3FDQA

Recognition of at-rich dna binding sites by the mogr repressor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
b'SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motility gene repressor mogR
publication title Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein/dna
total genus 50
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12181 MogR_DNAbind DNA binding domain of the motility gene repressor (MogR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1030 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fdqA01
3FDQA
chains in the Genus database with same CATH superfamily
3ZC4A 3V5XA 4CJOA 2GAQA 2ZD9A 3JTLO 2CNWA 1VTMP 4ZLCA 1NU7D 2HS5A 3VM6A 2Z15A 3LAYA 4GQHA 2GWWA 2HKVA 4N4WA 1XZQA 4ONSA 2HJ3A 3VRCA 2LIGA 1JRAA 1NZEA 3CEXA 5KYUB 3HLZA 1RMVA 3SNHA 5A6KA 5L3VA 3M1CB 1CGOA 4MVOA 3OEOA 2GDCA 2FGYA 2M4EA 4LDQA 3TJ5A 1R4TA 2AWCA 3RVZA 5KYXA 3SXKA 2GFHA 5JRAA 2XLEA 5TJ5E 2IOQA 2X51A 4NTBA 5CI9A 4E0HA 2M64A 4PJJA 2Y3GA 1V54C 1RKEB 1FTSA 3QW0A 1TFOB 4LERA 1Y4CA 2H7OA 2PX3A 3VYWA 2KGOA 5BQGA 4CSAA 1VMAA 2J9UA 2LK4A 3WHNA 1O5HA 3JSEO 4OIOF 2HJMA 3DD7A 2CCYA 2R02A 1V55C 3KMIA 1A0BA 3M79A 3NMIA 4GEHA 3W2VA 1TQGA 5L0HA 2LD6A 2HZ8A 4K7BA 4G7ZF 4B6IA 3ZQYA 1TWHA 1AVOB 1V74B 2EIKC 1AEPA 1YJGA 3SXMA 2EPKX 2L9JA 2X0CA 4P9TA 4PFOA 3JZ0A 4IRUA 2AP3A 4JEBA 2KYHA 4EBJA 4ULWA 2I8BA 3ZSUA 2L7AA 3C62A 1K05A 3ZIBA 2YRFA 4EKWA 4PJLA 3U0CA 1FMVA 3K7DA 1YLMA 1NFNA 2PX0A 1T9KA 1G8XA 3T6BA 5AC4A 3RQEA 4RDAA 4JTAB 4YL3A 3LLIA 5T3WA 4NY3A 5KYYB 2HSBA 4MVZA 1OCZC 1ZW3A 3K1IC 2HV6A 1WWPA 2WZFA 1YARO 1JPJA 3EZHA 5L0FA 1CPRA 2H7BA 1HW2A 3S28A 4U5EE 3RQGA 1OW7A 2LQGA 2XM4A 2XRHA 3LJBA 2KK1A 4O6NA 1H6GA 3UGOA 1KNYA 4N6CA 1PD0A 5B3SC 3X1OA 2XXAB 2NUPA 1MMAA 3DAFA 1ORYA 1J8MF 1H7IA 1VOMA 2A6EF 1DOWA 2AVKA 1ZU4A 1ZHYA 2YL7A 2XS8A 1WASA 4I3MA 1QLEC 1FFHA 4K1OA 4E7SA 2NSFA 1CGME 4CDVA 3ZTZA 1I4ZA 5AC5A 5L0DA 4OIRF 2C03A 4F4BA 1CPQA 4KBLA 1NFOA 1MMNA 1YYJA 4YL1A 3KPHA 5T1DB 4XLNF 3UMIA 1Z63A 4PJNA 3QMKA 3V7OA 1DOVA 3CZ6A 2R7SA 2EIMC 4XTKA 3UR3C 2XLMA 2G62A 5BUOA 1Y6DA 2YWAA 3K33A 1LIHA 3FDQA 2ZXWC 2IXNA 1LM3B 1ZW2A 2QUPA 5A69A 5D91A 3V5ZA 2HMQA 5D92A 4MTGA 2Y69C 4JJGA 1PD1A 4MVQA 3EH1A 1OKKD 2H7VC 2XM0A 1PV3A 5B3IA 3A11A 5HSWA 1PCXA 1JPNA 1Q0DA 1UFBA 1T5OA 4O7GA 1OR3A 3EGXA 2B0JA 3U3BA 3NRHA 2HV7A 3FOPA 2I15A 1RJ9B 2A68F 1GQAA 2AU5A 1D0ZA 1ZHZA 3H2UA 3ABLC 3QZCA 5F5HA 3NMJA 3EFOA 1E2XA 3ABKC 2W9YA 4MS2A 3LLKA 1E83A 3SYNA 3O6XA 4NC3A 1LS1A 3C8GA 2ASRA 4PJMA 4C7OA 3ZTMA 2CYDA 2ZXPA 3MBGA 4LACB 5JSLA 2R03A 3JRTA 4BEMJ 4CS9C 1LE4A 2NSGA 2L6GA 2R05A 2JX0A 4QI0A 1T6UA 3HKKA 3NMKA 1M2OA 3QVZA 1QZXA 3ITFA 3RQFA 3HNJA 2RD9A 2EPOA 4YT2A 1LI5A 1ZYRF 1GS9A 2R7XA 1O3UA 3K6BA 1VYIA 1A41A 1ZVZA 1QKRA 4NQFA 1M2VA 2OJED 4ANJA 2O9XA 2YL0A 3KYIA 4Z9JA 4C3BA 4XEKA 3TJ6A 2DGJA 4JKVA 3TK0A 4GYTA 5DVWA 4EUKB 1D0YA 1JR8A 1LPEA 1WGWA 2KW3C 1U89A 2JPUA 3DE9A 4FAPB 3B0UX 3GM2A 5F5FA 4Q4ZF 1ORJA 2CGEA 2V26A 4MW8A 1FR0A 2UUHA 4BJTA 4U9DA 4U5GA 3O55A 4EHPA 3S27A 3RIPA 1XWJA 4HEAJ 2JD3A 4IAQA 2PF4E 3G4ZA 3A9CA 4RBNA 3CSKA 2XL6A 4AK9A 2R7TA 2IM8A 5AGFA 1ZHWA 4AE4B 4U5FE 3C63A 1SZIA 1OCCC 4D4XA 1A7DA 1OR2A 4H54A 5B1AC 2J46A 2VC9A 3EG9A 3T6GB 4XPXA 2P6VA 2NUTB 1KTMA 2R7RA 2Y3BA 2W4MA 3W8IA 1JOGA 4IWBA 1E85A 4HFKB 3S9OA 2XLVA 2Q00A 3ASNC 3LS0A 3U2LA 4EBBA 5DS4A 1VYKA 4I44A 2OEVA 1OCRC 1EKYA 2AWYA 3L1MA 3M4BA 2WVOA 2QTVA 3GM1A 3N24A 2VCCA 1MMDA 2OOCA 1SYQA 2OQMA 1NG1A 1OXBA 1OXKA 2PFDA 2CNWD 2DYRC 4BJ1A 2EINC 3KL4A 3C18A 4EWCA 2J8WA 4CSAC 1G5ZA 2YVKA 3EGDB 4YT4A 1Z23A 1WTYA 5B1BC 3TQOA 3CQZA 4DRIB 3JT1A 1HY5A 1Z5ZA 4XLPF 3LS1A 2ZPAA 2J9WA 4XPWA 3FHDA 3VF0A 3JSZA 4XPYA 1J8YF 1BR4A 1OQCA 4E18A 2A69F 1NLXA 1TWCA 4FX5A 4JRZA 4KC9A 3TD7A 4A4AA 4CS8C 1I4YA 2A6HF 3RYLA 2VCBA 3ATPA 5BQIA 1E84A 3FOOA 1GM5A 1EQ1A 5E33A 2FAPB 1HMOA 2IYLD 1YAUO 2D5RB 3L0IA 4D4NA 1NU9C 1ZHXA 1WOLA 3X2QC 1ZHTA 5KYWA 1SR2A 3AG3C 3TULA 4JJFA 4YJWA 1W2WA 5DS5A 4J32B 1KU2A 4MVUA 3NYJA 4CBEA 1L7CA 3UGPA 1Q0MA 4BJ6C 1HE9A 2QLAA 2WZLA 3BEHA 3T6JA 4G7HF 3J06A 1T01A 3I4UA 1U6HA 3V5YA 4P9FA 3T4RA 3I5PA 1Q0GA 3Q7GA 4JIOA 4MQ9F 2MYSA 2YQYA 2DI3A 4E17A 1JMWA 2B0HA 3AJMA 1AUEA 3BRJA 2Y39A 3JCUQ 3DXJF 5A6AA 3K1IA 3RF3A 3ABMC 5A6BA 3JYYA 2J7PD 2UUIA 4U5HA 1N1CA 2Q9AA 3MX3A 3ZQVA 1NBBA 3F47A 3HNIA 3OA1A 4LLEA 4JZAA 2ETSA 4WGZA 3B71A 4DJ9A 4MNDA 3C7JA 3DWWA 3W8HA 3U9MA 4AL1A 3IQTA 4O6MA 2XLDA 1BR1A 3IQCA 3GWNA 3MLGA 4E7ZA 5A6JA 1F1MA 3C8ZA 3IHUA 3DM9B 3EH2A 5JP7A 5KYXB 3RW0A 4I1OB 1HE1A 2GA0A 3U9JA 1EA8A 1WN0A 2IXOA 3S90A 2W45A 1MNDA 2TMVP 2R7UA 1FFTC 1OCOC 3FAPB 2DB4A 3KYJA 1D1CA 4JURI 3HNKA 3S29A 3SXZA 3FXHA 1FAPB 4MVMA 2R7WA 3K1HA 2WB7A 4M63A 2J0XA 3IPMO 2P7VA 2NG1A 2WVNA 3AOUA 5KYUA 2HSQA 2XLWA 3AGTA 3M15A 2V3CC 4H4KC 2EILC 2R7VA 4Z9IA 4MVSA 4LDRA 4C3EA 3SZRA 4CIPA 1RXQA 1Z6AA 3IQ6A 2EPLX 1H9GA 4HE8D 5DLJA 1RKEA 3AG4C 3M4CA 1V4AA 1LE2A 3L8JA 3DI5A 3AGUA 2P0NA 4XEVA 3LESA 4CJGA 3DJNB 1OW6A 4XEFA 1LVKA 3ECSA 4JCHA 2A1DD 1ORSC 1YA7O 5JS5A 4KI2A 1I5NA 1A7VA 3WG7C 5L0JA 3NKDA 4JTCB 256BA 2ZXOA 3U8VA 5FCLA 2XSEA 4WABA 4WJ0A 4BJ5C 1YZCA 2QNLA 1A7EA 4E0IA 3Q6NA 4AX2A 3LNRA 3EJNA 4LLCA 2PP4A 3G4XA 3EQLF 4MTOA 5DQZA 3KH2A 3SEOA 4ULVA 3T9OA 3RH3A 1TR2A 4BG0A 2RSEB 2LFDA 3EHMA 2LCHA 2NUPB 4J7TA 4KNWA 3C8GD 4DBQA 4K0DA 1YDIA 2H8AA 2R7OA 2XLOA 1FMWA 3OWTA 4O79A 5E2QA 3POVA 2WVQA 1ZZPA 3AG1C 4RD9A 4WGYA 2HUJA 2MWQA 2L81A 2Q4FA 1C02A 2YLIA 5KYYA 1H9TA 5EHHA 4EBKA 2PBEA 3HNLA 2MHRA 2DYSC 1HMDA 1LKXA 3FVYA 3GWLA 3NYMA 3MYIA 2J9BA 2YLGA 3LEOA 3N2ZB 5COMA 2ZXRA 3H2VA 1LS4A 1TFKB 2IXMA 3IQ5A 4NCQA 5T3TA 4OIQF 2XXAA 1TWGA 2OCCC 3QTHA 4C3DA 1QPUA 3NYLA 1ST6A 2Y3HA 3WODF 2IBFA 3Q7LA 2Q9CA 3U3FA 4JC7A 4PFPA 3EGXB 3MYFA 4DVYP 4Q5SF 4BEJA 4OD4A 4W8PA 1OW8A 3E70C 3JYHA 2L6FA 3JRMO 3LNMB 4IB4A 1JAFA 1RKCA 2KSFA 2VCAA 3GEEA 1VLSA 1L3PA 3EFOB 3GM3A 1M57C 2XLHA 3CAXA 4L6RA 4P6IC 4DOZA 4OINF 5L3QA 3KKBA 3ZVRA 3GEIA 3C8GB 3DJUB 4C7OB 1YA9A 2OG2A 3RKOF 2LP4A 3S84A 2OKUA 3B9QA 3RFYA 3WAQA 5COGA 3O39A 1E86A 2FFHA 1M56C 2F22A 5JT4A 3W4YA 4YL0A 3U2MA 2XS1A 3HJCA 4FWVA 2EPMX 2YL3A 5DS6A 1SF8A 4CDYA 2G3KA 1VB5A 2QY9A 4MW3A 1RJ9A 1T6QA 1C03A 2PNOA 3MFNA 3ZDLA 3RVYA 3F46A 1M2VB 1YYXA 3U8PA 1ZU5A 1M6TA 4J7YA 5E3AA 4CS8A 3DKAA 2OJQA 2W4BA 1R5ID 1LI7A 4I1MA 2QE9A 4KNVA 1B68A 4MTFA 4N06A 4A2NB 2Y3DA 1S05A 2VH3A 2Q7RA 2G3VA 4U5CE 3UMHA 3ZWIA 1MNEA 1QVXA 2CDQA 3NKEA 2J7PA 3TOMA 4YWQA 1UG7A 2P61A 2A0UA 1QQ3A 2WZGA 1QSPA 2Q9BA 1Z7Qc 2LFFA 5JLIA 3I5QA 4BJ6A 3G50A 3B0VC 4HFFB 5HV9A 4YT5A 4QI2A 4X0RA 1CGNA 1Q0FA 2ICWG 1T6IA 3FMSA 3IEEA 5JUAA 1D0XA 1MMGA 2CW0F 1C17M 2OEXA 3Q6MA 2HMZA 5FZTA 4NTAA 2KQ9A 1G4WR 4G78A 4IJJA 4Z9HA 3EG9B 5K0IA 3LEVA 1YZAA 3US6A 1OKKA 3N0TA 3QVYA 1GGQA 3GODA 3PMRA 5COFA 4CS9A 2VASA 4O6YA 5JVEA 1Z3IX 1U0BB 4U9EA 4N6HA 3R7CA 3L8IA 3SXYA 2BC5A 3K66A 4DRHB 2C04A 1WATA 3ZG1A 2KC3A 4FESA 1VK5A 3GORA 3L34A 1G4US 2R25A 4J30B 4AE4A 4YT8A 3S0XA 3DMDA 5A6BD 3U5SA 1Q0KA 3R2PA 4IGGA 3O10A 2NPUA 4OD5A 2NUTA 4DBRA 3HTKC 3QW1A 2J0WA 3DM5A 3DE8A 4R32A 3TOLA 3B0PA 2BE5F 4U5DE 4JVSA 4BPMA 5BQHA 4CIHA 2XL4A 3H65A 5L0CA 2OU6A 1MQVA 1NSGB 2YKZA 3PCVA 2J45A 2IXPA 4JE9A 4Q7CA 5DQTA 5GPGB 4G7OF 1APCA 4QDLA 1BDJB 1BBHA 4JEAA 3B29A 2XL8A 4IAOA 5L0GA 1D1BA 3PHF2 1RCPA 5KYWB 1IZMA 4MVRA 3LUTB 5EK0A 3UNGC 2L6HA 2R9RB 1IW7F 1TWAA 3EGDA 3NG1A 4PACA 2EIJC 4ZLDA 2EPNA 3FAJA 4JCZA 4LDKA 2HFIA 2LSEA 2YEVA 1BZ4A 1EI7A 3DZAA 4CS7A 4CX9A 4ER9A 4CDAA 4DXWA 5IY5C 2Q3TA 1XZPA 3SP1A 2KJGA 2KNHA 5E3CA 2YLDA 4UDVA 2P1AA 4XWJA 1K40A 1S7ZA 1YVIA 1O87A 3VAYA 4JW1A 5EGYA 5L0IA 4W8KA 2YL1A 4BJ5A 3PDMP 4XQ1A 1TKNA 2WL8A 4EIYA 3UMKA 2YHSA 4G0HA 1HW1A 2D4UA 3EPVA 3GEHA 3E9VA 4AL0A 2J9VA 3EZIA 2YZSA 1K04A 4IARA 3EHNA 4DRJB 4U5BE 4YK5A 1SMYF 2VB6A 1BR2A 1D1AA 3W2WA 5F28E 3NDBB 3DAGA 4PK4A 4YN0B 5KYNA 5CI8A 2E87A 2A0BA 4JTDB 4NTFA 3AG2C 3ASOC 3GANA 2BL2A 4PR9A 4DVZA 3AQCA 5CIVA 1FNTc 2R7QA 4OIPF 3AQBA 1VLTA
chains in the Genus database with same CATH topology
3ZC4A 2CNWA 4ZLCA 1NU7D 2Z15A 3LAYA 1NZEA 5KYUB 3HLZA 3SNHA 5L3VA 3M1CB 3OEOA 2FGYA 2M4EA 5KYXA 2GFHA 2IOQA 2X51A 5CI9A 4PJJA 2Y3GA 1V54C 1FTSA 4LERA 2H7OA 2PX3A 3VYWA 2KGOA 4CSAA 1VMAA 2J9UA 1O5HA 4OIOF 3DD7A 3KMIA 4GEHA 1V55C 3W2VA 4Q5SF 4G7ZF 4K7BA 4B6IA 1TWHA 2EIKC 2L9JA 4PFOA 4IRUA 4ULWA 2I8BA 3ZSUA 3ZIBA 4PJLA 1FMVA 3K7DA 2PX0A 1G8XA 3T6BA 4RDAA 3LLIA 5T3WA 4NY3A 5KYYB 1OCZC 3K1IC 2HV6A 2WZFA 1JPJA 3EZHA 2H7BA 3S28A 4U5EE 3LJBA 2XRHA 4O6NA 3UGOA 1PD0A 5B3SC 3X1OA 2XXAB 2NUPA 1MMAA 3DAFA 1J8MF 1VOMA 2A6EF 1ZHYA 1ZU4A 4I3MA 4E7SA 1QLEC 1FFHA 4OIRF 2C03A 4KBLA 5T1DB 1MMNA 3UMIA 4XLNF 1Z63A 4PJNA 3QMKA 3V7OA 3CZ6A 2R7SA 2EIMC 4XTKA 3UR3C 2G62A 5BUOA 3K33A 3FDQA 2ZXWC 2IXNA 5D91A 5D92A 2Y69C 4JJGA 1PD1A 3EH1A 1OKKD 2H7VC 5HSWA 1PCXA 1JPNA 4O7GA 3EGXA 2B0JA 3NRHA 2HV7A 3UMHA 3QZCA 1RJ9B 2A68F 5F5HA 1D0ZA 1ZHZA 3ABLC 3EFOA 3ABKC 2W9YA 3LLKA 3SYNA 3O6XA 1LS1A 4PJMA 4C7OA 2ZXPA 4LACB 3JRTA 4QI0A 1M2OA 1QZXA 3ITFA 4YT2A 1ZYRF 2R7XA 3K6BA 1VYIA 1M2VA 4ANJA 2O9XA 4C3BA 2DGJA 4GYTA 5DVWA 1D0YA 1WGWA 2KW3C 3B0UX 5F5FA 4Q4ZF 2V26A 2CGEA 4BJTA 4U5GA 3S27A 3RIPA 4HEAJ 2JD3A 2PF4E 4RBNA 3CSKA 4AK9A 2R7TA 1ZHWA 4AE4B 4U5FE 1SZIA 1OCCC 5B1AC 2J46A 3EG9A 2P6VA 2NUTB 2R7RA 2Y3BA 2W4MA 3W8IA 4IWBA 4HFKB 3ASNC 3LS0A 4EBBA 5DS4A 1VYKA 4I44A 1OCRC 2WVOA 2QTVA 3N24A 1MMDA 1NG1A 2PFDA 2CNWD 2DYRC 4BJ1A 2EINC 3KL4A 4EWCA 3EGDB 4YT4A 1Z23A 5B1BC 3CQZA 1Z5ZA 4XLPF 3LS1A 2ZPAA 2J9WA 3FHDA 3JSZA 1J8YF 1BR4A 2A69F 4FX5A 1TWCA 4KC9A 3TD7A 4CS8C 2A6HF 3RYLA 5E33A 2IYLD 2D5RB 3L0IA 1NU9C 1ZHXA 3X2QC 5KYWA 1ZHTA 3AG3C 4JJFA 4YJWA 1W2WA 5DS5A 4J32B 1KU2A 4CBEA 3NYJA 3UGPA 4BJ6C 2WZLA 3T6JA 4G7HF 3I4UA 3T4RA 3I5PA 3Q7GA 4MQ9F 2MYSA 3JCUQ 2Y39A 3DXJF 3ABMC 2J7PD 4U5HA 1N1CA 2Q9AA 3MX3A 4CS9C 3F47A 3OA1A 4LLEA 4JZAA 4MNDA 3W8HA 4O6MA 1BR1A 3MLGA 4E7ZA 3DM9B 3EH2A 5KYXB 4I1OB 2IXOA 2W45A 1MNDA 2R7UA 1FFTC 1OCOC 4JURI 4F4BA 3S29A 1D1CA 2R7WA 3K1HA 2WB7A 4M63A 2J0XA 2P7VA 2NG1A 2WVNA 5KYUA 2V3CC 4H4KC 2EILC 2R7VA 4C3EA 3SZRA 1Z6AA 4HE8D 5DLJA 3AG4C 3LESA 3DJNB 1LVKA 3ECSA 4JCHA 2A1DD 4KI2A 3WG7C 3NKDA 2ZXOA 5FCLA 2XSEA 4WJ0A 4BJ5C 3Q6NA 4AX2A 3LNRA 3EJNA 4LLCA 2PP4A 3EQLF 5DQZA 3KH2A 3SEOA 3RH3A 1TR2A 4BG0A 3EHMA 4DBQA 2NUPB 4KNWA 4K0DA 2R7OA 1FMWA 3OWTA 4O79A 5E2QA 2WVQA 3AG1C 4RD9A 2MWQA 2L81A 5KYYA 5EHHA 2DYSC 1LKXA 3FVYA 3NYMA 3N2ZB 2ZXRA 2IXMA 4OIQF 5T3TA 2XXAA 1TWGA 2OCCC 4C3DA 3NYLA 1ST6A 2Y3HA 3WODF 3Q7LA 2Q9CA 4PFPA 3EGXB 4DVYP 4BEJA 4OD4A 3E70C 3JYHA 4CSAC 3JT1A 3POVA 4P6IC 3EFOB 4DOZA 1M57C 4OINF 5L3QA 3KKBA 3ZVRA 3DJUB 4C7OB 2OG2A 3RKOF 3B9QA 3RFYA 3O39A 2FFHA 1M56C 3HJCA 4FWVA 5DS6A 1SF8A 2G3KA 2QY9A 1RJ9A 3F46A 1M2VB 1ZU5A 5E3AA 4CS8A 2W4BA 4I1MA 4KNVA 4N06A 4A2NB 2Y3DA 2VH3A 2G3VA 4U5CE 1MNEA 2CDQA 3NKEA 2J7PA 4YWQA 2WZGA 2Q9BA 3I5QA 4BJ6A 3B0VC 4HFFB 4YT5A 4QI2A 4X0RA 3IEEA 1D0XA 1MMGA 2CW0F 3Q6MA 2KQ9A 4IJJA 3EG9B 3LEVA 1OKKA 3N0TA 4CS9A 3GODA 3PMRA 2VASA 4O6YA 1Z3IX 3K66A 2C04A 3ZG1A 4FESA 1VK5A 3L34A 4J30B 4YT8A 3S0XA 4AE4A 3DMDA 4OD5A 2NUTA 4DBRA 3HTKC 2J0WA 3DM5A 3B0PA 2BE5F 4U5DE 4JVSA 4CIHA 2XL4A 3H65A 4Q7CA 5DQTA 4G7OF 2J45A 2IXPA 4QDLA 4IAOA 1D1BA 3PHF2 5KYWB 1IZMA 3UNGC 1IW7F 1TWAA 3EGDA 3NG1A 4ZLDA 2EIJC 3FAJA 2LSEA 2YEVA 3DZAA 4CS7A 5IY5C 2Q3TA 3SP1A 2KJGA 2KNHA 5E3CA 4XWJA 1S7ZA 1O87A 3VAYA 4JW1A 5EGYA 4W8KA 4BJ5A 1TKNA 2WL8A 3UMKA 2YHSA 4G0HA 3EPVA 3E9VA 2J9VA 3EZIA 2YZSA 3EHNA 4U5BE 1SMYF 2VB6A 1D1AA 1BR2A 3W2WA 3NDBB 3DAGA 4PK4A 4YN0B 5KYNA 5CI8A 2E87A 3AG2C 3ASOC 3GANA 4DVZA 3AQCA 4OIPF 2R7QA 3AQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDQ A; 
#chains in the Genus database with same CATH topology
 3ZC4 A;  3V5X A;  4CJO A;  2GAQ A;  2ZD9 A;  3JTL O;  2CNW A;  1VTM P;  4ZLC A;  1NU7 D;  2HS5 A;  3VM6 A;  2Z15 A;  3LAY A;  4GQH A;  2GWW A;  2HKV A;  4N4W A;  1XZQ A;  4ONS A;  2HJ3 A;  3VRC A;  2LIG A;  1JRA A;  1NZE A;  3CEX A;  5KYU B;  3HLZ A;  1RMV A;  3SNH A;  5A6K A;  5L3V A;  3M1C B;  1CGO A;  4MVO A;  3OEO A;  2GDC A;  2FGY A;  2M4E A;  4LDQ A;  3TJ5 A;  1R4T A;  2AWC A;  3RVZ A;  5KYX A;  3SXK A;  2GFH A;  5JRA A;  2XLE A;  5TJ5 E;  2IOQ A;  2X51 A;  4NTB A;  5CI9 A;  4E0H A;  2M64 A;  4PJJ A;  2Y3G A;  1V54 C;  1RKE B;  1FTS A;  3QW0 A;  1TFO B;  4LER A;  1Y4C A;  2H7O A;  2PX3 A;  3VYW A;  2KGO A;  5BQG A;  4CSA A;  1VMA A;  2J9U A;  2LK4 A;  3WHN A;  1O5H A;  3JSE O;  4OIO F;  2HJM A;  3DD7 A;  2CCY A;  2R02 A;  1V55 C;  3KMI A;  1A0B A;  3M79 A;  3NMI A;  4GEH A;  3W2V A;  1TQG A;  5L0H A;  2LD6 A;  2HZ8 A;  4K7B A;  4G7Z F;  4B6I A;  3ZQY A;  1TWH A;  1AVO B;  1V74 B;  2EIK C;  1AEP A;  1YJG A;  3SXM A;  2EPK X;  2L9J A;  2X0C A;  4P9T A;  4PFO A;  3JZ0 A;  4IRU A;  2AP3 A;  4JEB A;  2KYH A;  4EBJ A;  4ULW A;  2I8B A;  3ZSU A;  2L7A A;  3C62 A;  1K05 A;  3ZIB A;  2YRF A;  4EKW A;  4PJL A;  3U0C A;  1FMV A;  3K7D A;  1YLM A;  1NFN A;  2PX0 A;  1T9K A;  1G8X A;  3T6B A;  5AC4 A;  3RQE A;  4RDA A;  4JTA B;  4YL3 A;  3LLI A;  5T3W A;  4NY3 A;  5KYY B;  2HSB A;  4MVZ A;  1OCZ C;  1ZW3 A;  3K1I C;  2HV6 A;  1WWP A;  2WZF A;  1YAR O;  1JPJ A;  3EZH A;  5L0F A;  1CPR A;  2H7B A;  1HW2 A;  3S28 A;  4U5E E;  3RQG A;  1OW7 A;  2LQG A;  2XM4 A;  2XRH A;  3LJB A;  2KK1 A;  4O6N A;  1H6G A;  3UGO A;  1KNY A;  4N6C A;  1PD0 A;  5B3S C;  3X1O A;  2XXA B;  2NUP A;  1MMA A;  3DAF A;  1ORY A;  1J8M F;  1H7I A;  1VOM A;  2A6E F;  1DOW A;  2AVK A;  1ZU4 A;  1ZHY A;  2YL7 A;  2XS8 A;  1WAS A;  4I3M A;  1QLE C;  1FFH A;  4K1O A;  4E7S A;  2NSF A;  1CGM E;  4CDV A;  3ZTZ A;  1I4Z A;  5AC5 A;  5L0D A;  4OIR F;  2C03 A;  4F4B A;  1CPQ A;  4KBL A;  1NFO A;  1MMN A;  1YYJ A;  4YL1 A;  3KPH A;  5T1D B;  4XLN F;  3UMI A;  1Z63 A;  4PJN A;  3QMK A;  3V7O A;  1DOV A;  3CZ6 A;  2R7S A;  2EIM C;  4XTK A;  3UR3 C;  2XLM A;  2G62 A;  5BUO A;  1Y6D A;  2YWA A;  3K33 A;  1LIH A;  3FDQ A;  2ZXW C;  2IXN A;  1LM3 B;  1ZW2 A;  2QUP A;  5A69 A;  5D91 A;  3V5Z A;  2HMQ A;  5D92 A;  4MTG A;  2Y69 C;  4JJG A;  1PD1 A;  4MVQ A;  3EH1 A;  1OKK D;  2H7V C;  2XM0 A;  1PV3 A;  5B3I A;  3A11 A;  5HSW A;  1PCX A;  1JPN A;  1Q0D A;  1UFB A;  1T5O A;  4O7G A;  1OR3 A;  3EGX A;  2B0J A;  3U3B A;  3NRH A;  2HV7 A;  3FOP A;  2I15 A;  1RJ9 B;  2A68 F;  1GQA A;  2AU5 A;  1D0Z A;  1ZHZ A;  3H2U A;  3ABL C;  3QZC A;  5F5H A;  3NMJ A;  3EFO A;  1E2X A;  3ABK C;  2W9Y A;  4MS2 A;  3LLK A;  1E83 A;  3SYN A;  3O6X A;  4NC3 A;  1LS1 A;  3C8G A;  2ASR A;  4PJM A;  4C7O A;  3ZTM A;  2CYD A;  2ZXP A;  3MBG A;  4LAC B;  5JSL A;  2R03 A;  3JRT A;  4BEM J;  4CS9 C;  1LE4 A;  2NSG A;  2L6G A;  2R05 A;  2JX0 A;  4QI0 A;  1T6U A;  3HKK A;  3NMK A;  1M2O A;  3QVZ A;  1QZX A;  3ITF A;  3RQF A;  3HNJ A;  2RD9 A;  2EPO A;  4YT2 A;  1LI5 A;  1ZYR F;  1GS9 A;  2R7X A;  1O3U A;  3K6B A;  1VYI A;  1A41 A;  1ZVZ A;  1QKR A;  4NQF A;  1M2V A;  2OJE D;  4ANJ A;  2O9X A;  2YL0 A;  3KYI A;  4Z9J A;  4C3B A;  4XEK A;  3TJ6 A;  2DGJ A;  4JKV A;  3TK0 A;  4GYT A;  5DVW A;  4EUK B;  1D0Y A;  1JR8 A;  1LPE A;  1WGW A;  2KW3 C;  1U89 A;  2JPU A;  3DE9 A;  4FAP B;  3B0U X;  3GM2 A;  5F5F A;  4Q4Z F;  1ORJ A;  2CGE A;  2V26 A;  4MW8 A;  1FR0 A;  2UUH A;  4BJT A;  4U9D A;  4U5G A;  3O55 A;  4EHP A;  3S27 A;  3RIP A;  1XWJ A;  4HEA J;  2JD3 A;  4IAQ A;  2PF4 E;  3G4Z A;  3A9C A;  4RBN A;  3CSK A;  2XL6 A;  4AK9 A;  2R7T A;  2IM8 A;  5AGF A;  1ZHW A;  4AE4 B;  4U5F E;  3C63 A;  1SZI A;  1OCC C;  4D4X A;  1A7D A;  1OR2 A;  4H54 A;  5B1A C;  2J46 A;  2VC9 A;  3EG9 A;  3T6G B;  4XPX A;  2P6V A;  2NUT B;  1KTM A;  2R7R A;  2Y3B A;  2W4M A;  3W8I A;  1JOG A;  4IWB A;  1E85 A;  4HFK B;  3S9O A;  2XLV A;  2Q00 A;  3ASN C;  3LS0 A;  3U2L A;  4EBB A;  5DS4 A;  1VYK A;  4I44 A;  2OEV A;  1OCR C;  1EKY A;  2AWY A;  3L1M A;  3M4B A;  2WVO A;  2QTV A;  3GM1 A;  3N24 A;  2VCC A;  1MMD A;  2OOC A;  1SYQ A;  2OQM A;  1NG1 A;  1OXB A;  1OXK A;  2PFD A;  2CNW D;  2DYR C;  4BJ1 A;  2EIN C;  3KL4 A;  3C18 A;  4EWC A;  2J8W A;  4CSA C;  1G5Z A;  2YVK A;  3EGD B;  4YT4 A;  1Z23 A;  1WTY A;  5B1B C;  3TQO A;  3CQZ A;  4DRI B;  3JT1 A;  1HY5 A;  1Z5Z A;  4XLP F;  3LS1 A;  2ZPA A;  2J9W A;  4XPW A;  3FHD A;  3VF0 A;  3JSZ A;  4XPY A;  1J8Y F;  1BR4 A;  1OQC A;  4E18 A;  2A69 F;  1NLX A;  1TWC A;  4FX5 A;  4JRZ A;  4KC9 A;  3TD7 A;  4A4A A;  4CS8 C;  1I4Y A;  2A6H F;  3RYL A;  2VCB A;  3ATP A;  5BQI A;  1E84 A;  3FOO A;  1GM5 A;  1EQ1 A;  5E33 A;  2FAP B;  1HMO A;  2IYL D;  1YAU O;  2D5R B;  3L0I A;  4D4N A;  1NU9 C;  1ZHX A;  1WOL A;  3X2Q C;  1ZHT A;  5KYW A;  1SR2 A;  3AG3 C;  3TUL A;  4JJF A;  4YJW A;  1W2W A;  5DS5 A;  4J32 B;  1KU2 A;  4MVU A;  3NYJ A;  4CBE A;  1L7C A;  3UGP A;  1Q0M A;  4BJ6 C;  1HE9 A;  2QLA A;  2WZL A;  3BEH A;  3T6J A;  4G7H F;  3J06 A;  1T01 A;  3I4U A;  1U6H A;  3V5Y A;  4P9F A;  3T4R A;  3I5P A;  1Q0G A;  3Q7G A;  4JIO A;  4MQ9 F;  2MYS A;  2YQY A;  2DI3 A;  4E17 A;  1JMW A;  2B0H A;  3AJM A;  1AUE A;  3BRJ A;  2Y39 A;  3JCU Q;  3DXJ F;  5A6A A;  3K1I A;  3RF3 A;  3ABM C;  5A6B A;  3JYY A;  2J7P D;  2UUI A;  4U5H A;  1N1C A;  2Q9A A;  3MX3 A;  3ZQV A;  1NBB A;  3F47 A;  3HNI A;  3OA1 A;  4LLE A;  4JZA A;  2ETS A;  4WGZ A;  3B71 A;  4DJ9 A;  4MND A;  3C7J A;  3DWW A;  3W8H A;  3U9M A;  4AL1 A;  3IQT A;  4O6M A;  2XLD A;  1BR1 A;  3IQC A;  3GWN A;  3MLG A;  4E7Z A;  5A6J A;  1F1M A;  3C8Z A;  3IHU A;  3DM9 B;  3EH2 A;  5JP7 A;  5KYX B;  3RW0 A;  4I1O B;  1HE1 A;  2GA0 A;  3U9J A;  1EA8 A;  1WN0 A;  2IXO A;  3S90 A;  2W45 A;  1MND A;  2TMV P;  2R7U A;  1FFT C;  1OCO C;  3FAP B;  2DB4 A;  3KYJ A;  1D1C A;  4JUR I;  3HNK A;  3S29 A;  3SXZ A;  3FXH A;  1FAP B;  4MVM A;  2R7W A;  3K1H A;  2WB7 A;  4M63 A;  2J0X A;  3IPM O;  2P7V A;  2NG1 A;  2WVN A;  3AOU A;  5KYU A;  2HSQ A;  2XLW A;  3AGT A;  3M15 A;  2V3C C;  4H4K C;  2EIL C;  2R7V A;  4Z9I A;  4MVS A;  4LDR A;  4C3E A;  3SZR A;  4CIP A;  1RXQ A;  1Z6A A;  3IQ6 A;  2EPL X;  1H9G A;  4HE8 D;  5DLJ A;  1RKE A;  3AG4 C;  3M4C A;  1V4A A;  1LE2 A;  3L8J A;  3DI5 A;  3AGU A;  2P0N A;  4XEV A;  3LES A;  4CJG A;  3DJN B;  1OW6 A;  4XEF A;  1LVK A;  3ECS A;  4JCH A;  2A1D D;  1ORS C;  1YA7 O;  5JS5 A;  4KI2 A;  1I5N A;  1A7V A;  3WG7 C;  5L0J A;  3NKD A;  4JTC B;  256B A;  2ZXO A;  3U8V A;  5FCL A;  2XSE A;  4WAB A;  4WJ0 A;  4BJ5 C;  1YZC A;  2QNL A;  1A7E A;  4E0I A;  3Q6N A;  4AX2 A;  3LNR A;  3EJN A;  4LLC A;  2PP4 A;  3G4X A;  3EQL F;  4MTO A;  5DQZ A;  3KH2 A;  3SEO A;  4ULV A;  3T9O A;  3RH3 A;  1TR2 A;  4BG0 A;  2RSE B;  2LFD A;  3EHM A;  2LCH A;  2NUP B;  4J7T A;  4KNW A;  3C8G D;  4DBQ A;  4K0D A;  1YDI A;  2H8A A;  2R7O A;  2XLO A;  1FMW A;  3OWT A;  4O79 A;  5E2Q A;  3POV A;  2WVQ A;  1ZZP A;  3AG1 C;  4RD9 A;  4WGY A;  2HUJ A;  2MWQ A;  2L81 A;  2Q4F A;  1C02 A;  2YLI A;  5KYY A;  1H9T A;  5EHH A;  4EBK A;  2PBE A;  3HNL A;  2MHR A;  2DYS C;  1HMD A;  1LKX A;  3FVY A;  3GWL A;  3NYM A;  3MYI A;  2J9B A;  2YLG A;  3LEO A;  3N2Z B;  5COM A;  2ZXR A;  3H2V A;  1LS4 A;  1TFK B;  2IXM A;  3IQ5 A;  4NCQ A;  5T3T A;  4OIQ F;  2XXA A;  1TWG A;  2OCC C;  3QTH A;  4C3D A;  1QPU A;  3NYL A;  1ST6 A;  2Y3H A;  3WOD F;  2IBF A;  3Q7L A;  2Q9C A;  3U3F A;  4JC7 A;  4PFP A;  3EGX B;  3MYF A;  4DVY P;  4Q5S F;  4BEJ A;  4OD4 A;  4W8P A;  1OW8 A;  3E70 C;  3JYH A;  2L6F A;  3JRM O;  3LNM B;  4IB4 A;  1JAF A;  1RKC A;  2KSF A;  2VCA A;  3GEE A;  1VLS A;  1L3P A;  3EFO B;  3GM3 A;  1M57 C;  2XLH A;  3CAX A;  4L6R A;  4P6I C;  4DOZ A;  4OIN F;  5L3Q A;  3KKB A;  3ZVR A;  3GEI A;  3C8G B;  3DJU B;  4C7O B;  1YA9 A;  2OG2 A;  3RKO F;  2LP4 A;  3S84 A;  2OKU A;  3B9Q A;  3RFY A;  3WAQ A;  5COG A;  3O39 A;  1E86 A;  2FFH A;  1M56 C;  2F22 A;  5JT4 A;  3W4Y A;  4YL0 A;  3U2M A;  2XS1 A;  3HJC A;  4FWV A;  2EPM X;  2YL3 A;  5DS6 A;  1SF8 A;  4CDY A;  2G3K A;  1VB5 A;  2QY9 A;  4MW3 A;  1RJ9 A;  1T6Q A;  1C03 A;  2PNO A;  3MFN A;  3ZDL A;  3RVY A;  3F46 A;  1M2V B;  1YYX A;  3U8P A;  1ZU5 A;  1M6T A;  4J7Y A;  5E3A A;  4CS8 A;  3DKA A;  2OJQ A;  2W4B A;  1R5I D;  1LI7 A;  4I1M A;  2QE9 A;  4KNV A;  1B68 A;  4MTF A;  4N06 A;  4A2N B;  2Y3D A;  1S05 A;  2VH3 A;  2Q7R A;  2G3V A;  4U5C E;  3UMH A;  3ZWI A;  1MNE A;  1QVX A;  2CDQ A;  3NKE A;  2J7P A;  3TOM A;  4YWQ A;  1UG7 A;  2P61 A;  2A0U A;  1QQ3 A;  2WZG A;  1QSP A;  2Q9B A;  1Z7Q c;  2LFF A;  5JLI A;  3I5Q A;  4BJ6 A;  3G50 A;  3B0V C;  4HFF B;  5HV9 A;  4YT5 A;  4QI2 A;  4X0R A;  1CGN A;  1Q0F A;  2ICW G;  1T6I A;  3FMS A;  3IEE A;  5JUA A;  1D0X A;  1MMG A;  2CW0 F;  1C17 M;  2OEX A;  3Q6M A;  2HMZ A;  5FZT A;  4NTA A;  2KQ9 A;  1G4W R;  4G78 A;  4IJJ A;  4Z9H A;  3EG9 B;  5K0I A;  3LEV A;  1YZA A;  3US6 A;  1OKK A;  3N0T A;  3QVY A;  1GGQ A;  3GOD A;  3PMR A;  5COF A;  4CS9 A;  2VAS A;  4O6Y A;  5JVE A;  1Z3I X;  1U0B B;  4U9E A;  4N6H A;  3R7C A;  3L8I A;  3SXY A;  2BC5 A;  3K66 A;  4DRH B;  2C04 A;  1WAT A;  3ZG1 A;  2KC3 A;  4FES A;  1VK5 A;  3GOR A;  3L34 A;  1G4U S;  2R25 A;  4J30 B;  4AE4 A;  4YT8 A;  3S0X A;  3DMD A;  5A6B D;  3U5S A;  1Q0K A;  3R2P A;  4IGG A;  3O10 A;  2NPU A;  4OD5 A;  2NUT A;  4DBR A;  3HTK C;  3QW1 A;  2J0W A;  3DM5 A;  3DE8 A;  4R32 A;  3TOL A;  3B0P A;  2BE5 F;  4U5D E;  4JVS A;  4BPM A;  5BQH A;  4CIH A;  2XL4 A;  3H65 A;  5L0C A;  2OU6 A;  1MQV A;  1NSG B;  2YKZ A;  3PCV A;  2J45 A;  2IXP A;  4JE9 A;  4Q7C A;  5DQT A;  5GPG B;  4G7O F;  1APC A;  4QDL A;  1BDJ B;  1BBH A;  4JEA A;  3B29 A;  2XL8 A;  4IAO A;  5L0G A;  1D1B A;  3PHF 2;  1RCP A;  5KYW B;  1IZM A;  4MVR A;  3LUT B;  5EK0 A;  3UNG C;  2L6H A;  2R9R B;  1IW7 F;  1TWA A;  3EGD A;  3NG1 A;  4PAC A;  2EIJ C;  4ZLD A;  2EPN A;  3FAJ A;  4JCZ A;  4LDK A;  2HFI A;  2LSE A;  2YEV A;  1BZ4 A;  1EI7 A;  3DZA A;  4CS7 A;  4CX9 A;  4ER9 A;  4CDA A;  4DXW A;  5IY5 C;  2Q3T A;  1XZP A;  3SP1 A;  2KJG A;  2KNH A;  5E3C A;  2YLD A;  4UDV A;  2P1A A;  4XWJ A;  1K40 A;  1S7Z A;  1YVI A;  1O87 A;  3VAY A;  4JW1 A;  5EGY A;  5L0I A;  4W8K A;  2YL1 A;  4BJ5 A;  3PDM P;  4XQ1 A;  1TKN A;  2WL8 A;  4EIY A;  3UMK A;  2YHS A;  4G0H A;  1HW1 A;  2D4U A;  3EPV A;  3GEH A;  3E9V A;  4AL0 A;  2J9V A;  3EZI A;  2YZS A;  1K04 A;  4IAR A;  3EHN A;  4DRJ B;  4U5B E;  4YK5 A;  1SMY F;  2VB6 A;  1BR2 A;  1D1A A;  3W2W A;  5F28 E;  3NDB B;  3DAG A;  4PK4 A;  4YN0 B;  5KYN A;  5CI8 A;  2E87 A;  2A0B A;  4JTD B;  4NTF A;  3AG2 C;  3ASO C;  3GAN A;  2BL2 A;  4PR9 A;  4DVZ A;  3AQC A;  5CIV A;  1FNT c;  2R7Q A;  4OIP F;  3AQB A;  1VLT A; 
#chains in the Genus database with same CATH homology
 3ZC4 A;  2CNW A;  4ZLC A;  1NU7 D;  2Z15 A;  3LAY A;  1NZE A;  5KYU B;  3HLZ A;  3SNH A;  5L3V A;  3M1C B;  3OEO A;  2FGY A;  2M4E A;  5KYX A;  2GFH A;  2IOQ A;  2X51 A;  5CI9 A;  4PJJ A;  2Y3G A;  1V54 C;  1FTS A;  4LER A;  2H7O A;  2PX3 A;  3VYW A;  2KGO A;  4CSA A;  1VMA A;  2J9U A;  1O5H A;  4OIO F;  3DD7 A;  3KMI A;  4GEH A;  1V55 C;  3W2V A;  4Q5S F;  4G7Z F;  4K7B A;  4B6I A;  1TWH A;  2EIK C;  2L9J A;  4PFO A;  4IRU A;  4ULW A;  2I8B A;  3ZSU A;  3ZIB A;  4PJL A;  1FMV A;  3K7D A;  2PX0 A;  1G8X A;  3T6B A;  4RDA A;  3LLI A;  5T3W A;  4NY3 A;  5KYY B;  1OCZ C;  3K1I C;  2HV6 A;  2WZF A;  1JPJ A;  3EZH A;  2H7B A;  3S28 A;  4U5E E;  3LJB A;  2XRH A;  4O6N A;  3UGO A;  1PD0 A;  5B3S C;  3X1O A;  2XXA B;  2NUP A;  1MMA A;  3DAF A;  1J8M F;  1VOM A;  2A6E F;  1ZHY A;  1ZU4 A;  4I3M A;  4E7S A;  1QLE C;  1FFH A;  4OIR F;  2C03 A;  4KBL A;  5T1D B;  1MMN A;  3UMI A;  4XLN F;  1Z63 A;  4PJN A;  3QMK A;  3V7O A;  3CZ6 A;  2R7S A;  2EIM C;  4XTK A;  3UR3 C;  2G62 A;  5BUO A;  3K33 A;  3FDQ A;  2ZXW C;  2IXN A;  5D91 A;  5D92 A;  2Y69 C;  4JJG A;  1PD1 A;  3EH1 A;  1OKK D;  2H7V C;  5HSW A;  1PCX A;  1JPN A;  4O7G A;  3EGX A;  2B0J A;  3NRH A;  2HV7 A;  3UMH A;  3QZC A;  1RJ9 B;  2A68 F;  5F5H A;  1D0Z A;  1ZHZ A;  3ABL C;  3EFO A;  3ABK C;  2W9Y A;  3LLK A;  3SYN A;  3O6X A;  1LS1 A;  4PJM A;  4C7O A;  2ZXP A;  4LAC B;  3JRT A;  4QI0 A;  1M2O A;  1QZX A;  3ITF A;  4YT2 A;  1ZYR F;  2R7X A;  3K6B A;  1VYI A;  1M2V A;  4ANJ A;  2O9X A;  4C3B A;  2DGJ A;  4GYT A;  5DVW A;  1D0Y A;  1WGW A;  2KW3 C;  3B0U X;  5F5F A;  4Q4Z F;  2V26 A;  2CGE A;  4BJT A;  4U5G A;  3S27 A;  3RIP A;  4HEA J;  2JD3 A;  2PF4 E;  4RBN A;  3CSK A;  4AK9 A;  2R7T A;  1ZHW A;  4AE4 B;  4U5F E;  1SZI A;  1OCC C;  5B1A C;  2J46 A;  3EG9 A;  2P6V A;  2NUT B;  2R7R A;  2Y3B A;  2W4M A;  3W8I A;  4IWB A;  4HFK B;  3ASN C;  3LS0 A;  4EBB A;  5DS4 A;  1VYK A;  4I44 A;  1OCR C;  2WVO A;  2QTV A;  3N24 A;  1MMD A;  1NG1 A;  2PFD A;  2CNW D;  2DYR C;  4BJ1 A;  2EIN C;  3KL4 A;  4EWC A;  3EGD B;  4YT4 A;  1Z23 A;  5B1B C;  3CQZ A;  1Z5Z A;  4XLP F;  3LS1 A;  2ZPA A;  2J9W A;  3FHD A;  3JSZ A;  1J8Y F;  1BR4 A;  2A69 F;  4FX5 A;  1TWC A;  4KC9 A;  3TD7 A;  4CS8 C;  2A6H F;  3RYL A;  5E33 A;  2IYL D;  2D5R B;  3L0I A;  1NU9 C;  1ZHX A;  3X2Q C;  5KYW A;  1ZHT A;  3AG3 C;  4JJF A;  4YJW A;  1W2W A;  5DS5 A;  4J32 B;  1KU2 A;  4CBE A;  3NYJ A;  3UGP A;  4BJ6 C;  2WZL A;  3T6J A;  4G7H F;  3I4U A;  3T4R A;  3I5P A;  3Q7G A;  4MQ9 F;  2MYS A;  3JCU Q;  2Y39 A;  3DXJ F;  3ABM C;  2J7P D;  4U5H A;  1N1C A;  2Q9A A;  3MX3 A;  4CS9 C;  3F47 A;  3OA1 A;  4LLE A;  4JZA A;  4MND A;  3W8H A;  4O6M A;  1BR1 A;  3MLG A;  4E7Z A;  3DM9 B;  3EH2 A;  5KYX B;  4I1O B;  2IXO A;  2W45 A;  1MND A;  2R7U A;  1FFT C;  1OCO C;  4JUR I;  4F4B A;  3S29 A;  1D1C A;  2R7W A;  3K1H A;  2WB7 A;  4M63 A;  2J0X A;  2P7V A;  2NG1 A;  2WVN A;  5KYU A;  2V3C C;  4H4K C;  2EIL C;  2R7V A;  4C3E A;  3SZR A;  1Z6A A;  4HE8 D;  5DLJ A;  3AG4 C;  3LES A;  3DJN B;  1LVK A;  3ECS A;  4JCH A;  2A1D D;  4KI2 A;  3WG7 C;  3NKD A;  2ZXO A;  5FCL A;  2XSE A;  4WJ0 A;  4BJ5 C;  3Q6N A;  4AX2 A;  3LNR A;  3EJN A;  4LLC A;  2PP4 A;  3EQL F;  5DQZ A;  3KH2 A;  3SEO A;  3RH3 A;  1TR2 A;  4BG0 A;  3EHM A;  4DBQ A;  2NUP B;  4KNW A;  4K0D A;  2R7O A;  1FMW A;  3OWT A;  4O79 A;  5E2Q A;  2WVQ A;  3AG1 C;  4RD9 A;  2MWQ A;  2L81 A;  5KYY A;  5EHH A;  2DYS C;  1LKX A;  3FVY A;  3NYM A;  3N2Z B;  2ZXR A;  2IXM A;  4OIQ F;  5T3T A;  2XXA A;  1TWG A;  2OCC C;  4C3D A;  3NYL A;  1ST6 A;  2Y3H A;  3WOD F;  3Q7L A;  2Q9C A;  4PFP A;  3EGX B;  4DVY P;  4BEJ A;  4OD4 A;  3E70 C;  3JYH A;  4CSA C;  3JT1 A;  3POV A;  4P6I C;  3EFO B;  4DOZ A;  1M57 C;  4OIN F;  5L3Q A;  3KKB A;  3ZVR A;  3DJU B;  4C7O B;  2OG2 A;  3RKO F;  3B9Q A;  3RFY A;  3O39 A;  2FFH A;  1M56 C;  3HJC A;  4FWV A;  5DS6 A;  1SF8 A;  2G3K A;  2QY9 A;  1RJ9 A;  3F46 A;  1M2V B;  1ZU5 A;  5E3A A;  4CS8 A;  2W4B A;  4I1M A;  4KNV A;  4N06 A;  4A2N B;  2Y3D A;  2VH3 A;  2G3V A;  4U5C E;  1MNE A;  2CDQ A;  3NKE A;  2J7P A;  4YWQ A;  2WZG A;  2Q9B A;  3I5Q A;  4BJ6 A;  3B0V C;  4HFF B;  4YT5 A;  4QI2 A;  4X0R A;  3IEE A;  1D0X A;  1MMG A;  2CW0 F;  3Q6M A;  2KQ9 A;  4IJJ A;  3EG9 B;  3LEV A;  1OKK A;  3N0T A;  4CS9 A;  3GOD A;  3PMR A;  2VAS A;  4O6Y A;  1Z3I X;  3K66 A;  2C04 A;  3ZG1 A;  4FES A;  1VK5 A;  3L34 A;  4J30 B;  4YT8 A;  3S0X A;  4AE4 A;  3DMD A;  4OD5 A;  2NUT A;  4DBR A;  3HTK C;  2J0W A;  3DM5 A;  3B0P A;  2BE5 F;  4U5D E;  4JVS A;  4CIH A;  2XL4 A;  3H65 A;  4Q7C A;  5DQT A;  4G7O F;  2J45 A;  2IXP A;  4QDL A;  4IAO A;  1D1B A;  3PHF 2;  5KYW B;  1IZM A;  3UNG C;  1IW7 F;  1TWA A;  3EGD A;  3NG1 A;  4ZLD A;  2EIJ C;  3FAJ A;  2LSE A;  2YEV A;  3DZA A;  4CS7 A;  5IY5 C;  2Q3T A;  3SP1 A;  2KJG A;  2KNH A;  5E3C A;  4XWJ A;  1S7Z A;  1O87 A;  3VAY A;  4JW1 A;  5EGY A;  4W8K A;  4BJ5 A;  1TKN A;  2WL8 A;  3UMK A;  2YHS A;  4G0H A;  3EPV A;  3E9V A;  2J9V A;  3EZI A;  2YZS A;  3EHN A;  4U5B E;  1SMY F;  2VB6 A;  1D1A A;  1BR2 A;  3W2W A;  3NDB B;  3DAG A;  4PK4 A;  4YN0 B;  5KYN A;  5CI8 A;  2E87 A;  3AG2 C;  3ASO C;  3GAN A;  4DVZ A;  3AQC A;  4OIP F;  2R7Q A;  3AQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...