3FDQA

Recognition of at-rich dna binding sites by the mogr repressor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
b'SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motility gene repressor mogR
publication title Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein/dna
total genus 50
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12181 MogR_DNAbind DNA binding domain of the motility gene repressor (MogR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1030 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fdqA01
3FDQA
chains in the Genus database with same CATH superfamily
4U5HA 4K0DA 3K6BA 4YT4A 3HKKA 3FXHA 4Q5SF 3VAYA 4JVSA 2L9JA 3AG4C 3M79A 2IXMA 4NY3A 3LAYA 4RDAA 5BQGA 1I4YA 1M6TA 3EH1A 2AWCA 2IM8A 2W9YA 5T1DB 1QQ3A 1U0BB 4QDLA 1GGQA 3ABKC 1G4WR 2WVQA 1DOVA 1HE9A 2J8WA 1M2VA 4YJWA 4CBEA 3Q7LA 2FAPB 3C8GA 3JSEO 4N4WA 3TK0A 3KMIA 1K40A 4AX2A 2H7OA 2L6FA 4BEMJ 4YT8A 1VMAA 5T3TA 4NCQA 3V7OA 3GWLA 2M64A 1OKKD 3EGXB 5DS6A 4O79A 2XLVA 2IYLD 2P7VA 5JT4A 1ZHZA 2YL0A 4LLCA 2G62A 2VH3A 1AVOB 1O87A 2KQ9A 2PFDA 3FAPB 4LLEA 4U9DA 3VRCA 4EWCA 1JPNA 2BL2A 3GEIA 1ZYRF 1M2OA 4MVMA 5CI9A 4AL0A 1OCOC 4J32B 4X0RA 3KYIA 1TR2A 4JJGA 5KYYB 3EGDA 2JPUA 3V5YA 1OXKA 4D4NA 1QPUA 3TJ5A 2LK4A 3LESA 3ZTZA 3RQGA 1D0XA 1JRAA 1MMAA 2MWQA 5JLIA 1S7ZA 3K1IA 5A6AA 5L3QA 1I5NA 3LLKA 5AC5A 1SR2A 3F47A 1M57C 2DYRC 4K1OA 1VTMP 3GM3A 1LIHA 3SZRA 2XM4A 1HMOA 3C8GB 4BPMA 1NU7D 1Q0GA 1YARO 2PNOA 4YT5A 4ZLCA 4J7YA 3TJ6A 5B3SC 3UMKA 3DJUB 3FMSA 3U2MA 2XS1A 1UFBA 2D5RB 4LDRA 2PF4E 3EZHA 3K1HA 5FZTA 2CW0F 1Z63A 3OWTA 1J8YF 3AGUA 4IRUA 5B1BC 4BJ6C 3JZ0A 1OKKA 3C8ZA 3G50A 2VASA 3RFYA 5KYWB 1FMWA 2R7UA 1H9TA 1Z6AA 2OU6A 3QZCA 1MMNA 4EKWA 1GQAA 3DM9B 3JRTA 4YK5A 2KYHA 1SMYF 5DS5A 3ZIBA 3N2ZB 5L3VA 1A7DA 5E3CA 4KI2A 5JVEA 4Z9IA 1Q0FA 1MMDA 4ANJA 2IOQA 3AQBA 3HNKA 1TWHA 1BR1A 4I44A 5KYUA 1VYIA 2R7VA 1AUEA 2NUPA 2WZGA 4H4KC 1FAPB 4LACB 1RJ9A 4W8KA 3ZSUA 3FVYA 4Q4ZF 3GODA 4U5EE 1SF8A 1RCPA 3HTKC 1H6GA 1L3PA 2ZPAA 2WB7A 3HLZA 3PMRA 3ASNC 2QUPA 2ZXRA 256BA 2YL1A 2LD6A 4K7BA 5KYXA 5JP7A 2RSEB 1NSGB 1ZVZA 4CS9C 2R7XA 4OIOF 3NMKA 1FFTC 1TWCA 4EBBA 3RQEA 2I8BA 4MVZA 2A0UA 2D4UA 2IXPA 2CYDA 2XM0A 2Y3GA 2R02A 1PCXA 2DGJA 4GYTA 3U5SA 1LVKA 2YZSA 2XLHA 1EKYA 2E87A 2M4EA 1OW8A 4MTGA 4JJFA 1OR2A 3C62A 5D91A 1D0YA 2WZFA 2BC5A 2XLWA 2YLIA 2R03A 3L1MA 2LSEA 3N24A 4MVUA 2V26A 3SXKA 4BJ1A 5JSLA 3DWWA 1EI7A 2Q4FA 1E2XA 4JKVA 4XQ1A 5EHHA 4DVYP 1T6QA 1E83A 3PHF2 2HJ3A 1JOGA 4FX5A 2L81A 3S29A 5CIVA 3RQFA 5KYUB 2C03A 5BQHA 3S84A 4E17A 5L0JA 4JCZA 3TQOA 4MS2A 4NTBA 1IW7F 3PCVA 3C8GD 2R25A 1E86A 4JC7A 4CS8A 4G7OF 3L0IA 4JRZA 3U3FA 1EQ1A 3HNLA 5KYNA 2WVOA 2R7QA 2YHSA 3IEEA 4ULVA 3I4UA 4CDVA 2HKVA 2R7TA 3M15A 1A7EA 1B68A 4GQHA 1KU2A 3O10A 4PFPA 1O5HA 3G4XA 1D0ZA 3AG2C 3DE8A 5DLJA 3LEOA 1HE1A 3V5ZA 2B0JA 3WG7C 2HSQA 2GDCA 5E2QA 5L0DA 1AEPA 4CJGA 2AU5A 1CGNA 1TWAA 2ZXPA 1OQCA 3ABMC 2ASRA 3T6BA 5KYYA 2G3KA 2L6GA 2J45A 1FMVA 2P6VA 2YL7A 3CAXA 3JSZA 5B3IA 4G7ZF 2P61A 2OG2A 4RBNA 2EPOA 2KJGA 4C7OB 2JD3A 4XPYA 1KNYA 4XLNF 3ABLC 4WABA 2YL3A 3DAGA 3ECSA 3HJCA 4OD4A 3M4CA 3GM1A 4PJLA 4U5FE 4Z9HA 4ONSA 3WHNA 2W4BA 5F28E 3AJMA 3N0TA 4YL3A 4JTAB 4DVZA 5L0CA 2FGYA 2XRHA 5L0FA 3EJNA 4JIOA 1LE4A 1PD0A 1SYQA 4BG0A 1E84A 3EPVA 4OIPF 1ST6A 2LQGA 2KW3C 1XWJA 5GPGB 1WASA 4LDQA 2KNHA 1FNTc 4N6HA 1D1AA 2ZXWC 3U0CA 2A6EF 3EHMA 2MYSA 3OEOA 5KYWA 3Q6NA 4NTAA 4IAQA 2XLOA 3X1OA 2R7WA 3W2VA 4O6YA 3US6A 2TMVP 2YQYA 1LE2A 3IQ6A 3NYLA 4C3EA 3S28A 2YEVA 3IPMO 3V5XA 1G8XA 2O9XA 3JYYA 1YLMA 1T6UA 2J46A 3U3BA 4A4AA 3NDBB 1Z3IX 1TFKB 4YL0A 2OCCC 1T9KA 2J7PA 4N06A 3CQZA 3NYMA 5JS5A 4EIYA 4PJMA 4IB4A 3TOMA 1BR4A 1WWPA 1WATA 4IJJA 5JRAA 5AC4A 3FDQA 3DXJF 2Y3BA 3JRMO 1TQGA 3ZDLA 4DRHB 2J9BA 3B0VC 3POVA 3B9QA 4OD5A 4P6IC 2R05A 4KNWA 2VC9A 4MW3A 4W8PA 2LP4A 1HW1A 4L6RA 1NFOA 1Z7Qc 4ER9A 4MTOA 3BRJA 1CPRA 2NG1A 4BJ5A 3A11A 1CPQA 1YAUO 1HY5A 2EPNA 1TWGA 4JURI 4KC9A 4M63A 3LJBA 3T6JA 3MYIA 2AWYA 3ZTMA 4E7SA 5DS4A 3DI5A 3SNHA 2G3VA 4EBJA 1ZHWA 2Y39A 4U5CE 1FTSA 1U6HA 3K1IC 3J06A 1VK5A 2OJQA 2X0CA 4YT2A 4YWQA 5D92A 1O3UA 2IXNA 2XLDA 5JUAA 1OW7A 1V4AA 4JTCB 3R7CA 1Q0KA 3L8JA 2EIMC 5BUOA 4MVRA 3IQCA 1ZU5A 3QW0A 3SXZA 3UMIA 4EBKA 3KL4A 1VOMA 1S05A 2YRFA 4PACA 4JEAA 2W45A 2EIJC 4U9EA 3WODF 4CX9A 2XXAB 4JW1A 2WL8A 2EINC 2PBEA 2QNLA 3NKDA 4LDKA 1J8MF 3T4RA 2VB6A 2V3CC 5A6JA 1ZHYA 2C04A 1NG1A 2A6HF 2J9WA 5COMA 5DVWA 4AK9A 3FOPA 1A0BA 1V54C 3G4ZA 3ZVRA 5BQIA 2HUJA 2KSFA 2HSBA 4WJ0A 4EUKB 3SXYA 3TD7A 1LI5A 5L0IA 2OQMA 4G0HA 2YLGA 4MVSA 1YZCA 1IZMA 1RKCA 1Q0MA 4NQFA 1LPEA 2EIKC 2Q00A 3LNMB 1N1CA 2XL8A 3CEXA 1RXQA 4BEJA 3H2VA 3L34A 5E33A 4OINF 3S9OA 3U9JA 4XLPF 1C02A 3LUTB 1SZIA 3NMJA 4CSAA 1BR2A 1MNDA 1K05A 1RKEB 1ZU4A 3M1CB 4PJNA 1JAFA 2RD9A 4ULWA 1YVIA 4DXWA 3EFOB 1D1BA 2NUTB 4A2NB 1NFNA 3IHUA 4CJOA 1LM3B 2VCBA 3S90A 1CGME 5E3AA 4E7ZA 4C7OA 3ZC4A 3NMIA 1ZW2A 1OR3A 2XLEA 3EQLF 1OXBA 1UG7A 3B0UX 3AG1C 2KGOA 3MYFA 5F5FA 3O39A 3X2QC 2LFDA 1QLEC 4Z9JA 4CDYA 2PP4A 4UDVA 2MHRA 3AOUA 5IY5C 2R7RA 3RW0A 1G4US 1BDJB 5COGA 3ZWIA 1YZAA 2HV6A 3FOOA 3MX3A 4NTFA 2EPLX 2HJMA 2Q9AA 2HFIA 2YWAA 3BEHA 3LLIA 3VF0A 2YVKA 3VM6A 3JCUQ 1NLXA 3GORA 3I5QA 4IGGA 1BBHA 3DZAA 1KTMA 4Q7CA 2Z15A 4C3DA 4QI2A 4LERA 3SYNA 2JX0A 2H8AA 3SXMA 3DKAA 1CGOA 3NRHA 2Y69C 3R2PA 4CS7A 4XPXA 3NG1A 1YDIA 2J0XA 3CSKA 2F22A 3Q6MA 3U9MA 3L8IA 1ZZPA 4CS8C 1MQVA 3W8HA 3NYJA 2J7PD 2OOCA 4XEFA 2B0HA 4MVQA 2OKUA 4NC3A 4XWJA 4AE4B 3EG9B 3ZG1A 4XEKA 3AGTA 2VCCA 5CI8A 3DM5A 4XTKA 1V55C 2QTVA 5T3WA 2R7OA 1WOLA 3FHDA 3IQ5A 1YYXA 1WGWA 3KKBA 4DBRA 1VB5A 4O7GA 1JR8A 3DD7A 3T9OA 3ZQVA 2IBFA 1R4TA 5F5HA 4CIHA 2W4MA 2YKZA 3K66A 3QVZA 4H54A 2CNWD 2LFFA 3O55A 4BJTA 2XL4A 4F4BA 2HMZA 4O6MA 4E0HA 3SP1A 3QTHA 2DB4A 3I5PA 3UNGC 4I1OB 4KNVA 1PD1A 2I15A 2CCYA 3U2LA 3UGPA 4CDAA 2EILC 2LIGA 1LI7A 5A6BA 3DMDA 3KH2A 2WVNA 2Q7RA 4HFFB 2Q9CA 1Q0DA 4J30B 3RKOF 4FAPB 3GEEA 4DOZA 2A69F 1ORJA 4EHPA 5A6KA 1TKNA 1V74B 3EZIA 1F1MA 1FR0A 3HNJA 4ZLDA 2DI3A 3U8VA 2KC3A 2XXAA 2QE9A 3NKEA 3UGOA 4R32A 1WN0A 1QZXA 3MBGA 3TOLA 1HMDA 3LEVA 4PR9A 3RVZA 2H7VC 1Z23A 3UR3C 3T6GB 2OEXA 4CIPA 2CDQA 3QVYA 4OIQF 3IQTA 2NPUA 1I4ZA 3GM2A 1OCZC 2HS5A 4U5DE 3ZQYA 1GS9A 4FWVA 1XZPA 1T6IA 4C3BA 2OEVA 2L6HA 3SEOA 3K7DA 1NZEA 3EH2A 4I1MA 4BJ6A 2CNWA 3Q7GA 2LCHA 4O6NA 2R9RB 4U5BE 2L7AA 1W2WA 1H7IA 1T01A 4MNDA 1FFHA 3H2UA 1RKEA 3FAJA 2HV7A 4WGYA 3RF3A 2PX0A 3W4YA 3CZ6A 1GM5A 2XL6A 4XEVA 1Z5ZA 3C18A 3EFOA 2NUTA 1M2VB 1HW2A 3KYJA 2NSFA 4FESA 4PJJA 3MLGA 4E0IA 2GFHA 3DE9A 1E85A 1APCA 4MVOA 4BJ5C 2UUIA 2ZXOA 1LS4A 2J0WA 2J9VA 1VYKA 5L0GA 4D4XA 1PV3A 3RH3A 2QY9A 3RYLA 3MFNA 4DJ9A 1MMGA 1NU9C 4DBQA 1M56C 2AVKA 3B71A 3UMHA 4DRIB 1A7VA 4RD9A 5B1AC 3JT1A 2A0BA 3GANA 2UUHA 1WTYA 4KBLA 4MQ9F 4WGZA 4JCHA 3WAQA 1RMVA 1C03A 4CS9A 2XLMA 3ATPA 1ORSC 4JEBA 3DJNB 2WZLA 3AG3C 2QLAA 3EGDB 1Y4CA 2FFHA 5EK0A 2ZD9A 1T5OA 4N6CA 3GWNA 2Y3DA 3PDMP 4IAOA 1MNEA 5K0IA 1VLSA 3LS0A 1Y6DA 2A68F 3ASOC 2XS8A 4HE8D 4IARA 3K33A 4IWBA 2P0NA 4MW8A 5DQZA 1OCRC 4MTFA 4AL1A 5A69A 2PX3A 1ZHXA 1JPJA 4P9TA 3AQCA 3VYWA 5DQTA 4B6IA 4G7HF 4AE4A 2BE5F 2ETSA 2A1DD 3EG9A 4QI0A 1L7CA 5HSWA 1QSPA 2X51A 1DOWA 5AGFA 2Q9BA 2Q3TA 1NBBA 4P9FA 2OJED 3QMKA 1ORYA 2P1AA 2YLDA 3RIPA 2EPKX 3O6XA 2H7BA 3B0PA 5FCLA 4YN0B 1BZ4A 4HFKB 3LNRA 4CSAC 3OA1A 3S0XA 3LS1A 1LS1A 1H9GA 4GEHA 1YJGA 4YL1A 2R7SA 1OCCC 1JMWA 1OW6A 4PK4A 2GAQA 2Y3HA 2DYSC 1ZW3A 3KPHA 5A6BD 4U5GA 1XZQA 4XPWA 2CGEA 3QW1A 3F46A 3H65A 1C17M 1LKXA 1VLTA 4OIRF 4JZAA 3U8PA 3W8IA 1ZHTA 2NUPB 1YA9A 1QVXA 4I3MA 4J7TA 1RJ9B 3EHNA 3E70C 5TJ5E 2KK1A 2XSEA 3M4BA 4HEAJ 3TULA 2HZ8A 2IXOA 3B29A 3W2WA 3JYHA 3A9CA 4DRJB 5KYXB 5L0HA 5EGYA 1A41A 4JTDB 3HNIA 1EA8A 4E18A 3JTLO 5HV9A 3S27A 3DAFA 3C63A 3ITFA 3E9VA 2GWWA 3EGXA 1TFOB 2J9UA 4JE9A 4PFOA 2NSGA 1U89A 2ICWG 4G78A 1D1CA 1R5ID 3RVYA 1G5ZA 1YYJA 2AP3A 3GEHA 1YA7O 5COFA 2EPMX 2HMQA 2VCAA 3C7JA 2GA0A 1K04A 1QKRA
chains in the Genus database with same CATH topology
4U5HA 4K0DA 3K6BA 4YT4A 4Q5SF 3VAYA 4JVSA 2L9JA 3AG4C 2IXMA 4NY3A 3LAYA 4RDAA 3EH1A 2W9YA 5T1DB 4QDLA 3ABKC 2WVQA 4YJWA 1M2VA 4CBEA 3Q7LA 3KMIA 4AX2A 2H7OA 4YT8A 1VMAA 5T3TA 3V7OA 3EGXB 1OKKD 5DS6A 4O79A 2IYLD 2P7VA 1ZHZA 4LLCA 2G62A 2VH3A 1O87A 2KQ9A 2PFDA 4LLEA 3S29A 4EWCA 1JPNA 5CI9A 1ZYRF 1M2OA 1OCOC 4J32B 4X0RA 1TR2A 4JJGA 5KYYB 3EGDA 3LESA 1D0XA 1MMAA 2MWQA 1S7ZA 5L3QA 3LLKA 3F47A 1M57C 2DYRC 3SZRA 1NU7D 4YT5A 4ZLCA 5B3SC 3UMKA 3DJUB 2D5RB 2PF4E 3EZHA 3K1HA 2CW0F 1Z63A 3OWTA 1J8YF 4IRUA 4BJ6C 1OKKA 3RFYA 2VASA 5KYWB 1FMWA 2R7UA 1Z6AA 3QZCA 1MMNA 3DM9B 3JRTA 1SMYF 5DS5A 3ZIBA 3N2ZB 5L3VA 5E3CA 4KI2A 1MMDA 4ANJA 2IOQA 3AQBA 1TWHA 1BR1A 4I44A 5KYUA 1VYIA 2R7VA 2NUPA 4LACB 2WZGA 4H4KC 4W8KA 1RJ9A 3ZSUA 4Q4ZF 3FVYA 3GODA 4U5EE 1SF8A 3HTKC 2ZPAA 2WB7A 3HLZA 3PMRA 3ASNC 2ZXRA 4K7BA 5KYXA 4CS9C 2R7XA 4OIOF 4EBBA 1FFTC 1TWCA 2I8BA 2Y3GA 2IXPA 1PCXA 2DGJA 4GYTA 1LVKA 2YZSA 2E87A 2M4EA 4JJFA 5D91A 1D0YA 2WZFA 3N24A 5B1BC 3ZVRA 3B0VC 2LSEA 2V26A 4BJ1A 5EHHA 4DVYP 3PHF2 4FX5A 2L81A 5KYUB 2C03A 1IW7F 4G7OF 4CS8A 3L0IA 5KYNA 2WVOA 2R7QA 2YHSA 3IEEA 3I4UA 2R7TA 1KU2A 4PFPA 1O5HA 1D0ZA 3AG2C 5DLJA 2B0JA 3WG7C 5E2QA 1TWAA 2ZXPA 3ABMC 3T6BA 5KYYA 2G3KA 2J45A 1FMVA 2P6VA 4G7ZF 3JSZA 2OG2A 4RBNA 2KJGA 4C7OB 2JD3A 4XLNF 3ABLC 3DAGA 3ECSA 3HJCA 4OD4A 4PJLA 4U5FE 2W4BA 3N0TA 4DVZA 2FGYA 2XRHA 3EJNA 1PD0A 4BG0A 3EPVA 4OIPF 1ST6A 2KW3C 2KNHA 1D1AA 2ZXWC 2A6EF 3EHMA 2MYSA 3OEOA 5KYWA 3Q6NA 3X1OA 2R7WA 3W2VA 4O6YA 3NYLA 4C3EA 3S28A 2YEVA 1G8XA 2O9XA 2J46A 3NDBB 1Z3IX 2OCCC 2J7PA 4N06A 3CQZA 3NYMA 4PJMA 1BR4A 4IJJA 3FDQA 3DXJF 2Y3BA 3POVA 3B9QA 4OD5A 4P6IC 4KNWA 2NG1A 4BJ5A 3T6JA 4JURI 1TWGA 4KC9A 4M63A 3LJBA 4E7SA 5DS4A 3SNHA 2G3VA 1ZHWA 2Y39A 4U5CE 1FTSA 3K1IC 1VK5A 4YT2A 4YWQA 5D92A 2IXNA 2EIMC 5BUOA 1ZU5A 3UMIA 3KL4A 1VOMA 2W45A 2EIJC 3WODF 2XXAB 4JW1A 2WL8A 2EINC 3NKDA 1J8MF 3T4RA 2VB6A 2V3CC 1ZHYA 2C04A 1NG1A 2A6HF 2J9WA 5DVWA 4AK9A 1V54C 4WJ0A 3TD7A 4G0HA 1IZMA 2EIKC 4BEJA 1N1CA 5E33A 3L34A 4OINF 4XLPF 1SZIA 4CSAA 1BR2A 1MNDA 1ZU4A 3M1CB 4PJNA 4ULWA 3EFOB 1D1BA 2NUTB 4A2NB 5E3AA 4E7ZA 4C7OA 3ZC4A 3EQLF 3B0UX 3AG1C 2KGOA 5F5FA 3O39A 3X2QC 1QLEC 2PP4A 5IY5C 2R7RA 3MX3A 2HV6A 2Q9AA 3LLIA 3JCUQ 3I5QA 3DZAA 4Q7CA 2Z15A 4C3DA 4QI2A 4LERA 3SYNA 3NRHA 2Y69C 4CS7A 3NG1A 3CSKA 2J0XA 3Q6MA 4CS8C 3W8HA 3NYJA 2J7PD 4XWJA 4AE4B 3EG9B 3ZG1A 5CI8A 3DM5A 4XTKA 1V55C 2QTVA 5T3WA 2R7OA 3FHDA 3KKBA 1WGWA 4DBRA 4O7GA 3DD7A 5F5HA 4CIHA 2W4MA 3K66A 2CNWD 4BJTA 2XL4A 4F4BA 4O6MA 3SP1A 3I5PA 3UNGC 4I1OB 4KNVA 1PD1A 3UGPA 2EILC 3DMDA 3KH2A 2WVNA 4HFFB 2Q9CA 4J30B 3RKOF 4DOZA 2A69F 1TKNA 3EZIA 4ZLDA 2XXAA 3NKEA 3UGOA 1QZXA 3LEVA 2H7VC 1Z23A 3UR3C 2CDQA 4OIQF 1OCZC 4U5DE 4FWVA 4C3BA 3SEOA 3K7DA 1NZEA 3EH2A 4I1MA 4BJ6A 2CNWA 3Q7GA 4O6NA 4U5BE 1W2WA 4MNDA 1FFHA 3FAJA 2HV7A 2PX0A 3CZ6A 1Z5ZA 3EFOA 2NUTA 1M2VB 4FESA 4PJJA 3MLGA 2GFHA 4BJ5C 2ZXOA 2J0WA 2J9VA 1VYKA 3RH3A 2QY9A 3RYLA 1MMGA 1NU9C 4DBQA 1M56C 3UMHA 4RD9A 5B1AC 3JT1A 3GANA 4MQ9F 4KBLA 4JCHA 4CS9A 3DJNB 2WZLA 3AG3C 3EGDB 2FFHA 2Y3DA 4IAOA 1MNEA 3LS0A 2A68F 3ASOC 4HE8D 3K33A 4IWBA 5DQZA 1OCRC 2PX3A 1ZHXA 1JPJA 3VYWA 3AQCA 5DQTA 4B6IA 4G7HF 4AE4A 2BE5F 2A1DD 3EG9A 4QI0A 5HSWA 2X51A 2Q9BA 2Q3TA 3QMKA 3RIPA 3O6XA 2H7BA 3B0PA 5FCLA 4YN0B 4HFKB 3LNRA 4CSAC 3OA1A 3S0XA 3LS1A 1LS1A 4GEHA 2R7SA 1OCCC 4PK4A 2Y3HA 2DYSC 4U5GA 2CGEA 3F46A 3H65A 1LKXA 4OIRF 3W8IA 4JZAA 1ZHTA 2NUPB 4I3MA 1RJ9B 3EHNA 3E70C 2XSEA 4HEAJ 2IXOA 3W2WA 3JYHA 5KYXB 5EGYA 3S27A 3DAFA 3ITFA 3E9VA 3EGXA 4PFOA 2J9UA 1D1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDQ A; 
#chains in the Genus database with same CATH topology
 4U5H A;  4K0D A;  3K6B A;  4YT4 A;  3HKK A;  3FXH A;  4Q5S F;  3VAY A;  4JVS A;  2L9J A;  3AG4 C;  3M79 A;  2IXM A;  4NY3 A;  3LAY A;  4RDA A;  5BQG A;  1I4Y A;  1M6T A;  3EH1 A;  2AWC A;  2IM8 A;  2W9Y A;  5T1D B;  1QQ3 A;  1U0B B;  4QDL A;  1GGQ A;  3ABK C;  1G4W R;  2WVQ A;  1DOV A;  1HE9 A;  2J8W A;  1M2V A;  4YJW A;  4CBE A;  3Q7L A;  2FAP B;  3C8G A;  3JSE O;  4N4W A;  3TK0 A;  3KMI A;  1K40 A;  4AX2 A;  2H7O A;  2L6F A;  4BEM J;  4YT8 A;  1VMA A;  5T3T A;  4NCQ A;  3V7O A;  3GWL A;  2M64 A;  1OKK D;  3EGX B;  5DS6 A;  4O79 A;  2XLV A;  2IYL D;  2P7V A;  5JT4 A;  1ZHZ A;  2YL0 A;  4LLC A;  2G62 A;  2VH3 A;  1AVO B;  1O87 A;  2KQ9 A;  2PFD A;  3FAP B;  4LLE A;  4U9D A;  3VRC A;  4EWC A;  1JPN A;  2BL2 A;  3GEI A;  1ZYR F;  1M2O A;  4MVM A;  5CI9 A;  4AL0 A;  1OCO C;  4J32 B;  4X0R A;  3KYI A;  1TR2 A;  4JJG A;  5KYY B;  3EGD A;  2JPU A;  3V5Y A;  1OXK A;  4D4N A;  1QPU A;  3TJ5 A;  2LK4 A;  3LES A;  3ZTZ A;  3RQG A;  1D0X A;  1JRA A;  1MMA A;  2MWQ A;  5JLI A;  1S7Z A;  3K1I A;  5A6A A;  5L3Q A;  1I5N A;  3LLK A;  5AC5 A;  1SR2 A;  3F47 A;  1M57 C;  2DYR C;  4K1O A;  1VTM P;  3GM3 A;  1LIH A;  3SZR A;  2XM4 A;  1HMO A;  3C8G B;  4BPM A;  1NU7 D;  1Q0G A;  1YAR O;  2PNO A;  4YT5 A;  4ZLC A;  4J7Y A;  3TJ6 A;  5B3S C;  3UMK A;  3DJU B;  3FMS A;  3U2M A;  2XS1 A;  1UFB A;  2D5R B;  4LDR A;  2PF4 E;  3EZH A;  3K1H A;  5FZT A;  2CW0 F;  1Z63 A;  3OWT A;  1J8Y F;  3AGU A;  4IRU A;  5B1B C;  4BJ6 C;  3JZ0 A;  1OKK A;  3C8Z A;  3G50 A;  2VAS A;  3RFY A;  5KYW B;  1FMW A;  2R7U A;  1H9T A;  1Z6A A;  2OU6 A;  3QZC A;  1MMN A;  4EKW A;  1GQA A;  3DM9 B;  3JRT A;  4YK5 A;  2KYH A;  1SMY F;  5DS5 A;  3ZIB A;  3N2Z B;  5L3V A;  1A7D A;  5E3C A;  4KI2 A;  5JVE A;  4Z9I A;  1Q0F A;  1MMD A;  4ANJ A;  2IOQ A;  3AQB A;  3HNK A;  1TWH A;  1BR1 A;  4I44 A;  5KYU A;  1VYI A;  2R7V A;  1AUE A;  2NUP A;  2WZG A;  4H4K C;  1FAP B;  4LAC B;  1RJ9 A;  4W8K A;  3ZSU A;  3FVY A;  4Q4Z F;  3GOD A;  4U5E E;  1SF8 A;  1RCP A;  3HTK C;  1H6G A;  1L3P A;  2ZPA A;  2WB7 A;  3HLZ A;  3PMR A;  3ASN C;  2QUP A;  2ZXR A;  256B A;  2YL1 A;  2LD6 A;  4K7B A;  5KYX A;  5JP7 A;  2RSE B;  1NSG B;  1ZVZ A;  4CS9 C;  2R7X A;  4OIO F;  3NMK A;  1FFT C;  1TWC A;  4EBB A;  3RQE A;  2I8B A;  4MVZ A;  2A0U A;  2D4U A;  2IXP A;  2CYD A;  2XM0 A;  2Y3G A;  2R02 A;  1PCX A;  2DGJ A;  4GYT A;  3U5S A;  1LVK A;  2YZS A;  2XLH A;  1EKY A;  2E87 A;  2M4E A;  1OW8 A;  4MTG A;  4JJF A;  1OR2 A;  3C62 A;  5D91 A;  1D0Y A;  2WZF A;  2BC5 A;  2XLW A;  2YLI A;  2R03 A;  3L1M A;  2LSE A;  3N24 A;  4MVU A;  2V26 A;  3SXK A;  4BJ1 A;  5JSL A;  3DWW A;  1EI7 A;  2Q4F A;  1E2X A;  4JKV A;  4XQ1 A;  5EHH A;  4DVY P;  1T6Q A;  1E83 A;  3PHF 2;  2HJ3 A;  1JOG A;  4FX5 A;  2L81 A;  3S29 A;  5CIV A;  3RQF A;  5KYU B;  2C03 A;  5BQH A;  3S84 A;  4E17 A;  5L0J A;  4JCZ A;  3TQO A;  4MS2 A;  4NTB A;  1IW7 F;  3PCV A;  3C8G D;  2R25 A;  1E86 A;  4JC7 A;  4CS8 A;  4G7O F;  3L0I A;  4JRZ A;  3U3F A;  1EQ1 A;  3HNL A;  5KYN A;  2WVO A;  2R7Q A;  2YHS A;  3IEE A;  4ULV A;  3I4U A;  4CDV A;  2HKV A;  2R7T A;  3M15 A;  1A7E A;  1B68 A;  4GQH A;  1KU2 A;  3O10 A;  4PFP A;  1O5H A;  3G4X A;  1D0Z A;  3AG2 C;  3DE8 A;  5DLJ A;  3LEO A;  1HE1 A;  3V5Z A;  2B0J A;  3WG7 C;  2HSQ A;  2GDC A;  5E2Q A;  5L0D A;  1AEP A;  4CJG A;  2AU5 A;  1CGN A;  1TWA A;  2ZXP A;  1OQC A;  3ABM C;  2ASR A;  3T6B A;  5KYY A;  2G3K A;  2L6G A;  2J45 A;  1FMV A;  2P6V A;  2YL7 A;  3CAX A;  3JSZ A;  5B3I A;  4G7Z F;  2P61 A;  2OG2 A;  4RBN A;  2EPO A;  2KJG A;  4C7O B;  2JD3 A;  4XPY A;  1KNY A;  4XLN F;  3ABL C;  4WAB A;  2YL3 A;  3DAG A;  3ECS A;  3HJC A;  4OD4 A;  3M4C A;  3GM1 A;  4PJL A;  4U5F E;  4Z9H A;  4ONS A;  3WHN A;  2W4B A;  5F28 E;  3AJM A;  3N0T A;  4YL3 A;  4JTA B;  4DVZ A;  5L0C A;  2FGY A;  2XRH A;  5L0F A;  3EJN A;  4JIO A;  1LE4 A;  1PD0 A;  1SYQ A;  4BG0 A;  1E84 A;  3EPV A;  4OIP F;  1ST6 A;  2LQG A;  2KW3 C;  1XWJ A;  5GPG B;  1WAS A;  4LDQ A;  2KNH A;  1FNT c;  4N6H A;  1D1A A;  2ZXW C;  3U0C A;  2A6E F;  3EHM A;  2MYS A;  3OEO A;  5KYW A;  3Q6N A;  4NTA A;  4IAQ A;  2XLO A;  3X1O A;  2R7W A;  3W2V A;  4O6Y A;  3US6 A;  2TMV P;  2YQY A;  1LE2 A;  3IQ6 A;  3NYL A;  4C3E A;  3S28 A;  2YEV A;  3IPM O;  3V5X A;  1G8X A;  2O9X A;  3JYY A;  1YLM A;  1T6U A;  2J46 A;  3U3B A;  4A4A A;  3NDB B;  1Z3I X;  1TFK B;  4YL0 A;  2OCC C;  1T9K A;  2J7P A;  4N06 A;  3CQZ A;  3NYM A;  5JS5 A;  4EIY A;  4PJM A;  4IB4 A;  3TOM A;  1BR4 A;  1WWP A;  1WAT A;  4IJJ A;  5JRA A;  5AC4 A;  3FDQ A;  3DXJ F;  2Y3B A;  3JRM O;  1TQG A;  3ZDL A;  4DRH B;  2J9B A;  3B0V C;  3POV A;  3B9Q A;  4OD5 A;  4P6I C;  2R05 A;  4KNW A;  2VC9 A;  4MW3 A;  4W8P A;  2LP4 A;  1HW1 A;  4L6R A;  1NFO A;  1Z7Q c;  4ER9 A;  4MTO A;  3BRJ A;  1CPR A;  2NG1 A;  4BJ5 A;  3A11 A;  1CPQ A;  1YAU O;  1HY5 A;  2EPN A;  1TWG A;  4JUR I;  4KC9 A;  4M63 A;  3LJB A;  3T6J A;  3MYI A;  2AWY A;  3ZTM A;  4E7S A;  5DS4 A;  3DI5 A;  3SNH A;  2G3V A;  4EBJ A;  1ZHW A;  2Y39 A;  4U5C E;  1FTS A;  1U6H A;  3K1I C;  3J06 A;  1VK5 A;  2OJQ A;  2X0C A;  4YT2 A;  4YWQ A;  5D92 A;  1O3U A;  2IXN A;  2XLD A;  5JUA A;  1OW7 A;  1V4A A;  4JTC B;  3R7C A;  1Q0K A;  3L8J A;  2EIM C;  5BUO A;  4MVR A;  3IQC A;  1ZU5 A;  3QW0 A;  3SXZ A;  3UMI A;  4EBK A;  3KL4 A;  1VOM A;  1S05 A;  2YRF A;  4PAC A;  4JEA A;  2W45 A;  2EIJ C;  4U9E A;  3WOD F;  4CX9 A;  2XXA B;  4JW1 A;  2WL8 A;  2EIN C;  2PBE A;  2QNL A;  3NKD A;  4LDK A;  1J8M F;  3T4R A;  2VB6 A;  2V3C C;  5A6J A;  1ZHY A;  2C04 A;  1NG1 A;  2A6H F;  2J9W A;  5COM A;  5DVW A;  4AK9 A;  3FOP A;  1A0B A;  1V54 C;  3G4Z A;  3ZVR A;  5BQI A;  2HUJ A;  2KSF A;  2HSB A;  4WJ0 A;  4EUK B;  3SXY A;  3TD7 A;  1LI5 A;  5L0I A;  2OQM A;  4G0H A;  2YLG A;  4MVS A;  1YZC A;  1IZM A;  1RKC A;  1Q0M A;  4NQF A;  1LPE A;  2EIK C;  2Q00 A;  3LNM B;  1N1C A;  2XL8 A;  3CEX A;  1RXQ A;  4BEJ A;  3H2V A;  3L34 A;  5E33 A;  4OIN F;  3S9O A;  3U9J A;  4XLP F;  1C02 A;  3LUT B;  1SZI A;  3NMJ A;  4CSA A;  1BR2 A;  1MND A;  1K05 A;  1RKE B;  1ZU4 A;  3M1C B;  4PJN A;  1JAF A;  2RD9 A;  4ULW A;  1YVI A;  4DXW A;  3EFO B;  1D1B A;  2NUT B;  4A2N B;  1NFN A;  3IHU A;  4CJO A;  1LM3 B;  2VCB A;  3S90 A;  1CGM E;  5E3A A;  4E7Z A;  4C7O A;  3ZC4 A;  3NMI A;  1ZW2 A;  1OR3 A;  2XLE A;  3EQL F;  1OXB A;  1UG7 A;  3B0U X;  3AG1 C;  2KGO A;  3MYF A;  5F5F A;  3O39 A;  3X2Q C;  2LFD A;  1QLE C;  4Z9J A;  4CDY A;  2PP4 A;  4UDV A;  2MHR A;  3AOU A;  5IY5 C;  2R7R A;  3RW0 A;  1G4U S;  1BDJ B;  5COG A;  3ZWI A;  1YZA A;  2HV6 A;  3FOO A;  3MX3 A;  4NTF A;  2EPL X;  2HJM A;  2Q9A A;  2HFI A;  2YWA A;  3BEH A;  3LLI A;  3VF0 A;  2YVK A;  3VM6 A;  3JCU Q;  1NLX A;  3GOR A;  3I5Q A;  4IGG A;  1BBH A;  3DZA A;  1KTM A;  4Q7C A;  2Z15 A;  4C3D A;  4QI2 A;  4LER A;  3SYN A;  2JX0 A;  2H8A A;  3SXM A;  3DKA A;  1CGO A;  3NRH A;  2Y69 C;  3R2P A;  4CS7 A;  4XPX A;  3NG1 A;  1YDI A;  2J0X A;  3CSK A;  2F22 A;  3Q6M A;  3U9M A;  3L8I A;  1ZZP A;  4CS8 C;  1MQV A;  3W8H A;  3NYJ A;  2J7P D;  2OOC A;  4XEF A;  2B0H A;  4MVQ A;  2OKU A;  4NC3 A;  4XWJ A;  4AE4 B;  3EG9 B;  3ZG1 A;  4XEK A;  3AGT A;  2VCC A;  5CI8 A;  3DM5 A;  4XTK A;  1V55 C;  2QTV A;  5T3W A;  2R7O A;  1WOL A;  3FHD A;  3IQ5 A;  1YYX A;  1WGW A;  3KKB A;  4DBR A;  1VB5 A;  4O7G A;  1JR8 A;  3DD7 A;  3T9O A;  3ZQV A;  2IBF A;  1R4T A;  5F5H A;  4CIH A;  2W4M A;  2YKZ A;  3K66 A;  3QVZ A;  4H54 A;  2CNW D;  2LFF A;  3O55 A;  4BJT A;  2XL4 A;  4F4B A;  2HMZ A;  4O6M A;  4E0H A;  3SP1 A;  3QTH A;  2DB4 A;  3I5P A;  3UNG C;  4I1O B;  4KNV A;  1PD1 A;  2I15 A;  2CCY A;  3U2L A;  3UGP A;  4CDA A;  2EIL C;  2LIG A;  1LI7 A;  5A6B A;  3DMD A;  3KH2 A;  2WVN A;  2Q7R A;  4HFF B;  2Q9C A;  1Q0D A;  4J30 B;  3RKO F;  4FAP B;  3GEE A;  4DOZ A;  2A69 F;  1ORJ A;  4EHP A;  5A6K A;  1TKN A;  1V74 B;  3EZI A;  1F1M A;  1FR0 A;  3HNJ A;  4ZLD A;  2DI3 A;  3U8V A;  2KC3 A;  2XXA A;  2QE9 A;  3NKE A;  3UGO A;  4R32 A;  1WN0 A;  1QZX A;  3MBG A;  3TOL A;  1HMD A;  3LEV A;  4PR9 A;  3RVZ A;  2H7V C;  1Z23 A;  3UR3 C;  3T6G B;  2OEX A;  4CIP A;  2CDQ A;  3QVY A;  4OIQ F;  3IQT A;  2NPU A;  1I4Z A;  3GM2 A;  1OCZ C;  2HS5 A;  4U5D E;  3ZQY A;  1GS9 A;  4FWV A;  1XZP A;  1T6I A;  4C3B A;  2OEV A;  2L6H A;  3SEO A;  3K7D A;  1NZE A;  3EH2 A;  4I1M A;  4BJ6 A;  2CNW A;  3Q7G A;  2LCH A;  4O6N A;  2R9R B;  4U5B E;  2L7A A;  1W2W A;  1H7I A;  1T01 A;  4MND A;  1FFH A;  3H2U A;  1RKE A;  3FAJ A;  2HV7 A;  4WGY A;  3RF3 A;  2PX0 A;  3W4Y A;  3CZ6 A;  1GM5 A;  2XL6 A;  4XEV A;  1Z5Z A;  3C18 A;  3EFO A;  2NUT A;  1M2V B;  1HW2 A;  3KYJ A;  2NSF A;  4FES A;  4PJJ A;  3MLG A;  4E0I A;  2GFH A;  3DE9 A;  1E85 A;  1APC A;  4MVO A;  4BJ5 C;  2UUI A;  2ZXO A;  1LS4 A;  2J0W A;  2J9V A;  1VYK A;  5L0G A;  4D4X A;  1PV3 A;  3RH3 A;  2QY9 A;  3RYL A;  3MFN A;  4DJ9 A;  1MMG A;  1NU9 C;  4DBQ A;  1M56 C;  2AVK A;  3B71 A;  3UMH A;  4DRI B;  1A7V A;  4RD9 A;  5B1A C;  3JT1 A;  2A0B A;  3GAN A;  2UUH A;  1WTY A;  4KBL A;  4MQ9 F;  4WGZ A;  4JCH A;  3WAQ A;  1RMV A;  1C03 A;  4CS9 A;  2XLM A;  3ATP A;  1ORS C;  4JEB A;  3DJN B;  2WZL A;  3AG3 C;  2QLA A;  3EGD B;  1Y4C A;  2FFH A;  5EK0 A;  2ZD9 A;  1T5O A;  4N6C A;  3GWN A;  2Y3D A;  3PDM P;  4IAO A;  1MNE A;  5K0I A;  1VLS A;  3LS0 A;  1Y6D A;  2A68 F;  3ASO C;  2XS8 A;  4HE8 D;  4IAR A;  3K33 A;  4IWB A;  2P0N A;  4MW8 A;  5DQZ A;  1OCR C;  4MTF A;  4AL1 A;  5A69 A;  2PX3 A;  1ZHX A;  1JPJ A;  4P9T A;  3AQC A;  3VYW A;  5DQT A;  4B6I A;  4G7H F;  4AE4 A;  2BE5 F;  2ETS A;  2A1D D;  3EG9 A;  4QI0 A;  1L7C A;  5HSW A;  1QSP A;  2X51 A;  1DOW A;  5AGF A;  2Q9B A;  2Q3T A;  1NBB A;  4P9F A;  2OJE D;  3QMK A;  1ORY A;  2P1A A;  2YLD A;  3RIP A;  2EPK X;  3O6X A;  2H7B A;  3B0P A;  5FCL A;  4YN0 B;  1BZ4 A;  4HFK B;  3LNR A;  4CSA C;  3OA1 A;  3S0X A;  3LS1 A;  1LS1 A;  1H9G A;  4GEH A;  1YJG A;  4YL1 A;  2R7S A;  1OCC C;  1JMW A;  1OW6 A;  4PK4 A;  2GAQ A;  2Y3H A;  2DYS C;  1ZW3 A;  3KPH A;  5A6B D;  4U5G A;  1XZQ A;  4XPW A;  2CGE A;  3QW1 A;  3F46 A;  3H65 A;  1C17 M;  1LKX A;  1VLT A;  4OIR F;  4JZA A;  3U8P A;  3W8I A;  1ZHT A;  2NUP B;  1YA9 A;  1QVX A;  4I3M A;  4J7T A;  1RJ9 B;  3EHN A;  3E70 C;  5TJ5 E;  2KK1 A;  2XSE A;  3M4B A;  4HEA J;  3TUL A;  2HZ8 A;  2IXO A;  3B29 A;  3W2W A;  3JYH A;  3A9C A;  4DRJ B;  5KYX B;  5L0H A;  5EGY A;  1A41 A;  4JTD B;  3HNI A;  1EA8 A;  4E18 A;  3JTL O;  5HV9 A;  3S27 A;  3DAF A;  3C63 A;  3ITF A;  3E9V A;  2GWW A;  3EGX A;  1TFO B;  2J9U A;  4JE9 A;  4PFO A;  2NSG A;  1U89 A;  2ICW G;  4G78 A;  1D1C A;  1R5I D;  3RVY A;  1G5Z A;  1YYJ A;  2AP3 A;  3GEH A;  1YA7 O;  5COF A;  2EPM X;  2HMQ A;  2VCA A;  3C7J A;  2GA0 A;  1K04 A;  1QKR A; 
#chains in the Genus database with same CATH homology
 4U5H A;  4K0D A;  3K6B A;  4YT4 A;  4Q5S F;  3VAY A;  4JVS A;  2L9J A;  3AG4 C;  2IXM A;  4NY3 A;  3LAY A;  4RDA A;  3EH1 A;  2W9Y A;  5T1D B;  4QDL A;  3ABK C;  2WVQ A;  4YJW A;  1M2V A;  4CBE A;  3Q7L A;  3KMI A;  4AX2 A;  2H7O A;  4YT8 A;  1VMA A;  5T3T A;  3V7O A;  3EGX B;  1OKK D;  5DS6 A;  4O79 A;  2IYL D;  2P7V A;  1ZHZ A;  4LLC A;  2G62 A;  2VH3 A;  1O87 A;  2KQ9 A;  2PFD A;  4LLE A;  3S29 A;  4EWC A;  1JPN A;  5CI9 A;  1ZYR F;  1M2O A;  1OCO C;  4J32 B;  4X0R A;  1TR2 A;  4JJG A;  5KYY B;  3EGD A;  3LES A;  1D0X A;  1MMA A;  2MWQ A;  1S7Z A;  5L3Q A;  3LLK A;  3F47 A;  1M57 C;  2DYR C;  3SZR A;  1NU7 D;  4YT5 A;  4ZLC A;  5B3S C;  3UMK A;  3DJU B;  2D5R B;  2PF4 E;  3EZH A;  3K1H A;  2CW0 F;  1Z63 A;  3OWT A;  1J8Y F;  4IRU A;  4BJ6 C;  1OKK A;  3RFY A;  2VAS A;  5KYW B;  1FMW A;  2R7U A;  1Z6A A;  3QZC A;  1MMN A;  3DM9 B;  3JRT A;  1SMY F;  5DS5 A;  3ZIB A;  3N2Z B;  5L3V A;  5E3C A;  4KI2 A;  1MMD A;  4ANJ A;  2IOQ A;  3AQB A;  1TWH A;  1BR1 A;  4I44 A;  5KYU A;  1VYI A;  2R7V A;  2NUP A;  4LAC B;  2WZG A;  4H4K C;  4W8K A;  1RJ9 A;  3ZSU A;  4Q4Z F;  3FVY A;  3GOD A;  4U5E E;  1SF8 A;  3HTK C;  2ZPA A;  2WB7 A;  3HLZ A;  3PMR A;  3ASN C;  2ZXR A;  4K7B A;  5KYX A;  4CS9 C;  2R7X A;  4OIO F;  4EBB A;  1FFT C;  1TWC A;  2I8B A;  2Y3G A;  2IXP A;  1PCX A;  2DGJ A;  4GYT A;  1LVK A;  2YZS A;  2E87 A;  2M4E A;  4JJF A;  5D91 A;  1D0Y A;  2WZF A;  3N24 A;  5B1B C;  3ZVR A;  3B0V C;  2LSE A;  2V26 A;  4BJ1 A;  5EHH A;  4DVY P;  3PHF 2;  4FX5 A;  2L81 A;  5KYU B;  2C03 A;  1IW7 F;  4G7O F;  4CS8 A;  3L0I A;  5KYN A;  2WVO A;  2R7Q A;  2YHS A;  3IEE A;  3I4U A;  2R7T A;  1KU2 A;  4PFP A;  1O5H A;  1D0Z A;  3AG2 C;  5DLJ A;  2B0J A;  3WG7 C;  5E2Q A;  1TWA A;  2ZXP A;  3ABM C;  3T6B A;  5KYY A;  2G3K A;  2J45 A;  1FMV A;  2P6V A;  4G7Z F;  3JSZ A;  2OG2 A;  4RBN A;  2KJG A;  4C7O B;  2JD3 A;  4XLN F;  3ABL C;  3DAG A;  3ECS A;  3HJC A;  4OD4 A;  4PJL A;  4U5F E;  2W4B A;  3N0T A;  4DVZ A;  2FGY A;  2XRH A;  3EJN A;  1PD0 A;  4BG0 A;  3EPV A;  4OIP F;  1ST6 A;  2KW3 C;  2KNH A;  1D1A A;  2ZXW C;  2A6E F;  3EHM A;  2MYS A;  3OEO A;  5KYW A;  3Q6N A;  3X1O A;  2R7W A;  3W2V A;  4O6Y A;  3NYL A;  4C3E A;  3S28 A;  2YEV A;  1G8X A;  2O9X A;  2J46 A;  3NDB B;  1Z3I X;  2OCC C;  2J7P A;  4N06 A;  3CQZ A;  3NYM A;  4PJM A;  1BR4 A;  4IJJ A;  3FDQ A;  3DXJ F;  2Y3B A;  3POV A;  3B9Q A;  4OD5 A;  4P6I C;  4KNW A;  2NG1 A;  4BJ5 A;  3T6J A;  4JUR I;  1TWG A;  4KC9 A;  4M63 A;  3LJB A;  4E7S A;  5DS4 A;  3SNH A;  2G3V A;  1ZHW A;  2Y39 A;  4U5C E;  1FTS A;  3K1I C;  1VK5 A;  4YT2 A;  4YWQ A;  5D92 A;  2IXN A;  2EIM C;  5BUO A;  1ZU5 A;  3UMI A;  3KL4 A;  1VOM A;  2W45 A;  2EIJ C;  3WOD F;  2XXA B;  4JW1 A;  2WL8 A;  2EIN C;  3NKD A;  1J8M F;  3T4R A;  2VB6 A;  2V3C C;  1ZHY A;  2C04 A;  1NG1 A;  2A6H F;  2J9W A;  5DVW A;  4AK9 A;  1V54 C;  4WJ0 A;  3TD7 A;  4G0H A;  1IZM A;  2EIK C;  4BEJ A;  1N1C A;  5E33 A;  3L34 A;  4OIN F;  4XLP F;  1SZI A;  4CSA A;  1BR2 A;  1MND A;  1ZU4 A;  3M1C B;  4PJN A;  4ULW A;  3EFO B;  1D1B A;  2NUT B;  4A2N B;  5E3A A;  4E7Z A;  4C7O A;  3ZC4 A;  3EQL F;  3B0U X;  3AG1 C;  2KGO A;  5F5F A;  3O39 A;  3X2Q C;  1QLE C;  2PP4 A;  5IY5 C;  2R7R A;  3MX3 A;  2HV6 A;  2Q9A A;  3LLI A;  3JCU Q;  3I5Q A;  3DZA A;  4Q7C A;  2Z15 A;  4C3D A;  4QI2 A;  4LER A;  3SYN A;  3NRH A;  2Y69 C;  4CS7 A;  3NG1 A;  3CSK A;  2J0X A;  3Q6M A;  4CS8 C;  3W8H A;  3NYJ A;  2J7P D;  4XWJ A;  4AE4 B;  3EG9 B;  3ZG1 A;  5CI8 A;  3DM5 A;  4XTK A;  1V55 C;  2QTV A;  5T3W A;  2R7O A;  3FHD A;  3KKB A;  1WGW A;  4DBR A;  4O7G A;  3DD7 A;  5F5H A;  4CIH A;  2W4M A;  3K66 A;  2CNW D;  4BJT A;  2XL4 A;  4F4B A;  4O6M A;  3SP1 A;  3I5P A;  3UNG C;  4I1O B;  4KNV A;  1PD1 A;  3UGP A;  2EIL C;  3DMD A;  3KH2 A;  2WVN A;  4HFF B;  2Q9C A;  4J30 B;  3RKO F;  4DOZ A;  2A69 F;  1TKN A;  3EZI A;  4ZLD A;  2XXA A;  3NKE A;  3UGO A;  1QZX A;  3LEV A;  2H7V C;  1Z23 A;  3UR3 C;  2CDQ A;  4OIQ F;  1OCZ C;  4U5D E;  4FWV A;  4C3B A;  3SEO A;  3K7D A;  1NZE A;  3EH2 A;  4I1M A;  4BJ6 A;  2CNW A;  3Q7G A;  4O6N A;  4U5B E;  1W2W A;  4MND A;  1FFH A;  3FAJ A;  2HV7 A;  2PX0 A;  3CZ6 A;  1Z5Z A;  3EFO A;  2NUT A;  1M2V B;  4FES A;  4PJJ A;  3MLG A;  2GFH A;  4BJ5 C;  2ZXO A;  2J0W A;  2J9V A;  1VYK A;  3RH3 A;  2QY9 A;  3RYL A;  1MMG A;  1NU9 C;  4DBQ A;  1M56 C;  3UMH A;  4RD9 A;  5B1A C;  3JT1 A;  3GAN A;  4MQ9 F;  4KBL A;  4JCH A;  4CS9 A;  3DJN B;  2WZL A;  3AG3 C;  3EGD B;  2FFH A;  2Y3D A;  4IAO A;  1MNE A;  3LS0 A;  2A68 F;  3ASO C;  4HE8 D;  3K33 A;  4IWB A;  5DQZ A;  1OCR C;  2PX3 A;  1ZHX A;  1JPJ A;  3VYW A;  3AQC A;  5DQT A;  4B6I A;  4G7H F;  4AE4 A;  2BE5 F;  2A1D D;  3EG9 A;  4QI0 A;  5HSW A;  2X51 A;  2Q9B A;  2Q3T A;  3QMK A;  3RIP A;  3O6X A;  2H7B A;  3B0P A;  5FCL A;  4YN0 B;  4HFK B;  3LNR A;  4CSA C;  3OA1 A;  3S0X A;  3LS1 A;  1LS1 A;  4GEH A;  2R7S A;  1OCC C;  4PK4 A;  2Y3H A;  2DYS C;  4U5G A;  2CGE A;  3F46 A;  3H65 A;  1LKX A;  4OIR F;  3W8I A;  4JZA A;  1ZHT A;  2NUP B;  4I3M A;  1RJ9 B;  3EHN A;  3E70 C;  2XSE A;  4HEA J;  2IXO A;  3W2W A;  3JYH A;  5KYX B;  5EGY A;  3S27 A;  3DAF A;  3ITF A;  3E9V A;  3EGX A;  4PFO A;  2J9U A;  1D1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...