4U9EA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
91
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 91
sequence length 106
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9eA00
4D4XA 2J8WA 2XL6A 4JEBA 4CIPA 4L6RA 2CCYA 1MQVA 1E85A 5B3IA 4ULVA 2YLGA 4IAQA 1LM3B 3TOLA 2XLWA 4WGZA 4CDVA 1QPUA 1CPQA 3QW0A 1QQ3A 3ZTMA 4CDAA 1CGNA 5JS5A 1JAFA 2YKZA 2QLAA 3M79A 1CGOA 1YYJA 3ZTZA 2XLEA 3TOMA 2XLMA 2BC5A 2XM4A 4IB4A 2XLDA 1M6TA 3HNKA 3HNIA 4CJGA 5JUAA 1EKYA 2XLVA 2YLDA 3FOOA 1GQAA 2YL3A 5AGFA 3ZQVA 2XL8A 1CPRA 4U9EA 2XM0A 2YLIA 5JLIA 4ER9A 3QVZA 1E83A 4U9DA 5JT4A 4IARA 4D4NA 3QW1A 4EIYA 4JEAA 3NMJA 1RCPA 1A7VA 3IQ6A 3ZQYA 1NBBA 256BA 1E84A 4N4WA 3NMKA 1YZCA 3VRCA 1E86A 3M15A 3IQ5A 2YL0A 1YYXA 3U8PA 1S05A 5JRAA 1YZAA 3C63A 1BBHA 5JSLA 3L1MA 4NC3A 4CDYA 3C62A 2YL7A 5JVEA 2XLHA 2YL1A 3DE8A 1APCA 4N6HA 2XLOA 3NMIA 4JE9A 3M4BA 3DE9A 5JP7A 3HNLA 3HNJA 3QVYA 3ZWIA 3FOPA 4CJOA 2J9BA 4CX9A 3M4CA 4JKVA 4WGYA
chains in the Genus database with same CATH superfamily
2J0WA 4JURI 3G50A 1YA9A 3DXJF 2OCCC 3AG2C 5K0IA 1TKNA 4CIPA 3MX3A 4C7OA 3UR3C 1DOWA 3AG1C 4L6RA 3SXMA 4JZAA 1A7DA 2R7XA 3RQEA 1BZ4A 1JPNA 3KKBA 5L0GA 4G7HF 1HW2A 1JR8A 3NKDA 3EH2A 2DB4A 3K7DA 4NTAA 4EBJA 3H2UA 3U3FA 1FMWA 1ZVZA 2F22A 2LQGA 3L34A 1FR0A 2IXPA 1SMYF 3LEVA 4FWVA 4MNDA 4I3MA 3I5QA 2AP3A 4PK4A 2HJMA 5T1DB 5D92A 2A0UA 3QW0A 3I4UA 3LESA 4U5GA 4A4AA 3GM1A 2R03A 2D4UA 4M63A 1KU2A 4U5BE 3UGOA 4LDKA 1G4US 1XZQA 1CGNA 4QDLA 1M2VA 4EBBA 2H7OA 1VLSA 4JW1A 4E0HA 5BQIA 1SR2A 4GYTA 3RW0A 1JAFA 1NFOA 1WWPA 2YKZA 3ASOC 5E3CA 2X0CA 1SYQA 2QLAA 1NZEA 4PJMA 1G8XA 5BQHA 5KYXB 1I4YA 2LD6A 3JYHA 5A6AA 1WASA 1YVIA 4P9TA 4QI0A 4A2NB 3SXZA 3B0VC 1XWJA 2XM4A 4HFKB 3VAYA 1LI5A 3O10A 3B71A 5DQTA 4MTFA 2Q4FA 1M6TA 2EPOA 2PFDA 2J0XA 2NUPA 2VB6A 2XLDA 3AQBA 3DI5A 5DLJA 3H2VA 3Q6MA 5KYWB 2AWCA 4OIPF 5F5FA 3NYMA 4MVMA 3LUTB 2KW3C 1OCCC 1ZW2A 3FXHA 3L0IA 3S9OA 2GWWA 3SZRA 3PHF2 2XLVA 3AG3C 2LP4A 3CSKA 1LVKA 2VCAA 1TQGA 3IQTA 4O6MA 2UUHA 4O79A 5AGFA 3WHNA 3NDBB 4BEMJ 4C7OB 1ORJA 1CPRA 4E7ZA 2HV6A 2JX0A 2G62A 2YLIA 3EJNA 2ICWG 3N0TA 3F47A 2G3VA 4HEAJ 2ETSA 5T3TA 4BPMA 4DBRA 5L0CA 5JT4A 2WB7A 3TJ5A 2DYRC 3ZDLA 4JEAA 3AGUA 1RCPA 3L8JA 5E2QA 3RVYA 1XZPA 2ZPAA 1OW6A 4BG0A 1GM5A 4JTCB 3DMDA 5CIVA 4CS8A 1EQ1A 2W4MA 4P9FA 3VRCA 3VM6A 1E86A 1G4WR 1PV3A 4G0HA 4G7ZF 1YYXA 3EZHA 3U8PA 5B1AC 3I5PA 4Z9IA 1TFOB 1FTSA 3O6XA 1A41A 1M2VB 2R7VA 1EI7A 4ULWA 1J8MF 4CDYA 3DJNB 4CS9A 2YL7A 4E18A 3O39A 3S84A 5KYYB 1V4AA 4Q4ZF 2XXAB 3VF0A 1O3UA 2Q7RA 3T6BA 3JRTA 3FAJA 2W45A 2XLOA 3MYFA 4GEHA 1SF8A 3M4BA 4NQFA 3W4YA 1K05A 3DWWA 4KC9A 5BUOA 3W2WA 2L81A 2PBEA 1MMAA 3ABMC 2L9JA 5KYUA 1NFNA 2HMQA 2QNLA 4MW3A 3TD7A 5B1BC 4CSAA 3ZWIA 1QKRA 3ZVRA 3OWTA 3IQCA 4K1OA 3GEIA 2W9YA 4DRIB 3JRMO 4DXWA 5L0IA 3RFYA 1HMOA 3FMSA 2ZD9A 4U5HA 4CX9A 1ORYA 2P7VA 4NY3A 4C3DA 5IY5C 3POVA 2EINC 1OCRC 3PCVA 1E2XA 1NG1A 2GDCA 2Y3GA 1YARO 3LLIA 1OKKD 1O87A 3GODA 5E33A 4EUKB 4JIOA 4BJ6A 2PP4A 4HE8D 5EHHA 2CCYA 2WVQA 1TFKB 2VC9A 3CQZA 1WTYA 1WN0A 2CDQA 2VH3A 2R9RB 1K04A 2A1DD 4KNWA 1Z6AA 2H8AA 1VMAA 3NYLA 2KK1A 2L6GA 4H54A 1LM3B 4IAQA 1T9KA 5GPGB 3RQGA 1L7CA 4MW8A 4UDVA 4WGZA 2ZXWC 2Q9BA 3EG9A 1HW1A 3MYIA 4CDVA 4EKWA 1S7ZA 2W4BA 2XS8A 3KL4A 3JSZA 1QPUA 4EBKA 1ZW3A 2M4EA 3LNMB 3NKEA 2OEVA 4C3BA 4YN0B 2OOCA 2J45A 2R05A 3RIPA 4AX2A 2Y39A 3KH2A 4Z9JA 3V5XA 5L3VA 4EHPA 5L0JA 4YWQA 4MTGA 4JC7A 4CS7A 4LLEA 4CIHA 3GEEA 1PD1A 3LJBA 2NUTA 2IBFA 2H7VC 3WG7C 3ITFA 5EGYA 2J9VA 3IHUA 5AC4A 1MMDA 2LCHA 3A9CA 3NG1A 1ST6A 5KYNA 1YDIA 4XTKA 3UGPA 3S0XA 3K6BA 3ZTZA 3QTHA 4E7SA 3JCUQ 4XWJA 2OQMA 1SZIA 2FGYA 3LLKA 3ZC4A 3Q6NA 2KQ9A 4IB4A 1ZHTA 3BRJA 1A7EA 2O9XA 3UNGC 4MVUA 3HNKA 5CI9A 4KI2A 1V74B 4I1MA 1HMDA 4O6YA 4J7TA 3S28A 2TMVP 4C3EA 4KNVA 2DI3A 2HSQA 4I1OB 4J30B 3AQCA 3OEOA 1Q0DA 1GQAA 1T01A 3BEHA 3MFNA 3EHMA 4E17A 4U9EA 2OG2A 1FFHA 2ZXOA 5E3AA 2XM0A 3U2LA 4CS8C 5JLIA 4ER9A 4IRUA 3AJMA 1VYKA 3GM3A 1I4ZA 3ABLC 2KYHA 2LFDA 1M2OA 2EIMC 1LKXA 3C8ZA 3X2QC 4U5FE 3US6A 4CBEA 4D4NA 2R02A 1C03A 1HY5A 2NSGA 3V7OA 3VYWA 4WABA 1ZHZA 3KYJA 4R32A 3HJCA 2WZFA 3B0PA 1YAUO 4N6CA 3AGTA 1Z3IX 3DM5A 3ZQYA 3T6GB 4AL0A 3NRHA 3U2MA 2ASRA 2P1AA 3NMKA 4XEFA 3EGXA 3M4CA 5COFA 2M64A 4DJ9A 3PDMP 1WGWA 3F46A 1VLTA 2R7QA 3IQ5A 3M15A 3U5SA 2KGOA 1MNEA 3W8IA 4DOZA 1OCOC 3ZSUA 2C03A 3K1IA 4FESA 1D0YA 3QMKA 5JRAA 3C63A 2IOQA 1HE1A 4O6NA 1WOLA 1PD0A 4NTFA 4ANJA 1TWGA 2RSEB 4XLPF 5DS6A 1ZYRF 4RBNA 4YL3A 2Y3BA 3TULA 2NG1A 3NMIA 1BR1A 1HE9A 4RD9A 2XS1A 3SYNA 3E9VA 1Z63A 1Z5ZA 2ZXRA 3EGDA 1DOVA 3SNHA 5F5HA 4BJ6C 1LS4A 3HLZA 1H9GA 4IAOA 2J9BA 1M57C 3H65A 4MVRA 4K7BA 3Q7LA 1FFTC 4JKVA 4WGYA 4D4XA 2J7PA 4BEJA 1O5HA 1OXBA 2J9WA 4PJNA 2EIKC 2XL6A 1Y4CA 2L6FA 5DVWA 1T6QA 1UG7A 1R5ID 1OCZC 3A11A 3DAFA 3DJUB 3IEEA 4JVSA 1FMVA 2HKVA 4YT5A 3LAYA 3S27A 5B3SC 3CZ6A 3EHNA 3EZIA 1MQVA 1ORSC 2XSEA 1NLXA 2LFFA 2WL8A 3EH1A 3RKOF 4ULVA 4B6IA 3E70C 4YT2A 2XL4A 3JZ0A 1E85A 2CNWD 3U0CA 2YLGA 3FVYA 1G5ZA 2MHRA 2CNWA 2HFIA 3TOLA 4MVZA 1MNDA 2YHSA 2BE5F 3ATPA 1JMWA 1TWHA 3EQLF 4IJJA 1D1CA 1RKEA 1QZXA 2YEVA 4YL1A 2LK4A 3IPMO 3X1OA 3JYYA 2XRHA 2NPUA 3EGXB 2NUPB 2YWAA 3DKAA 3ZTMA 3RQFA 5FCLA 1Q0KA 2AU5A 2L7AA 2NSFA 4I44A 4OIOF 2PX3A 1PCXA 1NSGB 2JPUA 2YVKA 4JCZA 2P61A 2Y69C 1D1BA 5JS5A 3JSEO 3TK0A 3G4ZA 3OA1A 1ZZPA 4IWBA 2R25A 2MWQA 3T6JA 3M79A 4NCQA 1CGOA 2VCCA 2B0JA 1D0ZA 4ZLCA 2J9UA 4K0DA 1YYJA 1BDJB 2XLEA 4LLCA 1Q0MA 4XEVA 5T3WA 5AC5A 1ZHWA 1OR2A 4W8PA 3TOMA 2BC5A 2IXNA 2G3KA 2V26A 2DYSC 2Q00A 5A6JA 4AK9A 1NU7D 1EA8A 1UFBA 1VTMP 3HNIA 1VB5A 1R4TA 2WZLA 1GGQA 4BJ1A 3C8GD 4DBQA 4ONSA 4G78A 2LSEA 4LDRA 3T9OA 3C8GA 3V5ZA 5JUAA 3JTLO 3U9JA 2R7TA 1M56C 1F1MA 1LE4A 2R7OA 2YLDA 3NYJA 5D91A 3R2PA 3W8HA 1JOGA 3GM2A 4F4BA 2YL3A 3SP1A 3WAQA 5DS5A 2V3CC 3N2ZB 1U6HA 1V54C 3TJ6A 4X0RA 3AOUA 5L0HA 1VK5A 2QTVA 3QVZA 4XPYA 2GAQA 3QZCA 5COGA 5F28E 3V5YA 3B9QA 3FHDA 2A68F 1KTMA 4EIYA 3QW1A 1QSPA 4GQHA 1A7VA 3K33A 3K1HA 3KMIA 3ZG1A 1KNYA 2MYSA 4AL1A 1ZHYA 3R7CA 5A6BA 4MQ9F 5KYWA 1AVOB 5TJ5E 5KYUB 4QI2A 2WZGA 4NTBA 4PJLA 4PFOA 1Z23A 4YK5A 1OW7A 1FNTc 2B0HA 2YL0A 2LIGA 1AUEA 4J7YA 4U5EE 1RKCA 4KBLA 1YLMA 2X51A 2EPKX 2OKUA 4PR9A 3DAGA 3L1MA 1T6IA 1W2WA 2DGJA 5JSLA 1Z7Qc 3W2VA 4NC3A 2PF4E 4OINF 3DD7A 1I5NA 2AVKA 1D1AA 2OJQA 4JTAB 3TQOA 4DRJB 5JVEA 4YT8A 2YL1A 2L6HA 3DE8A 4JJFA 3S90A 2A6EF 5HSWA 1OW8A 4JE9A 3U9MA 1QLEC 1VOMA 3AG4C 4XEKA 5JP7A 4OIRF 4BJ5A 3M1CB 4FX5A 5HV9A 3UMIA 2HUJA 2AWYA 3HNJA 3QVYA 1IW7F 4JJGA 5FZTA 3EG9B 2FFHA 2P6VA 4P6IC 4CS9C 2H7BA 3KPHA 4AE4A 1H9TA 1VYIA 3RVZA 2CGEA 2A69F 4XPXA 2J8WA 2KJGA 1TWAA 2IXMA 2YZSA 2GA0A 3C8GB 4G7OF 4JEBA 1L3PA 2EILC 4W8KA 5KYYA 2NUTB 1LPEA 2XXAA 1RXQA 2HJ3A 4CSAC 3PMRA 1TWCA 5B3IA 2IYLD 3L8IA 1LIHA 1Q0FA 1YA7O 2QY9A 3HTKC 3FDQA 4MVSA 3N24A 3ZIBA 2IXOA 4O7GA 2XLWA 1Q0GA 3B0UX 3J06A 1RJ9A 2UUIA 1CPQA 3EPVA 3LS0A 3SXYA 5DS4A 1QQ3A 2KNHA 3ECSA 2EIJC 2Y3HA 4LACB 2HMZA 5A6KA 2HSBA 2J7PD 2KC3A 3B29A 2CW0F 3WODF 4CDAA 4MTOA 2R7WA 1JRAA 2OEXA 1N1CA 4N06A 1OR3A 2D5RB 3GWNA 4PJJA 4ZLDA 2KSFA 2Q9CA 1Y6DA 4MS2A 2Q3TA 3GWLA 1YJGA 3C18A 2I15A 2Z15A 1LI7A 3Q7GA 4XQ1A 4Q7CA 2OJED 1CGME 1GS9A 2VASA 4LERA 2R7RA 1H7IA 2QE9A 2XLMA 2Q9AA 3HKKA 4MVQA 1T6UA 1K40A 4DVZA 4RDAA 3EFOA 2CYDA 1OXKA 3O55A 2P0NA 4CJGA 3MBGA 1JPJA 4H4KC 1C17M 1WATA 2A6HF 1NU9C 1RMVA 3ASNC 4AE4B 1EKYA 4E0IA 2QUPA 3GORA 3RF3A 3FOOA 4U5DE 1C02A 3ABKC 4PACA 4JTDB 2A0BA 4LDQA 4OD4A 1IZMA 2RD9A 4IGGA 1H6GA 5DQZA 4YL0A 4OIQF 3ZQVA 2XL8A 5L3QA 3KYIA 1OQCA 3DZAA 3MLGA 3CAXA 3UMKA 2OU6A 1ZHXA 3G4XA 5L0FA 1U89A 2I8BA 1E83A 4U9DA 3RYLA 4BJTA 3GANA 2YQYA 4MVOA 2EPLX 4IARA 4OD5A 1D0XA 3DM9B 3NMJA 4Q5SF 3IQ6A 2EPMX 1QVXA 1U0BB 1NBBA 256BA 2IM8A 2E87A 1E84A 1RJ9B 2BL2A 3K66A 2GFHA 4N4WA 2EPNA 1YZCA 3EGDB 3U3BA 4YT4A 3LEOA 4JCHA 4PFPA 3JT1A 3GEHA 3LNRA 5EK0A 2PX0A 3S29A 4XPWA 1B68A 2Y3DA 1S05A 3CEXA 4XLNF 2HZ8A 2R7SA 1AEPA 1LS1A 1YZAA 2VCBA 1BBHA 2HS5A 2JD3A 4BJ5C 4EWCA 1BR4A 1OKKA 2HV7A 1ZU5A 4JRZA 3T4RA 1TR2A 3C62A 4FAPB 5L0DA 2R7UA 5CI8A 3SXKA 2XLHA 5BQGA 2C04A 1MMGA 4HFFB 4DRHB 4WJ0A 1T5OA 1APCA 2J46A 4N6HA 5COMA 5KYXA 2ZXPA 3DE9A 4YJWA 3C7JA 1V55C 4U5CE 1J8YF 3HNLA 4Z9HA 3K1IC 3LS1A 1BR2A 3SEOA 2PNOA 1FAPB 4DVYP 3FAPB 1ZU4A 3UMHA 3EFOB 5A6BD 2YRFA 2FAPB 2WVNA 3FOPA 4CJOA 2WVOA 1RKEB 3RH3A 1MMNA 5A69A 4J32B 1A0BA 1LE2A 3U8VA
chains in the Genus database with same CATH topology
4D4XA 2J8WA 2XL6A 4JEBA 4CIPA 4L6RA 2CCYA 1MQVA 1E85A 5B3IA 4ULVA 2YLGA 4IAQA 1LM3B 3TOLA 2XLWA 4WGZA 4CDVA 1QPUA 1CPQA 3QW0A 1QQ3A 3ZTMA 4CDAA 1CGNA 5JS5A 1JAFA 2YKZA 2QLAA 3M79A 1CGOA 1YYJA 3ZTZA 2XLEA 3TOMA 2XLMA 2BC5A 2XM4A 4IB4A 2XLDA 1M6TA 3HNKA 3HNIA 4CJGA 5JUAA 1EKYA 2XLVA 2YLDA 3FOOA 1GQAA 2YL3A 5AGFA 3ZQVA 2XL8A 1CPRA 4U9EA 2XM0A 2YLIA 5JLIA 4ER9A 3QVZA 1E83A 4U9DA 5JT4A 4IARA 4D4NA 3QW1A 4EIYA 4JEAA 3NMJA 1RCPA 1A7VA 3IQ6A 3ZQYA 1NBBA 256BA 1E84A 4N4WA 3NMKA 1YZCA 3VRCA 1E86A 3M15A 3IQ5A 2YL0A 1YYXA 3U8PA 1S05A 5JRAA 1YZAA 3C63A 1BBHA 5JSLA 3L1MA 4NC3A 4CDYA 3C62A 2YL7A 5JVEA 2XLHA 2YL1A 3DE8A 1APCA 4N6HA 2XLOA 3NMIA 4JE9A 3M4BA 3DE9A 5JP7A 3HNLA 3HNJA 3QVYA 3ZWIA 3FOPA 4CJOA 2J9BA 4CX9A 3M4CA 4JKVA 4WGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4X A;  2J8W A;  2XL6 A;  4JEB A;  4CIP A;  4L6R A;  2CCY A;  1MQV A;  1E85 A;  5B3I A;  4ULV A;  2YLG A;  4IAQ A;  1LM3 B;  3TOL A;  2XLW A;  4WGZ A;  4CDV A;  1QPU A;  1CPQ A;  3QW0 A;  1QQ3 A;  3ZTM A;  4CDA A;  1CGN A;  5JS5 A;  1JAF A;  2YKZ A;  2QLA A;  3M79 A;  1CGO A;  1YYJ A;  3ZTZ A;  2XLE A;  3TOM A;  2XLM A;  2BC5 A;  2XM4 A;  4IB4 A;  2XLD A;  1M6T A;  3HNK A;  3HNI A;  4CJG A;  5JUA A;  1EKY A;  2XLV A;  2YLD A;  3FOO A;  1GQA A;  2YL3 A;  5AGF A;  3ZQV A;  2XL8 A;  1CPR A;  4U9E A;  2XM0 A;  2YLI A;  5JLI A;  4ER9 A;  3QVZ A;  1E83 A;  4U9D A;  5JT4 A;  4IAR A;  4D4N A;  3QW1 A;  4EIY A;  4JEA A;  3NMJ A;  1RCP A;  1A7V A;  3IQ6 A;  3ZQY A;  1NBB A;  256B A;  1E84 A;  4N4W A;  3NMK A;  1YZC A;  3VRC A;  1E86 A;  3M15 A;  3IQ5 A;  2YL0 A;  1YYX A;  3U8P A;  1S05 A;  5JRA A;  1YZA A;  3C63 A;  1BBH A;  5JSL A;  3L1M A;  4NC3 A;  4CDY A;  3C62 A;  2YL7 A;  5JVE A;  2XLH A;  2YL1 A;  3DE8 A;  1APC A;  4N6H A;  2XLO A;  3NMI A;  4JE9 A;  3M4B A;  3DE9 A;  5JP7 A;  3HNL A;  3HNJ A;  3QVY A;  3ZWI A;  3FOP A;  4CJO A;  2J9B A;  4CX9 A;  3M4C A;  4JKV A;  4WGY A; 
#chains in the Genus database with same CATH topology
 2J0W A;  4JUR I;  3G50 A;  1YA9 A;  3DXJ F;  2OCC C;  3AG2 C;  5K0I A;  1TKN A;  4CIP A;  3MX3 A;  4C7O A;  3UR3 C;  1DOW A;  3AG1 C;  4L6R A;  3SXM A;  4JZA A;  1A7D A;  2R7X A;  3RQE A;  1BZ4 A;  1JPN A;  3KKB A;  5L0G A;  4G7H F;  1HW2 A;  1JR8 A;  3NKD A;  3EH2 A;  2DB4 A;  3K7D A;  4NTA A;  4EBJ A;  3H2U A;  3U3F A;  1FMW A;  1ZVZ A;  2F22 A;  2LQG A;  3L34 A;  1FR0 A;  2IXP A;  1SMY F;  3LEV A;  4FWV A;  4MND A;  4I3M A;  3I5Q A;  2AP3 A;  4PK4 A;  2HJM A;  5T1D B;  5D92 A;  2A0U A;  3QW0 A;  3I4U A;  3LES A;  4U5G A;  4A4A A;  3GM1 A;  2R03 A;  2D4U A;  4M63 A;  1KU2 A;  4U5B E;  3UGO A;  4LDK A;  1G4U S;  1XZQ A;  1CGN A;  4QDL A;  1M2V A;  4EBB A;  2H7O A;  1VLS A;  4JW1 A;  4E0H A;  5BQI A;  1SR2 A;  4GYT A;  3RW0 A;  1JAF A;  1NFO A;  1WWP A;  2YKZ A;  3ASO C;  5E3C A;  2X0C A;  1SYQ A;  2QLA A;  1NZE A;  4PJM A;  1G8X A;  5BQH A;  5KYX B;  1I4Y A;  2LD6 A;  3JYH A;  5A6A A;  1WAS A;  1YVI A;  4P9T A;  4QI0 A;  4A2N B;  3SXZ A;  3B0V C;  1XWJ A;  2XM4 A;  4HFK B;  3VAY A;  1LI5 A;  3O10 A;  3B71 A;  5DQT A;  4MTF A;  2Q4F A;  1M6T A;  2EPO A;  2PFD A;  2J0X A;  2NUP A;  2VB6 A;  2XLD A;  3AQB A;  3DI5 A;  5DLJ A;  3H2V A;  3Q6M A;  5KYW B;  2AWC A;  4OIP F;  5F5F A;  3NYM A;  4MVM A;  3LUT B;  2KW3 C;  1OCC C;  1ZW2 A;  3FXH A;  3L0I A;  3S9O A;  2GWW A;  3SZR A;  3PHF 2;  2XLV A;  3AG3 C;  2LP4 A;  3CSK A;  1LVK A;  2VCA A;  1TQG A;  3IQT A;  4O6M A;  2UUH A;  4O79 A;  5AGF A;  3WHN A;  3NDB B;  4BEM J;  4C7O B;  1ORJ A;  1CPR A;  4E7Z A;  2HV6 A;  2JX0 A;  2G62 A;  2YLI A;  3EJN A;  2ICW G;  3N0T A;  3F47 A;  2G3V A;  4HEA J;  2ETS A;  5T3T A;  4BPM A;  4DBR A;  5L0C A;  5JT4 A;  2WB7 A;  3TJ5 A;  2DYR C;  3ZDL A;  4JEA A;  3AGU A;  1RCP A;  3L8J A;  5E2Q A;  3RVY A;  1XZP A;  2ZPA A;  1OW6 A;  4BG0 A;  1GM5 A;  4JTC B;  3DMD A;  5CIV A;  4CS8 A;  1EQ1 A;  2W4M A;  4P9F A;  3VRC A;  3VM6 A;  1E86 A;  1G4W R;  1PV3 A;  4G0H A;  4G7Z F;  1YYX A;  3EZH A;  3U8P A;  5B1A C;  3I5P A;  4Z9I A;  1TFO B;  1FTS A;  3O6X A;  1A41 A;  1M2V B;  2R7V A;  1EI7 A;  4ULW A;  1J8M F;  4CDY A;  3DJN B;  4CS9 A;  2YL7 A;  4E18 A;  3O39 A;  3S84 A;  5KYY B;  1V4A A;  4Q4Z F;  2XXA B;  3VF0 A;  1O3U A;  2Q7R A;  3T6B A;  3JRT A;  3FAJ A;  2W45 A;  2XLO A;  3MYF A;  4GEH A;  1SF8 A;  3M4B A;  4NQF A;  3W4Y A;  1K05 A;  3DWW A;  4KC9 A;  5BUO A;  3W2W A;  2L81 A;  2PBE A;  1MMA A;  3ABM C;  2L9J A;  5KYU A;  1NFN A;  2HMQ A;  2QNL A;  4MW3 A;  3TD7 A;  5B1B C;  4CSA A;  3ZWI A;  1QKR A;  3ZVR A;  3OWT A;  3IQC A;  4K1O A;  3GEI A;  2W9Y A;  4DRI B;  3JRM O;  4DXW A;  5L0I A;  3RFY A;  1HMO A;  3FMS A;  2ZD9 A;  4U5H A;  4CX9 A;  1ORY A;  2P7V A;  4NY3 A;  4C3D A;  5IY5 C;  3POV A;  2EIN C;  1OCR C;  3PCV A;  1E2X A;  1NG1 A;  2GDC A;  2Y3G A;  1YAR O;  3LLI A;  1OKK D;  1O87 A;  3GOD A;  5E33 A;  4EUK B;  4JIO A;  4BJ6 A;  2PP4 A;  4HE8 D;  5EHH A;  2CCY A;  2WVQ A;  1TFK B;  2VC9 A;  3CQZ A;  1WTY A;  1WN0 A;  2CDQ A;  2VH3 A;  2R9R B;  1K04 A;  2A1D D;  4KNW A;  1Z6A A;  2H8A A;  1VMA A;  3NYL A;  2KK1 A;  2L6G A;  4H54 A;  1LM3 B;  4IAQ A;  1T9K A;  5GPG B;  3RQG A;  1L7C A;  4MW8 A;  4UDV A;  4WGZ A;  2ZXW C;  2Q9B A;  3EG9 A;  1HW1 A;  3MYI A;  4CDV A;  4EKW A;  1S7Z A;  2W4B A;  2XS8 A;  3KL4 A;  3JSZ A;  1QPU A;  4EBK A;  1ZW3 A;  2M4E A;  3LNM B;  3NKE A;  2OEV A;  4C3B A;  4YN0 B;  2OOC A;  2J45 A;  2R05 A;  3RIP A;  4AX2 A;  2Y39 A;  3KH2 A;  4Z9J A;  3V5X A;  5L3V A;  4EHP A;  5L0J A;  4YWQ A;  4MTG A;  4JC7 A;  4CS7 A;  4LLE A;  4CIH A;  3GEE A;  1PD1 A;  3LJB A;  2NUT A;  2IBF A;  2H7V C;  3WG7 C;  3ITF A;  5EGY A;  2J9V A;  3IHU A;  5AC4 A;  1MMD A;  2LCH A;  3A9C A;  3NG1 A;  1ST6 A;  5KYN A;  1YDI A;  4XTK A;  3UGP A;  3S0X A;  3K6B A;  3ZTZ A;  3QTH A;  4E7S A;  3JCU Q;  4XWJ A;  2OQM A;  1SZI A;  2FGY A;  3LLK A;  3ZC4 A;  3Q6N A;  2KQ9 A;  4IB4 A;  1ZHT A;  3BRJ A;  1A7E A;  2O9X A;  3UNG C;  4MVU A;  3HNK A;  5CI9 A;  4KI2 A;  1V74 B;  4I1M A;  1HMD A;  4O6Y A;  4J7T A;  3S28 A;  2TMV P;  4C3E A;  4KNV A;  2DI3 A;  2HSQ A;  4I1O B;  4J30 B;  3AQC A;  3OEO A;  1Q0D A;  1GQA A;  1T01 A;  3BEH A;  3MFN A;  3EHM A;  4E17 A;  4U9E A;  2OG2 A;  1FFH A;  2ZXO A;  5E3A A;  2XM0 A;  3U2L A;  4CS8 C;  5JLI A;  4ER9 A;  4IRU A;  3AJM A;  1VYK A;  3GM3 A;  1I4Z A;  3ABL C;  2KYH A;  2LFD A;  1M2O A;  2EIM C;  1LKX A;  3C8Z A;  3X2Q C;  4U5F E;  3US6 A;  4CBE A;  4D4N A;  2R02 A;  1C03 A;  1HY5 A;  2NSG A;  3V7O A;  3VYW A;  4WAB A;  1ZHZ A;  3KYJ A;  4R32 A;  3HJC A;  2WZF A;  3B0P A;  1YAU O;  4N6C A;  3AGT A;  1Z3I X;  3DM5 A;  3ZQY A;  3T6G B;  4AL0 A;  3NRH A;  3U2M A;  2ASR A;  2P1A A;  3NMK A;  4XEF A;  3EGX A;  3M4C A;  5COF A;  2M64 A;  4DJ9 A;  3PDM P;  1WGW A;  3F46 A;  1VLT A;  2R7Q A;  3IQ5 A;  3M15 A;  3U5S A;  2KGO A;  1MNE A;  3W8I A;  4DOZ A;  1OCO C;  3ZSU A;  2C03 A;  3K1I A;  4FES A;  1D0Y A;  3QMK A;  5JRA A;  3C63 A;  2IOQ A;  1HE1 A;  4O6N A;  1WOL A;  1PD0 A;  4NTF A;  4ANJ A;  1TWG A;  2RSE B;  4XLP F;  5DS6 A;  1ZYR F;  4RBN A;  4YL3 A;  2Y3B A;  3TUL A;  2NG1 A;  3NMI A;  1BR1 A;  1HE9 A;  4RD9 A;  2XS1 A;  3SYN A;  3E9V A;  1Z63 A;  1Z5Z A;  2ZXR A;  3EGD A;  1DOV A;  3SNH A;  5F5H A;  4BJ6 C;  1LS4 A;  3HLZ A;  1H9G A;  4IAO A;  2J9B A;  1M57 C;  3H65 A;  4MVR A;  4K7B A;  3Q7L A;  1FFT C;  4JKV A;  4WGY A;  4D4X A;  2J7P A;  4BEJ A;  1O5H A;  1OXB A;  2J9W A;  4PJN A;  2EIK C;  2XL6 A;  1Y4C A;  2L6F A;  5DVW A;  1T6Q A;  1UG7 A;  1R5I D;  1OCZ C;  3A11 A;  3DAF A;  3DJU B;  3IEE A;  4JVS A;  1FMV A;  2HKV A;  4YT5 A;  3LAY A;  3S27 A;  5B3S C;  3CZ6 A;  3EHN A;  3EZI A;  1MQV A;  1ORS C;  2XSE A;  1NLX A;  2LFF A;  2WL8 A;  3EH1 A;  3RKO F;  4ULV A;  4B6I A;  3E70 C;  4YT2 A;  2XL4 A;  3JZ0 A;  1E85 A;  2CNW D;  3U0C A;  2YLG A;  3FVY A;  1G5Z A;  2MHR A;  2CNW A;  2HFI A;  3TOL A;  4MVZ A;  1MND A;  2YHS A;  2BE5 F;  3ATP A;  1JMW A;  1TWH A;  3EQL F;  4IJJ A;  1D1C A;  1RKE A;  1QZX A;  2YEV A;  4YL1 A;  2LK4 A;  3IPM O;  3X1O A;  3JYY A;  2XRH A;  2NPU A;  3EGX B;  2NUP B;  2YWA A;  3DKA A;  3ZTM A;  3RQF A;  5FCL A;  1Q0K A;  2AU5 A;  2L7A A;  2NSF A;  4I44 A;  4OIO F;  2PX3 A;  1PCX A;  1NSG B;  2JPU A;  2YVK A;  4JCZ A;  2P61 A;  2Y69 C;  1D1B A;  5JS5 A;  3JSE O;  3TK0 A;  3G4Z A;  3OA1 A;  1ZZP A;  4IWB A;  2R25 A;  2MWQ A;  3T6J A;  3M79 A;  4NCQ A;  1CGO A;  2VCC A;  2B0J A;  1D0Z A;  4ZLC A;  2J9U A;  4K0D A;  1YYJ A;  1BDJ B;  2XLE A;  4LLC A;  1Q0M A;  4XEV A;  5T3W A;  5AC5 A;  1ZHW A;  1OR2 A;  4W8P A;  3TOM A;  2BC5 A;  2IXN A;  2G3K A;  2V26 A;  2DYS C;  2Q00 A;  5A6J A;  4AK9 A;  1NU7 D;  1EA8 A;  1UFB A;  1VTM P;  3HNI A;  1VB5 A;  1R4T A;  2WZL A;  1GGQ A;  4BJ1 A;  3C8G D;  4DBQ A;  4ONS A;  4G78 A;  2LSE A;  4LDR A;  3T9O A;  3C8G A;  3V5Z A;  5JUA A;  3JTL O;  3U9J A;  2R7T A;  1M56 C;  1F1M A;  1LE4 A;  2R7O A;  2YLD A;  3NYJ A;  5D91 A;  3R2P A;  3W8H A;  1JOG A;  3GM2 A;  4F4B A;  2YL3 A;  3SP1 A;  3WAQ A;  5DS5 A;  2V3C C;  3N2Z B;  1U6H A;  1V54 C;  3TJ6 A;  4X0R A;  3AOU A;  5L0H A;  1VK5 A;  2QTV A;  3QVZ A;  4XPY A;  2GAQ A;  3QZC A;  5COG A;  5F28 E;  3V5Y A;  3B9Q A;  3FHD A;  2A68 F;  1KTM A;  4EIY A;  3QW1 A;  1QSP A;  4GQH A;  1A7V A;  3K33 A;  3K1H A;  3KMI A;  3ZG1 A;  1KNY A;  2MYS A;  4AL1 A;  1ZHY A;  3R7C A;  5A6B A;  4MQ9 F;  5KYW A;  1AVO B;  5TJ5 E;  5KYU B;  4QI2 A;  2WZG A;  4NTB A;  4PJL A;  4PFO A;  1Z23 A;  4YK5 A;  1OW7 A;  1FNT c;  2B0H A;  2YL0 A;  2LIG A;  1AUE A;  4J7Y A;  4U5E E;  1RKC A;  4KBL A;  1YLM A;  2X51 A;  2EPK X;  2OKU A;  4PR9 A;  3DAG A;  3L1M A;  1T6I A;  1W2W A;  2DGJ A;  5JSL A;  1Z7Q c;  3W2V A;  4NC3 A;  2PF4 E;  4OIN F;  3DD7 A;  1I5N A;  2AVK A;  1D1A A;  2OJQ A;  4JTA B;  3TQO A;  4DRJ B;  5JVE A;  4YT8 A;  2YL1 A;  2L6H A;  3DE8 A;  4JJF A;  3S90 A;  2A6E F;  5HSW A;  1OW8 A;  4JE9 A;  3U9M A;  1QLE C;  1VOM A;  3AG4 C;  4XEK A;  5JP7 A;  4OIR F;  4BJ5 A;  3M1C B;  4FX5 A;  5HV9 A;  3UMI A;  2HUJ A;  2AWY A;  3HNJ A;  3QVY A;  1IW7 F;  4JJG A;  5FZT A;  3EG9 B;  2FFH A;  2P6V A;  4P6I C;  4CS9 C;  2H7B A;  3KPH A;  4AE4 A;  1H9T A;  1VYI A;  3RVZ A;  2CGE A;  2A69 F;  4XPX A;  2J8W A;  2KJG A;  1TWA A;  2IXM A;  2YZS A;  2GA0 A;  3C8G B;  4G7O F;  4JEB A;  1L3P A;  2EIL C;  4W8K A;  5KYY A;  2NUT B;  1LPE A;  2XXA A;  1RXQ A;  2HJ3 A;  4CSA C;  3PMR A;  1TWC A;  5B3I A;  2IYL D;  3L8I A;  1LIH A;  1Q0F A;  1YA7 O;  2QY9 A;  3HTK C;  3FDQ A;  4MVS A;  3N24 A;  3ZIB A;  2IXO A;  4O7G A;  2XLW A;  1Q0G A;  3B0U X;  3J06 A;  1RJ9 A;  2UUI A;  1CPQ A;  3EPV A;  3LS0 A;  3SXY A;  5DS4 A;  1QQ3 A;  2KNH A;  3ECS A;  2EIJ C;  2Y3H A;  4LAC B;  2HMZ A;  5A6K A;  2HSB A;  2J7P D;  2KC3 A;  3B29 A;  2CW0 F;  3WOD F;  4CDA A;  4MTO A;  2R7W A;  1JRA A;  2OEX A;  1N1C A;  4N06 A;  1OR3 A;  2D5R B;  3GWN A;  4PJJ A;  4ZLD A;  2KSF A;  2Q9C A;  1Y6D A;  4MS2 A;  2Q3T A;  3GWL A;  1YJG A;  3C18 A;  2I15 A;  2Z15 A;  1LI7 A;  3Q7G A;  4XQ1 A;  4Q7C A;  2OJE D;  1CGM E;  1GS9 A;  2VAS A;  4LER A;  2R7R A;  1H7I A;  2QE9 A;  2XLM A;  2Q9A A;  3HKK A;  4MVQ A;  1T6U A;  1K40 A;  4DVZ A;  4RDA A;  3EFO A;  2CYD A;  1OXK A;  3O55 A;  2P0N A;  4CJG A;  3MBG A;  1JPJ A;  4H4K C;  1C17 M;  1WAT A;  2A6H F;  1NU9 C;  1RMV A;  3ASN C;  4AE4 B;  1EKY A;  4E0I A;  2QUP A;  3GOR A;  3RF3 A;  3FOO A;  4U5D E;  1C02 A;  3ABK C;  4PAC A;  4JTD B;  2A0B A;  4LDQ A;  4OD4 A;  1IZM A;  2RD9 A;  4IGG A;  1H6G A;  5DQZ A;  4YL0 A;  4OIQ F;  3ZQV A;  2XL8 A;  5L3Q A;  3KYI A;  1OQC A;  3DZA A;  3MLG A;  3CAX A;  3UMK A;  2OU6 A;  1ZHX A;  3G4X A;  5L0F A;  1U89 A;  2I8B A;  1E83 A;  4U9D A;  3RYL A;  4BJT A;  3GAN A;  2YQY A;  4MVO A;  2EPL X;  4IAR A;  4OD5 A;  1D0X A;  3DM9 B;  3NMJ A;  4Q5S F;  3IQ6 A;  2EPM X;  1QVX A;  1U0B B;  1NBB A;  256B A;  2IM8 A;  2E87 A;  1E84 A;  1RJ9 B;  2BL2 A;  3K66 A;  2GFH A;  4N4W A;  2EPN A;  1YZC A;  3EGD B;  3U3B A;  4YT4 A;  3LEO A;  4JCH A;  4PFP A;  3JT1 A;  3GEH A;  3LNR A;  5EK0 A;  2PX0 A;  3S29 A;  4XPW A;  1B68 A;  2Y3D A;  1S05 A;  3CEX A;  4XLN F;  2HZ8 A;  2R7S A;  1AEP A;  1LS1 A;  1YZA A;  2VCB A;  1BBH A;  2HS5 A;  2JD3 A;  4BJ5 C;  4EWC A;  1BR4 A;  1OKK A;  2HV7 A;  1ZU5 A;  4JRZ A;  3T4R A;  1TR2 A;  3C62 A;  4FAP B;  5L0D A;  2R7U A;  5CI8 A;  3SXK A;  2XLH A;  5BQG A;  2C04 A;  1MMG A;  4HFF B;  4DRH B;  4WJ0 A;  1T5O A;  1APC A;  2J46 A;  4N6H A;  5COM A;  5KYX A;  2ZXP A;  3DE9 A;  4YJW A;  3C7J A;  1V55 C;  4U5C E;  1J8Y F;  3HNL A;  4Z9H A;  3K1I C;  3LS1 A;  1BR2 A;  3SEO A;  2PNO A;  1FAP B;  4DVY P;  3FAP B;  1ZU4 A;  3UMH A;  3EFO B;  5A6B D;  2YRF A;  2FAP B;  2WVN A;  3FOP A;  4CJO A;  2WVO A;  1RKE B;  3RH3 A;  1MMN A;  5A69 A;  4J32 B;  1A0B A;  1LE2 A;  3U8V A; 
#chains in the Genus database with same CATH homology
 4D4X A;  2J8W A;  2XL6 A;  4JEB A;  4CIP A;  4L6R A;  2CCY A;  1MQV A;  1E85 A;  5B3I A;  4ULV A;  2YLG A;  4IAQ A;  1LM3 B;  3TOL A;  2XLW A;  4WGZ A;  4CDV A;  1QPU A;  1CPQ A;  3QW0 A;  1QQ3 A;  3ZTM A;  4CDA A;  1CGN A;  5JS5 A;  1JAF A;  2YKZ A;  2QLA A;  3M79 A;  1CGO A;  1YYJ A;  3ZTZ A;  2XLE A;  3TOM A;  2XLM A;  2BC5 A;  2XM4 A;  4IB4 A;  2XLD A;  1M6T A;  3HNK A;  3HNI A;  4CJG A;  5JUA A;  1EKY A;  2XLV A;  2YLD A;  3FOO A;  1GQA A;  2YL3 A;  5AGF A;  3ZQV A;  2XL8 A;  1CPR A;  4U9E A;  2XM0 A;  2YLI A;  5JLI A;  4ER9 A;  3QVZ A;  1E83 A;  4U9D A;  5JT4 A;  4IAR A;  4D4N A;  3QW1 A;  4EIY A;  4JEA A;  3NMJ A;  1RCP A;  1A7V A;  3IQ6 A;  3ZQY A;  1NBB A;  256B A;  1E84 A;  4N4W A;  3NMK A;  1YZC A;  3VRC A;  1E86 A;  3M15 A;  3IQ5 A;  2YL0 A;  1YYX A;  3U8P A;  1S05 A;  5JRA A;  1YZA A;  3C63 A;  1BBH A;  5JSL A;  3L1M A;  4NC3 A;  4CDY A;  3C62 A;  2YL7 A;  5JVE A;  2XLH A;  2YL1 A;  3DE8 A;  1APC A;  4N6H A;  2XLO A;  3NMI A;  4JE9 A;  3M4B A;  3DE9 A;  5JP7 A;  3HNL A;  3HNJ A;  3QVY A;  3ZWI A;  3FOP A;  4CJO A;  2J9B A;  4CX9 A;  3M4C A;  4JKV A;  4WGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...