1ZVZA

Vinculin head (0-258) in complex with the talin rod residue 820-844
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
253
structure length
253
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
molecule tags Protein binding
source organism Gallus gallus
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
total genus 111
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA01
3MYIA 1TR2A 5L0IA 3RF3A 2L7AA 2LQGA 2GWWA 5L0CA 5L0JA 4E17A 5L0FA 1ZW2A 3ZDLA 4E18A 1H6GA 1SYQA 2HSQA 4W8PA 1RKEA 1YDIA 4IGGA 1XWJA 2GDCA 2X0CA 1ST6A 3S90A 3TJ5A 5FZTA 1RKEB 2IBFA 1T01A 3H2VA 5L0HA 1DOVA 5L0DA 3VF0A 1L7CA 1ZVZA 4PR9A 4EHPA 4DJ9A 1U6HA 4K1OA 4P9TA 3T6GB 3TJ6A 1RKCA 5L0GA 4ONSA 1QKRA 1DOWA 1U89A 1ZW3A 2B0HA 3H2UA
chains in the Genus database with same CATH superfamily
1D0XA 2UUIA 3K33A 1WASA 3VYWA 2FGYA 2YWAA 3M4CA 1EQ1A 1IZMA 2R02A 4IJJA 1M6TA 4PFOA 5L0JA 1D1BA 4E18A 5A69A 1H6GA 2MWQA 2PF4E 3ZQYA 1RKEA 4LDRA 2TMVP 1H7IA 2NUPA 1XWJA 2YL7A 3LAYA 3M15A 4LLCA 3S90A 1MMGA 2Q00A 3NYJA 2XM4A 4XEVA 5T3TA 1BDJB 2XLMA 4GYTA 3T4RA 1JPNA 4Z9JA 3DZAA 4CDAA 4O7GA 3B9QA 1S7ZA 2DI3A 4MVSA 2FFHA 4PR9A 3DAFA 1V74B 3QW1A 2A0BA 3FDQA 1GGQA 2HMZA 4G7ZF 1HW2A 1YVIA 2KNHA 4MW3A 3FAPB 2LK4A 2XLHA 1A7VA 4N6HA 1Z3IX 3GWLA 2R7SA 1Z23A 2L7AA 1BBHA 2L6GA 2EPLX 2M64A 3DJUB 4HFKB 2IM8A 4MVZA 5AC5A 3ECSA 4JTDB 1YLMA 2WVOA 2WZFA 3CQZA 3Q7GA 2YKZA 1WOLA 4YL0A 3U9MA 3LJBA 2XSEA 2BE5F 2H7BA 2YZSA 5CI8A 5B1BC 3W8HA 1LS1A 3IQ6A 3ZSUA 4CIPA 1PD1A 3DWWA 3DM9B 3B71A 4LLEA 3ZVRA 1KTMA 2H7VC 2CCYA 3EH1A 5K0IA 1T6QA 4J30B 3KMIA 2A6HF 4FAPB 4AK9A 5JT4A 3RIPA 1MMAA 2HZ8A 2V26A 2J0WA 3C8GD 2G3VA 1ZW3A 3C8ZA 3IQ5A 1OW7A 3RQFA 3U2LA 4YT8A 5AC4A 5BQIA 4FESA 3DD7A 3U9JA 1G8XA 3ZIBA 4MS2A 2P7VA 2WVNA 2YRFA 3KPHA 2QE9A 3FHDA 1ZHTA 4LERA 4OIQF 4E7ZA 4E17A 3FMSA 3H65A 5E3AA 3POVA 3AGTA 4EUKB 4JCZA 3C63A 2PFDA 5L3QA 2X0CA 4U5GA 2Y3BA 4MNDA 1JPJA 2KJGA 3EPVA 2XM0A 3C18A 3B0PA 2YHSA 3KL4A 3QVYA 2EPKX 3EH2A 4KC9A 3RVYA 2XLEA 3K6BA 3OA1A 1CPRA 1LE2A 1SF8A 1HE9A 2L81A 3BRJA 4O79A 3LLIA 2NUTB 3EGXA 1HW1A 4HEAJ 3CAXA 4XLNF 1LVKA 2CW0F 3HNJA 1K05A 2HMQA 3VM6A 4ANJA 2ZD9A 2GAQA 3F47A 1U89A 3V5ZA 4BG0A 2Q7RA 3ABKC 1R5ID 3TQOA 1FR0A 1FFTC 3PMRA 5COGA 2Z15A 2L6HA 1NZEA 2OEXA 1PD0A 2VB6A 3OEOA 3T9OA 2HJMA 2J9WA 4CBEA 3AGUA 3JSEO 5T1DB 1I4ZA 3WAQA 4DBQA 1YDIA 2GA0A 1ZZPA 4N4WA 3GEIA 4XWJA 5D92A 3V7OA 1CGME 5A6BD 3PDMP 5JLIA 4N6CA 1BZ4A 4F4BA 4C7OA 2I8BA 4C3DA 2NG1A 4JJFA 3US6A 5BQGA 1LPEA 2OKUA 5T3WA 2CNWA 2BL2A 4C3BA 5A6AA 4MTOA 2CNWD 4LDKA 5BUOA 1ZHZA 1ORYA 4NTBA 1L7CA 5DS6A 2B0JA 2IXMA 4D4XA 3S28A 3JRMO 3SNHA 1JAFA 2W9YA 3AQCA 1WGWA 1M2VB 4HFFB 1OKKA 1RKCA 4G7HF 3TK0A 3K1IA 5E33A 1W2WA 2VCCA 3HKKA 3G50A 1O5HA 1N1CA 1J8YF 3UGPA 5F5FA 2MHRA 1NBBA 2GWWA 2Q3TA 2J8WA 3S84A 2E87A 3L1MA 1K04A 1D1AA 2YL3A 1TWHA 4DOZA 2O9XA 3I4UA 1EI7A 2IXOA 1O87A 3NYMA 4XEKA 4O6MA 4CJOA 1RKEB 3U0CA 4DVYP 1SR2A 1Z7Qc 1A7EA 1Q0MA 3RYLA 2VCBA 3EGDA 4U5FE 3KH2A 1DOVA 3JT1A 2V3CC 2YEVA 2ASRA 4AL1A 3NMKA 5EHHA 3J06A 3KYIA 4MVUA 4A2NB 5FCLA 1OXBA 1C03A 1VYIA 2VCAA 5CI9A 1MMDA 2GFHA 1OR3A 4IWBA 4PJLA 2KSFA 1SZIA 1TFKB 2LP4A 1QLEC 2ZPAA 5KYYB 2Q9AA 5DQTA 2JD3A 2LSEA 3A9CA 2H7OA 5B3SC 2AVKA 5IY5C 4FWVA 1ZU4A 2CDQA 4Q5SF 2WZLA 4WJ0A 3SXZA 2OQMA 4EIYA 5CIVA 4NQFA 5JP7A 1VTMP 2GDCA 4IB4A 4Z9IA 5B1AC 4NY3A 2WVQA 2ZXOA 3EZHA 4JURI 3SXMA 3U8PA 2PBEA 4UDVA 4XPXA 3R7CA 2FAPB 2L9JA 3Q6MA 1YARO 3DE9A 1B68A 3ABLC 1RJ9B 3ASNC 3GANA 4JW1A 4XEFA 3ZWIA 5JVEA 2Q9CA 3JCUQ 3MX3A 1LKXA 4U5BE 4W8KA 3ZTMA 3B0VC 2NSGA 1EA8A 2A68F 3NG1A 1IW7F 4ULWA 4GQHA 4N06A 3ZG1A 4CX9A 3L0IA 3HNKA 5L0GA 4AE4B 4ONSA 2DYSC 3LS0A 4JTAB 1C02A 2NUPB 1TWAA 4RD9A 1LS4A 5L0IA 2W4MA 2PX3A 4JVSA 3TOLA 3RQEA 3UMKA 3E70C 4BJ6A 2P61A 4D4NA 3G4XA 4BJ6C 3Q6NA 3O6XA 3ZDLA 3LEVA 1SYQA 2IXPA 4P6IC 3U3BA 3W2WA 1H9TA 1RXQA 5A6BA 4R32A 3C7JA 3W4YA 1WWPA 4XPYA 4A4AA 4EBJA 3NMJA 3IEEA 2R7QA 3NRHA 3PCVA 4Q7CA 1YYJA 4C7OB 4NTFA 2HV6A 2R9RB 2OCCC 3GM3A 3ATPA 1VK5A 1Q0GA 3U5SA 3JZ0A 4YWQA 4ZLDA 2XLOA 1A0BA 2XLVA 3N0TA 1FMVA 2J46A 3C62A 1V4AA 1TQGA 3DM5A 2YVKA 3I5PA 1VLSA 1QSPA 3TD7A 5KYUB 2Y69C 3SEOA 3L34A 2LQGA 256BA 4U5EE 2VASA 3B29A 4J32B 1R4TA 2AP3A 4CIHA 4PJJA 4W8PA 4JC7A 3QZCA 5KYUA 4CS9A 1XZQA 1C17M 4ULVA 3RKOF 4I1OB 4PK4A 1E85A 1HE1A 1F1MA 3JRTA 4BJTA 2IBFA 4CDVA 4U9DA 2XXAB 2DYRC 3MYFA 3AG4C 3VAYA 5EK0A 1ORSC 4XLPF 4CSAC 2ZXRA 2IOQA 2BC5A 1Y4CA 4EHPA 2EPNA 1AUEA 1FMWA 3G4ZA 3I5QA 4K1OA 1UFBA 2XXAA 1FFHA 2EIJC 1UG7A 1HMDA 1V55C 3MBGA 1ZHYA 3UMHA 4IRUA 4JTCB 4KBLA 3Q7LA 2W4BA 3RF3A 4QDLA 3K1HA 4H54A 5GPGB 3RVZA 4OIOF 3F46A 4CS8C 1WTYA 4WGZA 5L0FA 3ITFA 4BJ5A 2Y3HA 1YJGA 3M1CB 4XPWA 3LEOA 5HV9A 5DS5A 1TWGA 2VH3A 5AGFA 3K1IC 2OEVA 3OWTA 2D4UA 5F28E 2R05A 2JX0A 4OINF 2IXNA 1LI5A 3JYHA 3K7DA 4I44A 4K7BA 5E3CA 2Q9BA 2VC9A 1GM5A 2AWCA 1WATA 4CDYA 3LESA 2PNOA 5JS5A 3LNMB 3GORA 4YT4A 5L0DA 1ZVZA 1U6HA 3DKAA 2LIGA 1NG1A 4JIOA 4P9TA 4NC3A 3T6GB 3WG7C 4C3EA 3SP1A 4Z9HA 4BPMA 3EG9A 4G7OF 2G3KA 1OQCA 5EGYA 3DAGA 1TR2A 4CS8A 2OJQA 5KYYA 4OIRF 2A6EF 3QTHA 5L0CA 1H9GA 1NLXA 5DVWA 1RMVA 3LS1A 2JPUA 2QY9A 2XS1A 2XL8A 2ICWG 3SZRA 4JKVA 3ZTZA 1I4YA 5KYWA 2C04A 2UUHA 3EHMA 2R7RA 2CYDA 2A69F 4E0HA 5A6KA 4MVRA 1M2VA 4PJNA 3IPMO 4CSAA 3H2VA 4MVOA 4OD5A 1MNDA 1VYKA 2RSEB 3LUTB 1AEPA 4G78A 4PACA 4IARA 5JSLA 4DJ9A 1ZHXA 3NDBB 5COMA 3TJ6A 3PHF2 1T6UA 4CS9C 2PX0A 2AU5A 3HJCA 1QQ3A 3C8GA 3NKEA 3V5XA 3DMDA 5DQZA 2R7VA 4YT2A 3X2QC 1CPQA 1NFOA 2EIMC 1FNTc 4YN0B 4CS7A 2J45A 2WB7A 2F22A 4HE8D 4DRJB 2LD6A 4JRZA 1GQAA 1LM3B 2YLDA 2XS8A 4IGGA 4PFPA 5BQHA 4KI2A 1ST6A 3ZQVA 1JR8A 2EPMX 4BJ1A 2R7XA 1PV3A 2MYSA 3RQGA 1OKKD 1MMNA 2HJ3A 4AE4A 1LI7A 2ETSA 1OCCC 4MVMA 2HV7A 3B0UX 2Y39A 1ZHWA 3M4BA 3AG3C 1RCPA 2M4EA 2ZXWC 4JCHA 1YZAA 3T6BA 2QLAA 3R2PA 1NU9C 1HY5A 4MW8A 3JSZA 3SXYA 3FOPA 1CGNA 3NMIA 1BR1A 1HMOA 4PJMA 3SXKA 4DXWA 4JJGA 4LDQA 1OCRC 3AQBA 3WODF 4JEAA 1YZCA 2HKVA 3QVZA 4O6NA 3S0XA 4OIPF 2J9VA 2LFFA 2A1DD 4IAQA 3DXJF 3X1OA 1TKNA 3L8JA 2XL4A 4LACB 2CGEA 2R7TA 5KYXB 4BEJA 3EZIA 1OCZC 3QW0A 1E84A 1QPUA 4EBBA 1G5ZA 4L6RA 1AVOB 1Z63A 4EKWA 3EFOB 3GM1A 5FZTA 1JOGA 1D0YA 2P0NA 3EHNA 4WABA 3ZC4A 2R7WA 2R03A 4Q4ZF 3K66A 4K0DA 4EWCA 2RD9A 1YA7O 2KK1A 1Z5ZA 4RBNA 5L0HA 1FAPB 2P6VA 1JRAA 3VF0A 3KKBA 1NSGB 1WN0A 1S05A 1OR2A 3CEXA 2YL0A 3DE8A 3S27A 4U9EA 2I15A 2W45A 2YQYA 1OW8A 2R7OA 2HUJA 1Q0FA 1KU2A 3H2UA 4QI0A 2H8AA 3HLZA 4BJ5C 1M2OA 4KNVA 4DRHB 2C03A 3N2ZB 2L6FA 4ER9A 1GS9A 1ZW2A 1YAUO 4X0RA 4ZLCA 5JUAA 2R7UA 2EIKC 1NFNA 4JEBA 1Y6DA 3L8IA 3LLKA 1ORJA 4FX5A 2OG2A 1YA9A 4KNWA 2J7PD 3E9VA 3M79A 1J8MF 3IQTA 4YT5A 5DLJA 5DS4A 2QUPA 4QI2A 2YLIA 3NKDA 1E86A 2HFIA 1BR4A 2OOCA 4P9FA 3GM2A 1NU7D 3NYLA 2Y3GA 3AG2C 1ZYRF 2KYHA 4NTAA 1PCXA 1L3PA 4E0IA 1VLTA 1QZXA 2Y3DA 3W8IA 1D0ZA 4AL0A 1I5NA 2HS5A 3ASOC 3JTLO 3MYIA 2XRHA 3FOOA 1Q0DA 2WZGA 2PP4A 1O3UA 4JZAA 3AG1C 1ZU5A 2X51A 3FXHA 4GEHA 3CSKA 2NPUA 4OD4A 1YYXA 3UR3C 4U5CE 3WHNA 3UGOA 3GWNA 3FAJA 4MTGA 5A6JA 3DJNB 1T5OA 4B6IA 4DRIB 1MQVA 2D5RB 4E7SA 3LNRA 3N24A 2QTVA 4WGYA 2KC3A 2ZXPA 4M63A 1T9KA 2WL8A 4I1MA 1OW6A 3V5YA 4H4KC 3QMKA 5F5HA 2OJED 5JRAA 3GODA 3AOUA 1M56C 4JE9A 1OXKA 3SYNA 4J7YA 1DOWA 4AX2A 4IAOA 3VRCA 4MQ9F 3GEHA 2HSBA 4MTFA 4YJWA 3EQLF 4CJGA 1XZPA 2Q4FA 4MVQA 3FVYA 1U0BB 1TWCA 3JYYA 1M57C 1VB5A 3EJNA 3IQCA 3MLGA 3RW0A 1LIHA 2LFDA 4I3MA 1QVXA 1VOMA 2XLDA 3TJ5A 3U3FA 5KYNA 3KYJA 1A41A 1Z6AA 1OCOC 2XLWA 2DB4A 4DVZA 3RFYA 1RJ9A 3HNLA 5L3VA 1E83A 3HNIA 4DBRA 4XQ1A 3IHUA 5HSWA 3HTKC 4J7TA 4U5HA 4EBKA 3O55A 1K40A 1Q0KA 3GEEA 5COFA 1T6IA 5KYWB 1KNYA 4O6YA 2J9UA 2AWYA 3O10A 3S9OA 3U8VA 1QKRA 3EGDB 2J9BA 3MFNA 1V54C 2KW3C 3RH3A 3UMIA 3TULA 3O39A 2OU6A 1TFOB 2LCHA 1D1CA 2EPOA 1APCA 4XTKA 3U2MA 3W2VA 1JMWA 2YLGA 2IYLD 2QNLA 3CZ6A 2HSQA 2J0XA 1G4WR 3ABMC 5TJ5E 3AJMA 1E2XA 2G62A 4RDAA 1CGOA 2XL6A 2EILC 3C8GB 4YL1A 5KYXA 2DGJA 2EINC 2J7PA 2NSFA 1BR2A 2A0UA 3S29A 3UNGC 3EFOA 3EGXB 4YK5A 1T01A 2NUTA 1EKYA 4NCQA 4YL3A 1VMAA 1A7DA 1MNEA 5E2QA 3A11A 2P1AA 2KGOA 1FTSA 3BEHA 3EG9B 1G4US 2YL1A 1SMYF 3DI5A 4BEMJ 3TOMA 1LE4A 2B0HA 4G0HA 5D91A 4U5DE 3T6JA 2KQ9A 2R25A 5B3IA
chains in the Genus database with same CATH topology
3MYIA 1TR2A 5L0IA 3RF3A 2L7AA 2LQGA 2GWWA 5L0CA 5L0JA 4E17A 5L0FA 1ZW2A 3ZDLA 4E18A 1H6GA 1SYQA 2HSQA 4W8PA 1RKEA 1YDIA 4IGGA 1XWJA 2GDCA 2X0CA 1ST6A 3S90A 3TJ5A 5FZTA 1RKEB 2IBFA 1T01A 3H2VA 5L0HA 1DOVA 5L0DA 3VF0A 1L7CA 1ZVZA 4PR9A 4EHPA 4DJ9A 1U6HA 4K1OA 4P9TA 3T6GB 3TJ6A 1RKCA 5L0GA 4ONSA 1QKRA 1DOWA 1U89A 1ZW3A 2B0HA 3H2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYI A;  1TR2 A;  5L0I A;  3RF3 A;  2L7A A;  2LQG A;  2GWW A;  5L0C A;  5L0J A;  4E17 A;  5L0F A;  1ZW2 A;  3ZDL A;  4E18 A;  1H6G A;  1SYQ A;  2HSQ A;  4W8P A;  1RKE A;  1YDI A;  4IGG A;  1XWJ A;  2GDC A;  2X0C A;  1ST6 A;  3S90 A;  3TJ5 A;  5FZT A;  1RKE B;  2IBF A;  1T01 A;  3H2V A;  5L0H A;  1DOV A;  5L0D A;  3VF0 A;  1L7C A;  1ZVZ A;  4PR9 A;  4EHP A;  4DJ9 A;  1U6H A;  4K1O A;  4P9T A;  3T6G B;  3TJ6 A;  1RKC A;  5L0G A;  4ONS A;  1QKR A;  1DOW A;  1U89 A;  1ZW3 A;  2B0H A;  3H2U A; 
#chains in the Genus database with same CATH topology
 1D0X A;  2UUI A;  3K33 A;  1WAS A;  3VYW A;  2FGY A;  2YWA A;  3M4C A;  1EQ1 A;  1IZM A;  2R02 A;  4IJJ A;  1M6T A;  4PFO A;  5L0J A;  1D1B A;  4E18 A;  5A69 A;  1H6G A;  2MWQ A;  2PF4 E;  3ZQY A;  1RKE A;  4LDR A;  2TMV P;  1H7I A;  2NUP A;  1XWJ A;  2YL7 A;  3LAY A;  3M15 A;  4LLC A;  3S90 A;  1MMG A;  2Q00 A;  3NYJ A;  2XM4 A;  4XEV A;  5T3T A;  1BDJ B;  2XLM A;  4GYT A;  3T4R A;  1JPN A;  4Z9J A;  3DZA A;  4CDA A;  4O7G A;  3B9Q A;  1S7Z A;  2DI3 A;  4MVS A;  2FFH A;  4PR9 A;  3DAF A;  1V74 B;  3QW1 A;  2A0B A;  3FDQ A;  1GGQ A;  2HMZ A;  4G7Z F;  1HW2 A;  1YVI A;  2KNH A;  4MW3 A;  3FAP B;  2LK4 A;  2XLH A;  1A7V A;  4N6H A;  1Z3I X;  3GWL A;  2R7S A;  1Z23 A;  2L7A A;  1BBH A;  2L6G A;  2EPL X;  2M64 A;  3DJU B;  4HFK B;  2IM8 A;  4MVZ A;  5AC5 A;  3ECS A;  4JTD B;  1YLM A;  2WVO A;  2WZF A;  3CQZ A;  3Q7G A;  2YKZ A;  1WOL A;  4YL0 A;  3U9M A;  3LJB A;  2XSE A;  2BE5 F;  2H7B A;  2YZS A;  5CI8 A;  5B1B C;  3W8H A;  1LS1 A;  3IQ6 A;  3ZSU A;  4CIP A;  1PD1 A;  3DWW A;  3DM9 B;  3B71 A;  4LLE A;  3ZVR A;  1KTM A;  2H7V C;  2CCY A;  3EH1 A;  5K0I A;  1T6Q A;  4J30 B;  3KMI A;  2A6H F;  4FAP B;  4AK9 A;  5JT4 A;  3RIP A;  1MMA A;  2HZ8 A;  2V26 A;  2J0W A;  3C8G D;  2G3V A;  1ZW3 A;  3C8Z A;  3IQ5 A;  1OW7 A;  3RQF A;  3U2L A;  4YT8 A;  5AC4 A;  5BQI A;  4FES A;  3DD7 A;  3U9J A;  1G8X A;  3ZIB A;  4MS2 A;  2P7V A;  2WVN A;  2YRF A;  3KPH A;  2QE9 A;  3FHD A;  1ZHT A;  4LER A;  4OIQ F;  4E7Z A;  4E17 A;  3FMS A;  3H65 A;  5E3A A;  3POV A;  3AGT A;  4EUK B;  4JCZ A;  3C63 A;  2PFD A;  5L3Q A;  2X0C A;  4U5G A;  2Y3B A;  4MND A;  1JPJ A;  2KJG A;  3EPV A;  2XM0 A;  3C18 A;  3B0P A;  2YHS A;  3KL4 A;  3QVY A;  2EPK X;  3EH2 A;  4KC9 A;  3RVY A;  2XLE A;  3K6B A;  3OA1 A;  1CPR A;  1LE2 A;  1SF8 A;  1HE9 A;  2L81 A;  3BRJ A;  4O79 A;  3LLI A;  2NUT B;  3EGX A;  1HW1 A;  4HEA J;  3CAX A;  4XLN F;  1LVK A;  2CW0 F;  3HNJ A;  1K05 A;  2HMQ A;  3VM6 A;  4ANJ A;  2ZD9 A;  2GAQ A;  3F47 A;  1U89 A;  3V5Z A;  4BG0 A;  2Q7R A;  3ABK C;  1R5I D;  3TQO A;  1FR0 A;  1FFT C;  3PMR A;  5COG A;  2Z15 A;  2L6H A;  1NZE A;  2OEX A;  1PD0 A;  2VB6 A;  3OEO A;  3T9O A;  2HJM A;  2J9W A;  4CBE A;  3AGU A;  3JSE O;  5T1D B;  1I4Z A;  3WAQ A;  4DBQ A;  1YDI A;  2GA0 A;  1ZZP A;  4N4W A;  3GEI A;  4XWJ A;  5D92 A;  3V7O A;  1CGM E;  5A6B D;  3PDM P;  5JLI A;  4N6C A;  1BZ4 A;  4F4B A;  4C7O A;  2I8B A;  4C3D A;  2NG1 A;  4JJF A;  3US6 A;  5BQG A;  1LPE A;  2OKU A;  5T3W A;  2CNW A;  2BL2 A;  4C3B A;  5A6A A;  4MTO A;  2CNW D;  4LDK A;  5BUO A;  1ZHZ A;  1ORY A;  4NTB A;  1L7C A;  5DS6 A;  2B0J A;  2IXM A;  4D4X A;  3S28 A;  3JRM O;  3SNH A;  1JAF A;  2W9Y A;  3AQC A;  1WGW A;  1M2V B;  4HFF B;  1OKK A;  1RKC A;  4G7H F;  3TK0 A;  3K1I A;  5E33 A;  1W2W A;  2VCC A;  3HKK A;  3G50 A;  1O5H A;  1N1C A;  1J8Y F;  3UGP A;  5F5F A;  2MHR A;  1NBB A;  2GWW A;  2Q3T A;  2J8W A;  3S84 A;  2E87 A;  3L1M A;  1K04 A;  1D1A A;  2YL3 A;  1TWH A;  4DOZ A;  2O9X A;  3I4U A;  1EI7 A;  2IXO A;  1O87 A;  3NYM A;  4XEK A;  4O6M A;  4CJO A;  1RKE B;  3U0C A;  4DVY P;  1SR2 A;  1Z7Q c;  1A7E A;  1Q0M A;  3RYL A;  2VCB A;  3EGD A;  4U5F E;  3KH2 A;  1DOV A;  3JT1 A;  2V3C C;  2YEV A;  2ASR A;  4AL1 A;  3NMK A;  5EHH A;  3J06 A;  3KYI A;  4MVU A;  4A2N B;  5FCL A;  1OXB A;  1C03 A;  1VYI A;  2VCA A;  5CI9 A;  1MMD A;  2GFH A;  1OR3 A;  4IWB A;  4PJL A;  2KSF A;  1SZI A;  1TFK B;  2LP4 A;  1QLE C;  2ZPA A;  5KYY B;  2Q9A A;  5DQT A;  2JD3 A;  2LSE A;  3A9C A;  2H7O A;  5B3S C;  2AVK A;  5IY5 C;  4FWV A;  1ZU4 A;  2CDQ A;  4Q5S F;  2WZL A;  4WJ0 A;  3SXZ A;  2OQM A;  4EIY A;  5CIV A;  4NQF A;  5JP7 A;  1VTM P;  2GDC A;  4IB4 A;  4Z9I A;  5B1A C;  4NY3 A;  2WVQ A;  2ZXO A;  3EZH A;  4JUR I;  3SXM A;  3U8P A;  2PBE A;  4UDV A;  4XPX A;  3R7C A;  2FAP B;  2L9J A;  3Q6M A;  1YAR O;  3DE9 A;  1B68 A;  3ABL C;  1RJ9 B;  3ASN C;  3GAN A;  4JW1 A;  4XEF A;  3ZWI A;  5JVE A;  2Q9C A;  3JCU Q;  3MX3 A;  1LKX A;  4U5B E;  4W8K A;  3ZTM A;  3B0V C;  2NSG A;  1EA8 A;  2A68 F;  3NG1 A;  1IW7 F;  4ULW A;  4GQH A;  4N06 A;  3ZG1 A;  4CX9 A;  3L0I A;  3HNK A;  5L0G A;  4AE4 B;  4ONS A;  2DYS C;  3LS0 A;  4JTA B;  1C02 A;  2NUP B;  1TWA A;  4RD9 A;  1LS4 A;  5L0I A;  2W4M A;  2PX3 A;  4JVS A;  3TOL A;  3RQE A;  3UMK A;  3E70 C;  4BJ6 A;  2P61 A;  4D4N A;  3G4X A;  4BJ6 C;  3Q6N A;  3O6X A;  3ZDL A;  3LEV A;  1SYQ A;  2IXP A;  4P6I C;  3U3B A;  3W2W A;  1H9T A;  1RXQ A;  5A6B A;  4R32 A;  3C7J A;  3W4Y A;  1WWP A;  4XPY A;  4A4A A;  4EBJ A;  3NMJ A;  3IEE A;  2R7Q A;  3NRH A;  3PCV A;  4Q7C A;  1YYJ A;  4C7O B;  4NTF A;  2HV6 A;  2R9R B;  2OCC C;  3GM3 A;  3ATP A;  1VK5 A;  1Q0G A;  3U5S A;  3JZ0 A;  4YWQ A;  4ZLD A;  2XLO A;  1A0B A;  2XLV A;  3N0T A;  1FMV A;  2J46 A;  3C62 A;  1V4A A;  1TQG A;  3DM5 A;  2YVK A;  3I5P A;  1VLS A;  1QSP A;  3TD7 A;  5KYU B;  2Y69 C;  3SEO A;  3L34 A;  2LQG A;  256B A;  4U5E E;  2VAS A;  3B29 A;  4J32 B;  1R4T A;  2AP3 A;  4CIH A;  4PJJ A;  4W8P A;  4JC7 A;  3QZC A;  5KYU A;  4CS9 A;  1XZQ A;  1C17 M;  4ULV A;  3RKO F;  4I1O B;  4PK4 A;  1E85 A;  1HE1 A;  1F1M A;  3JRT A;  4BJT A;  2IBF A;  4CDV A;  4U9D A;  2XXA B;  2DYR C;  3MYF A;  3AG4 C;  3VAY A;  5EK0 A;  1ORS C;  4XLP F;  4CSA C;  2ZXR A;  2IOQ A;  2BC5 A;  1Y4C A;  4EHP A;  2EPN A;  1AUE A;  1FMW A;  3G4Z A;  3I5Q A;  4K1O A;  1UFB A;  2XXA A;  1FFH A;  2EIJ C;  1UG7 A;  1HMD A;  1V55 C;  3MBG A;  1ZHY A;  3UMH A;  4IRU A;  4JTC B;  4KBL A;  3Q7L A;  2W4B A;  3RF3 A;  4QDL A;  3K1H A;  4H54 A;  5GPG B;  3RVZ A;  4OIO F;  3F46 A;  4CS8 C;  1WTY A;  4WGZ A;  5L0F A;  3ITF A;  4BJ5 A;  2Y3H A;  1YJG A;  3M1C B;  4XPW A;  3LEO A;  5HV9 A;  5DS5 A;  1TWG A;  2VH3 A;  5AGF A;  3K1I C;  2OEV A;  3OWT A;  2D4U A;  5F28 E;  2R05 A;  2JX0 A;  4OIN F;  2IXN A;  1LI5 A;  3JYH A;  3K7D A;  4I44 A;  4K7B A;  5E3C A;  2Q9B A;  2VC9 A;  1GM5 A;  2AWC A;  1WAT A;  4CDY A;  3LES A;  2PNO A;  5JS5 A;  3LNM B;  3GOR A;  4YT4 A;  5L0D A;  1ZVZ A;  1U6H A;  3DKA A;  2LIG A;  1NG1 A;  4JIO A;  4P9T A;  4NC3 A;  3T6G B;  3WG7 C;  4C3E A;  3SP1 A;  4Z9H A;  4BPM A;  3EG9 A;  4G7O F;  2G3K A;  1OQC A;  5EGY A;  3DAG A;  1TR2 A;  4CS8 A;  2OJQ A;  5KYY A;  4OIR F;  2A6E F;  3QTH A;  5L0C A;  1H9G A;  1NLX A;  5DVW A;  1RMV A;  3LS1 A;  2JPU A;  2QY9 A;  2XS1 A;  2XL8 A;  2ICW G;  3SZR A;  4JKV A;  3ZTZ A;  1I4Y A;  5KYW A;  2C04 A;  2UUH A;  3EHM A;  2R7R A;  2CYD A;  2A69 F;  4E0H A;  5A6K A;  4MVR A;  1M2V A;  4PJN A;  3IPM O;  4CSA A;  3H2V A;  4MVO A;  4OD5 A;  1MND A;  1VYK A;  2RSE B;  3LUT B;  1AEP A;  4G78 A;  4PAC A;  4IAR A;  5JSL A;  4DJ9 A;  1ZHX A;  3NDB B;  5COM A;  3TJ6 A;  3PHF 2;  1T6U A;  4CS9 C;  2PX0 A;  2AU5 A;  3HJC A;  1QQ3 A;  3C8G A;  3NKE A;  3V5X A;  3DMD A;  5DQZ A;  2R7V A;  4YT2 A;  3X2Q C;  1CPQ A;  1NFO A;  2EIM C;  1FNT c;  4YN0 B;  4CS7 A;  2J45 A;  2WB7 A;  2F22 A;  4HE8 D;  4DRJ B;  2LD6 A;  4JRZ A;  1GQA A;  1LM3 B;  2YLD A;  2XS8 A;  4IGG A;  4PFP A;  5BQH A;  4KI2 A;  1ST6 A;  3ZQV A;  1JR8 A;  2EPM X;  4BJ1 A;  2R7X A;  1PV3 A;  2MYS A;  3RQG A;  1OKK D;  1MMN A;  2HJ3 A;  4AE4 A;  1LI7 A;  2ETS A;  1OCC C;  4MVM A;  2HV7 A;  3B0U X;  2Y39 A;  1ZHW A;  3M4B A;  3AG3 C;  1RCP A;  2M4E A;  2ZXW C;  4JCH A;  1YZA A;  3T6B A;  2QLA A;  3R2P A;  1NU9 C;  1HY5 A;  4MW8 A;  3JSZ A;  3SXY A;  3FOP A;  1CGN A;  3NMI A;  1BR1 A;  1HMO A;  4PJM A;  3SXK A;  4DXW A;  4JJG A;  4LDQ A;  1OCR C;  3AQB A;  3WOD F;  4JEA A;  1YZC A;  2HKV A;  3QVZ A;  4O6N A;  3S0X A;  4OIP F;  2J9V A;  2LFF A;  2A1D D;  4IAQ A;  3DXJ F;  3X1O A;  1TKN A;  3L8J A;  2XL4 A;  4LAC B;  2CGE A;  2R7T A;  5KYX B;  4BEJ A;  3EZI A;  1OCZ C;  3QW0 A;  1E84 A;  1QPU A;  4EBB A;  1G5Z A;  4L6R A;  1AVO B;  1Z63 A;  4EKW A;  3EFO B;  3GM1 A;  5FZT A;  1JOG A;  1D0Y A;  2P0N A;  3EHN A;  4WAB A;  3ZC4 A;  2R7W A;  2R03 A;  4Q4Z F;  3K66 A;  4K0D A;  4EWC A;  2RD9 A;  1YA7 O;  2KK1 A;  1Z5Z A;  4RBN A;  5L0H A;  1FAP B;  2P6V A;  1JRA A;  3VF0 A;  3KKB A;  1NSG B;  1WN0 A;  1S05 A;  1OR2 A;  3CEX A;  2YL0 A;  3DE8 A;  3S27 A;  4U9E A;  2I15 A;  2W45 A;  2YQY A;  1OW8 A;  2R7O A;  2HUJ A;  1Q0F A;  1KU2 A;  3H2U A;  4QI0 A;  2H8A A;  3HLZ A;  4BJ5 C;  1M2O A;  4KNV A;  4DRH B;  2C03 A;  3N2Z B;  2L6F A;  4ER9 A;  1GS9 A;  1ZW2 A;  1YAU O;  4X0R A;  4ZLC A;  5JUA A;  2R7U A;  2EIK C;  1NFN A;  4JEB A;  1Y6D A;  3L8I A;  3LLK A;  1ORJ A;  4FX5 A;  2OG2 A;  1YA9 A;  4KNW A;  2J7P D;  3E9V A;  3M79 A;  1J8M F;  3IQT A;  4YT5 A;  5DLJ A;  5DS4 A;  2QUP A;  4QI2 A;  2YLI A;  3NKD A;  1E86 A;  2HFI A;  1BR4 A;  2OOC A;  4P9F A;  3GM2 A;  1NU7 D;  3NYL A;  2Y3G A;  3AG2 C;  1ZYR F;  2KYH A;  4NTA A;  1PCX A;  1L3P A;  4E0I A;  1VLT A;  1QZX A;  2Y3D A;  3W8I A;  1D0Z A;  4AL0 A;  1I5N A;  2HS5 A;  3ASO C;  3JTL O;  3MYI A;  2XRH A;  3FOO A;  1Q0D A;  2WZG A;  2PP4 A;  1O3U A;  4JZA A;  3AG1 C;  1ZU5 A;  2X51 A;  3FXH A;  4GEH A;  3CSK A;  2NPU A;  4OD4 A;  1YYX A;  3UR3 C;  4U5C E;  3WHN A;  3UGO A;  3GWN A;  3FAJ A;  4MTG A;  5A6J A;  3DJN B;  1T5O A;  4B6I A;  4DRI B;  1MQV A;  2D5R B;  4E7S A;  3LNR A;  3N24 A;  2QTV A;  4WGY A;  2KC3 A;  2ZXP A;  4M63 A;  1T9K A;  2WL8 A;  4I1M A;  1OW6 A;  3V5Y A;  4H4K C;  3QMK A;  5F5H A;  2OJE D;  5JRA A;  3GOD A;  3AOU A;  1M56 C;  4JE9 A;  1OXK A;  3SYN A;  4J7Y A;  1DOW A;  4AX2 A;  4IAO A;  3VRC A;  4MQ9 F;  3GEH A;  2HSB A;  4MTF A;  4YJW A;  3EQL F;  4CJG A;  1XZP A;  2Q4F A;  4MVQ A;  3FVY A;  1U0B B;  1TWC A;  3JYY A;  1M57 C;  1VB5 A;  3EJN A;  3IQC A;  3MLG A;  3RW0 A;  1LIH A;  2LFD A;  4I3M A;  1QVX A;  1VOM A;  2XLD A;  3TJ5 A;  3U3F A;  5KYN A;  3KYJ A;  1A41 A;  1Z6A A;  1OCO C;  2XLW A;  2DB4 A;  4DVZ A;  3RFY A;  1RJ9 A;  3HNL A;  5L3V A;  1E83 A;  3HNI A;  4DBR A;  4XQ1 A;  3IHU A;  5HSW A;  3HTK C;  4J7T A;  4U5H A;  4EBK A;  3O55 A;  1K40 A;  1Q0K A;  3GEE A;  5COF A;  1T6I A;  5KYW B;  1KNY A;  4O6Y A;  2J9U A;  2AWY A;  3O10 A;  3S9O A;  3U8V A;  1QKR A;  3EGD B;  2J9B A;  3MFN A;  1V54 C;  2KW3 C;  3RH3 A;  3UMI A;  3TUL A;  3O39 A;  2OU6 A;  1TFO B;  2LCH A;  1D1C A;  2EPO A;  1APC A;  4XTK A;  3U2M A;  3W2V A;  1JMW A;  2YLG A;  2IYL D;  2QNL A;  3CZ6 A;  2HSQ A;  2J0X A;  1G4W R;  3ABM C;  5TJ5 E;  3AJM A;  1E2X A;  2G62 A;  4RDA A;  1CGO A;  2XL6 A;  2EIL C;  3C8G B;  4YL1 A;  5KYX A;  2DGJ A;  2EIN C;  2J7P A;  2NSF A;  1BR2 A;  2A0U A;  3S29 A;  3UNG C;  3EFO A;  3EGX B;  4YK5 A;  1T01 A;  2NUT A;  1EKY A;  4NCQ A;  4YL3 A;  1VMA A;  1A7D A;  1MNE A;  5E2Q A;  3A11 A;  2P1A A;  2KGO A;  1FTS A;  3BEH A;  3EG9 B;  1G4U S;  2YL1 A;  1SMY F;  3DI5 A;  4BEM J;  3TOM A;  1LE4 A;  2B0H A;  4G0H A;  5D91 A;  4U5D E;  3T6J A;  2KQ9 A;  2R25 A;  5B3I A; 
#chains in the Genus database with same CATH homology
 3MYI A;  1TR2 A;  5L0I A;  3RF3 A;  2L7A A;  2LQG A;  2GWW A;  5L0C A;  5L0J A;  4E17 A;  5L0F A;  1ZW2 A;  3ZDL A;  4E18 A;  1H6G A;  1SYQ A;  2HSQ A;  4W8P A;  1RKE A;  1YDI A;  4IGG A;  1XWJ A;  2GDC A;  2X0C A;  1ST6 A;  3S90 A;  3TJ5 A;  5FZT A;  1RKE B;  2IBF A;  1T01 A;  3H2V A;  5L0H A;  1DOV A;  5L0D A;  3VF0 A;  1L7C A;  1ZVZ A;  4PR9 A;  4EHP A;  4DJ9 A;  1U6H A;  4K1O A;  4P9T A;  3T6G B;  3TJ6 A;  1RKC A;  5L0G A;  4ONS A;  1QKR A;  1DOW A;  1U89 A;  1ZW3 A;  2B0H A;  3H2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...