1ZVZA

Vinculin head (0-258) in complex with the talin rod residue 820-844
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
253
structure length
253
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping and consensus sequence identification for multiple vinculin binding sites within the talin rod
pubmed doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords Vinculin
total genus 111
structure length 253
sequence length 253
ec nomenclature
pdb deposition date 2005-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1zvzA01
1XWJA 3VF0A 4E18A 2B0HA 1U6HA 4P9TA 1YDIA 1ST6A 2IBFA 1RKCA 4EHPA 3T6GB 1L7CA 1QKRA 5FZTA 2GDCA 3TJ6A 1DOWA 1DOVA 4IGGA 1ZW2A 1RKEB 1ZW3A 4ONSA 3ZDLA 5L0GA 4E17A 4K1OA 5L0IA 4PR9A 1RKEA 1SYQA 2X0CA 2L7AA 4DJ9A 2HSQA 3RF3A 3H2UA 5L0FA 1ZVZA 2GWWA 5L0JA 1T01A 5L0HA 3MYIA 3H2VA 4W8PA 3TJ5A 3S90A 1U89A 2LQGA 5L0CA 1TR2A 1H6GA 5L0DA
chains in the Genus database with same CATH superfamily
1R5ID 2UUIA 2VCBA 3NMIA 3EH1A 2NUPB 1OXKA 1Z23A 3S28A 4CS7A 4C7OB 4YL3A 2IYLD 2PNOA 4WGYA 3V5ZA 1QKRA 4EBBA 1G4WR 1WATA 3DM9B 4CSAA 4F4BA 4YJWA 3QMKA 4OD5A 2Y3GA 4YT4A 1V4AA 2CCYA 3AGUA 3JYYA 4Z9JA 1LS4A 4B6IA 3EPVA 3FVYA 1NG1A 1WWPA 2WZFA 3C8GD 3RQEA 2QLAA 4G78A 3UGOA 3EGXA 3Q6NA 2L6GA 5DQZA 3K1IA 3JZ0A 1LM3B 3W8HA 2XLEA 3GANA 3KH2A 3EZHA 3OA1A 2HV6A 3DE9A 3JSEO 2A0BA 1Q0MA 4K7BA 5B1AC 3RIPA 4CIPA 4Q7CA 4YWQA 4BJ6C 4Z9IA 2XLHA 2I15A 3Q7LA 4N4WA 3ZQYA 4CBEA 4D4XA 3DE8A 2ETSA 3EHMA 4JTAB 2XL6A 5BUOA 2Q4FA 2AWYA 2IOQA 3F46A 3FOPA 3RQGA 2GDCA 3UNGC 1UFBA 3U0CA 1TWGA 3LEOA 1DOWA 3JT1A 3OWTA 4NQFA 4ONSA 5DLJA 1PD0A 3FDQA 5KYNA 3M4BA 1D1CA 2R7WA 4HEAJ 3K7DA 3UR3C 1SZIA 2IXPA 1T6IA 2NG1A 4JEBA 4KNWA 3S29A 1HMOA 2P6VA 4NC3A 1OKKD 2GAQA 2XS8A 3I4UA 3M79A 3GEEA 2XSEA 4W8PA 3ITFA 3TJ5A 5AC5A 1J8YF 1ORYA 1YYJA 3NYMA 4MVUA 4MNDA 1ZHZA 2IXMA 2DYSC 2D4UA 4YT5A 3HLZA 3WG7C 2W4BA 4G7HF 1CPQA 1OW7A 4I1OB 4MVSA 4IAQA 1GGQA 3T6BA 4DRJB 4CSAC 2A1DD 4MS2A 2NSFA 4U9EA 3GM3A 3I5PA 3DWWA 1I4YA 1ZW2A 2R7XA 3O55A 1M56C 5TJ5E 1M57C 3U2MA 5JSLA 4AE4B 4PR9A 5IY5C 5KYYA 3EGDB 4J7YA 1OCRC 3E70C 3DM5A 2R7VA 3IQCA 3O6XA 4JC7A 4LDKA 1B68A 1Z3IX 4OIOF 2DGJA 3X1OA 1ZHTA 1LE4A 2NPUA 3ABKC 4U5DE 4XQ1A 4BEMJ 3QVYA 1ZZPA 4ULVA 2W4MA 4YL0A 3ASOC 1IW7F 4KC9A 1JPNA 2M4EA 4YN0B 4BJ6A 256BA 4C3DA 4BJTA 2GFHA 3EFOB 4IJJA 5KYWB 3C63A 1D1BA 2OQMA 1MNDA 2WVOA 4OIPF 1QSPA 1TQGA 3ECSA 3BEHA 3LS0A 3LS1A 1VLTA 4BJ1A 1RCPA 3N2ZB 1A0BA 3K33A 5F5FA 1Q0FA 1K05A 3ZG1A 3RVZA 1MMNA 2YLGA 2G62A 1MNEA 1WASA 2HMQA 2A6EF 3IQ6A 2L9JA 5A6BD 2AWCA 3EHNA 4DOZA 3UMIA 4KBLA 1FR0A 1M2VB 4LACB 4X0RA 3RF3A 3H2UA 4DJ9A 5JUAA 2FAPB 3HJCA 5L0FA 4DVZA 1T01A 1VK5A 2OOCA 2KGOA 1UG7A 1WOLA 3MYIA 1NLXA 1L3PA 1TWHA 3SZRA 1WN0A 3DJUB 3MYFA 2IXOA 4EBJA 2ZXPA 2L6FA 3HNIA 3GWNA 3U3FA 4ZLCA 2YL1A 1FFTC 3ZQVA 4EKWA 2H7BA 2HKVA 2WVNA 3U5SA 1K40A 1YARO 2MYSA 3I5QA 4MTOA 4MVRA 3S84A 4EHPA 5JLIA 2C04A 3CZ6A 1ZU4A 4O6MA 3WODF 4C3BA 4RD9A 1OW6A 3DAGA 4IWBA 4MTFA 2JD3A 3CAXA 3EGXB 2Q9BA 4AL0A 5JRAA 1RKEB 2R9RB 3FOOA 4K1OA 4XPYA 3NYJA 4U5CE 3LJBA 2IM8A 1RXQA 2R7OA 2DB4A 3DXJF 3JRMO 2Q7RA 5DQTA 5K0IA 3UGPA 2W45A 1ZVZA 4OINF 2CW0F 2DI3A 3QVZA 2PFDA 1OXBA 2A68F 1OCZC 2AVKA 4I44A 3HNKA 1YZCA 2J46A 1TFKB 1PD1A 2LQGA 2Z15A 3NMJA 1C03A 2F22A 1HMDA 3M4CA 2CYDA 2R7QA 3ZVRA 3JSZA 4W8KA 2OKUA 1O3UA 2Y69C 2YZSA 1QVXA 2CDQA 4G0HA 3H65A 4JVSA 1SF8A 2X51A 3EFOA 3TQOA 3W4YA 4JIOA 4N6HA 4XLNF 4E7SA 1TFOB 3B0VC 1JR8A 2KC3A 3QW1A 1A7DA 4CS8A 2XL4A 3QZCA 3V7OA 1FFHA 2QUPA 3GWLA 3TULA 2X0CA 2KW3C 1EQ1A 3SXMA 2VB6A 2R25A 4IARA 1I5NA 2Y3DA 3FHDA 1HE1A 5F28E 1H9TA 3IEEA 3K1HA 3K66A 1H7IA 2BE5F 3DMDA 4JTDB 1G5ZA 2EPLX 4CS9C 2LP4A 2HUJA 3U8PA 3UMHA 3G50A 4PFPA 2IBFA 2XLOA 5EK0A 2QE9A 4UDVA 3AGTA 3GEHA 4P9FA 2A69F 3FXHA 5CI9A 1NFOA 4L6RA 4CJOA 1BR1A 2J9VA 3KL4A 4EUKB 4DXWA 3EGDA 3JCUQ 1S7ZA 1Q0KA 4WJ0A 4JZAA 3SXYA 4BEJA 4G7ZF 2XXAA 4DBQA 3DD7A 4MVOA 3AG3C 4H4KC 2QTVA 2CNWD 3EJNA 1D0ZA 3V5YA 1C02A 4BPMA 1OQCA 2JPUA 3RYLA 4ER9A 2C03A 4H54A 4PFOA 4XPWA 2HZ8A 4GQHA 1K04A 3NKDA 4AK9A 4MW3A 3C18A 4NTAA 2P61A 2YEVA 2MHRA 3MX3A 1E86A 5COGA 3IPMO 4JCZA 1TR2A 2VH3A 4CIHA 1H6GA 2Y3BA 5T3TA 5HSWA 2VASA 4P9TA 2HFIA 3C8ZA 1OW8A 1OCCC 4CDYA 4P6IC 2RSEB 1V74B 2EIMC 4YL1A 1CGME 1T6QA 4LDQA 3T4RA 2J7PA 3ZC4A 4Q5SF 1NSGB 3L8JA 4U5EE 4EIYA 4EWCA 5JT4A 3POVA 1CGNA 1LS1A 2R05A 3MFNA 5AGFA 3NG1A 3NKEA 4RBNA 1JRAA 4MTGA 5COFA 5KYUA 3HNJA 5EHHA 4AL1A 2MWQA 4R32A 1E83A 2V26A 4O6NA 4E0IA 4HE8D 4JTCB 1PCXA 3W2VA 4C7OA 2R7TA 1WGWA 4JJFA 2KSFA 2P7VA 3IQTA 3OEOA 1O87A 1WTYA 2ZPAA 4HFFB 4CJGA 5B3SC 2PBEA 3LNMB 2TMVP 4FAPB 2J0WA 4IGGA 5L0CA 2EIKC 1TWCA 4NCQA 2HV7A 2H8AA 3AOUA 3B0PA 3N24A 2WL8A 4U5GA 3GEIA 1VTMP 4OIQF 4IAOA 1LKXA 2NUTA 2KNHA 5D91A 1JOGA 4AX2A 1N1CA 1RJ9A 1CGOA 2EPNA 1KU2A 3TK0A 3ZTZA 1C17M 2ZD9A 4CS8C 3TJ6A 5A6BA 3RKOF 1Z6AA 4A4AA 4XTKA 2R7UA 1ZW3A 1SR2A 4MW8A 4Z9HA 1KNYA 1ZHYA 2ZXWC 2XLDA 3O39A 3SXZA 2VC9A 2WVQA 1VB5A 2VCAA 3ATPA 2KYHA 3IQ5A 1YA7O 2XM4A 3LAYA 2GA0A 3V5XA 2BC5A 4J32B 2KQ9A 3C8GA 4CDAA 3G4ZA 3PMRA 4IB4A 1LIHA 1YLMA 3JRTA 4Q4ZF 1U89A 2H7VC 3Q6MA 2PP4A 1QZXA 2PX3A 3GM2A 1Z7Qc 3RFYA 4CS9A 3O10A 5E3AA 1BBHA 1U6HA 3C7JA 4E18A 5A6KA 1AVOB 1BZ4A 2YL3A 1AUEA 2LD6A 2OJQA 1G8XA 3AQCA 5JP7A 4ULWA 4PJNA 5E2QA 3WAQA 5D92A 2V3CC 3FAJA 2EPOA 3GM1A 5FZTA 4DRIB 2OEVA 3HKKA 2ICWG 3WHNA 2YLIA 5L3VA 1E85A 3VRCA 1RMVA 4D4NA 4N6CA 1QQ3A 1D0XA 1KTMA 3SYNA 2NSGA 4O6YA 4A2NB 5KYXB 3RW0A 3KYJA 2J45A 2L7AA 1YA9A 3B71A 4E0HA 1O5HA 2XLWA 3KPHA 1D0YA 3MLGA 5L0JA 2EIJC 4M63A 4FX5A 2Q00A 1T9KA 1FMWA 4HFKB 1M2OA 1PV3A 1M2VA 1BDJB 1VYIA 4QI2A 3KMIA 5KYUB 4PJLA 1YZAA 5B3IA 4I1MA 4XWJA 3CSKA 1FNTc 2HMZA 1CPRA 1OKKA 2OG2A 5E33A 5BQIA 1YVIA 2YHSA 2G3KA 3HTKC 3QW0A 4JRZA 4N06A 3T6GB 2R7RA 1ORJA 1Y6DA 1Y4CA 4J30B 4DVYP 4XLPF 2YVKA 3B0UX 2HJMA 3LLKA 4PACA 1IZMA 2HJ3A 1FMVA 5DS4A 3MBGA 4RDAA 4NTBA 4KI2A 3SP1A 1HE9A 5KYWA 1A7VA 2E87A 3K1IC 3SXKA 1SYQA 2NUTB 3BRJA 2HSQA 3CEXA 5COMA 5T3WA 4BJ5C 1M6TA 1LVKA 3T9OA 2AP3A 3QTHA 5HV9A 1ZHWA 3A9CA 1V55C 2ASRA 2Y3HA 1NU9C 3ASNC 5A69A 2KJGA 5L0DA 1XWJA 1VLSA 5BQHA 1MMAA 2Y39A 4O79A 4O7GA 1BR2A 2LIGA 4PJJA 2YL0A 4I3MA 1L7CA 3ABLC 3C8GB 4J7TA 4LLEA 4QDLA 4U5FE 1LI7A 5JS5A 3AQBA 3B9QA 3SEOA 2YQYA 4CX9A 1QLEC 2WZLA 2VCCA 4NY3A 2J9BA 2A6HF 2LCHA 1U0BB 4JKVA 5L3QA 5A6JA 2LSEA 2AU5A 4JE9A 5L0IA 4XEVA 2UUHA 4YT8A 3LUTB 3E9VA 1LPEA 1FTSA 3DZAA 3W2WA 3AG4C 3NMKA 3U9JA 1RJ9B 4U5BE 4G7OF 1AEPA 1LI5A 2OCCC 4BJ5A 4K0DA 1SMYF 2R03A 1ZHXA 2PX0A 4IRUA 3LEVA 4XPXA 1Q0DA 5L0HA 1GM5A 3R2PA 1VYKA 1RKEA 5CIVA 1T5OA 3NDBB 2A0UA 5DS5A 3VAYA 2YWAA 3U2LA 5DVWA 3ZWIA 2O9XA 1MMDA 2WZGA 2LFFA 1VMAA 2J9UA 1ST6A 4YK5A 1NZEA 3K6BA 2XLVA 1MQVA 2I8BA 1JMWA 1HW1A 2JX0A 3FMSA 2EINC 2LFDA 3IHUA 4FWVA 4WGZA 5T1DB 3TOLA 1GS9A 4PK4A 1FAPB 4ZLDA 1F1MA 3KYIA 3J06A 4JJGA 3LESA 1EKYA 2QY9A 1HY5A 2FGYA 4U5HA 2M64A 4E7ZA 5EGYA 3C62A 3ZSUA 1OR2A 2WB7A 2XS1A 3RH3A 1Q0GA 4XEFA 1BR4A 2R02A 2CNWA 1ZYRF 3DJNB 2OJED 1QPUA 3AG2C 2XLMA 3CQZA 3GODA 3UMKA 3PCVA 2CGEA 2Q3TA 1YJGA 3VF0A 3L0IA 3HNLA 1MMGA 3EZIA 1I4ZA 2B0JA 1YDIA 1J8MF 3EH2A 3L8IA 2QNLA 2DYRC 3JTLO 4CDVA 3SNHA 2R7SA 3ZIBA 1A41A 2YKZA 2XM0A 4FESA 2LK4A 1DOVA 2OU6A 1GQAA 1NU7D 3ZDLA 2H7OA 1G4US 1W2WA 5CI8A 3T6JA 2Q9AA 3U8VA 1JAFA 3RQFA 1R4TA 2ZXRA 1YYXA 5JVEA 2EILC 3L34A 1E84A 2P1AA 2FFHA 2PF4E 4QI0A 5GPGB 2W9YA 1VOMA 3DAFA 3G4XA 3Q7GA 3H2VA 4ANJA 5E3CA 2XXAB 2BL2A 4MVQA 3U9MA 3LNRA 1A7EA 4EBKA 3AG1C 4MVZA 4BG0A 1TKNA 1ORSC 1Z5ZA 5B1BC 2EPMX 2XRHA 5AC4A 1D1AA 1S05A 4JURI 4XEKA 1T6UA 3M15A 2YL7A 4JW1A 2L6HA 3JYHA 1EI7A 4KNVA 4C3EA 4OD4A 5DS6A 4E17A 4LDRA 1XZPA 2OEXA 2J7PD 3M1CB 2Q9CA 4LERA 1V54C 2ZXOA 3RVYA 1HW2A 3R7CA 3PHF2 2GWWA 3U3BA 2KK1A 4PJMA 3VYWA 1Z63A 3A11A 3EQLF 1LE2A 4AE4A 4GEHA 4MQ9F 1EA8A 3ZTMA 5KYYB 2J9WA 3ABMC 3PDMP 4JCHA 1H9GA 5BQGA 3NRHA 1NFNA 2EPKX 2B0HA 3NYLA 2IXNA 1RKCA 3S9OA 2J8WA 2YLDA 3AJMA 4OIRF 4U9DA 2YRFA 3DI5A 3VM6A 4DBRA 2J0XA 1OCOC 3F47A 1TWAA 1XZQA 4LLCA 2P0NA 1E2XA 3DKAA 3EG9B 3FAPB 5L0GA 3LLIA 3W8IA 4YT2A 2L81A 1ZU5A 3S27A 3TD7A 3US6A 3X2QC 4DRHB 2D5RB 3N0TA 4GYTA 3S0XA 2RD9A 1JPJA 2HSBA 2XL8A 3EG9A 2G3VA 4MVMA 5F5HA 5FCLA 1YAUO 1NBBA 4WABA 2NUPA 3GORA 3TOMA 3L1MA 4NTFA 1APCA 5KYXA 3KKBA 3S90A 5A6AA 1OR3A 4JEAA 3B29A 2HS5A
chains in the Genus database with same CATH topology
1XWJA 3VF0A 4E18A 2B0HA 1U6HA 4P9TA 1YDIA 1ST6A 2IBFA 1RKCA 4EHPA 3T6GB 1L7CA 1QKRA 5FZTA 2GDCA 3TJ6A 1DOWA 1DOVA 4IGGA 1ZW2A 1RKEB 1ZW3A 4ONSA 3ZDLA 5L0GA 4E17A 4K1OA 5L0IA 4PR9A 1RKEA 1SYQA 2X0CA 2L7AA 4DJ9A 2HSQA 3RF3A 3H2UA 5L0FA 1ZVZA 2GWWA 5L0JA 1T01A 5L0HA 3MYIA 3H2VA 4W8PA 3TJ5A 3S90A 1U89A 2LQGA 5L0CA 1TR2A 1H6GA 5L0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWJ A;  3VF0 A;  4E18 A;  2B0H A;  1U6H A;  4P9T A;  1YDI A;  1ST6 A;  2IBF A;  1RKC A;  4EHP A;  3T6G B;  1L7C A;  1QKR A;  5FZT A;  2GDC A;  3TJ6 A;  1DOW A;  1DOV A;  4IGG A;  1ZW2 A;  1RKE B;  1ZW3 A;  4ONS A;  3ZDL A;  5L0G A;  4E17 A;  4K1O A;  5L0I A;  4PR9 A;  1RKE A;  1SYQ A;  2X0C A;  2L7A A;  4DJ9 A;  2HSQ A;  3RF3 A;  3H2U A;  5L0F A;  1ZVZ A;  2GWW A;  5L0J A;  1T01 A;  5L0H A;  3MYI A;  3H2V A;  4W8P A;  3TJ5 A;  3S90 A;  1U89 A;  2LQG A;  5L0C A;  1TR2 A;  1H6G A;  5L0D A; 
#chains in the Genus database with same CATH topology
 1R5I D;  2UUI A;  2VCB A;  3NMI A;  3EH1 A;  2NUP B;  1OXK A;  1Z23 A;  3S28 A;  4CS7 A;  4C7O B;  4YL3 A;  2IYL D;  2PNO A;  4WGY A;  3V5Z A;  1QKR A;  4EBB A;  1G4W R;  1WAT A;  3DM9 B;  4CSA A;  4F4B A;  4YJW A;  3QMK A;  4OD5 A;  2Y3G A;  4YT4 A;  1V4A A;  2CCY A;  3AGU A;  3JYY A;  4Z9J A;  1LS4 A;  4B6I A;  3EPV A;  3FVY A;  1NG1 A;  1WWP A;  2WZF A;  3C8G D;  3RQE A;  2QLA A;  4G78 A;  3UGO A;  3EGX A;  3Q6N A;  2L6G A;  5DQZ A;  3K1I A;  3JZ0 A;  1LM3 B;  3W8H A;  2XLE A;  3GAN A;  3KH2 A;  3EZH A;  3OA1 A;  2HV6 A;  3DE9 A;  3JSE O;  2A0B A;  1Q0M A;  4K7B A;  5B1A C;  3RIP A;  4CIP A;  4Q7C A;  4YWQ A;  4BJ6 C;  4Z9I A;  2XLH A;  2I15 A;  3Q7L A;  4N4W A;  3ZQY A;  4CBE A;  4D4X A;  3DE8 A;  2ETS A;  3EHM A;  4JTA B;  2XL6 A;  5BUO A;  2Q4F A;  2AWY A;  2IOQ A;  3F46 A;  3FOP A;  3RQG A;  2GDC A;  3UNG C;  1UFB A;  3U0C A;  1TWG A;  3LEO A;  1DOW A;  3JT1 A;  3OWT A;  4NQF A;  4ONS A;  5DLJ A;  1PD0 A;  3FDQ A;  5KYN A;  3M4B A;  1D1C A;  2R7W A;  4HEA J;  3K7D A;  3UR3 C;  1SZI A;  2IXP A;  1T6I A;  2NG1 A;  4JEB A;  4KNW A;  3S29 A;  1HMO A;  2P6V A;  4NC3 A;  1OKK D;  2GAQ A;  2XS8 A;  3I4U A;  3M79 A;  3GEE A;  2XSE A;  4W8P A;  3ITF A;  3TJ5 A;  5AC5 A;  1J8Y F;  1ORY A;  1YYJ A;  3NYM A;  4MVU A;  4MND A;  1ZHZ A;  2IXM A;  2DYS C;  2D4U A;  4YT5 A;  3HLZ A;  3WG7 C;  2W4B A;  4G7H F;  1CPQ A;  1OW7 A;  4I1O B;  4MVS A;  4IAQ A;  1GGQ A;  3T6B A;  4DRJ B;  4CSA C;  2A1D D;  4MS2 A;  2NSF A;  4U9E A;  3GM3 A;  3I5P A;  3DWW A;  1I4Y A;  1ZW2 A;  2R7X A;  3O55 A;  1M56 C;  5TJ5 E;  1M57 C;  3U2M A;  5JSL A;  4AE4 B;  4PR9 A;  5IY5 C;  5KYY A;  3EGD B;  4J7Y A;  1OCR C;  3E70 C;  3DM5 A;  2R7V A;  3IQC A;  3O6X A;  4JC7 A;  4LDK A;  1B68 A;  1Z3I X;  4OIO F;  2DGJ A;  3X1O A;  1ZHT A;  1LE4 A;  2NPU A;  3ABK C;  4U5D E;  4XQ1 A;  4BEM J;  3QVY A;  1ZZP A;  4ULV A;  2W4M A;  4YL0 A;  3ASO C;  1IW7 F;  4KC9 A;  1JPN A;  2M4E A;  4YN0 B;  4BJ6 A;  256B A;  4C3D A;  4BJT A;  2GFH A;  3EFO B;  4IJJ A;  5KYW B;  3C63 A;  1D1B A;  2OQM A;  1MND A;  2WVO A;  4OIP F;  1QSP A;  1TQG A;  3ECS A;  3BEH A;  3LS0 A;  3LS1 A;  1VLT A;  4BJ1 A;  1RCP A;  3N2Z B;  1A0B A;  3K33 A;  5F5F A;  1Q0F A;  1K05 A;  3ZG1 A;  3RVZ A;  1MMN A;  2YLG A;  2G62 A;  1MNE A;  1WAS A;  2HMQ A;  2A6E F;  3IQ6 A;  2L9J A;  5A6B D;  2AWC A;  3EHN A;  4DOZ A;  3UMI A;  4KBL A;  1FR0 A;  1M2V B;  4LAC B;  4X0R A;  3RF3 A;  3H2U A;  4DJ9 A;  5JUA A;  2FAP B;  3HJC A;  5L0F A;  4DVZ A;  1T01 A;  1VK5 A;  2OOC A;  2KGO A;  1UG7 A;  1WOL A;  3MYI A;  1NLX A;  1L3P A;  1TWH A;  3SZR A;  1WN0 A;  3DJU B;  3MYF A;  2IXO A;  4EBJ A;  2ZXP A;  2L6F A;  3HNI A;  3GWN A;  3U3F A;  4ZLC A;  2YL1 A;  1FFT C;  3ZQV A;  4EKW A;  2H7B A;  2HKV A;  2WVN A;  3U5S A;  1K40 A;  1YAR O;  2MYS A;  3I5Q A;  4MTO A;  4MVR A;  3S84 A;  4EHP A;  5JLI A;  2C04 A;  3CZ6 A;  1ZU4 A;  4O6M A;  3WOD F;  4C3B A;  4RD9 A;  1OW6 A;  3DAG A;  4IWB A;  4MTF A;  2JD3 A;  3CAX A;  3EGX B;  2Q9B A;  4AL0 A;  5JRA A;  1RKE B;  2R9R B;  3FOO A;  4K1O A;  4XPY A;  3NYJ A;  4U5C E;  3LJB A;  2IM8 A;  1RXQ A;  2R7O A;  2DB4 A;  3DXJ F;  3JRM O;  2Q7R A;  5DQT A;  5K0I A;  3UGP A;  2W45 A;  1ZVZ A;  4OIN F;  2CW0 F;  2DI3 A;  3QVZ A;  2PFD A;  1OXB A;  2A68 F;  1OCZ C;  2AVK A;  4I44 A;  3HNK A;  1YZC A;  2J46 A;  1TFK B;  1PD1 A;  2LQG A;  2Z15 A;  3NMJ A;  1C03 A;  2F22 A;  1HMD A;  3M4C A;  2CYD A;  2R7Q A;  3ZVR A;  3JSZ A;  4W8K A;  2OKU A;  1O3U A;  2Y69 C;  2YZS A;  1QVX A;  2CDQ A;  4G0H A;  3H65 A;  4JVS A;  1SF8 A;  2X51 A;  3EFO A;  3TQO A;  3W4Y A;  4JIO A;  4N6H A;  4XLN F;  4E7S A;  1TFO B;  3B0V C;  1JR8 A;  2KC3 A;  3QW1 A;  1A7D A;  4CS8 A;  2XL4 A;  3QZC A;  3V7O A;  1FFH A;  2QUP A;  3GWL A;  3TUL A;  2X0C A;  2KW3 C;  1EQ1 A;  3SXM A;  2VB6 A;  2R25 A;  4IAR A;  1I5N A;  2Y3D A;  3FHD A;  1HE1 A;  5F28 E;  1H9T A;  3IEE A;  3K1H A;  3K66 A;  1H7I A;  2BE5 F;  3DMD A;  4JTD B;  1G5Z A;  2EPL X;  4CS9 C;  2LP4 A;  2HUJ A;  3U8P A;  3UMH A;  3G50 A;  4PFP A;  2IBF A;  2XLO A;  5EK0 A;  2QE9 A;  4UDV A;  3AGT A;  3GEH A;  4P9F A;  2A69 F;  3FXH A;  5CI9 A;  1NFO A;  4L6R A;  4CJO A;  1BR1 A;  2J9V A;  3KL4 A;  4EUK B;  4DXW A;  3EGD A;  3JCU Q;  1S7Z A;  1Q0K A;  4WJ0 A;  4JZA A;  3SXY A;  4BEJ A;  4G7Z F;  2XXA A;  4DBQ A;  3DD7 A;  4MVO A;  3AG3 C;  4H4K C;  2QTV A;  2CNW D;  3EJN A;  1D0Z A;  3V5Y A;  1C02 A;  4BPM A;  1OQC A;  2JPU A;  3RYL A;  4ER9 A;  2C03 A;  4H54 A;  4PFO A;  4XPW A;  2HZ8 A;  4GQH A;  1K04 A;  3NKD A;  4AK9 A;  4MW3 A;  3C18 A;  4NTA A;  2P61 A;  2YEV A;  2MHR A;  3MX3 A;  1E86 A;  5COG A;  3IPM O;  4JCZ A;  1TR2 A;  2VH3 A;  4CIH A;  1H6G A;  2Y3B A;  5T3T A;  5HSW A;  2VAS A;  4P9T A;  2HFI A;  3C8Z A;  1OW8 A;  1OCC C;  4CDY A;  4P6I C;  2RSE B;  1V74 B;  2EIM C;  4YL1 A;  1CGM E;  1T6Q A;  4LDQ A;  3T4R A;  2J7P A;  3ZC4 A;  4Q5S F;  1NSG B;  3L8J A;  4U5E E;  4EIY A;  4EWC A;  5JT4 A;  3POV A;  1CGN A;  1LS1 A;  2R05 A;  3MFN A;  5AGF A;  3NG1 A;  3NKE A;  4RBN A;  1JRA A;  4MTG A;  5COF A;  5KYU A;  3HNJ A;  5EHH A;  4AL1 A;  2MWQ A;  4R32 A;  1E83 A;  2V26 A;  4O6N A;  4E0I A;  4HE8 D;  4JTC B;  1PCX A;  3W2V A;  4C7O A;  2R7T A;  1WGW A;  4JJF A;  2KSF A;  2P7V A;  3IQT A;  3OEO A;  1O87 A;  1WTY A;  2ZPA A;  4HFF B;  4CJG A;  5B3S C;  2PBE A;  3LNM B;  2TMV P;  4FAP B;  2J0W A;  4IGG A;  5L0C A;  2EIK C;  1TWC A;  4NCQ A;  2HV7 A;  2H8A A;  3AOU A;  3B0P A;  3N24 A;  2WL8 A;  4U5G A;  3GEI A;  1VTM P;  4OIQ F;  4IAO A;  1LKX A;  2NUT A;  2KNH A;  5D91 A;  1JOG A;  4AX2 A;  1N1C A;  1RJ9 A;  1CGO A;  2EPN A;  1KU2 A;  3TK0 A;  3ZTZ A;  1C17 M;  2ZD9 A;  4CS8 C;  3TJ6 A;  5A6B A;  3RKO F;  1Z6A A;  4A4A A;  4XTK A;  2R7U A;  1ZW3 A;  1SR2 A;  4MW8 A;  4Z9H A;  1KNY A;  1ZHY A;  2ZXW C;  2XLD A;  3O39 A;  3SXZ A;  2VC9 A;  2WVQ A;  1VB5 A;  2VCA A;  3ATP A;  2KYH A;  3IQ5 A;  1YA7 O;  2XM4 A;  3LAY A;  2GA0 A;  3V5X A;  2BC5 A;  4J32 B;  2KQ9 A;  3C8G A;  4CDA A;  3G4Z A;  3PMR A;  4IB4 A;  1LIH A;  1YLM A;  3JRT A;  4Q4Z F;  1U89 A;  2H7V C;  3Q6M A;  2PP4 A;  1QZX A;  2PX3 A;  3GM2 A;  1Z7Q c;  3RFY A;  4CS9 A;  3O10 A;  5E3A A;  1BBH A;  1U6H A;  3C7J A;  4E18 A;  5A6K A;  1AVO B;  1BZ4 A;  2YL3 A;  1AUE A;  2LD6 A;  2OJQ A;  1G8X A;  3AQC A;  5JP7 A;  4ULW A;  4PJN A;  5E2Q A;  3WAQ A;  5D92 A;  2V3C C;  3FAJ A;  2EPO A;  3GM1 A;  5FZT A;  4DRI B;  2OEV A;  3HKK A;  2ICW G;  3WHN A;  2YLI A;  5L3V A;  1E85 A;  3VRC A;  1RMV A;  4D4N A;  4N6C A;  1QQ3 A;  1D0X A;  1KTM A;  3SYN A;  2NSG A;  4O6Y A;  4A2N B;  5KYX B;  3RW0 A;  3KYJ A;  2J45 A;  2L7A A;  1YA9 A;  3B71 A;  4E0H A;  1O5H A;  2XLW A;  3KPH A;  1D0Y A;  3MLG A;  5L0J A;  2EIJ C;  4M63 A;  4FX5 A;  2Q00 A;  1T9K A;  1FMW A;  4HFK B;  1M2O A;  1PV3 A;  1M2V A;  1BDJ B;  1VYI A;  4QI2 A;  3KMI A;  5KYU B;  4PJL A;  1YZA A;  5B3I A;  4I1M A;  4XWJ A;  3CSK A;  1FNT c;  2HMZ A;  1CPR A;  1OKK A;  2OG2 A;  5E33 A;  5BQI A;  1YVI A;  2YHS A;  2G3K A;  3HTK C;  3QW0 A;  4JRZ A;  4N06 A;  3T6G B;  2R7R A;  1ORJ A;  1Y6D A;  1Y4C A;  4J30 B;  4DVY P;  4XLP F;  2YVK A;  3B0U X;  2HJM A;  3LLK A;  4PAC A;  1IZM A;  2HJ3 A;  1FMV A;  5DS4 A;  3MBG A;  4RDA A;  4NTB A;  4KI2 A;  3SP1 A;  1HE9 A;  5KYW A;  1A7V A;  2E87 A;  3K1I C;  3SXK A;  1SYQ A;  2NUT B;  3BRJ A;  2HSQ A;  3CEX A;  5COM A;  5T3W A;  4BJ5 C;  1M6T A;  1LVK A;  3T9O A;  2AP3 A;  3QTH A;  5HV9 A;  1ZHW A;  3A9C A;  1V55 C;  2ASR A;  2Y3H A;  1NU9 C;  3ASN C;  5A69 A;  2KJG A;  5L0D A;  1XWJ A;  1VLS A;  5BQH A;  1MMA A;  2Y39 A;  4O79 A;  4O7G A;  1BR2 A;  2LIG A;  4PJJ A;  2YL0 A;  4I3M A;  1L7C A;  3ABL C;  3C8G B;  4J7T A;  4LLE A;  4QDL A;  4U5F E;  1LI7 A;  5JS5 A;  3AQB A;  3B9Q A;  3SEO A;  2YQY A;  4CX9 A;  1QLE C;  2WZL A;  2VCC A;  4NY3 A;  2J9B A;  2A6H F;  2LCH A;  1U0B B;  4JKV A;  5L3Q A;  5A6J A;  2LSE A;  2AU5 A;  4JE9 A;  5L0I A;  4XEV A;  2UUH A;  4YT8 A;  3LUT B;  3E9V A;  1LPE A;  1FTS A;  3DZA A;  3W2W A;  3AG4 C;  3NMK A;  3U9J A;  1RJ9 B;  4U5B E;  4G7O F;  1AEP A;  1LI5 A;  2OCC C;  4BJ5 A;  4K0D A;  1SMY F;  2R03 A;  1ZHX A;  2PX0 A;  4IRU A;  3LEV A;  4XPX A;  1Q0D A;  5L0H A;  1GM5 A;  3R2P A;  1VYK A;  1RKE A;  5CIV A;  1T5O A;  3NDB B;  2A0U A;  5DS5 A;  3VAY A;  2YWA A;  3U2L A;  5DVW A;  3ZWI A;  2O9X A;  1MMD A;  2WZG A;  2LFF A;  1VMA A;  2J9U A;  1ST6 A;  4YK5 A;  1NZE A;  3K6B A;  2XLV A;  1MQV A;  2I8B A;  1JMW A;  1HW1 A;  2JX0 A;  3FMS A;  2EIN C;  2LFD A;  3IHU A;  4FWV A;  4WGZ A;  5T1D B;  3TOL A;  1GS9 A;  4PK4 A;  1FAP B;  4ZLD A;  1F1M A;  3KYI A;  3J06 A;  4JJG A;  3LES A;  1EKY A;  2QY9 A;  1HY5 A;  2FGY A;  4U5H A;  2M64 A;  4E7Z A;  5EGY A;  3C62 A;  3ZSU A;  1OR2 A;  2WB7 A;  2XS1 A;  3RH3 A;  1Q0G A;  4XEF A;  1BR4 A;  2R02 A;  2CNW A;  1ZYR F;  3DJN B;  2OJE D;  1QPU A;  3AG2 C;  2XLM A;  3CQZ A;  3GOD A;  3UMK A;  3PCV A;  2CGE A;  2Q3T A;  1YJG A;  3VF0 A;  3L0I A;  3HNL A;  1MMG A;  3EZI A;  1I4Z A;  2B0J A;  1YDI A;  1J8M F;  3EH2 A;  3L8I A;  2QNL A;  2DYR C;  3JTL O;  4CDV A;  3SNH A;  2R7S A;  3ZIB A;  1A41 A;  2YKZ A;  2XM0 A;  4FES A;  2LK4 A;  1DOV A;  2OU6 A;  1GQA A;  1NU7 D;  3ZDL A;  2H7O A;  1G4U S;  1W2W A;  5CI8 A;  3T6J A;  2Q9A A;  3U8V A;  1JAF A;  3RQF A;  1R4T A;  2ZXR A;  1YYX A;  5JVE A;  2EIL C;  3L34 A;  1E84 A;  2P1A A;  2FFH A;  2PF4 E;  4QI0 A;  5GPG B;  2W9Y A;  1VOM A;  3DAF A;  3G4X A;  3Q7G A;  3H2V A;  4ANJ A;  5E3C A;  2XXA B;  2BL2 A;  4MVQ A;  3U9M A;  3LNR A;  1A7E A;  4EBK A;  3AG1 C;  4MVZ A;  4BG0 A;  1TKN A;  1ORS C;  1Z5Z A;  5B1B C;  2EPM X;  2XRH A;  5AC4 A;  1D1A A;  1S05 A;  4JUR I;  4XEK A;  1T6U A;  3M15 A;  2YL7 A;  4JW1 A;  2L6H A;  3JYH A;  1EI7 A;  4KNV A;  4C3E A;  4OD4 A;  5DS6 A;  4E17 A;  4LDR A;  1XZP A;  2OEX A;  2J7P D;  3M1C B;  2Q9C A;  4LER A;  1V54 C;  2ZXO A;  3RVY A;  1HW2 A;  3R7C A;  3PHF 2;  2GWW A;  3U3B A;  2KK1 A;  4PJM A;  3VYW A;  1Z63 A;  3A11 A;  3EQL F;  1LE2 A;  4AE4 A;  4GEH A;  4MQ9 F;  1EA8 A;  3ZTM A;  5KYY B;  2J9W A;  3ABM C;  3PDM P;  4JCH A;  1H9G A;  5BQG A;  3NRH A;  1NFN A;  2EPK X;  2B0H A;  3NYL A;  2IXN A;  1RKC A;  3S9O A;  2J8W A;  2YLD A;  3AJM A;  4OIR F;  4U9D A;  2YRF A;  3DI5 A;  3VM6 A;  4DBR A;  2J0X A;  1OCO C;  3F47 A;  1TWA A;  1XZQ A;  4LLC A;  2P0N A;  1E2X A;  3DKA A;  3EG9 B;  3FAP B;  5L0G A;  3LLI A;  3W8I A;  4YT2 A;  2L81 A;  1ZU5 A;  3S27 A;  3TD7 A;  3US6 A;  3X2Q C;  4DRH B;  2D5R B;  3N0T A;  4GYT A;  3S0X A;  2RD9 A;  1JPJ A;  2HSB A;  2XL8 A;  3EG9 A;  2G3V A;  4MVM A;  5F5H A;  5FCL A;  1YAU O;  1NBB A;  4WAB A;  2NUP A;  3GOR A;  3TOM A;  3L1M A;  4NTF A;  1APC A;  5KYX A;  3KKB A;  3S90 A;  5A6A A;  1OR3 A;  4JEA A;  3B29 A;  2HS5 A; 
#chains in the Genus database with same CATH homology
 1XWJ A;  3VF0 A;  4E18 A;  2B0H A;  1U6H A;  4P9T A;  1YDI A;  1ST6 A;  2IBF A;  1RKC A;  4EHP A;  3T6G B;  1L7C A;  1QKR A;  5FZT A;  2GDC A;  3TJ6 A;  1DOW A;  1DOV A;  4IGG A;  1ZW2 A;  1RKE B;  1ZW3 A;  4ONS A;  3ZDL A;  5L0G A;  4E17 A;  4K1O A;  5L0I A;  4PR9 A;  1RKE A;  1SYQ A;  2X0C A;  2L7A A;  4DJ9 A;  2HSQ A;  3RF3 A;  3H2U A;  5L0F A;  1ZVZ A;  2GWW A;  5L0J A;  1T01 A;  5L0H A;  3MYI A;  3H2V A;  4W8P A;  3TJ5 A;  3S90 A;  1U89 A;  2LQG A;  5L0C A;  1TR2 A;  1H6G A;  5L0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...