1ZVZA

Vinculin head (0-258) in complex with the talin rod residue 820-844
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
253
structure length
253
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 111
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA01
4P9TA 3H2UA 3ZDLA 4EHPA 1U6HA 5L0IA 3S90A 1ZW2A 1SYQA 1H6GA 1RKCA 4K1OA 4PR9A 4DJ9A 1RKEB 1DOVA 3TJ5A 4E17A 1QKRA 2L7AA 2GDCA 4E18A 1TR2A 2GWWA 2IBFA 4W8PA 1U89A 2B0HA 5L0JA 1ZVZA 3H2VA 1ST6A 3T6GB 1T01A 5FZTA 3MYIA 2X0CA 2LQGA 1DOWA 3RF3A 1ZW3A 5L0CA 5L0GA 3TJ6A 4ONSA 5L0HA 1L7CA 1YDIA 1RKEA 2HSQA 4IGGA 5L0FA 1XWJA 3VF0A 5L0DA
chains in the Genus database with same CATH superfamily
1D0YA 2L6FA 2WZGA 4AE4A 4E7ZA 1CGNA 4FWVA 4M63A 2W9YA 3NKDA 3U3FA 2XL4A 2F22A 1UFBA 3FAPB 1G4US 2G3VA 2IOQA 3VAYA 1YYJA 4IAOA 2KW3C 1OCZC 1Z7Qc 5KYUB 1L3PA 2R7UA 1HW1A 4PJNA 2DGJA 3S0XA 1EKYA 1C03A 2R7TA 2CYDA 2IBFA 1VMAA 1Q0DA 3UGOA 2DB4A 2EPOA 2R7QA 3DMDA 5JSLA 1T01A 3G4XA 2YKZA 4PACA 3DWWA 3RVYA 4QI0A 1RKEA 4YN0B 3TQOA 3V7OA 5TJ5E 4JIOA 1UG7A 2BE5F 2J46A 2J9VA 2XLWA 3TK0A 1PV3A 3SXZA 3GANA 3IQCA 1TWCA 2OU6A 5DQZA 3N24A 4H54A 3I5PA 3LS1A 3C7JA 4U5FE 1H6GA 3AG2C 3JRTA 4BJ6A 4NCQA 3ATPA 4CX9A 3DXJF 4O6MA 4U5CE 3ZWIA 5L3QA 3OWTA 3LLKA 2A6EF 1VTMP 1FNTc 2AWYA 4WGZA 4PJMA 1OCRC 1QQ3A 2L9JA 5DS5A 3L1MA 1Z23A 1VLSA 2I8BA 1BR1A 3U3BA 2L81A 5F28E 3R2PA 2P6VA 5HV9A 1OKKD 4N6CA 3ZTZA 3V5YA 3ZQVA 1A0BA 1K04A 2KC3A 2WVOA 1JR8A 1V74B 3C8ZA 2XLOA 2CDQA 3M4BA 5E3AA 2OEXA 5L0GA 4AK9A 3GORA 3AG4C 2CNWD 1O3UA 2YRFA 1I5NA 2MWQA 2G62A 4ANJA 4CDVA 2W4MA 5JUAA 3DJNB 1ZW2A 3N0TA 4DVZA 1Z6AA 4PJLA 5FCLA 3RQEA 3V5ZA 1RXQA 4DBRA 2R9RB 3LJBA 5T1DB 1MMDA 1JAFA 4DOZA 3HTKC 4C7OA 1M2VA 1YJGA 4BG0A 3KL4A 3M79A 4JJGA 2NPUA 4X0RA 3ABLC 4LERA 4AE4B 4N06A 1Y4CA 4G7OF 2EIKC 3FXHA 3AGUA 3CZ6A 2ETSA 1SZIA 4JCHA 2FGYA 4G7ZF 1CPQA 3IQTA 1LE4A 2DYRC 1VK5A 5HSWA 1GQAA 2NSFA 1WWPA 5COMA 3E70C 4I1OB 4MNDA 3MBGA 3V5XA 1WATA 4D4NA 3POVA 1Q0KA 4NC3A 3U9JA 4P9TA 4HE8D 1S7ZA 5CIVA 4MVMA 4OINF 2KK1A 5JT4A 4ULWA 3O39A 4U5GA 3J06A 2LSEA 1SYQA 3JSEO 3RQGA 4U5HA 2OCCC 1XZPA 3ZG1A 2XLHA 2KSFA 3LNRA 1FFTC 3NRHA 3S28A 1RKEB 1DOVA 4I1MA 4U5BE 4JEAA 1C17M 1AVOB 5T3WA 4BEMJ 2CW0F 1FAPB 4ER9A 2EIJC 1CGOA 3G50A 3JSZA 1Z3IX 3NKEA 4NTAA 5K0IA 2YL1A 3NYMA 3QW1A 4IWBA 4W8PA 1QVXA 4Z9JA 3RYLA 1VYKA 2KGOA 3JZ0A 4CDAA 4F4BA 5KYWB 1HMOA 1LE2A 2AWCA 2LFFA 3ZIBA 3VM6A 2OOCA 3K1IC 1G5ZA 2J0WA 1NSGB 4RDAA 4A4AA 4AX2A 3KMIA 3UNGC 5E33A 4CS8C 3JRMO 1KU2A 2OG2A 4XPWA 3TOLA 2O9XA 2NUTB 4O7GA 1NBBA 2HV6A 1YARO 1HW2A 1S05A 3HNIA 2FAPB 3EJNA 3GODA 3W8HA 2XS8A 3U8VA 2DYSC 2IXPA 4CS7A 2ZXWC 3AGTA 4JE9A 4Q4ZF 1EA8A 2Y3HA 4ZLCA 2ZXRA 4JVSA 4EBBA 5A6JA 4PFPA 4JEBA 1EI7A 2C04A 2R02A 1ZU4A 5KYXA 1G8XA 2YL0A 256BA 3PCVA 2GDCA 3RFYA 1OW6A 5JP7A 2A0UA 4E0IA 2R7VA 2MHRA 2R7WA 1VLTA 1JMWA 2A1DD 1YA9A 2QNLA 3NDBB 3RF3A 2R05A 5L0CA 4LDKA 2V26A 4JURI 4ONSA 2J8WA 1L7CA 4DXWA 4C7OB 2QUPA 5CI9A 1XWJA 2PX0A 3GM1A 3M15A 3EG9B 1OXKA 1VYIA 3AQBA 3S27A 3HNJA 4YT2A 1NU7D 3U2MA 1OR2A 1TQGA 3KYIA 5E2QA 2KYHA 3U8PA 2XLEA 4CBEA 3DKAA 4EBJA 2X51A 4EBKA 2R03A 5B1AC 3WHNA 5BQGA 1TWHA 3CQZA 3ECSA 3TJ5A 1MNDA 2L7AA 3L8JA 1RMVA 3W2VA 3C8GD 5JS5A 2BL2A 1OW8A 2Q9BA 3AG3C 2HFIA 2VCBA 4RD9A 3DE9A 4CS9A 2FFHA 1E83A 4A2NB 2HMZA 5EGYA 3T4RA 1ORYA 3ABKC 2HUJA 1WN0A 4KNWA 3C8GB 4MTFA 1Z63A 1CPRA 3LS0A 3FHDA 4L6RA 2P1AA 2XSEA 4CS9C 1U6HA 1NU9C 2WVNA 4U9EA 1FMWA 1K05A 4CSAA 4MTOA 2NUPA 4G78A 2VASA 4WGYA 1E85A 4DVYP 2J7PA 1YYXA 2LD6A 2LFDA 3L34A 2VB6A 1ZHZA 3AOUA 4JTCB 1H9GA 1OR3A 4WABA 3KPHA 1H9TA 2Y69C 3VYWA 4MVUA 5T3TA 3SYNA 4CSAC 1LPEA 3LESA 3DAFA 3WODF 2WVQA 2YL3A 3LNMB 3C62A 4DRJB 1ZVZA 2RD9A 3HLZA 1FTSA 3T6GB 4C3BA 2HJMA 1PCXA 4I3MA 2PF4E 5L3VA 1PD0A 1VB5A 3L0IA 3DM5A 2A6HF 1LI7A 1O87A 3NMJA 5KYYA 5BUOA 4IGGA 1Q0MA 5KYXB 5A6BD 4JW1A 4OIOF 3RH3A 3EGXA 4Q5SF 5E3CA 3X2QC 2R7OA 2BC5A 2XL6A 4YWQA 3UMKA 2Q3TA 3FOPA 2GAQA 4GYTA 2B0JA 2L6GA 4MVOA 1E86A 1D1CA 1SMYF 1V55C 1RKCA 1ZYRF 3LLIA 4FESA 3FVYA 4E17A 3CSKA 2PNOA 2CCYA 1ZHWA 2OKUA 5GPGB 4O6YA 1PD1A 1TKNA 4XEVA 3N2ZB 4MVRA 4XQ1A 4C3EA 3E9VA 3Q6NA 1A7EA 1HE1A 1ORSC 3S29A 3U2LA 2WZFA 2AU5A 1LS1A 2B0HA 2PFDA 3C63A 4IARA 1TFOB 1ST6A 2J9WA 2H8AA 1BR4A 2Y3DA 5CI8A 2Q00A 3GEHA 3HNKA 5AGFA 1M6TA 1GS9A 2HV7A 3GM2A 3VRCA 1YDIA 1Q0GA 3M4CA 2HSQA 3G4ZA 4JJFA 4NY3A 4U9DA 3EFOA 1A41A 4YT5A 3WAQA 1G4WR 4YT4A 2NSGA 1OXBA 3I4UA 2LCHA 2YVKA 2YLDA 5L0IA 1BZ4A 3S90A 1MNEA 1T6QA 2KJGA 3SP1A 3SZRA 1D1BA 1MMAA 2HSBA 5BQIA 3K33A 1LS4A 2D5RB 3KH2A 2D4UA 3QZCA 3ZC4A 2A0BA 3MX3A 3FOOA 4K1OA 3AQCA 1HY5A 3B0PA 4MTGA 4RBNA 4IJJA 5A6KA 2EPNA 3K1IA 1BR2A 2YQYA 3HNLA 3AG1C 2Q9AA 3MLGA 3HKKA 2EPMX 4DRIB 3RW0A 4BJTA 3QTHA 4CS8A 3UGPA 3K1HA 5D92A 4DBQA 2NG1A 2NUPB 3ASOC 5A6AA 2Z15A 2DI3A 2LQGA 2XM0A 3KYJA 4MQ9F 3RQFA 1ZU5A 2ZXPA 4XPXA 1QZXA 3TJ6A 4CJOA 4KI2A 4YK5A 5L0FA 2H7VC 2R7RA 4OIPF 3QVYA 2IM8A 2EIMC 3B29A 2TMVP 1ZHYA 2LIGA 1H7IA 3EQLF 2PP4A 4MVSA 2IXNA 4ULVA 4KC9A 2IXOA 2WL8A 4MW8A 4YJWA 4Z9IA 1ZHXA 2C03A 5JRAA 2IXMA 3M1CB 3NMIA 1RJ9A 4NTBA 1YZCA 5KYYB 4KNVA 2Y3BA 4DJ9A 4XLPF 1MMNA 3ZVRA 3K66A 3U9MA 4LDRA 2GFHA 2VC9A 4MS2A 5D91A 3W8IA 2GWWA 4J7YA 1YLMA 1OQCA 1U89A 2ASRA 1T9KA 1YAUO 4IB4A 2RSEB 3SXKA 2P7VA 3DJUB 3PHF2 2XXAA 2KNHA 5FZTA 2R7SA 3L8IA 1R4TA 4EIYA 3DAGA 2VH3A 1ZW3A 2AVKA 2W45A 2Y3GA 4YL0A 1M2VB 4BPMA 3QVZA 3B0VC 1JOGA 4PFOA 3FDQA 5BQHA 1HE9A 3BRJA 4JC7A 2PX3A 1AEPA 1LIHA 1NZEA 4YL1A 1D0ZA 1BBHA 1KTMA 4XLNF 3UMHA 1O5HA 4IAQA 3LUTB 1T6IA 4DRHB 2XL8A 1FMVA 1ORJA 1TFKB 2LK4A 2W4BA 2L6HA 3ABMC 3B71A 1OKKA 2HKVA 4MW3A 2Q7RA 3O10A 3EGDA 4E18A 5B3IA 3FAJA 2WB7A 4JTAB 5KYNA 1I4ZA 3Q6MA 3NYLA 4EWCA 3UR3C 3A11A 2CNWA 3AJMA 2YWAA 4XPYA 2XLDA 5B3SC 5JVEA 1NFOA 2G3KA 2ICWG 4U5EE 4C3DA 2R7XA 2JX0A 2MYSA 1LKXA 3MFNA 3SXYA 1J8MF 1MMGA 1WASA 3H2UA 2J9UA 4CDYA 4EHPA 3ZTMA 1OW7A 3SXMA 4GQHA 4BJ5A 1GM5A 4EUKB 1GGQA 1YZAA 2XLVA 2YZSA 4N4WA 3TULA 2P61A 3ASNC 3DI5A 3F47A 4OIQF 4MVZA 1V54C 4MVQA 3U0CA 3MYFA 5A69A 4J7TA 2WZLA 1QKRA 3GEEA 4OD5A 2OJED 2YL7A 3U5SA 4BJ5C 1C02A 4HFFB 3JTLO 4JCZA 4LLCA 1F1MA 4CJGA 4LLEA 1OCCC 3KKBA 3A9CA 2R25A 2VCCA 5COGA 2QY9A 3K7DA 4XWJA 2V3CC 4K0DA 4U5DE 1RJ9B 1QPUA 1A7VA 2HZ8A 2OEVA 3HJCA 5L0DA 1CGME 1Q0FA 1LVKA 1LI5A 3ZDLA 5DS4A 3O6XA 3JCUQ 1M57C 4J32B 4J30B 5KYWA 3I5QA 1E2XA 1IW7F 4XTKA 4QI2A 4OD4A 2XXAB 3PMRA 3S9OA 3WG7C 4PJJA 3IEEA 1FR0A 1WOLA 1K40A 2YEVA 1M2OA 1FFHA 4N6HA 3FMSA 5DQTA 1OCOC 2OQMA 3GM3A 3LAYA 1R5ID 2NUTA 4PK4A 5JLIA 3DE8A 2VCAA 1SF8A 2EPKX 1E84A 1TWGA 4JZAA 5DVWA 1T6UA 4BJ6C 2EILC 3H2VA 3W4YA 4ZLDA 3NG1A 4JTDB 3MYIA 3IQ6A 4Q7CA 2XS1A 3US6A 1WGWA 2ZD9A 2H7OA 3PDMP 4G0HA 2QLAA 3ITFA 4HFKB 3ZQYA 4LDQA 2M64A 5B1BC 3EGDB 3W2WA 1V4AA 3EPVA 2QTVA 2KQ9A 4I44A 2QE9A 2JD3A 4NQFA 3T6JA 1J8YF 4P6IC 4PR9A 2XRHA 4KBLA 2J7PD 1I4YA 1A7DA 3EG9A 2UUHA 4P9FA 1U0BB 2Q9CA 4G7HF 2ZPAA 1TR2A 5DS6A 3ZSUA 4E7SA 1B68A 1IZMA 3QMKA 4YL3A 1APCA 3LEVA 3GEIA 1BDJB 2X0CA 2I15A 1MQVA 2OJQA 2HMQA 3JYYA 3OA1A 1LM3B 4O79A 4R32A 5COFA 3SEOA 3X1OA 1VOMA 2JPUA 4UDVA 3RKOF 4E0HA 1ZZPA 5KYUA 3R7CA 5EK0A 4H4KC 4CIHA 4JKVA 3UMIA 3DD7A 2J45A 2Q4FA 1M56C 5F5HA 1TWAA 3EZHA 3SNHA 4BEJA 1WTYA 3B9QA 1ZHTA 3CAXA 4YT8A 5IY5C 3B0UX 2AP3A 4GEHA 3TOMA 1QLEC 1T5OA 3T6BA 2CGEA 5AC5A 3JYHA 3C8GA 2H7BA 2YHSA 4OIRF 3Q7LA 3QW0A 4NTFA 1EQ1A 3EGXB 4AL1A 2Y39A 3H65A 2E87A 2EINC 2A69F 2PBEA 4FAPB 3DM9B 3JT1A 2P0NA 2EPLX 4LACB 3GWLA 3EZIA 1YA7O 5F5FA 2A68F 1DOWA 1Z5ZA 1NFNA 3RVZA 1W2WA 1JPJA 1RCPA 1SR2A 3K6BA 3NYJA 1YVIA 3EH1A 5L0HA 4HEAJ 2YLGA 4XEKA 2HS5A 1NLXA 4CIPA 1D1AA 2LP4A 3O55A 4FX5A 4BJ1A 2HJ3A 2IYLD 2J0XA 4W8KA 5AC4A 4IRUA 4JRZA 4O6NA 2GA0A 4EKWA 3CEXA 1QSPA 4B6IA 3EHNA 3EH2A 2XLMA 4WJ0A 1JRAA 2UUIA 3IQ5A 4XEFA 4Z9HA 4D4XA 1HMDA 1D0XA 1JPNA 3C18A 1N1CA 1KNYA 4K7BA 4QDLA 3DZAA 3TD7A 1AUEA 3S84A 3IHUA 4AL0A 3EFOB 3BEHA 2M4EA 3EHMA 3LEOA 1NG1A 3NMKA 5L0JA 3IPMO 2YLIA 5DLJA 3GWNA 3OEOA 5A6BA 2ZXOA 3RIPA 1XZQA 3F46A 2XM4A 3T9OA 2J9BA 3Q7GA 1Y6DA 5EHHA 3VF0A
chains in the Genus database with same CATH topology
4P9TA 3H2UA 3ZDLA 4EHPA 1U6HA 5L0IA 3S90A 1ZW2A 1SYQA 1H6GA 1RKCA 4K1OA 4PR9A 4DJ9A 1RKEB 1DOVA 3TJ5A 4E17A 1QKRA 2L7AA 2GDCA 4E18A 1TR2A 2GWWA 2IBFA 4W8PA 1U89A 2B0HA 5L0JA 1ZVZA 3H2VA 1ST6A 3T6GB 1T01A 5FZTA 3MYIA 2X0CA 2LQGA 1DOWA 3RF3A 1ZW3A 5L0CA 5L0GA 3TJ6A 4ONSA 5L0HA 1L7CA 1YDIA 1RKEA 2HSQA 4IGGA 5L0FA 1XWJA 3VF0A 5L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9T A;  3H2U A;  3ZDL A;  4EHP A;  1U6H A;  5L0I A;  3S90 A;  1ZW2 A;  1SYQ A;  1H6G A;  1RKC A;  4K1O A;  4PR9 A;  4DJ9 A;  1RKE B;  1DOV A;  3TJ5 A;  4E17 A;  1QKR A;  2L7A A;  2GDC A;  4E18 A;  1TR2 A;  2GWW A;  2IBF A;  4W8P A;  1U89 A;  2B0H A;  5L0J A;  1ZVZ A;  3H2V A;  1ST6 A;  3T6G B;  1T01 A;  5FZT A;  3MYI A;  2X0C A;  2LQG A;  1DOW A;  3RF3 A;  1ZW3 A;  5L0C A;  5L0G A;  3TJ6 A;  4ONS A;  5L0H A;  1L7C A;  1YDI A;  1RKE A;  2HSQ A;  4IGG A;  5L0F A;  1XWJ A;  3VF0 A;  5L0D A; 
#chains in the Genus database with same CATH topology
 1D0Y A;  2L6F A;  2WZG A;  4AE4 A;  4E7Z A;  1CGN A;  4FWV A;  4M63 A;  2W9Y A;  3NKD A;  3U3F A;  2XL4 A;  2F22 A;  1UFB A;  3FAP B;  1G4U S;  2G3V A;  2IOQ A;  3VAY A;  1YYJ A;  4IAO A;  2KW3 C;  1OCZ C;  1Z7Q c;  5KYU B;  1L3P A;  2R7U A;  1HW1 A;  4PJN A;  2DGJ A;  3S0X A;  1EKY A;  1C03 A;  2R7T A;  2CYD A;  2IBF A;  1VMA A;  1Q0D A;  3UGO A;  2DB4 A;  2EPO A;  2R7Q A;  3DMD A;  5JSL A;  1T01 A;  3G4X A;  2YKZ A;  4PAC A;  3DWW A;  3RVY A;  4QI0 A;  1RKE A;  4YN0 B;  3TQO A;  3V7O A;  5TJ5 E;  4JIO A;  1UG7 A;  2BE5 F;  2J46 A;  2J9V A;  2XLW A;  3TK0 A;  1PV3 A;  3SXZ A;  3GAN A;  3IQC A;  1TWC A;  2OU6 A;  5DQZ A;  3N24 A;  4H54 A;  3I5P A;  3LS1 A;  3C7J A;  4U5F E;  1H6G A;  3AG2 C;  3JRT A;  4BJ6 A;  4NCQ A;  3ATP A;  4CX9 A;  3DXJ F;  4O6M A;  4U5C E;  3ZWI A;  5L3Q A;  3OWT A;  3LLK A;  2A6E F;  1VTM P;  1FNT c;  2AWY A;  4WGZ A;  4PJM A;  1OCR C;  1QQ3 A;  2L9J A;  5DS5 A;  3L1M A;  1Z23 A;  1VLS A;  2I8B A;  1BR1 A;  3U3B A;  2L81 A;  5F28 E;  3R2P A;  2P6V A;  5HV9 A;  1OKK D;  4N6C A;  3ZTZ A;  3V5Y A;  3ZQV A;  1A0B A;  1K04 A;  2KC3 A;  2WVO A;  1JR8 A;  1V74 B;  3C8Z A;  2XLO A;  2CDQ A;  3M4B A;  5E3A A;  2OEX A;  5L0G A;  4AK9 A;  3GOR A;  3AG4 C;  2CNW D;  1O3U A;  2YRF A;  1I5N A;  2MWQ A;  2G62 A;  4ANJ A;  4CDV A;  2W4M A;  5JUA A;  3DJN B;  1ZW2 A;  3N0T A;  4DVZ A;  1Z6A A;  4PJL A;  5FCL A;  3RQE A;  3V5Z A;  1RXQ A;  4DBR A;  2R9R B;  3LJB A;  5T1D B;  1MMD A;  1JAF A;  4DOZ A;  3HTK C;  4C7O A;  1M2V A;  1YJG A;  4BG0 A;  3KL4 A;  3M79 A;  4JJG A;  2NPU A;  4X0R A;  3ABL C;  4LER A;  4AE4 B;  4N06 A;  1Y4C A;  4G7O F;  2EIK C;  3FXH A;  3AGU A;  3CZ6 A;  2ETS A;  1SZI A;  4JCH A;  2FGY A;  4G7Z F;  1CPQ A;  3IQT A;  1LE4 A;  2DYR C;  1VK5 A;  5HSW A;  1GQA A;  2NSF A;  1WWP A;  5COM A;  3E70 C;  4I1O B;  4MND A;  3MBG A;  3V5X A;  1WAT A;  4D4N A;  3POV A;  1Q0K A;  4NC3 A;  3U9J A;  4P9T A;  4HE8 D;  1S7Z A;  5CIV A;  4MVM A;  4OIN F;  2KK1 A;  5JT4 A;  4ULW A;  3O39 A;  4U5G A;  3J06 A;  2LSE A;  1SYQ A;  3JSE O;  3RQG A;  4U5H A;  2OCC C;  1XZP A;  3ZG1 A;  2XLH A;  2KSF A;  3LNR A;  1FFT C;  3NRH A;  3S28 A;  1RKE B;  1DOV A;  4I1M A;  4U5B E;  4JEA A;  1C17 M;  1AVO B;  5T3W A;  4BEM J;  2CW0 F;  1FAP B;  4ER9 A;  2EIJ C;  1CGO A;  3G50 A;  3JSZ A;  1Z3I X;  3NKE A;  4NTA A;  5K0I A;  2YL1 A;  3NYM A;  3QW1 A;  4IWB A;  4W8P A;  1QVX A;  4Z9J A;  3RYL A;  1VYK A;  2KGO A;  3JZ0 A;  4CDA A;  4F4B A;  5KYW B;  1HMO A;  1LE2 A;  2AWC A;  2LFF A;  3ZIB A;  3VM6 A;  2OOC A;  3K1I C;  1G5Z A;  2J0W A;  1NSG B;  4RDA A;  4A4A A;  4AX2 A;  3KMI A;  3UNG C;  5E33 A;  4CS8 C;  3JRM O;  1KU2 A;  2OG2 A;  4XPW A;  3TOL A;  2O9X A;  2NUT B;  4O7G A;  1NBB A;  2HV6 A;  1YAR O;  1HW2 A;  1S05 A;  3HNI A;  2FAP B;  3EJN A;  3GOD A;  3W8H A;  2XS8 A;  3U8V A;  2DYS C;  2IXP A;  4CS7 A;  2ZXW C;  3AGT A;  4JE9 A;  4Q4Z F;  1EA8 A;  2Y3H A;  4ZLC A;  2ZXR A;  4JVS A;  4EBB A;  5A6J A;  4PFP A;  4JEB A;  1EI7 A;  2C04 A;  2R02 A;  1ZU4 A;  5KYX A;  1G8X A;  2YL0 A;  256B A;  3PCV A;  2GDC A;  3RFY A;  1OW6 A;  5JP7 A;  2A0U A;  4E0I A;  2R7V A;  2MHR A;  2R7W A;  1VLT A;  1JMW A;  2A1D D;  1YA9 A;  2QNL A;  3NDB B;  3RF3 A;  2R05 A;  5L0C A;  4LDK A;  2V26 A;  4JUR I;  4ONS A;  2J8W A;  1L7C A;  4DXW A;  4C7O B;  2QUP A;  5CI9 A;  1XWJ A;  2PX0 A;  3GM1 A;  3M15 A;  3EG9 B;  1OXK A;  1VYI A;  3AQB A;  3S27 A;  3HNJ A;  4YT2 A;  1NU7 D;  3U2M A;  1OR2 A;  1TQG A;  3KYI A;  5E2Q A;  2KYH A;  3U8P A;  2XLE A;  4CBE A;  3DKA A;  4EBJ A;  2X51 A;  4EBK A;  2R03 A;  5B1A C;  3WHN A;  5BQG A;  1TWH A;  3CQZ A;  3ECS A;  3TJ5 A;  1MND A;  2L7A A;  3L8J A;  1RMV A;  3W2V A;  3C8G D;  5JS5 A;  2BL2 A;  1OW8 A;  2Q9B A;  3AG3 C;  2HFI A;  2VCB A;  4RD9 A;  3DE9 A;  4CS9 A;  2FFH A;  1E83 A;  4A2N B;  2HMZ A;  5EGY A;  3T4R A;  1ORY A;  3ABK C;  2HUJ A;  1WN0 A;  4KNW A;  3C8G B;  4MTF A;  1Z63 A;  1CPR A;  3LS0 A;  3FHD A;  4L6R A;  2P1A A;  2XSE A;  4CS9 C;  1U6H A;  1NU9 C;  2WVN A;  4U9E A;  1FMW A;  1K05 A;  4CSA A;  4MTO A;  2NUP A;  4G78 A;  2VAS A;  4WGY A;  1E85 A;  4DVY P;  2J7P A;  1YYX A;  2LD6 A;  2LFD A;  3L34 A;  2VB6 A;  1ZHZ A;  3AOU A;  4JTC B;  1H9G A;  1OR3 A;  4WAB A;  3KPH A;  1H9T A;  2Y69 C;  3VYW A;  4MVU A;  5T3T A;  3SYN A;  4CSA C;  1LPE A;  3LES A;  3DAF A;  3WOD F;  2WVQ A;  2YL3 A;  3LNM B;  3C62 A;  4DRJ B;  1ZVZ A;  2RD9 A;  3HLZ A;  1FTS A;  3T6G B;  4C3B A;  2HJM A;  1PCX A;  4I3M A;  2PF4 E;  5L3V A;  1PD0 A;  1VB5 A;  3L0I A;  3DM5 A;  2A6H F;  1LI7 A;  1O87 A;  3NMJ A;  5KYY A;  5BUO A;  4IGG A;  1Q0M A;  5KYX B;  5A6B D;  4JW1 A;  4OIO F;  3RH3 A;  3EGX A;  4Q5S F;  5E3C A;  3X2Q C;  2R7O A;  2BC5 A;  2XL6 A;  4YWQ A;  3UMK A;  2Q3T A;  3FOP A;  2GAQ A;  4GYT A;  2B0J A;  2L6G A;  4MVO A;  1E86 A;  1D1C A;  1SMY F;  1V55 C;  1RKC A;  1ZYR F;  3LLI A;  4FES A;  3FVY A;  4E17 A;  3CSK A;  2PNO A;  2CCY A;  1ZHW A;  2OKU A;  5GPG B;  4O6Y A;  1PD1 A;  1TKN A;  4XEV A;  3N2Z B;  4MVR A;  4XQ1 A;  4C3E A;  3E9V A;  3Q6N A;  1A7E A;  1HE1 A;  1ORS C;  3S29 A;  3U2L A;  2WZF A;  2AU5 A;  1LS1 A;  2B0H A;  2PFD A;  3C63 A;  4IAR A;  1TFO B;  1ST6 A;  2J9W A;  2H8A A;  1BR4 A;  2Y3D A;  5CI8 A;  2Q00 A;  3GEH A;  3HNK A;  5AGF A;  1M6T A;  1GS9 A;  2HV7 A;  3GM2 A;  3VRC A;  1YDI A;  1Q0G A;  3M4C A;  2HSQ A;  3G4Z A;  4JJF A;  4NY3 A;  4U9D A;  3EFO A;  1A41 A;  4YT5 A;  3WAQ A;  1G4W R;  4YT4 A;  2NSG A;  1OXB A;  3I4U A;  2LCH A;  2YVK A;  2YLD A;  5L0I A;  1BZ4 A;  3S90 A;  1MNE A;  1T6Q A;  2KJG A;  3SP1 A;  3SZR A;  1D1B A;  1MMA A;  2HSB A;  5BQI A;  3K33 A;  1LS4 A;  2D5R B;  3KH2 A;  2D4U A;  3QZC A;  3ZC4 A;  2A0B A;  3MX3 A;  3FOO A;  4K1O A;  3AQC A;  1HY5 A;  3B0P A;  4MTG A;  4RBN A;  4IJJ A;  5A6K A;  2EPN A;  3K1I A;  1BR2 A;  2YQY A;  3HNL A;  3AG1 C;  2Q9A A;  3MLG A;  3HKK A;  2EPM X;  4DRI B;  3RW0 A;  4BJT A;  3QTH A;  4CS8 A;  3UGP A;  3K1H A;  5D92 A;  4DBQ A;  2NG1 A;  2NUP B;  3ASO C;  5A6A A;  2Z15 A;  2DI3 A;  2LQG A;  2XM0 A;  3KYJ A;  4MQ9 F;  3RQF A;  1ZU5 A;  2ZXP A;  4XPX A;  1QZX A;  3TJ6 A;  4CJO A;  4KI2 A;  4YK5 A;  5L0F A;  2H7V C;  2R7R A;  4OIP F;  3QVY A;  2IM8 A;  2EIM C;  3B29 A;  2TMV P;  1ZHY A;  2LIG A;  1H7I A;  3EQL F;  2PP4 A;  4MVS A;  2IXN A;  4ULV A;  4KC9 A;  2IXO A;  2WL8 A;  4MW8 A;  4YJW A;  4Z9I A;  1ZHX A;  2C03 A;  5JRA A;  2IXM A;  3M1C B;  3NMI A;  1RJ9 A;  4NTB A;  1YZC A;  5KYY B;  4KNV A;  2Y3B A;  4DJ9 A;  4XLP F;  1MMN A;  3ZVR A;  3K66 A;  3U9M A;  4LDR A;  2GFH A;  2VC9 A;  4MS2 A;  5D91 A;  3W8I A;  2GWW A;  4J7Y A;  1YLM A;  1OQC A;  1U89 A;  2ASR A;  1T9K A;  1YAU O;  4IB4 A;  2RSE B;  3SXK A;  2P7V A;  3DJU B;  3PHF 2;  2XXA A;  2KNH A;  5FZT A;  2R7S A;  3L8I A;  1R4T A;  4EIY A;  3DAG A;  2VH3 A;  1ZW3 A;  2AVK A;  2W45 A;  2Y3G A;  4YL0 A;  1M2V B;  4BPM A;  3QVZ A;  3B0V C;  1JOG A;  4PFO A;  3FDQ A;  5BQH A;  1HE9 A;  3BRJ A;  4JC7 A;  2PX3 A;  1AEP A;  1LIH A;  1NZE A;  4YL1 A;  1D0Z A;  1BBH A;  1KTM A;  4XLN F;  3UMH A;  1O5H A;  4IAQ A;  3LUT B;  1T6I A;  4DRH B;  2XL8 A;  1FMV A;  1ORJ A;  1TFK B;  2LK4 A;  2W4B A;  2L6H A;  3ABM C;  3B71 A;  1OKK A;  2HKV A;  4MW3 A;  2Q7R A;  3O10 A;  3EGD A;  4E18 A;  5B3I A;  3FAJ A;  2WB7 A;  4JTA B;  5KYN A;  1I4Z A;  3Q6M A;  3NYL A;  4EWC A;  3UR3 C;  3A11 A;  2CNW A;  3AJM A;  2YWA A;  4XPY A;  2XLD A;  5B3S C;  5JVE A;  1NFO A;  2G3K A;  2ICW G;  4U5E E;  4C3D A;  2R7X A;  2JX0 A;  2MYS A;  1LKX A;  3MFN A;  3SXY A;  1J8M F;  1MMG A;  1WAS A;  3H2U A;  2J9U A;  4CDY A;  4EHP A;  3ZTM A;  1OW7 A;  3SXM A;  4GQH A;  4BJ5 A;  1GM5 A;  4EUK B;  1GGQ A;  1YZA A;  2XLV A;  2YZS A;  4N4W A;  3TUL A;  2P61 A;  3ASN C;  3DI5 A;  3F47 A;  4OIQ F;  4MVZ A;  1V54 C;  4MVQ A;  3U0C A;  3MYF A;  5A69 A;  4J7T A;  2WZL A;  1QKR A;  3GEE A;  4OD5 A;  2OJE D;  2YL7 A;  3U5S A;  4BJ5 C;  1C02 A;  4HFF B;  3JTL O;  4JCZ A;  4LLC A;  1F1M A;  4CJG A;  4LLE A;  1OCC C;  3KKB A;  3A9C A;  2R25 A;  2VCC A;  5COG A;  2QY9 A;  3K7D A;  4XWJ A;  2V3C C;  4K0D A;  4U5D E;  1RJ9 B;  1QPU A;  1A7V A;  2HZ8 A;  2OEV A;  3HJC A;  5L0D A;  1CGM E;  1Q0F A;  1LVK A;  1LI5 A;  3ZDL A;  5DS4 A;  3O6X A;  3JCU Q;  1M57 C;  4J32 B;  4J30 B;  5KYW A;  3I5Q A;  1E2X A;  1IW7 F;  4XTK A;  4QI2 A;  4OD4 A;  2XXA B;  3PMR A;  3S9O A;  3WG7 C;  4PJJ A;  3IEE A;  1FR0 A;  1WOL A;  1K40 A;  2YEV A;  1M2O A;  1FFH A;  4N6H A;  3FMS A;  5DQT A;  1OCO C;  2OQM A;  3GM3 A;  3LAY A;  1R5I D;  2NUT A;  4PK4 A;  5JLI A;  3DE8 A;  2VCA A;  1SF8 A;  2EPK X;  1E84 A;  1TWG A;  4JZA A;  5DVW A;  1T6U A;  4BJ6 C;  2EIL C;  3H2V A;  3W4Y A;  4ZLD A;  3NG1 A;  4JTD B;  3MYI A;  3IQ6 A;  4Q7C A;  2XS1 A;  3US6 A;  1WGW A;  2ZD9 A;  2H7O A;  3PDM P;  4G0H A;  2QLA A;  3ITF A;  4HFK B;  3ZQY A;  4LDQ A;  2M64 A;  5B1B C;  3EGD B;  3W2W A;  1V4A A;  3EPV A;  2QTV A;  2KQ9 A;  4I44 A;  2QE9 A;  2JD3 A;  4NQF A;  3T6J A;  1J8Y F;  4P6I C;  4PR9 A;  2XRH A;  4KBL A;  2J7P D;  1I4Y A;  1A7D A;  3EG9 A;  2UUH A;  4P9F A;  1U0B B;  2Q9C A;  4G7H F;  2ZPA A;  1TR2 A;  5DS6 A;  3ZSU A;  4E7S A;  1B68 A;  1IZM A;  3QMK A;  4YL3 A;  1APC A;  3LEV A;  3GEI A;  1BDJ B;  2X0C A;  2I15 A;  1MQV A;  2OJQ A;  2HMQ A;  3JYY A;  3OA1 A;  1LM3 B;  4O79 A;  4R32 A;  5COF A;  3SEO A;  3X1O A;  1VOM A;  2JPU A;  4UDV A;  3RKO F;  4E0H A;  1ZZP A;  5KYU A;  3R7C A;  5EK0 A;  4H4K C;  4CIH A;  4JKV A;  3UMI A;  3DD7 A;  2J45 A;  2Q4F A;  1M56 C;  5F5H A;  1TWA A;  3EZH A;  3SNH A;  4BEJ A;  1WTY A;  3B9Q A;  1ZHT A;  3CAX A;  4YT8 A;  5IY5 C;  3B0U X;  2AP3 A;  4GEH A;  3TOM A;  1QLE C;  1T5O A;  3T6B A;  2CGE A;  5AC5 A;  3JYH A;  3C8G A;  2H7B A;  2YHS A;  4OIR F;  3Q7L A;  3QW0 A;  4NTF A;  1EQ1 A;  3EGX B;  4AL1 A;  2Y39 A;  3H65 A;  2E87 A;  2EIN C;  2A69 F;  2PBE A;  4FAP B;  3DM9 B;  3JT1 A;  2P0N A;  2EPL X;  4LAC B;  3GWL A;  3EZI A;  1YA7 O;  5F5F A;  2A68 F;  1DOW A;  1Z5Z A;  1NFN A;  3RVZ A;  1W2W A;  1JPJ A;  1RCP A;  1SR2 A;  3K6B A;  3NYJ A;  1YVI A;  3EH1 A;  5L0H A;  4HEA J;  2YLG A;  4XEK A;  2HS5 A;  1NLX A;  4CIP A;  1D1A A;  2LP4 A;  3O55 A;  4FX5 A;  4BJ1 A;  2HJ3 A;  2IYL D;  2J0X A;  4W8K A;  5AC4 A;  4IRU A;  4JRZ A;  4O6N A;  2GA0 A;  4EKW A;  3CEX A;  1QSP A;  4B6I A;  3EHN A;  3EH2 A;  2XLM A;  4WJ0 A;  1JRA A;  2UUI A;  3IQ5 A;  4XEF A;  4Z9H A;  4D4X A;  1HMD A;  1D0X A;  1JPN A;  3C18 A;  1N1C A;  1KNY A;  4K7B A;  4QDL A;  3DZA A;  3TD7 A;  1AUE A;  3S84 A;  3IHU A;  4AL0 A;  3EFO B;  3BEH A;  2M4E A;  3EHM A;  3LEO A;  1NG1 A;  3NMK A;  5L0J A;  3IPM O;  2YLI A;  5DLJ A;  3GWN A;  3OEO A;  5A6B A;  2ZXO A;  3RIP A;  1XZQ A;  3F46 A;  2XM4 A;  3T9O A;  2J9B A;  3Q7G A;  1Y6D A;  5EHH A;  3VF0 A; 
#chains in the Genus database with same CATH homology
 4P9T A;  3H2U A;  3ZDL A;  4EHP A;  1U6H A;  5L0I A;  3S90 A;  1ZW2 A;  1SYQ A;  1H6G A;  1RKC A;  4K1O A;  4PR9 A;  4DJ9 A;  1RKE B;  1DOV A;  3TJ5 A;  4E17 A;  1QKR A;  2L7A A;  2GDC A;  4E18 A;  1TR2 A;  2GWW A;  2IBF A;  4W8P A;  1U89 A;  2B0H A;  5L0J A;  1ZVZ A;  3H2V A;  1ST6 A;  3T6G B;  1T01 A;  5FZT A;  3MYI A;  2X0C A;  2LQG A;  1DOW A;  3RF3 A;  1ZW3 A;  5L0C A;  5L0G A;  3TJ6 A;  4ONS A;  5L0H A;  1L7C A;  1YDI A;  1RKE A;  2HSQ A;  4IGG A;  5L0F A;  1XWJ A;  3VF0 A;  5L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...