3FDQA

Recognition of at-rich dna binding sites by the mogr repressor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Motility gene repressor mogR
publication title Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 50
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12181 MogR_DNAbind DNA binding domain of the motility gene repressor (MogR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1030 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fdqA01
3FDQA
chains in the Genus database with same CATH superfamily
2P7VA 2ASRA 1OKKD 1QLEC 3L0IA 4JRZA 3JSZA 1HE9A 3DAGA 5E33A 4BEMJ 1Y6DA 3V5XA 4D4XA 2CW0F 4N6CA 3LS0A 3QVYA 4K7BA 1RJ9B 5COFA 3UMIA 4EHPA 2X0CA 2OG2A 5B3IA 5T3TA 4KI2A 4LERA 2YZSA 1RJ9A 3JT1A 5CI9A 3WODF 4EBJA 3JTLO 4PFOA 2LQGA 4CJOA 3GM3A 4OIOF 4BJ6A 1E84A 4XLPF 3EGDB 3ASNC 1K05A 3M15A 3EGXA 4F4BA 2Q00A 2KQ9A 3A9CA 3C62A 4MTOA 1Z7Qc 4A2NB 4DJ9A 2XM4A 4YWQA 3G4ZA 3Q7LA 3DM9B 3EGDA 3IQ5A 4LLCA 1TQGA 2R9RB 3LEVA 4PJLA 5KYXB 3KPHA 3HKKA 2KGOA 1PV3A 1LE4A 4NTAA 4O6YA 3POVA 2Y3HA 4N06A 5KYXA 3ZSUA 3DI5A 2WL8A 5KYUB 2HFIA 3B0PA 1ZW3A 1QKRA 1U6HA 2XXAB 3DWWA 1OR2A 4KC9A 5KYUA 2AWCA 1SZIA 2ZPAA 1H6GA 1WOLA 4JEAA 2PNOA 3NKEA 2XXAA 1TWGA 2NUTB 4CX9A 2XLEA 3F47A 1SMYF 5HSWA 1D1AA 3MX3A 1WGWA 2GWWA 1NFOA 4XTKA 2ICWG 2NUPB 1T5OA 1TKNA 2A69F 2NUTA 2HJ3A 4YL3A 3AG1C 4PR9A 3ZDLA 1B68A 1XZPA 4IGGA 2J0XA 4MW8A 4EKWA 1Z6AA 4JEBA 3NDBB 4LDRA 2DYSC 2KJGA 4IWBA 2VASA 2VH3A 1YVIA 3QW1A 3GWNA 4MTGA 3GM1A 5T1DB 5F5FA 4BJ6C 3DMDA 3SNHA 5JVEA 1A41A 1LS4A 2OJQA 3V5YA 4MVRA 5A6BA 1YA7O 1VTMP 1AUEA 4MQ9F 3ZG1A 2TMVP 2A68F 2HZ8A 3IQTA 4EIYA 1JPJA 2YLIA 2AU5A 5B1BC 1CPRA 4CSAA 3ZQVA 3AOUA 4IAOA 1SF8A 2R05A 4XEVA 3NYMA 5DS5A 3CAXA 2IBFA 4ULVA 5AGFA 5JP7A 4G7ZF 1NLXA 1OCOC 3EQLF 5JUAA 1JOGA 1VYKA 5A6BD 2HUJA 2OJED 1O3UA 2Y3GA 3H2UA 3S27A 3NYJA 3VM6A 1E2XA 3W8IA 2AVKA 4KBLA 4MNDA 3RIPA 4E0IA 3S29A 1D1BA 2HS5A 3GEHA 4QI0A 1C03A 5DLJA 3T9OA 4BG0A 4O79A 2EILC 3W4YA 1MQVA 3NYLA 4U5BE 3SP1A 1ZHTA 4U5FE 4U9EA 2NSGA 2L6HA 2A0UA 4GQHA 3I5QA 4J7TA 4U5EE 3SZRA 4CDAA 4YT4A 4OINF 2HV6A 2KNHA 3V7OA 1T6QA 5A69A 2M4EA 1A0BA 1R4TA 5L0CA 3B0UX 1RCPA 2M64A 2Y3BA 5BQGA 2G62A 1SYQA 5T3WA 1M2VB 4NTFA 2EPKX 1LI5A 2EIMC 3VAYA 5BUOA 2BC5A 3RKOF 4XLNF 5DS4A 4CSAC 2BE5F 2YL1A 3ZQYA 3FAPB 1M2VA 2P1AA 4E17A 1IW7F 1ZU4A 1V74B 3AQBA 4JC7A 4LDKA 4ZLCA 1UG7A 2C03A 2YL3A 4MS2A 4J32B 4P9TA 3UR3C 4DVZA 2R7TA 3GODA 2L7AA 2C04A 4WJ0A 4E7SA 2HSBA 1G5ZA 2HMQA 1S05A 3AG4C 4D4NA 1CGNA 1LKXA 1ORJA 2J7PA 5L0IA 2Z15A 3RQGA 1JPNA 3DD7A 5B1AC 3RH3A 1XZQA 1G4US 1V55C 2E87A 3DKAA 3NMJA 2YLGA 1YA9A 3U2MA 1YZCA 1FMWA 1MNEA 2OCCC 2LSEA 2OQMA 2W45A 3GORA 3LS1A 3M4CA 4NCQA 2GA0A 5JS5A 4ZLDA 3SXMA 5L0FA 5CIVA 2D5RB 2A6HF 2KK1A 5F28E 2Y3DA 2MWQA 3OWTA 4Z9IA 4DXWA 1XWJA 1JAFA 4EBKA 1Z63A 3J06A 3KH2A 2G3VA 2J7PD 1OCZC 1MMDA 4Z9JA 2EPLX 3LUTB 1K04A 1Q0MA 5IY5C 3TULA 4M63A 5KYWA 4GEHA 4Q4ZF 3EHNA 2RSEB 3FMSA 1FTSA 1K40A 1QSPA 1RKCA 2HKVA 3DJNB 5B3SC 2A1DD 2L9JA 4U5HA 3RF3A 2JX0A 3O10A 4H4KC 2VC9A 4JJGA 4JW1A 1GM5A 2J45A 1ZU5A 1MMGA 3RQFA 1RMVA 3C7JA 1Y4CA 2CNWA 1OW8A 3KKBA 4BJTA 1CGME 4CBEA 3RVYA 1I5NA 3FHDA 3U8PA 3PHF2 3C63A 3DJUB 3MBGA 4XPWA 3S0XA 3LLIA 2J9UA 2YWAA 1OW6A 2HJMA 3A11A 2IXOA 2J0WA 4G78A 1IZMA 3NMKA 2L6GA 1DOVA 4YJWA 1U0BB 1TWHA 2VB6A 3AGTA 3GANA 1WASA 2R7UA 1FR0A 5DS6A 1SR2A 1FFHA 3IQCA 1Z23A 4JCHA 2CNWD 3W2WA 3B29A 3Q7GA 1TWAA 3K7DA 2ETSA 2XM0A 3B0VC 3K33A 1TFKB 3K66A 2LK4A 2Y69C 2IYLD 1MMNA 2ZXRA 5E3CA 4CJGA 4AK9A 2YL0A 3NG1A 2W4MA 1VK5A 2Q7RA 3LJBA 2YHSA 5D91A 2XSEA 3F46A 4BJ5A 3HNLA 1LM3B 1AEPA 4YL1A 1VLSA 5L0JA 1BZ4A 1WN0A 1ORYA 2F22A 2XL4A 2XS8A 2NSFA 3EH1A 3IHUA 4OD4A 1D0XA 1VYIA 2WZLA 4PJMA 3MLGA 3TK0A 3ITFA 4KNVA 3ABKC 2L81A 2NUPA 2HMZA 2IXPA 2DI3A 3LEOA 4LDQA 4NC3A 1CPQA 3K1IA 4H54A 4YT8A 4MTFA 4ONSA 2PF4E 1GGQA 3SEOA 3DZAA 2YQYA 4BPMA 4CS9A 1MNDA 2YRFA 4R32A 3OA1A 3X2QC 1D0YA 2LCHA 3JRMO 5A6JA 3R7CA 1LIHA 2HV7A 2GFHA 2IXMA 2OKUA 4XPXA 2IM8A 3LAYA 1ZZPA 4WGZA 2OU6A 3IQ6A 3IPMO 3SXYA 2R03A 1M2OA 3JYYA 4W8KA 1VB5A 5BQIA 1YDIA 2Q9AA 3ZC4A 2XLOA 2R7VA 3G50A 3FXHA 1LI7A 4PJJA 2JD3A 1HY5A 3ZWIA 3K6BA 2XLMA 2A0BA 4RD9A 3U8VA 1L7CA 3JRTA 4I44A 5AC5A 3KYJA 1NBBA 3QVZA 3UNGC 1E85A 1ZW2A 2QTVA 2UUHA 3DM5A 1T6UA 3AG2C 4BJ5C 3K1HA 2VCAA 4DVYP 3C8GB 1NU7D 3N2ZB 2Q9BA 3Q6NA 5CI8A 3S90A 1OW7A 1VLTA 3QMKA 1EA8A 4OD5A 3C8GA 4LLEA 4JTCB 4RDAA 4FAPB 2VCCA 1KTMA 1OCRC 4IAQA 1YJGA 3K1IC 1V4AA 1FAPB 3EZHA 4CS9C 4MVSA 2GDCA 4N6HA 4G7HF 2LD6A 3L8JA 3AG3C 4EBBA 4G7OF 1EKYA 1BR4A 3WAQA 1HW2A 1RXQA 2R7XA 1TFOB 1L3PA 3BRJA 3CEXA 3I4UA 1YAUO 2PBEA 3N0TA 2R7OA 2WZFA 4PJNA 2YLDA 1M6TA 3C8GD 4JURI 4DRHB 1ZVZA 3DE9A 4JVSA 1H9GA 4JTDB 3HTKC 4LACB 3B9QA 1OR3A 2QE9A 4P9FA 4EWCA 3LLKA 3S84A 1QPUA 1E86A 3U2LA 4HFKB 3L1MA 3U0CA 2PX0A 1QVXA 1BDJB 2YL7A 2KSFA 3O39A 4J7YA 4AL1A 1Q0GA 2GAQA 4XWJA 2WZGA 5FZTA 2AP3A 1BBHA 3U9JA 5DVWA 1HE1A 1WTYA 3JCUQ 5BQHA 1OXKA 1LPEA 3KYIA 4G0HA 1WATA 1S7ZA 3AQCA 3KL4A 4AX2A 1NSGB 2X51A 4CS7A 2EIKC 4FWVA 3T6BA 1Q0FA 3DXJF 1LVKA 3E70C 4IJJA 3IEEA 4Z9HA 2A6EF 4E7ZA 2LFFA 1T6IA 1UFBA 2D4UA 2Q3TA 1PD1A 5EHHA 5K0IA 4P6IC 2CDQA 4O7GA 2DB4A 2WVNA 4NY3A 4EUKB 3N24A 2P61A 3B71A 1I4YA 4C3BA 2XS1A 2V3CC 2FGYA 1F1MA 4UDVA 4C3DA 4XEFA 3KMIA 3EFOB 3U3BA 1A7EA 1J8MF 4CDYA 2QNLA 2H7OA 2EIJC 2FAPB 4ULWA 5EK0A 3RFYA 3QZCA 3E9VA 2ZXOA 3HNJA 2R7SA 3US6A 3L34A 4PACA 4CS8A 3HJCA 2LFDA 2QLAA 2EPOA 3NRHA 2KYHA 4JJFA 4I3MA 3LNMB 1ZHWA 1H7IA 3VRCA 4U9DA 1PCXA 3CQZA 1LS1A 4C7OB 5FCLA 2XRHA 1DOWA 1BR2A 1Z3IX 2J46A 3ZTZA 1RKEB 1JMWA 4YT5A 3WG7C 5L0HA 2R7QA 3M1CB 4C7OA 4MVMA 3G4XA 3QW0A 1FNTc 3MYIA 4IB4A 1RKEA 1T9KA 3FAJA 3PMRA 4CIPA 2AWYA 2CCYA 3ECSA 4O6NA 2W4BA 1V54C 3FOOA 2H7VC 1BR1A 1QQ3A 2EPNA 2Q9CA 5F5HA 3EGXB 3DE8A 2ZD9A 2P6VA 3GWLA 3I5PA 2NG1A 1O5HA 1HMOA 3TD7A 3RVZA 4NQFA 2MHRA 3JSEO 2OOCA 4FESA 3S9OA 4JCZA 4B6IA 1MMAA 4IRUA 4K1OA 1HW1A 2H8AA 3LESA 2XL6A 3DAFA 4JIOA 4JTAB 4CS8C 3OEOA 3ZIBA 3EG9B 5GPGB 1C17M 3SYNA 2Y39A 4HEAJ 4I1MA 2NPUA 2XLHA 3GEEA 2BL2A 3LNRA 1OXBA 1NG1A 4I1OB 3EG9A 4XPYA 4E18A 3FDQA 4OIPF 2VCBA 5KYNA 1R5ID 1VOMA 4BJ1A 2YKZA 3HNKA 5A6KA 3NMIA 4NTBA 1OQCA 2YVKA 1H9TA 5COMA 4C3EA 1C02A 1FFTC 3JYHA 5JT4A 2DYRC 3U9MA 2KC3A 4HFFB 3ASOC 2ZXWC 2J9VA 3WHNA 2B0JA 2J9WA 4O6MA 3R2PA 1N1CA 5JLIA 5L0GA 1Q0DA 2O9XA 3U3FA 1QZXA 3CZ6A 2V26A 3PCVA 2PFDA 3NKDA 2ZXPA 1GS9A 1NZEA 5E3AA 1JR8A 4MVOA 2WVQA 5KYYB 4YL0A 1APCA 2KW3C 2XL8A 2UUIA 4DRJB 3UGPA 5KYYA 1E83A 3AJMA 3JZ0A 4RBNA 1ZHXA 3EZIA 2I8BA 3V5ZA 2R25A 1VMAA 1NU9C 2CGEA 4L6RA 2PX3A 4MVQA 1GQAA 2J8WA 2JPUA 2XLDA 4GYTA 2R7RA 4QI2A 5DQZA 1A7DA 4A4AA 2WVOA 3FOPA 3EJNA 1A7VA 1ST6A 4K0DA 3U5SA 3Q6MA 3CSKA 3EPVA 4MVUA 3RYLA 2R02A 3S28A 3TOMA 3ZVRA 4ER9A 4AE4B 5L0DA 4XEKA 1U89A 4BEJA 3ATPA 3FVYA 2WB7A 4AE4A 5AC4A 5EGYA 5A6AA 4JZAA 2XLWA 1KU2A 4XQ1A 3UMKA 1W2WA 2IXNA 3EHMA 5COGA 4X0RA 1EQ1A 3AGUA 2RD9A 3RQEA 5L3QA 4JE9A 3UMHA 3HLZA 4PFPA 4MVZA 1D0ZA 3W2VA 1AVOB 3C18A 5L3VA 5D92A 1Z5ZA 3SXKA 3HNIA 4YN0B 1M56C 2HSQA 3T6GB 3H2VA 4QDLA 2CYDA 2B0HA 1NFNA 1T01A 3TJ6A 4OIQF 4IARA 1D1CA 3PDMP 4FX5A 4CDVA 2YEVA 4HE8D 3M4BA 1CGOA 1KNYA 3L8IA 3GM2A 1YYJA 4U5CE 256BA 2Q4FA 2LIGA 2J9BA 2OEVA 2G3KA 3T6JA 5DQTA 2I15A 2FFHA 4PK4A 4YT2A 4DOZA 2R7WA 2PP4A 3BEHA 4KNWA 5HV9A 1JRAA 2LP4A 2IOQA 5E2QA 2OEXA 3RW0A 4DRIB 1TR2A 1ZYRF 4E0HA 3QTHA 1YARO 1O87A 1YLMA 4JKVA 4YK5A 3ABMC 4DBRA 1ORSC 5TJ5E 3M79A 3VF0A 3EH2A 1ZHYA 1LE2A 2DGJA 3GEIA 1WWPA 4CIHA 4U5GA 1TWCA 4N4WA 1M57C 4J30B 3VYWA 1HMDA 1PD0A 4OIRF 3EFOA 4Q5SF 4ANJA 1G8XA 5JSLA 1OCCC 1G4WR 3C8ZA 1J8YF 1OKKA 1ZHZA 3TQOA 3TOLA 5JRAA 3TJ5A 1EI7A 1FMVA 4AL0A 4W8PA 2W9YA 3ABLC 2P0NA 3MYFA 3UGOA 2EPMX 1YZAA 4Q7CA 3ZTMA 4U5DE 3T4RA 2H7BA 3O55A 3O6XA 3W8HA 4DBQA 1Q0KA 2L6FA 3MFNA 1YYXA 5KYWB 4MW3A 4WABA 3H65A 3X1OA 2EINC 2MYSA 1I4ZA 2QY9A 2XLVA 3SXZA 2QUPA 4WGYA
chains in the Genus database with same CATH topology
2P7VA 1OKKD 1QLEC 3L0IA 3JSZA 3DAGA 5E33A 2CW0F 3LS0A 4K7BA 1RJ9B 3UMIA 4KI2A 2OG2A 5T3TA 4LERA 2YZSA 1RJ9A 3JT1A 5CI9A 3WODF 4OIOF 4PFOA 4BJ6A 4XLPF 3EGDB 3ASNC 4F4BA 3EGXA 2KQ9A 4YWQA 4Q5SF 4A2NB 3Q7LA 3DM9B 3EGDA 4LLCA 3LEVA 4PJLA 5KYXB 2KGOA 4O6YA 3POVA 2Y3HA 4N06A 5KYXA 3ZSUA 5KYUB 2WL8A 3B0PA 2XXAB 4KC9A 5KYUA 2ZPAA 1SZIA 3NKEA 2XXAA 1TWGA 2NUTB 3F47A 1SMYF 5HSWA 1D1AA 3MX3A 1WGWA 4XTKA 2NUPB 2A69F 1TKNA 2NUTA 3AG1C 3NDBB 2J0XA 1Z6AA 2DYSC 2KJGA 4IWBA 2VASA 2VH3A 5T1DB 5F5FA 4BJ6C 3DMDA 3SNHA 4MQ9F 3ZG1A 2A68F 1JPJA 5B1BC 4CSAA 4IAOA 1SF8A 3NYMA 5DS5A 4G7ZF 1OCOC 3EQLF 1VYKA 2Y3GA 3S27A 3NYJA 3W8IA 4MNDA 4KBLA 3RIPA 3S29A 1D1BA 4QI0A 5DLJA 4BG0A 4O79A 2EILC 3NYLA 4U5BE 3SP1A 1ZHTA 4U5FE 4U5EE 3I5QA 3SZRA 4YT4A 4OINF 2HV6A 2KNHA 3V7OA 2M4EA 3B0UX 2Y3BA 2G62A 5T3WA 3VAYA 1M2VB 5BUOA 2EIMC 3RKOF 4XLNF 5DS4A 4CSAC 2BE5F 1M2VA 1IW7F 1ZU4A 3AQBA 4ZLCA 2C03A 3UR3C 4J32B 2R7TA 4DVZA 3GODA 2C04A 4WJ0A 4E7SA 3AG4C 1LKXA 2J7PA 2Z15A 1JPNA 3DD7A 5B1AC 3RH3A 1V55C 2E87A 1FMWA 1MNEA 2OCCC 2LSEA 2W45A 3LS1A 4ZLDA 2D5RB 2A6HF 2Y3DA 2MWQA 3OWTA 1Z63A 3KH2A 2G3VA 2J7PD 1OCZC 1MMDA 5IY5C 4M63A 5KYWA 4GEHA 4Q4ZF 3EHNA 1FTSA 3DJNB 5B3SC 2A1DD 2L9JA 4U5HA 4JW1A 4H4KC 4JJGA 2J45A 1ZU5A 1MMGA 2CNWA 3KKBA 4BJTA 4CBEA 3FHDA 3PHF2 3DJUB 3S0XA 3LLIA 2J9UA 2IXOA 2J0WA 1IZMA 4YJWA 1TWHA 2VB6A 3GANA 2R7UA 5DS6A 1FFHA 1Z23A 4JCHA 2CNWD 3W2WA 3Q7GA 1TWAA 3K7DA 3B0VC 3K33A 3K66A 2Y69C 2IYLD 1MMNA 2ZXRA 5E3CA 4AK9A 3NG1A 2W4MA 1VK5A 3LJBA 2YHSA 5D91A 2XSEA 3F46A 4BJ5A 2XL4A 3EH1A 4OD4A 1D0XA 1VYIA 2WZLA 4PJMA 3MLGA 3ITFA 4KNVA 3ABKC 2L81A 2NUPA 2IXPA 4YT8A 2PF4E 4CS9A 3SEOA 3DZAA 1MNDA 3OA1A 3X2QC 1D0YA 2HV7A 2GFHA 2IXMA 3LAYA 1M2OA 4W8KA 2Q9AA 3ZC4A 2R7VA 4PJJA 2JD3A 3K6BA 4RD9A 3JRTA 4I44A 3UNGC 2QTVA 3DM5A 3AG2C 4BJ5C 3K1HA 4DVYP 1NU7D 3N2ZB 2Q9BA 3Q6NA 5CI8A 3QMKA 4OD5A 4LLEA 4RDAA 1OCRC 3K1IC 3EZHA 4CS9C 4G7HF 4EBBA 4G7OF 1BR4A 2R7XA 4PJNA 3N0TA 3I4UA 2R7OA 2WZFA 4JURI 4JVSA 3HTKC 4LACB 3B9QA 4EWCA 3LLKA 4HFKB 2PX0A 3O39A 4XWJA 2WZGA 5DVWA 3JCUQ 4G0HA 1S7ZA 3AQCA 3KL4A 4AX2A 2X51A 4CS7A 2EIKC 4FWVA 3T6BA 3DXJF 4IJJA 1LVKA 3E70C 3IEEA 2A6EF 4E7ZA 2Q3TA 5EHHA 1PD1A 4P6IC 2CDQA 4O7GA 2WVNA 4NY3A 3N24A 4C3BA 2V3CC 2FGYA 4C3DA 3KMIA 3EFOB 1J8MF 2H7OA 2EIJC 4ULWA 3RFYA 3QZCA 3E9VA 2ZXOA 2R7SA 3L34A 4CS8A 3HJCA 3NRHA 4JJFA 4I3MA 1ZHWA 1PCXA 3CQZA 1LS1A 4C7OB 5FCLA 2XRHA 1Z3IX 1BR2A 2J46A 4YT5A 3WG7C 2R7QA 3M1CB 4C7OA 3FAJA 3PMRA 3ECSA 4O6NA 2W4BA 1V54C 2H7VC 1BR1A 5F5HA 5L3QA 2Q9CA 3EGXB 2P6VA 3I5PA 2NG1A 1O5HA 3TD7A 4B6IA 4FESA 1MMAA 4IRUA 3LESA 3DAFA 4CS8C 3OEOA 3ZIBA 3EG9B 3SYNA 2Y39A 4HEAJ 4I1MA 3LNRA 1NG1A 4I1OB 3EG9A 4OIPF 5KYNA 1VOMA 4BJ1A 4C3EA 1FFTC 3JYHA 2DYRC 4HFFB 3ASOC 2ZXWC 2J9VA 2B0JA 2J9WA 4O6MA 1N1CA 2O9XA 1QZXA 3CZ6A 2V26A 2PFDA 3NKDA 2ZXPA 1NZEA 5E3AA 2WVQA 5KYYB 2KW3C 3UGPA 5KYYA 4RBNA 1ZHXA 3EZIA 2I8BA 1VMAA 1NU9C 2CGEA 2PX3A 4QI2A 4GYTA 2R7RA 5DQZA 2WVOA 3EJNA 1ST6A 4K0DA 3ZVRA 3Q6MA 3CSKA 3EPVA 3RYLA 3S28A 3FDQA 4AE4B 4BEJA 3FVYA 2WB7A 4AE4A 5EGYA 4JZAA 1KU2A 3UMKA 1W2WA 2IXNA 3EHMA 4X0RA 3UMHA 3HLZA 4PFPA 1D0ZA 3W2VA 5L3VA 5D92A 1Z5ZA 4YN0B 1M56C 4QDLA 4OIQF 1D1CA 4FX5A 2YEVA 4HE8D 4U5CE 2G3KA 3T6JA 5DQTA 2FFHA 4PK4A 4YT2A 4DOZA 2R7WA 2PP4A 4KNWA 5E2QA 2IOQA 1TR2A 1ZYRF 1O87A 4DBRA 3ABMC 3EH2A 1ZHYA 2DGJA 4CIHA 4U5GA 1TWCA 1M57C 4J30B 3VYWA 1PD0A 4OIRF 3EFOA 4ANJA 1G8XA 1OCCC 1J8YF 1OKKA 1ZHZA 1FMVA 2W9YA 3ABLC 3UGOA 4Q7CA 4U5DE 3T4RA 2H7BA 3O6XA 3W8HA 4DBQA 5KYWB 3H65A 3X1OA 2EINC 2MYSA 2QY9A 3AG3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDQ A; 
#chains in the Genus database with same CATH topology
 2P7V A;  2ASR A;  1OKK D;  1QLE C;  3L0I A;  4JRZ A;  3JSZ A;  1HE9 A;  3DAG A;  5E33 A;  4BEM J;  1Y6D A;  3V5X A;  4D4X A;  2CW0 F;  4N6C A;  3LS0 A;  3QVY A;  4K7B A;  1RJ9 B;  5COF A;  3UMI A;  4EHP A;  2X0C A;  2OG2 A;  5B3I A;  5T3T A;  4KI2 A;  4LER A;  2YZS A;  1RJ9 A;  3JT1 A;  5CI9 A;  3WOD F;  4EBJ A;  3JTL O;  4PFO A;  2LQG A;  4CJO A;  3GM3 A;  4OIO F;  4BJ6 A;  1E84 A;  4XLP F;  3EGD B;  3ASN C;  1K05 A;  3M15 A;  3EGX A;  4F4B A;  2Q00 A;  2KQ9 A;  3A9C A;  3C62 A;  4MTO A;  1Z7Q c;  4A2N B;  4DJ9 A;  2XM4 A;  4YWQ A;  3G4Z A;  3Q7L A;  3DM9 B;  3EGD A;  3IQ5 A;  4LLC A;  1TQG A;  2R9R B;  3LEV A;  4PJL A;  5KYX B;  3KPH A;  3HKK A;  2KGO A;  1PV3 A;  1LE4 A;  4NTA A;  4O6Y A;  3POV A;  2Y3H A;  4N06 A;  5KYX A;  3ZSU A;  3DI5 A;  2WL8 A;  5KYU B;  2HFI A;  3B0P A;  1ZW3 A;  1QKR A;  1U6H A;  2XXA B;  3DWW A;  1OR2 A;  4KC9 A;  5KYU A;  2AWC A;  1SZI A;  2ZPA A;  1H6G A;  1WOL A;  4JEA A;  2PNO A;  3NKE A;  2XXA A;  1TWG A;  2NUT B;  4CX9 A;  2XLE A;  3F47 A;  1SMY F;  5HSW A;  1D1A A;  3MX3 A;  1WGW A;  2GWW A;  1NFO A;  4XTK A;  2ICW G;  2NUP B;  1T5O A;  1TKN A;  2A69 F;  2NUT A;  2HJ3 A;  4YL3 A;  3AG1 C;  4PR9 A;  3ZDL A;  1B68 A;  1XZP A;  4IGG A;  2J0X A;  4MW8 A;  4EKW A;  1Z6A A;  4JEB A;  3NDB B;  4LDR A;  2DYS C;  2KJG A;  4IWB A;  2VAS A;  2VH3 A;  1YVI A;  3QW1 A;  3GWN A;  4MTG A;  3GM1 A;  5T1D B;  5F5F A;  4BJ6 C;  3DMD A;  3SNH A;  5JVE A;  1A41 A;  1LS4 A;  2OJQ A;  3V5Y A;  4MVR A;  5A6B A;  1YA7 O;  1VTM P;  1AUE A;  4MQ9 F;  3ZG1 A;  2TMV P;  2A68 F;  2HZ8 A;  3IQT A;  4EIY A;  1JPJ A;  2YLI A;  2AU5 A;  5B1B C;  1CPR A;  4CSA A;  3ZQV A;  3AOU A;  4IAO A;  1SF8 A;  2R05 A;  4XEV A;  3NYM A;  5DS5 A;  3CAX A;  2IBF A;  4ULV A;  5AGF A;  5JP7 A;  4G7Z F;  1NLX A;  1OCO C;  3EQL F;  5JUA A;  1JOG A;  1VYK A;  5A6B D;  2HUJ A;  2OJE D;  1O3U A;  2Y3G A;  3H2U A;  3S27 A;  3NYJ A;  3VM6 A;  1E2X A;  3W8I A;  2AVK A;  4KBL A;  4MND A;  3RIP A;  4E0I A;  3S29 A;  1D1B A;  2HS5 A;  3GEH A;  4QI0 A;  1C03 A;  5DLJ A;  3T9O A;  4BG0 A;  4O79 A;  2EIL C;  3W4Y A;  1MQV A;  3NYL A;  4U5B E;  3SP1 A;  1ZHT A;  4U5F E;  4U9E A;  2NSG A;  2L6H A;  2A0U A;  4GQH A;  3I5Q A;  4J7T A;  4U5E E;  3SZR A;  4CDA A;  4YT4 A;  4OIN F;  2HV6 A;  2KNH A;  3V7O A;  1T6Q A;  5A69 A;  2M4E A;  1A0B A;  1R4T A;  5L0C A;  3B0U X;  1RCP A;  2M64 A;  2Y3B A;  5BQG A;  2G62 A;  1SYQ A;  5T3W A;  1M2V B;  4NTF A;  2EPK X;  1LI5 A;  2EIM C;  3VAY A;  5BUO A;  2BC5 A;  3RKO F;  4XLN F;  5DS4 A;  4CSA C;  2BE5 F;  2YL1 A;  3ZQY A;  3FAP B;  1M2V A;  2P1A A;  4E17 A;  1IW7 F;  1ZU4 A;  1V74 B;  3AQB A;  4JC7 A;  4LDK A;  4ZLC A;  1UG7 A;  2C03 A;  2YL3 A;  4MS2 A;  4J32 B;  4P9T A;  3UR3 C;  4DVZ A;  2R7T A;  3GOD A;  2L7A A;  2C04 A;  4WJ0 A;  4E7S A;  2HSB A;  1G5Z A;  2HMQ A;  1S05 A;  3AG4 C;  4D4N A;  1CGN A;  1LKX A;  1ORJ A;  2J7P A;  5L0I A;  2Z15 A;  3RQG A;  1JPN A;  3DD7 A;  5B1A C;  3RH3 A;  1XZQ A;  1G4U S;  1V55 C;  2E87 A;  3DKA A;  3NMJ A;  2YLG A;  1YA9 A;  3U2M A;  1YZC A;  1FMW A;  1MNE A;  2OCC C;  2LSE A;  2OQM A;  2W45 A;  3GOR A;  3LS1 A;  3M4C A;  4NCQ A;  2GA0 A;  5JS5 A;  4ZLD A;  3SXM A;  5L0F A;  5CIV A;  2D5R B;  2A6H F;  2KK1 A;  5F28 E;  2Y3D A;  2MWQ A;  3OWT A;  4Z9I A;  4DXW A;  1XWJ A;  1JAF A;  4EBK A;  1Z63 A;  3J06 A;  3KH2 A;  2G3V A;  2J7P D;  1OCZ C;  1MMD A;  4Z9J A;  2EPL X;  3LUT B;  1K04 A;  1Q0M A;  5IY5 C;  3TUL A;  4M63 A;  5KYW A;  4GEH A;  4Q4Z F;  3EHN A;  2RSE B;  3FMS A;  1FTS A;  1K40 A;  1QSP A;  1RKC A;  2HKV A;  3DJN B;  5B3S C;  2A1D D;  2L9J A;  4U5H A;  3RF3 A;  2JX0 A;  3O10 A;  4H4K C;  2VC9 A;  4JJG A;  4JW1 A;  1GM5 A;  2J45 A;  1ZU5 A;  1MMG A;  3RQF A;  1RMV A;  3C7J A;  1Y4C A;  2CNW A;  1OW8 A;  3KKB A;  4BJT A;  1CGM E;  4CBE A;  3RVY A;  1I5N A;  3FHD A;  3U8P A;  3PHF 2;  3C63 A;  3DJU B;  3MBG A;  4XPW A;  3S0X A;  3LLI A;  2J9U A;  2YWA A;  1OW6 A;  2HJM A;  3A11 A;  2IXO A;  2J0W A;  4G78 A;  1IZM A;  3NMK A;  2L6G A;  1DOV A;  4YJW A;  1U0B B;  1TWH A;  2VB6 A;  3AGT A;  3GAN A;  1WAS A;  2R7U A;  1FR0 A;  5DS6 A;  1SR2 A;  1FFH A;  3IQC A;  1Z23 A;  4JCH A;  2CNW D;  3W2W A;  3B29 A;  3Q7G A;  1TWA A;  3K7D A;  2ETS A;  2XM0 A;  3B0V C;  3K33 A;  1TFK B;  3K66 A;  2LK4 A;  2Y69 C;  2IYL D;  1MMN A;  2ZXR A;  5E3C A;  4CJG A;  4AK9 A;  2YL0 A;  3NG1 A;  2W4M A;  1VK5 A;  2Q7R A;  3LJB A;  2YHS A;  5D91 A;  2XSE A;  3F46 A;  4BJ5 A;  3HNL A;  1LM3 B;  1AEP A;  4YL1 A;  1VLS A;  5L0J A;  1BZ4 A;  1WN0 A;  1ORY A;  2F22 A;  2XL4 A;  2XS8 A;  2NSF A;  3EH1 A;  3IHU A;  4OD4 A;  1D0X A;  1VYI A;  2WZL A;  4PJM A;  3MLG A;  3TK0 A;  3ITF A;  4KNV A;  3ABK C;  2L81 A;  2NUP A;  2HMZ A;  2IXP A;  2DI3 A;  3LEO A;  4LDQ A;  4NC3 A;  1CPQ A;  3K1I A;  4H54 A;  4YT8 A;  4MTF A;  4ONS A;  2PF4 E;  1GGQ A;  3SEO A;  3DZA A;  2YQY A;  4BPM A;  4CS9 A;  1MND A;  2YRF A;  4R32 A;  3OA1 A;  3X2Q C;  1D0Y A;  2LCH A;  3JRM O;  5A6J A;  3R7C A;  1LIH A;  2HV7 A;  2GFH A;  2IXM A;  2OKU A;  4XPX A;  2IM8 A;  3LAY A;  1ZZP A;  4WGZ A;  2OU6 A;  3IQ6 A;  3IPM O;  3SXY A;  2R03 A;  1M2O A;  3JYY A;  4W8K A;  1VB5 A;  5BQI A;  1YDI A;  2Q9A A;  3ZC4 A;  2XLO A;  2R7V A;  3G50 A;  3FXH A;  1LI7 A;  4PJJ A;  2JD3 A;  1HY5 A;  3ZWI A;  3K6B A;  2XLM A;  2A0B A;  4RD9 A;  3U8V A;  1L7C A;  3JRT A;  4I44 A;  5AC5 A;  3KYJ A;  1NBB A;  3QVZ A;  3UNG C;  1E85 A;  1ZW2 A;  2QTV A;  2UUH A;  3DM5 A;  1T6U A;  3AG2 C;  4BJ5 C;  3K1H A;  2VCA A;  4DVY P;  3C8G B;  1NU7 D;  3N2Z B;  2Q9B A;  3Q6N A;  5CI8 A;  3S90 A;  1OW7 A;  1VLT A;  3QMK A;  1EA8 A;  4OD5 A;  3C8G A;  4LLE A;  4JTC B;  4RDA A;  4FAP B;  2VCC A;  1KTM A;  1OCR C;  4IAQ A;  1YJG A;  3K1I C;  1V4A A;  1FAP B;  3EZH A;  4CS9 C;  4MVS A;  2GDC A;  4N6H A;  4G7H F;  2LD6 A;  3L8J A;  3AG3 C;  4EBB A;  4G7O F;  1EKY A;  1BR4 A;  3WAQ A;  1HW2 A;  1RXQ A;  2R7X A;  1TFO B;  1L3P A;  3BRJ A;  3CEX A;  3I4U A;  1YAU O;  2PBE A;  3N0T A;  2R7O A;  2WZF A;  4PJN A;  2YLD A;  1M6T A;  3C8G D;  4JUR I;  4DRH B;  1ZVZ A;  3DE9 A;  4JVS A;  1H9G A;  4JTD B;  3HTK C;  4LAC B;  3B9Q A;  1OR3 A;  2QE9 A;  4P9F A;  4EWC A;  3LLK A;  3S84 A;  1QPU A;  1E86 A;  3U2L A;  4HFK B;  3L1M A;  3U0C A;  2PX0 A;  1QVX A;  1BDJ B;  2YL7 A;  2KSF A;  3O39 A;  4J7Y A;  4AL1 A;  1Q0G A;  2GAQ A;  4XWJ A;  2WZG A;  5FZT A;  2AP3 A;  1BBH A;  3U9J A;  5DVW A;  1HE1 A;  1WTY A;  3JCU Q;  5BQH A;  1OXK A;  1LPE A;  3KYI A;  4G0H A;  1WAT A;  1S7Z A;  3AQC A;  3KL4 A;  4AX2 A;  1NSG B;  2X51 A;  4CS7 A;  2EIK C;  4FWV A;  3T6B A;  1Q0F A;  3DXJ F;  1LVK A;  3E70 C;  4IJJ A;  3IEE A;  4Z9H A;  2A6E F;  4E7Z A;  2LFF A;  1T6I A;  1UFB A;  2D4U A;  2Q3T A;  1PD1 A;  5EHH A;  5K0I A;  4P6I C;  2CDQ A;  4O7G A;  2DB4 A;  2WVN A;  4NY3 A;  4EUK B;  3N24 A;  2P61 A;  3B71 A;  1I4Y A;  4C3B A;  2XS1 A;  2V3C C;  2FGY A;  1F1M A;  4UDV A;  4C3D A;  4XEF A;  3KMI A;  3EFO B;  3U3B A;  1A7E A;  1J8M F;  4CDY A;  2QNL A;  2H7O A;  2EIJ C;  2FAP B;  4ULW A;  5EK0 A;  3RFY A;  3QZC A;  3E9V A;  2ZXO A;  3HNJ A;  2R7S A;  3US6 A;  3L34 A;  4PAC A;  4CS8 A;  3HJC A;  2LFD A;  2QLA A;  2EPO A;  3NRH A;  2KYH A;  4JJF A;  4I3M A;  3LNM B;  1ZHW A;  1H7I A;  3VRC A;  4U9D A;  1PCX A;  3CQZ A;  1LS1 A;  4C7O B;  5FCL A;  2XRH A;  1DOW A;  1BR2 A;  1Z3I X;  2J46 A;  3ZTZ A;  1RKE B;  1JMW A;  4YT5 A;  3WG7 C;  5L0H A;  2R7Q A;  3M1C B;  4C7O A;  4MVM A;  3G4X A;  3QW0 A;  1FNT c;  3MYI A;  4IB4 A;  1RKE A;  1T9K A;  3FAJ A;  3PMR A;  4CIP A;  2AWY A;  2CCY A;  3ECS A;  4O6N A;  2W4B A;  1V54 C;  3FOO A;  2H7V C;  1BR1 A;  1QQ3 A;  2EPN A;  2Q9C A;  5F5H A;  3EGX B;  3DE8 A;  2ZD9 A;  2P6V A;  3GWL A;  3I5P A;  2NG1 A;  1O5H A;  1HMO A;  3TD7 A;  3RVZ A;  4NQF A;  2MHR A;  3JSE O;  2OOC A;  4FES A;  3S9O A;  4JCZ A;  4B6I A;  1MMA A;  4IRU A;  4K1O A;  1HW1 A;  2H8A A;  3LES A;  2XL6 A;  3DAF A;  4JIO A;  4JTA B;  4CS8 C;  3OEO A;  3ZIB A;  3EG9 B;  5GPG B;  1C17 M;  3SYN A;  2Y39 A;  4HEA J;  4I1M A;  2NPU A;  2XLH A;  3GEE A;  2BL2 A;  3LNR A;  1OXB A;  1NG1 A;  4I1O B;  3EG9 A;  4XPY A;  4E18 A;  3FDQ A;  4OIP F;  2VCB A;  5KYN A;  1R5I D;  1VOM A;  4BJ1 A;  2YKZ A;  3HNK A;  5A6K A;  3NMI A;  4NTB A;  1OQC A;  2YVK A;  1H9T A;  5COM A;  4C3E A;  1C02 A;  1FFT C;  3JYH A;  5JT4 A;  2DYR C;  3U9M A;  2KC3 A;  4HFF B;  3ASO C;  2ZXW C;  2J9V A;  3WHN A;  2B0J A;  2J9W A;  4O6M A;  3R2P A;  1N1C A;  5JLI A;  5L0G A;  1Q0D A;  2O9X A;  3U3F A;  1QZX A;  3CZ6 A;  2V26 A;  3PCV A;  2PFD A;  3NKD A;  2ZXP A;  1GS9 A;  1NZE A;  5E3A A;  1JR8 A;  4MVO A;  2WVQ A;  5KYY B;  4YL0 A;  1APC A;  2KW3 C;  2XL8 A;  2UUI A;  4DRJ B;  3UGP A;  5KYY A;  1E83 A;  3AJM A;  3JZ0 A;  4RBN A;  1ZHX A;  3EZI A;  2I8B A;  3V5Z A;  2R25 A;  1VMA A;  1NU9 C;  2CGE A;  4L6R A;  2PX3 A;  4MVQ A;  1GQA A;  2J8W A;  2JPU A;  2XLD A;  4GYT A;  2R7R A;  4QI2 A;  5DQZ A;  1A7D A;  4A4A A;  2WVO A;  3FOP A;  3EJN A;  1A7V A;  1ST6 A;  4K0D A;  3U5S A;  3Q6M A;  3CSK A;  3EPV A;  4MVU A;  3RYL A;  2R02 A;  3S28 A;  3TOM A;  3ZVR A;  4ER9 A;  4AE4 B;  5L0D A;  4XEK A;  1U89 A;  4BEJ A;  3ATP A;  3FVY A;  2WB7 A;  4AE4 A;  5AC4 A;  5EGY A;  5A6A A;  4JZA A;  2XLW A;  1KU2 A;  4XQ1 A;  3UMK A;  1W2W A;  2IXN A;  3EHM A;  5COG A;  4X0R A;  1EQ1 A;  3AGU A;  2RD9 A;  3RQE A;  5L3Q A;  4JE9 A;  3UMH A;  3HLZ A;  4PFP A;  4MVZ A;  1D0Z A;  3W2V A;  1AVO B;  3C18 A;  5L3V A;  5D92 A;  1Z5Z A;  3SXK A;  3HNI A;  4YN0 B;  1M56 C;  2HSQ A;  3T6G B;  3H2V A;  4QDL A;  2CYD A;  2B0H A;  1NFN A;  1T01 A;  3TJ6 A;  4OIQ F;  4IAR A;  1D1C A;  3PDM P;  4FX5 A;  4CDV A;  2YEV A;  4HE8 D;  3M4B A;  1CGO A;  1KNY A;  3L8I A;  3GM2 A;  1YYJ A;  4U5C E;  256B A;  2Q4F A;  2LIG A;  2J9B A;  2OEV A;  2G3K A;  3T6J A;  5DQT A;  2I15 A;  2FFH A;  4PK4 A;  4YT2 A;  4DOZ A;  2R7W A;  2PP4 A;  3BEH A;  4KNW A;  5HV9 A;  1JRA A;  2LP4 A;  2IOQ A;  5E2Q A;  2OEX A;  3RW0 A;  4DRI B;  1TR2 A;  1ZYR F;  4E0H A;  3QTH A;  1YAR O;  1O87 A;  1YLM A;  4JKV A;  4YK5 A;  3ABM C;  4DBR A;  1ORS C;  5TJ5 E;  3M79 A;  3VF0 A;  3EH2 A;  1ZHY A;  1LE2 A;  2DGJ A;  3GEI A;  1WWP A;  4CIH A;  4U5G A;  1TWC A;  4N4W A;  1M57 C;  4J30 B;  3VYW A;  1HMD A;  1PD0 A;  4OIR F;  3EFO A;  4Q5S F;  4ANJ A;  1G8X A;  5JSL A;  1OCC C;  1G4W R;  3C8Z A;  1J8Y F;  1OKK A;  1ZHZ A;  3TQO A;  3TOL A;  5JRA A;  3TJ5 A;  1EI7 A;  1FMV A;  4AL0 A;  4W8P A;  2W9Y A;  3ABL C;  2P0N A;  3MYF A;  3UGO A;  2EPM X;  1YZA A;  4Q7C A;  3ZTM A;  4U5D E;  3T4R A;  2H7B A;  3O55 A;  3O6X A;  3W8H A;  4DBQ A;  1Q0K A;  2L6F A;  3MFN A;  1YYX A;  5KYW B;  4MW3 A;  4WAB A;  3H65 A;  3X1O A;  2EIN C;  2MYS A;  1I4Z A;  2QY9 A;  2XLV A;  3SXZ A;  2QUP A;  4WGY A; 
#chains in the Genus database with same CATH homology
 2P7V A;  1OKK D;  1QLE C;  3L0I A;  3JSZ A;  3DAG A;  5E33 A;  2CW0 F;  3LS0 A;  4K7B A;  1RJ9 B;  3UMI A;  4KI2 A;  2OG2 A;  5T3T A;  4LER A;  2YZS A;  1RJ9 A;  3JT1 A;  5CI9 A;  3WOD F;  4OIO F;  4PFO A;  4BJ6 A;  4XLP F;  3EGD B;  3ASN C;  4F4B A;  3EGX A;  2KQ9 A;  4YWQ A;  4Q5S F;  4A2N B;  3Q7L A;  3DM9 B;  3EGD A;  4LLC A;  3LEV A;  4PJL A;  5KYX B;  2KGO A;  4O6Y A;  3POV A;  2Y3H A;  4N06 A;  5KYX A;  3ZSU A;  5KYU B;  2WL8 A;  3B0P A;  2XXA B;  4KC9 A;  5KYU A;  2ZPA A;  1SZI A;  3NKE A;  2XXA A;  1TWG A;  2NUT B;  3F47 A;  1SMY F;  5HSW A;  1D1A A;  3MX3 A;  1WGW A;  4XTK A;  2NUP B;  2A69 F;  1TKN A;  2NUT A;  3AG1 C;  3NDB B;  2J0X A;  1Z6A A;  2DYS C;  2KJG A;  4IWB A;  2VAS A;  2VH3 A;  5T1D B;  5F5F A;  4BJ6 C;  3DMD A;  3SNH A;  4MQ9 F;  3ZG1 A;  2A68 F;  1JPJ A;  5B1B C;  4CSA A;  4IAO A;  1SF8 A;  3NYM A;  5DS5 A;  4G7Z F;  1OCO C;  3EQL F;  1VYK A;  2Y3G A;  3S27 A;  3NYJ A;  3W8I A;  4MND A;  4KBL A;  3RIP A;  3S29 A;  1D1B A;  4QI0 A;  5DLJ A;  4BG0 A;  4O79 A;  2EIL C;  3NYL A;  4U5B E;  3SP1 A;  1ZHT A;  4U5F E;  4U5E E;  3I5Q A;  3SZR A;  4YT4 A;  4OIN F;  2HV6 A;  2KNH A;  3V7O A;  2M4E A;  3B0U X;  2Y3B A;  2G62 A;  5T3W A;  3VAY A;  1M2V B;  5BUO A;  2EIM C;  3RKO F;  4XLN F;  5DS4 A;  4CSA C;  2BE5 F;  1M2V A;  1IW7 F;  1ZU4 A;  3AQB A;  4ZLC A;  2C03 A;  3UR3 C;  4J32 B;  2R7T A;  4DVZ A;  3GOD A;  2C04 A;  4WJ0 A;  4E7S A;  3AG4 C;  1LKX A;  2J7P A;  2Z15 A;  1JPN A;  3DD7 A;  5B1A C;  3RH3 A;  1V55 C;  2E87 A;  1FMW A;  1MNE A;  2OCC C;  2LSE A;  2W45 A;  3LS1 A;  4ZLD A;  2D5R B;  2A6H F;  2Y3D A;  2MWQ A;  3OWT A;  1Z63 A;  3KH2 A;  2G3V A;  2J7P D;  1OCZ C;  1MMD A;  5IY5 C;  4M63 A;  5KYW A;  4GEH A;  4Q4Z F;  3EHN A;  1FTS A;  3DJN B;  5B3S C;  2A1D D;  2L9J A;  4U5H A;  4JW1 A;  4H4K C;  4JJG A;  2J45 A;  1ZU5 A;  1MMG A;  2CNW A;  3KKB A;  4BJT A;  4CBE A;  3FHD A;  3PHF 2;  3DJU B;  3S0X A;  3LLI A;  2J9U A;  2IXO A;  2J0W A;  1IZM A;  4YJW A;  1TWH A;  2VB6 A;  3GAN A;  2R7U A;  5DS6 A;  1FFH A;  1Z23 A;  4JCH A;  2CNW D;  3W2W A;  3Q7G A;  1TWA A;  3K7D A;  3B0V C;  3K33 A;  3K66 A;  2Y69 C;  2IYL D;  1MMN A;  2ZXR A;  5E3C A;  4AK9 A;  3NG1 A;  2W4M A;  1VK5 A;  3LJB A;  2YHS A;  5D91 A;  2XSE A;  3F46 A;  4BJ5 A;  2XL4 A;  3EH1 A;  4OD4 A;  1D0X A;  1VYI A;  2WZL A;  4PJM A;  3MLG A;  3ITF A;  4KNV A;  3ABK C;  2L81 A;  2NUP A;  2IXP A;  4YT8 A;  2PF4 E;  4CS9 A;  3SEO A;  3DZA A;  1MND A;  3OA1 A;  3X2Q C;  1D0Y A;  2HV7 A;  2GFH A;  2IXM A;  3LAY A;  1M2O A;  4W8K A;  2Q9A A;  3ZC4 A;  2R7V A;  4PJJ A;  2JD3 A;  3K6B A;  4RD9 A;  3JRT A;  4I44 A;  3UNG C;  2QTV A;  3DM5 A;  3AG2 C;  4BJ5 C;  3K1H A;  4DVY P;  1NU7 D;  3N2Z B;  2Q9B A;  3Q6N A;  5CI8 A;  3QMK A;  4OD5 A;  4LLE A;  4RDA A;  1OCR C;  3K1I C;  3EZH A;  4CS9 C;  4G7H F;  4EBB A;  4G7O F;  1BR4 A;  2R7X A;  4PJN A;  3N0T A;  3I4U A;  2R7O A;  2WZF A;  4JUR I;  4JVS A;  3HTK C;  4LAC B;  3B9Q A;  4EWC A;  3LLK A;  4HFK B;  2PX0 A;  3O39 A;  4XWJ A;  2WZG A;  5DVW A;  3JCU Q;  4G0H A;  1S7Z A;  3AQC A;  3KL4 A;  4AX2 A;  2X51 A;  4CS7 A;  2EIK C;  4FWV A;  3T6B A;  3DXJ F;  4IJJ A;  1LVK A;  3E70 C;  3IEE A;  2A6E F;  4E7Z A;  2Q3T A;  5EHH A;  1PD1 A;  4P6I C;  2CDQ A;  4O7G A;  2WVN A;  4NY3 A;  3N24 A;  4C3B A;  2V3C C;  2FGY A;  4C3D A;  3KMI A;  3EFO B;  1J8M F;  2H7O A;  2EIJ C;  4ULW A;  3RFY A;  3QZC A;  3E9V A;  2ZXO A;  2R7S A;  3L34 A;  4CS8 A;  3HJC A;  3NRH A;  4JJF A;  4I3M A;  1ZHW A;  1PCX A;  3CQZ A;  1LS1 A;  4C7O B;  5FCL A;  2XRH A;  1Z3I X;  1BR2 A;  2J46 A;  4YT5 A;  3WG7 C;  2R7Q A;  3M1C B;  4C7O A;  3FAJ A;  3PMR A;  3ECS A;  4O6N A;  2W4B A;  1V54 C;  2H7V C;  1BR1 A;  5F5H A;  5L3Q A;  2Q9C A;  3EGX B;  2P6V A;  3I5P A;  2NG1 A;  1O5H A;  3TD7 A;  4B6I A;  4FES A;  1MMA A;  4IRU A;  3LES A;  3DAF A;  4CS8 C;  3OEO A;  3ZIB A;  3EG9 B;  3SYN A;  2Y39 A;  4HEA J;  4I1M A;  3LNR A;  1NG1 A;  4I1O B;  3EG9 A;  4OIP F;  5KYN A;  1VOM A;  4BJ1 A;  4C3E A;  1FFT C;  3JYH A;  2DYR C;  4HFF B;  3ASO C;  2ZXW C;  2J9V A;  2B0J A;  2J9W A;  4O6M A;  1N1C A;  2O9X A;  1QZX A;  3CZ6 A;  2V26 A;  2PFD A;  3NKD A;  2ZXP A;  1NZE A;  5E3A A;  2WVQ A;  5KYY B;  2KW3 C;  3UGP A;  5KYY A;  4RBN A;  1ZHX A;  3EZI A;  2I8B A;  1VMA A;  1NU9 C;  2CGE A;  2PX3 A;  4QI2 A;  4GYT A;  2R7R A;  5DQZ A;  2WVO A;  3EJN A;  1ST6 A;  4K0D A;  3ZVR A;  3Q6M A;  3CSK A;  3EPV A;  3RYL A;  3S28 A;  3FDQ A;  4AE4 B;  4BEJ A;  3FVY A;  2WB7 A;  4AE4 A;  5EGY A;  4JZA A;  1KU2 A;  3UMK A;  1W2W A;  2IXN A;  3EHM A;  4X0R A;  3UMH A;  3HLZ A;  4PFP A;  1D0Z A;  3W2V A;  5L3V A;  5D92 A;  1Z5Z A;  4YN0 B;  1M56 C;  4QDL A;  4OIQ F;  1D1C A;  4FX5 A;  2YEV A;  4HE8 D;  4U5C E;  2G3K A;  3T6J A;  5DQT A;  2FFH A;  4PK4 A;  4YT2 A;  4DOZ A;  2R7W A;  2PP4 A;  4KNW A;  5E2Q A;  2IOQ A;  1TR2 A;  1ZYR F;  1O87 A;  4DBR A;  3ABM C;  3EH2 A;  1ZHY A;  2DGJ A;  4CIH A;  4U5G A;  1TWC A;  1M57 C;  4J30 B;  3VYW A;  1PD0 A;  4OIR F;  3EFO A;  4ANJ A;  1G8X A;  1OCC C;  1J8Y F;  1OKK A;  1ZHZ A;  1FMV A;  2W9Y A;  3ABL C;  3UGO A;  4Q7C A;  4U5D E;  3T4R A;  2H7B A;  3O6X A;  3W8H A;  4DBQ A;  5KYW B;  3H65 A;  3X1O A;  2EIN C;  2MYS A;  2QY9 A;  3AG3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...