3FDQA

Recognition of at-rich dna binding sites by the mogr repressor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
140
structure length
140
Chain Sequence
SEIRKLLQEIKKQVDNPGNSSTTEIKKMASEAGIDEQTAEEIYHLLTEFYQAVEEHGGIEKYMHSNISWLKIELELLSACYQIAILEDMKVLDISEMLSLNDLRIFPKTPSQLQNTYYKLKKELIQVEDIPKNKPGRKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Motility gene repressor mogR
publication title Recognition of AT-Rich DNA Binding Sites by the MogR Repressor.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Dna binding protein/dna
total genus 50
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12181 MogR_DNAbind DNA binding domain of the motility gene repressor (MogR)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1030 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3fdqA01
3FDQA
chains in the Genus database with same CATH superfamily
3PHF2 3M79A 4U5GA 2BE5F 5L0IA 5KYYA 2EPMX 3HJCA 1C17M 3O55A 4DRJB 5TJ5E 5EHHA 4MS2A 1V74B 4ULWA 1MNEA 3HNKA 3PCVA 5E3AA 3SNHA 3U3FA 4EBKA 3POVA 1JOGA 256BA 1A0BA 2A0BA 1D1BA 1GM5A 1ST6A 4EHPA 2KGOA 3LS1A 1MMDA 1VK5A 4JRZA 4E7ZA 1E2XA 1SF8A 3FDQA 3M4CA 2VCBA 5JLIA 2OJED 4ANJA 2L6GA 4B6IA 3AG1C 1MQVA 1BBHA 2ZXOA 1SYQA 4R32A 4Z9HA 1OXBA 1Y6DA 3C62A 3OA1A 4LACB 3ZWIA 5AGFA 3HTKC 4JCZA 1E84A 2HFIA 4G7ZF 2ICWG 2XM0A 3EHNA 3I4UA 2R7XA 3FAPB 4U5CE 3JRMO 1MMGA 1TWHA 4E0HA 4IWBA 3U3BA 4CS8A 2J0XA 1Q0DA 2XXAA 4J30B 1E86A 4C3EA 1TWCA 4H4KC 2XLDA 2XLVA 4ZLCA 3RW0A 3ZQYA 2HSQA 3H65A 3WAQA 5F5FA 3NMJA 1M57C 3RKOF 1EKYA 5FCLA 3ABKC 4K1OA 2CCYA 4PFOA 1V4AA 5CIVA 4OIQF 3ZDLA 2A0UA 2QNLA 2RD9A 4ER9A 3NDBB 2YLGA 3IHUA 4AL0A 4PJMA 1Z7Qc 4CSAA 1KU2A 2Q9CA 3JTLO 2NG1A 3TJ5A 4XPXA 4LDQA 3I5QA 2C04A 1K40A 3LLKA 3LNMB 4A4AA 5KYUB 2IXMA 4CDVA 2HV6A 1C02A 1LI7A 4JVSA 1Y4CA 4IJJA 4JTCB 2KNHA 4NTAA 4U5BE 1ORSC 1ZU5A 4XEKA 3Q6MA 3ASNC 3TD7A 2J7PD 3DXJF 3HNJA 4EKWA 3SP1A 1BR2A 1WN0A 2PNOA 3BEHA 2NPUA 3C8GB 2R02A 1LE2A 3KL4A 2YL7A 2X0CA 1Q0GA 5L3VA 5CI9A 5B1BC 1FTSA 2EPOA 1VTMP 4GEHA 3GM1A 1YYJA 3RFYA 3SXMA 2OKUA 4A2NB 2JPUA 3EG9B 4PR9A 3SZRA 3IPMO 2E87A 4Z9IA 2WB7A 1APCA 1E83A 3U8VA 4OD4A 2Q9BA 5DLJA 1WWPA 3CQZA 3KH2A 3R7CA 3ZTMA 4F4BA 3J06A 1D0ZA 1NLXA 2H8AA 4J7TA 2B0JA 5T3WA 3T6GB 3X2QC 1ZHZA 2J9WA 4JEBA 3GM3A 5HSWA 1FR0A 1LIHA 2Q7RA 1L3PA 1J8YF 3AQCA 2GWWA 3EZHA 3T6BA 4EBJA 2L6HA 1MMAA 4FWVA 4RDAA 5JP7A 4FX5A 4GYTA 4CX9A 1T9KA 3ZG1A 3VAYA 1LKXA 2TMVP 4C7OB 3EHMA 4CS7A 1RKCA 1VYKA 3U8PA 3W8IA 4BJ5C 3V5ZA 2EIJC 4OIPF 1VLSA 3K33A 3GM2A 2XLWA 3DJUB 1KNYA 3K6BA 4WABA 3CZ6A 1C03A 2AU5A 2L81A 3HNIA 3O10A 4AL1A 4AX2A 3NG1A 4G0HA 5A6KA 2J9VA 4DVZA 1PD1A 1XZPA 5DS6A 2LP4A 4XEFA 2HJ3A 4NQFA 1LS1A 2EPLX 2HJMA 4D4NA 4JTDB 5DQZA 1JR8A 3EG9A 4I44A 3NKDA 2KJGA 3NYMA 3AGUA 1JPJA 4E17A 5B3SC 3UNGC 2HUJA 2R9RB 5A69A 1OCOC 1M56C 4PACA 3IQCA 2L7AA 1BZ4A 1JPNA 2XSEA 2LFFA 5AC5A 4DVYP 2R25A 1IW7F 4J32B 3VF0A 3B71A 2MHRA 2HV7A 1HMDA 2QUPA 2VCAA 4HFFB 4NY3A 3LS0A 3V5YA 2R7TA 1PV3A 1YA9A 1T6UA 1OCCC 2NSGA 4FESA 3SXZA 1EQ1A 1CGNA 3G4ZA 1ZW2A 4X0RA 1QSPA 1HMOA 1QZXA 3C8ZA 4XPWA 4C7OA 1N1CA 4Z9JA 1Z63A 1BR1A 3QW0A 1BDJB 2P6VA 3OWTA 4H54A 1R4TA 2AWCA 4CS9A 4KBLA 2YRFA 1XWJA 1Z6AA 3M4BA 1RMVA 1CPQA 3I5PA 3RH3A 5A6BD 3W4YA 2DYRC 3KKBA 1A7EA 3S9OA 1LI5A 2NUTA 3N24A 4C3DA 1NBBA 2YKZA 2V26A 3QVZA 2P1AA 4P9TA 2YLIA 3G4XA 2R7SA 1U89A 2PFDA 3T9OA 4BJ6C 5L0DA 5CI8A 3BRJA 4OIRF 1VOMA 1ZHTA 3S27A 3TK0A 5HV9A 2D5RB 2A68F 2W4BA 3MYIA 1RKEB 4ULVA 5EK0A 4Q4ZF 3W8HA 3UMIA 3X1OA 3WODF 3DWWA 2R7OA 3EH2A 1O3UA 4LLEA 2P0NA 2JX0A 1WGWA 4QI0A 2CDQA 1ZU4A 4XLNF 2YHSA 1LPEA 2XS1A 1D1AA 2GFHA 1I4ZA 2ZPAA 4J7YA 4JJGA 1TWGA 2B0HA 3EGXB 1M2VB 2J8WA 5DQTA 2Y3BA 3AGTA 1OW6A 1OW7A 1DOWA 1VLTA 3DMDA 4D4XA 3TOLA 2CW0F 2QTVA 2J7PA 3GWLA 3MBGA 3RYLA 3SYNA 5DS5A 2HSBA 4G7HF 5L0GA 3K66A 2G3KA 4JKVA 5T3TA 1G4WR 5JUAA 2YQYA 4CJGA 1FFHA 3CEXA 3NYJA 4OIOF 2Y69C 2FGYA 5BQIA 2Y3DA 1OQCA 3JCUQ 1T5OA 4KNWA 5KYWB 1YYXA 4QI2A 2KSFA 1H6GA 5BQHA 1A7DA 4IB4A 1MNDA 4AE4B 1G4US 2ASRA 1ZHYA 3LAYA 1ZHXA 3FMSA 2IBFA 2LIGA 2PX0A 3E9VA 5B3IA 2WZGA 5GPGB 4WGYA 2HS5A 3LEVA 1RKEA 1U6HA 3ZC4A 2EPKX 2LK4A 3DJNB 3IQTA 5KYXB 3GWNA 3Q7GA 4KC9A 4L6RA 4BEMJ 2XL4A 2Z15A 3DM9B 1TWAA 3NMIA 1NFOA 3RVZA 3MX3A 5DVWA 3RQFA 1V55C 3ECSA 3GEIA 3EGXA 3ABMC 4DBRA 5KYNA 2AP3A 4N6HA 2C03A 1PD0A 4BPMA 2Q3TA 4KI2A 1YA7O 1TQGA 2A69F 3WHNA 3S0XA 4RD9A 5FZTA 1Z3IX 2XL8A 4YK5A 3RIPA 3LJBA 3F47A 2OEXA 2W45A 4NCQA 4CDAA 4QDLA 2IM8A 2LD6A 3JRTA 5L0HA 3S84A 2EIKC 1TFOB 4WGZA 4DRIB 2UUHA 4XLPF 4O6NA 1UFBA 5KYWA 3TQOA 1LS4A 3EJNA 1ZZPA 2WVNA 2IXOA 4JCHA 5D92A 2LFDA 4AE4A 4DOZA 4PJLA 1DOVA 4U5DE 3EZIA 1A7VA 3FOPA 5COMA 3B9QA 2W4MA 2G3VA 2EIMC 1Z23A 2AWYA 1S05A 2V3CC 1WTYA 1VYIA 4O7GA 5KYXA 1S7ZA 1HE9A 2NUPB 3AG2C 2HMZA 3LESA 4DJ9A 3AJMA 2WL8A 1QPUA 3ABLC 4IGGA 5KYUA 4G7OF 4EBBA 2HZ8A 3GODA 3ZTZA 2J9BA 4N4WA 3ATPA 1RCPA 2EINC 2WVQA 1NU7D 1M6TA 4YL1A 2IXPA 2WZFA 3C8GA 1D0YA 1V54C 2FFHA 1OKKD 4JJFA 5L0JA 1FAPB 2NSFA 4BJ5A 3C18A 2J46A 2Q00A 1NFNA 3IQ6A 1O87A 1TR2A 3DE9A 2KW3C 1LM3B 3JT1A 1ZHWA 4XQ1A 4FAPB 5A6BA 4CDYA 2GDCA 1RXQA 3KYIA 3T6JA 2J9UA 3DZAA 2ZXRA 2WVOA 5F28E 3A11A 2XLOA 1F1MA 3JSEO 2DI3A 2LCHA 4LLCA 4PFPA 2EILC 4PJJA 4WJ0A 1AEPA 2CGEA 4U5EE 1QLEC 4YT5A 4LDRA 3UMHA 5K0IA 2R7RA 3U9JA 2IXNA 3ZVRA 4MVZA 1BR4A 2OEVA 5A6JA 2R03A 5L0FA 5COGA 3A9CA 1YZCA 2GAQA 2NUPA 4OD5A 3RQGA 3ZQVA 3EGDB 1FMWA 2IOQA 2CNWD 4O79A 5D91A 3T4RA 2M64A 4RBNA 2IYLD 3VRCA 4OINF 2VC9A 3DE8A 3EFOB 3V7OA 3GANA 4XTKA 2OU6A 2DB4A 2MYSA 2AVKA 2QY9A 4MVRA 4U5FE 4MVUA 3HNLA 1ZYRF 3K1IC 3FXHA 1WOLA 1FMVA 1AUEA 2PBEA 3RF3A 3RQEA 3M15A 4IRUA 1FNTc 3V5XA 3PMRA 5JS5A 2R7VA 3JZ0A 2ZXPA 3L0IA 4E18A 5DS4A 1QQ3A 3UGOA 2DGJA 1CGOA 1YJGA 1R5ID 1Z5ZA 3L34A 2YZSA 2Y39A 3DD7A 3JYYA 1LE4A 3K1IA 3Q6NA 1EA8A 1ORJA 3MLGA 4I1MA 2QE9A 5BQGA 3DI5A 4E7SA 1NZEA 2OCCC 1A41A 2X51A 2YLDA 1Q0MA 1MMNA 4JW1A 4BJ6A 5EGYA 1G5ZA 3MFNA 1HW1A 1OW8A 5L3QA 2H7OA 2XS8A 3PDMP 3UMKA 2YL3A 2EPNA 3UR3C 3C7JA 1YVIA 4NTFA 2L6FA 3FAJA 2KC3A 4W8KA 1YAUO 1D0XA 2PX3A 2R05A 4GQHA 3EGDA 3IQ5A 3QZCA 3L1MA 3L8JA 1RJ9B 3O39A 2Y3HA 1ORYA 1ZW3A 4U5HA 3W2WA 1NSGB 1VB5A 2YL1A 3EFOA 2XLMA 4Q7CA 3F46A 5IY5C 1Q0FA 2ETSA 2YWAA 3GEEA 1H9GA 3ZSUA 4JURI 1YARO 4DXWA 3SEOA 2LSEA 3NMKA 1TFKB 1CPRA 3U2LA 3LLIA 1AVOB 3TOMA 3WG7C 3DAGA 3N0TA 4MNDA 1SR2A 1YLMA 1GGQA 4CS8C 3KPHA 3E70C 3B0PA 2YVKA 4DRHB 2I8BA 2A6HF 4MQ9F 3SXKA 2A6EF 3NYLA 4IARA 1G8XA 1T6QA 4PK4A 2WZLA 4Q5SF 1T01A 5F5HA 3B0UX 1YDIA 4O6YA 2DYSC 1J8MF 3NKEA 4MTFA 3SXYA 4CIPA 2KQ9A 2I15A 4PJNA 4BEJA 2BC5A 3JYHA 4XEVA 4CJOA 1M2VA 3CSKA 4EWCA 1B68A 4CSAC 3DKAA 2H7VC 2M4EA 3K7DA 2MWQA 1VMAA 1H7IA 1IZMA 1OR3A 2VH3A 3K1HA 4K7BA 4P6IC 3S28A 3AOUA 4EIYA 1KTMA 2OG2A 2HKVA 1RJ9A 4IAQA 5E33A 3L8IA 1OR2A 4N06A 1OKKA 3AG4C 3VM6A 2UUIA 3VYWA 2XM4A 4MW3A 4NC3A 4DBQA 3U0CA 5B1AC 1SMYF 2H7BA 2W9YA 2J45A 3QVYA 3DAFA 2R7WA 4JIOA 1I5NA 4IAOA 4U9EA 1EI7A 4LDKA 3TJ6A 2FAPB 1OXKA 2Q4FA 2R7UA 4JTAB 3EH1A 3H2VA 1K04A 2L9JA 3FHDA 2VCCA 4K0DA 4CIHA 3CAXA 2QLAA 2OOCA 3B29A 3W2VA 4ZLDA 1H9TA 4BJTA 2F22A 4MW8A 3U2MA 1U0BB 3IEEA 3AG3C 3AQBA 5JT4A 2JD3A 3Q7LA 3EQLF 1Q0KA 2KK1A 5JSLA 2O9XA 2G62A 2YEVA 4JEAA 5E2QA 3GORA 1W2WA 2BL2A 1QKRA 3LUTB 2P7VA 2VASA 3G50A 3ASOC 3O6XA 2CNWA 2XRHA 2HMQA 4MVQA 4YN0B 4LERA 4AK9A 4P9FA 4W8PA 4XWJA 5JVEA 3KMIA 1JMWA 1UG7A 4MVOA 4MVMA 4EUKB 4YT8A 1FFTC 1ZVZA 5A6AA 1NG1A 3QTHA 2P61A 4MTOA 2XLHA 3QMKA 4C3BA 4E0IA 1WASA 4CBEA 1NU9C 2CYDA 2KYHA 4YT4A 3B0VC 1D1CA 5AC4A 3S90A 3HKKA 3US6A 5JRAA 2R7QA 3QW1A 4G78A 4HEAJ 1GS9A 3M1CB 3N2ZB 3OEOA 4JC7A 4MVSA 1M2OA 5COFA 4NTBA 1LVKA 3U5SA 1CGME 5T1DB 2ZXWC 4N6CA 1OCRC 1XZQA 2PF4E 3H2UA 2VB6A 4UDVA 2RSEB 3GEHA 3R2PA 1HW2A 1OCZC 2NUTB 4YL0A 1O5HA 1I4YA 3HLZA 3S29A 3ZIBA 1JRAA 5KYYB 4O6MA 3JSZA 3KYJA 3UGPA 2XLEA 4JZAA 2PP4A 4KNVA 4ONSA 3U9MA 4BG0A 1HE1A 4YL3A 1WATA 3RVYA 5L0CA 1YZAA 2OQMA 1K05A 1QVXA 4BJ1A 3LEOA 3LNRA 3NRHA 3EPVA 3ITFA 2J0WA 4I3MA 2GA0A 3FVYA 2YL0A 1JAFA 4YT2A 4CS9C 2XL6A 4M63A 1L7CA 3C63A 1SZIA 1HY5A 4JE9A 4MTGA 2Y3GA 1T6IA 5E3CA 3TULA 2A1DD 4YWQA 2OJQA 4U9DA 2Q9AA 3C8GD 4I1OB 1GQAA 2LQGA 3MYFA 1PCXA 2ZD9A 4HFKB 5BUOA 2XXAB 3DM5A 1E85A 4XPYA 3FOOA 2D4UA 4HE8D 4YJWA 1TKNA
chains in the Genus database with same CATH topology
3PHF2 4U5GA 2BE5F 5KYYA 3HJCA 5EHHA 4ULWA 5E3AA 1MNEA 3SNHA 3POVA 1D1BA 1ST6A 2KGOA 3LS1A 1MMDA 1VK5A 4E7ZA 3FDQA 1SF8A 4ANJA 4B6IA 3AG1C 2ZXOA 3OA1A 4LACB 3HTKC 4G7ZF 3EHNA 3I4UA 2R7XA 4U5CE 1MMGA 1TWHA 4IWBA 4CS8A 2J0XA 2XXAA 4J30B 4C3EA 1TWCA 4H4KC 4ZLCA 5F5FA 3H65A 1M57C 3RKOF 5FCLA 3ABKC 4PFOA 4OIQF 3NDBB 4PJMA 4CSAA 1KU2A 2Q9CA 2NG1A 3I5QA 2C04A 3LLKA 5KYUB 2IXMA 2HV6A 4JVSA 4IJJA 2KNHA 4U5BE 1ZU5A 3Q6MA 3ASNC 3TD7A 2J7PD 3DXJF 3SP1A 1BR2A 3KL4A 5L3VA 5CI9A 5B1BC 1FTSA 4GEHA 3RFYA 4A2NB 3EG9B 3SZRA 2E87A 2WB7A 4OD4A 2Q9BA 5DLJA 3CQZA 3KH2A 4F4BA 1D0ZA 2B0JA 5T3WA 3X2QC 1ZHZA 2J9WA 5HSWA 1J8YF 3AQCA 3EZHA 3T6BA 1MMAA 4FWVA 4RDAA 4FX5A 4GYTA 3ZG1A 3VAYA 1LKXA 4C7OB 3EHMA 4CS7A 1VYKA 3W8IA 4BJ5C 2EIJC 4OIPF 3K33A 3DJUB 3K6BA 3CZ6A 2L81A 4AX2A 3NG1A 4G0HA 2J9VA 4DVZA 1PD1A 5DS6A 1LS1A 5DQZA 3EG9A 4I44A 3NKDA 2KJGA 3NYMA 5B3SC 1JPJA 3UNGC 1OCOC 1M56C 1JPNA 2XSEA 4DVYP 1IW7F 4J32B 2HV7A 2R7TA 4HFFB 4NY3A 3LS0A 4FESA 1OCCC 4X0RA 1QZXA 4C7OA 1N1CA 1Z63A 1BR1A 2P6VA 3OWTA 4CS9A 4KBLA 1Z6AA 3I5PA 3RH3A 2DYRC 3KKBA 2NUTA 3N24A 4C3DA 2V26A 2R7SA 2PFDA 4BJ6C 5CI8A 4OIRF 1VOMA 1ZHTA 3S27A 1TKNA 2D5RB 2A68F 2W4BA 4Q4ZF 3W8HA 3UMIA 3WODF 2R7OA 3EH2A 4LLEA 1WGWA 4QI0A 2CDQA 1ZU4A 4XLNF 2YHSA 1D1AA 2GFHA 2ZPAA 4JJGA 5DQTA 1TWGA 3EGXB 1M2VB 2Y3BA 3DMDA 2CW0F 2QTVA 2J7PA 5DS5A 3RYLA 3SYNA 4G7HF 3K66A 2G3KA 5T3TA 1FFHA 3NYJA 4OIOF 2Y69C 2FGYA 2Y3DA 3JCUQ 4KNWA 5KYWB 4QI2A 1MNDA 4AE4B 3LAYA 1ZHYA 1ZHXA 2PX0A 3E9VA 2WZGA 3LEVA 3ZC4A 3DJNB 5KYXB 3Q7GA 4KC9A 2XL4A 2Z15A 3DM9B 1TWAA 3MX3A 5DVWA 1V55C 3ECSA 3EGXA 3ABMC 4DBRA 5KYNA 2C03A 1PD0A 2Q3TA 4KI2A 2A69F 3S0XA 4RD9A 1Z3IX 3RIPA 3LJBA 3F47A 2W45A 4QDLA 3JRTA 2EIKC 4XLPF 4O6NA 5KYWA 2WVNA 2IXOA 4JCHA 5D92A 4AE4A 4DOZA 4PJLA 4U5DE 3EZIA 3B9QA 2W4MA 2G3VA 2EIMC 1Z23A 2V3CC 4O7GA 1VYIA 5KYXA 1S7ZA 2NUPB 3AG2C 3LESA 2WL8A 3ABLC 5KYUA 4G7OF 4EBBA 3GODA 2EINC 2WVQA 1NU7D 2IXPA 2WZFA 1D0YA 1V54C 2FFHA 1OKKD 4JJFA 4BJ5A 2J46A 1O87A 1TR2A 3JT1A 2KW3C 1ZHWA 3T6JA 2J9UA 3DZAA 2ZXRA 2WVOA 4LLCA 4PFPA 2EILC 4PJJA 4WJ0A 2CGEA 4U5EE 1QLEC 4YT5A 3UMHA 2R7RA 3ZVRA 2IXNA 1BR4A 4OD5A 2NUPA 3EGDB 1FMWA 2IOQA 2CNWD 4O79A 5D91A 3T4RA 4RBNA 2IYLD 4OINF 3EFOB 3V7OA 3GANA 4XTKA 2MYSA 2QY9A 4U5FE 2R7VA 1ZYRF 3K1IC 1FMVA 4IRUA 3PMRA 2ZXPA 3L0IA 5DS4A 3UGOA 2DGJA 1Z5ZA 3L34A 2YZSA 2Y39A 3DD7A 3Q6NA 4I1MA 4E7SA 3MLGA 1NZEA 2OCCC 2X51A 4JW1A 1MMNA 4BJ6A 5EGYA 5L3QA 2H7OA 3UMKA 3UR3C 3FAJA 4W8KA 1D0XA 2PX3A 3EGDA 3QZCA 1RJ9B 3O39A 2Y3HA 4U5HA 3W2WA 3X1OA 3B0UX 3EFOA 4Q7CA 3F46A 5IY5C 3ZSUA 4JURI 3SEOA 2LSEA 3LLIA 3WG7C 3DAGA 3N0TA 4MNDA 4CS8C 3E70C 3B0PA 2I8BA 2A6HF 4MQ9F 2A6EF 3NYLA 1G8XA 4PK4A 2WZLA 4Q5SF 5F5HA 4O6YA 2DYSC 1J8MF 3NKEA 2KQ9A 4PJNA 4BEJA 3JYHA 4EWCA 1M2VA 3CSKA 4CSAC 2H7VC 2M4EA 3K7DA 2MWQA 1VMAA 3S28A 1IZMA 2VH3A 3K1HA 4K7BA 4P6IC 2OG2A 5E33A 1RJ9A 4N06A 1OKKA 3AG4C 3VYWA 4DBQA 5B1AC 1SMYF 2H7BA 2W9YA 2J45A 2R7WA 3DAFA 4IAOA 2R7UA 3EH1A 2L9JA 3FHDA 4K0DA 4CIHA 4ZLDA 3W2VA 4BJTA 3IEEA 3AG3C 3AQBA 2JD3A 3Q7LA 3EQLF 2O9XA 2G62A 2YEVA 5E2QA 1W2WA 2P7VA 2VASA 3ASOC 3O6XA 2CNWA 2XRHA 4YN0B 4LERA 4AK9A 4XWJA 3KMIA 4YT8A 1FFTC 1NG1A 3QMKA 4C3BA 4CBEA 1NU9C 4YT4A 3B0VC 1D1CA 2R7QA 4HEAJ 3M1CB 3N2ZB 3OEOA 1M2OA 1LVKA 5T1DB 2ZXWC 1OCRC 2PF4E 2VB6A 1OCZC 2NUTB 1O5HA 3HLZA 3S29A 3ZIBA 5KYYB 4O6MA 3JSZA 3UGPA 4JZAA 2PP4A 4KNVA 4BG0A 4BJ1A 3LNRA 3NRHA 3EPVA 3ITFA 2J0WA 4I3MA 3FVYA 4YT2A 4CS9C 4M63A 1SZIA 2Y3GA 5E3CA 2A1DD 4YWQA 2Q9AA 4I1OB 1PCXA 4HFKB 5BUOA 2XXAB 3DM5A 4HE8D 4YJWA 3EJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDQ A; 
#chains in the Genus database with same CATH topology
 3PHF 2;  3M79 A;  4U5G A;  2BE5 F;  5L0I A;  5KYY A;  2EPM X;  3HJC A;  1C17 M;  3O55 A;  4DRJ B;  5TJ5 E;  5EHH A;  4MS2 A;  1V74 B;  4ULW A;  1MNE A;  3HNK A;  3PCV A;  5E3A A;  3SNH A;  3U3F A;  4EBK A;  3POV A;  1JOG A;  256B A;  1A0B A;  2A0B A;  1D1B A;  1GM5 A;  1ST6 A;  4EHP A;  2KGO A;  3LS1 A;  1MMD A;  1VK5 A;  4JRZ A;  4E7Z A;  1E2X A;  1SF8 A;  3FDQ A;  3M4C A;  2VCB A;  5JLI A;  2OJE D;  4ANJ A;  2L6G A;  4B6I A;  3AG1 C;  1MQV A;  1BBH A;  2ZXO A;  1SYQ A;  4R32 A;  4Z9H A;  1OXB A;  1Y6D A;  3C62 A;  3OA1 A;  4LAC B;  3ZWI A;  5AGF A;  3HTK C;  4JCZ A;  1E84 A;  2HFI A;  4G7Z F;  2ICW G;  2XM0 A;  3EHN A;  3I4U A;  2R7X A;  3FAP B;  4U5C E;  3JRM O;  1MMG A;  1TWH A;  4E0H A;  4IWB A;  3U3B A;  4CS8 A;  2J0X A;  1Q0D A;  2XXA A;  4J30 B;  1E86 A;  4C3E A;  1TWC A;  4H4K C;  2XLD A;  2XLV A;  4ZLC A;  3RW0 A;  3ZQY A;  2HSQ A;  3H65 A;  3WAQ A;  5F5F A;  3NMJ A;  1M57 C;  3RKO F;  1EKY A;  5FCL A;  3ABK C;  4K1O A;  2CCY A;  4PFO A;  1V4A A;  5CIV A;  4OIQ F;  3ZDL A;  2A0U A;  2QNL A;  2RD9 A;  4ER9 A;  3NDB B;  2YLG A;  3IHU A;  4AL0 A;  4PJM A;  1Z7Q c;  4CSA A;  1KU2 A;  2Q9C A;  3JTL O;  2NG1 A;  3TJ5 A;  4XPX A;  4LDQ A;  3I5Q A;  2C04 A;  1K40 A;  3LLK A;  3LNM B;  4A4A A;  5KYU B;  2IXM A;  4CDV A;  2HV6 A;  1C02 A;  1LI7 A;  4JVS A;  1Y4C A;  4IJJ A;  4JTC B;  2KNH A;  4NTA A;  4U5B E;  1ORS C;  1ZU5 A;  4XEK A;  3Q6M A;  3ASN C;  3TD7 A;  2J7P D;  3DXJ F;  3HNJ A;  4EKW A;  3SP1 A;  1BR2 A;  1WN0 A;  2PNO A;  3BEH A;  2NPU A;  3C8G B;  2R02 A;  1LE2 A;  3KL4 A;  2YL7 A;  2X0C A;  1Q0G A;  5L3V A;  5CI9 A;  5B1B C;  1FTS A;  2EPO A;  1VTM P;  4GEH A;  3GM1 A;  1YYJ A;  3RFY A;  3SXM A;  2OKU A;  4A2N B;  2JPU A;  3EG9 B;  4PR9 A;  3SZR A;  3IPM O;  2E87 A;  4Z9I A;  2WB7 A;  1APC A;  1E83 A;  3U8V A;  4OD4 A;  2Q9B A;  5DLJ A;  1WWP A;  3CQZ A;  3KH2 A;  3R7C A;  3ZTM A;  4F4B A;  3J06 A;  1D0Z A;  1NLX A;  2H8A A;  4J7T A;  2B0J A;  5T3W A;  3T6G B;  3X2Q C;  1ZHZ A;  2J9W A;  4JEB A;  3GM3 A;  5HSW A;  1FR0 A;  1LIH A;  2Q7R A;  1L3P A;  1J8Y F;  3AQC A;  2GWW A;  3EZH A;  3T6B A;  4EBJ A;  2L6H A;  1MMA A;  4FWV A;  4RDA A;  5JP7 A;  4FX5 A;  4GYT A;  4CX9 A;  1T9K A;  3ZG1 A;  3VAY A;  1LKX A;  2TMV P;  4C7O B;  3EHM A;  4CS7 A;  1RKC A;  1VYK A;  3U8P A;  3W8I A;  4BJ5 C;  3V5Z A;  2EIJ C;  4OIP F;  1VLS A;  3K33 A;  3GM2 A;  2XLW A;  3DJU B;  1KNY A;  3K6B A;  4WAB A;  3CZ6 A;  1C03 A;  2AU5 A;  2L81 A;  3HNI A;  3O10 A;  4AL1 A;  4AX2 A;  3NG1 A;  4G0H A;  5A6K A;  2J9V A;  4DVZ A;  1PD1 A;  1XZP A;  5DS6 A;  2LP4 A;  4XEF A;  2HJ3 A;  4NQF A;  1LS1 A;  2EPL X;  2HJM A;  4D4N A;  4JTD B;  5DQZ A;  1JR8 A;  3EG9 A;  4I44 A;  3NKD A;  2KJG A;  3NYM A;  3AGU A;  1JPJ A;  4E17 A;  5B3S C;  3UNG C;  2HUJ A;  2R9R B;  5A69 A;  1OCO C;  1M56 C;  4PAC A;  3IQC A;  2L7A A;  1BZ4 A;  1JPN A;  2XSE A;  2LFF A;  5AC5 A;  4DVY P;  2R25 A;  1IW7 F;  4J32 B;  3VF0 A;  3B71 A;  2MHR A;  2HV7 A;  1HMD A;  2QUP A;  2VCA A;  4HFF B;  4NY3 A;  3LS0 A;  3V5Y A;  2R7T A;  1PV3 A;  1YA9 A;  1T6U A;  1OCC C;  2NSG A;  4FES A;  3SXZ A;  1EQ1 A;  1CGN A;  3G4Z A;  1ZW2 A;  4X0R A;  1QSP A;  1HMO A;  1QZX A;  3C8Z A;  4XPW A;  4C7O A;  1N1C A;  4Z9J A;  1Z63 A;  1BR1 A;  3QW0 A;  1BDJ B;  2P6V A;  3OWT A;  4H54 A;  1R4T A;  2AWC A;  4CS9 A;  4KBL A;  2YRF A;  1XWJ A;  1Z6A A;  3M4B A;  1RMV A;  1CPQ A;  3I5P A;  3RH3 A;  5A6B D;  3W4Y A;  2DYR C;  3KKB A;  1A7E A;  3S9O A;  1LI5 A;  2NUT A;  3N24 A;  4C3D A;  1NBB A;  2YKZ A;  2V26 A;  3QVZ A;  2P1A A;  4P9T A;  2YLI A;  3G4X A;  2R7S A;  1U89 A;  2PFD A;  3T9O A;  4BJ6 C;  5L0D A;  5CI8 A;  3BRJ A;  4OIR F;  1VOM A;  1ZHT A;  3S27 A;  3TK0 A;  5HV9 A;  2D5R B;  2A68 F;  2W4B A;  3MYI A;  1RKE B;  4ULV A;  5EK0 A;  4Q4Z F;  3W8H A;  3UMI A;  3X1O A;  3WOD F;  3DWW A;  2R7O A;  3EH2 A;  1O3U A;  4LLE A;  2P0N A;  2JX0 A;  1WGW A;  4QI0 A;  2CDQ A;  1ZU4 A;  4XLN F;  2YHS A;  1LPE A;  2XS1 A;  1D1A A;  2GFH A;  1I4Z A;  2ZPA A;  4J7Y A;  4JJG A;  1TWG A;  2B0H A;  3EGX B;  1M2V B;  2J8W A;  5DQT A;  2Y3B A;  3AGT A;  1OW6 A;  1OW7 A;  1DOW A;  1VLT A;  3DMD A;  4D4X A;  3TOL A;  2CW0 F;  2QTV A;  2J7P A;  3GWL A;  3MBG A;  3RYL A;  3SYN A;  5DS5 A;  2HSB A;  4G7H F;  5L0G A;  3K66 A;  2G3K A;  4JKV A;  5T3T A;  1G4W R;  5JUA A;  2YQY A;  4CJG A;  1FFH A;  3CEX A;  3NYJ A;  4OIO F;  2Y69 C;  2FGY A;  5BQI A;  2Y3D A;  1OQC A;  3JCU Q;  1T5O A;  4KNW A;  5KYW B;  1YYX A;  4QI2 A;  2KSF A;  1H6G A;  5BQH A;  1A7D A;  4IB4 A;  1MND A;  4AE4 B;  1G4U S;  2ASR A;  1ZHY A;  3LAY A;  1ZHX A;  3FMS A;  2IBF A;  2LIG A;  2PX0 A;  3E9V A;  5B3I A;  2WZG A;  5GPG B;  4WGY A;  2HS5 A;  3LEV A;  1RKE A;  1U6H A;  3ZC4 A;  2EPK X;  2LK4 A;  3DJN B;  3IQT A;  5KYX B;  3GWN A;  3Q7G A;  4KC9 A;  4L6R A;  4BEM J;  2XL4 A;  2Z15 A;  3DM9 B;  1TWA A;  3NMI A;  1NFO A;  3RVZ A;  3MX3 A;  5DVW A;  3RQF A;  1V55 C;  3ECS A;  3GEI A;  3EGX A;  3ABM C;  4DBR A;  5KYN A;  2AP3 A;  4N6H A;  2C03 A;  1PD0 A;  4BPM A;  2Q3T A;  4KI2 A;  1YA7 O;  1TQG A;  2A69 F;  3WHN A;  3S0X A;  4RD9 A;  5FZT A;  1Z3I X;  2XL8 A;  4YK5 A;  3RIP A;  3LJB A;  3F47 A;  2OEX A;  2W45 A;  4NCQ A;  4CDA A;  4QDL A;  2IM8 A;  2LD6 A;  3JRT A;  5L0H A;  3S84 A;  2EIK C;  1TFO B;  4WGZ A;  4DRI B;  2UUH A;  4XLP F;  4O6N A;  1UFB A;  5KYW A;  3TQO A;  1LS4 A;  3EJN A;  1ZZP A;  2WVN A;  2IXO A;  4JCH A;  5D92 A;  2LFD A;  4AE4 A;  4DOZ A;  4PJL A;  1DOV A;  4U5D E;  3EZI A;  1A7V A;  3FOP A;  5COM A;  3B9Q A;  2W4M A;  2G3V A;  2EIM C;  1Z23 A;  2AWY A;  1S05 A;  2V3C C;  1WTY A;  1VYI A;  4O7G A;  5KYX A;  1S7Z A;  1HE9 A;  2NUP B;  3AG2 C;  2HMZ A;  3LES A;  4DJ9 A;  3AJM A;  2WL8 A;  1QPU A;  3ABL C;  4IGG A;  5KYU A;  4G7O F;  4EBB A;  2HZ8 A;  3GOD A;  3ZTZ A;  2J9B A;  4N4W A;  3ATP A;  1RCP A;  2EIN C;  2WVQ A;  1NU7 D;  1M6T A;  4YL1 A;  2IXP A;  2WZF A;  3C8G A;  1D0Y A;  1V54 C;  2FFH A;  1OKK D;  4JJF A;  5L0J A;  1FAP B;  2NSF A;  4BJ5 A;  3C18 A;  2J46 A;  2Q00 A;  1NFN A;  3IQ6 A;  1O87 A;  1TR2 A;  3DE9 A;  2KW3 C;  1LM3 B;  3JT1 A;  1ZHW A;  4XQ1 A;  4FAP B;  5A6B A;  4CDY A;  2GDC A;  1RXQ A;  3KYI A;  3T6J A;  2J9U A;  3DZA A;  2ZXR A;  2WVO A;  5F28 E;  3A11 A;  2XLO A;  1F1M A;  3JSE O;  2DI3 A;  2LCH A;  4LLC A;  4PFP A;  2EIL C;  4PJJ A;  4WJ0 A;  1AEP A;  2CGE A;  4U5E E;  1QLE C;  4YT5 A;  4LDR A;  3UMH A;  5K0I A;  2R7R A;  3U9J A;  2IXN A;  3ZVR A;  4MVZ A;  1BR4 A;  2OEV A;  5A6J A;  2R03 A;  5L0F A;  5COG A;  3A9C A;  1YZC A;  2GAQ A;  2NUP A;  4OD5 A;  3RQG A;  3ZQV A;  3EGD B;  1FMW A;  2IOQ A;  2CNW D;  4O79 A;  5D91 A;  3T4R A;  2M64 A;  4RBN A;  2IYL D;  3VRC A;  4OIN F;  2VC9 A;  3DE8 A;  3EFO B;  3V7O A;  3GAN A;  4XTK A;  2OU6 A;  2DB4 A;  2MYS A;  2AVK A;  2QY9 A;  4MVR A;  4U5F E;  4MVU A;  3HNL A;  1ZYR F;  3K1I C;  3FXH A;  1WOL A;  1FMV A;  1AUE A;  2PBE A;  3RF3 A;  3RQE A;  3M15 A;  4IRU A;  1FNT c;  3V5X A;  3PMR A;  5JS5 A;  2R7V A;  3JZ0 A;  2ZXP A;  3L0I A;  4E18 A;  5DS4 A;  1QQ3 A;  3UGO A;  2DGJ A;  1CGO A;  1YJG A;  1R5I D;  1Z5Z A;  3L34 A;  2YZS A;  2Y39 A;  3DD7 A;  3JYY A;  1LE4 A;  3K1I A;  3Q6N A;  1EA8 A;  1ORJ A;  3MLG A;  4I1M A;  2QE9 A;  5BQG A;  3DI5 A;  4E7S A;  1NZE A;  2OCC C;  1A41 A;  2X51 A;  2YLD A;  1Q0M A;  1MMN A;  4JW1 A;  4BJ6 A;  5EGY A;  1G5Z A;  3MFN A;  1HW1 A;  1OW8 A;  5L3Q A;  2H7O A;  2XS8 A;  3PDM P;  3UMK A;  2YL3 A;  2EPN A;  3UR3 C;  3C7J A;  1YVI A;  4NTF A;  2L6F A;  3FAJ A;  2KC3 A;  4W8K A;  1YAU O;  1D0X A;  2PX3 A;  2R05 A;  4GQH A;  3EGD A;  3IQ5 A;  3QZC A;  3L1M A;  3L8J A;  1RJ9 B;  3O39 A;  2Y3H A;  1ORY A;  1ZW3 A;  4U5H A;  3W2W A;  1NSG B;  1VB5 A;  2YL1 A;  3EFO A;  2XLM A;  4Q7C A;  3F46 A;  5IY5 C;  1Q0F A;  2ETS A;  2YWA A;  3GEE A;  1H9G A;  3ZSU A;  4JUR I;  1YAR O;  4DXW A;  3SEO A;  2LSE A;  3NMK A;  1TFK B;  1CPR A;  3U2L A;  3LLI A;  1AVO B;  3TOM A;  3WG7 C;  3DAG A;  3N0T A;  4MND A;  1SR2 A;  1YLM A;  1GGQ A;  4CS8 C;  3KPH A;  3E70 C;  3B0P A;  2YVK A;  4DRH B;  2I8B A;  2A6H F;  4MQ9 F;  3SXK A;  2A6E F;  3NYL A;  4IAR A;  1G8X A;  1T6Q A;  4PK4 A;  2WZL A;  4Q5S F;  1T01 A;  5F5H A;  3B0U X;  1YDI A;  4O6Y A;  2DYS C;  1J8M F;  3NKE A;  4MTF A;  3SXY A;  4CIP A;  2KQ9 A;  2I15 A;  4PJN A;  4BEJ A;  2BC5 A;  3JYH A;  4XEV A;  4CJO A;  1M2V A;  3CSK A;  4EWC A;  1B68 A;  4CSA C;  3DKA A;  2H7V C;  2M4E A;  3K7D A;  2MWQ A;  1VMA A;  1H7I A;  1IZM A;  1OR3 A;  2VH3 A;  3K1H A;  4K7B A;  4P6I C;  3S28 A;  3AOU A;  4EIY A;  1KTM A;  2OG2 A;  2HKV A;  1RJ9 A;  4IAQ A;  5E33 A;  3L8I A;  1OR2 A;  4N06 A;  1OKK A;  3AG4 C;  3VM6 A;  2UUI A;  3VYW A;  2XM4 A;  4MW3 A;  4NC3 A;  4DBQ A;  3U0C A;  5B1A C;  1SMY F;  2H7B A;  2W9Y A;  2J45 A;  3QVY A;  3DAF A;  2R7W A;  4JIO A;  1I5N A;  4IAO A;  4U9E A;  1EI7 A;  4LDK A;  3TJ6 A;  2FAP B;  1OXK A;  2Q4F A;  2R7U A;  4JTA B;  3EH1 A;  3H2V A;  1K04 A;  2L9J A;  3FHD A;  2VCC A;  4K0D A;  4CIH A;  3CAX A;  2QLA A;  2OOC A;  3B29 A;  3W2V A;  4ZLD A;  1H9T A;  4BJT A;  2F22 A;  4MW8 A;  3U2M A;  1U0B B;  3IEE A;  3AG3 C;  3AQB A;  5JT4 A;  2JD3 A;  3Q7L A;  3EQL F;  1Q0K A;  2KK1 A;  5JSL A;  2O9X A;  2G62 A;  2YEV A;  4JEA A;  5E2Q A;  3GOR A;  1W2W A;  2BL2 A;  1QKR A;  3LUT B;  2P7V A;  2VAS A;  3G50 A;  3ASO C;  3O6X A;  2CNW A;  2XRH A;  2HMQ A;  4MVQ A;  4YN0 B;  4LER A;  4AK9 A;  4P9F A;  4W8P A;  4XWJ A;  5JVE A;  3KMI A;  1JMW A;  1UG7 A;  4MVO A;  4MVM A;  4EUK B;  4YT8 A;  1FFT C;  1ZVZ A;  5A6A A;  1NG1 A;  3QTH A;  2P61 A;  4MTO A;  2XLH A;  3QMK A;  4C3B A;  4E0I A;  1WAS A;  4CBE A;  1NU9 C;  2CYD A;  2KYH A;  4YT4 A;  3B0V C;  1D1C A;  5AC4 A;  3S90 A;  3HKK A;  3US6 A;  5JRA A;  2R7Q A;  3QW1 A;  4G78 A;  4HEA J;  1GS9 A;  3M1C B;  3N2Z B;  3OEO A;  4JC7 A;  4MVS A;  1M2O A;  5COF A;  4NTB A;  1LVK A;  3U5S A;  1CGM E;  5T1D B;  2ZXW C;  4N6C A;  1OCR C;  1XZQ A;  2PF4 E;  3H2U A;  2VB6 A;  4UDV A;  2RSE B;  3GEH A;  3R2P A;  1HW2 A;  1OCZ C;  2NUT B;  4YL0 A;  1O5H A;  1I4Y A;  3HLZ A;  3S29 A;  3ZIB A;  1JRA A;  5KYY B;  4O6M A;  3JSZ A;  3KYJ A;  3UGP A;  2XLE A;  4JZA A;  2PP4 A;  4KNV A;  4ONS A;  3U9M A;  4BG0 A;  1HE1 A;  4YL3 A;  1WAT A;  3RVY A;  5L0C A;  1YZA A;  2OQM A;  1K05 A;  1QVX A;  4BJ1 A;  3LEO A;  3LNR A;  3NRH A;  3EPV A;  3ITF A;  2J0W A;  4I3M A;  2GA0 A;  3FVY A;  2YL0 A;  1JAF A;  4YT2 A;  4CS9 C;  2XL6 A;  4M63 A;  1L7C A;  3C63 A;  1SZI A;  1HY5 A;  4JE9 A;  4MTG A;  2Y3G A;  1T6I A;  5E3C A;  3TUL A;  2A1D D;  4YWQ A;  2OJQ A;  4U9D A;  2Q9A A;  3C8G D;  4I1O B;  1GQA A;  2LQG A;  3MYF A;  1PCX A;  2ZD9 A;  4HFK B;  5BUO A;  2XXA B;  3DM5 A;  1E85 A;  4XPY A;  3FOO A;  2D4U A;  4HE8 D;  4YJW A;  1TKN A; 
#chains in the Genus database with same CATH homology
 3PHF 2;  4U5G A;  2BE5 F;  5KYY A;  3HJC A;  5EHH A;  4ULW A;  5E3A A;  1MNE A;  3SNH A;  3POV A;  1D1B A;  1ST6 A;  2KGO A;  3LS1 A;  1MMD A;  1VK5 A;  4E7Z A;  3FDQ A;  1SF8 A;  4ANJ A;  4B6I A;  3AG1 C;  2ZXO A;  3OA1 A;  4LAC B;  3HTK C;  4G7Z F;  3EHN A;  3I4U A;  2R7X A;  4U5C E;  1MMG A;  1TWH A;  4IWB A;  4CS8 A;  2J0X A;  2XXA A;  4J30 B;  4C3E A;  1TWC A;  4H4K C;  4ZLC A;  5F5F A;  3H65 A;  1M57 C;  3RKO F;  5FCL A;  3ABK C;  4PFO A;  4OIQ F;  3NDB B;  4PJM A;  4CSA A;  1KU2 A;  2Q9C A;  2NG1 A;  3I5Q A;  2C04 A;  3LLK A;  5KYU B;  2IXM A;  2HV6 A;  4JVS A;  4IJJ A;  2KNH A;  4U5B E;  1ZU5 A;  3Q6M A;  3ASN C;  3TD7 A;  2J7P D;  3DXJ F;  3SP1 A;  1BR2 A;  3KL4 A;  5L3V A;  5CI9 A;  5B1B C;  1FTS A;  4GEH A;  3RFY A;  4A2N B;  3EG9 B;  3SZR A;  2E87 A;  2WB7 A;  4OD4 A;  2Q9B A;  5DLJ A;  3CQZ A;  3KH2 A;  4F4B A;  1D0Z A;  2B0J A;  5T3W A;  3X2Q C;  1ZHZ A;  2J9W A;  5HSW A;  1J8Y F;  3AQC A;  3EZH A;  3T6B A;  1MMA A;  4FWV A;  4RDA A;  4FX5 A;  4GYT A;  3ZG1 A;  3VAY A;  1LKX A;  4C7O B;  3EHM A;  4CS7 A;  1VYK A;  3W8I A;  4BJ5 C;  2EIJ C;  4OIP F;  3K33 A;  3DJU B;  3K6B A;  3CZ6 A;  2L81 A;  4AX2 A;  3NG1 A;  4G0H A;  2J9V A;  4DVZ A;  1PD1 A;  5DS6 A;  1LS1 A;  5DQZ A;  3EG9 A;  4I44 A;  3NKD A;  2KJG A;  3NYM A;  5B3S C;  1JPJ A;  3UNG C;  1OCO C;  1M56 C;  1JPN A;  2XSE A;  4DVY P;  1IW7 F;  4J32 B;  2HV7 A;  2R7T A;  4HFF B;  4NY3 A;  3LS0 A;  4FES A;  1OCC C;  4X0R A;  1QZX A;  4C7O A;  1N1C A;  1Z63 A;  1BR1 A;  2P6V A;  3OWT A;  4CS9 A;  4KBL A;  1Z6A A;  3I5P A;  3RH3 A;  2DYR C;  3KKB A;  2NUT A;  3N24 A;  4C3D A;  2V26 A;  2R7S A;  2PFD A;  4BJ6 C;  5CI8 A;  4OIR F;  1VOM A;  1ZHT A;  3S27 A;  1TKN A;  2D5R B;  2A68 F;  2W4B A;  4Q4Z F;  3W8H A;  3UMI A;  3WOD F;  2R7O A;  3EH2 A;  4LLE A;  1WGW A;  4QI0 A;  2CDQ A;  1ZU4 A;  4XLN F;  2YHS A;  1D1A A;  2GFH A;  2ZPA A;  4JJG A;  5DQT A;  1TWG A;  3EGX B;  1M2V B;  2Y3B A;  3DMD A;  2CW0 F;  2QTV A;  2J7P A;  5DS5 A;  3RYL A;  3SYN A;  4G7H F;  3K66 A;  2G3K A;  5T3T A;  1FFH A;  3NYJ A;  4OIO F;  2Y69 C;  2FGY A;  2Y3D A;  3JCU Q;  4KNW A;  5KYW B;  4QI2 A;  1MND A;  4AE4 B;  3LAY A;  1ZHY A;  1ZHX A;  2PX0 A;  3E9V A;  2WZG A;  3LEV A;  3ZC4 A;  3DJN B;  5KYX B;  3Q7G A;  4KC9 A;  2XL4 A;  2Z15 A;  3DM9 B;  1TWA A;  3MX3 A;  5DVW A;  1V55 C;  3ECS A;  3EGX A;  3ABM C;  4DBR A;  5KYN A;  2C03 A;  1PD0 A;  2Q3T A;  4KI2 A;  2A69 F;  3S0X A;  4RD9 A;  1Z3I X;  3RIP A;  3LJB A;  3F47 A;  2W45 A;  4QDL A;  3JRT A;  2EIK C;  4XLP F;  4O6N A;  5KYW A;  2WVN A;  2IXO A;  4JCH A;  5D92 A;  4AE4 A;  4DOZ A;  4PJL A;  4U5D E;  3EZI A;  3B9Q A;  2W4M A;  2G3V A;  2EIM C;  1Z23 A;  2V3C C;  4O7G A;  1VYI A;  5KYX A;  1S7Z A;  2NUP B;  3AG2 C;  3LES A;  2WL8 A;  3ABL C;  5KYU A;  4G7O F;  4EBB A;  3GOD A;  2EIN C;  2WVQ A;  1NU7 D;  2IXP A;  2WZF A;  1D0Y A;  1V54 C;  2FFH A;  1OKK D;  4JJF A;  4BJ5 A;  2J46 A;  1O87 A;  1TR2 A;  3JT1 A;  2KW3 C;  1ZHW A;  3T6J A;  2J9U A;  3DZA A;  2ZXR A;  2WVO A;  4LLC A;  4PFP A;  2EIL C;  4PJJ A;  4WJ0 A;  2CGE A;  4U5E E;  1QLE C;  4YT5 A;  3UMH A;  2R7R A;  3ZVR A;  2IXN A;  1BR4 A;  4OD5 A;  2NUP A;  3EGD B;  1FMW A;  2IOQ A;  2CNW D;  4O79 A;  5D91 A;  3T4R A;  4RBN A;  2IYL D;  4OIN F;  3EFO B;  3V7O A;  3GAN A;  4XTK A;  2MYS A;  2QY9 A;  4U5F E;  2R7V A;  1ZYR F;  3K1I C;  1FMV A;  4IRU A;  3PMR A;  2ZXP A;  3L0I A;  5DS4 A;  3UGO A;  2DGJ A;  1Z5Z A;  3L34 A;  2YZS A;  2Y39 A;  3DD7 A;  3Q6N A;  4I1M A;  4E7S A;  3MLG A;  1NZE A;  2OCC C;  2X51 A;  4JW1 A;  1MMN A;  4BJ6 A;  5EGY A;  5L3Q A;  2H7O A;  3UMK A;  3UR3 C;  3FAJ A;  4W8K A;  1D0X A;  2PX3 A;  3EGD A;  3QZC A;  1RJ9 B;  3O39 A;  2Y3H A;  4U5H A;  3W2W A;  3X1O A;  3B0U X;  3EFO A;  4Q7C A;  3F46 A;  5IY5 C;  3ZSU A;  4JUR I;  3SEO A;  2LSE A;  3LLI A;  3WG7 C;  3DAG A;  3N0T A;  4MND A;  4CS8 C;  3E70 C;  3B0P A;  2I8B A;  2A6H F;  4MQ9 F;  2A6E F;  3NYL A;  1G8X A;  4PK4 A;  2WZL A;  4Q5S F;  5F5H A;  4O6Y A;  2DYS C;  1J8M F;  3NKE A;  2KQ9 A;  4PJN A;  4BEJ A;  3JYH A;  4EWC A;  1M2V A;  3CSK A;  4CSA C;  2H7V C;  2M4E A;  3K7D A;  2MWQ A;  1VMA A;  3S28 A;  1IZM A;  2VH3 A;  3K1H A;  4K7B A;  4P6I C;  2OG2 A;  5E33 A;  1RJ9 A;  4N06 A;  1OKK A;  3AG4 C;  3VYW A;  4DBQ A;  5B1A C;  1SMY F;  2H7B A;  2W9Y A;  2J45 A;  2R7W A;  3DAF A;  4IAO A;  2R7U A;  3EH1 A;  2L9J A;  3FHD A;  4K0D A;  4CIH A;  4ZLD A;  3W2V A;  4BJT A;  3IEE A;  3AG3 C;  3AQB A;  2JD3 A;  3Q7L A;  3EQL F;  2O9X A;  2G62 A;  2YEV A;  5E2Q A;  1W2W A;  2P7V A;  2VAS A;  3ASO C;  3O6X A;  2CNW A;  2XRH A;  4YN0 B;  4LER A;  4AK9 A;  4XWJ A;  3KMI A;  4YT8 A;  1FFT C;  1NG1 A;  3QMK A;  4C3B A;  4CBE A;  1NU9 C;  4YT4 A;  3B0V C;  1D1C A;  2R7Q A;  4HEA J;  3M1C B;  3N2Z B;  3OEO A;  1M2O A;  1LVK A;  5T1D B;  2ZXW C;  1OCR C;  2PF4 E;  2VB6 A;  1OCZ C;  2NUT B;  1O5H A;  3HLZ A;  3S29 A;  3ZIB A;  5KYY B;  4O6M A;  3JSZ A;  3UGP A;  4JZA A;  2PP4 A;  4KNV A;  4BG0 A;  4BJ1 A;  3LNR A;  3NRH A;  3EPV A;  3ITF A;  2J0W A;  4I3M A;  3FVY A;  4YT2 A;  4CS9 C;  4M63 A;  1SZI A;  2Y3G A;  5E3C A;  2A1D D;  4YWQ A;  2Q9A A;  4I1O B;  1PCX A;  4HFK B;  5BUO A;  2XXA B;  3DM5 A;  4HE8 D;  4YJW A;  3EJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...