1QSPA

Crystal structure of the yeast phosphorelay protein ypd1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
TIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPD1
publication title Conservation of structure and function among histidine-containing phosphotransfer (HPt) domains as revealed by the crystal structure of YPD1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 62
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1qspA00
1QSPA 4EUKB 1C03A 2LCHA 1FR0A 1OXBA 1BDJB 2Q4FA 3KYJA 1OXKA 3KYIA 1I5NA 1C02A 1TQGA 2LP4A 1YVIA 2R25A 1WN0A 3MYFA 1SR2A 4G78A 4PACA 2LD6A 3US6A 1A0BA 1Y6DA 2A0BA 2OOCA 3IQTA 3U3BA
chains in the Genus database with same CATH superfamily
3F46A 1LE2A 4LDRA 1IZMA 3EGXA 4Q4ZF 5E2QA 4O79A 2W4MA 4NTBA 3TULA 3SYNA 3IHUA 3UGPA 4PJMA 4AE4B 1TWCA 4HE8D 5BUOA 1OW8A 4XLPF 3DJNB 4DBQA 2HMZA 1PD1A 3NKDA 2RSEB 3K7DA 2EPMX 5DS5A 4ZLDA 5AGFA 1M6TA 4YT8A 5JVEA 1J8YF 4WJ0A 5BQIA 1NBBA 5HSWA 1QZXA 3KMIA 1PD0A 1WASA 2A0UA 3B9QA 2CNWD 4IWBA 4N6HA 3H2VA 1VB5A 3KKBA 3EFOA 2XM4A 4DXWA 3U2LA 3V5ZA 3UMHA 1SF8A 2HS5A 2NUPA 3DJUB 4H4KC 1MMNA 4XEFA 3T9OA 4J7TA 1WATA 4OD5A 3V5XA 2R7XA 3N0TA 1TFKB 5GPGB 2CNWA 5JLIA 2HV6A 3ZVRA 2WL8A 1G8XA 4FESA 4MW3A 4N06A 2EPOA 2AWCA 3JCUQ 1WTYA 5KYUA 2AVKA 3ASNC 1JAFA 5B1BC 3LNMB 1E86A 3C8GB 5JT4A 3S0XA 3FOPA 3O39A 4B6IA 2YEVA 4WGYA 4CS9A 3B0VC 4GQHA 4BJ1A 2J9UA 4XTKA 2NPUA 2TMVP 2RD9A 5T3WA 2NG1A 2OJED 4BEJA 3ITFA 3TJ6A 3MLGA 3C8ZA 4OIRF 1YZCA 1BBHA 5HV9A 2KC3A 2OKUA 1Q0DA 2QY9A 3M1CB 2G3VA 4JCZA 4ULWA 3SNHA 3VRCA 3AG1C 1OCOC 1RJ9A 2OJQA 2VC9A 2YZSA 3CEXA 3G4ZA 4N6CA 4C7OA 2Q9CA 2KK1A 2XL8A 5A69A 2EPNA 1SZIA 2XLVA 2V26A 2FFHA 2H7VC 2VCCA 5E3CA 1GQAA 4JKVA 1GM5A 3KYJA 1ZU5A 3B0PA 2I15A 2Q00A 4CS9C 1WOLA 3EG9B 4XQ1A 2YL7A 4JCHA 2A6EF 1XWJA 1I5NA 2PNOA 4K7BA 3K66A 1BR2A 4GYTA 2BL2A 2D4UA 4U5HA 3EGXB 4YL0A 1NU9C 2LP4A 5DVWA 5JSLA 2HMQA 4O6YA 4EBJA 4WABA 1BZ4A 1YZAA 3QW1A 4A4AA 3LNRA 1SR2A 1TWAA 2JX0A 3O55A 2VCBA 2Y39A 5AC4A 1XZPA 4NC3A 2IXNA 4P9FA 3AQCA 3X2QC 3HJCA 5DQTA 5L3VA 3SXZA 4MVSA 3AG2C 1MMAA 4AX2A 2HKVA 4C3EA 2QUPA 3J06A 2F22A 3ECSA 1MMDA 3FXHA 4OIOF 3EFOB 1MMGA 1FFTC 1NLXA 2NUPB 4GEHA 3CZ6A 4CSAA 4JJFA 2YQYA 3K1IA 4P6IC 3DAFA 4O6NA 3QVYA 4JEAA 1OKKD 2KYHA 2J7PD 3NMJA 1D1CA 3K6BA 2QTVA 4Q7CA 3ZQYA 2J9WA 3CSKA 3ZSUA 4JZAA 5JP7A 3G50A 5KYUB 5KYWA 2AP3A 2H7OA 1E84A 4G78A 4DBRA 2J7PA 3L8IA 4NQFA 5COFA 1FTSA 3NYMA 1H6GA 3ZC4A 4YK5A 1T6QA 4BJ5A 5K0IA 1G4US 4K0DA 1TKNA 2KGOA 3QTHA 3MBGA 2LCHA 4AL1A 4D4XA 1HE1A 1S7ZA 4CSAC 3K1IC 2IXOA 1VLSA 1L3PA 3O6XA 2PP4A 4YN0B 1RJ9B 3NYJA 3TD7A 3W2WA 3KYIA 4BEMJ 4PFPA 1TWHA 1GS9A 3F47A 2R7SA 2J0XA 4RD9A 2PF4E 4YWQA 3EH1A 4J7YA 1AUEA 2YVKA 3T6JA 2W4BA 1LI5A 2DGJA 1OCCC 4XPXA 3RKOF 3RW0A 3RIPA 1QPUA 4HEAJ 3SEOA 2I8BA 3LAYA 1FFHA 3S29A 2DI3A 1HE9A 3U9JA 2Q9AA 3QMKA 5FZTA 1ZVZA 3OWTA 4BJ5C 2OCCC 1A7VA 2XL4A 4G0HA 4PFOA 4OIPF 1DOVA 3V5YA 4PJJA 1SYQA 1O87A 5D91A 1RKEA 2WZLA 1QSPA 4DRIB 1M2VA 2OQMA 3T4RA 4HFFB 1Q0GA 1LI7A 4JE9A 5E3AA 3LEVA 2XLHA 3KH2A 4CIHA 3R2PA 5A6BA 3DZAA 1YDIA 3GM1A 1Z63A 3DE9A 3JSEO 4U9DA 2OG2A 3ZDLA 3ABMC 4CDYA 3DI5A 1LS4A 1C17M 2L6HA 4CJOA 2WVNA 3DAGA 3S90A 3MYFA 2YKZA 2YRFA 3JT1A 2EIJC 4EKWA 5CIVA 1M57C 3VF0A 4XLNF 3JRTA 3MX3A 4H54A 1LVKA 1VYIA 5BQHA 3AGUA 1CGOA 4I3MA 5KYWB 4MS2A 3EPVA 4OINF 5JS5A 1RKCA 2OEXA 1KU2A 4N4WA 3RF3A 1T6UA 2E87A 3JYHA 3I5PA 3U8VA 2V3CC 2KJGA 2UUHA 2WB7A 4C3BA 4YT4A 3EZIA 2O9XA 1TWGA 3M4BA 1QLEC 3CAXA 4JW1A 4CS8A 4DVYP 2VB6A 4G7ZF 1OR2A 3W2VA 256BA 5DQZA 1RCPA 5IY5C 1MNDA 2AWYA 1ORYA 3UNGC 2KW3C 2M4EA 3DXJF 4U5BE 5F28E 1L7CA 2R25A 3RVYA 4JEBA 4MTGA 3US6A 2EINC 3EJNA 3FAJA 2R7OA 1O5HA 4R32A 1VOMA 2Y3GA 3CQZA 4Z9HA 4E7SA 3PDMP 1KTMA 2Q9BA 2VCAA 5A6KA 3AGTA 4BPMA 2BC5A 3DD7A 3GANA 5L0IA 2HV7A 4CIPA 1VK5A 4JTDB 1JRAA 2X51A 3NG1A 2FGYA 1D0ZA 2P7VA 3W8HA 3ATPA 1EA8A 4YT2A 3LEOA 2R02A 4CS8C 1GGQA 2HSBA 1UG7A 4CJGA 3VAYA 4QI2A 1EKYA 4EBKA 3OA1A 2HFIA 2J8WA 1Z3IX 2JPUA 3FDQA 1E83A 2XLMA 2IOQA 2XXAA 1RKEB 2G62A 2HZ8A 2EPKX 3VM6A 1M2VB 4KNWA 4KNVA 1TQGA 1W2WA 1HW2A 4U5CE 2ZXWC 3BEHA 4X0RA 3U9MA 1FR0A 4E17A 2ZD9A 2OEVA 1VYKA 1U89A 3L1MA 3UMIA 3UGOA 3WAQA 2Q7RA 4KC9A 1MQVA 2AU5A 3DKAA 2R05A 2WZGA 3FAPB 3NRHA 3WG7C 4F4BA 5AC5A 1AVOB 4NCQA 2NSFA 3A9CA 3EGDA 4IARA 3RQGA 1NSGB 2B0JA 3RVZA 3FOOA 3KL4A 3U3FA 3ZG1A 1S05A 2OU6A 4OD4A 3E9VA 4I1OB 3RQFA 1Z6AA 3QW0A 4IJJA 1YAUO 3ZQVA 5COGA 1D0YA 1CPRA 2P61A 2XLEA 4QI0A 1ZHTA 2IYLD 4JIOA 4NY3A 2WVOA 4FWVA 1YYJA 3U5SA 4IGGA 3TJ5A 3SXKA 3HTKC 3JRMO 3HNIA 4YT5A 4PK4A 3H2UA 3WODF 2ZXRA 5EGYA 1OCZC 4Z9IA 3RYLA 1HY5A 2LD6A 4JTAB 4M63A 4XEKA 1OKKA 1EQ1A 2VASA 1EI7A 3N24A 4BG0A 4BJ6A 2LK4A 2OOCA 2D5RB 3R7CA 4LDKA 2R7UA 3ZTMA 2IXMA 2Z15A 4FX5A 4KBLA 4AL0A 5F5HA 2HUJA 2YHSA 3QVZA 1YLMA 2LQGA 4U5FE 4LLCA 3LESA 4PJNA 2ZXOA 4IAOA 1VLTA 1BDJB 4NTFA 2PBEA 1U6HA 3GWNA 4ULVA 2DB4A 4MVQA 5CI8A 2G3KA 2FAPB 3Q6NA 1U0BB 1G5ZA 2UUIA 3MFNA 1OW7A 3MYIA 3U8PA 4CDAA 4C7OB 4EBBA 3KPHA 1D1AA 2PX0A 4CS7A 1V54C 2NUTA 5DS6A 3S9OA 2EILC 1HMDA 3EH2A 1YA7O 4XPWA 4MVRA 4CBEA 4KI2A 2XSEA 4BJ6C 1IW7F 2KQ9A 2Q3TA 1RXQA 3LLKA 5A6AA 4ONSA 5JUAA 4RBNA 4LDQA 5T3TA 1JMWA 5A6JA 4LACB 4U9EA 3LS0A 1Z7Qc 4MQ9F 4PJLA 1LIHA 2YL1A 3EQLF 1T01A 2LFDA 2L9JA 2EPLX 1OR3A 5EK0A 4EUKB 2CW0F 2WZFA 1F1MA 1ZHZA 4E18A 1LE4A 1E2XA 2Y3DA 4ZLCA 5DS4A 4J32B 1FNTc 1A7DA 1XZQA 2LSEA 1OXKA 4JVSA 4E0HA 1FMVA 5BQGA 3Q6MA 1V4AA 4EIYA 1MNEA 3EGDB 2DYRC 3G4XA 4IAQA 3B29A 3Q7GA 4U5EE 3Q7LA 2X0CA 4DRJB 2EIMC 3IQ5A 4MVMA 1ZW2A 2A6HF 4D4NA 2XM0A 4YL3A 3TK0A 3TQOA 4DRHB 3IQCA 2IXPA 1TR2A 5L0JA 1ZYRF 2R03A 3FVYA 2J0WA 4PACA 1A0BA 3W4YA 3T6BA 5KYNA 2A0BA 1Z5ZA 3I5QA 3AQBA 3N2ZB 4UDVA 1ZU4A 1JR8A 3M79A 1K40A 1VMAA 2J9VA 1HW1A 2JD3A 4BJTA 3GEEA 3U0CA 4IRUA 2P6VA 3S84A 2VH3A 2Y3BA 4JTCB 4HFKB 1UFBA 1HMOA 2IM8A 1ZZPA 3H65A 2GAQA 4MTOA 4O7GA 2QE9A 2IBFA 3GM2A 4C3DA 5KYYA 3HKKA 2R7RA 2GDCA 4DOZA 3WHNA 5F5FA 1SMYF 2HJMA 4MNDA 1Q0FA 1M56C 1YJGA 3C18A 2CYDA 3X1OA 3B0UX 2LFFA 1OW6A 2KSFA 4A2NB 2R7WA 2R7TA 2M64A 3PMRA 5L0GA 2R9RB 2R7VA 1YVIA 5E33A 1H9TA 2L6GA 3IEEA 3ZIBA 3ZWIA 5B3SC 1PV3A 2EIKC 1JOGA 4LERA 4MW8A 4YJWA 5B1AC 4NTAA 4FAPB 4U5GA 3C62A 4YL1A 2W45A 3NDBB 2NUTB 1BR4A 5D92A 3ZTZA 1A41A 4CDVA 4J30B 3ABLC 3AOUA 1CGME 1BR1A 1I4ZA 3ASOC 4K1OA 4JC7A 2QLAA 3JYYA 5L0DA 5L0HA 2R7QA 3GEIA 1D1BA 3TOLA 1OQCA 1LKXA 2GFHA 2ETSA 2J46A 3FMSA 1I4YA 2XRHA 1V74B 4XPYA 3HNKA 4QDLA 1KNYA 2CDQA 2XLWA 2YL0A 2C04A 1M2OA 1O3UA 3GM3A 4LLEA 4RDAA 5FCLA 3SZRA 2ASRA 1T6IA 1QVXA 2BE5F 2YL3A 3RH3A 1NU7D 2YLIA 2A68F 1CPQA 2L6FA 3SXMA 3ABKC 4XEVA 1WGWA 5JRAA 2A1DD 2HSQA 2QNLA 3UMKA 1NFOA 3IQTA 3C7JA 1NFNA 3NYLA 3UR3C 2B0HA 1JPNA 2PX3A 3S27A 2MHRA 2C03A 2H7BA 2WVQA 3M15A 3VYWA 1C03A 3AG4C 4MTFA 1ZHYA 2J45A 3T6GB 2ZPAA 3LS1A 4Z9JA 3DMDA 3EZHA 1T9KA 1Z23A 3AG3C 3HNJA 1PCXA 4I44A 3LUTB 3DM5A 3JTLO 4Q5SF 4JRZA 3K33A 5T1DB 3GEHA 3LLIA 5DLJA 1TFOB 4OIQF 2XS8A 2HJ3A 3OEOA 5KYYB 4AK9A 2J9BA 4EHPA 1K05A 5KYXA 5L0FA 4G7OF 4W8KA 2H8AA 1H7IA 3L34A 1OCRC 1G4WR 3L8JA 1ORSC 3AJMA 3EHNA 1T5OA 3HLZA 3NMIA 1LPEA 3I4UA 4PR9A 3PCVA 2GWWA 3B71A 1R5ID 4L6RA 2YWAA 3HNLA 1WWPA 4AE4A 3QZCA 3O10A 4IB4A 3A11A 3GORA 1APCA 3GODA 3RQEA 1K04A 4ANJA 1YARO 1OXBA 5L3QA 2LIGA 2Q4FA 3EHMA 1A7EA 2ZXPA 1J8MF 2Y69C 3W8IA 1E85A 3C63A 3E70C 2GA0A 4W8PA 1RMVA 4WGZA 4E7ZA 3K1HA 2ICWG 4G7HF 2A69F 1V55C 1H9GA 1LM3B 1C02A 1NG1A 2XS1A 1YA9A 2CCYA 4JJGA 1B68A 1D0XA 1ORJA 1Q0KA 4P9TA 2MWQA 3PHF2 1Q0MA 2PFDA 3C8GD 4DVZA 1YYXA 1QQ3A 1QKRA 2XL6A 2XLDA 2YLGA 2YLDA 4O6MA 4ER9A 3DE8A 1NZEA 4U5DE 5CI9A 4JURI 2XXAB 5L0CA 1LS1A 3LJBA 1ZHXA 3C8GA 5COMA 3U3BA 3M4CA 4EWCA 2NSGA 3JZ0A 3IQ6A 1Y4CA 2KNHA 3GWLA 3NMKA 1ST6A 3BRJA 3SP1A 3POVA 5EHHA 3TOMA 5KYXB 3U2MA 4E0IA 3NKEA 2W9YA 5TJ5E 2P1AA 5B3IA 1FAPB 2DYSC 1ZHWA 1R4TA 2Y3HA 3DWWA 3IPMO 3JSZA 1JPJA 1VTMP 4MVOA 3V7OA 1N1CA 3SXYA 2CGEA 4MVZA 1FMWA 1WN0A 1ZW3A 2L7AA 2L81A 4DJ9A 1Y6DA 4MVUA 2P0NA 4CX9A 1AEPA 4I1MA 1CGNA 3L0IA 3RFYA 5A6BD 3EG9A 2XLOA 3FHDA 2MYSA 3S28A 4XWJA 3DM9B 1DOWA
chains in the Genus database with same CATH topology
1QSPA 4EUKB 1C03A 2LCHA 1FR0A 1OXBA 1BDJB 2Q4FA 3KYJA 1OXKA 3KYIA 1I5NA 1C02A 1TQGA 2LP4A 1YVIA 2R25A 1WN0A 3MYFA 1SR2A 4G78A 4PACA 2LD6A 3US6A 1A0BA 1Y6DA 2A0BA 2OOCA 3IQTA 3U3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QSP A;  4EUK B;  1C03 A;  2LCH A;  1FR0 A;  1OXB A;  1BDJ B;  2Q4F A;  3KYJ A;  1OXK A;  3KYI A;  1I5N A;  1C02 A;  1TQG A;  2LP4 A;  1YVI A;  2R25 A;  1WN0 A;  3MYF A;  1SR2 A;  4G78 A;  4PAC A;  2LD6 A;  3US6 A;  1A0B A;  1Y6D A;  2A0B A;  2OOC A;  3IQT A;  3U3B A; 
#chains in the Genus database with same CATH topology
 3F46 A;  1LE2 A;  4LDR A;  1IZM A;  3EGX A;  4Q4Z F;  5E2Q A;  4O79 A;  2W4M A;  4NTB A;  3TUL A;  3SYN A;  3IHU A;  3UGP A;  4PJM A;  4AE4 B;  1TWC A;  4HE8 D;  5BUO A;  1OW8 A;  4XLP F;  3DJN B;  4DBQ A;  2HMZ A;  1PD1 A;  3NKD A;  2RSE B;  3K7D A;  2EPM X;  5DS5 A;  4ZLD A;  5AGF A;  1M6T A;  4YT8 A;  5JVE A;  1J8Y F;  4WJ0 A;  5BQI A;  1NBB A;  5HSW A;  1QZX A;  3KMI A;  1PD0 A;  1WAS A;  2A0U A;  3B9Q A;  2CNW D;  4IWB A;  4N6H A;  3H2V A;  1VB5 A;  3KKB A;  3EFO A;  2XM4 A;  4DXW A;  3U2L A;  3V5Z A;  3UMH A;  1SF8 A;  2HS5 A;  2NUP A;  3DJU B;  4H4K C;  1MMN A;  4XEF A;  3T9O A;  4J7T A;  1WAT A;  4OD5 A;  3V5X A;  2R7X A;  3N0T A;  1TFK B;  5GPG B;  2CNW A;  5JLI A;  2HV6 A;  3ZVR A;  2WL8 A;  1G8X A;  4FES A;  4MW3 A;  4N06 A;  2EPO A;  2AWC A;  3JCU Q;  1WTY A;  5KYU A;  2AVK A;  3ASN C;  1JAF A;  5B1B C;  3LNM B;  1E86 A;  3C8G B;  5JT4 A;  3S0X A;  3FOP A;  3O39 A;  4B6I A;  2YEV A;  4WGY A;  4CS9 A;  3B0V C;  4GQH A;  4BJ1 A;  2J9U A;  4XTK A;  2NPU A;  2TMV P;  2RD9 A;  5T3W A;  2NG1 A;  2OJE D;  4BEJ A;  3ITF A;  3TJ6 A;  3MLG A;  3C8Z A;  4OIR F;  1YZC A;  1BBH A;  5HV9 A;  2KC3 A;  2OKU A;  1Q0D A;  2QY9 A;  3M1C B;  2G3V A;  4JCZ A;  4ULW A;  3SNH A;  3VRC A;  3AG1 C;  1OCO C;  1RJ9 A;  2OJQ A;  2VC9 A;  2YZS A;  3CEX A;  3G4Z A;  4N6C A;  4C7O A;  2Q9C A;  2KK1 A;  2XL8 A;  5A69 A;  2EPN A;  1SZI A;  2XLV A;  2V26 A;  2FFH A;  2H7V C;  2VCC A;  5E3C A;  1GQA A;  4JKV A;  1GM5 A;  3KYJ A;  1ZU5 A;  3B0P A;  2I15 A;  2Q00 A;  4CS9 C;  1WOL A;  3EG9 B;  4XQ1 A;  2YL7 A;  4JCH A;  2A6E F;  1XWJ A;  1I5N A;  2PNO A;  4K7B A;  3K66 A;  1BR2 A;  4GYT A;  2BL2 A;  2D4U A;  4U5H A;  3EGX B;  4YL0 A;  1NU9 C;  2LP4 A;  5DVW A;  5JSL A;  2HMQ A;  4O6Y A;  4EBJ A;  4WAB A;  1BZ4 A;  1YZA A;  3QW1 A;  4A4A A;  3LNR A;  1SR2 A;  1TWA A;  2JX0 A;  3O55 A;  2VCB A;  2Y39 A;  5AC4 A;  1XZP A;  4NC3 A;  2IXN A;  4P9F A;  3AQC A;  3X2Q C;  3HJC A;  5DQT A;  5L3V A;  3SXZ A;  4MVS A;  3AG2 C;  1MMA A;  4AX2 A;  2HKV A;  4C3E A;  2QUP A;  3J06 A;  2F22 A;  3ECS A;  1MMD A;  3FXH A;  4OIO F;  3EFO B;  1MMG A;  1FFT C;  1NLX A;  2NUP B;  4GEH A;  3CZ6 A;  4CSA A;  4JJF A;  2YQY A;  3K1I A;  4P6I C;  3DAF A;  4O6N A;  3QVY A;  4JEA A;  1OKK D;  2KYH A;  2J7P D;  3NMJ A;  1D1C A;  3K6B A;  2QTV A;  4Q7C A;  3ZQY A;  2J9W A;  3CSK A;  3ZSU A;  4JZA A;  5JP7 A;  3G50 A;  5KYU B;  5KYW A;  2AP3 A;  2H7O A;  1E84 A;  4G78 A;  4DBR A;  2J7P A;  3L8I A;  4NQF A;  5COF A;  1FTS A;  3NYM A;  1H6G A;  3ZC4 A;  4YK5 A;  1T6Q A;  4BJ5 A;  5K0I A;  1G4U S;  4K0D A;  1TKN A;  2KGO A;  3QTH A;  3MBG A;  2LCH A;  4AL1 A;  4D4X A;  1HE1 A;  1S7Z A;  4CSA C;  3K1I C;  2IXO A;  1VLS A;  1L3P A;  3O6X A;  2PP4 A;  4YN0 B;  1RJ9 B;  3NYJ A;  3TD7 A;  3W2W A;  3KYI A;  4BEM J;  4PFP A;  1TWH A;  1GS9 A;  3F47 A;  2R7S A;  2J0X A;  4RD9 A;  2PF4 E;  4YWQ A;  3EH1 A;  4J7Y A;  1AUE A;  2YVK A;  3T6J A;  2W4B A;  1LI5 A;  2DGJ A;  1OCC C;  4XPX A;  3RKO F;  3RW0 A;  3RIP A;  1QPU A;  4HEA J;  3SEO A;  2I8B A;  3LAY A;  1FFH A;  3S29 A;  2DI3 A;  1HE9 A;  3U9J A;  2Q9A A;  3QMK A;  5FZT A;  1ZVZ A;  3OWT A;  4BJ5 C;  2OCC C;  1A7V A;  2XL4 A;  4G0H A;  4PFO A;  4OIP F;  1DOV A;  3V5Y A;  4PJJ A;  1SYQ A;  1O87 A;  5D91 A;  1RKE A;  2WZL A;  1QSP A;  4DRI B;  1M2V A;  2OQM A;  3T4R A;  4HFF B;  1Q0G A;  1LI7 A;  4JE9 A;  5E3A A;  3LEV A;  2XLH A;  3KH2 A;  4CIH A;  3R2P A;  5A6B A;  3DZA A;  1YDI A;  3GM1 A;  1Z63 A;  3DE9 A;  3JSE O;  4U9D A;  2OG2 A;  3ZDL A;  3ABM C;  4CDY A;  3DI5 A;  1LS4 A;  1C17 M;  2L6H A;  4CJO A;  2WVN A;  3DAG A;  3S90 A;  3MYF A;  2YKZ A;  2YRF A;  3JT1 A;  2EIJ C;  4EKW A;  5CIV A;  1M57 C;  3VF0 A;  4XLN F;  3JRT A;  3MX3 A;  4H54 A;  1LVK A;  1VYI A;  5BQH A;  3AGU A;  1CGO A;  4I3M A;  5KYW B;  4MS2 A;  3EPV A;  4OIN F;  5JS5 A;  1RKC A;  2OEX A;  1KU2 A;  4N4W A;  3RF3 A;  1T6U A;  2E87 A;  3JYH A;  3I5P A;  3U8V A;  2V3C C;  2KJG A;  2UUH A;  2WB7 A;  4C3B A;  4YT4 A;  3EZI A;  2O9X A;  1TWG A;  3M4B A;  1QLE C;  3CAX A;  4JW1 A;  4CS8 A;  4DVY P;  2VB6 A;  4G7Z F;  1OR2 A;  3W2V A;  256B A;  5DQZ A;  1RCP A;  5IY5 C;  1MND A;  2AWY A;  1ORY A;  3UNG C;  2KW3 C;  2M4E A;  3DXJ F;  4U5B E;  5F28 E;  1L7C A;  2R25 A;  3RVY A;  4JEB A;  4MTG A;  3US6 A;  2EIN C;  3EJN A;  3FAJ A;  2R7O A;  1O5H A;  4R32 A;  1VOM A;  2Y3G A;  3CQZ A;  4Z9H A;  4E7S A;  3PDM P;  1KTM A;  2Q9B A;  2VCA A;  5A6K A;  3AGT A;  4BPM A;  2BC5 A;  3DD7 A;  3GAN A;  5L0I A;  2HV7 A;  4CIP A;  1VK5 A;  4JTD B;  1JRA A;  2X51 A;  3NG1 A;  2FGY A;  1D0Z A;  2P7V A;  3W8H A;  3ATP A;  1EA8 A;  4YT2 A;  3LEO A;  2R02 A;  4CS8 C;  1GGQ A;  2HSB A;  1UG7 A;  4CJG A;  3VAY A;  4QI2 A;  1EKY A;  4EBK A;  3OA1 A;  2HFI A;  2J8W A;  1Z3I X;  2JPU A;  3FDQ A;  1E83 A;  2XLM A;  2IOQ A;  2XXA A;  1RKE B;  2G62 A;  2HZ8 A;  2EPK X;  3VM6 A;  1M2V B;  4KNW A;  4KNV A;  1TQG A;  1W2W A;  1HW2 A;  4U5C E;  2ZXW C;  3BEH A;  4X0R A;  3U9M A;  1FR0 A;  4E17 A;  2ZD9 A;  2OEV A;  1VYK A;  1U89 A;  3L1M A;  3UMI A;  3UGO A;  3WAQ A;  2Q7R A;  4KC9 A;  1MQV A;  2AU5 A;  3DKA A;  2R05 A;  2WZG A;  3FAP B;  3NRH A;  3WG7 C;  4F4B A;  5AC5 A;  1AVO B;  4NCQ A;  2NSF A;  3A9C A;  3EGD A;  4IAR A;  3RQG A;  1NSG B;  2B0J A;  3RVZ A;  3FOO A;  3KL4 A;  3U3F A;  3ZG1 A;  1S05 A;  2OU6 A;  4OD4 A;  3E9V A;  4I1O B;  3RQF A;  1Z6A A;  3QW0 A;  4IJJ A;  1YAU O;  3ZQV A;  5COG A;  1D0Y A;  1CPR A;  2P61 A;  2XLE A;  4QI0 A;  1ZHT A;  2IYL D;  4JIO A;  4NY3 A;  2WVO A;  4FWV A;  1YYJ A;  3U5S A;  4IGG A;  3TJ5 A;  3SXK A;  3HTK C;  3JRM O;  3HNI A;  4YT5 A;  4PK4 A;  3H2U A;  3WOD F;  2ZXR A;  5EGY A;  1OCZ C;  4Z9I A;  3RYL A;  1HY5 A;  2LD6 A;  4JTA B;  4M63 A;  4XEK A;  1OKK A;  1EQ1 A;  2VAS A;  1EI7 A;  3N24 A;  4BG0 A;  4BJ6 A;  2LK4 A;  2OOC A;  2D5R B;  3R7C A;  4LDK A;  2R7U A;  3ZTM A;  2IXM A;  2Z15 A;  4FX5 A;  4KBL A;  4AL0 A;  5F5H A;  2HUJ A;  2YHS A;  3QVZ A;  1YLM A;  2LQG A;  4U5F E;  4LLC A;  3LES A;  4PJN A;  2ZXO A;  4IAO A;  1VLT A;  1BDJ B;  4NTF A;  2PBE A;  1U6H A;  3GWN A;  4ULV A;  2DB4 A;  4MVQ A;  5CI8 A;  2G3K A;  2FAP B;  3Q6N A;  1U0B B;  1G5Z A;  2UUI A;  3MFN A;  1OW7 A;  3MYI A;  3U8P A;  4CDA A;  4C7O B;  4EBB A;  3KPH A;  1D1A A;  2PX0 A;  4CS7 A;  1V54 C;  2NUT A;  5DS6 A;  3S9O A;  2EIL C;  1HMD A;  3EH2 A;  1YA7 O;  4XPW A;  4MVR A;  4CBE A;  4KI2 A;  2XSE A;  4BJ6 C;  1IW7 F;  2KQ9 A;  2Q3T A;  1RXQ A;  3LLK A;  5A6A A;  4ONS A;  5JUA A;  4RBN A;  4LDQ A;  5T3T A;  1JMW A;  5A6J A;  4LAC B;  4U9E A;  3LS0 A;  1Z7Q c;  4MQ9 F;  4PJL A;  1LIH A;  2YL1 A;  3EQL F;  1T01 A;  2LFD A;  2L9J A;  2EPL X;  1OR3 A;  5EK0 A;  4EUK B;  2CW0 F;  2WZF A;  1F1M A;  1ZHZ A;  4E18 A;  1LE4 A;  1E2X A;  2Y3D A;  4ZLC A;  5DS4 A;  4J32 B;  1FNT c;  1A7D A;  1XZQ A;  2LSE A;  1OXK A;  4JVS A;  4E0H A;  1FMV A;  5BQG A;  3Q6M A;  1V4A A;  4EIY A;  1MNE A;  3EGD B;  2DYR C;  3G4X A;  4IAQ A;  3B29 A;  3Q7G A;  4U5E E;  3Q7L A;  2X0C A;  4DRJ B;  2EIM C;  3IQ5 A;  4MVM A;  1ZW2 A;  2A6H F;  4D4N A;  2XM0 A;  4YL3 A;  3TK0 A;  3TQO A;  4DRH B;  3IQC A;  2IXP A;  1TR2 A;  5L0J A;  1ZYR F;  2R03 A;  3FVY A;  2J0W A;  4PAC A;  1A0B A;  3W4Y A;  3T6B A;  5KYN A;  2A0B A;  1Z5Z A;  3I5Q A;  3AQB A;  3N2Z B;  4UDV A;  1ZU4 A;  1JR8 A;  3M79 A;  1K40 A;  1VMA A;  2J9V A;  1HW1 A;  2JD3 A;  4BJT A;  3GEE A;  3U0C A;  4IRU A;  2P6V A;  3S84 A;  2VH3 A;  2Y3B A;  4JTC B;  4HFK B;  1UFB A;  1HMO A;  2IM8 A;  1ZZP A;  3H65 A;  2GAQ A;  4MTO A;  4O7G A;  2QE9 A;  2IBF A;  3GM2 A;  4C3D A;  5KYY A;  3HKK A;  2R7R A;  2GDC A;  4DOZ A;  3WHN A;  5F5F A;  1SMY F;  2HJM A;  4MND A;  1Q0F A;  1M56 C;  1YJG A;  3C18 A;  2CYD A;  3X1O A;  3B0U X;  2LFF A;  1OW6 A;  2KSF A;  4A2N B;  2R7W A;  2R7T A;  2M64 A;  3PMR A;  5L0G A;  2R9R B;  2R7V A;  1YVI A;  5E33 A;  1H9T A;  2L6G A;  3IEE A;  3ZIB A;  3ZWI A;  5B3S C;  1PV3 A;  2EIK C;  1JOG A;  4LER A;  4MW8 A;  4YJW A;  5B1A C;  4NTA A;  4FAP B;  4U5G A;  3C62 A;  4YL1 A;  2W45 A;  3NDB B;  2NUT B;  1BR4 A;  5D92 A;  3ZTZ A;  1A41 A;  4CDV A;  4J30 B;  3ABL C;  3AOU A;  1CGM E;  1BR1 A;  1I4Z A;  3ASO C;  4K1O A;  4JC7 A;  2QLA A;  3JYY A;  5L0D A;  5L0H A;  2R7Q A;  3GEI A;  1D1B A;  3TOL A;  1OQC A;  1LKX A;  2GFH A;  2ETS A;  2J46 A;  3FMS A;  1I4Y A;  2XRH A;  1V74 B;  4XPY A;  3HNK A;  4QDL A;  1KNY A;  2CDQ A;  2XLW A;  2YL0 A;  2C04 A;  1M2O A;  1O3U A;  3GM3 A;  4LLE A;  4RDA A;  5FCL A;  3SZR A;  2ASR A;  1T6I A;  1QVX A;  2BE5 F;  2YL3 A;  3RH3 A;  1NU7 D;  2YLI A;  2A68 F;  1CPQ A;  2L6F A;  3SXM A;  3ABK C;  4XEV A;  1WGW A;  5JRA A;  2A1D D;  2HSQ A;  2QNL A;  3UMK A;  1NFO A;  3IQT A;  3C7J A;  1NFN A;  3NYL A;  3UR3 C;  2B0H A;  1JPN A;  2PX3 A;  3S27 A;  2MHR A;  2C03 A;  2H7B A;  2WVQ A;  3M15 A;  3VYW A;  1C03 A;  3AG4 C;  4MTF A;  1ZHY A;  2J45 A;  3T6G B;  2ZPA A;  3LS1 A;  4Z9J A;  3DMD A;  3EZH A;  1T9K A;  1Z23 A;  3AG3 C;  3HNJ A;  1PCX A;  4I44 A;  3LUT B;  3DM5 A;  3JTL O;  4Q5S F;  4JRZ A;  3K33 A;  5T1D B;  3GEH A;  3LLI A;  5DLJ A;  1TFO B;  4OIQ F;  2XS8 A;  2HJ3 A;  3OEO A;  5KYY B;  4AK9 A;  2J9B A;  4EHP A;  1K05 A;  5KYX A;  5L0F A;  4G7O F;  4W8K A;  2H8A A;  1H7I A;  3L34 A;  1OCR C;  1G4W R;  3L8J A;  1ORS C;  3AJM A;  3EHN A;  1T5O A;  3HLZ A;  3NMI A;  1LPE A;  3I4U A;  4PR9 A;  3PCV A;  2GWW A;  3B71 A;  1R5I D;  4L6R A;  2YWA A;  3HNL A;  1WWP A;  4AE4 A;  3QZC A;  3O10 A;  4IB4 A;  3A11 A;  3GOR A;  1APC A;  3GOD A;  3RQE A;  1K04 A;  4ANJ A;  1YAR O;  1OXB A;  5L3Q A;  2LIG A;  2Q4F A;  3EHM A;  1A7E A;  2ZXP A;  1J8M F;  2Y69 C;  3W8I A;  1E85 A;  3C63 A;  3E70 C;  2GA0 A;  4W8P A;  1RMV A;  4WGZ A;  4E7Z A;  3K1H A;  2ICW G;  4G7H F;  2A69 F;  1V55 C;  1H9G A;  1LM3 B;  1C02 A;  1NG1 A;  2XS1 A;  1YA9 A;  2CCY A;  4JJG A;  1B68 A;  1D0X A;  1ORJ A;  1Q0K A;  4P9T A;  2MWQ A;  3PHF 2;  1Q0M A;  2PFD A;  3C8G D;  4DVZ A;  1YYX A;  1QQ3 A;  1QKR A;  2XL6 A;  2XLD A;  2YLG A;  2YLD A;  4O6M A;  4ER9 A;  3DE8 A;  1NZE A;  4U5D E;  5CI9 A;  4JUR I;  2XXA B;  5L0C A;  1LS1 A;  3LJB A;  1ZHX A;  3C8G A;  5COM A;  3U3B A;  3M4C A;  4EWC A;  2NSG A;  3JZ0 A;  3IQ6 A;  1Y4C A;  2KNH A;  3GWL A;  3NMK A;  1ST6 A;  3BRJ A;  3SP1 A;  3POV A;  5EHH A;  3TOM A;  5KYX B;  3U2M A;  4E0I A;  3NKE A;  2W9Y A;  5TJ5 E;  2P1A A;  5B3I A;  1FAP B;  2DYS C;  1ZHW A;  1R4T A;  2Y3H A;  3DWW A;  3IPM O;  3JSZ A;  1JPJ A;  1VTM P;  4MVO A;  3V7O A;  1N1C A;  3SXY A;  2CGE A;  4MVZ A;  1FMW A;  1WN0 A;  1ZW3 A;  2L7A A;  2L81 A;  4DJ9 A;  1Y6D A;  4MVU A;  2P0N A;  4CX9 A;  1AEP A;  4I1M A;  1CGN A;  3L0I A;  3RFY A;  5A6B D;  3EG9 A;  2XLO A;  3FHD A;  2MYS A;  3S28 A;  4XWJ A;  3DM9 B;  1DOW A; 
#chains in the Genus database with same CATH homology
 1QSP A;  4EUK B;  1C03 A;  2LCH A;  1FR0 A;  1OXB A;  1BDJ B;  2Q4F A;  3KYJ A;  1OXK A;  3KYI A;  1I5N A;  1C02 A;  1TQG A;  2LP4 A;  1YVI A;  2R25 A;  1WN0 A;  3MYF A;  1SR2 A;  4G78 A;  4PAC A;  2LD6 A;  3US6 A;  1A0B A;  1Y6D A;  2A0B A;  2OOC A;  3IQT A;  3U3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...