1ZVZA

Vinculin head (0-258) in complex with the talin rod residue 820-844
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
253
structure length
253
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 111
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA01
1ZW3A 1DOWA 1ST6A 3H2VA 3RF3A 1TR2A 1H6GA 4P9TA 1SYQA 1DOVA 3TJ5A 4EHPA 4DJ9A 5L0IA 4PR9A 1ZW2A 2B0HA 3ZDLA 5L0FA 1ZVZA 4E17A 4E18A 1RKEA 2IBFA 2X0CA 1XWJA 2L7AA 3S90A 3VF0A 1RKEB 1U89A 5L0JA 3MYIA 1RKCA 2LQGA 4K1OA 5L0GA 4W8PA 1L7CA 1U6HA 2GWWA 4IGGA 5L0CA 3H2UA 5L0HA 2GDCA 3T6GB 4ONSA 2HSQA 5L0DA 1T01A 1YDIA 5FZTA 1QKRA 3TJ6A
chains in the Genus database with same CATH superfamily
1T9KA 3T4RA 2XM4A 4AL1A 1NFOA 2KSFA 2L6HA 3H2VA 4E0IA 5COMA 1TR2A 3W2WA 4CS8A 3I4UA 3TJ5A 1A41A 2V26A 3EJNA 4H54A 1C03A 1E86A 1ZW2A 4MVUA 1NFNA 2CW0F 3VRCA 3FOPA 2FGYA 2HJ3A 2LFDA 2NUPB 3NRHA 2OEVA 3UMHA 3QW1A 4DRIB 4BJ1A 5EHHA 2PFDA 5JVEA 1CGME 4OIOF 4JRZA 5COGA 3ZQYA 4K1OA 5JP7A 4FAPB 3L8IA 5L0GA 3K6BA 4A4AA 3JZ0A 3DAFA 3L1MA 2ETSA 2FAPB 2H7VC 3A9CA 5JSLA 3LESA 1S05A 3G4ZA 2CDQA 4MVQA 4O6MA 4C7OA 4BEJA 2WVOA 3FAJA 4N06A 3SP1A 1WASA 1NSGB 1DOWA 2Q9AA 2UUIA 1OW6A 1ST6A 3TOLA 4AX2A 1SF8A 1SMYF 2JX0A 1AEPA 1PV3A 1RXQA 1VB5A 2B0HA 4OD4A 256BA 3U9MA 5KYWA 3ASOC 5KYYB 2KGOA 1M57C 3KH2A 1GM5A 4E0HA 3S9OA 4EWCA 3PDMP 4OIPF 5E3CA 1N1CA 1BZ4A 4BEMJ 2J7PD 4JKVA 4MTOA 3B0PA 3DM9B 3FAPB 1MMGA 3U3BA 2XXAA 1XZPA 1EKYA 3PMRA 1TWGA 1Y6DA 3GODA 3N24A 2KJGA 3AGUA 4GQHA 1QPUA 1OCZC 2BL2A 4XQ1A 3U8PA 1MMDA 1BR1A 4DXWA 3H65A 1QVXA 3FOOA 2WZGA 3JTLO 4CSAA 4X0RA 3JCUQ 1BDJB 1MNDA 2W4BA 1Q0DA 3T9OA 5FZTA 4O6NA 4JJFA 2KYHA 2ICWG 4XPXA 3ZG1A 4PJJA 5COFA 3UMKA 4AE4A 3RF3A 5JS5A 4P9TA 1H6GA 5IY5C 3S84A 3CZ6A 3Q6MA 3GM3A 3GEIA 4ER9A 5L0IA 1LIHA 4G78A 2A0BA 3GEEA 3EQLF 3L8JA 1VLSA 4E17A 1ZU5A 1XWJA 2OQMA 3PCVA 4NTFA 2GAQA 3NMIA 3ABKC 4CIPA 3S90A 1FR0A 2WZLA 2VASA 3BEHA 1NU9C 2A68F 3HJCA 1OW8A 3DE8A 3GM1A 3VAYA 4AK9A 4IAOA 1OXBA 2W9YA 1O3UA 5E2QA 5GPGB 1BR2A 4IARA 1OQCA 5KYUB 2R7TA 2L9JA 5HV9A 2FFHA 3WG7C 2Y69C 3U5SA 1J8YF 1JAFA 5B3IA 3LAYA 4XPYA 3RYLA 2BE5F 3B29A 2GFHA 2OJED 1L3PA 2CNWD 3AQBA 4O79A 1TFOB 5B3SC 1G4US 3KPHA 2AU5A 4XWJA 3K66A 3EGDB 3ZTZA 2R7WA 4IJJA 5KYXA 3EPVA 2R7RA 2NSFA 3MBGA 4BG0A 4DJ9A 4OINF 2QY9A 2DGJA 3IQTA 3IPMO 4BJ6A 4LACB 3IQ5A 4JZAA 1LKXA 1M2VB 3AG3C 2HS5A 2XLHA 1T6IA 1RKEB 3CEXA 2IM8A 3K33A 2G62A 3U8VA 1R4TA 3Q7LA 5HSWA 1BBHA 3DWWA 3RQFA 4JCZA 5KYNA 3LEVA 5D91A 2Q4FA 1R5ID 2AWCA 4HEAJ 1WTYA 2GWWA 2XL8A 4MVRA 3RQGA 4I3MA 4ZLDA 2YL0A 1Z6AA 2Q9BA 4YK5A 1LPEA 4QI2A 3EZIA 4E7ZA 4ONSA 3BRJA 1D1BA 2KNHA 1A7VA 1ZW3A 1JPJA 3O6XA 4U5GA 4U5CE 3W4YA 1GQAA 2KC3A 5A6JA 1MMAA 1B68A 1LI7A 2AP3A 4YJWA 2NUTB 3AGTA 3MYFA 3UGPA 3JT1A 2JPUA 2OG2A 1ZVZA 3NYLA 4JTCB 3ZVRA 3HNLA 2L6FA 4G0HA 1Y4CA 4MTGA 4Z9IA 1NLXA 1YAUO 3QW0A 1G8XA 4CS7A 2GA0A 2WVQA 3ABLC 4JW1A 2D5RB 4XEKA 1ZZPA 3LEOA 4F4BA 2R25A 4CIHA 1TWCA 3F46A 5CI9A 1BR4A 1W2WA 1NG1A 1TFKB 3DI5A 3AG4C 3M15A 2EIJC 3TOMA 3UNGC 4U5EE 4JVSA 4EBKA 1HE1A 2CYDA 3ZTMA 3I5PA 1YDIA 1CPQA 2HKVA 2J9WA 1YLMA 4J7YA 2BC5A 3NYMA 1HMOA 4IWBA 4JC7A 2C03A 4U5DE 3ZIBA 4BJ5C 4EUKB 3PHF2 1JRAA 2HUJA 4MVSA 2R7SA 3DJUB 5JUAA 4E18A 1ZHTA 1ZU4A 2IBFA 2Y39A 1D0YA 2ZXWC 4EBBA 3MLGA 4UDVA 3RVYA 1OKKD 4KNWA 2ASRA 2VCAA 2J7PA 3DMDA 4FESA 3UMIA 4BJ5A 3JSEO 5BQIA 1G4WR 5L0JA 4WJ0A 2L81A 1LS1A 3QVZA 3KL4A 5CIVA 2A6HF 2ZPAA 1M6TA 2R7OA 3S29A 1O87A 2CCYA 2KW3C 1MQVA 2ZXOA 3WAQA 2A6EF 3U0CA 1T01A 1UG7A 2PP4A 3K7DA 4H4KC 2YZSA 3GWNA 1UFBA 3ZWIA 4MS2A 2Q3TA 1T6QA 4C7OB 3EZHA 2YL7A 2YL1A 2I8BA 4D4XA 2CGEA 3SZRA 2A1DD 1DOVA 1ZHZA 4FWVA 1VMAA 3SXMA 1VK5A 2IXPA 3U3FA 2J0WA 3CQZA 2TMVP 3EFOA 5AC4A 1FAPB 2YHSA 4CJOA 2G3VA 2HFIA 2YLDA 2J9UA 2R05A 3KYIA 4XLNF 1D1AA 1YA9A 3ZC4A 3QVYA 3S0XA 3W8HA 4CDYA 3C8GB 2XXAB 2B0JA 1U6HA 5L0CA 1PD0A 3DJNB 1WOLA 4WGZA 3CAXA 4XEFA 3VM6A 3WHNA 2QNLA 3HNIA 4WGYA 2ZXRA 4MW3A 3TJ6A 4PJNA 2CNWA 2VC9A 1YYXA 2L6GA 2MHRA 3JRTA 3LS1A 4KNVA 1J8MF 1XZQA 1GS9A 1VYIA 2NSGA 4K7BA 4OIRF 4XLPF 2XSEA 1SYQA 1RJ9B 4DBRA 2Z15A 2YLGA 1FNTc 4HFFB 1ZHWA 2EIMC 1VOMA 2AWYA 2RD9A 2XLOA 3K1HA 5A69A 2EIKC 1KNYA 5L3VA 4NCQA 4I1OB 5E33A 1U0BB 1JR8A 4PFOA 4W8KA 4MVMA 5FCLA 1KTMA 1YARO 3A11A 4Q7CA 1VYKA 2Y3GA 3FMSA 1WN0A 4DRJB 3N2ZB 1ZHXA 3C7JA 1YJGA 1E84A 1E85A 3CSKA 2W4MA 3T6BA 1OCCC 2KK1A 3HTKC 3NMKA 5F5HA 4NQFA 3X2QC 4DRHB 2YQYA 3O55A 4DVYP 4PJLA 4D4NA 1QSPA 3DXJF 2OEXA 2OOCA 4O6YA 4P9FA 2XLVA 1H7IA 2LD6A 2WZFA 2LIGA 2J0XA 2R9RB 3DD7A 3GEHA 2IXOA 2HMQA 2J46A 3Q7GA 3LNMB 3MFNA 4C3DA 2J9BA 2RSEB 3C8GD 3ASNC 3GWLA 1FMWA 1GGQA 2XLEA 4AL0A 4DOZA 3SXKA 1FFHA 4XPWA 2ZXPA 3MYIA 2LQGA 4MVOA 3SYNA 3V5XA 1NU7D 2C04A 3B71A 4G7HF 2M64A 3H2UA 3DKAA 4Q5SF 4JJGA 4J32B 4LLEA 2GDCA 4N6HA 2NPUA 5BQHA 2YKZA 5EGYA 4HE8D 4LLCA 4RDAA 4Z9JA 3ZSUA 1H9TA 4U5BE 2A0UA 1M56C 4JTAB 3EGXB 3V7OA 4MQ9F 1LI5A 2QTVA 4IRUA 4O7GA 5F28E 2EPKX 1M2VA 3S27A 2LK4A 3LUTB 3SXZA 4BJTA 2V3CC 4IAQA 4CX9A 5BQGA 1HW2A 4E7SA 3OWTA 4HFKB 3RFYA 2XLWA 1OKKA 3M4BA 1C17M 3DZAA 1FMVA 2P1AA 3LJBA 1OR3A 1OR2A 1G5ZA 3GANA 3L0IA 1PCXA 3NKDA 4GEHA 2R7VA 5F5FA 3TULA 1EA8A 4J30B 2H8AA 3JSZA 1H9GA 2DYRC 3ITFA 3IHUA 4QI0A 1NBBA 1A0BA 3IEEA 2KQ9A 3KKBA 4YL1A 3RKOF 3SNHA 3NDBB 2OKUA 2H7OA 1TKNA 3O39A 3JRMO 1ORSC 1D0ZA 1Z5ZA 2VCBA 4B6IA 4YL0A 2R7UA 4EKWA 4I44A 3DM5A 3LLIA 4EBJA 4KI2A 1ZYRF 1AVOB 3FHDA 1PD1A 4EIYA 4YT2A 5DLJA 5EK0A 3DAGA 4DVZA 5A6BD 5DS5A 1FTSA 3AG1C 1V74B 3EG9A 2EPNA 3L34A 4LDKA 2VB6A 2YRFA 5B1BC 5A6KA 3T6JA 4WABA 4ULWA 4PFPA 2P61A 4LDRA 5DS6A 2J8WA 3M4CA 4QDLA 4U5FE 3TD7A 2P7VA 4DBQA 5L0HA 1K04A 3C18A 1LS4A 3C62A 2EPOA 2YVKA 2XLMA 3N0TA 4JE9A 4CJGA 2E87A 2QE9A 3W8IA 3EHMA 3EHNA 2VCCA 1IW7F 3US6A 1A7EA 1QQ3A 1VLTA 2X51A 3R2PA 5JT4A 2A69F 4EHPA 3QTHA 3FDQA 2LP4A 2R02A 5BUOA 1ZHYA 3EH2A 2NUPA 2Q00A 3AOUA 3C63A 5KYWB 2UUHA 4J7TA 3GM2A 4G7OF 1S7ZA 3EFOB 3AG2C 4JCHA 5DS4A 2LFFA 1F1MA 4PJMA 2HV7A 3ABMC 1M2OA 1RKCA 4JURI 4OD5A 1V4AA 4GYTA 5AC5A 3LS0A 4LERA 4RD9A 4IGGA 2OJQA 5T1DB 4M63A 4U5HA 1MNEA 1MMNA 1WWPA 3G4XA 4RBNA 3S28A 1ORYA 2PX3A 3V5ZA 1APCA 3T6GB 4Q4ZF 2G3KA 2EPLX 1YVIA 4MNDA 1E2XA 3W2VA 4ZLCA 1IZMA 4P6IC 3TQOA 1WGWA 2QLAA 2ZD9A 1CPRA 1A7DA 3JYHA 4CDAA 2DI3A 1TWHA 3V5YA 5JRAA 2XRHA 4YL3A 3NMJA 5KYYA 2WL8A 1VTMP 2M4EA 4AE4B 1JOGA 3QMKA 3HNKA 3LNRA 3RIPA 3RVZA 2AVKA 2I15A 2Y3BA 2XL4A 1V55C 2X0CA 4CSAC 1D1CA 3VF0A 4C3EA 3ECSA 2H7BA 2OCCC 3C8GA 5B1AC 4JEBA 4YT4A 2NG1A 2PNOA 2YWAA 4PACA 3F47A 1O5HA 2VH3A 5L3QA 1TWAA 1EI7A 1LE2A 2MWQA 1L7CA 1OCOC 4U9DA 3M79A 4ANJA 1OW7A 3RW0A 4CS9C 4LDQA 3DE9A 4NC3A 1KU2A 2MYSA 3NYJA 1ORJA 3QZCA 1E83A 3M1CB 2HSQA 5L0DA 4XEVA 1HMDA 1K05A 2XLDA 3SXYA 2OU6A 2IOQA 1RJ9A 2YEVA 1K40A 1WATA 4CS9A 1NZEA 1HE9A 1OCRC 4Z9HA 1JMWA 1YA7O 2EINC 2LSEA 1Z23A 3HLZA 3E70C 4BPMA 2D4UA 2YL3A 3SEOA 4JIOA 5KYXB 2R03A 4XTKA 3TK0A 3RQEA 3JYYA 5E3AA 5KYUA 4NTBA 4R32A 1Q0KA 3FVYA 4NTAA 2P6VA 3AQCA 4PK4A 3E9VA 4JEAA 1Z7Qc 4KC9A 2WVNA 1TQGA 3AJMA 3GORA 5DVWA 2WB7A 3KYJA 2O9XA 2PBEA 3KMIA 3NKEA 4A2NB 1V54C 3K1IC 1CGNA 1OXKA 2JD3A 3NG1A 4BJ6C 2IXNA 5DQZA 3UGOA 3EGDA 5CI8A 4MTFA 1YYJA 1HY5A 2W45A 2PF4E 2LCHA 3I5QA 4CDVA 1I5NA 1RCPA 3OA1A 3K1IA 4PR9A 4ULVA 3U2LA 5L0FA 3B0VC 1YZAA 3R7CA 2HSBA 4L6RA 1RKEA 2Q7RA 3MX3A 2PX0A 2L7AA 3U2MA 4YT5A 1FFTC 4U9EA 4C3BA 1C02A 4YN0B 4NY3A 5A6BA 1Z63A 4MW8A 1I4YA 3VYWA 1D0XA 2YLIA 3B0UX 2R7QA 2DYSC 1RMVA 1AUEA 3X1OA 5JLIA 2XL6A 4FX5A 2R7XA 5D92A 5T3TA 4K0DA 1SR2A 4KBLA 3LLKA 1Q0FA 1QZXA 1QKRA 5K0IA 3EGXA 2Y3DA 4IB4A 1Z3IX 1CGOA 3B9QA 2HJMA 2NUTA 4YT8A 1HW1A 1Q0MA 2IXMA 2HV6A 2EILC 3RH3A 3U9JA 3ZDLA 3ZQVA 5T3WA 4YWQA 2QUPA 2XS1A 5TJ5E 1JPNA 3UR3C 3OEOA 2J9VA 1QLEC 2IYLD 4I1MA 4MVZA 3IQCA 3WODF 3HNJA 4N6CA 1LE4A 1T5OA 3ATPA 1U89A 1LVKA 4CBEA 4G7ZF 3J06A 1EQ1A 1T6UA 2J45A 3EG9B 2HZ8A 4N4WA 1Q0GA 2P0NA 2Q9CA 4W8PA 5DQTA 3G50A 4OIQF 3IQ6A 1I4ZA 1SZIA 5AGFA 3HKKA 3Q6NA 1LM3B 2EPMX 3FXHA 2F22A 3C8ZA 4CS8C 3POVA 2DB4A 2Y3HA 2HMZA 3EH1A 2XM0A 2XS8A 1YZCA 4JTDB 3O10A 5A6AA
chains in the Genus database with same CATH topology
1ZW3A 1DOWA 1ST6A 3H2VA 3RF3A 1TR2A 1H6GA 4P9TA 1SYQA 1DOVA 3TJ5A 4EHPA 4DJ9A 5L0IA 4PR9A 1ZW2A 2B0HA 3ZDLA 5L0FA 1ZVZA 4E17A 4E18A 1RKEA 2IBFA 2X0CA 1XWJA 2L7AA 3S90A 3VF0A 1RKEB 1U89A 5L0JA 3MYIA 1RKCA 2LQGA 4K1OA 5L0GA 4W8PA 1L7CA 1U6HA 2GWWA 4IGGA 5L0CA 3H2UA 5L0HA 2GDCA 3T6GB 4ONSA 2HSQA 5L0DA 1T01A 1YDIA 5FZTA 1QKRA 3TJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW3 A;  1DOW A;  1ST6 A;  3H2V A;  3RF3 A;  1TR2 A;  1H6G A;  4P9T A;  1SYQ A;  1DOV A;  3TJ5 A;  4EHP A;  4DJ9 A;  5L0I A;  4PR9 A;  1ZW2 A;  2B0H A;  3ZDL A;  5L0F A;  1ZVZ A;  4E17 A;  4E18 A;  1RKE A;  2IBF A;  2X0C A;  1XWJ A;  2L7A A;  3S90 A;  3VF0 A;  1RKE B;  1U89 A;  5L0J A;  3MYI A;  1RKC A;  2LQG A;  4K1O A;  5L0G A;  4W8P A;  1L7C A;  1U6H A;  2GWW A;  4IGG A;  5L0C A;  3H2U A;  5L0H A;  2GDC A;  3T6G B;  4ONS A;  2HSQ A;  5L0D A;  1T01 A;  1YDI A;  5FZT A;  1QKR A;  3TJ6 A; 
#chains in the Genus database with same CATH topology
 1T9K A;  3T4R A;  2XM4 A;  4AL1 A;  1NFO A;  2KSF A;  2L6H A;  3H2V A;  4E0I A;  5COM A;  1TR2 A;  3W2W A;  4CS8 A;  3I4U A;  3TJ5 A;  1A41 A;  2V26 A;  3EJN A;  4H54 A;  1C03 A;  1E86 A;  1ZW2 A;  4MVU A;  1NFN A;  2CW0 F;  3VRC A;  3FOP A;  2FGY A;  2HJ3 A;  2LFD A;  2NUP B;  3NRH A;  2OEV A;  3UMH A;  3QW1 A;  4DRI B;  4BJ1 A;  5EHH A;  2PFD A;  5JVE A;  1CGM E;  4OIO F;  4JRZ A;  5COG A;  3ZQY A;  4K1O A;  5JP7 A;  4FAP B;  3L8I A;  5L0G A;  3K6B A;  4A4A A;  3JZ0 A;  3DAF A;  3L1M A;  2ETS A;  2FAP B;  2H7V C;  3A9C A;  5JSL A;  3LES A;  1S05 A;  3G4Z A;  2CDQ A;  4MVQ A;  4O6M A;  4C7O A;  4BEJ A;  2WVO A;  3FAJ A;  4N06 A;  3SP1 A;  1WAS A;  1NSG B;  1DOW A;  2Q9A A;  2UUI A;  1OW6 A;  1ST6 A;  3TOL A;  4AX2 A;  1SF8 A;  1SMY F;  2JX0 A;  1AEP A;  1PV3 A;  1RXQ A;  1VB5 A;  2B0H A;  4OD4 A;  256B A;  3U9M A;  5KYW A;  3ASO C;  5KYY B;  2KGO A;  1M57 C;  3KH2 A;  1GM5 A;  4E0H A;  3S9O A;  4EWC A;  3PDM P;  4OIP F;  5E3C A;  1N1C A;  1BZ4 A;  4BEM J;  2J7P D;  4JKV A;  4MTO A;  3B0P A;  3DM9 B;  3FAP B;  1MMG A;  3U3B A;  2XXA A;  1XZP A;  1EKY A;  3PMR A;  1TWG A;  1Y6D A;  3GOD A;  3N24 A;  2KJG A;  3AGU A;  4GQH A;  1QPU A;  1OCZ C;  2BL2 A;  4XQ1 A;  3U8P A;  1MMD A;  1BR1 A;  4DXW A;  3H65 A;  1QVX A;  3FOO A;  2WZG A;  3JTL O;  4CSA A;  4X0R A;  3JCU Q;  1BDJ B;  1MND A;  2W4B A;  1Q0D A;  3T9O A;  5FZT A;  4O6N A;  4JJF A;  2KYH A;  2ICW G;  4XPX A;  3ZG1 A;  4PJJ A;  5COF A;  3UMK A;  4AE4 A;  3RF3 A;  5JS5 A;  4P9T A;  1H6G A;  5IY5 C;  3S84 A;  3CZ6 A;  3Q6M A;  3GM3 A;  3GEI A;  4ER9 A;  5L0I A;  1LIH A;  4G78 A;  2A0B A;  3GEE A;  3EQL F;  3L8J A;  1VLS A;  4E17 A;  1ZU5 A;  1XWJ A;  2OQM A;  3PCV A;  4NTF A;  2GAQ A;  3NMI A;  3ABK C;  4CIP A;  3S90 A;  1FR0 A;  2WZL A;  2VAS A;  3BEH A;  1NU9 C;  2A68 F;  3HJC A;  1OW8 A;  3DE8 A;  3GM1 A;  3VAY A;  4AK9 A;  4IAO A;  1OXB A;  2W9Y A;  1O3U A;  5E2Q A;  5GPG B;  1BR2 A;  4IAR A;  1OQC A;  5KYU B;  2R7T A;  2L9J A;  5HV9 A;  2FFH A;  3WG7 C;  2Y69 C;  3U5S A;  1J8Y F;  1JAF A;  5B3I A;  3LAY A;  4XPY A;  3RYL A;  2BE5 F;  3B29 A;  2GFH A;  2OJE D;  1L3P A;  2CNW D;  3AQB A;  4O79 A;  1TFO B;  5B3S C;  1G4U S;  3KPH A;  2AU5 A;  4XWJ A;  3K66 A;  3EGD B;  3ZTZ A;  2R7W A;  4IJJ A;  5KYX A;  3EPV A;  2R7R A;  2NSF A;  3MBG A;  4BG0 A;  4DJ9 A;  4OIN F;  2QY9 A;  2DGJ A;  3IQT A;  3IPM O;  4BJ6 A;  4LAC B;  3IQ5 A;  4JZA A;  1LKX A;  1M2V B;  3AG3 C;  2HS5 A;  2XLH A;  1T6I A;  1RKE B;  3CEX A;  2IM8 A;  3K33 A;  2G62 A;  3U8V A;  1R4T A;  3Q7L A;  5HSW A;  1BBH A;  3DWW A;  3RQF A;  4JCZ A;  5KYN A;  3LEV A;  5D91 A;  2Q4F A;  1R5I D;  2AWC A;  4HEA J;  1WTY A;  2GWW A;  2XL8 A;  4MVR A;  3RQG A;  4I3M A;  4ZLD A;  2YL0 A;  1Z6A A;  2Q9B A;  4YK5 A;  1LPE A;  4QI2 A;  3EZI A;  4E7Z A;  4ONS A;  3BRJ A;  1D1B A;  2KNH A;  1A7V A;  1ZW3 A;  1JPJ A;  3O6X A;  4U5G A;  4U5C E;  3W4Y A;  1GQA A;  2KC3 A;  5A6J A;  1MMA A;  1B68 A;  1LI7 A;  2AP3 A;  4YJW A;  2NUT B;  3AGT A;  3MYF A;  3UGP A;  3JT1 A;  2JPU A;  2OG2 A;  1ZVZ A;  3NYL A;  4JTC B;  3ZVR A;  3HNL A;  2L6F A;  4G0H A;  1Y4C A;  4MTG A;  4Z9I A;  1NLX A;  1YAU O;  3QW0 A;  1G8X A;  4CS7 A;  2GA0 A;  2WVQ A;  3ABL C;  4JW1 A;  2D5R B;  4XEK A;  1ZZP A;  3LEO A;  4F4B A;  2R25 A;  4CIH A;  1TWC A;  3F46 A;  5CI9 A;  1BR4 A;  1W2W A;  1NG1 A;  1TFK B;  3DI5 A;  3AG4 C;  3M15 A;  2EIJ C;  3TOM A;  3UNG C;  4U5E E;  4JVS A;  4EBK A;  1HE1 A;  2CYD A;  3ZTM A;  3I5P A;  1YDI A;  1CPQ A;  2HKV A;  2J9W A;  1YLM A;  4J7Y A;  2BC5 A;  3NYM A;  1HMO A;  4IWB A;  4JC7 A;  2C03 A;  4U5D E;  3ZIB A;  4BJ5 C;  4EUK B;  3PHF 2;  1JRA A;  2HUJ A;  4MVS A;  2R7S A;  3DJU B;  5JUA A;  4E18 A;  1ZHT A;  1ZU4 A;  2IBF A;  2Y39 A;  1D0Y A;  2ZXW C;  4EBB A;  3MLG A;  4UDV A;  3RVY A;  1OKK D;  4KNW A;  2ASR A;  2VCA A;  2J7P A;  3DMD A;  4FES A;  3UMI A;  4BJ5 A;  3JSE O;  5BQI A;  1G4W R;  5L0J A;  4WJ0 A;  2L81 A;  1LS1 A;  3QVZ A;  3KL4 A;  5CIV A;  2A6H F;  2ZPA A;  1M6T A;  2R7O A;  3S29 A;  1O87 A;  2CCY A;  2KW3 C;  1MQV A;  2ZXO A;  3WAQ A;  2A6E F;  3U0C A;  1T01 A;  1UG7 A;  2PP4 A;  3K7D A;  4H4K C;  2YZS A;  3GWN A;  1UFB A;  3ZWI A;  4MS2 A;  2Q3T A;  1T6Q A;  4C7O B;  3EZH A;  2YL7 A;  2YL1 A;  2I8B A;  4D4X A;  2CGE A;  3SZR A;  2A1D D;  1DOV A;  1ZHZ A;  4FWV A;  1VMA A;  3SXM A;  1VK5 A;  2IXP A;  3U3F A;  2J0W A;  3CQZ A;  2TMV P;  3EFO A;  5AC4 A;  1FAP B;  2YHS A;  4CJO A;  2G3V A;  2HFI A;  2YLD A;  2J9U A;  2R05 A;  3KYI A;  4XLN F;  1D1A A;  1YA9 A;  3ZC4 A;  3QVY A;  3S0X A;  3W8H A;  4CDY A;  3C8G B;  2XXA B;  2B0J A;  1U6H A;  5L0C A;  1PD0 A;  3DJN B;  1WOL A;  4WGZ A;  3CAX A;  4XEF A;  3VM6 A;  3WHN A;  2QNL A;  3HNI A;  4WGY A;  2ZXR A;  4MW3 A;  3TJ6 A;  4PJN A;  2CNW A;  2VC9 A;  1YYX A;  2L6G A;  2MHR A;  3JRT A;  3LS1 A;  4KNV A;  1J8M F;  1XZQ A;  1GS9 A;  1VYI A;  2NSG A;  4K7B A;  4OIR F;  4XLP F;  2XSE A;  1SYQ A;  1RJ9 B;  4DBR A;  2Z15 A;  2YLG A;  1FNT c;  4HFF B;  1ZHW A;  2EIM C;  1VOM A;  2AWY A;  2RD9 A;  2XLO A;  3K1H A;  5A69 A;  2EIK C;  1KNY A;  5L3V A;  4NCQ A;  4I1O B;  5E33 A;  1U0B B;  1JR8 A;  4PFO A;  4W8K A;  4MVM A;  5FCL A;  1KTM A;  1YAR O;  3A11 A;  4Q7C A;  1VYK A;  2Y3G A;  3FMS A;  1WN0 A;  4DRJ B;  3N2Z B;  1ZHX A;  3C7J A;  1YJG A;  1E84 A;  1E85 A;  3CSK A;  2W4M A;  3T6B A;  1OCC C;  2KK1 A;  3HTK C;  3NMK A;  5F5H A;  4NQF A;  3X2Q C;  4DRH B;  2YQY A;  3O55 A;  4DVY P;  4PJL A;  4D4N A;  1QSP A;  3DXJ F;  2OEX A;  2OOC A;  4O6Y A;  4P9F A;  2XLV A;  1H7I A;  2LD6 A;  2WZF A;  2LIG A;  2J0X A;  2R9R B;  3DD7 A;  3GEH A;  2IXO A;  2HMQ A;  2J46 A;  3Q7G A;  3LNM B;  3MFN A;  4C3D A;  2J9B A;  2RSE B;  3C8G D;  3ASN C;  3GWL A;  1FMW A;  1GGQ A;  2XLE A;  4AL0 A;  4DOZ A;  3SXK A;  1FFH A;  4XPW A;  2ZXP A;  3MYI A;  2LQG A;  4MVO A;  3SYN A;  3V5X A;  1NU7 D;  2C04 A;  3B71 A;  4G7H F;  2M64 A;  3H2U A;  3DKA A;  4Q5S F;  4JJG A;  4J32 B;  4LLE A;  2GDC A;  4N6H A;  2NPU A;  5BQH A;  2YKZ A;  5EGY A;  4HE8 D;  4LLC A;  4RDA A;  4Z9J A;  3ZSU A;  1H9T A;  4U5B E;  2A0U A;  1M56 C;  4JTA B;  3EGX B;  3V7O A;  4MQ9 F;  1LI5 A;  2QTV A;  4IRU A;  4O7G A;  5F28 E;  2EPK X;  1M2V A;  3S27 A;  2LK4 A;  3LUT B;  3SXZ A;  4BJT A;  2V3C C;  4IAQ A;  4CX9 A;  5BQG A;  1HW2 A;  4E7S A;  3OWT A;  4HFK B;  3RFY A;  2XLW A;  1OKK A;  3M4B A;  1C17 M;  3DZA A;  1FMV A;  2P1A A;  3LJB A;  1OR3 A;  1OR2 A;  1G5Z A;  3GAN A;  3L0I A;  1PCX A;  3NKD A;  4GEH A;  2R7V A;  5F5F A;  3TUL A;  1EA8 A;  4J30 B;  2H8A A;  3JSZ A;  1H9G A;  2DYR C;  3ITF A;  3IHU A;  4QI0 A;  1NBB A;  1A0B A;  3IEE A;  2KQ9 A;  3KKB A;  4YL1 A;  3RKO F;  3SNH A;  3NDB B;  2OKU A;  2H7O A;  1TKN A;  3O39 A;  3JRM O;  1ORS C;  1D0Z A;  1Z5Z A;  2VCB A;  4B6I A;  4YL0 A;  2R7U A;  4EKW A;  4I44 A;  3DM5 A;  3LLI A;  4EBJ A;  4KI2 A;  1ZYR F;  1AVO B;  3FHD A;  1PD1 A;  4EIY A;  4YT2 A;  5DLJ A;  5EK0 A;  3DAG A;  4DVZ A;  5A6B D;  5DS5 A;  1FTS A;  3AG1 C;  1V74 B;  3EG9 A;  2EPN A;  3L34 A;  4LDK A;  2VB6 A;  2YRF A;  5B1B C;  5A6K A;  3T6J A;  4WAB A;  4ULW A;  4PFP A;  2P61 A;  4LDR A;  5DS6 A;  2J8W A;  3M4C A;  4QDL A;  4U5F E;  3TD7 A;  2P7V A;  4DBQ A;  5L0H A;  1K04 A;  3C18 A;  1LS4 A;  3C62 A;  2EPO A;  2YVK A;  2XLM A;  3N0T A;  4JE9 A;  4CJG A;  2E87 A;  2QE9 A;  3W8I A;  3EHM A;  3EHN A;  2VCC A;  1IW7 F;  3US6 A;  1A7E A;  1QQ3 A;  1VLT A;  2X51 A;  3R2P A;  5JT4 A;  2A69 F;  4EHP A;  3QTH A;  3FDQ A;  2LP4 A;  2R02 A;  5BUO A;  1ZHY A;  3EH2 A;  2NUP A;  2Q00 A;  3AOU A;  3C63 A;  5KYW B;  2UUH A;  4J7T A;  3GM2 A;  4G7O F;  1S7Z A;  3EFO B;  3AG2 C;  4JCH A;  5DS4 A;  2LFF A;  1F1M A;  4PJM A;  2HV7 A;  3ABM C;  1M2O A;  1RKC A;  4JUR I;  4OD5 A;  1V4A A;  4GYT A;  5AC5 A;  3LS0 A;  4LER A;  4RD9 A;  4IGG A;  2OJQ A;  5T1D B;  4M63 A;  4U5H A;  1MNE A;  1MMN A;  1WWP A;  3G4X A;  4RBN A;  3S28 A;  1ORY A;  2PX3 A;  3V5Z A;  1APC A;  3T6G B;  4Q4Z F;  2G3K A;  2EPL X;  1YVI A;  4MND A;  1E2X A;  3W2V A;  4ZLC A;  1IZM A;  4P6I C;  3TQO A;  1WGW A;  2QLA A;  2ZD9 A;  1CPR A;  1A7D A;  3JYH A;  4CDA A;  2DI3 A;  1TWH A;  3V5Y A;  5JRA A;  2XRH A;  4YL3 A;  3NMJ A;  5KYY A;  2WL8 A;  1VTM P;  2M4E A;  4AE4 B;  1JOG A;  3QMK A;  3HNK A;  3LNR A;  3RIP A;  3RVZ A;  2AVK A;  2I15 A;  2Y3B A;  2XL4 A;  1V55 C;  2X0C A;  4CSA C;  1D1C A;  3VF0 A;  4C3E A;  3ECS A;  2H7B A;  2OCC C;  3C8G A;  5B1A C;  4JEB A;  4YT4 A;  2NG1 A;  2PNO A;  2YWA A;  4PAC A;  3F47 A;  1O5H A;  2VH3 A;  5L3Q A;  1TWA A;  1EI7 A;  1LE2 A;  2MWQ A;  1L7C A;  1OCO C;  4U9D A;  3M79 A;  4ANJ A;  1OW7 A;  3RW0 A;  4CS9 C;  4LDQ A;  3DE9 A;  4NC3 A;  1KU2 A;  2MYS A;  3NYJ A;  1ORJ A;  3QZC A;  1E83 A;  3M1C B;  2HSQ A;  5L0D A;  4XEV A;  1HMD A;  1K05 A;  2XLD A;  3SXY A;  2OU6 A;  2IOQ A;  1RJ9 A;  2YEV A;  1K40 A;  1WAT A;  4CS9 A;  1NZE A;  1HE9 A;  1OCR C;  4Z9H A;  1JMW A;  1YA7 O;  2EIN C;  2LSE A;  1Z23 A;  3HLZ A;  3E70 C;  4BPM A;  2D4U A;  2YL3 A;  3SEO A;  4JIO A;  5KYX B;  2R03 A;  4XTK A;  3TK0 A;  3RQE A;  3JYY A;  5E3A A;  5KYU A;  4NTB A;  4R32 A;  1Q0K A;  3FVY A;  4NTA A;  2P6V A;  3AQC A;  4PK4 A;  3E9V A;  4JEA A;  1Z7Q c;  4KC9 A;  2WVN A;  1TQG A;  3AJM A;  3GOR A;  5DVW A;  2WB7 A;  3KYJ A;  2O9X A;  2PBE A;  3KMI A;  3NKE A;  4A2N B;  1V54 C;  3K1I C;  1CGN A;  1OXK A;  2JD3 A;  3NG1 A;  4BJ6 C;  2IXN A;  5DQZ A;  3UGO A;  3EGD A;  5CI8 A;  4MTF A;  1YYJ A;  1HY5 A;  2W45 A;  2PF4 E;  2LCH A;  3I5Q A;  4CDV A;  1I5N A;  1RCP A;  3OA1 A;  3K1I A;  4PR9 A;  4ULV A;  3U2L A;  5L0F A;  3B0V C;  1YZA A;  3R7C A;  2HSB A;  4L6R A;  1RKE A;  2Q7R A;  3MX3 A;  2PX0 A;  2L7A A;  3U2M A;  4YT5 A;  1FFT C;  4U9E A;  4C3B A;  1C02 A;  4YN0 B;  4NY3 A;  5A6B A;  1Z63 A;  4MW8 A;  1I4Y A;  3VYW A;  1D0X A;  2YLI A;  3B0U X;  2R7Q A;  2DYS C;  1RMV A;  1AUE A;  3X1O A;  5JLI A;  2XL6 A;  4FX5 A;  2R7X A;  5D92 A;  5T3T A;  4K0D A;  1SR2 A;  4KBL A;  3LLK A;  1Q0F A;  1QZX A;  1QKR A;  5K0I A;  3EGX A;  2Y3D A;  4IB4 A;  1Z3I X;  1CGO A;  3B9Q A;  2HJM A;  2NUT A;  4YT8 A;  1HW1 A;  1Q0M A;  2IXM A;  2HV6 A;  2EIL C;  3RH3 A;  3U9J A;  3ZDL A;  3ZQV A;  5T3W A;  4YWQ A;  2QUP A;  2XS1 A;  5TJ5 E;  1JPN A;  3UR3 C;  3OEO A;  2J9V A;  1QLE C;  2IYL D;  4I1M A;  4MVZ A;  3IQC A;  3WOD F;  3HNJ A;  4N6C A;  1LE4 A;  1T5O A;  3ATP A;  1U89 A;  1LVK A;  4CBE A;  4G7Z F;  3J06 A;  1EQ1 A;  1T6U A;  2J45 A;  3EG9 B;  2HZ8 A;  4N4W A;  1Q0G A;  2P0N A;  2Q9C A;  4W8P A;  5DQT A;  3G50 A;  4OIQ F;  3IQ6 A;  1I4Z A;  1SZI A;  5AGF A;  3HKK A;  3Q6N A;  1LM3 B;  2EPM X;  3FXH A;  2F22 A;  3C8Z A;  4CS8 C;  3POV A;  2DB4 A;  2Y3H A;  2HMZ A;  3EH1 A;  2XM0 A;  2XS8 A;  1YZC A;  4JTD B;  3O10 A;  5A6A A; 
#chains in the Genus database with same CATH homology
 1ZW3 A;  1DOW A;  1ST6 A;  3H2V A;  3RF3 A;  1TR2 A;  1H6G A;  4P9T A;  1SYQ A;  1DOV A;  3TJ5 A;  4EHP A;  4DJ9 A;  5L0I A;  4PR9 A;  1ZW2 A;  2B0H A;  3ZDL A;  5L0F A;  1ZVZ A;  4E17 A;  4E18 A;  1RKE A;  2IBF A;  2X0C A;  1XWJ A;  2L7A A;  3S90 A;  3VF0 A;  1RKE B;  1U89 A;  5L0J A;  3MYI A;  1RKC A;  2LQG A;  4K1O A;  5L0G A;  4W8P A;  1L7C A;  1U6H A;  2GWW A;  4IGG A;  5L0C A;  3H2U A;  5L0H A;  2GDC A;  3T6G B;  4ONS A;  2HSQ A;  5L0D A;  1T01 A;  1YDI A;  5FZT A;  1QKR A;  3TJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...