3FDQA

Recognition of at-rich dna binding sites by the mogr repressor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein/dna
molecule keywords Motility gene repressor mogR
total genus 50
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12181 MogR_DNAbind DNA binding domain of the motility gene repressor (MogR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1030 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fdqA01
3FDQA
chains in the Genus database with same CATH superfamily
4JEAA 5JSLA 5JLIA 1Z5ZA 5COFA 5DS5A 3RH3A 4MVUA 4CSAA 1OQCA 3R2PA 3I5QA 3E9VA 1Q0MA 4LDKA 3ZDLA 3ZWIA 3EZHA 5L0GA 2OOCA 5D91A 3NRHA 1KNYA 3EGXB 1BDJB 3U3FA 3LS1A 2IXMA 1HMDA 2VB6A 1C02A 1O87A 3U3BA 1T6IA 4WGYA 3FAPB 3AGTA 1RJ9B 4Z9IA 3EZIA 2VCBA 4YL0A 3RKOF 5EGYA 4O6NA 3A9CA 5KYXA 2A69F 4GEHA 3EG9B 4XLNF 5T3WA 1LVKA 2NPUA 1JMWA 2Z15A 2MHRA 4HE8D 4IB4A 2KGOA 4U5CE 4AK9A 4CIHA 1RJ9A 3G50A 1OXBA 2A68F 1CPQA 1JOGA 2CCYA 2ETSA 2Q9AA 3MX3A 3RQFA 2YL1A 2Q4FA 3K66A 3LNMB 3O39A 5T3TA 4JE9A 4I3MA 1OCRC 4Z9JA 1ZHZA 2YLDA 5T1DB 4O7GA 3UMIA 3W8IA 2YWAA 4C7OA 1WWPA 1OW6A 3GORA 5JT4A 1H7IA 1HE1A 2ZXRA 3IEEA 4J7YA 3EGDB 3V5YA 3LAYA 1ZHXA 1BR1A 3US6A 4NTFA 3WODF 3H2VA 5DS4A 2IBFA 3DAFA 1B68A 4ER9A 1UG7A 2H7BA 3SZRA 1FMVA 1NFOA 5JP7A 4MVRA 4CJOA 1AEPA 5K0IA 1E85A 1VLSA 1FTSA 1EA8A 2R7WA 1Z3IX 3EG9A 1D1AA 4K1OA 4GQHA 1SF8A 4HFKB 5L0CA 5BUOA 1VMAA 4MS2A 4PR9A 3DD7A 4H4KC 3MLGA 1LE4A 2OQMA 3DE8A 4JCZA 5D92A 4CDVA 4YT2A 4O79A 3DMDA 3ITFA 2DB4A 5E2QA 2L6FA 4JJFA 2IM8A 1OCZC 5DQTA 3EHMA 4B6IA 1Q0DA 2C04A 1G4US 5DS6A 3VF0A 4EUKB 2YLIA 1TKNA 1K05A 3ZSUA 4IARA 4I44A 3JSEO 4MVZA 2UUIA 2J45A 5HSWA 1Z63A 1TQGA 1WASA 1W2WA 1WATA 1MMNA 3JRMO 2W4BA 2X0CA 4HFFB 5L0JA 3O10A 1FMWA 4OD5A 5A6AA 1YA7O 1QPUA 4X0RA 3B0PA 4RDAA 1G5ZA 4G78A 3B0VC 2KYHA 1A0BA 1C03A 2IXOA 3X1OA 4EKWA 4G7OF 1RCPA 3QTHA 4OIQF 1MQVA 2OU6A 2H7OA 3L8JA 3ZTMA 1I5NA 3QW1A 5F5HA 3DI5A 2L6HA 3Q6MA 4U9DA 1MMGA 4Q4ZF 4P9FA 5L0FA 1VOMA 1NFNA 2RD9A 4R32A 5KYXB 3N0TA 2NUPA 1J8YF 1TWHA 3GEHA 5E33A 3UNGC 2HKVA 4CS9A 1VTMP 4BJ5C 3V7OA 1QVXA 2EINC 1RXQA 3LLIA 5E3AA 3SYNA 2QNLA 2XM4A 4CX9A 4LLEA 4O6YA 4PFOA 4BPMA 4DVYP 5DLJA 3HNKA 4XQ1A 3U8PA 2XRHA 3GWNA 3SEOA 3NYLA 3S0XA 4DRHB 4G7ZF 1OKKD 1JPNA 1CGNA 2HSBA 3B29A 4BEJA 2X51A 3SXMA 4LACB 3RQEA 3GEEA 4MVQA 2OEXA 2PNOA 2XLOA 2LQGA 5BQGA 4MTGA 1L7CA 2GAQA 3CEXA 3ASOC 2KNHA 3S9OA 4XEVA 3C8GB 2H7VC 3NMKA 3RQGA 2D4UA 2KSFA 3IPMO 4MW8A 2V26A 4U5GA 3C8ZA 1OW7A 3EH1A 5JUAA 2YQYA 3QMKA 1R5ID 3IQTA 2BC5A 5EHHA 3K1HA 2DYRC 1NZEA 4NC3A 3NG1A 5CI9A 1O5HA 4C3DA 3HNIA 2HJMA 4N6HA 1RKEA 1TFOB 1YVIA 2W9YA 4FAPB 4FX5A 3CSKA 1LPEA 2XS1A 3MYFA 4FWVA 2QE9A 4K0DA 4XPWA 3SP1A 4CDAA 1QSPA 2HFIA 3TJ6A 3ZQYA 4ULVA 4C3EA 3ASNC 4CJGA 1GM5A 4EHPA 4HEAJ 3MYIA 1BBHA 2FFHA 2MWQA 1O3UA 3EH2A 3W2VA 3K1IA 3KH2A 4PJNA 4DOZA 2DYSC 2L7AA 3C18A 2ASRA 2Y3DA 3QZCA 1OCOC 3GM1A 3T6JA 3TOLA 5FCLA 2Q9CA 1TR2A 1WN0A 2EPLX 3U2MA 4BJ6A 1I4YA 2XL6A 4XWJA 2OJQA 3KYIA 3IQCA 1KTMA 3PCVA 3T6GB 3JRTA 1V54C 1D1CA 2AP3A 3NKDA 3RF3A 5DVWA 5BQIA 2GFHA 3F47A 3PHF2 4DBRA 3AG3C 2WVOA 2EPKX 5A6BD 1TFKB 1A41A 1T5OA 5E3CA 5A6KA 3BRJA 1E2XA 1SMYF 3C8GD 3Q7LA 1RMVA 3DAGA 3GM3A 2CDQA 4E0IA 2YLGA 1D0XA 3CZ6A 3IQ6A 1CPRA 2ICWG 1K40A 4G7HF 2J7PD 3GEIA 4NY3A 1Z6AA 1HW2A 2BL2A 4D4XA 1MMAA 1APCA 3U9JA 5KYNA 1JAFA 2WZLA 3PDMP 2J0XA 5KYYA 3ZIBA 1KU2A 4JURI 1ZW3A 1FFHA 2ZXOA 4L6RA 2PX3A 1IZMA 2VCAA 3HTKC 3MBGA 4EWCA 1JRAA 4JIOA 1DOWA 3TD7A 1F1MA 3OWTA 4OIOF 1NU7D 3HNJA 3HKKA 2MYSA 4ULWA 2GA0A 4D4NA 4PACA 2J9VA 2Y3HA 2R7TA 1AVOB 4IJJA 2LIGA 3AG1C 2EIKC 2M4EA 2WZGA 3B71A 4W8KA 3V5ZA 3G4ZA 3KMIA 4MW3A 1EI7A 2XXAB 3EFOB 4EBJA 4ONSA 5BQHA 1OCCC 1WOLA 4MVMA 2FGYA 2LFDA 3HJCA 1TWGA 1D0YA 4XPYA 1YLMA 3A11A 1Q0FA 2P1AA 2Y3GA 3HLZA 1ZHWA 4YT8A 1U89A 2BE5F 1RKEB 3KKBA 1A7DA 1OR2A 3VAYA 1YJGA 4QI0A 4MNDA 5CIVA 3N2ZB 2J9UA 4YL1A 3SXKA 5B3SC 1SZIA 2R02A 3LJBA 1NG1A 1LKXA 5B3IA 4E18A 1HW1A 3U0CA 4DBQA 2A1DD 3JTLO 3JZ0A 2QLAA 4IGGA 3L34A 1EQ1A 1I4ZA 3I5PA 3JSZA 1YDIA 3DXJF 2QUPA 4JRZA 1WTYA 2CYDA 2DGJA 2NUTA 3C8GA 2JX0A 3M79A 4Z9HA 2M64A 2L9JA 2AU5A 2TMVP 2IXNA 5COGA 2IXPA 4G0HA 1IW7F 4C3BA 1TWAA 4KNVA 2G62A 2LK4A 1ZU5A 2XSEA 2EIMC 2XLMA 2Y3BA 2QTVA 4IAOA 1LI5A 2LFFA 2YVKA 3GM2A 2R05A 3U5SA 2R7UA 4EBKA 4JTDB 2XL8A 4JJGA 2P6VA 1UFBA 3IQ5A 1Q0KA 3GWLA 3ABKC 1ZU4A 2ZPAA 1MMDA 1M2VB 4MTOA 3DM5A 4A4AA 2R9RB 3EJNA 4LDRA 5JVEA 3UGPA 2GWWA 4JTAB 2Y39A 3TQOA 1E83A 4QDLA 3BEHA 3ECSA 3EGXA 4PFPA 3S28A 2O9XA 5KYWB 1ZYRF 2GDCA 1S05A 2EPOA 3QW0A 2LCHA 2EILC 3C63A 1EKYA 3AQCA 1AUEA 1ORYA 1QLEC 1RKCA 2P0NA 4E17A 2WL8A 5TJ5E 1V55C 4JZAA 1LIHA 2HV7A 2NUTB 3NKEA 4CIPA 4CS8C 4FESA 1V74B 3ZG1A 5F5FA 4K7BA 2R03A 2R7RA 4MQ9F 4MVOA 2YL0A 1GQAA 1U6HA 2AWYA 2I15A 1M6TA 2ZXWC 1E84A 2KW3C 3CQZA 3QVYA 4N4WA 3AG2C 5A6BA 2DI3A 4OD4A 2VASA 2VC9A 3RFYA 4XLPF 4C7OB 3F46A 4CS9C 4P9TA 2XLWA 2HZ8A 2P7VA 3O55A 1D0ZA 3J06A 1M56C 4N06A 3H65A 3K33A 2YRFA 2WB7A 3S29A 3UMHA 4QI2A 3HNLA 4NTBA 3JYHA 4DRJB 2OG2A 4H54A 4YL3A 4DXWA 4EBBA 1LS4A 4I1MA 2PX0A 2PFDA 3FAJA 3JCUQ 3JYYA 5KYWA 4KBLA 4CSAC 1YARO 4BG0A 3DJNB 4BJTA 3S90A 1H9TA 1DOVA 3DM9B 3ATPA 2YEVA 4JCHA 4WGZA 2XLHA 1QQ3A 2H8AA 3UR3C 4M63A 1LS1A 4PJLA 3DE9A 2I8BA 2Q00A 3DWWA 1G8XA 4YJWA 3M1CB 4PK4A 3TK0A 4AL1A 1YAUO 2HSQA 3VRCA 4DJ9A 1QKRA 1ZW2A 2AVKA 4E0HA 3NDBB 2YKZA 4P6IC 2CW0F 3M4BA 3LEOA 2WVQA 4AE4A 3B0UX 3EQLF 2EPMX 1BZ4A 3ZC4A 2J9BA 1H9GA 2XLDA 2A0UA 2Q9BA 4LERA 3WAQA 4U5DE 3TULA 4AL0A 1V4AA 1BR2A 1T01A 2OEVA 3AGUA 3CAXA 4U5HA 4LDQA 5L3VA 3AJMA 4J32B 3NYMA 4MTFA 3TJ5A 1Z7Qc 1GGQA 3B9QA 1XZQA 2HV6A 1MNEA 2B0JA 4F4BA 1ORSC 2CNWD 1SR2A 2B0HA 1PD1A 2IOQA 4U9EA 2AWCA 1HY5A 1JR8A 1OXKA 5IY5C 2XM0A 4A2NB 1G4WR 1OW8A 2R7QA 4IWBA 3X2QC 3WHNA 5AC5A 1M2VA 2C03A 3DKAA 3AG4C 2PBEA 3NMIA 3AQBA 3Q7GA 1NU9C 4MVSA 4U5EE 3T9OA 1PCXA 2OJED 2A6EF 1M2OA 1S7ZA 3GANA 1A7VA 3U2LA 4BJ6C 1BR4A 1U0BB 4JTCB 2QY9A 1Y4CA 2J8WA 3DZAA 4JVSA 3FVYA 5CI8A 3IHUA 5A6JA 1L3PA 1T6QA 1YZAA 2KC3A 2WZFA 3EFOA 5AGFA 1K04A 2XXAA 4JC7A 2LP4A 1QZXA 3KYJA 1FNTc 3RW0A 4UDVA 4OINF 4GYTA 4CBEA 3LS0A 5L3QA 3RVZA 3S84A 3H2UA 2NG1A 3PMRA 2HUJA 2YHSA 4U5FE 4YWQA 1OR3A 3N24A 3QVZA 5AC4A 1ZVZA 3K7DA 2CGEA 3RIPA 2CNWA 5B1AC 3KL4A 3AOUA 1LE2A 3RYLA 4XTKA 3W4YA 2R7VA 5KYYB 2PP4A 1PV3A 2G3KA 3EHNA 3EGDA 3I4UA 2P61A 3L0IA 1LM3B 4PJMA 4LLCA 2LD6A 1ZHTA 4JW1A 4XEKA 2J7PA 2YL7A 4CS7A 3L8IA 5JRAA 2R25A 4XEFA 1VLTA 1HE9A 4AX2A 4NCQA 2LSEA 3UMKA 4IAQA 3Q6NA 1C17M 1YYJA 4NQFA 3ZQVA 1OKKA 3DJUB 3TOMA 4RD9A 1ZZPA 5B1BC 1VYKA 3MFNA 5COMA 1TWCA 3G4XA 5F28E 3WG7C 2R7SA 1XWJA 4E7SA 1Q0GA 1D1BA 4DRIB 2NSFA 3NYJA 2HS5A 4OIPF 2OKUA 1J8MF 2W45A 256BA 1VB5A 2L81A 2EIJC 1VK5A 1NSGB 2OCCC 2YZSA 3JT1A 4KI2A 2NUPB 2J46A 1MNDA 3U9MA 5HV9A 4EIYA 1Y6DA 2IYLD 3FOOA 4RBNA 4BJ5A 1YZCA 4KC9A 1YYXA 2EPNA 4YN0B 3VM6A 1A7EA 1VYIA 3FOPA 5L0IA 1CGME 4OIRF 1GS9A 2VH3A 2HMQA 2KK1A 4KNWA 4Q7CA 4E7ZA 4ZLCA 2E87A 3KPHA 2XL4A 5KYUA 1H6GA 2L6GA 1FAPB 2YL3A 2WVNA 3K6BA 3POVA 4JEBA 4YT4A 3ZVRA 2HJ3A 3C7JA 2JPUA 5DQZA 4U5BE 3FHDA 1ST6A 4W8PA 1R4TA 4WABA 1LI7A 3R7CA 5KYUB 2HMZA 2KQ9A 2A0BA 2RSEB 3LNRA 4YT5A 1E86A 3ABMC 1PD0A 3C62A 2VCCA 4AE4B 3O6XA 1SYQA 3S27A 3U8VA 5L0HA 1JPJA 4ZLDA 1XZPA 3OA1A 3RVYA 3FMSA 2W4MA 3EPVA 4XPXA 2KJGA 2ZXPA 2Y69C 2V3CC 3LEVA 1Z23A 2XLEA 3V5XA 2ZD9A 3T4RA 3VYWA 4ANJA 1ZHYA 1WGWA 1FFTC 1HMOA 3E70C 1ORJA 4IRUA 3OEOA 2JD3A 4J30B 5EK0A 1FR0A 5JS5A 4O6MA 2Q3TA 4YK5A 3W8HA 1YA9A 4N6CA 4CDYA 4I1OB 4CS8A 5L0DA 2D5RB 3SXYA 1CGOA 3NMJA 2J0WA 1M57C 2J9WA 3W2WA 3UGOA 2FAPB 3LLKA 3K1IC 2A6HF 2NSGA 2UUHA 3FDQA 3ABLC 2PF4E 2R7XA 1NLXA 1NBBA 2R7OA 3T6BA 1N1CA 3GODA 3L1MA 3LESA 5FZTA 3SXZA 3M4CA 4WJ0A 4BEMJ 3LUTB 5A69A 3ZTZA 1T6UA 1T9KA 3M15A 4J7TA 2XS8A 2XLVA 3SNHA 4DVZA 2G3VA 4NTAA 2Q7RA 4JKVA 5GPGB 4BJ1A 4Q5SF 3FXHA 2F22A 4PJJA
chains in the Genus database with same CATH topology
1Z5ZA 5DS5A 3RH3A 4CSAA 3I5QA 3E9VA 3EZHA 5D91A 3NRHA 3EGXB 3LS1A 2IXMA 2VB6A 1O87A 1RJ9B 3EZIA 3RKOF 5EGYA 4O6NA 5KYXA 2A69F 4GEHA 3EG9B 4XLNF 5T3WA 1LVKA 2Z15A 4HE8D 4U5CE 2KGOA 4AK9A 4CIHA 1RJ9A 2A68F 3MX3A 2Q9AA 3K66A 5T3TA 3O39A 4I3MA 1OCRC 1ZHZA 5T1DB 4O7GA 3UMIA 3W8IA 4C7OA 2ZXRA 3IEEA 3EGDB 3LAYA 1ZHXA 1BR1A 3WODF 5DS4A 3DAFA 2H7BA 3SZRA 1FMVA 1FTSA 2R7WA 1Z3IX 3EG9A 1D1AA 1SF8A 4HFKB 5BUOA 1VMAA 3DD7A 4H4KC 3MLGA 5D92A 4YT2A 4O79A 3DMDA 3ITFA 5E2QA 4JJFA 1OCZC 5DQTA 3EHMA 4B6IA 2C04A 5DS6A 1TKNA 3ZSUA 4I44A 1Z63A 2J45A 5HSWA 1W2WA 1MMNA 2W4BA 4HFFB 1FMWA 4OD5A 4X0RA 3B0PA 4RDAA 3B0VC 2IXOA 3X1OA 4G7OF 4OIQF 2H7OA 5F5HA 3Q6MA 4Q4ZF 1MMGA 1VOMA 5KYXB 3N0TA 2NUPA 1J8YF 1TWHA 5E33A 3UNGC 4CS9A 4BJ5C 3V7OA 5E3AA 2EINC 3LLIA 3SYNA 4LLEA 4O6YA 4PFOA 4DVYP 5DLJA 2XRHA 3SEOA 3NYLA 3S0XA 1OKKD 1JPNA 4BEJA 2X51A 4LACB 3ASOC 2KNHA 2H7VC 4U5GA 2V26A 3EH1A 3QMKA 5EHHA 3K1HA 2DYRC 1NZEA 3NG1A 5CI9A 1O5HA 4C3DA 4G7ZF 2W9YA 4FX5A 3CSKA 4FWVA 3SP1A 4K0DA 4C3EA 3ASNC 4HEAJ 2FFHA 2MWQA 3EH2A 3W2VA 3KH2A 4PJNA 4DOZA 3QZCA 2DYSC 3T6JA 2Y3DA 1OCOC 5FCLA 2Q9CA 1TR2A 4BJ6A 4XWJA 3JRTA 1V54C 1D1CA 3NKDA 3PHF2 5DVWA 2GFHA 3F47A 4DBRA 3AG3C 2WVOA 5E3CA 1SMYF 3Q7LA 3DAGA 2CDQA 1D0XA 3CZ6A 4G7HF 2J7PD 4NY3A 1Z6AA 1MMAA 5KYNA 2WZLA 2J0XA 5KYYA 3ZIBA 1KU2A 4JURI 1FFHA 2ZXOA 2PX3A 1IZMA 3HTKC 4EWCA 3TD7A 4OIOF 3OWTA 1NU7D 2MYSA 4ULWA 2J9VA 2Y3HA 2R7TA 4IJJA 3AG1C 2EIKC 2M4EA 2WZGA 4W8KA 3KMIA 2XXAB 3EFOB 1OCCC 2FGYA 3HJCA 1TWGA 1D0YA 2Y3GA 3HLZA 1ZHWA 4YT8A 2BE5F 3KKBA 3VAYA 4QI0A 4MNDA 3N2ZB 2J9UA 5B3SC 1SZIA 3LJBA 1NG1A 1LKXA 4DBQA 2A1DD 3L34A 3I5PA 3JSZA 3DXJF 2NUTA 2DGJA 2L9JA 2IXNA 2IXPA 4G0HA 1IW7F 4C3BA 1TWAA 4KNVA 2G62A 1ZU5A 2XSEA 2EIMC 2Y3BA 2QTVA 4IAOA 2R7UA 4JJGA 2P6VA 3ABKC 1ZU4A 2ZPAA 1MMDA 1M2VB 3DM5A 3EJNA 3UGPA 2Y39A 4QDLA 3S28A 3ECSA 3EGXA 4PFPA 2O9XA 5KYWB 1ZYRF 2EILC 3AQCA 1QLEC 2WL8A 1V55C 4JZAA 2HV7A 2NUTB 3NKEA 4CS8C 4FESA 3ZG1A 5F5FA 4K7BA 2R7RA 4MQ9F 2ZXWC 2KW3C 3CQZA 3AG2C 4OD4A 2VASA 3RFYA 4XLPF 4C7OB 3F46A 4CS9C 2P7VA 1D0ZA 1M56C 4N06A 3H65A 3K33A 3S29A 2WB7A 4QI2A 3UMHA 3JYHA 2OG2A 4EBBA 4I1MA 2PX0A 2PFDA 3FAJA 3JCUQ 5KYWA 4KBLA 4CSAC 4BG0A 3DJNB 4BJTA 3DM9B 4JCHA 2YEVA 3UR3C 4M63A 1LS1A 4PJLA 2I8BA 4YJWA 1G8XA 3M1CB 4PK4A 3NDBB 4P6IC 2CW0F 4AE4A 2WVQA 3B0UX 3EQLF 3ZC4A 2Q9BA 4LERA 4U5DE 1BR2A 4U5HA 5L3VA 4J32B 3NYMA 3B9QA 2HV6A 1MNEA 2B0JA 4F4BA 2CNWD 1PD1A 2IOQA 5IY5C 4A2NB 2R7QA 4IWBA 3X2QC 1M2VA 2C03A 3AG4C 3Q7GA 3AQBA 4U5EE 1NU9C 1PCXA 2A6EF 1M2OA 1S7ZA 3GANA 4BJ6C 1BR4A 2QY9A 3DZAA 4JVSA 3FVYA 5CI8A 2WZFA 3EFOA 2XXAA 1QZXA 4OINF 4GYTA 4CBEA 3LS0A 5L3QA 3PMRA 2NG1A 2YHSA 4U5FE 4YWQA 3N24A 3K7DA 2CGEA 3RIPA 2CNWA 5B1AC 3KL4A 3RYLA 4XTKA 2R7VA 5KYYB 2PP4A 3EHNA 2G3KA 3EGDA 3I4UA 3L0IA 4PJMA 4LLCA 1ZHTA 4JW1A 4CS7A 2J7PA 4AX2A 2LSEA 3UMKA 3Q6NA 1OKKA 3DJUB 4RD9A 5B1BC 1VYKA 1TWCA 3WG7C 2R7SA 4E7SA 1D1BA 3NYJA 4OIPF 1J8MF 2W45A 2OCCC 2L81A 1VK5A 2EIJC 2YZSA 3JT1A 4KI2A 2NUPB 2J46A 1MNDA 2IYLD 4RBNA 4BJ5A 4KC9A 4YN0B 1VYIA 4OIRF 2VH3A 4KNWA 4Q7CA 4ZLCA 4E7ZA 2E87A 2XL4A 5KYUA 3POVA 2WVNA 3K6BA 4YT4A 3ZVRA 5DQZA 4U5BE 3FHDA 1ST6A 5KYUB 2KQ9A 3LNRA 4YT5A 3ABMC 1PD0A 4AE4B 3O6XA 3S27A 1JPJA 4ZLDA 3OA1A 2W4MA 3EPVA 2KJGA 2ZXPA 2Y69C 2V3CC 3LEVA 1Z23A 3T4RA 3VYWA 4ANJA 1ZHYA 1WGWA 1FFTC 3E70C 4IRUA 3OEOA 2JD3A 4J30B 4O6MA 2Q3TA 3W8HA 4CS8A 4I1OB 2D5RB 2J0WA 1M57C 2J9WA 3W2WA 3UGOA 3LLKA 3K1IC 2A6HF 3FDQA 3ABLC 2PF4E 2R7XA 2R7OA 3T6BA 1N1CA 3GODA 3LESA 4WJ0A 3SNHA 4DVZA 2G3VA 4BJ1A 4Q5SF 4PJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDQ A; 
#chains in the Genus database with same CATH topology
 4JEA A;  5JSL A;  5JLI A;  1Z5Z A;  5COF A;  5DS5 A;  3RH3 A;  4MVU A;  4CSA A;  1OQC A;  3R2P A;  3I5Q A;  3E9V A;  1Q0M A;  4LDK A;  3ZDL A;  3ZWI A;  3EZH A;  5L0G A;  2OOC A;  5D91 A;  3NRH A;  1KNY A;  3EGX B;  1BDJ B;  3U3F A;  3LS1 A;  2IXM A;  1HMD A;  2VB6 A;  1C02 A;  1O87 A;  3U3B A;  1T6I A;  4WGY A;  3FAP B;  3AGT A;  1RJ9 B;  4Z9I A;  3EZI A;  2VCB A;  4YL0 A;  3RKO F;  5EGY A;  4O6N A;  3A9C A;  5KYX A;  2A69 F;  4GEH A;  3EG9 B;  4XLN F;  5T3W A;  1LVK A;  2NPU A;  1JMW A;  2Z15 A;  2MHR A;  4HE8 D;  4IB4 A;  2KGO A;  4U5C E;  4AK9 A;  4CIH A;  1RJ9 A;  3G50 A;  1OXB A;  2A68 F;  1CPQ A;  1JOG A;  2CCY A;  2ETS A;  2Q9A A;  3MX3 A;  3RQF A;  2YL1 A;  2Q4F A;  3K66 A;  3LNM B;  3O39 A;  5T3T A;  4JE9 A;  4I3M A;  1OCR C;  4Z9J A;  1ZHZ A;  2YLD A;  5T1D B;  4O7G A;  3UMI A;  3W8I A;  2YWA A;  4C7O A;  1WWP A;  1OW6 A;  3GOR A;  5JT4 A;  1H7I A;  1HE1 A;  2ZXR A;  3IEE A;  4J7Y A;  3EGD B;  3V5Y A;  3LAY A;  1ZHX A;  1BR1 A;  3US6 A;  4NTF A;  3WOD F;  3H2V A;  5DS4 A;  2IBF A;  3DAF A;  1B68 A;  4ER9 A;  1UG7 A;  2H7B A;  3SZR A;  1FMV A;  1NFO A;  5JP7 A;  4MVR A;  4CJO A;  1AEP A;  5K0I A;  1E85 A;  1VLS A;  1FTS A;  1EA8 A;  2R7W A;  1Z3I X;  3EG9 A;  1D1A A;  4K1O A;  4GQH A;  1SF8 A;  4HFK B;  5L0C A;  5BUO A;  1VMA A;  4MS2 A;  4PR9 A;  3DD7 A;  4H4K C;  3MLG A;  1LE4 A;  2OQM A;  3DE8 A;  4JCZ A;  5D92 A;  4CDV A;  4YT2 A;  4O79 A;  3DMD A;  3ITF A;  2DB4 A;  5E2Q A;  2L6F A;  4JJF A;  2IM8 A;  1OCZ C;  5DQT A;  3EHM A;  4B6I A;  1Q0D A;  2C04 A;  1G4U S;  5DS6 A;  3VF0 A;  4EUK B;  2YLI A;  1TKN A;  1K05 A;  3ZSU A;  4IAR A;  4I44 A;  3JSE O;  4MVZ A;  2UUI A;  2J45 A;  5HSW A;  1Z63 A;  1TQG A;  1WAS A;  1W2W A;  1WAT A;  1MMN A;  3JRM O;  2W4B A;  2X0C A;  4HFF B;  5L0J A;  3O10 A;  1FMW A;  4OD5 A;  5A6A A;  1YA7 O;  1QPU A;  4X0R A;  3B0P A;  4RDA A;  1G5Z A;  4G78 A;  3B0V C;  2KYH A;  1A0B A;  1C03 A;  2IXO A;  3X1O A;  4EKW A;  4G7O F;  1RCP A;  3QTH A;  4OIQ F;  1MQV A;  2OU6 A;  2H7O A;  3L8J A;  3ZTM A;  1I5N A;  3QW1 A;  5F5H A;  3DI5 A;  2L6H A;  3Q6M A;  4U9D A;  1MMG A;  4Q4Z F;  4P9F A;  5L0F A;  1VOM A;  1NFN A;  2RD9 A;  4R32 A;  5KYX B;  3N0T A;  2NUP A;  1J8Y F;  1TWH A;  3GEH A;  5E33 A;  3UNG C;  2HKV A;  4CS9 A;  1VTM P;  4BJ5 C;  3V7O A;  1QVX A;  2EIN C;  1RXQ A;  3LLI A;  5E3A A;  3SYN A;  2QNL A;  2XM4 A;  4CX9 A;  4LLE A;  4O6Y A;  4PFO A;  4BPM A;  4DVY P;  5DLJ A;  3HNK A;  4XQ1 A;  3U8P A;  2XRH A;  3GWN A;  3SEO A;  3NYL A;  3S0X A;  4DRH B;  4G7Z F;  1OKK D;  1JPN A;  1CGN A;  2HSB A;  3B29 A;  4BEJ A;  2X51 A;  3SXM A;  4LAC B;  3RQE A;  3GEE A;  4MVQ A;  2OEX A;  2PNO A;  2XLO A;  2LQG A;  5BQG A;  4MTG A;  1L7C A;  2GAQ A;  3CEX A;  3ASO C;  2KNH A;  3S9O A;  4XEV A;  3C8G B;  2H7V C;  3NMK A;  3RQG A;  2D4U A;  2KSF A;  3IPM O;  4MW8 A;  2V26 A;  4U5G A;  3C8Z A;  1OW7 A;  3EH1 A;  5JUA A;  2YQY A;  3QMK A;  1R5I D;  3IQT A;  2BC5 A;  5EHH A;  3K1H A;  2DYR C;  1NZE A;  4NC3 A;  3NG1 A;  5CI9 A;  1O5H A;  4C3D A;  3HNI A;  2HJM A;  4N6H A;  1RKE A;  1TFO B;  1YVI A;  2W9Y A;  4FAP B;  4FX5 A;  3CSK A;  1LPE A;  2XS1 A;  3MYF A;  4FWV A;  2QE9 A;  4K0D A;  4XPW A;  3SP1 A;  4CDA A;  1QSP A;  2HFI A;  3TJ6 A;  3ZQY A;  4ULV A;  4C3E A;  3ASN C;  4CJG A;  1GM5 A;  4EHP A;  4HEA J;  3MYI A;  1BBH A;  2FFH A;  2MWQ A;  1O3U A;  3EH2 A;  3W2V A;  3K1I A;  3KH2 A;  4PJN A;  4DOZ A;  2DYS C;  2L7A A;  3C18 A;  2ASR A;  2Y3D A;  3QZC A;  1OCO C;  3GM1 A;  3T6J A;  3TOL A;  5FCL A;  2Q9C A;  1TR2 A;  1WN0 A;  2EPL X;  3U2M A;  4BJ6 A;  1I4Y A;  2XL6 A;  4XWJ A;  2OJQ A;  3KYI A;  3IQC A;  1KTM A;  3PCV A;  3T6G B;  3JRT A;  1V54 C;  1D1C A;  2AP3 A;  3NKD A;  3RF3 A;  5DVW A;  5BQI A;  2GFH A;  3F47 A;  3PHF 2;  4DBR A;  3AG3 C;  2WVO A;  2EPK X;  5A6B D;  1TFK B;  1A41 A;  1T5O A;  5E3C A;  5A6K A;  3BRJ A;  1E2X A;  1SMY F;  3C8G D;  3Q7L A;  1RMV A;  3DAG A;  3GM3 A;  2CDQ A;  4E0I A;  2YLG A;  1D0X A;  3CZ6 A;  3IQ6 A;  1CPR A;  2ICW G;  1K40 A;  4G7H F;  2J7P D;  3GEI A;  4NY3 A;  1Z6A A;  1HW2 A;  2BL2 A;  4D4X A;  1MMA A;  1APC A;  3U9J A;  5KYN A;  1JAF A;  2WZL A;  3PDM P;  2J0X A;  5KYY A;  3ZIB A;  1KU2 A;  4JUR I;  1ZW3 A;  1FFH A;  2ZXO A;  4L6R A;  2PX3 A;  1IZM A;  2VCA A;  3HTK C;  3MBG A;  4EWC A;  1JRA A;  4JIO A;  1DOW A;  3TD7 A;  1F1M A;  3OWT A;  4OIO F;  1NU7 D;  3HNJ A;  3HKK A;  2MYS A;  4ULW A;  2GA0 A;  4D4N A;  4PAC A;  2J9V A;  2Y3H A;  2R7T A;  1AVO B;  4IJJ A;  2LIG A;  3AG1 C;  2EIK C;  2M4E A;  2WZG A;  3B71 A;  4W8K A;  3V5Z A;  3G4Z A;  3KMI A;  4MW3 A;  1EI7 A;  2XXA B;  3EFO B;  4EBJ A;  4ONS A;  5BQH A;  1OCC C;  1WOL A;  4MVM A;  2FGY A;  2LFD A;  3HJC A;  1TWG A;  1D0Y A;  4XPY A;  1YLM A;  3A11 A;  1Q0F A;  2P1A A;  2Y3G A;  3HLZ A;  1ZHW A;  4YT8 A;  1U89 A;  2BE5 F;  1RKE B;  3KKB A;  1A7D A;  1OR2 A;  3VAY A;  1YJG A;  4QI0 A;  4MND A;  5CIV A;  3N2Z B;  2J9U A;  4YL1 A;  3SXK A;  5B3S C;  1SZI A;  2R02 A;  3LJB A;  1NG1 A;  1LKX A;  5B3I A;  4E18 A;  1HW1 A;  3U0C A;  4DBQ A;  2A1D D;  3JTL O;  3JZ0 A;  2QLA A;  4IGG A;  3L34 A;  1EQ1 A;  1I4Z A;  3I5P A;  3JSZ A;  1YDI A;  3DXJ F;  2QUP A;  4JRZ A;  1WTY A;  2CYD A;  2DGJ A;  2NUT A;  3C8G A;  2JX0 A;  3M79 A;  4Z9H A;  2M64 A;  2L9J A;  2AU5 A;  2TMV P;  2IXN A;  5COG A;  2IXP A;  4G0H A;  1IW7 F;  4C3B A;  1TWA A;  4KNV A;  2G62 A;  2LK4 A;  1ZU5 A;  2XSE A;  2EIM C;  2XLM A;  2Y3B A;  2QTV A;  4IAO A;  1LI5 A;  2LFF A;  2YVK A;  3GM2 A;  2R05 A;  3U5S A;  2R7U A;  4EBK A;  4JTD B;  2XL8 A;  4JJG A;  2P6V A;  1UFB A;  3IQ5 A;  1Q0K A;  3GWL A;  3ABK C;  1ZU4 A;  2ZPA A;  1MMD A;  1M2V B;  4MTO A;  3DM5 A;  4A4A A;  2R9R B;  3EJN A;  4LDR A;  5JVE A;  3UGP A;  2GWW A;  4JTA B;  2Y39 A;  3TQO A;  1E83 A;  4QDL A;  3BEH A;  3ECS A;  3EGX A;  4PFP A;  3S28 A;  2O9X A;  5KYW B;  1ZYR F;  2GDC A;  1S05 A;  2EPO A;  3QW0 A;  2LCH A;  2EIL C;  3C63 A;  1EKY A;  3AQC A;  1AUE A;  1ORY A;  1QLE C;  1RKC A;  2P0N A;  4E17 A;  2WL8 A;  5TJ5 E;  1V55 C;  4JZA A;  1LIH A;  2HV7 A;  2NUT B;  3NKE A;  4CIP A;  4CS8 C;  4FES A;  1V74 B;  3ZG1 A;  5F5F A;  4K7B A;  2R03 A;  2R7R A;  4MQ9 F;  4MVO A;  2YL0 A;  1GQA A;  1U6H A;  2AWY A;  2I15 A;  1M6T A;  2ZXW C;  1E84 A;  2KW3 C;  3CQZ A;  3QVY A;  4N4W A;  3AG2 C;  5A6B A;  2DI3 A;  4OD4 A;  2VAS A;  2VC9 A;  3RFY A;  4XLP F;  4C7O B;  3F46 A;  4CS9 C;  4P9T A;  2XLW A;  2HZ8 A;  2P7V A;  3O55 A;  1D0Z A;  3J06 A;  1M56 C;  4N06 A;  3H65 A;  3K33 A;  2YRF A;  2WB7 A;  3S29 A;  3UMH A;  4QI2 A;  3HNL A;  4NTB A;  3JYH A;  4DRJ B;  2OG2 A;  4H54 A;  4YL3 A;  4DXW A;  4EBB A;  1LS4 A;  4I1M A;  2PX0 A;  2PFD A;  3FAJ A;  3JCU Q;  3JYY A;  5KYW A;  4KBL A;  4CSA C;  1YAR O;  4BG0 A;  3DJN B;  4BJT A;  3S90 A;  1H9T A;  1DOV A;  3DM9 B;  3ATP A;  2YEV A;  4JCH A;  4WGZ A;  2XLH A;  1QQ3 A;  2H8A A;  3UR3 C;  4M63 A;  1LS1 A;  4PJL A;  3DE9 A;  2I8B A;  2Q00 A;  3DWW A;  1G8X A;  4YJW A;  3M1C B;  4PK4 A;  3TK0 A;  4AL1 A;  1YAU O;  2HSQ A;  3VRC A;  4DJ9 A;  1QKR A;  1ZW2 A;  2AVK A;  4E0H A;  3NDB B;  2YKZ A;  4P6I C;  2CW0 F;  3M4B A;  3LEO A;  2WVQ A;  4AE4 A;  3B0U X;  3EQL F;  2EPM X;  1BZ4 A;  3ZC4 A;  2J9B A;  1H9G A;  2XLD A;  2A0U A;  2Q9B A;  4LER A;  3WAQ A;  4U5D E;  3TUL A;  4AL0 A;  1V4A A;  1BR2 A;  1T01 A;  2OEV A;  3AGU A;  3CAX A;  4U5H A;  4LDQ A;  5L3V A;  3AJM A;  4J32 B;  3NYM A;  4MTF A;  3TJ5 A;  1Z7Q c;  1GGQ A;  3B9Q A;  1XZQ A;  2HV6 A;  1MNE A;  2B0J A;  4F4B A;  1ORS C;  2CNW D;  1SR2 A;  2B0H A;  1PD1 A;  2IOQ A;  4U9E A;  2AWC A;  1HY5 A;  1JR8 A;  1OXK A;  5IY5 C;  2XM0 A;  4A2N B;  1G4W R;  1OW8 A;  2R7Q A;  4IWB A;  3X2Q C;  3WHN A;  5AC5 A;  1M2V A;  2C03 A;  3DKA A;  3AG4 C;  2PBE A;  3NMI A;  3AQB A;  3Q7G A;  1NU9 C;  4MVS A;  4U5E E;  3T9O A;  1PCX A;  2OJE D;  2A6E F;  1M2O A;  1S7Z A;  3GAN A;  1A7V A;  3U2L A;  4BJ6 C;  1BR4 A;  1U0B B;  4JTC B;  2QY9 A;  1Y4C A;  2J8W A;  3DZA A;  4JVS A;  3FVY A;  5CI8 A;  3IHU A;  5A6J A;  1L3P A;  1T6Q A;  1YZA A;  2KC3 A;  2WZF A;  3EFO A;  5AGF A;  1K04 A;  2XXA A;  4JC7 A;  2LP4 A;  1QZX A;  3KYJ A;  1FNT c;  3RW0 A;  4UDV A;  4OIN F;  4GYT A;  4CBE A;  3LS0 A;  5L3Q A;  3RVZ A;  3S84 A;  3H2U A;  2NG1 A;  3PMR A;  2HUJ A;  2YHS A;  4U5F E;  4YWQ A;  1OR3 A;  3N24 A;  3QVZ A;  5AC4 A;  1ZVZ A;  3K7D A;  2CGE A;  3RIP A;  2CNW A;  5B1A C;  3KL4 A;  3AOU A;  1LE2 A;  3RYL A;  4XTK A;  3W4Y A;  2R7V A;  5KYY B;  2PP4 A;  1PV3 A;  2G3K A;  3EHN A;  3EGD A;  3I4U A;  2P61 A;  3L0I A;  1LM3 B;  4PJM A;  4LLC A;  2LD6 A;  1ZHT A;  4JW1 A;  4XEK A;  2J7P A;  2YL7 A;  4CS7 A;  3L8I A;  5JRA A;  2R25 A;  4XEF A;  1VLT A;  1HE9 A;  4AX2 A;  4NCQ A;  2LSE A;  3UMK A;  4IAQ A;  3Q6N A;  1C17 M;  1YYJ A;  4NQF A;  3ZQV A;  1OKK A;  3DJU B;  3TOM A;  4RD9 A;  1ZZP A;  5B1B C;  1VYK A;  3MFN A;  5COM A;  1TWC A;  3G4X A;  5F28 E;  3WG7 C;  2R7S A;  1XWJ A;  4E7S A;  1Q0G A;  1D1B A;  4DRI B;  2NSF A;  3NYJ A;  2HS5 A;  4OIP F;  2OKU A;  1J8M F;  2W45 A;  256B A;  1VB5 A;  2L81 A;  2EIJ C;  1VK5 A;  1NSG B;  2OCC C;  2YZS A;  3JT1 A;  4KI2 A;  2NUP B;  2J46 A;  1MND A;  3U9M A;  5HV9 A;  4EIY A;  1Y6D A;  2IYL D;  3FOO A;  4RBN A;  4BJ5 A;  1YZC A;  4KC9 A;  1YYX A;  2EPN A;  4YN0 B;  3VM6 A;  1A7E A;  1VYI A;  3FOP A;  5L0I A;  1CGM E;  4OIR F;  1GS9 A;  2VH3 A;  2HMQ A;  2KK1 A;  4KNW A;  4Q7C A;  4E7Z A;  4ZLC A;  2E87 A;  3KPH A;  2XL4 A;  5KYU A;  1H6G A;  2L6G A;  1FAP B;  2YL3 A;  2WVN A;  3K6B A;  3POV A;  4JEB A;  4YT4 A;  3ZVR A;  2HJ3 A;  3C7J A;  2JPU A;  5DQZ A;  4U5B E;  3FHD A;  1ST6 A;  4W8P A;  1R4T A;  4WAB A;  1LI7 A;  3R7C A;  5KYU B;  2HMZ A;  2KQ9 A;  2A0B A;  2RSE B;  3LNR A;  4YT5 A;  1E86 A;  3ABM C;  1PD0 A;  3C62 A;  2VCC A;  4AE4 B;  3O6X A;  1SYQ A;  3S27 A;  3U8V A;  5L0H A;  1JPJ A;  4ZLD A;  1XZP A;  3OA1 A;  3RVY A;  3FMS A;  2W4M A;  3EPV A;  4XPX A;  2KJG A;  2ZXP A;  2Y69 C;  2V3C C;  3LEV A;  1Z23 A;  2XLE A;  3V5X A;  2ZD9 A;  3T4R A;  3VYW A;  4ANJ A;  1ZHY A;  1WGW A;  1FFT C;  1HMO A;  3E70 C;  1ORJ A;  4IRU A;  3OEO A;  2JD3 A;  4J30 B;  5EK0 A;  1FR0 A;  5JS5 A;  4O6M A;  2Q3T A;  4YK5 A;  3W8H A;  1YA9 A;  4N6C A;  4CDY A;  4I1O B;  4CS8 A;  5L0D A;  2D5R B;  3SXY A;  1CGO A;  3NMJ A;  2J0W A;  1M57 C;  2J9W A;  3W2W A;  3UGO A;  2FAP B;  3LLK A;  3K1I C;  2A6H F;  2NSG A;  2UUH A;  3FDQ A;  3ABL C;  2PF4 E;  2R7X A;  1NLX A;  1NBB A;  2R7O A;  3T6B A;  1N1C A;  3GOD A;  3L1M A;  3LES A;  5FZT A;  3SXZ A;  3M4C A;  4WJ0 A;  4BEM J;  3LUT B;  5A69 A;  3ZTZ A;  1T6U A;  1T9K A;  3M15 A;  4J7T A;  2XS8 A;  2XLV A;  3SNH A;  4DVZ A;  2G3V A;  4NTA A;  2Q7R A;  4JKV A;  5GPG B;  4BJ1 A;  4Q5S F;  3FXH A;  2F22 A;  4PJJ A; 
#chains in the Genus database with same CATH homology
 1Z5Z A;  5DS5 A;  3RH3 A;  4CSA A;  3I5Q A;  3E9V A;  3EZH A;  5D91 A;  3NRH A;  3EGX B;  3LS1 A;  2IXM A;  2VB6 A;  1O87 A;  1RJ9 B;  3EZI A;  3RKO F;  5EGY A;  4O6N A;  5KYX A;  2A69 F;  4GEH A;  3EG9 B;  4XLN F;  5T3W A;  1LVK A;  2Z15 A;  4HE8 D;  4U5C E;  2KGO A;  4AK9 A;  4CIH A;  1RJ9 A;  2A68 F;  3MX3 A;  2Q9A A;  3K66 A;  5T3T A;  3O39 A;  4I3M A;  1OCR C;  1ZHZ A;  5T1D B;  4O7G A;  3UMI A;  3W8I A;  4C7O A;  2ZXR A;  3IEE A;  3EGD B;  3LAY A;  1ZHX A;  1BR1 A;  3WOD F;  5DS4 A;  3DAF A;  2H7B A;  3SZR A;  1FMV A;  1FTS A;  2R7W A;  1Z3I X;  3EG9 A;  1D1A A;  1SF8 A;  4HFK B;  5BUO A;  1VMA A;  3DD7 A;  4H4K C;  3MLG A;  5D92 A;  4YT2 A;  4O79 A;  3DMD A;  3ITF A;  5E2Q A;  4JJF A;  1OCZ C;  5DQT A;  3EHM A;  4B6I A;  2C04 A;  5DS6 A;  1TKN A;  3ZSU A;  4I44 A;  1Z63 A;  2J45 A;  5HSW A;  1W2W A;  1MMN A;  2W4B A;  4HFF B;  1FMW A;  4OD5 A;  4X0R A;  3B0P A;  4RDA A;  3B0V C;  2IXO A;  3X1O A;  4G7O F;  4OIQ F;  2H7O A;  5F5H A;  3Q6M A;  4Q4Z F;  1MMG A;  1VOM A;  5KYX B;  3N0T A;  2NUP A;  1J8Y F;  1TWH A;  5E33 A;  3UNG C;  4CS9 A;  4BJ5 C;  3V7O A;  5E3A A;  2EIN C;  3LLI A;  3SYN A;  4LLE A;  4O6Y A;  4PFO A;  4DVY P;  5DLJ A;  2XRH A;  3SEO A;  3NYL A;  3S0X A;  1OKK D;  1JPN A;  4BEJ A;  2X51 A;  4LAC B;  3ASO C;  2KNH A;  2H7V C;  4U5G A;  2V26 A;  3EH1 A;  3QMK A;  5EHH A;  3K1H A;  2DYR C;  1NZE A;  3NG1 A;  5CI9 A;  1O5H A;  4C3D A;  4G7Z F;  2W9Y A;  4FX5 A;  3CSK A;  4FWV A;  3SP1 A;  4K0D A;  4C3E A;  3ASN C;  4HEA J;  2FFH A;  2MWQ A;  3EH2 A;  3W2V A;  3KH2 A;  4PJN A;  4DOZ A;  3QZC A;  2DYS C;  3T6J A;  2Y3D A;  1OCO C;  5FCL A;  2Q9C A;  1TR2 A;  4BJ6 A;  4XWJ A;  3JRT A;  1V54 C;  1D1C A;  3NKD A;  3PHF 2;  5DVW A;  2GFH A;  3F47 A;  4DBR A;  3AG3 C;  2WVO A;  5E3C A;  1SMY F;  3Q7L A;  3DAG A;  2CDQ A;  1D0X A;  3CZ6 A;  4G7H F;  2J7P D;  4NY3 A;  1Z6A A;  1MMA A;  5KYN A;  2WZL A;  2J0X A;  5KYY A;  3ZIB A;  1KU2 A;  4JUR I;  1FFH A;  2ZXO A;  2PX3 A;  1IZM A;  3HTK C;  4EWC A;  3TD7 A;  4OIO F;  3OWT A;  1NU7 D;  2MYS A;  4ULW A;  2J9V A;  2Y3H A;  2R7T A;  4IJJ A;  3AG1 C;  2EIK C;  2M4E A;  2WZG A;  4W8K A;  3KMI A;  2XXA B;  3EFO B;  1OCC C;  2FGY A;  3HJC A;  1TWG A;  1D0Y A;  2Y3G A;  3HLZ A;  1ZHW A;  4YT8 A;  2BE5 F;  3KKB A;  3VAY A;  4QI0 A;  4MND A;  3N2Z B;  2J9U A;  5B3S C;  1SZI A;  3LJB A;  1NG1 A;  1LKX A;  4DBQ A;  2A1D D;  3L34 A;  3I5P A;  3JSZ A;  3DXJ F;  2NUT A;  2DGJ A;  2L9J A;  2IXN A;  2IXP A;  4G0H A;  1IW7 F;  4C3B A;  1TWA A;  4KNV A;  2G62 A;  1ZU5 A;  2XSE A;  2EIM C;  2Y3B A;  2QTV A;  4IAO A;  2R7U A;  4JJG A;  2P6V A;  3ABK C;  1ZU4 A;  2ZPA A;  1MMD A;  1M2V B;  3DM5 A;  3EJN A;  3UGP A;  2Y39 A;  4QDL A;  3S28 A;  3ECS A;  3EGX A;  4PFP A;  2O9X A;  5KYW B;  1ZYR F;  2EIL C;  3AQC A;  1QLE C;  2WL8 A;  1V55 C;  4JZA A;  2HV7 A;  2NUT B;  3NKE A;  4CS8 C;  4FES A;  3ZG1 A;  5F5F A;  4K7B A;  2R7R A;  4MQ9 F;  2ZXW C;  2KW3 C;  3CQZ A;  3AG2 C;  4OD4 A;  2VAS A;  3RFY A;  4XLP F;  4C7O B;  3F46 A;  4CS9 C;  2P7V A;  1D0Z A;  1M56 C;  4N06 A;  3H65 A;  3K33 A;  3S29 A;  2WB7 A;  4QI2 A;  3UMH A;  3JYH A;  2OG2 A;  4EBB A;  4I1M A;  2PX0 A;  2PFD A;  3FAJ A;  3JCU Q;  5KYW A;  4KBL A;  4CSA C;  4BG0 A;  3DJN B;  4BJT A;  3DM9 B;  4JCH A;  2YEV A;  3UR3 C;  4M63 A;  1LS1 A;  4PJL A;  2I8B A;  4YJW A;  1G8X A;  3M1C B;  4PK4 A;  3NDB B;  4P6I C;  2CW0 F;  4AE4 A;  2WVQ A;  3B0U X;  3EQL F;  3ZC4 A;  2Q9B A;  4LER A;  4U5D E;  1BR2 A;  4U5H A;  5L3V A;  4J32 B;  3NYM A;  3B9Q A;  2HV6 A;  1MNE A;  2B0J A;  4F4B A;  2CNW D;  1PD1 A;  2IOQ A;  5IY5 C;  4A2N B;  2R7Q A;  4IWB A;  3X2Q C;  1M2V A;  2C03 A;  3AG4 C;  3Q7G A;  3AQB A;  4U5E E;  1NU9 C;  1PCX A;  2A6E F;  1M2O A;  1S7Z A;  3GAN A;  4BJ6 C;  1BR4 A;  2QY9 A;  3DZA A;  4JVS A;  3FVY A;  5CI8 A;  2WZF A;  3EFO A;  2XXA A;  1QZX A;  4OIN F;  4GYT A;  4CBE A;  3LS0 A;  5L3Q A;  3PMR A;  2NG1 A;  2YHS A;  4U5F E;  4YWQ A;  3N24 A;  3K7D A;  2CGE A;  3RIP A;  2CNW A;  5B1A C;  3KL4 A;  3RYL A;  4XTK A;  2R7V A;  5KYY B;  2PP4 A;  3EHN A;  2G3K A;  3EGD A;  3I4U A;  3L0I A;  4PJM A;  4LLC A;  1ZHT A;  4JW1 A;  4CS7 A;  2J7P A;  4AX2 A;  2LSE A;  3UMK A;  3Q6N A;  1OKK A;  3DJU B;  4RD9 A;  5B1B C;  1VYK A;  1TWC A;  3WG7 C;  2R7S A;  4E7S A;  1D1B A;  3NYJ A;  4OIP F;  1J8M F;  2W45 A;  2OCC C;  2L81 A;  1VK5 A;  2EIJ C;  2YZS A;  3JT1 A;  4KI2 A;  2NUP B;  2J46 A;  1MND A;  2IYL D;  4RBN A;  4BJ5 A;  4KC9 A;  4YN0 B;  1VYI A;  4OIR F;  2VH3 A;  4KNW A;  4Q7C A;  4ZLC A;  4E7Z A;  2E87 A;  2XL4 A;  5KYU A;  3POV A;  2WVN A;  3K6B A;  4YT4 A;  3ZVR A;  5DQZ A;  4U5B E;  3FHD A;  1ST6 A;  5KYU B;  2KQ9 A;  3LNR A;  4YT5 A;  3ABM C;  1PD0 A;  4AE4 B;  3O6X A;  3S27 A;  1JPJ A;  4ZLD A;  3OA1 A;  2W4M A;  3EPV A;  2KJG A;  2ZXP A;  2Y69 C;  2V3C C;  3LEV A;  1Z23 A;  3T4R A;  3VYW A;  4ANJ A;  1ZHY A;  1WGW A;  1FFT C;  3E70 C;  4IRU A;  3OEO A;  2JD3 A;  4J30 B;  4O6M A;  2Q3T A;  3W8H A;  4CS8 A;  4I1O B;  2D5R B;  2J0W A;  1M57 C;  2J9W A;  3W2W A;  3UGO A;  3LLK A;  3K1I C;  2A6H F;  3FDQ A;  3ABL C;  2PF4 E;  2R7X A;  2R7O A;  3T6B A;  1N1C A;  3GOD A;  3LES A;  4WJ0 A;  3SNH A;  4DVZ A;  2G3V A;  4BJ1 A;  4Q5S F;  4PJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...