA 3PHF2 2MYSA 2Z1DA 2IS2A 3LESA 3OYKA 3OY9A 3OS1A 3Q6MA 3B0UX 4BG0A 4DJAA 3V7OA 3LS1A 1U0JA 3NKEA 4NNJA 3OYEA 3NYLA 5B1AC 2WVQA 1D0YA 3NG1A 2J7PA 1PD1A 2D5RB 4XKVA 3D5RC 4G6TB 4ZJZA 5T3WA 2Q2EB 3EFOB 3L2UA 1SF8A 2FFHA 3HJCA 2Q1ZB 3LL7A 4JQFA 2WZFA 4EBBA 2G3KA 2KL4A 2J9VA 3ABLC 3UNGC 3S3MA 2R7OA 4K0DA 4J32B 3AFHA 3DAGA 1TKNA 2V26A 2VL8A 2L9NA 3OS2A 3EGDA 1JI8A 2VQGA 2WVNA 3VYSB 2L81A 3UMHA 3I4UA 5CI8A 2CMPA 2M0MA 4N06A 2E1MC 3PSIA 4CS9A 1PJRA 3HUGB 3RPUD 4AU7A 1PD0A 3FDYA 1NG1A 4GEHA 1O87A 4XMYA 4BJ1A 3AL0C 4BJ6C 4AE4A 1DGRM 2QY9A 2XF5A 2ZXWC 4AX2A 3B0VC 3AG2C 1VYKA 2KZVA 5DQZA 3X2QC 3D5SC 2XC7A 2NUTB 3Q6NA 3KH2A 4DBQA 1QZXA 2E1MB 2I8DA 2VQHA 1JPNA 3K10A 3ASNC 4BDZA 2FGYA 2XSJC 4I3MA 3QODA 3M1CB 2VJJA 1W36C 4J00A 2DOAA 1Z6AA 3G2BA 3LJBA 3FBNB 4II3A 4RLQA 3ASOC 4G0HA 4IWBA 4I1MA 4OD5A 2VB6A 3EUKL 4HPQA 2VIXA 2HPIA 3DTIA 3OYNA 4PFPA 4BE2A 2Y3BA 3KMIA 4C2TA 2R7TA 3LFUA 4EWCA 4IKFA 2M3AA 3DAFA 4ITVA 3DXJF 4IRUA 4YRVA 3RFYA 4PK4A 2X6WA 2CV1A 2HQAA 2VXZA 5KNLA 2LG4A 4XKCA 3H9GA 1WJFA 2IYLD 2KQ9A 2MC4A 4B44A 3PSFA 3KX2A 3CP2A 3ZGKA 3MKZA 2WZLA 2BVLA 1SAUA 2R7VA 1D1BA 2M7BA 4XN3A 4XLAA 2EIMC 3ZG1A 2HU9A 2M4KA 4C7OB 4F92B 1Z3YA 2W4SA 3SYTA 2DGJA 3RIPA 3QOEA 4YT4A 3X1OA 4BJ6A 2VJIA 4PSXA 2NUPB 2A6TA 3OR2C 3SNHA 2R7SA 5FROA 4CCLA 1PYVA 2R7QA 4XTKA 1ZHZA 2KGOA 5L3QA 5E3AA 4C3EA 2PX0A 3FKJA 1K6YA 2I8BA 3EUHC 2V6EA 4XOPA 2HZDA 2PMZA 1WFXA 3K6BA 2PX3A 4YEJA 3CJQB 2KLOA 3OYDA 2XDVA 1SMYF 2WVOA 4B43A 4NQWB 4JCHA 1LKXA 4QPQA 1LDKB 3W2AA 2QKLB 4XORA 3HC7A 4XLCA 2R7RA 3QYBA 4BE0A 1J09A 2Y69C 2QTVA 4CBEA 5KYXB 4XONA 5KCMA 4XLNF 3J7AY 2WBMA 3ITFA 1W36D 3UMIA 3SEZA 4RM2A 3OYGA 3E9VA 2E5NA 4CCOA 4JW1A 2DYSC 4YWQA 4ZLCA 3RKOF 3S27A 2BVMA 4XLHA 3H9JA 3E1SA 3EUAA 3S93A 4KBLA 4JURI 4QI2A 2CUJA 2XF6A 4B6IA 4F52A 4F91B 2L9JA 3IAM2 4XLPF 4N4NB 2CNWD 4C2UA 2XL4A 1DQUA 3LSMA 2VQLA 3CP8A 4E7JA 4JJGA 4IZZA 5EHHA 3AQCA 4E7KA 2EIKC 3DJNB 1ZU5A 3PNYA 1YE9A 2LRDA 4MQ9F 3ZVRA 5LD2C 4I1OB 4ZDLA 4G7ZF 4BE1A 1X4PA 3SDBA 3EQLF 2IS6A 1ZHYA 3EGDB 4C30A 3S32A 4CSAA 4BEHA 1OLTA 2ZXPA 3BG6A 2AQEA 2GFHA 1V55C 2Z16A 2LREA 2DXIA 2YEVA 4IJJA 2X6XA 3M8JA 3W2WA 1ZHWA 3AQBA 3D5LA 2CW0F 3BCAA 4XOTA 4P6IC 5EGYA 4DVYP 4MLOA 1X1BA 4XLFA 2NUTA 1TT0A 3K1HA 3VSKA 2K5CA 4XL9A 1TWAA 3EGXA 2X1DA 2GOXB 1T0FC 1X1CA 1WJ5A 2Y3DA 3OA1A 4FESA 4X0RA 2P7VA 3VAYA 4WJ0A 2LY1A 3OOUA 2ZSIB 2L5QA 5HVQC 4BACA 4YT8A 2KQRA 3VDXA 1SFKA 4O7GA 3LLKA 4RM3A 1Y6IA 4BGDA 2Z15A 3L0IA 2J0WA 3CF2A 1NU7D 4CSAC 4E6KG 4C3BA 2KHMA 3Q7GA 4CZCA 3UMKA 4AVZA 2R7XA 4YN0B 4HFKB 4U5FE 1WJBA 4NC8A 4OAZA 1D1AA 4YJWA 3DTEA 2H7VC 2VJ5A 3IUOA 3B9QA 3W3CA 3SYNA 3F47A 3W8HA 5DLJA 1V5GA 1BR1A 3B0PA 3LSKA 4OAYA 4F4BA 1W2WA 2WADA 4DOZA 2HPMA 5D92A 5FCLA 4IQJA 4ULWA 3SZGA 2ZXIA 2QKMB 2CDQA 3POVA 4XN0A 4BQQA 4KT6A 4F93B 1J8MF 3V42A 4JZAA 2M7AA 4W8KA 3O6XA 3UGPA 2LBFA 2C03A 2X6YA 2YZSA 1EA3A 2IS4A 4M63A 1ZELA 3RCOA 1R6RA 2LH9A 1OCCC 5DQTA 1TZLA 3F9KA 2XRHA 2NOJB 3HXLA 3C2GA 3ZC4A 1FMVA 4LITA 4HNTA 4Y3OA 4MNDA 2AQFA 3CZ6A 3U21A 2LYCA 4ANJA 4U87A 3OYMA 3EHMA 3MKWB 3EFOA 3N05A 4HE8D 3JSZA 3H5RA 5HOOA 1MMDA 3EHNA 2JSPA 4PJLA 4YELA 3LSIA 3QYFA 4XNFA 1G59A 2PJRB 3DKXA 2NG1A 1BOBA 4AK9A 2IXPA 3WG7C 5DS6A 4KC9A 2Q3TA 3EJNA 4Y33A 4JOMA 1X1AA 2C04A 3IP4B 3E70C 4QI0A 4O6YA 4H4KC 4XQFA 4CCKA 1TR2A 2KNHA 2HVRA 2MABA 3OIQA 3FBIB 1Z23A 5L3VA 2IS1A 4OIPF 2NUPA 2JD3A 3N24A 3OYFA 3AL0B 2O9XA 4BEHB 5TGTA 2KDOA 3O39A 2K3PA 1UG0A 2E60A 2VQCA 2Y3GA 2RNGA 2E5ZA 2LOOA 3ZRGA 4NY3A 2X51A 3JRTA 1AA7A 2JA2A 2ZFUA 3BG7A 2ELJA 2MWQA 2H7OA 2ZPAA 4I44A 1M57C 4RBNA 2BOLA 4HEA2 1HA8A 2X1EA 3DM5A 3M1CA 1VZ0A 1OCZC 1TWCA 1O5HA 1Z3IX 2A69F 2VH3A 4E7ZA 1S7ZA 4CS7A 1NG6A 2Q9AA 4OINF 3DPLC 4CSWA 3S28A 4OIOF 3HG9A 2DCEA 4BJ5C 2HNHA 1PCXA 3OYCA 1MNEA 2JUGA 4EATA 4U5HA 4KJZA 3MX3A 3HOTA 2WZGA 3LSHA 1MMNA 2IGNA 4CCMA 3OS0A 1T95A 1LS1A 4JJFA 1N1CA 3RQ4A 2YHSA 2V9KA 4BL0B 4KNVA 4G7OF 2P6VA 4P1WA 4BEJA 2WY8Q 3TL4X 2XSEA 3EZHA 3LNRA 3OR1C 1RJ9A 3AKZA 3NYMA 2V7FA 4LACB 4ZDPA 3EPVA 3NYJA 2ZXRA 3WODF 2KP6A 4B3XA 4E7SA 3S3OA 5HNFA 3DWLE 3DU6A 1M2OA 4KI2A 2J9UA 4CUGA 3L2VA 3JCUQ 3DQVC 2PJRA 2OUMA 5KYWB 4HRIA 3K33A 3N0TA 3S0XA 3H35A 2G62A 3PJRA 3QYEA 3L2QA 5B1BC 2W7NA 5DS5A 1KONA 4IX7A 1X19A 2OCCC 1QHHD 2CW8A 2PFDA 2OV7A 4BQNA 2A6HF 1DP3A 2IXMA 2LC2A 2M4GA 4GRIA 3GODA 2A1DD 3VYRB 1FTSA 1FFHA 3H5NA 4PJMA 3VWBA 3OEOA 2P0WA 3KEYA 2RREA 4RLFA 4ZTJA 3E0JB 2VKDA 3HOSA 4ZDOA 3EH1A 3EH2A 3CQZA 2VKHA 2MFZA 3N2ZB 4DBRA 3TD7A 2W4BA 3QMKA 1J8YF 4CCNA 2VPLA 3NRHA 5B3SC 4FASD 1YX5A 1UAAA 2XXAB 2J9WA 2VJ4A 4J01A 2IGOA 3K70C 3H9QA 3ABKC 2B0JA 3F46A 4D1QA 3GBGA 4YT5A 4PJNA 4GYTA 4QPOA 1SZIA 4LERA 1OCOC 2KRCA 2ZSHB 1WJEA 3PNTA 2W00A 1M2VA 2MD0A 3KYLA 2L7KA 3S3NA 3AG4C 3OIPA 1OR7C 3ZXSA 2IOQA 2ZXOA 3LLIA 3K4MA 3TBIA 3EZIA 5KYUA 2CUZA 2LY2A 3OYHA 1QHGA 3PUBA 5LFAA 3OWTA 4D9JA 2HDWA 3K4CA 2HV6A 3K4BA 3EGXB 3GANA 2LBFB 3DTKA 4HG2A 4X0GA 2A68F 2IGKA 2XF7A 1LVKA 3DPTA 5T3TA 4HSTA 3OYJA 1P9QC 3IEEA 3RYLA 1VYIA 2VXDA 1X1DA 4BS9A 3HTKC 3JT1A 3H5AA 3SZRA 2UUZA 5KYYB 4HFFB 2Q9BA 3T6JA 2BW3A 1OKKA 3MMYB 3ZCOA 4FX5A 4OIRF 3MKYB 3CSKA 3A4CA 2HVQA 4BDYA 5CQGA 2J45A 1IRXA 1S9HA 3OMYA 4NUBA 4FWVA 1X4OA 1NG7A 4LLCA 1Z21A 4U5EE 4U5CE 1QU3A 3T6BA 3CESA 4JVSA 5KHDA 3OYAA 4ZLDA 2W1OA 2G3VA 3ABMC 5E2QA 3VYWA 1Y56A 1Z7LA 1ST6A 5DS4A 4E4HA 5FRMA 4OD4A 1ZYRF 1NU9C 1WJCA 3EG9A 2CS3A 2CV2A 1ZU4A 2ZXHA 3DKYA 1V5EA 2WAEA 3VSLA 2WA0A 2CFOA 3BLYA 3EPZA 4ZYAA 3OYBA 4U5BE 2V4JC 3OYIA 2W45A 4DIQA 2KMUA 4KITB 2LSEA 3S29A 3W8IA 1BR4A 2CH0A 3K4JA 4NC7A 4CH7A 3CJRB 4R79A 4B48A 4E7IA 2WL8A 3HPHA 1KU2A 4BJ5A 4O6NA 4PSWA 5CPRB 3K4KA 4ZTFA 3VYUB 2IXNA 3BCBA 3UR3C 3ONQA 3K4LA 2CW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BJ6 C;  4BJ5 C;  4BJT A;  3CZ6 A;  3OWT A;  3K6G A; 
#chains in the Genus database with same CATH topology
 5KK1 A;  4Q5S F;  4F55 A;  1Z6R A;  2LKP A;  3K4N A;  2ETH A;  2NVY J;  3LA7 A;  5D91 A;  2EIN C;  3E5U A;  3K1I C;  2EIL C;  4KNW A;  2K9M A;  3G71 I;  1EH8 A;  1D3Y A;  2YU3 A;  3C2H A;  5L0J A;  4AD9 A;  5E1Z B;  5EGO A;  2HV7 A;  3CF5 F;  1SC7 A;  3C62 A;  3UGO A;  1BIB A;  4M71 A;  1OCR C;  2WAF A;  2QA4 I;  3OSG A;  2UXN A;  4IRI A;  4LIV A;  3BC8 A;  3RQI A;  2GM4 A;  4J30 B;  3DFG A;  1BW6 A;  1OPC A;  3HTS B;  4IAQ A;  2KRH A;  2WAQ A;  1X2M A;  3A2K A;  3M79 A;  2KIU A;  1SAX A;  2CGE A;  2JSC A;  5LHH A;  2XXA A;  2JPC A;  3R6S A;  1UZC A;  3U1D A;  4A5N A;  2XSD C;  3G4Z A;  4HX8 A;  3TOA A;  3IAS 2;  4ENM A;  3FVY A;  2XGC A;  4A3D J;  2TDX A;  2VCC A;  1FOY A;  5BUO A;  2RQQ A;  4DVZ A;  1I6X A;  3PL8 A;  1OCO H;  3GM3 A;  2J0X A;  4KNY A;  3QU6 A;  4XR6 A;  4XKB A;  2FF4 A;  2JA6 J;  2ACJ A;  1YAR O;  3CCM I;  1VQ8 I;  3I4P A;  4Q4Z F;  4ZC3 A;  5FRN A;  3QZC A;  2W48 A;  3A0H C;  4XKW A;  4S05 A;  2KJC A;  3OL3 A;  3SP1 A;  1XSX A;  4I0A A;  5B1B H;  2IGM A;  5J6X A;  3WU0 A;  1VI0 A;  2XS8 A;  1L7C A;  2EPM X;  5E33 A;  4PFO A;  2OQR A;  3LAY A;  3A01 B;  4A3L J;  1KU9 A;  1W5S A;  1DU0 A;  1U2W A;  3HUG A;  1IZ1 A;  1E3H A;  2KIQ A;  3VYT B;  4B4C A;  5D8K B;  5IP9 J;  4ZYD A;  1F1M A;  1RR8 C;  2Y39 A;  3KET A;  5IY5 C;  1WVR A;  2QM3 A;  5C3E J;  4YT2 A;  2GA2 A;  5HS9 A;  3ZQ7 A;  3FXR A;  1R4N B;  2ZJR F;  1QVT A;  5COM A;  5CQE A;  2IP2 A;  2YLG A;  2Q4F A;  5HNH A;  1IN5 A;  5L3C A;  3U9M A;  4LIU A;  4AL1 A;  2Z2S B;  1HST A;  2OZ6 A;  1P4W A;  4S0H B;  2XAU A;  1Y39 A;  3C1D A;  1TWH J;  2IXS A;  2UV1 A;  4EKW A;  3F72 A;  2DA1 A;  1D0Z A;  1WPK A;  1LDD A;  2F6C A;  3NEU A;  1Z6T A;  2BZT A;  1OKK D;  2WY7 Q;  1Z5Z A;  2R7W A;  5AIP A;  4U0V A;  3T4R A;  3AG3 C;  2VAS A;  4LB6 B;  5E20 A;  1AKH B;  3HNI A;  2R7D A;  2G7H A;  2XGE A;  1N75 A;  1ZLJ A;  3CMM A;  1OW6 A;  3RI4 A;  3IH3 A;  2O61 A;  1WAS A;  2NRA C;  4M9X A;  3DMD A;  1C0W A;  2EIJ C;  4GXO A;  4A2N B;  2Y3H A;  3K66 A;  4DRH B;  2VKE A;  2A07 F;  1MKM A;  1YX3 A;  5GAD J;  4EMS A;  3M4O J;  2DYR C;  2M64 A;  2N8G A;  3EG9 B;  1W7P D;  1G8X A;  2OC6 A;  4KIG A;  3DD7 A;  2HQN A;  3FXH A;  3PHF 2;  1JJ6 C;  2CYY A;  5D4S A;  4ENJ A;  3LES A;  4A3G J;  3KP7 A;  5C44 J;  2FOK A;  2NVQ J;  5IP6 A;  4L9J A;  4RGU A;  2HOT A;  3GEH A;  3NKE A;  4CX9 A;  3TW6 A;  4ZYE A;  1PD1 A;  4G6T B;  2D5V A;  4HDU A;  2HQR A;  3HJC A;  3BQZ A;  1NFO A;  3LL7 A;  4JQF A;  4AIH A;  3U0C A;  2J9V A;  5HSW A;  1TKN A;  1LE8 A;  3Q0U A;  5H6R A;  3VYS B;  3FXU A;  2XS1 A;  2CCY A;  5JHU A;  4KMF A;  3M4C A;  3F8C A;  2M0M A;  4Y15 A;  3TQO A;  4ZZD A;  3PSI A;  2WB1 N;  3FMS A;  2XAF A;  1QZE A;  1PJR A;  1FEX A;  3BQY A;  2L7M P;  2RVC A;  3J7A O;  4GEH A;  3CO7 C;  2XLW A;  2E1N A;  3S9O A;  1DGR M;  1ZW3 A;  3GOR A;  2XF5 A;  1Y1W J;  4A3I J;  1WRJ A;  4AX2 A;  4FHT A;  3QPT A;  4HF2 A;  3X2Q C;  3WTX C;  2NUT B;  3I54 A;  3O8H A;  2QNL A;  2I8D A;  1POG A;  5E1X A;  2MA3 A;  2HDC A;  1JPN A;  3ASN C;  3EGX A;  2E2H J;  2HS5 A;  3H3U A;  2DMU A;  1JHH A;  1MBG A;  4UDV A;  3G2B A;  5DUI A;  3L2C A;  1H8A C;  3FBN B;  4II3 A;  4RLQ A;  3BG3 A;  4OD5 A;  2J5O A;  5K7F A;  4FIS A;  3EUK L;  4HPQ A;  2VC0 A;  1O3R A;  3KMI A;  4BE2 A;  4GQH A;  3MFN A;  4IKF A;  4EJT A;  2Y9Y A;  3I59 B;  4CDA A;  2HQA A;  5L3D A;  4IGG A;  5KNL A;  3Q5F A;  2MC4 A;  4B44 A;  3PSF A;  3ZGK A;  3CME I;  2BVL A;  1LEB A;  1I5N A;  2R7V A;  1W4M A;  1D1B A;  4XN3 A;  2Z5U A;  1QBJ A;  1ZW2 A;  2EIM C;  1MD0 A;  3CCY A;  2W4S A;  2DGJ A;  3IC7 A;  4YT4 A;  4BJ6 A;  1J7K A;  3GCM A;  2IM8 A;  4CCL A;  2STW A;  2EPN A;  1B59 A;  3HOY J;  4XTK A;  1T38 A;  3H2V A;  1A36 A;  5EEG A;  3GEZ A;  3FKJ A;  3T8R A;  2WV0 A;  1R9T J;  4W8P A;  3KP3 A;  4XOP A;  2HZD A;  2J9B A;  2PMZ A;  2EQR A;  1T8I A;  4D7M A;  4A6D A;  4BY1 J;  4YEJ A;  3CJQ B;  1R1V A;  4RB0 A;  3HZJ A;  2WVO A;  1A7V A;  3W4Y A;  4U88 A;  3GW2 A;  3KP2 A;  4QPQ A;  4HYE A;  4CJG A;  1R5G A;  4XEV A;  4BE0 A;  2Y69 C;  1R22 A;  1DP7 P;  4CBE A;  1U8R A;  1AKH A;  5KCM A;  2ZCW A;  1I27 A;  3O8G A;  1W36 D;  2E1O A;  3ITF A;  3WHN A;  1YFH A;  4BXX J;  4YWQ A;  3RKO F;  3DWW A;  3LA2 A;  2BVM A;  4M3B A;  2R5Y A;  3E1S A;  3EUA A;  2CUJ A;  2EFQ A;  4DYQ A;  3FM3 A;  1HDD C;  1YS6 A;  1NTC A;  4N4N B;  2CNW D;  2Y69 H;  4IHX A;  1J2X A;  2H8A A;  3IV5 A;  3LSM A;  2VQL A;  4E7J A;  1LE8 B;  3GTG J;  5BQI A;  5EHH A;  3AQC A;  4E7K A;  5M5W J;  3HRM A;  4MQ9 F;  5F6F A;  2LRD A;  3GFL A;  2X0C A;  3V5Y A;  2DN0 A;  3ZVR A;  5LD2 C;  4IXA A;  4YFX F;  1T08 B;  3WG7 H;  3IPM O;  1U5T C;  3CC4 I;  1YIO A;  5DD4 A;  3CUQ A;  5JSL A;  3S32 A;  2W57 A;  5DD8 A;  2Z16 A;  2A0U A;  4A4A A;  4MVS A;  4G78 A;  3M8J A;  1ZHW A;  2B0L A;  1VQP I;  5IYC J;  5E17 F;  4XOT A;  1X1B A;  4XLF A;  4L6R A;  1TT0 A;  1BIA A;  2NUT A;  3BR5 A;  1I1G A;  5CIV A;  3CDI A;  1TWA A;  1X3W B;  2GOX B;  1WJ5 A;  3GFJ A;  2Y3D A;  5DCM A;  1IN8 A;  2X0L A;  3OA1 A;  2OCC H;  2LY1 A;  1H6G A;  1YVI A;  5M5X J;  1SFK A;  3Q9S A;  4R32 A;  2HTJ A;  1X2N A;  4BGD A;  3PO2 J;  1GQA A;  2E35 A;  3S15 J;  1OQY A;  2FOW A;  2K4B A;  2VN2 A;  2QWW A;  4E6K G;  2LKS A;  2O9L A;  3WAQ A;  3Q7G A;  2XLV A;  2R7X A;  3AG2 H;  5J1U A;  1G3Y A;  2AHQ A;  2ZXW H;  4NC8 A;  1XMK A;  3I64 A;  2MD5 A;  2YR2 A;  3IUO A;  1VQM I;  2H7V C;  4ONS A;  3SYN A;  1V5G A;  2OTL I;  3LSK A;  4OAY A;  2E2J J;  4DOZ A;  3JTG A;  5FCL A;  2JJ7 A;  4EJV A;  4EM2 A;  4ASN A;  4XN0 A;  2YLI A;  4R8H A;  3UGP A;  2M7A A;  2LBF A;  5FFX A;  2XRN A;  5KAI C;  3JRI A;  1KQ0 A;  3WE2 A;  1JT6 A;  3GLL A;  1OCC C;  1UCR A;  3CDH A;  3IQC A;  1TZL A;  5E3M A;  4LDK A;  2Q0O A;  3ZC4 A;  3HXL A;  1FMV A;  2W24 A;  4Y3O A;  3MCZ A;  3OIO A;  3JRM O;  3GTO J;  3AAF A;  1YJN I;  3EHM A;  2A3S A;  4EBK A;  3H5R A;  1XC5 A;  4BHB A;  3HRU A;  1IF1 A;  4PJL A;  1EH7 A;  1UFM A;  3LST A;  2ZKZ A;  3MAJ A;  4XNF A;  2PJR B;  1BOB A;  2KK1 A;  1E83 A;  4M74 A;  2VC9 A;  3QRF F;  2LCH A;  1I3A A;  4KC9 A;  3ZQF A;  3WGG A;  1MQV A;  3GLX A;  2NPU A;  5FKO A;  2H27 A;  1TW3 A;  4FCY A;  2UZK A;  3G4X A;  1A6I A;  3M9A A;  1IDZ A;  5F08 A;  4OIP F;  1S29 A;  3ROU A;  2IS1 A;  3CUO A;  2JD3 A;  3N4M A;  3HOV J;  1F4K A;  1HKS A;  2XIG A;  1UG0 A;  2VT3 A;  4NY3 A;  2RNG A;  4KIC A;  3ZRG A;  5FO5 A;  3HKK A;  3V7S A;  1HXD A;  1XCB A;  1GVD A;  1NHA A;  2JA2 A;  2ELJ A;  2W25 A;  4E70 A;  2ZPA A;  4I44 A;  4XQ1 A;  4HEA 2;  3GUD A;  4MFE A;  2DO7 A;  3M1C A;  5ED4 A;  1R00 A;  1RET A;  2VH3 A;  2A69 F;  4CS7 A;  3IQT A;  3GTM J;  4IHV A;  5FKN A;  5TJ5 E;  4OIO F;  3HG9 A;  3GZ5 A;  3MQ0 A;  4A0X A;  1TP4 A;  4AUX A;  4NC3 A;  4BJ5 C;  1PCX A;  4X6A J;  4U5H A;  5HDK A;  2KKO A;  2WZG A;  1OR2 A;  3ML6 A;  5HS7 A;  3LFK A;  2OJE D;  5CVI A;  3H1C A;  4P1W A;  4CO8 A;  4CGZ A;  3CCL I;  2XSE A;  2GIZ A;  4I02 A;  4BXU A;  3HOU J;  3AKZ A;  1RJ9 A;  2LQG A;  4PR9 A;  2XPU A;  3EPV A;  2OCE A;  3K9T A;  2P6S A;  4E7S A;  2EPK X;  3A0B C;  5A6B D;  2QQA A;  5BNG A;  1PDN C;  3GFI A;  2GLO A;  5ILS A;  4J7Y A;  1VQ6 I;  2CG4 A;  2W85 A;  3AGT A;  1FIP A;  1T6Q A;  3CQZ J;  4HRI A;  3N0T A;  3ASO H;  5JUA A;  2COM A;  3US6 A;  3S0X A;  3U2L A;  4I98 B;  4G12 A;  2W7N A;  1V74 B;  1KON A;  5E3O A;  1X19 A;  2B7E A;  1QHH D;  3LAJ A;  4A3E J;  4AIJ A;  2PFB A;  1DOW A;  3SJM A;  2IXM A;  3AJM A;  2LK4 A;  5COG A;  2HQ5 A;  4XPX A;  1FTS A;  1TTY A;  2XL8 A;  2YL0 A;  4EJO A;  2JT1 A;  1KU7 A;  1MZB A;  2R0Q C;  2LP0 A;  4RLF A;  4ZTJ A;  2IT0 A;  3N2Z B;  3EH2 A;  4ENN A;  1O57 A;  3O6B B;  2MFZ A;  4D5C A;  2LIG A;  1G3S A;  1AWC A;  1J8Y F;  2VPL A;  1A31 A;  1UAA A;  3HNL A;  3CJT B;  2J9W A;  1IDY A;  2RC4 A;  2EV5 A;  1I5Z A;  3J80 K;  4D1Q A;  4YT5 A;  1MDM A;  1WCM J;  3PCV A;  1OCO C;  4UUT A;  1WJE A;  2L7Z A;  3LSJ A;  2W00 A;  3KYL A;  1ENH A;  3S3N A;  4L0Y B;  1K40 A;  3AG4 C;  3LLI A;  3ZXS A;  1KTM A;  2C6Y A;  5KYU A;  2CUZ A;  4NB5 A;  2EJR A;  2BHZ A;  1IUF A;  4HLX A;  4A0Z A;  5B3S H;  3R61 A;  3F21 A;  5A6K A;  3EGX B;  3K4B A;  3BOQ A;  3GAN A;  3QAH A;  1M1E B;  5FZT A;  1R58 A;  2ZC2 A;  4HG2 A;  1FR0 A;  2LFD A;  4I01 A;  2A68 F;  1C03 A;  3F22 A;  2L0K A;  3G6E I;  4HST A;  3OYJ A;  3JW4 A;  3ABL H;  2MGQ A;  3U2M A;  4ZYG A;  2DA7 A;  1GV5 A;  4A2U A;  2ME0 A;  2R05 A;  1L3P A;  1FOW A;  2DQL A;  3MMY B;  4P96 A;  1QPI A;  2JA7 J;  4YK5 A;  2EFN A;  3CSK A;  4BDY A;  3OMY A;  1S9H A;  4YT8 A;  3DF8 A;  4U5C E;  3BR6 A;  3CES A;  5BQT A;  6PAX A;  2BC5 A;  3ZDL A;  1ZAO A;  4WXC A;  2EBI A;  1YLF A;  4ZLD A;  2EV6 A;  2W1O A;  2CFX A;  1GM5 A;  3VYW A;  2AWC A;  2R7Z J;  5DS4 A;  1C17 M;  3IRQ A;  3GXO A;  2L3D A;  3RKY A;  3MZ8 A;  5FLX Z;  4JE9 A;  4BEJ A;  2F48 A;  1KYZ A;  4A0Y A;  1VND A;  4A6E A;  1WJC A;  1X1P A;  3HOW J;  2V9V A;  1B72 A;  3DKY A;  2ASR A;  1V5E A;  3VSL A;  1VF9 A;  3EPZ A;  3IH4 A;  3OYB A;  2VLA A;  3K2A A;  1IRZ A;  2W45 A;  4KIT B;  2KMU A;  2EZK A;  5H20 A;  1R23 A;  1YHQ I;  3W8I A;  1BR4 A;  4NC7 A;  4E7I A;  3CJR B;  4BJ5 A;  1RUN A;  3H3V K;  2JA5 J;  1B6A A;  3K4K A;  4IRG A;  3GME A;  3VYU B;  5F0H A;  4ZTF A;  1HMD A;  4WXH A;  1LS4 A;  3MEX A;  1VLS A;  1YDI A;  2P5L C;  2LP4 A;  3ZSU A;  2A6E F;  2H6B A;  3ABT A;  1VQ5 I;  3P5J A;  4QDL A;  1Z05 A;  4XSZ F;  1MBK A;  2M1B A;  1XSD A;  1H9G A;  4CYC A;  3F8F A;  1V4R A;  2XAJ A;  3BRO A;  1F36 A;  1HQC A;  4GGG A;  4IPA A;  5F5F A;  2O6G E;  4NTF A;  4EGY A;  4A93 J;  1PVE A;  3BT9 A;  1WGW A;  3G1L A;  4BAY A;  5KYY A;  1QZZ A;  4NTA A;  3DLA A;  3ECH A;  3HPG A;  3MLG A;  4XEF A;  2F4O B;  1T33 A;  3FX3 A;  4PJJ A;  4IQ4 A;  3OL4 A;  3MD2 A;  4BY7 J;  4IO9 F;  1YW9 A;  1YW8 A;  2WB1 A;  4AM3 A;  1E0E A;  2HXI A;  1V3F A;  2K9N A;  4D4X A;  1T6S A;  2Y2Z A;  3ELK A;  2HVS A;  4LOC A;  3HLZ A;  3GZ6 A;  1IW7 F;  4PAC A;  3VOE A;  3VF0 A;  4B47 A;  2L9S A;  2HFH A;  3T9O A;  3FIS A;  5HLT A;  5E3C A;  2HXO A;  2M4E A;  1HKQ A;  2W4M A;  4W97 A;  4LG0 A;  1IZM A;  3E97 A;  1REP C;  1ITY A;  3TK0 A;  4MVU A;  3BRJ A;  5F04 A;  2OG2 A;  2O5R A;  3S1N J;  2DBB A;  4XM3 A;  3K1P A;  5CI9 A;  3C3W A;  2VI6 A;  2F5F A;  3MYI A;  4F3Q A;  3AG1 C;  5CVR A;  1R36 A;  3JRA A;  2F4I A;  3GTJ J;  5E18 F;  1BOA A;  1GLN A;  5ILU A;  3QW0 A;  2CGP A;  4I0B A;  2NS8 A;  4HDV A;  3KP5 A;  2CNW A;  1DPR A;  5IOZ A;  1ETK A;  2GA1 A;  1JKR C;  3DU5 A;  2PF4 E;  1E2X A;  4ABZ A;  1DUX C;  1D8K A;  2OJQ A;  1JXS A;  4NCQ A;  4EUK B;  2F4M B;  4HSR A;  1V5F A;  5FKM A;  4O5V A;  1T01 A;  2ZME A;  2ICW G;  2D1V A;  1QPM A;  1BR2 A;  3I3L A;  1OJL A;  3DEE A;  1QQI A;  4XBF A;  1NFN A;  2W9Y A;  5A69 A;  5AGF A;  4BKX A;  2YL3 A;  1VMA A;  4XWJ A;  1MMA A;  3L2R A;  2DK5 A;  1YZA A;  4E0H A;  5EEA A;  1RMV A;  1V54 C;  5H6Q A;  3FAJ A;  1R7J A;  1JUS A;  1R49 A;  1ZK8 A;  4LGW A;  3TO6 A;  2P7V B;  3FHN A;  4B8X A;  4BQO A;  3JRH A;  2A5W A;  3NWS A;  5J1R A;  1SFX A;  2PP4 A;  3CCV I;  2CUE A;  3R2P A;  2CV0 A;  2YL1 A;  1OYI A;  5D4R A;  5K0I A;  4DYR A;  1LPQ A;  2DTR A;  4TV7 A;  1UEL B;  5CKT A;  3T5X A;  4C2M J;  1XB4 A;  4CCJ A;  2JQ7 A;  1MJA A;  3PFY A;  3W6K B;  1JRA A;  4BXF A;  1ZZP A;  2J46 A;  2P1A A;  2DT7 B;  4Z2Y A;  1YA9 A;  2ESN A;  5JLW A;  2L2O A;  4CS8 C;  4CDG A;  5CVV A;  4HF1 A;  1WH5 A;  4O79 A;  2YSR A;  5LGN A;  3K70 D;  3KYC B;  3PMR A;  2M2E A;  5KYX A;  1ZHT A;  4BU2 A;  5FJ8 J;  2QVO A;  2Z1D A;  2IS2 A;  1P7J A;  1J0R A;  1J59 A;  4DQ2 A;  1FP2 A;  3CUQ B;  4JIO A;  4YIR X;  1XG1 A;  4DJA A;  4BH9 A;  3V7O A;  3FXO A;  3HNJ A;  4O3M A;  3LS1 A;  1U0J A;  1G2H A;  4MHG A;  5DCF A;  3E5X A;  3LSR A;  1VQL I;  2EA2 A;  1JT0 A;  4NNJ A;  2M87 A;  3OYE A;  2LF7 A;  4WAB A;  5M5Y J;  2WVQ A;  1D0Y A;  2J7P A;  4XKV A;  3D5R C;  4N0B A;  3J7Y J;  4ZJZ A;  4N4W A;  3EFO B;  2V1U A;  3L2U A;  2JA8 J;  2CYD A;  5T3W A;  4EBB A;  2WZF A;  2FE3 A;  2KL4 A;  1FBQ A;  3P7N A;  5DUK A;  3S3M A;  2R7O A;  3SFI A;  1OCT C;  2G3K A;  3ABL C;  3DAG A;  4J32 B;  1OCC H;  3ABU A;  1K7A A;  2V26 A;  4AYB N;  3OS2 A;  2AVK A;  4J19 A;  1H0M A;  1QPU A;  1RPW A;  2WVN A;  2JX0 A;  3DEU A;  1ETY A;  1KU3 A;  2P6T A;  5TIS C;  3UMH A;  5E3N A;  5EG0 B;  4DRI B;  5CI8 A;  3BTI A;  2E1M C;  3FZV A;  3I5U A;  1UG2 A;  2ECC A;  1K04 A;  1MBH A;  1UST A;  1ZGJ A;  3FMQ A;  3FDY A;  4XRS A;  2DMP A;  3WTT C;  1TC3 C;  3AL0 C;  4BJ6 C;  4AE4 A;  2ZXW C;  3RF3 A;  4UUS B;  2DFE A;  3AG2 C;  2DI3 A;  4W1U A;  2YU9 J;  4HQE A;  2Y48 A;  2ZBK A;  3D5S C;  3Q6N A;  4IF4 A;  3KH2 A;  4GFB A;  3K10 A;  4BDZ A;  1T98 A;  2PNO A;  3JSE O;  1HBX G;  3ZN0 A;  1LDJ A;  4PJ0 C;  3B6A A;  1EH6 A;  1W36 C;  2DOF A;  4LG0 B;  3LJB A;  2QCO A;  3C18 A;  4HQM A;  3KEQ A;  3REO A;  4I1M A;  3NMJ A;  2VIX A;  2HPI A;  3DTI A;  1B8I A;  3PDM P;  5GPC A;  2E19 A;  2ZME B;  5E79 C;  4C2T A;  3VM6 A;  1XGS A;  2M3A A;  3DAF A;  4QWQ A;  5EJC A;  4YRV A;  4AID A;  4PK4 A;  2A05 A;  1ZGW A;  2HMZ A;  1IXC A;  3LEO A;  2QQ9 A;  2R3S A;  3DBR B;  3KX2 A;  3MKZ A;  2WZL A;  1WOL A;  5COF A;  4XLA A;  5AC5 A;  4BQA A;  2KDZ A;  4C7O B;  1Z3Y A;  2IBD A;  1F9N A;  3SYT A;  3CCJ I;  3PUF A;  2ZJ2 A;  3QOE A;  1OKR A;  3FF5 A;  4PGG A;  2VJI A;  4PSX A;  4RAG A;  3WE3 A;  4EM1 A;  1GDT A;  5L3B A;  3FIW A;  5FRO A;  1BC7 C;  4L18 B;  1PYV A;  2R7Q A;  2D45 A;  2MLG A;  3FWE A;  5L3Q A;  1S3J A;  5E3A A;  1K6Y A;  2W84 A;  3EUH C;  3JRD A;  2PEX A;  1N25 A;  3M07 A;  3T6G B;  1WFX A;  2HR3 A;  3AGU A;  2PX3 A;  3J06 A;  1Z77 A;  2XDV A;  1SMY F;  1Y4C A;  3DE8 A;  1VQ7 I;  4JCH A;  3E5Q A;  2M45 A;  1X3Z B;  5HLG A;  2GA0 A;  2ZJQ F;  3W2A A;  4D7N A;  1GS9 A;  4JTA B;  3GTL J;  4AL0 A;  1SD6 A;  3E6D A;  5KYX B;  4UVC A;  2ME6 A;  5L3G A;  2H1L A;  4XON A;  3J7A Y;  2AS5 F;  2XRO A;  5KVR A;  4XRS G;  1E3O C;  3OYG A;  2E5N A;  4BYY A;  2EA4 A;  2DYS C;  4XLH A;  4MTF A;  4DNC A;  2K9Q A;  5E8I A;  3ZPL A;  3ZMU A;  4KBL A;  2XF6 A;  4F52 A;  4F91 B;  3FXL A;  1FPQ A;  1MBJ A;  2NOG A;  3BWG A;  1PUE E;  3LAP A;  3V8L A;  2XL4 A;  4HOB A;  4EGZ A;  1P6R A;  4JJG A;  3WGH A;  1S6L A;  2EIK C;  2FML A;  1ETO A;  3LNQ A;  2MSY A;  3HB9 A;  1FTT A;  2FAP B;  3M1E A;  2L9V A;  4ZDL A;  5A2Q K;  2J5P A;  4HNV A;  2ZJP F;  1Q0G A;  1X4P A;  2XKO A;  3EQL F;  3K2Z A;  1K4S A;  5GP9 A;  2XLO A;  2YQY A;  3EUH A;  4C30 A;  3IWZ A;  4CSA A;  2R5Z A;  1KYW A;  1JE8 A;  2EZI A;  2X6X A;  3KYJ A;  2GXG A;  2OQG A;  2Y30 A;  4Y13 A;  3V7R A;  2EPF A;  4MLO A;  4YII A;  2L4M A;  5EEH A;  2L6G A;  2QGU A;  2K5C A;  5LRR A;  3VSK A;  3ERE D;  3W6V A;  2GXB A;  2AWY A;  1TWF J;  3V8J A;  2JPU A;  2IJL A;  3A02 A;  2L6H A;  1FC3 A;  4FES A;  5JLI A;  1F1Z A;  1PV3 A;  1TFO B;  1LI7 A;  5HVQ C;  1VQK I;  4MEX F;  1SD4 A;  3LQQ A;  2YL7 A;  3ESW B;  2BY0 A;  3VDX A;  3LLK A;  3BJ6 A;  1Y6I A;  2Z15 A;  3ASN H;  5DM6 F;  2J0W A;  3F8B A;  1O3T A;  2KHM A;  2BXZ A;  3X2Q H;  3ZQL A;  256B A;  2IA0 A;  4AVZ A;  1HLV A;  5LEK A;  2OTJ I;  2DA5 A;  4P55 A;  2HYG D;  4L5J A;  4WWC A;  3TJ6 A;  4JEA A;  1BR1 A;  2X6O A;  3H92 A;  3B0P A;  3CLO A;  1YIT I;  1QKR A;  1W2W A;  2WAD A;  3O3K A;  4LK1 F;  1CF7 A;  4IQJ A;  3V7C A;  4GYG A;  4ULW A;  2QKM B;  2CDQ A;  3POV A;  1JJ8 C;  4M9S A;  3V42 A;  5FKL A;  1BBH A;  4JZA A;  1AU7 A;  3Q0W A;  5IT9 K;  1EA3 A;  5EF6 A;  1ZEL A;  4H0E A;  1LJ9 A;  2P61 A;  2GIV A;  2OEV A;  5DQT A;  3C2G A;  3CLQ A;  1BI3 A;  2LKX A;  4IHY A;  1ON2 A;  1OIS A;  2AQF A;  3I4N J;  3ZMS A;  3EFO A;  4U87 A;  1QO0 D;  3MKW B;  5HOD A;  2V9P A;  2YX4 A;  3BTL A;  3LSI A;  4JYK A;  4YEL A;  4OMY A;  1YJ9 I;  2DYS H;  5DS6 A;  3WG7 C;  3BR3 A;  3HOZ J;  1XN7 A;  3E6B A;  1BC8 C;  3FM5 A;  3EJN A;  4Y33 A;  4LDQ A;  3KZZ A;  1E86 A;  4JOM A;  1O7L A;  1X1A A;  2E34 A;  2C04 A;  2HOA A;  2PN6 A;  3NAR A;  1FYL A;  4O6Y A;  3OOP A;  4XQF A;  2KNH A;  3FXJ A;  2HVR A;  2MAB A;  3OIQ A;  3FBI B;  4UB6 C;  3QPL A;  2KYH A;  5LGU A;  1ETV A;  2NUP A;  2L4A A;  2WC2 A;  5IT3 A;  3BJO A;  4PGH A;  1Z91 A;  3OSF A;  1MSF C;  3G4S I;  2E60 A;  2VQC A;  2EIJ H;  2E5Z A;  4HF0 A;  1LFB A;  3JRT A;  3F6O A;  2MWQ A;  2H7O A;  3U9G A;  2DA3 A;  5M3F J;  1XSV A;  3DBH B;  2X1E A;  2PMZ N;  3AG3 H;  1VZ0 A;  3DM5 A;  2RDP A;  1OCZ C;  3GFM A;  1O5H A;  2GQQ A;  4HX4 A;  3LNM B;  4E7Z A;  1S7Z A;  1NG6 A;  3SQN A;  4OIN F;  1R5I D;  3DPL C;  2DCE A;  1E3P A;  5FFZ A;  4EAT A;  4KJZ A;  4MEY F;  5HDN A;  4CDY A;  5L0G A;  3LSH A;  2VE9 A;  2OD5 A;  3HNK A;  2LDU A;  1BJZ A;  2P6V A;  4EWC A;  2HOE A;  3EZH A;  3LNR A;  4LAC B;  3NYM A;  4WF2 A;  3NYJ A;  1HE9 A;  1FP1 D;  1T9K A;  2ZXR A;  2KP6 A;  1A7E A;  2DDB A;  3DWL E;  1ZKG A;  1RES A;  2GWR A;  1Z7Q c;  1QVX A;  3L1P A;  1FTZ A;  3BEH A;  4IEJ A;  2P4W A;  1XWJ A;  1W0U A;  2DPD A;  5ICF A;  4YFK F;  1KQ8 A;  3KYI A;  1K6O A;  5B1B C;  4HLY A;  2VOO A;  1JR8 A;  5DS5 A;  2O8X A;  1GXQ A;  3GEE A;  4BPM A;  2R02 A;  2CJJ A;  3FKI J;  4IX7 A;  2IRF G;  2CW8 A;  2DB4 A;  2PFD A;  1D5Y A;  3JCU C;  1DP3 A;  1ORK A;  1SD7 A;  3CEX A;  4U7D A;  1OXK A;  4Z9I A;  4IHT A;  3GOD A;  4M73 A;  3VYR B;  1WAT A;  1FWZ A;  2YX7 A;  1IN6 A;  1CF7 B;  4PJM A;  1XMX A;  4KT5 C;  2EPO A;  3F6V A;  2FJ1 A;  1KNY A;  1J5Y A;  4BG0 A;  3E0J B;  4L9V A;  3EH1 A;  3CQZ A;  5A6B A;  3TD7 A;  2RSE B;  1EI7 A;  1LUJ B;  3QMK A;  1YX5 A;  2XXA B;  4P9T A;  3CC7 I;  3JTH A;  3TUL A;  2I10 A;  4PJN A;  2NSG A;  1SZI A;  4LER A;  2I15 A;  2KRC A;  1BJA A;  1M2V A;  2L7K A;  4ON0 A;  3OYH A;  3PUB A;  2Q7R A;  3I4M J;  2D1H A;  3OWT A;  3JTL O;  4D9J A;  2HDW A;  3K4C A;  2TRT A;  1ON1 A;  2I5U A;  3DTK A;  3S16 J;  4X0G A;  3JRC A;  1G4D A;  2B0H A;  1WQ2 A;  2IGK A;  2BY1 A;  1FNT c;  4KUM A;  2XF7 A;  3DE9 A;  4A3F J;  2EIK H;  3DPT A;  1CPR A;  5T3T A;  3IEE A;  1VYI A;  9ANT A;  4BS9 A;  3JT1 A;  2VOD A;  3H5A A;  2EIN H;  1RKC A;  4HA8 A;  1MSE C;  3T6J A;  2EZL A;  3GWZ A;  4MFD A;  3GTK J;  5GPA A;  2BHY A;  1OKK A;  2O8K A;  3ZCO A;  4P9U A;  4LK0 F;  4FX5 A;  5GTI C;  1STZ A;  5J47 A;  3MKY B;  4J7T A;  1IRX A;  2F5C A;  1CGP A;  4RS8 A;  2E1C A;  2M8G X;  1Z21 A;  2HSQ A;  2HJ3 A;  4LLC A;  3I71 A;  4JVS A;  4Z9H A;  3G1O A;  1MGT A;  1Q0M A;  3KCC A;  4LB5 A;  2G3V A;  1ST6 A;  1EA8 A;  3KE2 A;  2GWW A;  4LLG F;  3DKW A;  1ZYR F;  3GYH X;  2A0B A;  3EG9 A;  2CS3 A;  2DFF A;  1LM3 B;  1WHU A;  4L9N A;  3M3Y J;  1ZU4 A;  2ZXH A;  4Q48 A;  3FHZ A;  4ZYA A;  1HE1 A;  4M9Z A;  3PIP F;  2RD9 A;  3OYI A;  4DIQ A;  3BR1 A;  1LNW A;  3WHC A;  3K4J A;  1ZLK A;  3CC2 I;  4JEB A;  4B48 A;  3HPH A;  2BGC A;  3MZH A;  1JAF A;  3MZY A;  3I53 A;  3UR3 C;  3I56 I;  2JZY A;  3HSR A;  1IRG A;  3LMM A;  4KMU X;  1OCZ H;  3KEO A;  2D4U A;  1Q0F A;  5IYD J;  4ER9 A;  3QQA A;  2FXA A;  2O7O A;  1R4T A;  1O3U A;  2WTE A;  2LTP A;  1LVA A;  3HRT A;  2XM4 A;  1WJD A;  3L00 A;  4II2 A;  4CIC A;  1UB9 A;  5KYW A;  4JK1 X;  1U0B B;  3PQK A;  1LFP A;  3LUT B;  3SEO A;  5B5E C;  5L0D A;  1NZE A;  4LLE A;  3VEP A;  1TWG J;  5HDG A;  4XLE A;  4ETS A;  3K6G A;  5IY5 H;  3HSE A;  2IPQ X;  2YS9 A;  2ZNZ A;  3LSG A;  2Q00 A;  1WTY A;  3S8P A;  3L34 A;  5DS9 A;  1E85 A;  1IC8 A;  4JKV A;  2F5E A;  1Y8R B;  2FUG 2;  2YLD A;  2V79 A;  5LLQ A;  3WTS C;  3LSP A;  4L9T A;  1ODD A;  2GOM A;  1IV8 A;  4UHT A;  3TOB A;  3MBG A;  1W0T A;  4C7O A;  1K05 A;  3ECS A;  1OFC X;  1WH7 A;  3LEV A;  3OYL A;  3DM9 B;  2P0N A;  4MTG A;  3RW0 A;  4UVB A;  1K4T A;  4Y52 J;  2X1C A;  1RRJ A;  1B8I B;  4NTB A;  2Y31 A;  1M2V B;  5F5H A;  3Q7L A;  2QUF A;  3P9C A;  3K7D A;  2RQP A;  1N77 A;  3NQO A;  4C9Y A;  3S2H J;  1YZC A;  3WHB A;  1RJ9 B;  3I9V 2;  4N9I A;  4P5O A;  4DXW A;  2X85 A;  3GVA A;  1GXP A;  2IXO A;  1ZHX A;  3ZTZ A;  3RSN A;  4UV9 A;  4M3G A;  4CA0 A;  1WN0 A;  3PQJ A;  1KQ9 A;  3NDB B;  2CRG A;  3NWT A;  1D8J A;  1TBX A;  3JYH A;  1I6H J;  3T8T A;  2XAG A;  4E7L A;  2F22 A;  2FNA A;  4LG3 A;  1W5T A;  3MKL A;  1K78 B;  5FD6 A;  1B72 B;  2KRF A;  3IKV A;  2E87 A;  2R4G A;  2MC3 A;  3ISP A;  1Y8Q B;  4V2F A;  1I1S A;  1SR2 A;  4D4N A;  4FAP B;  3JAM Z;  5D6F A;  3NKD A;  1YG2 A;  4AYB A;  4UUS A;  1Z9C A;  2M9H A;  3LS0 A;  2HZT A;  1MW7 A;  5KYU B;  4ESB A;  4CIH A;  4A3M J;  5T1D B;  2MH9 A;  2UWM A;  2K9L A;  2VT2 A;  4S04 A;  4K7B A;  4XEK A;  3K0L A;  1MMG A;  2DMT A;  2XPW A;  1HW5 A;  2BE5 F;  4U5G A;  2STT A;  5JHF A;  1ERD A;  3H65 A;  4FET A;  3PNV A;  4RA2 A;  1QSP A;  4AE4 B;  3C8G D;  2DT6 A;  4I76 A;  3D1N I;  2VC1 A;  4LDR A;  2X4H A;  3VB2 A;  4XRM A;  2UUI A;  1NH3 A;  4CS9 C;  2V1N A;  3T0Y A;  5E3L A;  2Z9O A;  1Y1V J;  4WGZ A;  2FX0 A;  1I4Z A;  1MND A;  1YW7 A;  1FY7 A;  1TWH A;  4A69 C;  1N78 A;  4HV5 A;  3DZA A;  1TL8 A;  3I5P A;  1FBU A;  1XGM A;  3WTU C;  3LWF A;  3KKB A;  2NVU B;  4IOA F;  4E7H A;  4OWR B;  3CCQ I;  2Y9Z A;  3MX3 A;  3DJU B;  3KLN A;  2K27 A;  2DLL A;  3EYY A;  1WWP A;  2OOC A;  4ULV A;  2H8R A;  2K9S A;  4C3I J;  2X48 A;  4QLC U;  3OYK A;  4ESJ A;  1IV6 A;  3O55 A;  3OY9 A;  3B0U X;  1A35 A;  4MVM A;  1LEA A;  3D0S A;  2CQX A;  1G3T A;  5LEJ A;  5DTD A;  2B9S A;  5K7Z A;  3RKQ A;  3ZQC A;  1VQ9 I;  3NYL A;  3ZTM A;  1A7D A;  1SVO A;  3DLL F;  1PUF B;  2D5R B;  3GEI A;  1Q0K A;  4CJO A;  4DJ9 A;  3AG4 H;  2BEO A;  4A3J J;  2FFH A;  2Q1Z B;  2OBP A;  3JSP A;  2ISZ A;  1Q0D A;  3F8N A;  4RBO A;  3UNG C;  5JS5 A;  4FE7 A;  2RNJ A;  2VON A;  3AFH A;  4NQW A;  3QTH A;  1U9O A;  1UG7 A;  3G50 A;  2L9N A;  1JI8 A;  2VQG A;  3GF2 A;  1CGN A;  3E6M A;  3KZI C;  3IKT A;  4LFU A;  3DCF A;  3ZN1 A;  4MIM A;  1NSG B;  1YQA A;  4HAM A;  2CMP A;  1MIJ A;  3BY6 A;  4N06 A;  2ESH A;  4CS9 A;  1I50 J;  2LR8 A;  2P8T A;  3RPU D;  3FK6 A;  3VRC A;  3Q0V A;  3MVP A;  4MTO A;  4JX4 A;  1O87 A;  3A11 A;  4E17 A;  2FBH A;  5K5Q A;  1CQT A;  3OV8 A;  4MVO A;  5D5W B;  3H0G J;  1QQ3 A;  2FBK A;  2G0E A;  2KZV A;  1ZG1 A;  5HV9 A;  2XC7 A;  1U89 A;  4DBQ A;  3O10 A;  2VQH A;  1XPX A;  5EYR A;  1R71 A;  3FOP A;  2TCT A;  4U0W A;  2FQ3 A;  2FNP A;  4FQG A;  2XSJ C;  1ZN2 A;  2DW4 A;  3QOD A;  3CMY A;  2BY2 A;  5DDG A;  1XZP A;  3DI5 A;  2VOP A;  3M1C B;  1SFO J;  2DOA A;  2ETS A;  2QF7 A;  3ASO C;  4G0H A;  4D5F A;  3F23 A;  1NK2 P;  2QQB A;  4IWB A;  2XPV A;  1OXB A;  5EZH A;  2HI3 A;  2Y3B A;  4PFP A;  4JTC B;  2R7T A;  1Y6D A;  1K78 A;  3DXJ F;  4ITV A;  4M6V A;  3SFZ A;  3WTY C;  1FLI A;  3RFY A;  2VXZ A;  1XZQ A;  2LG4 A;  4RAY A;  4XKC A;  1WJF A;  2IYL D;  2KQ9 A;  3IQ5 A;  3J80 Z;  2BY3 A;  3CP2 A;  1O3Q A;  3LOC A;  1R4M B;  4MW3 A;  2Z99 A;  2M7B A;  3QPS A;  3SXK A;  3ZG1 A;  2HU9 A;  2M4K A;  2NNN A;  2BBY A;  2NNY A;  2JPB A;  4KFC A;  2YRF A;  2R5Z B;  1YYX A;  3COA C;  2NUP B;  2DA6 A;  2A6T A;  3OR2 C;  4KN4 X;  4KA4 A;  3RQF A;  5JI6 A;  3VPR A;  3G3Z A;  3R60 A;  1LFU P;  3M15 A;  2EV0 A;  2KGO A;  4Y17 A;  4C3E A;  1SD5 A;  5IPA A;  1SMT A;  2V6E A;  5L0H A;  4GYI A;  1FYM A;  2IVM A;  2F5D A;  3H3Z A;  1VFC A;  2GZW A;  2ELK A;  5B66 C;  2HJM A;  2BV6 A;  1IAW A;  4H54 A;  1WI9 A;  3R4K A;  3AOU A;  2XHK A;  1ZHF A;  1U6G A;  1H89 C;  5HLH A;  4A5M A;  4KYW A;  1APC A;  1LDK B;  1J75 A;  4XOR A;  5BQG A;  3KLO A;  1HDP A;  4XLC A;  1J09 A;  3ERM A;  3BPV A;  4RAZ A;  1YAU O;  2QTV A;  1JTX A;  1ETX A;  2ELH A;  3F0C A;  5CVJ A;  3PFI A;  4XLN F;  1AVO B;  2WBM A;  5LHI A;  3R0J A;  3UMI A;  2EFW A;  4RM2 A;  3E9V A;  2LD5 A;  3S27 A;  3H9J A;  3S93 A;  4JUR I;  4L0Z B;  2HYJ A;  3K1M A;  4PZJ A;  1BW5 A;  4EBJ A;  1NLX A;  2L9J A;  4MVR A;  3MWM A;  3CJN A;  2EPL X;  2YWA A;  3CP8 A;  5HLI A;  5JT4 A;  3CO6 C;  2PBI A;  2QYO A;  3SXZ A;  3PNY A;  1YE9 A;  1QVU A;  1OR7 A;  1TNT A;  1JUM A;  4G7Z F;  1BL0 A;  3JRG A;  2CQ7 A;  2IS6 A;  2EWN A;  3QWL A;  1U3E M;  3S14 J;  2QSH X;  1TWC J;  2EH3 A;  1OLT A;  1ZG3 A;  2JWT A;  2VBW A;  3IWF A;  4NDL A;  3BG6 A;  4BEH A;  3JAM K;  3EDP A;  2GFH A;  1S7O A;  1ZAR A;  2FA5 A;  2YEV A;  4IJJ A;  1CGO A;  5JP7 A;  3D5L A;  1T5O A;  5D5U B;  4JX6 A;  4Q47 A;  3KPH A;  4P6I C;  4X1E A;  5M3M J;  1EKY A;  4M6Y A;  3K1H A;  1T39 A;  4U9D A;  4V19 K;  1V54 H;  4RDU A;  2BL2 A;  2X1D A;  1X1C A;  4JX5 A;  3RDI A;  4X0R A;  4MTD A;  2R92 J;  4V2G A;  4IRH A;  4IHS A;  4WJ0 A;  4BAC A;  2ZSI B;  2L5Q A;  2KQR A;  3M8F A;  3RKW A;  4CZZ A;  4NC6 A;  5AIQ A;  4I6Z A;  4LJZ F;  5BOX A;  4O7G A;  4RM3 A;  1BZ4 A;  2DAO A;  1S7A A;  2PLY A;  3CF2 A;  4RGS A;  2XM0 A;  1W5C C;  4LLL A;  1USS A;  2IEK A;  2XRL A;  1ZH5 A;  1H88 C;  2HSB A;  2ID6 A;  4YN0 B;  3UMK A;  5L0I A;  4YJW A;  3DTE A;  3B9Q A;  2VJ5 A;  2Z33 A;  5DLJ A;  3W3C A;  5DM7 F;  2IBF A;  3F47 A;  2XLM A;  2HYF A;  1FIA A;  3K1I A;  2K7L A;  2Y0S N;  1E17 A;  5JR3 A;  4G8X A;  5JRA A;  1JTY A;  2FMY A;  5GTH C;  4JC7 A;  1OW7 A;  2X6Y A;  3BZC A;  4WX9 A;  2YZS A;  3FMR A;  3WU2 C;  2E2I J;  4M63 A;  3RCO A;  1MH4 A;  4YL1 A;  3I59 A;  2XRH A;  5IP7 J;  4HBL A;  1SFE A;  2CQK A;  3NRV A;  1YLM A;  2D2W A;  2OF7 A;  4EQQ A;  3ZOB A;  3S90 A;  2XB0 X;  3HIF A;  3B71 A;  3N05 A;  2PG4 A;  1M6T A;  3EHN A;  3JSO A;  4MVZ A;  3CTA A;  2NG1 A;  3DKX A;  1JUP A;  1IG7 A;  5JVG F;  2IXP A;  2V1X A;  2V1D A;  5H2F C;  4O6M A;  2DA2 A;  1ZRC A;  1WZ2 A;  1JKO C;  3S17 J;  3IP4 B;  1O7F A;  1IO2 A;  2ZXJ A;  3E70 C;  4QI0 A;  3TOM A;  4H4K C;  1HMO A;  4CCK A;  1TR2 A;  2R03 A;  1EKE A;  3GTP J;  2V6C A;  5TGT A;  3I55 I;  4BNC A;  3O39 A;  3QP6 A;  5F0F A;  1B4A A;  1JHF A;  2YPR A;  5FB2 A;  1AA7 A;  3S1R J;  1XX5 A;  1HF0 A;  2OA4 A;  1GVJ A;  4RBN A;  2BOL A;  3M8E A;  4HZF A;  1HA8 A;  1I3Q J;  2PMH A;  1Z3I X;  1BI1 A;  3TED A;  4EJU A;  1QRY A;  3KZY A;  3SXY A;  2Q9A A;  3ZMV A;  2XGX A;  3HRS A;  3S28 A;  5DV5 A;  2HNH A;  3OYC A;  2JUG A;  1RC9 A;  1FT9 A;  2KIF A;  2XVC A;  2DQR A;  3C2B A;  5IOY A;  4CCM A;  3HOT A;  4JJF A;  3SDG A;  1T95 A;  1SEU A;  2XL6 A;  2NYX A;  2WV1 A;  2Y75 A;  2LF8 A;  1ETW A;  5CVU A;  3RQ4 A;  1IN4 A;  1XTA A;  2VBZ A;  4BL0 B;  4G7O F;  2YKZ A;  5A6J A;  2WY8 Q;  2EFO A;  2V7F A;  4XSX F;  1LI5 A;  4ZDP A;  3VFZ A;  1JKP C;  4RGR A;  4K1O A;  3S3O A;  4B3X A;  3HHH A;  5HNF A;  3DU6 A;  4KI2 A;  2E7X A;  1MBE A;  2ZO4 A;  5F1J A;  4PCQ A;  2AU5 A;  5J8C A;  1ACI A;  1FX7 A;  1FSH A;  3JCU Q;  3K33 A;  3P9K A;  1ZR2 A;  4B1R A;  4IJA A;  3H35 A;  2DFH A;  2R7F A;  2FSW A;  3PJR A;  4B3A A;  3JZ0 A;  4MQV A;  2LD6 A;  4YL3 A;  4E18 A;  3JYY A;  2QBY B;  2EK5 A;  2OV7 A;  3FXK A;  4CIP A;  5L0F A;  2A6H F;  2LC2 A;  2A5Y B;  2M4G A;  3U2R A;  2KFD A;  3KIO A;  1KGS A;  5F1R A;  1BBY A;  1FFH A;  1V4A A;  2P81 A;  4HV6 A;  3FK7 A;  3H5N A;  3QU3 A;  1RCP A;  5F64 A;  2P0W A;  3KEY A;  1LE2 A;  3H36 A;  3HOS A;  3IQ6 A;  4XK4 A;  3ZP5 A;  1APL C;  4ZDO A;  4DBR A;  4I7H A;  2W4B A;  3F8M A;  3NRH A;  3V5X A;  1Z0X A;  3HGY A;  5B3S C;  2F2E A;  4FAS D;  4MO7 A;  4JTD B;  2VJ4 A;  2NXN B;  3IH2 A;  4KN7 X;  3H9Q A;  3K70 C;  4J01 A;  2NVT J;  2B0J A;  3ABK C;  3U3F A;  1VTM P;  3F46 A;  4YL0 A;  3WGI A;  3HJE A;  1S8N A;  4QPO A;  1VLT A;  4QTR A;  3PNT A;  1AEP A;  2MD0 A;  4G94 A;  3OIP A;  1OR7 C;  3ULQ B;  2IOQ A;  2ZXO A;  5F0C A;  1Q1H A;  3K4M A;  4XID A;  3EZI A;  2LY2 A;  2O03 A;  3ZQI A;  4XIC A;  1U6H A;  2HV6 A;  5KAF C;  2LBF B;  3TO7 A;  3WTZ A;  2HZ8 A;  5EGO B;  1TT5 B;  1UJ8 A;  2K86 A;  1J9I A;  2PMU A;  4I09 A;  5BPD A;  2GAQ A;  3HTK C;  3BTC A;  3BDD A;  3C8Z A;  1K61 A;  1HSJ A;  3CDL A;  2BXY A;  4FT8 A;  2UUZ A;  5J4Y A;  1W1W E;  4A3K J;  3PIO F;  4EJW A;  4ZYH A;  2Q9B A;  3FAP B;  1G4W R;  4LMY A;  1FZP B;  3PO3 J;  4A12 A;  5AC4 A;  4OIR F;  1A6Q A;  3H2U A;  3RKX A;  5CQG A;  2J45 A;  4NUB A;  4NQF A;  4C3J J;  3ZQH A;  1X4O A;  3V5Z A;  2J8W A;  4U5E E;  2KZG A;  1NBB A;  5ILV A;  3U5S A;  3W6J B;  1WSU A;  5KHD A;  4Y7N J;  3CCE I;  4UVA A;  2IW5 A;  1ULY A;  1Y56 A;  1YS7 A;  4OU0 A;  4FX0 A;  1YRN A;  4NHJ A;  2H6C A;  3QP5 A;  1YA7 O;  5ICE A;  1XDU A;  1NU9 C;  5J3L A;  2MHR A;  2DOD A;  1U5T A;  1XDS A;  2WAE A;  2CFO A;  3QVZ A;  2L7A A;  2V4J C;  2CWE A;  4B09 A;  2LSE A;  2IA2 A;  4EM0 B;  1P92 A;  4O6N A;  4PSW A;  1R5H A;  5CPR B;  1T2K A;  3A03 A;  2IXN A;  3BCB A;  4D0P A;  1RIO H;  2DJN A;  3K69 A;  3ONQ A;  4M3D A;  3SHF A;  2CW7 A;  2OAZ A;  5CYV A;  1W7P A;  5K7H A;  4OIQ F;  1RR7 A;  3B73 A;  1ZRD A;  4CS8 A;  1ZQ3 P;  1YOV B;  4FTH A;  4MVQ A;  1D0X A;  4YG2 F;  4G7H F;  3L7W A;  3HEF A;  3TP0 A;  2XAH A;  1QLE C;  3J81 Z;  3HTU A;  4GCV A;  1YI2 I;  5TRD A;  4BJT A;  2JVH A;  1YTY A;  2EB7 A;  4M72 A;  1TW2 A;  5ICC A;  1ORS C;  4HEA J;  4PUS A;  1X58 A;  2JTV A;  2KW3 C;  5KYN A;  3KL4 A;  3L2W A;  2QE9 A;  1Z7U A;  4Y4R A;  4KIS A;  3TDU C;  1M56 C;  2H7B A;  3A1Y A;  2XLH A;  4G6D A;  3QVY A;  1FMW A;  2QBY A;  3HKZ N;  1RKE B;  3RH3 A;  3RIR A;  2VUM J;  1FJL A;  2J7P D;  3GX4 X;  2LNB A;  2WB7 A;  4RGX A;  3MYF A;  1D1C A;  2KJG A;  2OEX A;  1VK5 A;  1HOM A;  4U5D E;  1ZRE A;  2R93 J;  2GAU A;  3E6C C;  2Q9C A;  4JRZ A;  3CUQ C;  2PX9 A;  1B1B A;  4AVP A;  1Q1V A;  1HY5 A;  1TFK B;  3HDD A;  1R1U A;  5EG0 A;  3MFK A;  3QW1 A;  3TGN A;  2WWY A;  1Z1D A;  3PM1 A;  2F5V A;  1U8B A;  1MBF A;  5EZG A;  4LLN A;  1TWG A;  1Z67 A;  2BW3 B;  2DJI A;  5BPI A;  2KPM A;  2BYV E;  4LD5 A;  3SEQ A;  1VTN C;  1KZH A;  2JVG A;  4UUV A;  3HL2 A;  4A3C J;  3BZ6 A;  5L3E A;  1ZR4 A;  1Z3X A;  1DGW Y;  4N4O B;  1RKT A;  1AHD P;  4Q7C A;  5D92 A;  2W82 A;  3DPU A;  4BUP A;  5LGT A;  3ZMT A;  2XUB A;  4A3B J;  5K5R A;  2R9R B;  1FFT C;  1EQ1 A;  3ZWI A;  3JR9 A;  5J4V A;  1UHM A;  4UY8 I;  1JGS A;  3BR0 A;  1I4Y A;  3I5Q A;  4DZJ A;  5FLM J;  5A2Q Z;  2ZNY A;  3B6C A;  1OR3 A;  2EIL H;  2Q8K A;  2DU9 A;  2AXL A;  4HNU A;  3ZMD A;  2FQ4 A;  1UHW A;  3IHU A;  2QLA A;  1BI0 A;  3RQG A;  3ZIB A;  4U9E A;  4U7B A;  4RD9 A;  4RB2 C;  1VOM A;  4CDV A;  2R7U A;  5HS8 A;  5J40 A;  4DGW B;  1ZTR A;  4JBA A;  3RTR A;  2Y0S A;  2AO9 A;  2MH2 A;  3H0D A;  2G7U A;  2CQQ A;  1SYQ A;  2QEN A;  3O2P E;  2V3C C;  1JPJ A;  2EFP A;  2FD5 A;  4YFN F;  3TMO A;  3FDQ A;  1WJA A;  3FHD A;  1DU6 A;  2LVS A;  3BTJ A;  5FD5 A;  3W2V A;  4IAO A;  4IB4 A;  5ICG A;  4PDK A;  1VB5 A;  3U9J A;  1HCR A;  4CYD A;  1Z63 A;  3IRR A;  3NAU A;  3ZR8 X;  5A6A A;  5DVW A;  1XGN A;  3HKZ A;  2HKX A;  3HBL A;  3RQE A;  2Y0M A;  3ZQQ A;  4RMN A;  2MYS A;  4JCZ A;  2L01 A;  1MDM B;  3OS1 A;  3Q6M A;  2Z3Y A;  5D6E A;  3TDZ C;  2RV8 A;  1ZRF A;  4WGY A;  2HTS A;  2HFI A;  4AC0 A;  3AG1 H;  3WG9 A;  3TJ5 A;  2HEO A;  1W7P B;  1LQ1 A;  5B1A C;  3NG1 A;  3GO5 A;  2Q2E B;  1RI7 A;  1SF8 A;  4BHP A;  2ECB A;  2LY9 A;  4QI2 A;  1ZGA A;  3V4G A;  4K0D A;  1GUU A;  2HMQ A;  4N6H A;  3RPQ A;  2ZD9 A;  2VL8 A;  3Q3S A;  4AWX B;  3EGD A;  4FX4 A;  1CPQ A;  2L81 A;  2K85 A;  1OYW A;  1OMI A;  3I4U A;  1B9N A;  2QQ8 A;  3B02 A;  2RKH A;  3S84 A;  5IYB J;  3HUG B;  4KIB A;  4L5E A;  5BQH A;  2DK8 A;  2CSO A;  4AU7 A;  1BA5 A;  1PD0 A;  1NG1 A;  3DP7 A;  1T0F A;  4XMY A;  4BJ1 A;  1DOV A;  5D5V B;  4E0I A;  2XGD A;  3J81 K;  2QY9 A;  1JMW A;  3B0V C;  3L9F A;  4AIK A;  1VYK A;  5DQZ A;  4M3F A;  3I0T A;  3ABK H;  5CLS A;  2EIM H;  2X9D A;  1QZX A;  2E1M B;  4UNO A;  1SAN A;  5K1Y A;  2FGY A;  2HKO A;  3TO9 A;  1G4U S;  3J7Z I;  4I3M A;  2VJJ A;  5CJ9 A;  4J00 A;  1Z6A A;  2VKV A;  4ESF A;  1X3U A;  1DPU A;  1RXQ A;  4GO1 A;  2H09 A;  1LPE A;  2VB6 A;  1YJW I;  1E84 A;  2R5Y B;  1IUY A;  3OYN A;  3NMI A;  2XLE A;  3LFU A;  2HDD A;  3IL2 A;  4IRU A;  3DV8 A;  1TQI A;  2X6W A;  5J8F A;  1OCR H;  4CXF A;  1HW1 A;  2CV1 A;  1T6U A;  1FNN A;  4UXN A;  4QIW N;  2WAQ N;  3H9G A;  2JRM A;  3T1B A;  1UMQ A;  3GM1 A;  5FKK A;  2P5K A;  1SAU A;  2CO5 A;  1GV2 A;  1P2F A;  4I2O A;  3BG9 A;  2NAZ A;  3GWN A;  3E3V A;  1B68 A;  1JOG A;  1OW8 A;  4F92 B;  3RIP A;  3U3B A;  2DDA A;  2HKV A;  3X1O A;  2OU2 A;  4M3E A;  1GHC A;  3R0A A;  3SNH A;  4FE4 A;  2R7S A;  5E1W A;  2AXT C;  2OPT A;  4K2E A;  4UV8 A;  2IA1 A;  1S5L C;  2DA4 A;  4BBR J;  1ZHZ A;  1RKE A;  2PX0 A;  3C8G A;  3BR2 A;  2FEZ A;  2L54 A;  1FOK A;  1S05 A;  2I8B A;  2XAQ A;  4M6X A;  3QOP A;  4UB8 C;  1PUF A;  3K6B A;  1ORY A;  3HYI A;  2KLO A;  2DT5 A;  2RGV A;  3OYD A;  2OU6 A;  1YO5 C;  3KP4 A;  3F3X A;  4B43 A;  4NQW B;  1LKX A;  1TQM A;  5JLX A;  1MJB A;  4WXD A;  2QKL B;  3U8V A;  3HC7 A;  2R7R A;  4EHP A;  3QYB A;  1VQO I;  3FOO A;  3ZQY A;  2DFI A;  4MNU A;  3A01 A;  4MW8 A;  2QSG X;  2DTZ A;  2DMN A;  1B9M A;  3I58 A;  2PI0 A;  4EIY A;  2CUF A;  1BN5 A;  1OYY A;  3L09 A;  3SEZ A;  4DZP A;  4CCO A;  4JW1 A;  3SXM A;  4ZLC A;  4NBQ A;  3CCR I;  3G73 A;  2MW8 A;  1Y0U A;  1CGM E;  2LLK A;  2QZ8 A;  3TW7 A;  5TJJ A;  2LFB A;  4B6I A;  4IHW A;  5C4J J;  3IAM 2;  5LHG A;  4XLP F;  1UHS A;  1YIJ I;  4C2U A;  3Q9V A;  5EDN A;  1DQU A;  1TQP A;  1LB2 A;  2P7C B;  4IZZ A;  1A5J A;  3DJN B;  4N6C A;  2DYR H;  1ZU5 A;  2KC3 A;  1XGO A;  2HUJ A;  3LA3 A;  1QA6 A;  4OOI A;  3RYP A;  1OQC A;  4I1O B;  3EET A;  4BE1 A;  2VCB A;  3TOL A;  3SDB A;  4KIF A;  4HW0 A;  3S1Q J;  1WGX A;  1ZHY A;  3EGD B;  2ZXP A;  4XPY A;  5L0C A;  2AQE A;  3HHG A;  4WK8 F;  1V55 C;  4BBS J;  2LRE A;  2DXI A;  4OMZ A;  3W2W A;  2LK2 A;  3AQB A;  2CW0 F;  3BCA A;  3HGG A;  1KA8 A;  2P5V A;  2VBY A;  5EGY A;  4DVY P;  4C3H J;  2UXX A;  2B63 J;  2M34 A;  1FOX A;  5JFR A;  4XL9 A;  4XPW A;  1R1T A;  1IRF A;  1T0F C;  2HGC A;  3VAY A;  4CHU A;  3SZT A;  3SZP A;  1HKT A;  1YYJ A;  2P7V A;  2UUH A;  3JRF A;  3OOU A;  3QPH A;  2AP3 A;  4DYC A;  1O3S A;  1HC8 A;  2K4J A;  1F43 A;  3L0I A;  1TNS A;  1NU7 D;  4CSA C;  2ZFW A;  1ETQ A;  3LQR A;  1WI3 A;  2L6F A;  4C3B A;  1H9T A;  2CQN A;  4CZC A;  2M8E A;  4C3D A;  1WKM A;  2LMD A;  2QSF X;  2NS0 A;  4HFK B;  4U5F E;  1WJB A;  4RB3 C;  5F28 E;  4OAZ A;  2M0C A;  1D1A A;  1MJ9 A;  3TP3 A;  3W8H A;  4U0Y A;  5JVT A;  4HX7 A;  1XMA A;  1IXS B;  1T56 A;  4F4B A;  4WCG A;  2HPM A;  2H94 A;  5FGM A;  2NS7 A;  3SZG A;  2JMW A;  2ZXI A;  2G9W A;  4BQQ A;  4F93 B;  2O0Y A;  4KT6 A;  4EVI A;  1J8M F;  4W8K A;  3O6X A;  2C03 A;  2IS4 A;  2GDC A;  1R6R A;  2LH9 A;  3WU1 B;  3F9K A;  2NOJ B;  2JN6 A;  4LIT A;  4R1H A;  4IVN A;  4HNT A;  3CD6 I;  3C8G B;  3L8J A;  2PQ8 A;  4MND A;  2Q2E A;  3CZ6 A;  2LYC A;  3U21 A;  4ANJ A;  3OYM A;  1MMS A;  4HE8 D;  4MS2 A;  3JSZ A;  5HOO A;  1MMD A;  1JGG A;  3ZQG A;  2MLK A;  1VQN I;  1YYV A;  1L0O C;  1WWX A;  2JSP A;  4DW6 A;  3QYF A;  5BS6 A;  1IGN A;  1G59 A;  4AK9 A;  3R7C A;  1AOY A;  4BEM J;  2KSF A;  2COB A;  3U1K A;  2Q3T A;  1RZ4 A;  3C7J A;  1GGQ A;  1A04 A;  1FBS A;  1NK3 P;  4MGR A;  3A9C A;  4MTE A;  3CMA I;  1QGP A;  3E7L A;  2EZH A;  3V8K A;  4KDP A;  1Z23 A;  5L3V A;  4O6J A;  3K7A J;  3N24 A;  3C63 A;  3KP6 A;  3OYF A;  3AL0 B;  2O9X A;  4BEH B;  5LRS A;  2KIS A;  2ZME C;  3K1N A;  2KDO A;  1BDJ B;  1SFU A;  3B29 A;  2K3P A;  3FXQ A;  1DDN A;  1SVM A;  2Y3G A;  5GPG B;  2LOO A;  2X51 A;  2ZFU A;  3BG7 A;  1EF4 A;  1MH3 A;  2XKP A;  3RJP A;  3BZK A;  1O4X A;  1M57 C;  2QUP A;  2YVK A;  1PP8 F;  2OQM A;  2LFF A;  1TWC A;  2RAE A;  2R25 A;  3DBL B;  3GM2 A;  3NMK A;  1ZVZ A;  5DCM B;  3KFW X;  4CSW A;  1I39 A;  5F27 A;  1PP7 U;  1D5V A;  2K40 A;  5LBQ A;  4QSH A;  3WTV C;  5GAG J;  1A41 A;  3CCU I;  5EK0 A;  1MNE A;  1RKW A;  1IXR C;  1U78 A;  2MBF A;  5D8L B;  3GWL A;  2L7F P;  1MMN A;  2IGN A;  5DEQ A;  4BHC A;  3OS0 A;  1ZG5 A;  1LS1 A;  2JRT A;  1N1C A;  4IL6 C;  2YHS A;  2V9K A;  4KNV A;  2XB5 A;  2K02 A;  4P9F A;  5J1Y A;  1QNT A;  3TL4 X;  2M30 A;  3UKG A;  3OR1 C;  3RYR A;  1LIH A;  2KJB A;  5D5X B;  1SVL A;  2IAI A;  4JP0 A;  2H1K A;  1G6N A;  3TKY A;  3TQN A;  1P7I A;  1XD7 A;  3BJA A;  3WOD F;  4EV0 A;  1EJ9 A;  5GAH J;  1M2O A;  1QZY A;  2VE8 A;  2DPU A;  2JK3 A;  2TMV P;  2J9U A;  4CUG A;  3L2V A;  3DQV C;  3ABM H;  2PJR A;  2OUM A;  5KYW B;  2L9R A;  2FRH A;  1FYK A;  1HW2 A;  3M4B A;  1AUE A;  3N97 A;  1GT0 C;  2G62 A;  3QYE A;  1U5T B;  3L2Q A;  2HOS A;  3HOX J;  5JVE A;  1BM9 A;  2E36 A;  1Y0N A;  3P9I A;  1IN7 A;  2FU4 A;  2O3F A;  2OCC C;  4ZZL A;  1EV7 A;  5AON A;  1TWA J;  3BG5 A;  4BQN A;  5BMZ A;  3GTQ J;  3RZO J;  4GRI A;  2VPR A;  2L02 A;  3DKA A;  2A1D D;  2ISY A;  3BP8 A;  4RAF A;  4XRF A;  2E71 A;  1YRN B;  3WTW C;  3VWB A;  3OEO A;  2RRE A;  2OZU A;  2VBX A;  2VKD A;  4IOC F;  2VKH A;  2K3F A;  2E7W A;  4DRJ B;  4CCN A;  1BI2 A;  3FXM A;  2LSO A;  3CCS I;  2HWV A;  5B3I A;  2IGO A;  2ADU A;  3ECO A;  1XCV A;  4EEF G;  1C02 A;  3GBG A;  4GYT A;  1RUO A;  5IT9 Z;  2JUC A;  1G5Z A;  2ZSH B;  5C4X J;  2GXA A;  2PBE A;  2XAS A;  2XV4 S;  1XS9 A;  2A61 A;  2FBI A;  1V55 H;  3TBI A;  1IJW C;  2QEX I;  1QHG A;  5B1A H;  5LFA A;  1P4A A;  2KIM A;  3S2W A;  1VQ4 I;  1S7E A;  1ONV A;  1P4X A;  1S72 I;  4G9Y A;  3JRE A;  1FAP B;  1ORJ A;  1FSE A;  2NVX J;  1YJG A;  4F7Z A;  2OKU A;  4CYC B;  3ZMZ A;  2RN7 A;  3S1M J;  1LVK A;  2KT0 A;  4YIF A;  1P9Q C;  1U9N A;  3RYL A;  1L3L A;  2VXD A;  1X1D A;  2NSF A;  2ID3 A;  1F5T A;  5K5O A;  3SZR A;  5GAE J;  2XLD A;  5KYY B;  3BPX A;  2GBY A;  3M7G A;  4HFF B;  2BW3 A;  3RZD J;  1JKQ C;  1LE4 A;  3HM5 A;  3RPU A;  3A4C A;  2HVQ A;  4G6Q A;  4FWV A;  1NG7 A;  3T6B A;  3L1M A;  2VCA A;  1T6I A;  1QU3 A;  1TLH B;  2H8W A;  3VOD A;  3G1M A;  2DMQ A;  4Z6Y A;  3CAX A;  3OYA A;  2CU7 A;  3DEW A;  5FLX K;  3L8I A;  4ENK A;  3ABM C;  5E2Q A;  1K83 J;  1Z7L A;  4ZH4 F;  2DOE A;  4E4H A;  5L3F A;  5FRM A;  4OD4 A;  4Z9J A;  1MNM C;  1OCP A;  4IAR A;  4GDF A;  2MG4 A;  2YUS A;  5E8G A;  1H7I A;  3HSF A;  2CV2 A;  1RNL A;  4I99 C;  5FLV A;  3MN2 A;  4L5I A;  3S2D J;  2WA0 A;  3BLY A;  4U5B E;  4RB1 A;  1UFB A;  2ZB9 A;  2PJP A;  1TQG A;  3U8P A;  3S29 A;  3JRB A;  1A0B A;  5ERI A;  2CH0 A;  4R79 A;  4CH7 A;  4RDA A;  2WL8 A;  3RVY A;  1KU2 A;  2M5W A;  1K79 A;  3EYI A;  3ATP A;  3RVZ A;  5DYM A;  1G3W A;  3GZN B;  4N9H A;  3KYD B;  2QLZ A;  3K4L A;  3ZQV A; 
#chains in the Genus database with same CATH homology
 4OIQ F;  4Q5S F;  4F55 A;  3K4N A;  5D91 A;  2EIN C;  3K1I C;  3ZSU A;  3LMM A;  2A6E F;  2EIL C;  4CS8 A;  4KNW A;  2K9M A;  4QDL A;  1D0X A;  4G7H F;  3C2H A;  1QLE C;  1WJD A;  4BJT A;  4II2 A;  2JVH A;  2HV7 A;  4HEA J;  5KYW A;  5F5F A;  4PUS A;  2KW3 C;  1LFP A;  1WGW A;  3SEO A;  1OCR C;  5KYN A;  3KL4 A;  2WAF A;  3L2W A;  1NZE A;  4LLE A;  4KIS A;  4Y4R A;  1M56 C;  4RDA A;  5KYY A;  2H7B A;  3A1Y A;  4LIV A;  3K6G A;  4XLE A;  3BC8 A;  3UGO A;  1FMW A;  3DLA A;  3LSG A;  3L34 A;  3S8P A;  3HPG A;  3MLG A;  4J30 B;  3RH3 A;  4PJJ A;  2J7P D;  4IQ4 A;  3OL4 A;  2FUG 2;  3MD2 A;  2WB7 A;  2KRH A;  2WAQ A;  2WB1 A;  3A2K A;  1D1C A;  1E0E A;  2KJG A;  2CGE A;  1VK5 A;  2XXA A;  2GOM A;  4U5D E;  4C7O A;  3ECS A;  2Q9C A;  2HVS A;  3HLZ A;  3OYL A;  3IAS 2;  3DM9 B;  1IW7 F;  3LEV A;  4B47 A;  2L9S A;  2X1C A;  3FVY A;  5HLT A;  5E3C A;  2M4E A;  5BUO A;  2RQQ A;  1M2V B;  4DVZ A;  5F5H A;  3Q7L A;  2F5V A;  2W4M A;  3K7D A;  1TWG A;  1N77 A;  2BW3 B;  2DJI A;  3PL8 A;  4C9Y A;  1IZM A;  2KPM A;  3SEQ A;  1RJ9 B;  3I9V 2;  2JVG A;  4P5O A;  2X85 A;  3HL2 A;  2OG2 A;  4XR6 A;  1ZHX A;  2O5R A;  1Z3X A;  1DGW Y;  4N4O B;  4XKB A;  3RSN A;  2IXO A;  3QZC A;  2W82 A;  4XM3 A;  3DPU A;  5FRN A;  4Q7C A;  4ZC3 A;  4BUP A;  5CI9 A;  4Q4Z F;  4CS9 C;  4XKW A;  4CA0 A;  4F3Q A;  3AG1 C;  3OL3 A;  3SP1 A;  3NDB B;  2F4I A;  3NWT A;  1FFT C;  1GLN A;  3JYH A;  2IGM A;  4E7L A;  3I5Q A;  2CNW A;  4LG3 A;  5E33 A;  4PFO A;  3LAY A;  3DU5 A;  2PF4 E;  3VYT B;  2Y39 A;  2E87 A;  4HNU A;  5IY5 C;  2R4G A;  4HSR A;  1V5F A;  4YT2 A;  3NKD A;  4AYB A;  3ZIB A;  5CQE A;  1BR2 A;  3I3L A;  3LS0 A;  5HNH A;  5HSW A;  3DEE A;  4LIU A;  1MW7 A;  4U7B A;  2W9Y A;  4RD9 A;  5KYU B;  2Z2S B;  1VOM A;  4CIH A;  2R7U A;  1VMA A;  5T1D B;  4DGW B;  2UWM A;  4XWJ A;  1MMA A;  2XAU A;  2Y0S A;  3RTR A;  3L2R A;  2IXS A;  2K9L A;  2UV1 A;  1V54 C;  3H0D A;  1D0Z A;  3FAJ A;  4K7B A;  2F6C A;  2V3C C;  1OKK D;  1JPJ A;  1MMG A;  4BQO A;  2VLA A;  2WY7 Q;  3FHN A;  1Z5Z A;  2J0X A;  2PP4 A;  2BE5 F;  2A5W A;  3NWS A;  2R7W A;  5JHF A;  1ERD A;  4U5G A;  3H65 A;  4FET A;  2CV0 A;  3PNV A;  3TMO A;  3T4R A;  1WJA A;  3AG3 C;  2VAS A;  2DT6 A;  3FHD A;  4AE4 B;  3FDQ A;  4IAO A;  3W2V A;  3CMM A;  1N75 A;  1UEL B;  2V1N A;  5CKT A;  4CCJ A;  3DMD A;  4O6M A;  4C3D A;  3PFY A;  4O79 A;  4BXF A;  2J46 A;  2EIJ C;  4CS8 C;  2DT7 B;  1MND A;  1Z63 A;  4A2N B;  2Y3H A;  2L2O A;  1TWH A;  1N78 A;  3ZR8 X;  3DZA A;  3K66 A;  3I5P A;  3HKZ A;  5DVW A;  1YX3 A;  2DYR C;  3KKB A;  3EG9 B;  1G8X A;  2OC6 A;  3ZQQ A;  3K70 D;  4E7H A;  4RMN A;  4OWR B;  3DD7 A;  3PMR A;  1ZHT A;  4BU2 A;  3DJU B;  5KYX A;  3PHF 2;  2MYS A;  2Z1D A;  2IS2 A;  3LES A;  3OYK A;  3OY9 A;  3OS1 A;  3Q6M A;  3B0U X;  4BG0 A;  4DJA A;  3V7O A;  3LS1 A;  1U0J A;  3NKE A;  4NNJ A;  3OYE A;  3NYL A;  5B1A C;  2WVQ A;  1D0Y A;  3NG1 A;  2J7P A;  1PD1 A;  2D5R B;  4XKV A;  3D5R C;  4G6T B;  4ZJZ A;  5T3W A;  2Q2E B;  3EFO B;  3L2U A;  1SF8 A;  2FFH A;  3HJC A;  2Q1Z B;  3LL7 A;  4JQF A;  2WZF A;  4EBB A;  2G3K A;  2KL4 A;  2J9V A;  3ABL C;  3UNG C;  3S3M A;  2R7O A;  4K0D A;  4J32 B;  3AFH A;  3DAG A;  1TKN A;  2V26 A;  2VL8 A;  2L9N A;  3OS2 A;  3EGD A;  1JI8 A;  2VQG A;  2WVN A;  3VYS B;  2L81 A;  3UMH A;  3I4U A;  5CI8 A;  2CMP A;  2M0M A;  4N06 A;  2E1M C;  3PSI A;  4CS9 A;  1PJR A;  3HUG B;  3RPU D;  4AU7 A;  1PD0 A;  3FDY A;  1NG1 A;  4GEH A;  1O87 A;  4XMY A;  4BJ1 A;  3AL0 C;  4BJ6 C;  4AE4 A;  1DGR M;  2QY9 A;  2XF5 A;  2ZXW C;  4AX2 A;  3B0V C;  3AG2 C;  1VYK A;  2KZV A;  5DQZ A;  3X2Q C;  3D5S C;  2XC7 A;  2NUT B;  3Q6N A;  3KH2 A;  4DBQ A;  1QZX A;  2E1M B;  2I8D A;  2VQH A;  1JPN A;  3K10 A;  3ASN C;  4BDZ A;  2FGY A;  2XSJ C;  4I3M A;  3QOD A;  3M1C B;  2VJJ A;  1W36 C;  4J00 A;  2DOA A;  1Z6A A;  3G2B A;  3LJB A;  3FBN B;  4II3 A;  4RLQ A;  3ASO C;  4G0H A;  4IWB A;  4I1M A;  4OD5 A;  2VB6 A;  3EUK L;  4HPQ A;  2VIX A;  2HPI A;  3DTI A;  3OYN A;  4PFP A;  4BE2 A;  2Y3B A;  3KMI A;  4C2T A;  2R7T A;  3LFU A;  4EWC A;  4IKF A;  2M3A A;  3DAF A;  4ITV A;  3DXJ F;  4IRU A;  4YRV A;  3RFY A;  4PK4 A;  2X6W A;  2CV1 A;  2HQA A;  2VXZ A;  5KNL A;  2LG4 A;  4XKC A;  3H9G A;  1WJF A;  2IYL D;  2KQ9 A;  2MC4 A;  4B44 A;  3PSF A;  3KX2 A;  3CP2 A;  3ZGK A;  3MKZ A;  2WZL A;  2BVL A;  1SAU A;  2R7V A;  1D1B A;  2M7B A;  4XN3 A;  4XLA A;  2EIM C;  3ZG1 A;  2HU9 A;  2M4K A;  4C7O B;  4F92 B;  1Z3Y A;  2W4S A;  3SYT A;  2DGJ A;  3RIP A;  3QOE A;  4YT4 A;  3X1O A;  4BJ6 A;  2VJI A;  4PSX A;  2NUP B;  2A6T A;  3OR2 C;  3SNH A;  2R7S A;  5FRO A;  4CCL A;  1PYV A;  2R7Q A;  4XTK A;  1ZHZ A;  2KGO A;  5L3Q A;  5E3A A;  4C3E A;  2PX0 A;  3FKJ A;  1K6Y A;  2I8B A;  3EUH C;  2V6E A;  4XOP A;  2HZD A;  2PMZ A;  1WFX A;  3K6B A;  2PX3 A;  4YEJ A;  3CJQ B;  2KLO A;  3OYD A;  2XDV A;  1SMY F;  2WVO A;  4B43 A;  4NQW B;  4JCH A;  1LKX A;  4QPQ A;  1LDK B;  3W2A A;  2QKL B;  4XOR A;  3HC7 A;  4XLC A;  2R7R A;  3QYB A;  4BE0 A;  1J09 A;  2Y69 C;  2QTV A;  4CBE A;  5KYX B;  4XON A;  5KCM A;  4XLN F;  3J7A Y;  2WBM A;  3ITF A;  1W36 D;  3UMI A;  3SEZ A;  4RM2 A;  3OYG A;  3E9V A;  2E5N A;  4CCO A;  4JW1 A;  2DYS C;  4YWQ A;  4ZLC A;  3RKO F;  3S27 A;  2BVM A;  4XLH A;  3H9J A;  3E1S A;  3EUA A;  3S93 A;  4KBL A;  4JUR I;  4QI2 A;  2CUJ A;  2XF6 A;  4B6I A;  4F52 A;  4F91 B;  2L9J A;  3IAM 2;  4XLP F;  4N4N B;  2CNW D;  4C2U A;  2XL4 A;  1DQU A;  3LSM A;  2VQL A;  3CP8 A;  4E7J A;  4JJG A;  4IZZ A;  5EHH A;  3AQC A;  4E7K A;  2EIK C;  3DJN B;  1ZU5 A;  3PNY A;  1YE9 A;  2LRD A;  4MQ9 F;  3ZVR A;  5LD2 C;  4I1O B;  4ZDL A;  4G7Z F;  4BE1 A;  1X4P A;  3SDB A;  3EQL F;  2IS6 A;  1ZHY A;  3EGD B;  4C30 A;  3S32 A;  4CSA A;  4BEH A;  1OLT A;  2ZXP A;  3BG6 A;  2AQE A;  2GFH A;  1V55 C;  2Z16 A;  2LRE A;  2DXI A;  2YEV A;  4IJJ A;  2X6X A;  3M8J A;  3W2W A;  1ZHW A;  3AQB A;  3D5L A;  2CW0 F;  3BCA A;  4XOT A;  4P6I C;  5EGY A;  4DVY P;  4MLO A;  1X1B A;  4XLF A;  2NUT A;  1TT0 A;  3K1H A;  3VSK A;  2K5C A;  4XL9 A;  1TWA A;  3EGX A;  2X1D A;  2GOX B;  1T0F C;  1X1C A;  1WJ5 A;  2Y3D A;  3OA1 A;  4FES A;  4X0R A;  2P7V A;  3VAY A;  4WJ0 A;  2LY1 A;  3OOU A;  2ZSI B;  2L5Q A;  5HVQ C;  4BAC A;  4YT8 A;  2KQR A;  3VDX A;  1SFK A;  4O7G A;  3LLK A;  4RM3 A;  1Y6I A;  4BGD A;  2Z15 A;  3L0I A;  2J0W A;  3CF2 A;  1NU7 D;  4CSA C;  4E6K G;  4C3B A;  2KHM A;  3Q7G A;  4CZC A;  3UMK A;  4AVZ A;  2R7X A;  4YN0 B;  4HFK B;  4U5F E;  1WJB A;  4NC8 A;  4OAZ A;  1D1A A;  4YJW A;  3DTE A;  2H7V C;  2VJ5 A;  3IUO A;  3B9Q A;  3W3C A;  3SYN A;  3F47 A;  3W8H A;  5DLJ A;  1V5G A;  1BR1 A;  3B0P A;  3LSK A;  4OAY A;  4F4B A;  1W2W A;  2WAD A;  4DOZ A;  2HPM A;  5D92 A;  5FCL A;  4IQJ A;  4ULW A;  3SZG A;  2ZXI A;  2QKM B;  2CDQ A;  3POV A;  4XN0 A;  4BQQ A;  4KT6 A;  4F93 B;  1J8M F;  3V42 A;  4JZA A;  2M7A A;  4W8K A;  3O6X A;  3UGP A;  2LBF A;  2C03 A;  2X6Y A;  2YZS A;  1EA3 A;  2IS4 A;  4M63 A;  1ZEL A;  3RCO A;  1R6R A;  2LH9 A;  1OCC C;  5DQT A;  1TZL A;  3F9K A;  2XRH A;  2NOJ B;  3HXL A;  3C2G A;  3ZC4 A;  1FMV A;  4LIT A;  4HNT A;  4Y3O A;  4MND A;  2AQF A;  3CZ6 A;  3U21 A;  2LYC A;  4ANJ A;  4U87 A;  3OYM A;  3EHM A;  3MKW B;  3EFO A;  3N05 A;  4HE8 D;  3JSZ A;  3H5R A;  5HOO A;  1MMD A;  3EHN A;  2JSP A;  4PJL A;  4YEL A;  3LSI A;  3QYF A;  4XNF A;  1G59 A;  2PJR B;  3DKX A;  2NG1 A;  1BOB A;  4AK9 A;  2IXP A;  3WG7 C;  5DS6 A;  4KC9 A;  2Q3T A;  3EJN A;  4Y33 A;  4JOM A;  1X1A A;  2C04 A;  3IP4 B;  3E70 C;  4QI0 A;  4O6Y A;  4H4K C;  4XQF A;  4CCK A;  1TR2 A;  2KNH A;  2HVR A;  2MAB A;  3OIQ A;  3FBI B;  1Z23 A;  5L3V A;  2IS1 A;  4OIP F;  2NUP A;  2JD3 A;  3N24 A;  3OYF A;  3AL0 B;  2O9X A;  4BEH B;  5TGT A;  2KDO A;  3O39 A;  2K3P A;  1UG0 A;  2E60 A;  2VQC A;  2Y3G A;  2RNG A;  2E5Z A;  2LOO A;  3ZRG A;  4NY3 A;  2X51 A;  3JRT A;  1AA7 A;  2JA2 A;  2ZFU A;  3BG7 A;  2ELJ A;  2MWQ A;  2H7O A;  2ZPA A;  4I44 A;  1M57 C;  4RBN A;  2BOL A;  4HEA 2;  1HA8 A;  2X1E A;  3DM5 A;  3M1C A;  1VZ0 A;  1OCZ C;  1TWC A;  1O5H A;  1Z3I X;  2A69 F;  2VH3 A;  4E7Z A;  1S7Z A;  4CS7 A;  1NG6 A;  2Q9A A;  4OIN F;  3DPL C;  4CSW A;  3S28 A;  4OIO F;  3HG9 A;  2DCE A;  4BJ5 C;  2HNH A;  1PCX A;  3OYC A;  1MNE A;  2JUG A;  4EAT A;  4U5H A;  4KJZ A;  3MX3 A;  3HOT A;  2WZG A;  3LSH A;  1MMN A;  2IGN A;  4CCM A;  3OS0 A;  1T95 A;  1LS1 A;  4JJF A;  1N1C A;  3RQ4 A;  2YHS A;  2V9K A;  4BL0 B;  4KNV A;  4G7O F;  2P6V A;  4P1W A;  4BEJ A;  2WY8 Q;  3TL4 X;  2XSE A;  3EZH A;  3LNR A;  3OR1 C;  1RJ9 A;  3AKZ A;  3NYM A;  2V7F A;  4LAC B;  4ZDP A;  3EPV A;  3NYJ A;  2ZXR A;  3WOD F;  2KP6 A;  4B3X A;  4E7S A;  3S3O A;  5HNF A;  3DWL E;  3DU6 A;  1M2O A;  4KI2 A;  2J9U A;  4CUG A;  3L2V A;  3JCU Q;  3DQV C;  2PJR A;  2OUM A;  5KYW B;  4HRI A;  3K33 A;  3N0T A;  3S0X A;  3H35 A;  2G62 A;  3PJR A;  3QYE A;  3L2Q A;  5B1B C;  2W7N A;  5DS5 A;  1KON A;  4IX7 A;  1X19 A;  2OCC C;  1QHH D;  2CW8 A;  2PFD A;  2OV7 A;  4BQN A;  2A6H F;  1DP3 A;  2IXM A;  2LC2 A;  2M4G A;  4GRI A;  3GOD A;  2A1D D;  3VYR B;  1FTS A;  1FFH A;  3H5N A;  4PJM A;  3VWB A;  3OEO A;  2P0W A;  3KEY A;  2RRE A;  4RLF A;  4ZTJ A;  3E0J B;  2VKD A;  3HOS A;  4ZDO A;  3EH1 A;  3EH2 A;  3CQZ A;  2VKH A;  2MFZ A;  3N2Z B;  4DBR A;  3TD7 A;  2W4B A;  3QMK A;  1J8Y F;  4CCN A;  2VPL A;  3NRH A;  5B3S C;  4FAS D;  1YX5 A;  1UAA A;  2XXA B;  2J9W A;  2VJ4 A;  4J01 A;  2IGO A;  3K70 C;  3H9Q A;  3ABK C;  2B0J A;  3F46 A;  4D1Q A;  3GBG A;  4YT5 A;  4PJN A;  4GYT A;  4QPO A;  1SZI A;  4LER A;  1OCO C;  2KRC A;  2ZSH B;  1WJE A;  3PNT A;  2W00 A;  1M2V A;  2MD0 A;  3KYL A;  2L7K A;  3S3N A;  3AG4 C;  3OIP A;  1OR7 C;  3ZXS A;  2IOQ A;  2ZXO A;  3LLI A;  3K4M A;  3TBI A;  3EZI A;  5KYU A;  2CUZ A;  2LY2 A;  3OYH A;  1QHG A;  3PUB A;  5LFA A;  3OWT A;  4D9J A;  2HDW A;  3K4C A;  2HV6 A;  3K4B A;  3EGX B;  3GAN A;  2LBF B;  3DTK A;  4HG2 A;  4X0G A;  2A68 F;  2IGK A;  2XF7 A;  1LVK A;  3DPT A;  5T3T A;  4HST A;  3OYJ A;  1P9Q C;  3IEE A;  3RYL A;  1VYI A;  2VXD A;  1X1D A;  4BS9 A;  3HTK C;  3JT1 A;  3H5A A;  3SZR A;  2UUZ A;  5KYY B;  4HFF B;  2Q9B A;  3T6J A;  2BW3 A;  1OKK A;  3MMY B;  3ZCO A;  4FX5 A;  4OIR F;  3MKY B;  3CSK A;  3A4C A;  2HVQ A;  4BDY A;  5CQG A;  2J45 A;  1IRX A;  1S9H A;  3OMY A;  4NUB A;  4FWV A;  1X4O A;  1NG7 A;  4LLC A;  1Z21 A;  4U5E E;  4U5C E;  1QU3 A;  3T6B A;  3CES A;  4JVS A;  5KHD A;  3OYA A;  4ZLD A;  2W1O A;  2G3V A;  3ABM C;  5E2Q A;  3VYW A;  1Y56 A;  1Z7L A;  1ST6 A;  5DS4 A;  4E4H A;  5FRM A;  4OD4 A;  1ZYR F;  1NU9 C;  1WJC A;  3EG9 A;  2CS3 A;  2CV2 A;  1ZU4 A;  2ZXH A;  3DKY A;  1V5E A;  2WAE A;  3VSL A;  2WA0 A;  2CFO A;  3BLY A;  3EPZ A;  4ZYA A;  3OYB A;  4U5B E;  2V4J C;  3OYI A;  2W45 A;  4DIQ A;  2KMU A;  4KIT B;  2LSE A;  3S29 A;  3W8I A;  1BR4 A;  2CH0 A;  3K4J A;  4NC7 A;  4CH7 A;  3CJR B;  4R79 A;  4B48 A;  4E7I A;  2WL8 A;  3HPH A;  1KU2 A;  4BJ5 A;  4O6N A;  4PSW A;  5CPR B;  3K4K A;  4ZTF A;  3VYU B;  2IXN A;  3BCB A;  3UR3 C;  3ONQ A;  3K4L A;  2CW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...