4U9EA

Crystal structure of the zn-directed tetramer of the engineered cyt cb562 variant, a104/57g ab3
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
91
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSMHDFRHGFWILIGQIHDALHLANEGKVKEAQHAAEQLKCTCNHCHQAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title A designed supramolecular protein assembly with in vivo enzymatic activity
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 35
structure length 91
sequence length 106
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 4u9eA00
5B3IA 2XLEA 4D4XA 4WGYA 1LM3B 2XLVA 3QVZA 4IARA 1MQVA 4JEAA 4CIPA 1S05A 3M15A 2YLGA 4ER9A 5AGFA 4L6RA 2QLAA 2XLMA 4CJOA 1YYXA 1E83A 3FOPA 5JSLA 256BA 1QQ3A 4NC3A 2YKZA 1YZCA 1YZAA 3L1MA 4JKVA 4CJGA 1CPQA 3ZQYA 2J9BA 4WGZA 3NMKA 3VRCA 1BBHA 3QVYA 4CDVA 4CDYA 2XL6A 3DE8A 1NBBA 3M4CA 5JLIA 3HNJA 4CX9A 2XM0A 2XLOA 5JT4A 3NMIA 1CPRA 3HNKA 3QW1A 2XLHA 1E84A 2YL3A 2XLWA 4U9DA 1A7VA 2YLIA 4D4NA 4N4WA 2YL1A 4EIYA 3IQ6A 4IAQA 1CGNA 2BC5A 1YYJA 2YL0A 1M6TA 3M4BA 3C62A 1EKYA 4JEBA 5JRAA 5JS5A 2YL7A 2XM4A 3TOMA 1E86A 1RCPA 3U8PA 3HNIA 4ULVA 3TOLA 3M79A 3NMJA 1APCA 3HNLA 3ZTMA 5JVEA 3DE9A 2CCYA 5JP7A 4JE9A 3QW0A 3FOOA 1E85A 4CDAA 3IQ5A 1JAFA 3ZWIA 1QPUA 2J8WA 3ZQVA 2XL8A 4IB4A 1GQAA 2YLDA 4U9EA 4N6HA 1CGOA 3C63A 5JUAA 2XLDA 3ZTZA
chains in the Genus database with same CATH superfamily
3SZRA 2XLEA 2FFHA 2HMQA 4D4XA 4DBQA 1ZHWA 1KTMA 2XLVA 1XWJA 3QVZA 2V26A 1MQVA 2WB7A 2LFFA 1FNTc 3WODF 2D4UA 4CS8C 1EA8A 1LS1A 3U2LA 1HE1A 2A68F 3UR3C 5L0GA 4LERA 1FAPB 1KU2A 3KH2A 2GFHA 4K0DA 1DOWA 1OCCC 1Q0DA 2OEXA 5E3AA 3Q6NA 1EI7A 5JSLA 3JZ0A 1NZEA 2ZXRA 2XS1A 5COGA 3POVA 1H6GA 1QQ3A 1ZHYA 1BR4A 2HZ8A 3V5ZA 1J8MF 3HTKC 5L0DA 2BL2A 4CJGA 2EILC 5AC5A 1Q0MA 1AEPA 2LCHA 3K1HA 5BQIA 3M1CB 1TWAA 1ZVZA 2LIGA 2HJMA 2FAPB 3GEIA 2KQ9A 3W8IA 1H9TA 3B0UX 2PX3A 1SF8A 2CNWD 4FWVA 3UMHA 4CDVA 3NRHA 3NDBB 5L0CA 4XPWA 1KNYA 2MYSA 1MMAA 2J0XA 3ABMC 3WHNA 2H7OA 1MNDA 3HJCA 3HLZA 4P9TA 3TD7A 3UMIA 4BJTA 4DRJB 3AQCA 4JJFA 1M56C 1F1MA 4YK5A 2AU5A 4Q7CA 3AQBA 3DD7A 4MS2A 1O87A 1SR2A 4K7BA 3HNJA 3RIPA 4MVMA 2CNWA 1D0XA 2DYSC 2XM0A 2OU6A 2XRHA 4DBRA 4Z9JA 4G7HF 4F4BA 1BZ4A 5A6BA 2F22A 3T4RA 4CBEA 1VK5A 1YJGA 2IXOA 5BQGA 4ZLDA 3CAXA 4E0IA 4C7OA 4BEJA 3VYWA 1LVKA 5KYYA 4D4NA 4JTDB 1K40A 3FVYA 4HEAJ 5B1BC 5A6JA 2Q00A 3L0IA 1HY5A 2X0CA 4IAQA 1LPEA 3EHNA 3A11A 5L3QA 2BC5A 3GM2A 3K33A 4MVOA 1G8XA 3SP1A 2J45A 4RD9A 4E7SA 3AG4C 4G0HA 4M63A 4IAOA 4YT8A 2J9UA 1AUEA 2EIMC 5EGYA 2YL0A 1TKNA 2PBEA 3M4BA 4XPXA 2D5RB 3JRTA 3JSZA 4JEBA 5JS5A 3CZ6A 1O3UA 1FMWA 2FGYA 2JD3A 4EBKA 3PHF2 1VLTA 2CYDA 2XM4A 3RQFA 1VTMP 4E7ZA 4LDQA 2HSBA 1Q0KA 2QNLA 1ZHXA 2A6EF 5E2QA 5DQTA 3NKDA 3IQTA 5K0IA 1K05A 2R7TA 4O6YA 2CDQA 4XTKA 2O9XA 1Z3IX 2WZGA 2OCCC 3ASNC 1V54C 2H7BA 1ZHTA 3M79A 3NMJA 3RKOF 4EKWA 2A0BA 1TQGA 2EINC 3FDQA 2KSFA 2MHRA 4BJ5C 4OD5A 4BEMJ 3C8GD 3RFYA 1E85A 3QTHA 2LQGA 1D0ZA 3IQ5A 3U0CA 1JAFA 2V3CC 2QY9A 5HSWA 3VF0A 3PDMP 2VCBA 2VH3A 3DZAA 2GDCA 1GQAA 2YLDA 3U3BA 5DQZA 3EHMA 3DI5A 2KGOA 2UUIA 3EGXA 1G4WR 4CS9A 1CGOA 1PCXA 1XZQA 4X0RA 2YEVA 3RQEA 1FR0A 2R02A 5F5HA 1JRAA 4DRIB 1YDIA 1Y4CA 4C3BA 4YT4A 3ECSA 2XXAA 2XLDA 2YHSA 4PACA 1ZYRF 1A0BA 2NUTB 4AX2A 4C3EA 4JJGA 3SXMA 1VYKA 5L3VA 1Q0FA 3EGXB 3FHDA 1IW7F 1G4US 2LP4A 3JYHA 3M15A 5DVWA 3PMRA 1RMVA 4L6RA 1OCOC 2I8BA 3ATPA 3C8GB 5AC4A 2Y69C 1T6QA 4CJOA 3KMIA 1YYXA 1BR1A 2P61A 4QI2A 4JC7A 2Q9AA 3S27A 3V5XA 3JTLO 1A41A 4OIOF 1A7EA 1ZW2A 4P6IC 2DYRC 1S7ZA 4U5CE 3NYLA 4KNVA 4XPYA 4IJJA 5T1DB 4MQ9F 5L0FA 1YZCA 4JKVA 4O6MA 4XWJA 1CPQA 2QE9A 3ZQYA 2NUPB 1QSPA 4QI0A 2R7RA 2OG2A 1WOLA 3NMKA 1QZXA 1FTSA 5A6AA 2J9WA 2LSEA 1XZPA 2A1DD 2KYHA 3KPHA 2PP4A 3IHUA 1ZU5A 2OQMA 3QVYA 3VM6A 1U0BB 3IEEA 1GS9A 4CDYA 3IPMO 1HW2A 4MTGA 3O10A 3DJNB 3JYYA 3SEOA 1NBBA 1OW6A 4JURI 4XQ1A 2R25A 3B0PA 1OQCA 4N6CA 5F28E 5DS5A 3RQGA 3TJ5A 3VRCA 3ZC4A 1Z23A 4G7ZF 4RBNA 3ASOC 1UG7A 1SYQA 5DLJA 4CX9A 2E87A 1SZIA 2L9JA 4AK9A 3O55A 2C04A 3NYJA 3DKAA 1EQ1A 4BJ6A 3E70C 3GWNA 1WWPA 2EPMX 2WVNA 2XS8A 1LKXA 5JT4A 1CPRA 1SMYF 2VB6A 4YL3A 1Q0GA 4YWQA 3OWTA 3SNHA 2XLHA 2ZPAA 4OINF 1VB5A 2LD6A 1A7VA 5KYXB 2R7UA 2YLIA 2P0NA 3Q7GA 1ZU4A 4N4WA 3GORA 5IY5C 3V5YA 4BPMA 5COFA 2KK1A 3W2VA 1D0YA 1CGNA 2Q9CA 4I44A 1QVXA 3VAYA 3TULA 1OW7A 2LK4A 4HFKB 5CIVA 2HS5A 2W9YA 1MMDA 1OXBA 1U89A 5EK0A 3W8HA 2Y3HA 5B3SC 5FZTA 5HV9A 1YA7O 2VCAA 4EHPA 3EH2A 3AG3C 2AWCA 4U5FE 1NG1A 1UFBA 3WG7C 2R7SA 4KC9A 2JX0A 3RH3A 1LE2A 3AGTA 4ULVA 1H9GA 2HKVA 3GWLA 2R03A 1OW8A 3LNRA 4BJ6C 1V55C 4OIQF 4A2NB 2CW0F 1APCA 3E9VA 3L34A 2R7QA 4NTBA 3ZTMA 4BJ5A 3DE9A 3MFNA 4DJ9A 3ZDLA 4W8KA 5JP7A 2YVKA 3JT1A 3QW0A 3EG9B 3FOOA 1U6HA 2A6HF 3X2QC 1M2OA 4I1MA 3U2MA 3A9CA 4LDKA 3KYIA 3W4YA 4KI2A 1ORJA 2HSQA 4XEFA 2LFDA 1RJ9A 1L3PA 3AG1C 3IQCA 4YN0B 2YZSA 3ZSUA 3LEOA 2R9RB 2A69F 3AJMA 2VCCA 2CGEA 2WL8A 3C7JA 1I4YA 4O7GA 5COMA 3JSEO 4YT5A 4UDVA 2EPLX 4IRUA 3O6XA 4U5EE 2IOQA 1RJ9B 1TWCA 4JEAA 2JPUA 1RKCA 4XEKA 3U3FA 1VYIA 4AE4B 5GPGB 4Z9IA 4OIRF 1E2XA 2BE5F 3HKKA 4KNWA 1A7DA 1E83A 3T9OA 1NFOA 1G5ZA 2R7OA 4MVSA 3FOPA 3OEOA 2OJED 2B0JA 4GEHA 2QTVA 3WAQA 2I15A 4I1OB 3S90A 256BA 2P6VA 4XLNF 3UNGC 4Q4ZF 4NC3A 1ST6A 4BJ1A 2NUTA 5B1AC 2J0WA 3MX3A 3LJBA 3B29A 1YZAA 1NU9C 4FAPB 2YQYA 3K6BA 4J30B 5BQHA 1I5NA 2ZXWC 1J8YF 3LEVA 2X51A 2NPUA 4WABA 1JPJA 1TR2A 3C8GA 3KYJA 3L8IA 2Q4FA 1QLEC 4MVRA 3X1OA 2HV7A 3ZG1A 5E3CA 3S0XA 2XSEA 4DVZA 2P1AA 3EGDB 3MYFA 3RF3A 2Y3DA 2EPKX 2IXNA 1WATA 4AL1A 4H54A 4W8PA 2HV6A 3GANA 4J32B 1LIHA 3Q7LA 4QDLA 4GQHA 4JTCB 4MVUA 2M4EA 3K1IA 2NUPA 4LDRA 5TJ5E 5JLIA 3EZIA 2WVOA 2EPOA 2HJ3A 4K1OA 4YL0A 5CI8A 1LI5A 3GM3A 4MNDA 3N0TA 3BEHA 1R4TA 2AP3A 3AOUA 2KC3A 2W4BA 2NSFA 1WTYA 5BUOA 3R2PA 3QW1A 1H7IA 1BDJB 4LLCA 4ANJA 1E84A 4ONSA 2HUJA 2RSEB 4GYTA 1FMVA 1QKRA 1TWGA 2NSGA 1YLMA 5E33A 3IQ6A 3N24A 2R7WA 1L7CA 4PK4A 4C3DA 2VC9A 1AVOB 2WZFA 2NG1A 3FMSA 1V74B 1RKEA 5A69A 1PV3A 2DB4A 4XLPF 1WGWA 2IBFA 1YYJA 4JCZA 4E18A 2B0HA 3J06A 1OCRC 2HFIA 1R5ID 4PJLA 1M6TA 5A6KA 1Y6DA 3C62A 5KYXA 1T5OA 4J7YA 1E86A 1RCPA 1OKKD 5D92A 1ZZPA 1RKEB 4U5HA 5CI9A 1PD1A 2ICWG 1O5HA 2OOCA 3T6JA 3US6A 1OR2A 3TJ6A 1D1CA 4CIHA 2L81A 3DWWA 5L0HA 1K04A 3EPVA 2WVQA 4EBJA 1M2VB 3HNLA 4Q5SF 2A0UA 4B6IA 4FX5A 2GWWA 4YJWA 2UUHA 3CSKA 4JE9A 1PD0A 3EFOB 3LS1A 1OKKA 1ORSC 4MTFA 4A4AA 1MNEA 3CQZA 4MW8A 5KYNA 4NTFA 3JRMO 2L7AA 4C7OB 3RYLA 1QPUA 2J8WA 3ZQVA 1VOMA 3KL4A 4NCQA 2Q7RA 1MMNA 4IB4A 3U8VA 4U5BE 3ZVRA 1TFKB 2L6GA 1FFTC 1DOVA 3N2ZB 3LAYA 3LLKA 4U9EA 3GODA 3DAGA 1ZW3A 3EQLF 2R05A 3SXZA 1WN0A 3EZHA 2Y3BA 4R32A 1LI7A 5A6BD 2GAQA 3EG9A 2OKUA 3C63A 1CGME 5JUAA 2IXMA 2GA0A 3MLGA 4E17A 3O39A 4PJJA 4WGYA 2OEVA 5B3IA 1Z6AA 1LM3B 4IARA 2IXPA 1I4ZA 3SXYA 2Y39A 3DMDA 4I3MA 1GGQA 3LS0A 3QMKA 4CIPA 3MBGA 4IWBA 4G7OF 1S05A 2YLGA 4ER9A 1GM5A 3EJNA 5AGFA 3I4UA 1C17M 2H7VC 2QLAA 4JIOA 2XLMA 3BRJA 3GEEA 3MYIA 1VLSA 4H4KC 5L0JA 4AL0A 2ZXOA 4HFFB 1HMDA 2Z15A 3AG2C 4JTAB 5T3TA 1M57C 3GEHA 4YL1A 1ORYA 2G62A 2Q9BA 3JCUQ 3RW0A 4DVYP 1VMAA 2EPNA 4ULWA 1HE9A 2PF4E 1W2WA 1NSGB 2YKZA 3DJUB 1NFNA 1C02A 3L1MA 4NY3A 1V4AA 2ETSA 4AE4A 1NU7D 4FESA 4Z9HA 4G78A 2KNHA 2OJQA 3AGUA 2PNOA 1T9KA 2J9BA 1ZHZA 3ZIBA 2G3VA 4WGZA 2W45A 2ZXPA 2HMZA 3C8ZA 2W4MA 2WZLA 1D1BA 3EH1A 1BBHA 1JOGA 1JPNA 1YA9A 3ABKC 3L8JA 3G4ZA 4YT2A 4EWCA 3TK0A 4WJ0A 4JW1A 2DI3A 2XL6A 5D91A 3DE8A 1BR2A 2P7VA 4O79A 3LNMB 4O6NA 1D1AA 3GM1A 3M4CA 1B68A 4RDAA 4DXWA 2H8AA 4MVZA 3T6GB 5KYYB 4PFOA 3B9QA 3UGOA 4N06A 1YAUO 3TQOA 1T6UA 1IZMA 4HE8D 4U5DE 3F46A 2ASRA 2R7VA 4JRZA 2XLOA 3EGDA 3OA1A 4E0HA 1Z63A 1OR3A 1LE4A 3NMIA 4U5GA 3HNKA 3G50A 2KW3C 3DAFA 3KKBA 2YRFA 3FAJA 3NG1A 1C03A 2YL3A 2XLWA 4NTAA 4U9DA 3R7CA 3K66A 2Y3GA 3NYMA 3DM9B 3DXJF 4PJNA 5F5FA 2YL1A 2AWYA 1YARO 2MWQA 4P9FA 4MVQA 4EIYA 5FCLA 3U9JA 1Z5ZA 2IYLD 1FFHA 3K1IC 4OIPF 4MTOA 4XEVA 5KYUA 3SYNA 2IM8A 3LLIA 4PR9A 3ITFA 2VASA 3F47A 2C03A 5T3WA 2RD9A 1EKYA 4CSAA 3C18A 5JRAA 4IGGA 4PJMA 3S28A 2TMVP 1OCZC 2YL7A 3CEXA 3TOMA 5DS6A 3LUTB 3U8PA 5KYWA 3U5SA 3I5QA 2J7PD 5DS4A 3HNIA 1WASA 5KYUB 3U9MA 5EHHA 3H2VA 3K7DA 3V7OA 3RVZA 4CS8A 4EUKB 4DOZA 2L6FA 3LESA 2J9VA 1YVIA 3TOLA 4J7TA 2PX0A 2ZD9A 1Z7Qc 4PFPA 5JVEA 2EIJC 3UMKA 2KJGA 2AVKA 2M64A 1TFOB 2CCYA 1T6IA 1JMWA 1HW1A 3DM5A 3H65A 4KBLA 2PFDA 3W2WA 5KYWB 3PCVA 3ABLC 1MMGA 2J7PA 1N1CA 4CDAA 4CS7A 3B0VC 2XXAB 2L6HA 2G3KA 1NLXA 4MW3A 3ZWIA 4BG0A 5L0IA 3UGPA 1HMOA 3G4XA 3H2UA 4ZLCA 2XL8A 1OXKA 1TWHA 2XL4A 1JR8A 4JZAA 3B71A 4JCHA 3I5PA 1M2VA 1LS4A 4LACB 3NKEA 3RVYA 3SXKA 2R7XA 3S29A 2DGJA 2EIKC 2QUPA 4N6HA 3Q6MA 1T01A 2YWAA 4NQFA 3FXHA 4OD4A 3FAPB 4JVSA 3EFOA 3S9OA 3T6BA 4EBBA 2J46A 4CSAC 1RXQA 4DRHB 2Q3TA 3S84A 4CS9C 4LLEA 3QZCA 3ZTZA
chains in the Genus database with same CATH topology
5B3IA 2XLEA 4D4XA 4WGYA 1LM3B 2XLVA 3QVZA 4IARA 1MQVA 4JEAA 4CIPA 1S05A 3M15A 2YLGA 4ER9A 5AGFA 4L6RA 2QLAA 2XLMA 4CJOA 1YYXA 1E83A 3FOPA 5JSLA 256BA 1QQ3A 4NC3A 2YKZA 1YZCA 1YZAA 3L1MA 4JKVA 4CJGA 1CPQA 3ZQYA 2J9BA 4WGZA 3NMKA 3VRCA 1BBHA 3QVYA 4CDVA 4CDYA 2XL6A 3DE8A 1NBBA 3M4CA 5JLIA 3HNJA 4CX9A 2XM0A 2XLOA 5JT4A 3NMIA 1CPRA 3HNKA 3QW1A 2XLHA 1E84A 2YL3A 2XLWA 4U9DA 1A7VA 2YLIA 4D4NA 4N4WA 2YL1A 4EIYA 3IQ6A 4IAQA 1CGNA 2BC5A 1YYJA 2YL0A 1M6TA 3M4BA 3C62A 1EKYA 4JEBA 5JRAA 5JS5A 2YL7A 2XM4A 3TOMA 1E86A 1RCPA 3U8PA 3HNIA 4ULVA 3TOLA 3M79A 3NMJA 1APCA 3HNLA 3ZTMA 5JVEA 3DE9A 2CCYA 5JP7A 4JE9A 3QW0A 3FOOA 1E85A 4CDAA 3IQ5A 1JAFA 3ZWIA 1QPUA 2J8WA 3ZQVA 2XL8A 4IB4A 1GQAA 2YLDA 4U9EA 4N6HA 1CGOA 3C63A 5JUAA 2XLDA 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3I A;  2XLE A;  4D4X A;  4WGY A;  1LM3 B;  2XLV A;  3QVZ A;  4IAR A;  1MQV A;  4JEA A;  4CIP A;  1S05 A;  3M15 A;  2YLG A;  4ER9 A;  5AGF A;  4L6R A;  2QLA A;  2XLM A;  4CJO A;  1YYX A;  1E83 A;  3FOP A;  5JSL A;  256B A;  1QQ3 A;  4NC3 A;  2YKZ A;  1YZC A;  1YZA A;  3L1M A;  4JKV A;  4CJG A;  1CPQ A;  3ZQY A;  2J9B A;  4WGZ A;  3NMK A;  3VRC A;  1BBH A;  3QVY A;  4CDV A;  4CDY A;  2XL6 A;  3DE8 A;  1NBB A;  3M4C A;  5JLI A;  3HNJ A;  4CX9 A;  2XM0 A;  2XLO A;  5JT4 A;  3NMI A;  1CPR A;  3HNK A;  3QW1 A;  2XLH A;  1E84 A;  2YL3 A;  2XLW A;  4U9D A;  1A7V A;  2YLI A;  4D4N A;  4N4W A;  2YL1 A;  4EIY A;  3IQ6 A;  4IAQ A;  1CGN A;  2BC5 A;  1YYJ A;  2YL0 A;  1M6T A;  3M4B A;  3C62 A;  1EKY A;  4JEB A;  5JRA A;  5JS5 A;  2YL7 A;  2XM4 A;  3TOM A;  1E86 A;  1RCP A;  3U8P A;  3HNI A;  4ULV A;  3TOL A;  3M79 A;  3NMJ A;  1APC A;  3HNL A;  3ZTM A;  5JVE A;  3DE9 A;  2CCY A;  5JP7 A;  4JE9 A;  3QW0 A;  3FOO A;  1E85 A;  4CDA A;  3IQ5 A;  1JAF A;  3ZWI A;  1QPU A;  2J8W A;  3ZQV A;  2XL8 A;  4IB4 A;  1GQA A;  2YLD A;  4U9E A;  4N6H A;  1CGO A;  3C63 A;  5JUA A;  2XLD A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 3SZR A;  2XLE A;  2FFH A;  2HMQ A;  4D4X A;  4DBQ A;  1ZHW A;  1KTM A;  2XLV A;  1XWJ A;  3QVZ A;  2V26 A;  1MQV A;  2WB7 A;  2LFF A;  1FNT c;  3WOD F;  2D4U A;  4CS8 C;  1EA8 A;  1LS1 A;  3U2L A;  1HE1 A;  2A68 F;  3UR3 C;  5L0G A;  4LER A;  1FAP B;  1KU2 A;  3KH2 A;  2GFH A;  4K0D A;  1DOW A;  1OCC C;  1Q0D A;  2OEX A;  5E3A A;  3Q6N A;  1EI7 A;  5JSL A;  3JZ0 A;  1NZE A;  2ZXR A;  2XS1 A;  5COG A;  3POV A;  1H6G A;  1QQ3 A;  1ZHY A;  1BR4 A;  2HZ8 A;  3V5Z A;  1J8M F;  3HTK C;  5L0D A;  2BL2 A;  4CJG A;  2EIL C;  5AC5 A;  1Q0M A;  1AEP A;  2LCH A;  3K1H A;  5BQI A;  3M1C B;  1TWA A;  1ZVZ A;  2LIG A;  2HJM A;  2FAP B;  3GEI A;  2KQ9 A;  3W8I A;  1H9T A;  3B0U X;  2PX3 A;  1SF8 A;  2CNW D;  4FWV A;  3UMH A;  4CDV A;  3NRH A;  3NDB B;  5L0C A;  4XPW A;  1KNY A;  2MYS A;  1MMA A;  2J0X A;  3ABM C;  3WHN A;  2H7O A;  1MND A;  3HJC A;  3HLZ A;  4P9T A;  3TD7 A;  3UMI A;  4BJT A;  4DRJ B;  3AQC A;  4JJF A;  1M56 C;  1F1M A;  4YK5 A;  2AU5 A;  4Q7C A;  3AQB A;  3DD7 A;  4MS2 A;  1O87 A;  1SR2 A;  4K7B A;  3HNJ A;  3RIP A;  4MVM A;  2CNW A;  1D0X A;  2DYS C;  2XM0 A;  2OU6 A;  2XRH A;  4DBR A;  4Z9J A;  4G7H F;  4F4B A;  1BZ4 A;  5A6B A;  2F22 A;  3T4R A;  4CBE A;  1VK5 A;  1YJG A;  2IXO A;  5BQG A;  4ZLD A;  3CAX A;  4E0I A;  4C7O A;  4BEJ A;  3VYW A;  1LVK A;  5KYY A;  4D4N A;  4JTD B;  1K40 A;  3FVY A;  4HEA J;  5B1B C;  5A6J A;  2Q00 A;  3L0I A;  1HY5 A;  2X0C A;  4IAQ A;  1LPE A;  3EHN A;  3A11 A;  5L3Q A;  2BC5 A;  3GM2 A;  3K33 A;  4MVO A;  1G8X A;  3SP1 A;  2J45 A;  4RD9 A;  4E7S A;  3AG4 C;  4G0H A;  4M63 A;  4IAO A;  4YT8 A;  2J9U A;  1AUE A;  2EIM C;  5EGY A;  2YL0 A;  1TKN A;  2PBE A;  3M4B A;  4XPX A;  2D5R B;  3JRT A;  3JSZ A;  4JEB A;  5JS5 A;  3CZ6 A;  1O3U A;  1FMW A;  2FGY A;  2JD3 A;  4EBK A;  3PHF 2;  1VLT A;  2CYD A;  2XM4 A;  3RQF A;  1VTM P;  4E7Z A;  4LDQ A;  2HSB A;  1Q0K A;  2QNL A;  1ZHX A;  2A6E F;  5E2Q A;  5DQT A;  3NKD A;  3IQT A;  5K0I A;  1K05 A;  2R7T A;  4O6Y A;  2CDQ A;  4XTK A;  2O9X A;  1Z3I X;  2WZG A;  2OCC C;  3ASN C;  1V54 C;  2H7B A;  1ZHT A;  3M79 A;  3NMJ A;  3RKO F;  4EKW A;  2A0B A;  1TQG A;  2EIN C;  3FDQ A;  2KSF A;  2MHR A;  4BJ5 C;  4OD5 A;  4BEM J;  3C8G D;  3RFY A;  1E85 A;  3QTH A;  2LQG A;  1D0Z A;  3IQ5 A;  3U0C A;  1JAF A;  2V3C C;  2QY9 A;  5HSW A;  3VF0 A;  3PDM P;  2VCB A;  2VH3 A;  3DZA A;  2GDC A;  1GQA A;  2YLD A;  3U3B A;  5DQZ A;  3EHM A;  3DI5 A;  2KGO A;  2UUI A;  3EGX A;  1G4W R;  4CS9 A;  1CGO A;  1PCX A;  1XZQ A;  4X0R A;  2YEV A;  3RQE A;  1FR0 A;  2R02 A;  5F5H A;  1JRA A;  4DRI B;  1YDI A;  1Y4C A;  4C3B A;  4YT4 A;  3ECS A;  2XXA A;  2XLD A;  2YHS A;  4PAC A;  1ZYR F;  1A0B A;  2NUT B;  4AX2 A;  4C3E A;  4JJG A;  3SXM A;  1VYK A;  5L3V A;  1Q0F A;  3EGX B;  3FHD A;  1IW7 F;  1G4U S;  2LP4 A;  3JYH A;  3M15 A;  5DVW A;  3PMR A;  1RMV A;  4L6R A;  1OCO C;  2I8B A;  3ATP A;  3C8G B;  5AC4 A;  2Y69 C;  1T6Q A;  4CJO A;  3KMI A;  1YYX A;  1BR1 A;  2P61 A;  4QI2 A;  4JC7 A;  2Q9A A;  3S27 A;  3V5X A;  3JTL O;  1A41 A;  4OIO F;  1A7E A;  1ZW2 A;  4P6I C;  2DYR C;  1S7Z A;  4U5C E;  3NYL A;  4KNV A;  4XPY A;  4IJJ A;  5T1D B;  4MQ9 F;  5L0F A;  1YZC A;  4JKV A;  4O6M A;  4XWJ A;  1CPQ A;  2QE9 A;  3ZQY A;  2NUP B;  1QSP A;  4QI0 A;  2R7R A;  2OG2 A;  1WOL A;  3NMK A;  1QZX A;  1FTS A;  5A6A A;  2J9W A;  2LSE A;  1XZP A;  2A1D D;  2KYH A;  3KPH A;  2PP4 A;  3IHU A;  1ZU5 A;  2OQM A;  3QVY A;  3VM6 A;  1U0B B;  3IEE A;  1GS9 A;  4CDY A;  3IPM O;  1HW2 A;  4MTG A;  3O10 A;  3DJN B;  3JYY A;  3SEO A;  1NBB A;  1OW6 A;  4JUR I;  4XQ1 A;  2R25 A;  3B0P A;  1OQC A;  4N6C A;  5F28 E;  5DS5 A;  3RQG A;  3TJ5 A;  3VRC A;  3ZC4 A;  1Z23 A;  4G7Z F;  4RBN A;  3ASO C;  1UG7 A;  1SYQ A;  5DLJ A;  4CX9 A;  2E87 A;  1SZI A;  2L9J A;  4AK9 A;  3O55 A;  2C04 A;  3NYJ A;  3DKA A;  1EQ1 A;  4BJ6 A;  3E70 C;  3GWN A;  1WWP A;  2EPM X;  2WVN A;  2XS8 A;  1LKX A;  5JT4 A;  1CPR A;  1SMY F;  2VB6 A;  4YL3 A;  1Q0G A;  4YWQ A;  3OWT A;  3SNH A;  2XLH A;  2ZPA A;  4OIN F;  1VB5 A;  2LD6 A;  1A7V A;  5KYX B;  2R7U A;  2YLI A;  2P0N A;  3Q7G A;  1ZU4 A;  4N4W A;  3GOR A;  5IY5 C;  3V5Y A;  4BPM A;  5COF A;  2KK1 A;  3W2V A;  1D0Y A;  1CGN A;  2Q9C A;  4I44 A;  1QVX A;  3VAY A;  3TUL A;  1OW7 A;  2LK4 A;  4HFK B;  5CIV A;  2HS5 A;  2W9Y A;  1MMD A;  1OXB A;  1U89 A;  5EK0 A;  3W8H A;  2Y3H A;  5B3S C;  5FZT A;  5HV9 A;  1YA7 O;  2VCA A;  4EHP A;  3EH2 A;  3AG3 C;  2AWC A;  4U5F E;  1NG1 A;  1UFB A;  3WG7 C;  2R7S A;  4KC9 A;  2JX0 A;  3RH3 A;  1LE2 A;  3AGT A;  4ULV A;  1H9G A;  2HKV A;  3GWL A;  2R03 A;  1OW8 A;  3LNR A;  4BJ6 C;  1V55 C;  4OIQ F;  4A2N B;  2CW0 F;  1APC A;  3E9V A;  3L34 A;  2R7Q A;  4NTB A;  3ZTM A;  4BJ5 A;  3DE9 A;  3MFN A;  4DJ9 A;  3ZDL A;  4W8K A;  5JP7 A;  2YVK A;  3JT1 A;  3QW0 A;  3EG9 B;  3FOO A;  1U6H A;  2A6H F;  3X2Q C;  1M2O A;  4I1M A;  3U2M A;  3A9C A;  4LDK A;  3KYI A;  3W4Y A;  4KI2 A;  1ORJ A;  2HSQ A;  4XEF A;  2LFD A;  1RJ9 A;  1L3P A;  3AG1 C;  3IQC A;  4YN0 B;  2YZS A;  3ZSU A;  3LEO A;  2R9R B;  2A69 F;  3AJM A;  2VCC A;  2CGE A;  2WL8 A;  3C7J A;  1I4Y A;  4O7G A;  5COM A;  3JSE O;  4YT5 A;  4UDV A;  2EPL X;  4IRU A;  3O6X A;  4U5E E;  2IOQ A;  1RJ9 B;  1TWC A;  4JEA A;  2JPU A;  1RKC A;  4XEK A;  3U3F A;  1VYI A;  4AE4 B;  5GPG B;  4Z9I A;  4OIR F;  1E2X A;  2BE5 F;  3HKK A;  4KNW A;  1A7D A;  1E83 A;  3T9O A;  1NFO A;  1G5Z A;  2R7O A;  4MVS A;  3FOP A;  3OEO A;  2OJE D;  2B0J A;  4GEH A;  2QTV A;  3WAQ A;  2I15 A;  4I1O B;  3S90 A;  256B A;  2P6V A;  4XLN F;  3UNG C;  4Q4Z F;  4NC3 A;  1ST6 A;  4BJ1 A;  2NUT A;  5B1A C;  2J0W A;  3MX3 A;  3LJB A;  3B29 A;  1YZA A;  1NU9 C;  4FAP B;  2YQY A;  3K6B A;  4J30 B;  5BQH A;  1I5N A;  2ZXW C;  1J8Y F;  3LEV A;  2X51 A;  2NPU A;  4WAB A;  1JPJ A;  1TR2 A;  3C8G A;  3KYJ A;  3L8I A;  2Q4F A;  1QLE C;  4MVR A;  3X1O A;  2HV7 A;  3ZG1 A;  5E3C A;  3S0X A;  2XSE A;  4DVZ A;  2P1A A;  3EGD B;  3MYF A;  3RF3 A;  2Y3D A;  2EPK X;  2IXN A;  1WAT A;  4AL1 A;  4H54 A;  4W8P A;  2HV6 A;  3GAN A;  4J32 B;  1LIH A;  3Q7L A;  4QDL A;  4GQH A;  4JTC B;  4MVU A;  2M4E A;  3K1I A;  2NUP A;  4LDR A;  5TJ5 E;  5JLI A;  3EZI A;  2WVO A;  2EPO A;  2HJ3 A;  4K1O A;  4YL0 A;  5CI8 A;  1LI5 A;  3GM3 A;  4MND A;  3N0T A;  3BEH A;  1R4T A;  2AP3 A;  3AOU A;  2KC3 A;  2W4B A;  2NSF A;  1WTY A;  5BUO A;  3R2P A;  3QW1 A;  1H7I A;  1BDJ B;  4LLC A;  4ANJ A;  1E84 A;  4ONS A;  2HUJ A;  2RSE B;  4GYT A;  1FMV A;  1QKR A;  1TWG A;  2NSG A;  1YLM A;  5E33 A;  3IQ6 A;  3N24 A;  2R7W A;  1L7C A;  4PK4 A;  4C3D A;  2VC9 A;  1AVO B;  2WZF A;  2NG1 A;  3FMS A;  1V74 B;  1RKE A;  5A69 A;  1PV3 A;  2DB4 A;  4XLP F;  1WGW A;  2IBF A;  1YYJ A;  4JCZ A;  4E18 A;  2B0H A;  3J06 A;  1OCR C;  2HFI A;  1R5I D;  4PJL A;  1M6T A;  5A6K A;  1Y6D A;  3C62 A;  5KYX A;  1T5O A;  4J7Y A;  1E86 A;  1RCP A;  1OKK D;  5D92 A;  1ZZP A;  1RKE B;  4U5H A;  5CI9 A;  1PD1 A;  2ICW G;  1O5H A;  2OOC A;  3T6J A;  3US6 A;  1OR2 A;  3TJ6 A;  1D1C A;  4CIH A;  2L81 A;  3DWW A;  5L0H A;  1K04 A;  3EPV A;  2WVQ A;  4EBJ A;  1M2V B;  3HNL A;  4Q5S F;  2A0U A;  4B6I A;  4FX5 A;  2GWW A;  4YJW A;  2UUH A;  3CSK A;  4JE9 A;  1PD0 A;  3EFO B;  3LS1 A;  1OKK A;  1ORS C;  4MTF A;  4A4A A;  1MNE A;  3CQZ A;  4MW8 A;  5KYN A;  4NTF A;  3JRM O;  2L7A A;  4C7O B;  3RYL A;  1QPU A;  2J8W A;  3ZQV A;  1VOM A;  3KL4 A;  4NCQ A;  2Q7R A;  1MMN A;  4IB4 A;  3U8V A;  4U5B E;  3ZVR A;  1TFK B;  2L6G A;  1FFT C;  1DOV A;  3N2Z B;  3LAY A;  3LLK A;  4U9E A;  3GOD A;  3DAG A;  1ZW3 A;  3EQL F;  2R05 A;  3SXZ A;  1WN0 A;  3EZH A;  2Y3B A;  4R32 A;  1LI7 A;  5A6B D;  2GAQ A;  3EG9 A;  2OKU A;  3C63 A;  1CGM E;  5JUA A;  2IXM A;  2GA0 A;  3MLG A;  4E17 A;  3O39 A;  4PJJ A;  4WGY A;  2OEV A;  5B3I A;  1Z6A A;  1LM3 B;  4IAR A;  2IXP A;  1I4Z A;  3SXY A;  2Y39 A;  3DMD A;  4I3M A;  1GGQ A;  3LS0 A;  3QMK A;  4CIP A;  3MBG A;  4IWB A;  4G7O F;  1S05 A;  2YLG A;  4ER9 A;  1GM5 A;  3EJN A;  5AGF A;  3I4U A;  1C17 M;  2H7V C;  2QLA A;  4JIO A;  2XLM A;  3BRJ A;  3GEE A;  3MYI A;  1VLS A;  4H4K C;  5L0J A;  4AL0 A;  2ZXO A;  4HFF B;  1HMD A;  2Z15 A;  3AG2 C;  4JTA B;  5T3T A;  1M57 C;  3GEH A;  4YL1 A;  1ORY A;  2G62 A;  2Q9B A;  3JCU Q;  3RW0 A;  4DVY P;  1VMA A;  2EPN A;  4ULW A;  1HE9 A;  2PF4 E;  1W2W A;  1NSG B;  2YKZ A;  3DJU B;  1NFN A;  1C02 A;  3L1M A;  4NY3 A;  1V4A A;  2ETS A;  4AE4 A;  1NU7 D;  4FES A;  4Z9H A;  4G78 A;  2KNH A;  2OJQ A;  3AGU A;  2PNO A;  1T9K A;  2J9B A;  1ZHZ A;  3ZIB A;  2G3V A;  4WGZ A;  2W45 A;  2ZXP A;  2HMZ A;  3C8Z A;  2W4M A;  2WZL A;  1D1B A;  3EH1 A;  1BBH A;  1JOG A;  1JPN A;  1YA9 A;  3ABK C;  3L8J A;  3G4Z A;  4YT2 A;  4EWC A;  3TK0 A;  4WJ0 A;  4JW1 A;  2DI3 A;  2XL6 A;  5D91 A;  3DE8 A;  1BR2 A;  2P7V A;  4O79 A;  3LNM B;  4O6N A;  1D1A A;  3GM1 A;  3M4C A;  1B68 A;  4RDA A;  4DXW A;  2H8A A;  4MVZ A;  3T6G B;  5KYY B;  4PFO A;  3B9Q A;  3UGO A;  4N06 A;  1YAU O;  3TQO A;  1T6U A;  1IZM A;  4HE8 D;  4U5D E;  3F46 A;  2ASR A;  2R7V A;  4JRZ A;  2XLO A;  3EGD A;  3OA1 A;  4E0H A;  1Z63 A;  1OR3 A;  1LE4 A;  3NMI A;  4U5G A;  3HNK A;  3G50 A;  2KW3 C;  3DAF A;  3KKB A;  2YRF A;  3FAJ A;  3NG1 A;  1C03 A;  2YL3 A;  2XLW A;  4NTA A;  4U9D A;  3R7C A;  3K66 A;  2Y3G A;  3NYM A;  3DM9 B;  3DXJ F;  4PJN A;  5F5F A;  2YL1 A;  2AWY A;  1YAR O;  2MWQ A;  4P9F A;  4MVQ A;  4EIY A;  5FCL A;  3U9J A;  1Z5Z A;  2IYL D;  1FFH A;  3K1I C;  4OIP F;  4MTO A;  4XEV A;  5KYU A;  3SYN A;  2IM8 A;  3LLI A;  4PR9 A;  3ITF A;  2VAS A;  3F47 A;  2C03 A;  5T3W A;  2RD9 A;  1EKY A;  4CSA A;  3C18 A;  5JRA A;  4IGG A;  4PJM A;  3S28 A;  2TMV P;  1OCZ C;  2YL7 A;  3CEX A;  3TOM A;  5DS6 A;  3LUT B;  3U8P A;  5KYW A;  3U5S A;  3I5Q A;  2J7P D;  5DS4 A;  3HNI A;  1WAS A;  5KYU B;  3U9M A;  5EHH A;  3H2V A;  3K7D A;  3V7O A;  3RVZ A;  4CS8 A;  4EUK B;  4DOZ A;  2L6F A;  3LES A;  2J9V A;  1YVI A;  3TOL A;  4J7T A;  2PX0 A;  2ZD9 A;  1Z7Q c;  4PFP A;  5JVE A;  2EIJ C;  3UMK A;  2KJG A;  2AVK A;  2M64 A;  1TFO B;  2CCY A;  1T6I A;  1JMW A;  1HW1 A;  3DM5 A;  3H65 A;  4KBL A;  2PFD A;  3W2W A;  5KYW B;  3PCV A;  3ABL C;  1MMG A;  2J7P A;  1N1C A;  4CDA A;  4CS7 A;  3B0V C;  2XXA B;  2L6H A;  2G3K A;  1NLX A;  4MW3 A;  3ZWI A;  4BG0 A;  5L0I A;  3UGP A;  1HMO A;  3G4X A;  3H2U A;  4ZLC A;  2XL8 A;  1OXK A;  1TWH A;  2XL4 A;  1JR8 A;  4JZA A;  3B71 A;  4JCH A;  3I5P A;  1M2V A;  1LS4 A;  4LAC B;  3NKE A;  3RVY A;  3SXK A;  2R7X A;  3S29 A;  2DGJ A;  2EIK C;  2QUP A;  4N6H A;  3Q6M A;  1T01 A;  2YWA A;  4NQF A;  3FXH A;  4OD4 A;  3FAP B;  4JVS A;  3EFO A;  3S9O A;  3T6B A;  4EBB A;  2J46 A;  4CSA C;  1RXQ A;  4DRH B;  2Q3T A;  3S84 A;  4CS9 C;  4LLE A;  3QZC A;  3ZTZ A; 
#chains in the Genus database with same CATH homology
 5B3I A;  2XLE A;  4D4X A;  4WGY A;  1LM3 B;  2XLV A;  3QVZ A;  4IAR A;  1MQV A;  4JEA A;  4CIP A;  1S05 A;  3M15 A;  2YLG A;  4ER9 A;  5AGF A;  4L6R A;  2QLA A;  2XLM A;  4CJO A;  1YYX A;  1E83 A;  3FOP A;  5JSL A;  256B A;  1QQ3 A;  4NC3 A;  2YKZ A;  1YZC A;  1YZA A;  3L1M A;  4JKV A;  4CJG A;  1CPQ A;  3ZQY A;  2J9B A;  4WGZ A;  3NMK A;  3VRC A;  1BBH A;  3QVY A;  4CDV A;  4CDY A;  2XL6 A;  3DE8 A;  1NBB A;  3M4C A;  5JLI A;  3HNJ A;  4CX9 A;  2XM0 A;  2XLO A;  5JT4 A;  3NMI A;  1CPR A;  3HNK A;  3QW1 A;  2XLH A;  1E84 A;  2YL3 A;  2XLW A;  4U9D A;  1A7V A;  2YLI A;  4D4N A;  4N4W A;  2YL1 A;  4EIY A;  3IQ6 A;  4IAQ A;  1CGN A;  2BC5 A;  1YYJ A;  2YL0 A;  1M6T A;  3M4B A;  3C62 A;  1EKY A;  4JEB A;  5JRA A;  5JS5 A;  2YL7 A;  2XM4 A;  3TOM A;  1E86 A;  1RCP A;  3U8P A;  3HNI A;  4ULV A;  3TOL A;  3M79 A;  3NMJ A;  1APC A;  3HNL A;  3ZTM A;  5JVE A;  3DE9 A;  2CCY A;  5JP7 A;  4JE9 A;  3QW0 A;  3FOO A;  1E85 A;  4CDA A;  3IQ5 A;  1JAF A;  3ZWI A;  1QPU A;  2J8W A;  3ZQV A;  2XL8 A;  4IB4 A;  1GQA A;  2YLD A;  4U9E A;  4N6H A;  1CGO A;  3C63 A;  5JUA A;  2XLD A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...