1ZVZA

Vinculin head (0-258) in complex with the talin rod residue 820-844
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
253
structure length
253
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Vinculin
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
total genus 111
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA01
2GDCA 2L7AA 1L7CA 4W8PA 3VF0A 5L0DA 3T6GB 5L0HA 4E18A 2B0HA 1RKCA 4PR9A 4IGGA 1XWJA 2GWWA 3TJ6A 3TJ5A 1TR2A 1ZW3A 5L0GA 5L0IA 3S90A 1U89A 1SYQA 3MYIA 4P9TA 5L0JA 5L0FA 1RKEA 1RKEB 1YDIA 2IBFA 2X0CA 1T01A 4K1OA 5L0CA 2LQGA 1H6GA 4EHPA 1DOWA 3ZDLA 3RF3A 4ONSA 3H2UA 4DJ9A 2HSQA 5FZTA 1DOVA 1U6HA 3H2VA 1ST6A 4E17A 1ZVZA 1QKRA 1ZW2A
chains in the Genus database with same CATH superfamily
1Z3IX 4NCQA 3VF0A 3GWLA 5HV9A 4BJ6C 3NYMA 4E0HA 1L3PA 3GEHA 3KYIA 5L0HA 3ZQYA 3UGOA 2DI3A 4CS9A 1MQVA 1D0XA 3DAFA 1PD1A 2LP4A 5BQGA 5BQIA 1HW1A 2R7TA 1D0ZA 4JJFA 2Q7RA 5JRAA 3VM6A 1K05A 4N6HA 5L0JA 2YL7A 1H7IA 3MBGA 5A6KA 1NFOA 4JE9A 4O6MA 2KW3C 2ETSA 1OQCA 2VCAA 4KC9A 1S7ZA 2Z15A 3JRTA 3K1IA 3KPHA 3SXKA 4MNDA 1LE2A 3HLZA 5L3VA 4FESA 2MYSA 2EINC 3FAPB 1MMAA 1C02A 2OQMA 3DD7A 4QI0A 2TMVP 1IZMA 1F1MA 1LS4A 2HMZA 1BDJB 1AVOB 2R7VA 5F28E 5DLJA 4LLCA 2PF4E 4O79A 5CI8A 4PJMA 4YJWA 2KK1A 3R7CA 2R05A 2XL4A 3LESA 1VK5A 3Q6MA 1BZ4A 2EPLX 3RFYA 5A6AA 4OIQF 1NG1A 2Q9BA 4XEFA 3JRMO 2ZXOA 1LM3B 3RIPA 2PFDA 2WZGA 5L0FA 1WGWA 2H8AA 1JPJA 1YDIA 4XEVA 1YYXA 2BL2A 4PFPA 4AE4B 2B0JA 3LS0A 1B68A 2HMQA 2J9VA 3ZIBA 1OW8A 2NUPB 3AQCA 2HKVA 4YN0B 5KYXB 2W45A 3QW0A 4CS8A 3C63A 5KYWB 3AOUA 3CAXA 3DM9B 3ASNC 4OD4A 1K04A 2DB4A 4IRUA 2P6VA 4L6RA 1WATA 4MTGA 5GPGB 2R7RA 3GORA 2C04A 4E17A 4JCHA 1WOLA 4A2NB 4HEAJ 1D1BA 1PV3A 3SZRA 4DRJB 3A9CA 2YZSA 1NZEA 2UUIA 1C03A 1YA7O 4J30B 2AWYA 3OWTA 1Q0GA 5JLIA 3KMIA 3I5PA 1ZU5A 3EGXA 4B6IA 4BJTA 4IWBA 1AUEA 4CX9A 3H65A 1H9TA 4G0HA 1JAFA 1XWJA 3LLKA 4LDKA 2EPKX 2XLMA 2PP4A 1QSPA 4DVYP 4RD9A 3M1CB 2L6HA 4K1OA 4NQFA 1WWPA 4XQ1A 3UMHA 4JEBA 1M6TA 3PDMP 2H7VC 2VB6A 3B9QA 3G4XA 4JW1A 1M56C 1G5ZA 1YA9A 1MNDA 4YL3A 1EA8A 3RQGA 5D92A 3RW0A 1OR3A 3DJUB 4QDLA 4GQHA 1NFNA 4U5GA 1T6IA 1D0YA 1ST6A 1KTMA 3TD7A 3C8GA 4OIRF 4QI2A 2FAPB 3TK0A 3FXHA 4F4BA 1VOMA 3ABKC 4E18A 3EGDB 1A41A 4M63A 4YL1A 2BC5A 3CSKA 4PR9A 2QLAA 4JTCB 4C7OA 4DRHB 2R02A 256BA 2GWWA 3S27A 3TJ5A 1YYJA 1J8YF 2R7UA 5A69A 2ZD9A 4P9TA 5IY5C 3EPVA 2HFIA 3UGPA 4JTAB 3ECSA 4U5BE 4H4KC 4CJOA 3NMKA 1Q0FA 3DXJF 2OU6A 3C8ZA 2AU5A 1A7EA 4Z9HA 4EHPA 4OIPF 1E85A 4J32B 1FR0A 3POVA 3AG2C 3LEVA 5T1DB 3NDBB 3GEEA 2R03A 1G4WR 3K1HA 4UDVA 4ER9A 3K66A 5COMA 1GS9A 2JX0A 2ZXWC 1NLXA 4MVUA 4N4WA 2Y3HA 2J45A 4MVMA 2DYSC 4EBJA 4KNWA 5CI9A 4DBRA 4CDAA 1VYIA 1C17M 1RJ9A 2Q00A 3IEEA 4MTFA 4N6CA 2DGJA 3M79A 5EK0A 3W8HA 2GAQA 5BUOA 3PMRA 4CSAA 3I5QA 2Y3BA 3GANA 5B3SC 3S90A 1ZW3A 2Q3TA 2NUTB 5B1BC 3LJBA 1TFOB 1SYQA 5DQTA 4DRIB 5A6BA 1ZHYA 4G7HF 4KBLA 3HNJA 2IOQA 3RVZA 5JVEA 2CW0F 1QVXA 1SF8A 2P7VA 1O87A 1VTMP 4E7SA 5E3AA 4GYTA 4E7ZA 2V3CC 1WASA 2XRHA 2Y69C 3ITFA 5DS6A 4KI2A 4CSAC 3AQBA 4R32A 4U5EE 3T9OA 1TKNA 5B1AC 5F5FA 1ZZPA 1HMDA 4MQ9F 1U0BB 1OW6A 5JS5A 4XTKA 4MTOA 3L0IA 1BR2A 1TWHA 1Z6AA 1OXBA 2KYHA 2J7PA 4JC7A 4PACA 2A0UA 3S9OA 3T6GB 4C3EA 2LFFA 2L6GA 4RBNA 2LD6A 2EIKC 3TQOA 2IXOA 1FMVA 2H7OA 2J9BA 2NSGA 2H7BA 2C03A 3U5SA 1Z63A 5T3TA 1LS1A 3KKBA 2YEVA 1Q0MA 4P9FA 2CNWA 1QZXA 3OEOA 3L8JA 2OEXA 1Z7Qc 4Z9JA 1DOWA 1VYKA 2KQ9A 1APCA 4YL0A 5TJ5E 2KSFA 1OCOC 3LS1A 4CS9C 1TFKB 3I4UA 2OCCC 1UG7A 4XPWA 4NTAA 4ZLCA 1A0BA 2XL8A 3H2VA 3GWNA 3GM3A 1YAUO 1K40A 2L7AA 1TWGA 2YL3A 3TOLA 3C8GD 3Q7LA 1M2VB 3SXMA 3U9MA 4YT5A 3EZHA 4H54A 2QNLA 1TWAA 1I4YA 2XLEA 3C18A 3JTLO 3K1IC 2B0HA 5AGFA 3LAYA 4G78A 4OINF 4XLNF 1Y4CA 2HS5A 2YL0A 4N06A 4YT4A 3WHNA 1D1CA 1WTYA 2XLVA 4EIYA 1LI7A 3O10A 1RKEB 3DKAA 3HTKC 2OJED 2W4BA 3EFOA 3VRCA 4EBKA 4K0DA 2NSFA 2WL8A 2O9XA 4PFOA 3M15A 2A6HF 3TULA 1FTSA 2W9YA 3J06A 2YKZA 3ABLC 3X2QC 3SNHA 3GM1A 1GQAA 4NY3A 3UNGC 5HSWA 1EI7A 2A69F 3NMJA 4YK5A 3N0TA 3UMIA 5FZTA 2IYLD 3EG9A 1VLTA 2EIMC 2KC3A 1ORSC 2XXAB 5KYYB 5EHHA 1CGOA 4MS2A 4WJ0A 3JCUQ 3ZG1A 4BEJA 3U3FA 4DOZA 3Q7GA 2R7XA 1NSGB 1OR2A 4CS8C 2Y3GA 3CZ6A 5L0GA 3RYLA 3V5XA 3O6XA 5A6JA 5AC5A 3K33A 3AGTA 1H9GA 1HW2A 3B0PA 2R7SA 3S29A 2JPUA 1QQ3A 3S84A 1OCCC 4XPXA 3JZ0A 3RF3A 3K6BA 3H2UA 2EPNA 2GA0A 2HSBA 4JIOA 4PK4A 5KYUA 1MMNA 3V5YA 3S28A 2HV6A 4AL0A 2WVOA 3UR3C 4DXWA 3EQLF 1FAPB 4Q7CA 3IQ6A 4MVRA 2IXPA 3U8PA 4XWJA 3DWWA 5DQZA 3DE8A 4MW3A 4CJGA 3X1OA 3B71A 5JSLA 3U2LA 3HNLA 3M4CA 2J7PD 4I1OB 4IJJA 5E33A 4EUKB 2J9WA 3FDQA 3T6JA 2J8WA 1ZU4A 3JSZA 5COFA 3L1MA 4KNVA 3EFOB 4G7ZF 2VCCA 3V5ZA 3U3BA 3GM2A 2X0CA 4JURI 1RCPA 3E70C 4JCZA 2CYDA 4XPYA 3IHUA 2KNHA 4J7TA 1YJGA 3EJNA 2HUJA 4I3MA 1LI5A 2M64A 4U9EA 5F5HA 1RMVA 3RKOF 5T3WA 3EHNA 1A7VA 1LPEA 3F46A 2YLDA 1GM5A 1OKKA 1V54C 4I44A 1M2OA 4EKWA 2D5RB 1CPRA 2MWQA 4DVZA 3SEOA 5D91A 2YLIA 5E2QA 2XLHA 4E0IA 3LLIA 3IPMO 3T6BA 3N24A 3PHF2 3NYJA 4K7BA 4WABA 3BEHA 3IQ5A 3W4YA 1E86A 3AG4C 3EGXB 3IQCA 2L9JA 2WB7A 2RSEB 3VYWA 2Y39A 3NKEA 2G3VA 4Z9IA 4AL1A 1MMDA 3DJNB 2J0XA 1U89A 1NBBA 2G62A 3GODA 3HKKA 1BR4A 2AVKA 4JTDB 3US6A 2KJGA 1W2WA 4GEHA 4P6IC 1LE4A 3DAGA 2F22A 4IARA 2WVNA 2PX3A 1FFHA 3O39A 2OOCA 2AWCA 3LEOA 4ONSA 3VAYA 1FFTC 2WZLA 3DE9A 2XM4A 4CIPA 2CGEA 1EQ1A 3MYFA 4HFKB 4BJ5A 2IXNA 4LDRA 3C8GB 3L34A 1YARO 3G4ZA 2R25A 3E9VA 3CQZA 2OEVA 1KU2A 3ZWIA 3C62A 1HMOA 1Y6DA 3CEXA 4NTBA 5AC4A 3V7OA 3O55A 4C7OB 4XEKA 3W8IA 4Q5SF 3ZTMA 1I5NA 3HNIA 3NRHA 1JR8A 2J9UA 2XM0A 4LDQA 4W8KA 4BJ5C 3WODF 5FCLA 2IBFA 3B0VC 1SR2A 4OD5A 2LIGA 1UFBA 4AE4A 3FMSA 4EBBA 1Q0KA 4BJ6A 4Q4ZF 1T6QA 1OCRC 2YQYA 1A7DA 2YVKA 4MVSA 1O5HA 2XS1A 1PD0A 2A6EF 3EH2A 5KYXA 5KYWA 3JSEO 5JP7A 1Z23A 2DYRC 3AGUA 2HSQA 2WVQA 2R7WA 4BEMJ 1ZHWA 2XSEA 3IQTA 2HJMA 4J7YA 2R7OA 1T5OA 2EIJC 4ZLDA 1QKRA 2GDCA 2BE5F 4IAQA 2VH3A 5CIVA 4O6YA 1CPQA 4MVOA 2Y3DA 4D4XA 1RJ9B 5L0DA 2R7QA 3FAJA 4PJNA 3RQEA 3LNRA 3W2VA 1RKCA 1JOGA 1VLSA 2VASA 1EKYA 2HZ8A 3U0CA 2HJ3A 4OIOF 2FGYA 3S0XA 2PBEA 1NU9C 3OA1A 2PNOA 1T01A 2ZPAA 3JT1A 4U9DA 4CDYA 2A1DD 4XLPF 5L0CA 2J0WA 4FX5A 4ANJA 3FVYA 2QTVA 3PCVA 4NC3A 3FOOA 2P0NA 1E83A 1MMGA 3EZIA 5DS5A 2LK4A 4JZAA 2MHRA 4CDVA 1OKKD 1U6HA 2I15A 3ABMC 3DZAA 2JD3A 3N2ZB 1ZW2A 1OXKA 2EPOA 1ZHTA 1IW7F 1L7CA 1MNEA 3FOPA 3MFNA 4G7OF 4C3DA 4A4AA 2FFHA 3SXZA 1LKXA 1V74B 3EGDA 1T9KA 3K7DA 4BG0A 3F47A 1JMWA 2XS8A 3SYNA 3L8IA 3DI5A 1TR2A 2Q9CA 1J8MF 4YWQA 1XZPA 4MVZA 1VB5A 4O7GA 4AK9A 3QW1A 5K0IA 2A0BA 1FNTc 3T4RA 3G50A 5A6BD 2A68F 4NTFA 1ZHXA 4D4NA 3KYJA 3B0UX 3MX3A 2Q9AA 4CS7A 2XLDA 2ICWG 2ZXPA 5BQHA 4IB4A 1O3UA 1QPUA 2J46A 3RVYA 3ZTZA 2X51A 1HE1A 3SP1A 2OKUA 3ZQVA 5L3QA 2L81A 4WGYA 1OCZC 2OG2A 1LVKA 1N1CA 3MLGA 3DMDA 5DVWA 3RQFA 3ASOC 1BBHA 4I1MA 1TWCA 2P61A 4U5HA 3QMKA 1R4TA 3TOMA 4FAPB 4PJLA 1V55C 2YLGA 2YWAA 3NG1A 3NKDA 4WGZA 2QUPA 1OW7A 3U2MA 5L0IA 2NUTA 4DBQA 2XL6A 2E87A 3ATPA 3C7JA 5E3CA 4BJ1A 3B29A 2IXMA 1I4ZA 4PJJA 3JYYA 4JKVA 1AEPA 2HV7A 4FWVA 1H6GA 3M4BA 2Q4FA 1T6UA 2LCHA 3JYHA 2CNWD 2VCBA 1NU7D 3WAQA 4DJ9A 4MVQA 1XZQA 1QLEC 2KGOA 4U5DE 2RD9A 3EG9B 1ZYRF 4JRZA 3ZC4A 2ASRA 3LUTB 3LNMB 1ZVZA 3QZCA 3R2PA 1PCXA 2LSEA 2GFHA 4W8PA 4AX2A 2XLWA 3NYLA 4ULVA 3RH3A 4LERA 2PX0A 4LLEA 2OJQA 2D4UA 3Q6NA 3EHMA 3W2WA 2G3KA 4LACB 1YZCA 1M57C 4IGGA 1E2XA 2CDQA 5DS4A 1YLMA 3NMIA 3TJ6A 2W4MA 1BR1A 1KNYA 2YL1A 2M4EA 3A11A 3MYIA 2VC9A 4U5CE 2IM8A 4HE8D 2NG1A 4C3BA 1S05A 1LIHA 4CBEA 1ORJA 1VMAA 5KYNA 5B3IA 2EPMX 2UUHA 4RDAA 4X0RA 4YT2A 1G4US 1SZIA 3EH1A 5JUAA 3ZDLA 1YZAA 3GEIA 4JVSA 1D1AA 5JT4A 4O6NA 1HY5A 3KL4A 1JPNA 2WZFA 2YRFA 5KYUB 1GGQA 1JRAA 4BPMA 3HNKA 1HE9A 1RXQA 4HFFB 3FHDA 4ULWA 1CGNA 1M2VA 3BRJA 3KH2A 1YVIA 2XLOA 4YT8A 3UMKA 3U9JA 3AG3C 1Q0DA 4MW8A 1WN0A 2NPUA 2QE9A 1ORYA 1R5ID 2YHSA 3AJMA 4JEAA 2CCYA 1V4AA 1RKEA 1Z5ZA 2I8BA 2L6FA 2QY9A 5COGA 3WG7C 5EGYA 2LFDA 4IAOA 3QVYA 3SXYA 3HJCA 2R9RB 3AG1C 2LQGA 2AP3A 3DM5A 2NUPA 4JJGA 2P1AA 3QTHA 1CGME 2V26A 1SMYF 2EILC 1G8XA 3U8VA 3ZVRA 4EWCA 1ZHZA 3ZSUA 1DOVA 3QVZA 4CIHA 1E84A 4U5FE 1FMWA 1TQGA 2ZXRA 2XXAA 5KYYA
chains in the Genus database with same CATH topology
2GDCA 2L7AA 1L7CA 4W8PA 3VF0A 5L0DA 3T6GB 5L0HA 4E18A 2B0HA 1RKCA 4PR9A 4IGGA 1XWJA 2GWWA 3TJ6A 3TJ5A 1TR2A 1ZW3A 5L0GA 5L0IA 3S90A 1U89A 1SYQA 3MYIA 4P9TA 5L0JA 5L0FA 1RKEA 1RKEB 1YDIA 2IBFA 2X0CA 1T01A 4K1OA 5L0CA 2LQGA 1H6GA 4EHPA 1DOWA 3ZDLA 3RF3A 4ONSA 3H2UA 4DJ9A 2HSQA 5FZTA 1DOVA 1U6HA 3H2VA 1ST6A 4E17A 1ZVZA 1QKRA 1ZW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDC A;  2L7A A;  1L7C A;  4W8P A;  3VF0 A;  5L0D A;  3T6G B;  5L0H A;  4E18 A;  2B0H A;  1RKC A;  4PR9 A;  4IGG A;  1XWJ A;  2GWW A;  3TJ6 A;  3TJ5 A;  1TR2 A;  1ZW3 A;  5L0G A;  5L0I A;  3S90 A;  1U89 A;  1SYQ A;  3MYI A;  4P9T A;  5L0J A;  5L0F A;  1RKE A;  1RKE B;  1YDI A;  2IBF A;  2X0C A;  1T01 A;  4K1O A;  5L0C A;  2LQG A;  1H6G A;  4EHP A;  1DOW A;  3ZDL A;  3RF3 A;  4ONS A;  3H2U A;  4DJ9 A;  2HSQ A;  5FZT A;  1DOV A;  1U6H A;  3H2V A;  1ST6 A;  4E17 A;  1ZVZ A;  1QKR A;  1ZW2 A; 
#chains in the Genus database with same CATH topology
 1Z3I X;  4NCQ A;  3VF0 A;  3GWL A;  5HV9 A;  4BJ6 C;  3NYM A;  4E0H A;  1L3P A;  3GEH A;  3KYI A;  5L0H A;  3ZQY A;  3UGO A;  2DI3 A;  4CS9 A;  1MQV A;  1D0X A;  3DAF A;  1PD1 A;  2LP4 A;  5BQG A;  5BQI A;  1HW1 A;  2R7T A;  1D0Z A;  4JJF A;  2Q7R A;  5JRA A;  3VM6 A;  1K05 A;  4N6H A;  5L0J A;  2YL7 A;  1H7I A;  3MBG A;  5A6K A;  1NFO A;  4JE9 A;  4O6M A;  2KW3 C;  2ETS A;  1OQC A;  2VCA A;  4KC9 A;  1S7Z A;  2Z15 A;  3JRT A;  3K1I A;  3KPH A;  3SXK A;  4MND A;  1LE2 A;  3HLZ A;  5L3V A;  4FES A;  2MYS A;  2EIN C;  3FAP B;  1MMA A;  1C02 A;  2OQM A;  3DD7 A;  4QI0 A;  2TMV P;  1IZM A;  1F1M A;  1LS4 A;  2HMZ A;  1BDJ B;  1AVO B;  2R7V A;  5F28 E;  5DLJ A;  4LLC A;  2PF4 E;  4O79 A;  5CI8 A;  4PJM A;  4YJW A;  2KK1 A;  3R7C A;  2R05 A;  2XL4 A;  3LES A;  1VK5 A;  3Q6M A;  1BZ4 A;  2EPL X;  3RFY A;  5A6A A;  4OIQ F;  1NG1 A;  2Q9B A;  4XEF A;  3JRM O;  2ZXO A;  1LM3 B;  3RIP A;  2PFD A;  2WZG A;  5L0F A;  1WGW A;  2H8A A;  1JPJ A;  1YDI A;  4XEV A;  1YYX A;  2BL2 A;  4PFP A;  4AE4 B;  2B0J A;  3LS0 A;  1B68 A;  2HMQ A;  2J9V A;  3ZIB A;  1OW8 A;  2NUP B;  3AQC A;  2HKV A;  4YN0 B;  5KYX B;  2W45 A;  3QW0 A;  4CS8 A;  3C63 A;  5KYW B;  3AOU A;  3CAX A;  3DM9 B;  3ASN C;  4OD4 A;  1K04 A;  2DB4 A;  4IRU A;  2P6V A;  4L6R A;  1WAT A;  4MTG A;  5GPG B;  2R7R A;  3GOR A;  2C04 A;  4E17 A;  4JCH A;  1WOL A;  4A2N B;  4HEA J;  1D1B A;  1PV3 A;  3SZR A;  4DRJ B;  3A9C A;  2YZS A;  1NZE A;  2UUI A;  1C03 A;  1YA7 O;  4J30 B;  2AWY A;  3OWT A;  1Q0G A;  5JLI A;  3KMI A;  3I5P A;  1ZU5 A;  3EGX A;  4B6I A;  4BJT A;  4IWB A;  1AUE A;  4CX9 A;  3H65 A;  1H9T A;  4G0H A;  1JAF A;  1XWJ A;  3LLK A;  4LDK A;  2EPK X;  2XLM A;  2PP4 A;  1QSP A;  4DVY P;  4RD9 A;  3M1C B;  2L6H A;  4K1O A;  4NQF A;  1WWP A;  4XQ1 A;  3UMH A;  4JEB A;  1M6T A;  3PDM P;  2H7V C;  2VB6 A;  3B9Q A;  3G4X A;  4JW1 A;  1M56 C;  1G5Z A;  1YA9 A;  1MND A;  4YL3 A;  1EA8 A;  3RQG A;  5D92 A;  3RW0 A;  1OR3 A;  3DJU B;  4QDL A;  4GQH A;  1NFN A;  4U5G A;  1T6I A;  1D0Y A;  1ST6 A;  1KTM A;  3TD7 A;  3C8G A;  4OIR F;  4QI2 A;  2FAP B;  3TK0 A;  3FXH A;  4F4B A;  1VOM A;  3ABK C;  4E18 A;  3EGD B;  1A41 A;  4M63 A;  4YL1 A;  2BC5 A;  3CSK A;  4PR9 A;  2QLA A;  4JTC B;  4C7O A;  4DRH B;  2R02 A;  256B A;  2GWW A;  3S27 A;  3TJ5 A;  1YYJ A;  1J8Y F;  2R7U A;  5A69 A;  2ZD9 A;  4P9T A;  5IY5 C;  3EPV A;  2HFI A;  3UGP A;  4JTA B;  3ECS A;  4U5B E;  4H4K C;  4CJO A;  3NMK A;  1Q0F A;  3DXJ F;  2OU6 A;  3C8Z A;  2AU5 A;  1A7E A;  4Z9H A;  4EHP A;  4OIP F;  1E85 A;  4J32 B;  1FR0 A;  3POV A;  3AG2 C;  3LEV A;  5T1D B;  3NDB B;  3GEE A;  2R03 A;  1G4W R;  3K1H A;  4UDV A;  4ER9 A;  3K66 A;  5COM A;  1GS9 A;  2JX0 A;  2ZXW C;  1NLX A;  4MVU A;  4N4W A;  2Y3H A;  2J45 A;  4MVM A;  2DYS C;  4EBJ A;  4KNW A;  5CI9 A;  4DBR A;  4CDA A;  1VYI A;  1C17 M;  1RJ9 A;  2Q00 A;  3IEE A;  4MTF A;  4N6C A;  2DGJ A;  3M79 A;  5EK0 A;  3W8H A;  2GAQ A;  5BUO A;  3PMR A;  4CSA A;  3I5Q A;  2Y3B A;  3GAN A;  5B3S C;  3S90 A;  1ZW3 A;  2Q3T A;  2NUT B;  5B1B C;  3LJB A;  1TFO B;  1SYQ A;  5DQT A;  4DRI B;  5A6B A;  1ZHY A;  4G7H F;  4KBL A;  3HNJ A;  2IOQ A;  3RVZ A;  5JVE A;  2CW0 F;  1QVX A;  1SF8 A;  2P7V A;  1O87 A;  1VTM P;  4E7S A;  5E3A A;  4GYT A;  4E7Z A;  2V3C C;  1WAS A;  2XRH A;  2Y69 C;  3ITF A;  5DS6 A;  4KI2 A;  4CSA C;  3AQB A;  4R32 A;  4U5E E;  3T9O A;  1TKN A;  5B1A C;  5F5F A;  1ZZP A;  1HMD A;  4MQ9 F;  1U0B B;  1OW6 A;  5JS5 A;  4XTK A;  4MTO A;  3L0I A;  1BR2 A;  1TWH A;  1Z6A A;  1OXB A;  2KYH A;  2J7P A;  4JC7 A;  4PAC A;  2A0U A;  3S9O A;  3T6G B;  4C3E A;  2LFF A;  2L6G A;  4RBN A;  2LD6 A;  2EIK C;  3TQO A;  2IXO A;  1FMV A;  2H7O A;  2J9B A;  2NSG A;  2H7B A;  2C03 A;  3U5S A;  1Z63 A;  5T3T A;  1LS1 A;  3KKB A;  2YEV A;  1Q0M A;  4P9F A;  2CNW A;  1QZX A;  3OEO A;  3L8J A;  2OEX A;  1Z7Q c;  4Z9J A;  1DOW A;  1VYK A;  2KQ9 A;  1APC A;  4YL0 A;  5TJ5 E;  2KSF A;  1OCO C;  3LS1 A;  4CS9 C;  1TFK B;  3I4U A;  2OCC C;  1UG7 A;  4XPW A;  4NTA A;  4ZLC A;  1A0B A;  2XL8 A;  3H2V A;  3GWN A;  3GM3 A;  1YAU O;  1K40 A;  2L7A A;  1TWG A;  2YL3 A;  3TOL A;  3C8G D;  3Q7L A;  1M2V B;  3SXM A;  3U9M A;  4YT5 A;  3EZH A;  4H54 A;  2QNL A;  1TWA A;  1I4Y A;  2XLE A;  3C18 A;  3JTL O;  3K1I C;  2B0H A;  5AGF A;  3LAY A;  4G78 A;  4OIN F;  4XLN F;  1Y4C A;  2HS5 A;  2YL0 A;  4N06 A;  4YT4 A;  3WHN A;  1D1C A;  1WTY A;  2XLV A;  4EIY A;  1LI7 A;  3O10 A;  1RKE B;  3DKA A;  3HTK C;  2OJE D;  2W4B A;  3EFO A;  3VRC A;  4EBK A;  4K0D A;  2NSF A;  2WL8 A;  2O9X A;  4PFO A;  3M15 A;  2A6H F;  3TUL A;  1FTS A;  2W9Y A;  3J06 A;  2YKZ A;  3ABL C;  3X2Q C;  3SNH A;  3GM1 A;  1GQA A;  4NY3 A;  3UNG C;  5HSW A;  1EI7 A;  2A69 F;  3NMJ A;  4YK5 A;  3N0T A;  3UMI A;  5FZT A;  2IYL D;  3EG9 A;  1VLT A;  2EIM C;  2KC3 A;  1ORS C;  2XXA B;  5KYY B;  5EHH A;  1CGO A;  4MS2 A;  4WJ0 A;  3JCU Q;  3ZG1 A;  4BEJ A;  3U3F A;  4DOZ A;  3Q7G A;  2R7X A;  1NSG B;  1OR2 A;  4CS8 C;  2Y3G A;  3CZ6 A;  5L0G A;  3RYL A;  3V5X A;  3O6X A;  5A6J A;  5AC5 A;  3K33 A;  3AGT A;  1H9G A;  1HW2 A;  3B0P A;  2R7S A;  3S29 A;  2JPU A;  1QQ3 A;  3S84 A;  1OCC C;  4XPX A;  3JZ0 A;  3RF3 A;  3K6B A;  3H2U A;  2EPN A;  2GA0 A;  2HSB A;  4JIO A;  4PK4 A;  5KYU A;  1MMN A;  3V5Y A;  3S28 A;  2HV6 A;  4AL0 A;  2WVO A;  3UR3 C;  4DXW A;  3EQL F;  1FAP B;  4Q7C A;  3IQ6 A;  4MVR A;  2IXP A;  3U8P A;  4XWJ A;  3DWW A;  5DQZ A;  3DE8 A;  4MW3 A;  4CJG A;  3X1O A;  3B71 A;  5JSL A;  3U2L A;  3HNL A;  3M4C A;  2J7P D;  4I1O B;  4IJJ A;  5E33 A;  4EUK B;  2J9W A;  3FDQ A;  3T6J A;  2J8W A;  1ZU4 A;  3JSZ A;  5COF A;  3L1M A;  4KNV A;  3EFO B;  4G7Z F;  2VCC A;  3V5Z A;  3U3B A;  3GM2 A;  2X0C A;  4JUR I;  1RCP A;  3E70 C;  4JCZ A;  2CYD A;  4XPY A;  3IHU A;  2KNH A;  4J7T A;  1YJG A;  3EJN A;  2HUJ A;  4I3M A;  1LI5 A;  2M64 A;  4U9E A;  5F5H A;  1RMV A;  3RKO F;  5T3W A;  3EHN A;  1A7V A;  1LPE A;  3F46 A;  2YLD A;  1GM5 A;  1OKK A;  1V54 C;  4I44 A;  1M2O A;  4EKW A;  2D5R B;  1CPR A;  2MWQ A;  4DVZ A;  3SEO A;  5D91 A;  2YLI A;  5E2Q A;  2XLH A;  4E0I A;  3LLI A;  3IPM O;  3T6B A;  3N24 A;  3PHF 2;  3NYJ A;  4K7B A;  4WAB A;  3BEH A;  3IQ5 A;  3W4Y A;  1E86 A;  3AG4 C;  3EGX B;  3IQC A;  2L9J A;  2WB7 A;  2RSE B;  3VYW A;  2Y39 A;  3NKE A;  2G3V A;  4Z9I A;  4AL1 A;  1MMD A;  3DJN B;  2J0X A;  1U89 A;  1NBB A;  2G62 A;  3GOD A;  3HKK A;  1BR4 A;  2AVK A;  4JTD B;  3US6 A;  2KJG A;  1W2W A;  4GEH A;  4P6I C;  1LE4 A;  3DAG A;  2F22 A;  4IAR A;  2WVN A;  2PX3 A;  1FFH A;  3O39 A;  2OOC A;  2AWC A;  3LEO A;  4ONS A;  3VAY A;  1FFT C;  2WZL A;  3DE9 A;  2XM4 A;  4CIP A;  2CGE A;  1EQ1 A;  3MYF A;  4HFK B;  4BJ5 A;  2IXN A;  4LDR A;  3C8G B;  3L34 A;  1YAR O;  3G4Z A;  2R25 A;  3E9V A;  3CQZ A;  2OEV A;  1KU2 A;  3ZWI A;  3C62 A;  1HMO A;  1Y6D A;  3CEX A;  4NTB A;  5AC4 A;  3V7O A;  3O55 A;  4C7O B;  4XEK A;  3W8I A;  4Q5S F;  3ZTM A;  1I5N A;  3HNI A;  3NRH A;  1JR8 A;  2J9U A;  2XM0 A;  4LDQ A;  4W8K A;  4BJ5 C;  3WOD F;  5FCL A;  2IBF A;  3B0V C;  1SR2 A;  4OD5 A;  2LIG A;  1UFB A;  4AE4 A;  3FMS A;  4EBB A;  1Q0K A;  4BJ6 A;  4Q4Z F;  1T6Q A;  1OCR C;  2YQY A;  1A7D A;  2YVK A;  4MVS A;  1O5H A;  2XS1 A;  1PD0 A;  2A6E F;  3EH2 A;  5KYX A;  5KYW A;  3JSE O;  5JP7 A;  1Z23 A;  2DYR C;  3AGU A;  2HSQ A;  2WVQ A;  2R7W A;  4BEM J;  1ZHW A;  2XSE A;  3IQT A;  2HJM A;  4J7Y A;  2R7O A;  1T5O A;  2EIJ C;  4ZLD A;  1QKR A;  2GDC A;  2BE5 F;  4IAQ A;  2VH3 A;  5CIV A;  4O6Y A;  1CPQ A;  4MVO A;  2Y3D A;  4D4X A;  1RJ9 B;  5L0D A;  2R7Q A;  3FAJ A;  4PJN A;  3RQE A;  3LNR A;  3W2V A;  1RKC A;  1JOG A;  1VLS A;  2VAS A;  1EKY A;  2HZ8 A;  3U0C A;  2HJ3 A;  4OIO F;  2FGY A;  3S0X A;  2PBE A;  1NU9 C;  3OA1 A;  2PNO A;  1T01 A;  2ZPA A;  3JT1 A;  4U9D A;  4CDY A;  2A1D D;  4XLP F;  5L0C A;  2J0W A;  4FX5 A;  4ANJ A;  3FVY A;  2QTV A;  3PCV A;  4NC3 A;  3FOO A;  2P0N A;  1E83 A;  1MMG A;  3EZI A;  5DS5 A;  2LK4 A;  4JZA A;  2MHR A;  4CDV A;  1OKK D;  1U6H A;  2I15 A;  3ABM C;  3DZA A;  2JD3 A;  3N2Z B;  1ZW2 A;  1OXK A;  2EPO A;  1ZHT A;  1IW7 F;  1L7C A;  1MNE A;  3FOP A;  3MFN A;  4G7O F;  4C3D A;  4A4A A;  2FFH A;  3SXZ A;  1LKX A;  1V74 B;  3EGD A;  1T9K A;  3K7D A;  4BG0 A;  3F47 A;  1JMW A;  2XS8 A;  3SYN A;  3L8I A;  3DI5 A;  1TR2 A;  2Q9C A;  1J8M F;  4YWQ A;  1XZP A;  4MVZ A;  1VB5 A;  4O7G A;  4AK9 A;  3QW1 A;  5K0I A;  2A0B A;  1FNT c;  3T4R A;  3G50 A;  5A6B D;  2A68 F;  4NTF A;  1ZHX A;  4D4N A;  3KYJ A;  3B0U X;  3MX3 A;  2Q9A A;  4CS7 A;  2XLD A;  2ICW G;  2ZXP A;  5BQH A;  4IB4 A;  1O3U A;  1QPU A;  2J46 A;  3RVY A;  3ZTZ A;  2X51 A;  1HE1 A;  3SP1 A;  2OKU A;  3ZQV A;  5L3Q A;  2L81 A;  4WGY A;  1OCZ C;  2OG2 A;  1LVK A;  1N1C A;  3MLG A;  3DMD A;  5DVW A;  3RQF A;  3ASO C;  1BBH A;  4I1M A;  1TWC A;  2P61 A;  4U5H A;  3QMK A;  1R4T A;  3TOM A;  4FAP B;  4PJL A;  1V55 C;  2YLG A;  2YWA A;  3NG1 A;  3NKD A;  4WGZ A;  2QUP A;  1OW7 A;  3U2M A;  5L0I A;  2NUT A;  4DBQ A;  2XL6 A;  2E87 A;  3ATP A;  3C7J A;  5E3C A;  4BJ1 A;  3B29 A;  2IXM A;  1I4Z A;  4PJJ A;  3JYY A;  4JKV A;  1AEP A;  2HV7 A;  4FWV A;  1H6G A;  3M4B A;  2Q4F A;  1T6U A;  2LCH A;  3JYH A;  2CNW D;  2VCB A;  1NU7 D;  3WAQ A;  4DJ9 A;  4MVQ A;  1XZQ A;  1QLE C;  2KGO A;  4U5D E;  2RD9 A;  3EG9 B;  1ZYR F;  4JRZ A;  3ZC4 A;  2ASR A;  3LUT B;  3LNM B;  1ZVZ A;  3QZC A;  3R2P A;  1PCX A;  2LSE A;  2GFH A;  4W8P A;  4AX2 A;  2XLW A;  3NYL A;  4ULV A;  3RH3 A;  4LER A;  2PX0 A;  4LLE A;  2OJQ A;  2D4U A;  3Q6N A;  3EHM A;  3W2W A;  2G3K A;  4LAC B;  1YZC A;  1M57 C;  4IGG A;  1E2X A;  2CDQ A;  5DS4 A;  1YLM A;  3NMI A;  3TJ6 A;  2W4M A;  1BR1 A;  1KNY A;  2YL1 A;  2M4E A;  3A11 A;  3MYI A;  2VC9 A;  4U5C E;  2IM8 A;  4HE8 D;  2NG1 A;  4C3B A;  1S05 A;  1LIH A;  4CBE A;  1ORJ A;  1VMA A;  5KYN A;  5B3I A;  2EPM X;  2UUH A;  4RDA A;  4X0R A;  4YT2 A;  1G4U S;  1SZI A;  3EH1 A;  5JUA A;  3ZDL A;  1YZA A;  3GEI A;  4JVS A;  1D1A A;  5JT4 A;  4O6N A;  1HY5 A;  3KL4 A;  1JPN A;  2WZF A;  2YRF A;  5KYU B;  1GGQ A;  1JRA A;  4BPM A;  3HNK A;  1HE9 A;  1RXQ A;  4HFF B;  3FHD A;  4ULW A;  1CGN A;  1M2V A;  3BRJ A;  3KH2 A;  1YVI A;  2XLO A;  4YT8 A;  3UMK A;  3U9J A;  3AG3 C;  1Q0D A;  4MW8 A;  1WN0 A;  2NPU A;  2QE9 A;  1ORY A;  1R5I D;  2YHS A;  3AJM A;  4JEA A;  2CCY A;  1V4A A;  1RKE A;  1Z5Z A;  2I8B A;  2L6F A;  2QY9 A;  5COG A;  3WG7 C;  5EGY A;  2LFD A;  4IAO A;  3QVY A;  3SXY A;  3HJC A;  2R9R B;  3AG1 C;  2LQG A;  2AP3 A;  3DM5 A;  2NUP A;  4JJG A;  2P1A A;  3QTH A;  1CGM E;  2V26 A;  1SMY F;  2EIL C;  1G8X A;  3U8V A;  3ZVR A;  4EWC A;  1ZHZ A;  3ZSU A;  1DOV A;  3QVZ A;  4CIH A;  1E84 A;  4U5F E;  1FMW A;  1TQG A;  2ZXR A;  2XXA A;  5KYY A; 
#chains in the Genus database with same CATH homology
 2GDC A;  2L7A A;  1L7C A;  4W8P A;  3VF0 A;  5L0D A;  3T6G B;  5L0H A;  4E18 A;  2B0H A;  1RKC A;  4PR9 A;  4IGG A;  1XWJ A;  2GWW A;  3TJ6 A;  3TJ5 A;  1TR2 A;  1ZW3 A;  5L0G A;  5L0I A;  3S90 A;  1U89 A;  1SYQ A;  3MYI A;  4P9T A;  5L0J A;  5L0F A;  1RKE A;  1RKE B;  1YDI A;  2IBF A;  2X0C A;  1T01 A;  4K1O A;  5L0C A;  2LQG A;  1H6G A;  4EHP A;  1DOW A;  3ZDL A;  3RF3 A;  4ONS A;  3H2U A;  4DJ9 A;  2HSQ A;  5FZT A;  1DOV A;  1U6H A;  3H2V A;  1ST6 A;  4E17 A;  1ZVZ A;  1QKR A;  1ZW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...