4U9EA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
91
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQAYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 35
structure length 91
sequence length 106
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9eA00
4WGZA 5JLIA 3QW0A 4CDAA 2XLDA 3M15A 5B3IA 3HNJA 1A7VA 5JUAA 4JEAA 3VRCA 1M6TA 4N4WA 2BC5A 3FOOA 4CJOA 4ULVA 1APCA 2XM0A 3C62A 4N6HA 1E83A 1CGOA 1E84A 1LM3B 4CJGA 4U9DA 1E85A 2CCYA 4CIPA 1EKYA 1GQAA 5JSLA 4CX9A 3TOMA 3ZWIA 5AGFA 3TOLA 2XLOA 5JS5A 2YLDA 2YL3A 2XL8A 5JT4A 2XLVA 3HNIA 3NMKA 3U8PA 3HNKA 3QVZA 1S05A 3ZQYA 1E86A 1JAFA 4U9EA 2XL6A 2XLMA 4IAQA 1RCPA 2YKZA 4JKVA 4ER9A 1BBHA 4D4XA 3M4CA 1MQVA 4JE9A 4EIYA 2XM4A 2J8WA 1QQ3A 3IQ6A 3DE8A 3ZTMA 4L6RA 3ZQVA 2YLGA 2YL7A 1CPQA 3FOPA 1NBBA 4IARA 2YL0A 4WGYA 4JEBA 5JP7A 3QW1A 2XLEA 3M79A 1YZCA 4NC3A 4CDYA 3NMJA 3HNLA 3IQ5A 3DE9A 4IB4A 3C63A 2XLHA 2J9BA 4CDVA 3L1MA 1CPRA 2YL1A 2YLIA 1CGNA 4D4NA 1YZAA 3M4BA 5JRAA 3QVYA 1QPUA 256BA 1YYXA 2XLWA 3ZTZA 3NMIA 1YYJA 5JVEA 2QLAA
chains in the Genus database with same CATH superfamily
1ORYA 4LACB 4BJ6A 2PX3A 2NUTB 2QUPA 1GS9A 3AOUA 3CZ6A 3EGDB 1XWJA 4P9FA 3QW0A 4Q7CA 4EBBA 4F4BA 2WZLA 2Z15A 4N6CA 2R7QA 3N24A 1HE1A 2Y3DA 3MYFA 4DRJB 4OIPF 1LPEA 4K7BA 3R7CA 1A7VA 4MVSA 3FDQA 3JT1A 4G0HA 4DJ9A 4JEAA 3L34A 1PD0A 4O6MA 1FAPB 2L6GA 2J0WA 2J9VA 2KQ9A 4EHPA 3U0CA 2PNOA 1IZMA 2R9RB 1RXQA 2WVQA 2DB4A 4IGGA 3ZVRA 2DGJA 1OKKA 1APCA 2XM0A 4JCZA 4EWCA 2E87A 1U6HA 3FVYA 2P1AA 4EBJA 1AEPA 5BQGA 3W2VA 2G62A 4DOZA 1JRAA 1CGOA 1EI7A 1LM3B 2VCAA 3LLIA 4XQ1A 5HV9A 1E85A 2CCYA 4CIPA 2HV6A 5BUOA 5K0IA 5JSLA 2OEVA 2LFDA 2Q9CA 5BQIA 3POVA 2R7XA 3DI5A 4N06A 3TOLA 2R05A 1A41A 5JS5A 3SYNA 1VLSA 1JR8A 4PJMA 2DI3A 1G4US 2YL3A 5DQZA 3TULA 1PD1A 5IY5C 3TK0A 4RD9A 3LESA 2R25A 4LLCA 4I1OB 3AG4C 3PCVA 3I5QA 1CGME 1M2VB 1O5HA 1E86A 2XS8A 4CS8C 4DBQA 5COFA 2IOQA 4I3MA 4MW3A 4IAQA 5DS4A 2UUIA 1RCPA 3K66A 1Z7Qc 2AP3A 2QY9A 1LVKA 1YDIA 4ER9A 1LS1A 4YT2A 3B71A 3DWWA 1LIHA 3GM2A 3X2QC 2QE9A 4KNWA 4C7OA 2OQMA 2AU5A 4EIYA 1MNDA 1GM5A 1ZHWA 4PJLA 1RKCA 4MQ9F 1RMVA 1EA8A 3JRTA 1JPNA 5E3CA 4IAOA 1YAUO 3T6JA 4LDQA 3C8GD 4DBRA 1WWPA 3RQFA 2AWYA 5COGA 3ZQVA 5L0IA 2YLGA 3GM1A 1T6IA 5AC4A 2D5RB 3T9OA 1XZPA 1CPQA 2J9WA 2L9JA 5GPGB 3GEHA 1VMAA 2NG1A 3GWLA 1LKXA 2HMZA 1MMNA 2IXPA 4IARA 5AC5A 1MMAA 1FFTC 1Y4CA 2WB7A 3JYHA 5E33A 4CS9A 4E0HA 1DOVA 1N1CA 2VB6A 4JEBA 4DVYP 3PDMP 3H2VA 1W2WA 1L7CA 3CSKA 3FXHA 2ZXOA 4CDYA 3K7DA 3HNLA 3IQ5A 4CSAA 2YQYA 2KNHA 3DM9B 4G7OF 4U5DE 3C63A 3A9CA 4BJ5A 3SNHA 2J9BA 5TJ5E 3T6BA 4XEVA 4CDVA 4H4KC 4WABA 4BEJA 3UGOA 4ZLDA 1CPRA 2OU6A 2YL1A 2L7AA 2PBEA 3DD7A 3DJNB 4U5EE 5CI8A 4B6IA 1Z23A 4NQFA 3WAQA 4ANJA 3M4BA 1Q0MA 1Q0FA 4G78A 1QKRA 4CSAC 1T9KA 4U5CE 4X0RA 5A69A 3OWTA 3ZTZA 1R5ID 1WN0A 1O3UA 2EIJC 1YYJA 2HZ8A 3AG3C 3SXMA 5A6BA 1HW1A 2TMVP 4C3DA 2QLAA 4WGZA 1G4WR 1LI7A 1Z63A 1ZHTA 4OD5A 1TFKB 4O7GA 1MMDA 2HV7A 2ZXRA 5EK0A 4YWQA 1PCXA 2JD3A 3GANA 3HNJA 4JTAB 5B3IA 2NUPA 5CIVA 4NTFA 1G5ZA 4XWJA 2M64A 3S90A 3WG7C 3U2LA 2PF4E 5DS5A 2KJGA 3B0PA 2VASA 1YA9A 4FWVA 2I15A 2Q9BA 3LEOA 4JW1A 4NCQA 1C17M 4CJOA 3S0XA 2EIMC 3C8GA 4Z9JA 4KI2A 4PFPA 3CAXA 3RQGA 2R7VA 3UMHA 1E83A 4U5FE 2IM8A 1NFNA 2DYSC 1NSGB 3RF3A 4Q4ZF 2GFHA 4CJGA 4U9DA 1A7DA 3KL4A 4JVSA 2LSEA 4ONSA 2X0CA 3Q6MA 4E18A 1ZZPA 3H2UA 1EKYA 3MLGA 3GODA 3TOMA 2CGEA 5L0FA 4I1MA 4O79A 2DYRC 1SR2A 4C7OB 4J32B 5FZTA 3JSZA 3RW0A 3EPVA 2IBFA 2HFIA 3EFOA 3KMIA 3V7OA 4ZLCA 2XL8A 1WASA 4BPMA 4JTDB 1WTYA 2EPMX 1O87A 2C03A 1NU7D 3TJ6A 3HNKA 2NSFA 4J7YA 3ZC4A 2WZFA 5E2QA 3K33A 3L8JA 1S05A 1FFHA 3MBGA 4YL1A 3IEEA 5KYNA 3AGTA 4MS2A 1K40A 3NG1A 1L3PA 4AE4A 1LE2A 2XLMA 2YZSA 4MVOA 1QZXA 3DKAA 1ZU4A 1OCOC 3LAYA 4FESA 2LK4A 4D4XA 4P6IC 2P6VA 1HMOA 4XEKA 1D1CA 1TWGA 2LCHA 1V4AA 1OCRC 3K1IA 2IXMA 4JZAA 3Q7LA 4RBNA 3RVYA 5L3VA 3EH2A 2LQGA 2GA0A 2W4BA 5DVWA 3VF0A 1QQ3A 3IQ6A 4K1OA 2EILC 3DE8A 1QVXA 2MHRA 4CS8A 5L0DA 2PX0A 2IXNA 2WVNA 2EPKX 2L6FA 4C3EA 3TJ5A 3EGXB 4R32A 4OD4A 3L0IA 2CNWD 3K1IC 5T3WA 2EIKC 4Z9HA 2WVOA 5A6BD 1BZ4A 4PFOA 2V26A 2GAQA 2VCCA 1BR1A 2WL8A 2R7UA 2VH3A 3DMDA 5JP7A 4XLPF 3VAYA 3M79A 1Y6DA 1YZCA 2L81A 4O6NA 3UNGC 1M56C 4BEMJ 2R7WA 5KYXB 3G4XA 2QNLA 1K04A 5BQHA 4HFFB 4AL1A 2H8AA 4IB4A 3FAJA 3M1CB 1H6GA 3AQCA 3NYLA 2BE5F 5D91A 4OINF 1VYKA 4MNDA 2I8BA 4YT5A 2NUPB 3QTHA 1VLTA 2YLIA 4LLEA 1TR2A 2LD6A 2XL4A 3BRJA 2G3KA 2PP4A 2QTVA 3LS1A 3RKOF 4QDLA 3V5XA 4DXWA 2ZD9A 1OCZC 4JTCB 1C03A 1RKEA 3PHF2 2KGOA 2OJQA 5L0JA 1LE4A 2XXAA 2HSBA 1H9GA 1OQCA 2A0BA 3C8GB 3NMIA 2ZXPA 3ATPA 4XLNF 3EJNA 4W8KA 5D92A 1M2OA 1YA7O 2P7VA 2NUTA 3O10A 4QI2A 3EGDA 3JTLO 3C7JA 4WJ0A 2HSQA 4FX5A 1TQGA 2J46A 2OOCA 1UG7A 3SXKA 4E7ZA 3DZAA 3B0UX 2A69F 5F5FA 3FAPB 3DAFA 2JX0A 3U2MA 3C8ZA 3LUTB 3ZG1A 3U9MA 2KC3A 2OG2A 1Z3IX 4G7HF 3IHUA 1Z5ZA 3NRHA 4JRZA 3ABMC 1K05A 4ULWA 2D4UA 3DJUB 3U8VA 1YLMA 2R02A 2XSEA 3LEVA 4PR9A 4AK9A 3EH1A 2Y3HA 1U0BB 4DRIB 2BC5A 1I4YA 1BR2A 2OEXA 2OJED 4YT4A 4IWBA 2AWCA 1OW6A 2J0XA 1S7ZA 1ZHXA 2M4EA 2UUHA 3C62A 3GEEA 4KC9A 3CQZA 3GWNA 4HEAJ 3RQEA 4XPYA 5FCLA 2CNWA 2RSEB 2HJMA 3GM3A 3N0TA 4XTKA 3C18A 3I4UA 3TD7A 4AE4B 5KYWA 1ORSC 3B0VC 2A1DD 5DS6A 4E7SA 3ABLC 1GQAA 3S9OA 1I4ZA 1TKNA 2XRHA 1T5OA 4PJJA 1LI5A 3A11A 3ZWIA 1T6UA 4YL0A 5AGFA 1D0ZA 5HSWA 3E9VA 2XLOA 1MNEA 1WGWA 1ORJA 1VOMA 2NSGA 3F47A 2YHSA 1OR3A 4M63A 4UDVA 3AJMA 3IQCA 1HMDA 2LFFA 2LIGA 1VTMP 4PJNA 2CDQA 2Q4FA 2BL2A 2Q00A 3HNIA 1M57C 3NMKA 4QI0A 1V55C 3DAGA 3RFYA 5B3SC 2GWWA 2IXOA 2VCBA 1OR2A 3NYJA 2HMQA 4U5BE 1D0YA 4XEFA 1JAFA 2W45A 3W8IA 3UMIA 3AQBA 3LNMB 3OA1A 4JC7A 1T6QA 1HW2A 3F46A 4JJGA 4JKVA 1R4TA 1ZVZA 2JPUA 3QMKA 1J8MF 2EPNA 1BBHA 3X1OA 4JIOA 1A7EA 1TWCA 4P9TA 1SF8A 3EG9A 4MVRA 3M4CA 4H54A 4AX2A 4EBKA 4MTFA 2XM4A 5EHHA 2J8WA 2F22A 2A6EF 4MVMA 3ASOC 1OXKA 3O39A 1JOGA 4GYTA 2Q7RA 4EKWA 4Q5SF 4BJ1A 1B68A 4KBLA 3ZTMA 4MVQA 2W4MA 4W8PA 3DM5A 2CW0F 3U3FA 1F1MA 5T1DB 2J7PD 2A0UA 2MYSA 5COMA 3WODF 1RKEB 1PV3A 1SYQA 2HS5A 2YL7A 3W2WA 1XZQA 1LS4A 1KTMA 3Q7GA 2XXAB 3VM6A 2R7RA 1Q0DA 1NBBA 1HE9A 4DVZA 2YL0A 3LS0A 3LNRA 2HJ3A 4WGYA 5L0GA 1H9TA 3SEOA 2H7BA 1TWAA 3QW1A 2V3CC 4AL0A 2XLEA 5EGYA 2KSFA 3NYMA 4NC3A 3T4RA 2AVKA 3NMJA 5B1BC 3ZSUA 2X51A 3JYYA 1KU2A 2MWQA 3KKBA 3DE9A 1V54C 3O6XA 1QSPA 2A6HF 2Q3TA 1V74B 3ECSA 4MW8A 1NG1A 3SZRA 4BJ6C 4LERA 3JSEO 3LLKA 1CGNA 4J7TA 4D4NA 1YZAA 3KYIA 4A2NB 3N2ZB 1ZW3A 3EZHA 3QVYA 5L0HA 1NU9C 3J06A 256BA 1YYXA 3EZIA 4OIRF 3G50A 2XLWA 2YWAA 3NKDA 1YVIA 1FNTc 2VC9A 3ASNC 1GGQA 2W9YA 3S29A 3WHNA 3ABKC 3ZDLA 5DQTA 2FFHA 3T6GB 5JVEA 4JURI 5KYWB 3V5YA 1FTSA 1OXBA 2Y39A 1RJ9A 5JLIA 4OIQF 3JCUQ 1DOWA 4CBEA 1TFOB 4HFKB 2P61A 3FHDA 3O55A 4YL3A 2ZPAA 4CDAA 4K0DA 2XLDA 5F28E 2H7OA 3HKKA 2YRFA 1Z6AA 3M15A 1WATA 1U89A 5KYUA 5JUAA 3FMSA 4BG0A 3R2PA 3KYJA 5KYYA 3HTKC 4U5GA 4A4AA 2Y69C 4YJWA 1C02A 3UMKA 1OCCC 3B29A 1M6TA 1NFOA 3SP1A 3VRCA 4N4WA 2YEVA 1BDJB 2FAPB 4E0IA 3UR3C 1JMWA 4GQHA 2R7SA 3FOOA 1NZEA 1AUEA 1D1AA 4N6HA 4ULVA 5B1AC 5L0CA 3EQLF 2ZXWC 1ZHZA 2J7PA 2Y3BA 1VK5A 2H7VC 4NTAA 1Q0GA 1AVOB 2C04A 3DXJF 1NLXA 3KPHA 3MX3A 4JJFA 1E84A 1E2XA 1T01A 5A6JA 3QZCA 3JRMO 2EPLX 4JCHA 1EQ1A 1TWHA 5L3QA 1MMGA 4CX9A 1UFBA 3VYWA 3W4YA 3U3BA 1Q0KA 3EG9B 1FMVA 3PMRA 3RYLA 2FGYA 2Y3GA 2ICWG 1YARO 2YLDA 3OEOA 4NTBA 3G4ZA 2XS1A 1JPJA 4FAPB 1G8XA 5JT4A 1IW7F 3AGUA 2XLVA 4J30B 2L6HA 3EFOB 3U8PA 2OCCC 4BJTA 3QVZA 2KW3C 4G7ZF 5DLJA 3U5SA 4E17A 3NDBB 3ZQYA 2CYDA 1ZU5A 4U9EA 2XL6A 1OW8A 4NY3A 4C3BA 2A68F 2HKVA 3ZIBA 2YKZA 3K1HA 2HUJA 3U9JA 3ITFA 2NPUA 2YVKA 4XPWA 2J45A 3I5PA 3RIPA 2G3VA 2ETSA 1SMYF 1MQVA 2OKUA 3B9QA 4I44A 4IRUA 4JE9A 3TQOA 5F5HA 1BR4A 3MFNA 4CS9C 4O6YA 1QLEC 4MVUA 3EGXA 1FMWA 4OIOF 1OKKD 2Q9AA 4L6RA 3V5ZA 3W8HA 5A6KA 4YT8A 2KK1A 3LJBA 4MTGA 2IYLD 2WZGA 3RVZA 4BJ5C 1M2VA 1ZHYA 4Z9IA 1KNYA 4U5HA 3FOPA 3EHMA 2ASRA 2J9UA 2PFDA 2RD9A 1D1BA 3US6A 4YK5A 5T3TA 4CIHA 3UGPA 1FR0A 3CEXA 5KYXA 1A0BA 3EHNA 3S84A 3Q6NA 1ZW2A 1RJ9B 4PACA 1YJGA 1I5NA 4RDAA 3L8IA 3BEHA 3IQTA 3HJCA 1WOLA 5E3AA 1ST6A 2XLHA 3H65A 2B0HA 3KH2A 4LDRA 3S27A 3JZ0A 2O9XA 4MTOA 5A6AA 3NKEA 3HLZA 3L1MA 3SXYA 4IJJA 3SXZA 5KYUB 2B0JA 4LDKA 1D0XA 3MYIA 2EINC 5KYYB 1HY5A 5JRAA 1VB5A 3GEIA 3K6BA 4KNVA 3RH3A 2R7TA 1QPUA 3S28A 3AG2C 1OW7A 2P0NA 4MVZA 1SZIA 4DRHB 4GEHA 1H7IA 4EUKB 1VYIA 2R7OA 4XPXA 2KYHA 2LP4A 4CS7A 3AG1C 4PK4A 4HE8D 3E70C 1ZYRF 1J8YF 2R03A 4YN0B 3IPMO 2EPOA 2GDCA 5CI9A 3GORA
chains in the Genus database with same CATH topology
4WGZA 5JLIA 3QW0A 4CDAA 2XLDA 3M15A 5B3IA 3HNJA 1A7VA 5JUAA 4JEAA 3VRCA 1M6TA 4N4WA 2BC5A 3FOOA 4CJOA 4ULVA 1APCA 2XM0A 3C62A 4N6HA 1E83A 1CGOA 1E84A 1LM3B 4CJGA 4U9DA 1E85A 2CCYA 4CIPA 1EKYA 1GQAA 5JSLA 4CX9A 3TOMA 3ZWIA 5AGFA 3TOLA 2XLOA 5JS5A 2YLDA 2YL3A 2XL8A 5JT4A 2XLVA 3HNIA 3NMKA 3U8PA 3HNKA 3QVZA 1S05A 3ZQYA 1E86A 1JAFA 4U9EA 2XL6A 2XLMA 4IAQA 1RCPA 2YKZA 4JKVA 4ER9A 1BBHA 4D4XA 3M4CA 1MQVA 4JE9A 4EIYA 2XM4A 2J8WA 1QQ3A 3IQ6A 3DE8A 3ZTMA 4L6RA 3ZQVA 2YLGA 2YL7A 1CPQA 3FOPA 1NBBA 4IARA 2YL0A 4WGYA 4JEBA 5JP7A 3QW1A 2XLEA 3M79A 1YZCA 4NC3A 4CDYA 3NMJA 3HNLA 3IQ5A 3DE9A 4IB4A 3C63A 2XLHA 2J9BA 4CDVA 3L1MA 1CPRA 2YL1A 2YLIA 1CGNA 4D4NA 1YZAA 3M4BA 5JRAA 3QVYA 1QPUA 256BA 1YYXA 2XLWA 3ZTZA 3NMIA 1YYJA 5JVEA 2QLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WGZ A;  5JLI A;  3QW0 A;  4CDA A;  2XLD A;  3M15 A;  5B3I A;  3HNJ A;  1A7V A;  5JUA A;  4JEA A;  3VRC A;  1M6T A;  4N4W A;  2BC5 A;  3FOO A;  4CJO A;  4ULV A;  1APC A;  2XM0 A;  3C62 A;  4N6H A;  1E83 A;  1CGO A;  1E84 A;  1LM3 B;  4CJG A;  4U9D A;  1E85 A;  2CCY A;  4CIP A;  1EKY A;  1GQA A;  5JSL A;  4CX9 A;  3TOM A;  3ZWI A;  5AGF A;  3TOL A;  2XLO A;  5JS5 A;  2YLD A;  2YL3 A;  2XL8 A;  5JT4 A;  2XLV A;  3HNI A;  3NMK A;  3U8P A;  3HNK A;  3QVZ A;  1S05 A;  3ZQY A;  1E86 A;  1JAF A;  4U9E A;  2XL6 A;  2XLM A;  4IAQ A;  1RCP A;  2YKZ A;  4JKV A;  4ER9 A;  1BBH A;  4D4X A;  3M4C A;  1MQV A;  4JE9 A;  4EIY A;  2XM4 A;  2J8W A;  1QQ3 A;  3IQ6 A;  3DE8 A;  3ZTM A;  4L6R A;  3ZQV A;  2YLG A;  2YL7 A;  1CPQ A;  3FOP A;  1NBB A;  4IAR A;  2YL0 A;  4WGY A;  4JEB A;  5JP7 A;  3QW1 A;  2XLE A;  3M79 A;  1YZC A;  4NC3 A;  4CDY A;  3NMJ A;  3HNL A;  3IQ5 A;  3DE9 A;  4IB4 A;  3C63 A;  2XLH A;  2J9B A;  4CDV A;  3L1M A;  1CPR A;  2YL1 A;  2YLI A;  1CGN A;  4D4N A;  1YZA A;  3M4B A;  5JRA A;  3QVY A;  1QPU A;  256B A;  1YYX A;  2XLW A;  3ZTZ A;  3NMI A;  1YYJ A;  5JVE A;  2QLA A; 
#chains in the Genus database with same CATH topology
 1ORY A;  4LAC B;  4BJ6 A;  2PX3 A;  2NUT B;  2QUP A;  1GS9 A;  3AOU A;  3CZ6 A;  3EGD B;  1XWJ A;  4P9F A;  3QW0 A;  4Q7C A;  4EBB A;  4F4B A;  2WZL A;  2Z15 A;  4N6C A;  2R7Q A;  3N24 A;  1HE1 A;  2Y3D A;  3MYF A;  4DRJ B;  4OIP F;  1LPE A;  4K7B A;  3R7C A;  1A7V A;  4MVS A;  3FDQ A;  3JT1 A;  4G0H A;  4DJ9 A;  4JEA A;  3L34 A;  1PD0 A;  4O6M A;  1FAP B;  2L6G A;  2J0W A;  2J9V A;  2KQ9 A;  4EHP A;  3U0C A;  2PNO A;  1IZM A;  2R9R B;  1RXQ A;  2WVQ A;  2DB4 A;  4IGG A;  3ZVR A;  2DGJ A;  1OKK A;  1APC A;  2XM0 A;  4JCZ A;  4EWC A;  2E87 A;  1U6H A;  3FVY A;  2P1A A;  4EBJ A;  1AEP A;  5BQG A;  3W2V A;  2G62 A;  4DOZ A;  1JRA A;  1CGO A;  1EI7 A;  1LM3 B;  2VCA A;  3LLI A;  4XQ1 A;  5HV9 A;  1E85 A;  2CCY A;  4CIP A;  2HV6 A;  5BUO A;  5K0I A;  5JSL A;  2OEV A;  2LFD A;  2Q9C A;  5BQI A;  3POV A;  2R7X A;  3DI5 A;  4N06 A;  3TOL A;  2R05 A;  1A41 A;  5JS5 A;  3SYN A;  1VLS A;  1JR8 A;  4PJM A;  2DI3 A;  1G4U S;  2YL3 A;  5DQZ A;  3TUL A;  1PD1 A;  5IY5 C;  3TK0 A;  4RD9 A;  3LES A;  2R25 A;  4LLC A;  4I1O B;  3AG4 C;  3PCV A;  3I5Q A;  1CGM E;  1M2V B;  1O5H A;  1E86 A;  2XS8 A;  4CS8 C;  4DBQ A;  5COF A;  2IOQ A;  4I3M A;  4MW3 A;  4IAQ A;  5DS4 A;  2UUI A;  1RCP A;  3K66 A;  1Z7Q c;  2AP3 A;  2QY9 A;  1LVK A;  1YDI A;  4ER9 A;  1LS1 A;  4YT2 A;  3B71 A;  3DWW A;  1LIH A;  3GM2 A;  3X2Q C;  2QE9 A;  4KNW A;  4C7O A;  2OQM A;  2AU5 A;  4EIY A;  1MND A;  1GM5 A;  1ZHW A;  4PJL A;  1RKC A;  4MQ9 F;  1RMV A;  1EA8 A;  3JRT A;  1JPN A;  5E3C A;  4IAO A;  1YAU O;  3T6J A;  4LDQ A;  3C8G D;  4DBR A;  1WWP A;  3RQF A;  2AWY A;  5COG A;  3ZQV A;  5L0I A;  2YLG A;  3GM1 A;  1T6I A;  5AC4 A;  2D5R B;  3T9O A;  1XZP A;  1CPQ A;  2J9W A;  2L9J A;  5GPG B;  3GEH A;  1VMA A;  2NG1 A;  3GWL A;  1LKX A;  2HMZ A;  1MMN A;  2IXP A;  4IAR A;  5AC5 A;  1MMA A;  1FFT C;  1Y4C A;  2WB7 A;  3JYH A;  5E33 A;  4CS9 A;  4E0H A;  1DOV A;  1N1C A;  2VB6 A;  4JEB A;  4DVY P;  3PDM P;  3H2V A;  1W2W A;  1L7C A;  3CSK A;  3FXH A;  2ZXO A;  4CDY A;  3K7D A;  3HNL A;  3IQ5 A;  4CSA A;  2YQY A;  2KNH A;  3DM9 B;  4G7O F;  4U5D E;  3C63 A;  3A9C A;  4BJ5 A;  3SNH A;  2J9B A;  5TJ5 E;  3T6B A;  4XEV A;  4CDV A;  4H4K C;  4WAB A;  4BEJ A;  3UGO A;  4ZLD A;  1CPR A;  2OU6 A;  2YL1 A;  2L7A A;  2PBE A;  3DD7 A;  3DJN B;  4U5E E;  5CI8 A;  4B6I A;  1Z23 A;  4NQF A;  3WAQ A;  4ANJ A;  3M4B A;  1Q0M A;  1Q0F A;  4G78 A;  1QKR A;  4CSA C;  1T9K A;  4U5C E;  4X0R A;  5A69 A;  3OWT A;  3ZTZ A;  1R5I D;  1WN0 A;  1O3U A;  2EIJ C;  1YYJ A;  2HZ8 A;  3AG3 C;  3SXM A;  5A6B A;  1HW1 A;  2TMV P;  4C3D A;  2QLA A;  4WGZ A;  1G4W R;  1LI7 A;  1Z63 A;  1ZHT A;  4OD5 A;  1TFK B;  4O7G A;  1MMD A;  2HV7 A;  2ZXR A;  5EK0 A;  4YWQ A;  1PCX A;  2JD3 A;  3GAN A;  3HNJ A;  4JTA B;  5B3I A;  2NUP A;  5CIV A;  4NTF A;  1G5Z A;  4XWJ A;  2M64 A;  3S90 A;  3WG7 C;  3U2L A;  2PF4 E;  5DS5 A;  2KJG A;  3B0P A;  2VAS A;  1YA9 A;  4FWV A;  2I15 A;  2Q9B A;  3LEO A;  4JW1 A;  4NCQ A;  1C17 M;  4CJO A;  3S0X A;  2EIM C;  3C8G A;  4Z9J A;  4KI2 A;  4PFP A;  3CAX A;  3RQG A;  2R7V A;  3UMH A;  1E83 A;  4U5F E;  2IM8 A;  1NFN A;  2DYS C;  1NSG B;  3RF3 A;  4Q4Z F;  2GFH A;  4CJG A;  4U9D A;  1A7D A;  3KL4 A;  4JVS A;  2LSE A;  4ONS A;  2X0C A;  3Q6M A;  4E18 A;  1ZZP A;  3H2U A;  1EKY A;  3MLG A;  3GOD A;  3TOM A;  2CGE A;  5L0F A;  4I1M A;  4O79 A;  2DYR C;  1SR2 A;  4C7O B;  4J32 B;  5FZT A;  3JSZ A;  3RW0 A;  3EPV A;  2IBF A;  2HFI A;  3EFO A;  3KMI A;  3V7O A;  4ZLC A;  2XL8 A;  1WAS A;  4BPM A;  4JTD B;  1WTY A;  2EPM X;  1O87 A;  2C03 A;  1NU7 D;  3TJ6 A;  3HNK A;  2NSF A;  4J7Y A;  3ZC4 A;  2WZF A;  5E2Q A;  3K33 A;  3L8J A;  1S05 A;  1FFH A;  3MBG A;  4YL1 A;  3IEE A;  5KYN A;  3AGT A;  4MS2 A;  1K40 A;  3NG1 A;  1L3P A;  4AE4 A;  1LE2 A;  2XLM A;  2YZS A;  4MVO A;  1QZX A;  3DKA A;  1ZU4 A;  1OCO C;  3LAY A;  4FES A;  2LK4 A;  4D4X A;  4P6I C;  2P6V A;  1HMO A;  4XEK A;  1D1C A;  1TWG A;  2LCH A;  1V4A A;  1OCR C;  3K1I A;  2IXM A;  4JZA A;  3Q7L A;  4RBN A;  3RVY A;  5L3V A;  3EH2 A;  2LQG A;  2GA0 A;  2W4B A;  5DVW A;  3VF0 A;  1QQ3 A;  3IQ6 A;  4K1O A;  2EIL C;  3DE8 A;  1QVX A;  2MHR A;  4CS8 A;  5L0D A;  2PX0 A;  2IXN A;  2WVN A;  2EPK X;  2L6F A;  4C3E A;  3TJ5 A;  3EGX B;  4R32 A;  4OD4 A;  3L0I A;  2CNW D;  3K1I C;  5T3W A;  2EIK C;  4Z9H A;  2WVO A;  5A6B D;  1BZ4 A;  4PFO A;  2V26 A;  2GAQ A;  2VCC A;  1BR1 A;  2WL8 A;  2R7U A;  2VH3 A;  3DMD A;  5JP7 A;  4XLP F;  3VAY A;  3M79 A;  1Y6D A;  1YZC A;  2L81 A;  4O6N A;  3UNG C;  1M56 C;  4BEM J;  2R7W A;  5KYX B;  3G4X A;  2QNL A;  1K04 A;  5BQH A;  4HFF B;  4AL1 A;  2H8A A;  4IB4 A;  3FAJ A;  3M1C B;  1H6G A;  3AQC A;  3NYL A;  2BE5 F;  5D91 A;  4OIN F;  1VYK A;  4MND A;  2I8B A;  4YT5 A;  2NUP B;  3QTH A;  1VLT A;  2YLI A;  4LLE A;  1TR2 A;  2LD6 A;  2XL4 A;  3BRJ A;  2G3K A;  2PP4 A;  2QTV A;  3LS1 A;  3RKO F;  4QDL A;  3V5X A;  4DXW A;  2ZD9 A;  1OCZ C;  4JTC B;  1C03 A;  1RKE A;  3PHF 2;  2KGO A;  2OJQ A;  5L0J A;  1LE4 A;  2XXA A;  2HSB A;  1H9G A;  1OQC A;  2A0B A;  3C8G B;  3NMI A;  2ZXP A;  3ATP A;  4XLN F;  3EJN A;  4W8K A;  5D92 A;  1M2O A;  1YA7 O;  2P7V A;  2NUT A;  3O10 A;  4QI2 A;  3EGD A;  3JTL O;  3C7J A;  4WJ0 A;  2HSQ A;  4FX5 A;  1TQG A;  2J46 A;  2OOC A;  1UG7 A;  3SXK A;  4E7Z A;  3DZA A;  3B0U X;  2A69 F;  5F5F A;  3FAP B;  3DAF A;  2JX0 A;  3U2M A;  3C8Z A;  3LUT B;  3ZG1 A;  3U9M A;  2KC3 A;  2OG2 A;  1Z3I X;  4G7H F;  3IHU A;  1Z5Z A;  3NRH A;  4JRZ A;  3ABM C;  1K05 A;  4ULW A;  2D4U A;  3DJU B;  3U8V A;  1YLM A;  2R02 A;  2XSE A;  3LEV A;  4PR9 A;  4AK9 A;  3EH1 A;  2Y3H A;  1U0B B;  4DRI B;  2BC5 A;  1I4Y A;  1BR2 A;  2OEX A;  2OJE D;  4YT4 A;  4IWB A;  2AWC A;  1OW6 A;  2J0X A;  1S7Z A;  1ZHX A;  2M4E A;  2UUH A;  3C62 A;  3GEE A;  4KC9 A;  3CQZ A;  3GWN A;  4HEA J;  3RQE A;  4XPY A;  5FCL A;  2CNW A;  2RSE B;  2HJM A;  3GM3 A;  3N0T A;  4XTK A;  3C18 A;  3I4U A;  3TD7 A;  4AE4 B;  5KYW A;  1ORS C;  3B0V C;  2A1D D;  5DS6 A;  4E7S A;  3ABL C;  1GQA A;  3S9O A;  1I4Z A;  1TKN A;  2XRH A;  1T5O A;  4PJJ A;  1LI5 A;  3A11 A;  3ZWI A;  1T6U A;  4YL0 A;  5AGF A;  1D0Z A;  5HSW A;  3E9V A;  2XLO A;  1MNE A;  1WGW A;  1ORJ A;  1VOM A;  2NSG A;  3F47 A;  2YHS A;  1OR3 A;  4M63 A;  4UDV A;  3AJM A;  3IQC A;  1HMD A;  2LFF A;  2LIG A;  1VTM P;  4PJN A;  2CDQ A;  2Q4F A;  2BL2 A;  2Q00 A;  3HNI A;  1M57 C;  3NMK A;  4QI0 A;  1V55 C;  3DAG A;  3RFY A;  5B3S C;  2GWW A;  2IXO A;  2VCB A;  1OR2 A;  3NYJ A;  2HMQ A;  4U5B E;  1D0Y A;  4XEF A;  1JAF A;  2W45 A;  3W8I A;  3UMI A;  3AQB A;  3LNM B;  3OA1 A;  4JC7 A;  1T6Q A;  1HW2 A;  3F46 A;  4JJG A;  4JKV A;  1R4T A;  1ZVZ A;  2JPU A;  3QMK A;  1J8M F;  2EPN A;  1BBH A;  3X1O A;  4JIO A;  1A7E A;  1TWC A;  4P9T A;  1SF8 A;  3EG9 A;  4MVR A;  3M4C A;  4H54 A;  4AX2 A;  4EBK A;  4MTF A;  2XM4 A;  5EHH A;  2J8W A;  2F22 A;  2A6E F;  4MVM A;  3ASO C;  1OXK A;  3O39 A;  1JOG A;  4GYT A;  2Q7R A;  4EKW A;  4Q5S F;  4BJ1 A;  1B68 A;  4KBL A;  3ZTM A;  4MVQ A;  2W4M A;  4W8P A;  3DM5 A;  2CW0 F;  3U3F A;  1F1M A;  5T1D B;  2J7P D;  2A0U A;  2MYS A;  5COM A;  3WOD F;  1RKE B;  1PV3 A;  1SYQ A;  2HS5 A;  2YL7 A;  3W2W A;  1XZQ A;  1LS4 A;  1KTM A;  3Q7G A;  2XXA B;  3VM6 A;  2R7R A;  1Q0D A;  1NBB A;  1HE9 A;  4DVZ A;  2YL0 A;  3LS0 A;  3LNR A;  2HJ3 A;  4WGY A;  5L0G A;  1H9T A;  3SEO A;  2H7B A;  1TWA A;  3QW1 A;  2V3C C;  4AL0 A;  2XLE A;  5EGY A;  2KSF A;  3NYM A;  4NC3 A;  3T4R A;  2AVK A;  3NMJ A;  5B1B C;  3ZSU A;  2X51 A;  3JYY A;  1KU2 A;  2MWQ A;  3KKB A;  3DE9 A;  1V54 C;  3O6X A;  1QSP A;  2A6H F;  2Q3T A;  1V74 B;  3ECS A;  4MW8 A;  1NG1 A;  3SZR A;  4BJ6 C;  4LER A;  3JSE O;  3LLK A;  1CGN A;  4J7T A;  4D4N A;  1YZA A;  3KYI A;  4A2N B;  3N2Z B;  1ZW3 A;  3EZH A;  3QVY A;  5L0H A;  1NU9 C;  3J06 A;  256B A;  1YYX A;  3EZI A;  4OIR F;  3G50 A;  2XLW A;  2YWA A;  3NKD A;  1YVI A;  1FNT c;  2VC9 A;  3ASN C;  1GGQ A;  2W9Y A;  3S29 A;  3WHN A;  3ABK C;  3ZDL A;  5DQT A;  2FFH A;  3T6G B;  5JVE A;  4JUR I;  5KYW B;  3V5Y A;  1FTS A;  1OXB A;  2Y39 A;  1RJ9 A;  5JLI A;  4OIQ F;  3JCU Q;  1DOW A;  4CBE A;  1TFO B;  4HFK B;  2P61 A;  3FHD A;  3O55 A;  4YL3 A;  2ZPA A;  4CDA A;  4K0D A;  2XLD A;  5F28 E;  2H7O A;  3HKK A;  2YRF A;  1Z6A A;  3M15 A;  1WAT A;  1U89 A;  5KYU A;  5JUA A;  3FMS A;  4BG0 A;  3R2P A;  3KYJ A;  5KYY A;  3HTK C;  4U5G A;  4A4A A;  2Y69 C;  4YJW A;  1C02 A;  3UMK A;  1OCC C;  3B29 A;  1M6T A;  1NFO A;  3SP1 A;  3VRC A;  4N4W A;  2YEV A;  1BDJ B;  2FAP B;  4E0I A;  3UR3 C;  1JMW A;  4GQH A;  2R7S A;  3FOO A;  1NZE A;  1AUE A;  1D1A A;  4N6H A;  4ULV A;  5B1A C;  5L0C A;  3EQL F;  2ZXW C;  1ZHZ A;  2J7P A;  2Y3B A;  1VK5 A;  2H7V C;  4NTA A;  1Q0G A;  1AVO B;  2C04 A;  3DXJ F;  1NLX A;  3KPH A;  3MX3 A;  4JJF A;  1E84 A;  1E2X A;  1T01 A;  5A6J A;  3QZC A;  3JRM O;  2EPL X;  4JCH A;  1EQ1 A;  1TWH A;  5L3Q A;  1MMG A;  4CX9 A;  1UFB A;  3VYW A;  3W4Y A;  3U3B A;  1Q0K A;  3EG9 B;  1FMV A;  3PMR A;  3RYL A;  2FGY A;  2Y3G A;  2ICW G;  1YAR O;  2YLD A;  3OEO A;  4NTB A;  3G4Z A;  2XS1 A;  1JPJ A;  4FAP B;  1G8X A;  5JT4 A;  1IW7 F;  3AGU A;  2XLV A;  4J30 B;  2L6H A;  3EFO B;  3U8P A;  2OCC C;  4BJT A;  3QVZ A;  2KW3 C;  4G7Z F;  5DLJ A;  3U5S A;  4E17 A;  3NDB B;  3ZQY A;  2CYD A;  1ZU5 A;  4U9E A;  2XL6 A;  1OW8 A;  4NY3 A;  4C3B A;  2A68 F;  2HKV A;  3ZIB A;  2YKZ A;  3K1H A;  2HUJ A;  3U9J A;  3ITF A;  2NPU A;  2YVK A;  4XPW A;  2J45 A;  3I5P A;  3RIP A;  2G3V A;  2ETS A;  1SMY F;  1MQV A;  2OKU A;  3B9Q A;  4I44 A;  4IRU A;  4JE9 A;  3TQO A;  5F5H A;  1BR4 A;  3MFN A;  4CS9 C;  4O6Y A;  1QLE C;  4MVU A;  3EGX A;  1FMW A;  4OIO F;  1OKK D;  2Q9A A;  4L6R A;  3V5Z A;  3W8H A;  5A6K A;  4YT8 A;  2KK1 A;  3LJB A;  4MTG A;  2IYL D;  2WZG A;  3RVZ A;  4BJ5 C;  1M2V A;  1ZHY A;  4Z9I A;  1KNY A;  4U5H A;  3FOP A;  3EHM A;  2ASR A;  2J9U A;  2PFD A;  2RD9 A;  1D1B A;  3US6 A;  4YK5 A;  5T3T A;  4CIH A;  3UGP A;  1FR0 A;  3CEX A;  5KYX A;  1A0B A;  3EHN A;  3S84 A;  3Q6N A;  1ZW2 A;  1RJ9 B;  4PAC A;  1YJG A;  1I5N A;  4RDA A;  3L8I A;  3BEH A;  3IQT A;  3HJC A;  1WOL A;  5E3A A;  1ST6 A;  2XLH A;  3H65 A;  2B0H A;  3KH2 A;  4LDR A;  3S27 A;  3JZ0 A;  2O9X A;  4MTO A;  5A6A A;  3NKE A;  3HLZ A;  3L1M A;  3SXY A;  4IJJ A;  3SXZ A;  5KYU B;  2B0J A;  4LDK A;  1D0X A;  3MYI A;  2EIN C;  5KYY B;  1HY5 A;  5JRA A;  1VB5 A;  3GEI A;  3K6B A;  4KNV A;  3RH3 A;  2R7T A;  1QPU A;  3S28 A;  3AG2 C;  1OW7 A;  2P0N A;  4MVZ A;  1SZI A;  4DRH B;  4GEH A;  1H7I A;  4EUK B;  1VYI A;  2R7O A;  4XPX A;  2KYH A;  2LP4 A;  4CS7 A;  3AG1 C;  4PK4 A;  4HE8 D;  3E70 C;  1ZYR F;  1J8Y F;  2R03 A;  4YN0 B;  3IPM O;  2EPO A;  2GDC A;  5CI9 A;  3GOR A; 
#chains in the Genus database with same CATH homology
 4WGZ A;  5JLI A;  3QW0 A;  4CDA A;  2XLD A;  3M15 A;  5B3I A;  3HNJ A;  1A7V A;  5JUA A;  4JEA A;  3VRC A;  1M6T A;  4N4W A;  2BC5 A;  3FOO A;  4CJO A;  4ULV A;  1APC A;  2XM0 A;  3C62 A;  4N6H A;  1E83 A;  1CGO A;  1E84 A;  1LM3 B;  4CJG A;  4U9D A;  1E85 A;  2CCY A;  4CIP A;  1EKY A;  1GQA A;  5JSL A;  4CX9 A;  3TOM A;  3ZWI A;  5AGF A;  3TOL A;  2XLO A;  5JS5 A;  2YLD A;  2YL3 A;  2XL8 A;  5JT4 A;  2XLV A;  3HNI A;  3NMK A;  3U8P A;  3HNK A;  3QVZ A;  1S05 A;  3ZQY A;  1E86 A;  1JAF A;  4U9E A;  2XL6 A;  2XLM A;  4IAQ A;  1RCP A;  2YKZ A;  4JKV A;  4ER9 A;  1BBH A;  4D4X A;  3M4C A;  1MQV A;  4JE9 A;  4EIY A;  2XM4 A;  2J8W A;  1QQ3 A;  3IQ6 A;  3DE8 A;  3ZTM A;  4L6R A;  3ZQV A;  2YLG A;  2YL7 A;  1CPQ A;  3FOP A;  1NBB A;  4IAR A;  2YL0 A;  4WGY A;  4JEB A;  5JP7 A;  3QW1 A;  2XLE A;  3M79 A;  1YZC A;  4NC3 A;  4CDY A;  3NMJ A;  3HNL A;  3IQ5 A;  3DE9 A;  4IB4 A;  3C63 A;  2XLH A;  2J9B A;  4CDV A;  3L1M A;  1CPR A;  2YL1 A;  2YLI A;  1CGN A;  4D4N A;  1YZA A;  3M4B A;  5JRA A;  3QVY A;  1QPU A;  256B A;  1YYX A;  2XLW A;  3ZTZ A;  3NMI A;  1YYJ A;  5JVE A;  2QLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...