1QSPA

Crystal structure of the yeast phosphorelay protein ypd1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
b'TIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPD1
molecule tags Signaling protein
source organism Saccharomyces cerevisiae
publication title Conservation of structure and function among histidine-containing phosphotransfer (HPt) domains as revealed by the crystal structure of YPD1.
pubmed doi rcsb
total genus 62
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1qspA00
1Y6DA 3KYJA 3US6A 1C02A 4G78A 3KYIA 1A0BA 1OXBA 4PACA 1SR2A 1C03A 3IQTA 1TQGA 2LCHA 3MYFA 1I5NA 2A0BA 2LP4A 1FR0A 1YVIA 1BDJB 2LD6A 2R25A 1OXKA 2OOCA 1QSPA 4EUKB 2Q4FA 1WN0A 3U3BA
chains in the Genus database with same CATH superfamily
3QMKA 3H2UA 3NYLA 2UUHA 1NFOA 2Z15A 3ITFA 3O6XA 3C62A 3SZRA 4E0HA 2Y3BA 2ZXWC 3GORA 1LE4A 4MS2A 1U0BB 4PJLA 3L8JA 1RCPA 2XLEA 2EPKX 1JR8A 3JRTA 1WASA 2J46A 3ZIBA 5KYNA 2KK1A 2PX3A 2Q9BA 2G62A 4NTFA 3RQEA 1E83A 4BJ1A 3J06A 1MMGA 3HNLA 1YA9A 3U5SA 1DOWA 1PV3A 4R32A 3AG4C 4YT5A 3O55A 3T6GB 1TKNA 2Q00A 1YZCA 1Q0DA 2J0WA 3UR3C 3V7OA 1EA8A 3NRHA 4YL0A 3VF0A 2IM8A 1JRAA 4ONSA 2MHRA 2XM0A 1A7VA 1RJ9A 5F5HA 3WODF 2OEXA 3K66A 3EGDB 3S9OA 2YLIA 3JYHA 5COFA 3S29A 3FAJA 3RFYA 1LS4A 4EKWA 1EI7A 5DS4A 1K40A 1NG1A 5EK0A 4BJ6C 3EGXB 4XLNF 3VAYA 1IW7F 3IHUA 3T4RA 3FOPA 2OG2A 3W4YA 3DAFA 3WG7C 4O6MA 4D4XA 4DVZA 1VMAA 2GDCA 1OKKD 1TFOB 2VH3A 2V26A 2VCCA 3U2LA 1TWAA 4DOZA 3N24A 1FTSA 2R7UA 4OINF 1J8YF 3DMDA 2A68F 3QW0A 3M4BA 2CYDA 1MNEA 4EBJA 3MFNA 3AG3C 4LERA 4MVSA 1U6HA 1KU2A 1V74B 2WB7A 3ATPA 3MBGA 4N06A 4PK4A 3TOLA 5KYXA 4U9DA 4I1OB 1LS1A 2XS1A 4YL1A 1HE9A 2LIGA 3U8PA 2WVOA 4O6NA 4ULWA 3S0XA 2HV6A 5E3CA 3CAXA 1BZ4A 2YKZA 3JZ0A 4C3BA 2ETSA 256BA 4XEVA 3RIPA 3TQOA 1T6UA 2WZLA 3LESA 5KYWB 3H2VA 4G0HA 1TWHA 2XM4A 5L0FA 3ZDLA 1OW7A 3ZQVA 3Q7LA 3FMSA 2E87A 4PJMA 5DS6A 1A7DA 3A9CA 3ZG1A 4J30B 5T1DB 2R7XA 3AQCA 2XRHA 4O6YA 1CPQA 2BC5A 3RKOF 4ZLCA 2P0NA 1E86A 2D5RB 3G50A 2J9WA 4LLCA 3ZVRA 2B0JA 5GPGB 4ZLDA 3ABKC 4P6IC 4P9TA 4HE8D 5A6BD 1ZHTA 3TK0A 4BJ6A 1WWPA 3DE8A 5T3TA 2I15A 2NSGA 3FHDA 4D4NA 2HUJA 2CNWD 1RKCA 1APCA 2QNLA 2Y69C 4XEFA 5DQZA 1T9KA 3IQ5A 4UDVA 2NUPB 3HLZA 3W8HA 1VOMA 3VRCA 3U3BA 1WGWA 3QW1A 5CI9A 5BQIA 2GFHA 4BG0A 1QPUA 1NU7D 5B3SC 3K33A 4O7GA 4ANJA 1ORSC 2OKUA 1O87A 3QZCA 1HMDA 5EHHA 4JURI 3SEOA 4Q7CA 1QVXA 2CW0F 1G5ZA 5JS5A 1FNTc 2H7VC 2PNOA 3DI5A 3GM2A 4BJ5A 4OD5A 3KMIA 3CEXA 3Q6MA 4CDYA 2EILC 3RF3A 1MQVA 3B0VC 4KI2A 4IAOA 2XL6A 1YLMA 1NSGB 4U5GA 1YVIA 2GWWA 2IYLD 2YL7A 4J7YA 2Q9AA 1ORJA 4MW3A 3K1IA 4XTKA 4FX5A 3EGXA 4CS7A 5DLJA 4C3EA 1H6GA 1NBBA 1Z5ZA 4ER9A 3M79A 1QQ3A 1T5OA 1VYIA 1AUEA 5F28E 4U5CE 1FFTC 1Y6DA 1D1AA 1I4ZA 2XLVA 5AGFA 3RQGA 4DJ9A 2R7TA 4E0IA 3JSZA 3U3FA 5L3QA 3LJBA 4X0RA 4IJJA 2MWQA 2J0XA 2QUPA 4PACA 1HW2A 3LNRA 4CS9C 3CQZA 2ZPAA 3KH2A 2Q3TA 3N2ZB 3MYFA 2R9RB 4ULVA 3SXYA 2KJGA 1H9GA 3DZAA 3M1CB 4IGGA 4XQ1A 4CJGA 2LP4A 1CGNA 1T6IA 2LK4A 3JSEO 5L0GA 3SYNA 3TULA 1EKYA 2P7VA 5BQGA 2OQMA 1OW6A 4JZAA 5TJ5E 2XLWA 3KL4A 4EBBA 3BEHA 1L3PA 5A6JA 3POVA 3NKEA 3NKDA 5L0HA 5AC5A 2JX0A 2ZD9A 3C8GA 2EIMC 5JVEA 1ZVZA 1UFBA 1FAPB 3LEVA 4MTGA 1VK5A 3I5PA 2NUTA 4G7OF 2XSEA 4EIYA 2H7OA 3C8GB 2XLDA 1E2XA 2L9JA 1B68A 2CGEA 2ZXPA 1O3UA 4BEMJ 4JCZA 1MNDA 3LLKA 2Y39A 3RVYA 4J7TA 3K1HA 1Z23A 1Q0FA 5E33A 2F22A 5FCLA 1JAFA 1ZU5A 2A6EF 1GM5A 2EINC 1OXKA 1M2OA 1BR4A 1GQAA 4GEHA 5CI8A 5DVWA 1FFHA 3AG1C 4HEAJ 4MVOA 4EUKB 1GS9A 3B29A 4MVRA 1SYQA 2MYSA 4H4KC 4QDLA 1N1CA 2OJQA 3H65A 4G7HF 3E9VA 2PF4E 2HMZA 3KYIA 2J8WA 1HW1A 4P9FA 3KPHA 4CSAA 1IZMA 1R5ID 2W9YA 3S28A 2A1DD 2L6HA 1I4YA 3W8IA 3EJNA 4KNVA 3AJMA 1KTMA 3V5YA 1RMVA 2A6HF 4EHPA 3T6BA 4OIPF 2W4MA 3NYJA 2YVKA 2L6GA 2NSFA 2H7BA 1HMOA 2AWYA 4CS8C 5BQHA 5A6AA 1YYXA 1SZIA 1LI7A 3B9QA 3LAYA 3IEEA 4DRHB 2KSFA 4AL0A 2XL4A 4CS9A 1F1MA 1S05A 2YQYA 3K7DA 3K6BA 3PHF2 1FMWA 2R7OA 3VM6A 3LS1A 2J9UA 4DBRA 3UGPA 4YT2A 2V3CC 4EWCA 2HMQA 3TD7A 2YL0A 2J9VA 3TOMA 4KBLA 2HS5A 2EIJC 3JRMO 4CX9A 3HNKA 2M4EA 4CSAC 2R05A 1VTMP 2VCBA 2IBFA 2VASA 4FESA 2FAPB 3F46A 1VLTA 3IQTA 4JKVA 3O39A 4PR9A 3SNHA 2BL2A 2PBEA 4Z9JA 3C63A 1Z3IX 4WGYA 3VYWA 4OIOF 2QY9A 4N6CA 2RD9A 1A7EA 4JIOA 2QE9A 4LLEA 4U5DE 3ZTZA 2D4UA 3ZWIA 2EPMX 2YLDA 5CIVA 4E7ZA 3HJCA 3F47A 2VC9A 4YWQA 1C17M 4NC3A 2R03A 3K1IC 1NLXA 2J45A 1Q0MA 3MYIA 4A2NB 5KYUB 1NZEA 3EPVA 3GEIA 1V55C 1XWJA 2IXNA 4RDAA 3EGDA 1OKKA 3DM9B 1HE1A 5E3AA 1DOVA 4H54A 4CDAA 2A0UA 2XS8A 4YL3A 3RH3A 3GODA 2O9XA 3EZIA 3PCVA 3DKAA 4KNWA 4NTAA 5JP7A 4IB4A 3RVZA 1A0BA 1Z63A 3W2VA 1D0XA 1OXBA 5JT4A 1V54C 3FOOA 3I4UA 2GAQA 3DXJF 5JUAA 5L0JA 2DGJA 2YZSA 4XWJA 2OJED 4DRJB 3PDMP 3LEOA 1XZQA 1LKXA 4JTCB 4JVSA 4QI0A 1M2VA 2HSBA 1S7ZA 2J9BA 1YARO 2HJ3A 4U9EA 1NU9C 1ORYA 1ZHXA 2DI3A 4JC7A 5HV9A 3U9JA 4Q4ZF 4FWVA 1QKRA 2NG1A 5KYXB 2LSEA 5KYUA 2ASRA 2XL8A 3HNJA 2J7PA 1JOGA 1QSPA 4MNDA 3NMIA 4XPXA 3SP1A 1ST6A 3EH2A 4IARA 4IWBA 1JPJA 1H7IA 3HTKC 3OEOA 3R2PA 3RQFA 2BE5F 2EPOA 1Q0KA 4JEBA 4Z9IA 2YLGA 2P61A 2KQ9A 3SXMA 3UMHA 1BBHA 3S84A 2KNHA 1G4WR 2YL1A 4Q5SF 1OCCC 1PCXA 4PJNA 1G8XA 1TQGA 2L7AA 3EH1A 3TJ5A 2LFDA 3U2MA 3FXHA 1ZHZA 4CIHA 3Q7GA 2WZGA 1Z7Qc 3N0TA 1D1BA 4CJOA 3MX3A 4YN0B 4AE4A 2RSEB 3L8IA 4GQHA 4HFFB 3QTHA 1CGME 1OR2A 2LQGA 2G3VA 2NUTB 3I5QA 4N6HA 3X2QC 5B3IA 4U5FE 2AVKA 2L6FA 3MLGA 4XEKA 4F4BA 3DM5A 3GWNA 3DWWA 3UMIA 4DXWA 3Q6NA 2R7QA 1C02A 1NFNA 4PJJA 2H8AA 3RYLA 4B6IA 5E2QA 4JRZA 2HZ8A 3AQBA 1TFKB 2CDQA 1T6QA 3DD7A 3B0PA 3NMJA 2IXMA 4XPWA 5T3WA 2JD3A 1MMDA 3EFOA 4K7BA 3T6JA 1JMWA 1CGOA 1ZW2A 2FFHA 4I44A 4OIQF 1D0ZA 2WL8A 4MVMA 4CS8A 4DRIB 3U9MA 5A6BA 1YAUO 4IRUA 4LDKA 1RXQA 2HKVA 4MVUA 1SMYF 4U5EE 1YZAA 2TMVP 3NDBB 2P6VA 3FVYA 1LI5A 3IQCA 3LNMB 2CCYA 3ZC4A 4NY3A 4MW8A 1MMNA 5KYYB 1RKEB 3CSKA 3LLIA 2HV7A 4GYTA 2HSQA 3AGUA 4U5BE 4E7SA 2IXPA 4YK5A 4AE4B 3FDQA 5L0CA 3IPMO 5KYYA 2R7RA 5L3VA 1C03A 2A69F 4BJ5C 3AG2C 2XLMA 5IY5C 1XZPA 3GM1A 4RBNA 4C3DA 1FMVA 2WVNA 4K1OA 1E85A 1CPRA 2LFFA 3U8VA 3B71A 2YL3A 3EQLF 3EZHA 3L34A 4W8KA 4EBKA 3U0CA 4JE9A 4PFOA 1BDJB 1LE2A 2XLHA 5DQTA 2HJMA 4MVQA 4AK9A 3W2WA 5DS5A 2I8BA 1J8MF 2XXAB 2P1AA 1LIHA 2OEVA 3DAGA 2DYSC 3S27A 4JJGA 3WHNA 4CBEA 1RKEA 4MVZA 3SXKA 3ASNC 2WVQA 1W2WA 3AOUA 3KYJA 3M4CA 3NYMA 2QLAA 2YRFA 1YJGA 4BPMA 1GGQA 3V5XA 1SF8A 4DBQA 1Q0GA 3ABLC 4XLPF 4JW1A 4Z9HA 1KNYA 1YDIA 2WZFA 3G4XA 3X1OA 3BRJA 2B0HA 4JTAB 2PX0A 4JEAA 1ZW3A 4IAQA 4NCQA 4WABA 5FZTA 5BUOA 2Q9CA 4J32B 3GEHA 4I1MA 1BR2A 1ZYRF 2A0BA 2OCCC 4C7OB 2IOQA 3FAPB 4JCHA 1OQCA 3IQ6A 1YYJA 2PFDA 2PP4A 2Y3HA 1M57C 3QVYA 3TJ6A 3V5ZA 2R7SA 2IXOA 3L0IA 1OW8A 1PD1A 2Q4FA 1WN0A 4JTDB 2YWAA 3ZTMA 3T9OA 3ABMC 3C8GD 3JT1A 3UMKA 5K0IA 3S90A 5F5FA 3US6A 4L6RA 2AP3A 1JPNA 3O10A 3C18A 1HY5A 1TWGA 2FGYA 2KC3A 2KYHA 2Q7RA 2EIKC 3QVZA 4NTBA 3ZQYA 2AU5A 2W4BA 1SR2A 2JPUA 3UNGC 1U89A 1AVOB 1K04A 4MQ9F 4LDQA 2C03A 1VLSA 2R7VA 3DJNB 4YT8A 3ASOC 1LPEA 4YT4A 1FR0A 2UUIA 4BJTA 3HKKA 4HFKB 2M64A 2HFIA 4O79A 5B1AC 2C04A 2OU6A 2VCAA 5COGA 5L0DA 5JSLA 2W45A 3NMKA 2AWCA 2CNWA 4BEJA 3EG9A 3OWTA 4G7ZF 1UG7A 1V4AA 3A11A 1M2VB 1WOLA 2J7PD 3EHNA 4MTOA 2DB4A 5D91A 3GM3A 1Z6AA 4WJ0A 1OCZC 2NUPA 3L1MA 4W8PA 2KGOA 4OIRF 1LM3B 2KW3C 5JLIA 3B0UX 4KC9A 1WTYA 3R7CA 3GWLA 4JJFA 1RJ9B 4PFPA 4G78A 1VYKA 3RW0A 3AGTA 2X0CA 1ZU4A 3C8ZA 5EGYA 1R4TA 1YA7O 2ICWG 3DJUB 3UGOA 2EPLX 4YJWA 3WAQA 1OR3A 1ZHWA 2GA0A 1E84A 3LS0A 1ZHYA 3EFOB 3JCUQ 3KKBA 4WGZA 2Y3DA 1D1CA 5A6KA 1M6TA 1MMAA 1H9TA 3LUTB 2XXAA 4LDRA 5A69A 1L7CA 3DE9A 1PD0A 4M63A 5HSWA 4AX2A 1OCRC 2LD6A 3EG9B 5KYWA 3OA1A 2OOCA 3GANA 1D0YA 2Y3GA 2G3KA 1OCOC 2ZXRA 4FAPB 1AEPA 2NPUA 3GEEA 4DVYP 4CIPA 3ZSUA 1K05A 1BR1A 3E70C 1Y4CA 3EHMA 3JYYA 4AL1A 3HNIA 2ZXOA 4CDVA 4A4AA 2YEVA 5D92A 1T01A 1M56C 5L0IA 2X51A 4I3MA 4OD4A 1QLEC 4N4WA 3SXZA 1EQ1A 4XPYA 4E17A 1TR2A 2R7WA 2QTVA 3M15A 3NG1A 2LCHA 3G4ZA 4K0DA 4U5HA 1O5HA 2DYRC 1G4US 2R02A 1I5NA 1ZZPA 2EPNA 1A41A 2YHSA 3JTLO 3PMRA 2VB6A 4MTFA 4NQFA 1QZXA 2R25A 3C7JA 4RD9A 2L81A 5COMA 5JRAA 4QI2A 1TWCA 4LACB 4E18A 1WATA 1VB5A 2XLOA 3CZ6A 5B1BC 3ECSA 5AC4A 4C7OA 1LVKA
chains in the Genus database with same CATH topology
1Y6DA 3KYJA 3US6A 1C02A 4G78A 3KYIA 1A0BA 1OXBA 4PACA 1SR2A 1C03A 3IQTA 1TQGA 2LCHA 3MYFA 1I5NA 2A0BA 2LP4A 1FR0A 1YVIA 1BDJB 2LD6A 2R25A 1OXKA 2OOCA 1QSPA 4EUKB 2Q4FA 1WN0A 3U3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6D A;  3KYJ A;  3US6 A;  1C02 A;  4G78 A;  3KYI A;  1A0B A;  1OXB A;  4PAC A;  1SR2 A;  1C03 A;  3IQT A;  1TQG A;  2LCH A;  3MYF A;  1I5N A;  2A0B A;  2LP4 A;  1FR0 A;  1YVI A;  1BDJ B;  2LD6 A;  2R25 A;  1OXK A;  2OOC A;  1QSP A;  4EUK B;  2Q4F A;  1WN0 A;  3U3B A; 
#chains in the Genus database with same CATH topology
 3QMK A;  3H2U A;  3NYL A;  2UUH A;  1NFO A;  2Z15 A;  3ITF A;  3O6X A;  3C62 A;  3SZR A;  4E0H A;  2Y3B A;  2ZXW C;  3GOR A;  1LE4 A;  4MS2 A;  1U0B B;  4PJL A;  3L8J A;  1RCP A;  2XLE A;  2EPK X;  1JR8 A;  3JRT A;  1WAS A;  2J46 A;  3ZIB A;  5KYN A;  2KK1 A;  2PX3 A;  2Q9B A;  2G62 A;  4NTF A;  3RQE A;  1E83 A;  4BJ1 A;  3J06 A;  1MMG A;  3HNL A;  1YA9 A;  3U5S A;  1DOW A;  1PV3 A;  4R32 A;  3AG4 C;  4YT5 A;  3O55 A;  3T6G B;  1TKN A;  2Q00 A;  1YZC A;  1Q0D A;  2J0W A;  3UR3 C;  3V7O A;  1EA8 A;  3NRH A;  4YL0 A;  3VF0 A;  2IM8 A;  1JRA A;  4ONS A;  2MHR A;  2XM0 A;  1A7V A;  1RJ9 A;  5F5H A;  3WOD F;  2OEX A;  3K66 A;  3EGD B;  3S9O A;  2YLI A;  3JYH A;  5COF A;  3S29 A;  3FAJ A;  3RFY A;  1LS4 A;  4EKW A;  1EI7 A;  5DS4 A;  1K40 A;  1NG1 A;  5EK0 A;  4BJ6 C;  3EGX B;  4XLN F;  3VAY A;  1IW7 F;  3IHU A;  3T4R A;  3FOP A;  2OG2 A;  3W4Y A;  3DAF A;  3WG7 C;  4O6M A;  4D4X A;  4DVZ A;  1VMA A;  2GDC A;  1OKK D;  1TFO B;  2VH3 A;  2V26 A;  2VCC A;  3U2L A;  1TWA A;  4DOZ A;  3N24 A;  1FTS A;  2R7U A;  4OIN F;  1J8Y F;  3DMD A;  2A68 F;  3QW0 A;  3M4B A;  2CYD A;  1MNE A;  4EBJ A;  3MFN A;  3AG3 C;  4LER A;  4MVS A;  1U6H A;  1KU2 A;  1V74 B;  2WB7 A;  3ATP A;  3MBG A;  4N06 A;  4PK4 A;  3TOL A;  5KYX A;  4U9D A;  4I1O B;  1LS1 A;  2XS1 A;  4YL1 A;  1HE9 A;  2LIG A;  3U8P A;  2WVO A;  4O6N A;  4ULW A;  3S0X A;  2HV6 A;  5E3C A;  3CAX A;  1BZ4 A;  2YKZ A;  3JZ0 A;  4C3B A;  2ETS A;  256B A;  4XEV A;  3RIP A;  3TQO A;  1T6U A;  2WZL A;  3LES A;  5KYW B;  3H2V A;  4G0H A;  1TWH A;  2XM4 A;  5L0F A;  3ZDL A;  1OW7 A;  3ZQV A;  3Q7L A;  3FMS A;  2E87 A;  4PJM A;  5DS6 A;  1A7D A;  3A9C A;  3ZG1 A;  4J30 B;  5T1D B;  2R7X A;  3AQC A;  2XRH A;  4O6Y A;  1CPQ A;  2BC5 A;  3RKO F;  4ZLC A;  2P0N A;  1E86 A;  2D5R B;  3G50 A;  2J9W A;  4LLC A;  3ZVR A;  2B0J A;  5GPG B;  4ZLD A;  3ABK C;  4P6I C;  4P9T A;  4HE8 D;  5A6B D;  1ZHT A;  3TK0 A;  4BJ6 A;  1WWP A;  3DE8 A;  5T3T A;  2I15 A;  2NSG A;  3FHD A;  4D4N A;  2HUJ A;  2CNW D;  1RKC A;  1APC A;  2QNL A;  2Y69 C;  4XEF A;  5DQZ A;  1T9K A;  3IQ5 A;  4UDV A;  2NUP B;  3HLZ A;  3W8H A;  1VOM A;  3VRC A;  3U3B A;  1WGW A;  3QW1 A;  5CI9 A;  5BQI A;  2GFH A;  4BG0 A;  1QPU A;  1NU7 D;  5B3S C;  3K33 A;  4O7G A;  4ANJ A;  1ORS C;  2OKU A;  1O87 A;  3QZC A;  1HMD A;  5EHH A;  4JUR I;  3SEO A;  4Q7C A;  1QVX A;  2CW0 F;  1G5Z A;  5JS5 A;  1FNT c;  2H7V C;  2PNO A;  3DI5 A;  3GM2 A;  4BJ5 A;  4OD5 A;  3KMI A;  3CEX A;  3Q6M A;  4CDY A;  2EIL C;  3RF3 A;  1MQV A;  3B0V C;  4KI2 A;  4IAO A;  2XL6 A;  1YLM A;  1NSG B;  4U5G A;  1YVI A;  2GWW A;  2IYL D;  2YL7 A;  4J7Y A;  2Q9A A;  1ORJ A;  4MW3 A;  3K1I A;  4XTK A;  4FX5 A;  3EGX A;  4CS7 A;  5DLJ A;  4C3E A;  1H6G A;  1NBB A;  1Z5Z A;  4ER9 A;  3M79 A;  1QQ3 A;  1T5O A;  1VYI A;  1AUE A;  5F28 E;  4U5C E;  1FFT C;  1Y6D A;  1D1A A;  1I4Z A;  2XLV A;  5AGF A;  3RQG A;  4DJ9 A;  2R7T A;  4E0I A;  3JSZ A;  3U3F A;  5L3Q A;  3LJB A;  4X0R A;  4IJJ A;  2MWQ A;  2J0X A;  2QUP A;  4PAC A;  1HW2 A;  3LNR A;  4CS9 C;  3CQZ A;  2ZPA A;  3KH2 A;  2Q3T A;  3N2Z B;  3MYF A;  2R9R B;  4ULV A;  3SXY A;  2KJG A;  1H9G A;  3DZA A;  3M1C B;  4IGG A;  4XQ1 A;  4CJG A;  2LP4 A;  1CGN A;  1T6I A;  2LK4 A;  3JSE O;  5L0G A;  3SYN A;  3TUL A;  1EKY A;  2P7V A;  5BQG A;  2OQM A;  1OW6 A;  4JZA A;  5TJ5 E;  2XLW A;  3KL4 A;  4EBB A;  3BEH A;  1L3P A;  5A6J A;  3POV A;  3NKE A;  3NKD A;  5L0H A;  5AC5 A;  2JX0 A;  2ZD9 A;  3C8G A;  2EIM C;  5JVE A;  1ZVZ A;  1UFB A;  1FAP B;  3LEV A;  4MTG A;  1VK5 A;  3I5P A;  2NUT A;  4G7O F;  2XSE A;  4EIY A;  2H7O A;  3C8G B;  2XLD A;  1E2X A;  2L9J A;  1B68 A;  2CGE A;  2ZXP A;  1O3U A;  4BEM J;  4JCZ A;  1MND A;  3LLK A;  2Y39 A;  3RVY A;  4J7T A;  3K1H A;  1Z23 A;  1Q0F A;  5E33 A;  2F22 A;  5FCL A;  1JAF A;  1ZU5 A;  2A6E F;  1GM5 A;  2EIN C;  1OXK A;  1M2O A;  1BR4 A;  1GQA A;  4GEH A;  5CI8 A;  5DVW A;  1FFH A;  3AG1 C;  4HEA J;  4MVO A;  4EUK B;  1GS9 A;  3B29 A;  4MVR A;  1SYQ A;  2MYS A;  4H4K C;  4QDL A;  1N1C A;  2OJQ A;  3H65 A;  4G7H F;  3E9V A;  2PF4 E;  2HMZ A;  3KYI A;  2J8W A;  1HW1 A;  4P9F A;  3KPH A;  4CSA A;  1IZM A;  1R5I D;  2W9Y A;  3S28 A;  2A1D D;  2L6H A;  1I4Y A;  3W8I A;  3EJN A;  4KNV A;  3AJM A;  1KTM A;  3V5Y A;  1RMV A;  2A6H F;  4EHP A;  3T6B A;  4OIP F;  2W4M A;  3NYJ A;  2YVK A;  2L6G A;  2NSF A;  2H7B A;  1HMO A;  2AWY A;  4CS8 C;  5BQH A;  5A6A A;  1YYX A;  1SZI A;  1LI7 A;  3B9Q A;  3LAY A;  3IEE A;  4DRH B;  2KSF A;  4AL0 A;  2XL4 A;  4CS9 A;  1F1M A;  1S05 A;  2YQY A;  3K7D A;  3K6B A;  3PHF 2;  1FMW A;  2R7O A;  3VM6 A;  3LS1 A;  2J9U A;  4DBR A;  3UGP A;  4YT2 A;  2V3C C;  4EWC A;  2HMQ A;  3TD7 A;  2YL0 A;  2J9V A;  3TOM A;  4KBL A;  2HS5 A;  2EIJ C;  3JRM O;  4CX9 A;  3HNK A;  2M4E A;  4CSA C;  2R05 A;  1VTM P;  2VCB A;  2IBF A;  2VAS A;  4FES A;  2FAP B;  3F46 A;  1VLT A;  3IQT A;  4JKV A;  3O39 A;  4PR9 A;  3SNH A;  2BL2 A;  2PBE A;  4Z9J A;  3C63 A;  1Z3I X;  4WGY A;  3VYW A;  4OIO F;  2QY9 A;  4N6C A;  2RD9 A;  1A7E A;  4JIO A;  2QE9 A;  4LLE A;  4U5D E;  3ZTZ A;  2D4U A;  3ZWI A;  2EPM X;  2YLD A;  5CIV A;  4E7Z A;  3HJC A;  3F47 A;  2VC9 A;  4YWQ A;  1C17 M;  4NC3 A;  2R03 A;  3K1I C;  1NLX A;  2J45 A;  1Q0M A;  3MYI A;  4A2N B;  5KYU B;  1NZE A;  3EPV A;  3GEI A;  1V55 C;  1XWJ A;  2IXN A;  4RDA A;  3EGD A;  1OKK A;  3DM9 B;  1HE1 A;  5E3A A;  1DOV A;  4H54 A;  4CDA A;  2A0U A;  2XS8 A;  4YL3 A;  3RH3 A;  3GOD A;  2O9X A;  3EZI A;  3PCV A;  3DKA A;  4KNW A;  4NTA A;  5JP7 A;  4IB4 A;  3RVZ A;  1A0B A;  1Z63 A;  3W2V A;  1D0X A;  1OXB A;  5JT4 A;  1V54 C;  3FOO A;  3I4U A;  2GAQ A;  3DXJ F;  5JUA A;  5L0J A;  2DGJ A;  2YZS A;  4XWJ A;  2OJE D;  4DRJ B;  3PDM P;  3LEO A;  1XZQ A;  1LKX A;  4JTC B;  4JVS A;  4QI0 A;  1M2V A;  2HSB A;  1S7Z A;  2J9B A;  1YAR O;  2HJ3 A;  4U9E A;  1NU9 C;  1ORY A;  1ZHX A;  2DI3 A;  4JC7 A;  5HV9 A;  3U9J A;  4Q4Z F;  4FWV A;  1QKR A;  2NG1 A;  5KYX B;  2LSE A;  5KYU A;  2ASR A;  2XL8 A;  3HNJ A;  2J7P A;  1JOG A;  1QSP A;  4MND A;  3NMI A;  4XPX A;  3SP1 A;  1ST6 A;  3EH2 A;  4IAR A;  4IWB A;  1JPJ A;  1H7I A;  3HTK C;  3OEO A;  3R2P A;  3RQF A;  2BE5 F;  2EPO A;  1Q0K A;  4JEB A;  4Z9I A;  2YLG A;  2P61 A;  2KQ9 A;  3SXM A;  3UMH A;  1BBH A;  3S84 A;  2KNH A;  1G4W R;  2YL1 A;  4Q5S F;  1OCC C;  1PCX A;  4PJN A;  1G8X A;  1TQG A;  2L7A A;  3EH1 A;  3TJ5 A;  2LFD A;  3U2M A;  3FXH A;  1ZHZ A;  4CIH A;  3Q7G A;  2WZG A;  1Z7Q c;  3N0T A;  1D1B A;  4CJO A;  3MX3 A;  4YN0 B;  4AE4 A;  2RSE B;  3L8I A;  4GQH A;  4HFF B;  3QTH A;  1CGM E;  1OR2 A;  2LQG A;  2G3V A;  2NUT B;  3I5Q A;  4N6H A;  3X2Q C;  5B3I A;  4U5F E;  2AVK A;  2L6F A;  3MLG A;  4XEK A;  4F4B A;  3DM5 A;  3GWN A;  3DWW A;  3UMI A;  4DXW A;  3Q6N A;  2R7Q A;  1C02 A;  1NFN A;  4PJJ A;  2H8A A;  3RYL A;  4B6I A;  5E2Q A;  4JRZ A;  2HZ8 A;  3AQB A;  1TFK B;  2CDQ A;  1T6Q A;  3DD7 A;  3B0P A;  3NMJ A;  2IXM A;  4XPW A;  5T3W A;  2JD3 A;  1MMD A;  3EFO A;  4K7B A;  3T6J A;  1JMW A;  1CGO A;  1ZW2 A;  2FFH A;  4I44 A;  4OIQ F;  1D0Z A;  2WL8 A;  4MVM A;  4CS8 A;  4DRI B;  3U9M A;  5A6B A;  1YAU O;  4IRU A;  4LDK A;  1RXQ A;  2HKV A;  4MVU A;  1SMY F;  4U5E E;  1YZA A;  2TMV P;  3NDB B;  2P6V A;  3FVY A;  1LI5 A;  3IQC A;  3LNM B;  2CCY A;  3ZC4 A;  4NY3 A;  4MW8 A;  1MMN A;  5KYY B;  1RKE B;  3CSK A;  3LLI A;  2HV7 A;  4GYT A;  2HSQ A;  3AGU A;  4U5B E;  4E7S A;  2IXP A;  4YK5 A;  4AE4 B;  3FDQ A;  5L0C A;  3IPM O;  5KYY A;  2R7R A;  5L3V A;  1C03 A;  2A69 F;  4BJ5 C;  3AG2 C;  2XLM A;  5IY5 C;  1XZP A;  3GM1 A;  4RBN A;  4C3D A;  1FMV A;  2WVN A;  4K1O A;  1E85 A;  1CPR A;  2LFF A;  3U8V A;  3B71 A;  2YL3 A;  3EQL F;  3EZH A;  3L34 A;  4W8K A;  4EBK A;  3U0C A;  4JE9 A;  4PFO A;  1BDJ B;  1LE2 A;  2XLH A;  5DQT A;  2HJM A;  4MVQ A;  4AK9 A;  3W2W A;  5DS5 A;  2I8B A;  1J8M F;  2XXA B;  2P1A A;  1LIH A;  2OEV A;  3DAG A;  2DYS C;  3S27 A;  4JJG A;  3WHN A;  4CBE A;  1RKE A;  4MVZ A;  3SXK A;  3ASN C;  2WVQ A;  1W2W A;  3AOU A;  3KYJ A;  3M4C A;  3NYM A;  2QLA A;  2YRF A;  1YJG A;  4BPM A;  1GGQ A;  3V5X A;  1SF8 A;  4DBQ A;  1Q0G A;  3ABL C;  4XLP F;  4JW1 A;  4Z9H A;  1KNY A;  1YDI A;  2WZF A;  3G4X A;  3X1O A;  3BRJ A;  2B0H A;  4JTA B;  2PX0 A;  4JEA A;  1ZW3 A;  4IAQ A;  4NCQ A;  4WAB A;  5FZT A;  5BUO A;  2Q9C A;  4J32 B;  3GEH A;  4I1M A;  1BR2 A;  1ZYR F;  2A0B A;  2OCC C;  4C7O B;  2IOQ A;  3FAP B;  4JCH A;  1OQC A;  3IQ6 A;  1YYJ A;  2PFD A;  2PP4 A;  2Y3H A;  1M57 C;  3QVY A;  3TJ6 A;  3V5Z A;  2R7S A;  2IXO A;  3L0I A;  1OW8 A;  1PD1 A;  2Q4F A;  1WN0 A;  4JTD B;  2YWA A;  3ZTM A;  3T9O A;  3ABM C;  3C8G D;  3JT1 A;  3UMK A;  5K0I A;  3S90 A;  5F5F A;  3US6 A;  4L6R A;  2AP3 A;  1JPN A;  3O10 A;  3C18 A;  1HY5 A;  1TWG A;  2FGY A;  2KC3 A;  2KYH A;  2Q7R A;  2EIK C;  3QVZ A;  4NTB A;  3ZQY A;  2AU5 A;  2W4B A;  1SR2 A;  2JPU A;  3UNG C;  1U89 A;  1AVO B;  1K04 A;  4MQ9 F;  4LDQ A;  2C03 A;  1VLS A;  2R7V A;  3DJN B;  4YT8 A;  3ASO C;  1LPE A;  4YT4 A;  1FR0 A;  2UUI A;  4BJT A;  3HKK A;  4HFK B;  2M64 A;  2HFI A;  4O79 A;  5B1A C;  2C04 A;  2OU6 A;  2VCA A;  5COG A;  5L0D A;  5JSL A;  2W45 A;  3NMK A;  2AWC A;  2CNW A;  4BEJ A;  3EG9 A;  3OWT A;  4G7Z F;  1UG7 A;  1V4A A;  3A11 A;  1M2V B;  1WOL A;  2J7P D;  3EHN A;  4MTO A;  2DB4 A;  5D91 A;  3GM3 A;  1Z6A A;  4WJ0 A;  1OCZ C;  2NUP A;  3L1M A;  4W8P A;  2KGO A;  4OIR F;  1LM3 B;  2KW3 C;  5JLI A;  3B0U X;  4KC9 A;  1WTY A;  3R7C A;  3GWL A;  4JJF A;  1RJ9 B;  4PFP A;  4G78 A;  1VYK A;  3RW0 A;  3AGT A;  2X0C A;  1ZU4 A;  3C8Z A;  5EGY A;  1R4T A;  1YA7 O;  2ICW G;  3DJU B;  3UGO A;  2EPL X;  4YJW A;  3WAQ A;  1OR3 A;  1ZHW A;  2GA0 A;  1E84 A;  3LS0 A;  1ZHY A;  3EFO B;  3JCU Q;  3KKB A;  4WGZ A;  2Y3D A;  1D1C A;  5A6K A;  1M6T A;  1MMA A;  1H9T A;  3LUT B;  2XXA A;  4LDR A;  5A69 A;  1L7C A;  3DE9 A;  1PD0 A;  4M63 A;  5HSW A;  4AX2 A;  1OCR C;  2LD6 A;  3EG9 B;  5KYW A;  3OA1 A;  2OOC A;  3GAN A;  1D0Y A;  2Y3G A;  2G3K A;  1OCO C;  2ZXR A;  4FAP B;  1AEP A;  2NPU A;  3GEE A;  4DVY P;  4CIP A;  3ZSU A;  1K05 A;  1BR1 A;  3E70 C;  1Y4C A;  3EHM A;  3JYY A;  4AL1 A;  3HNI A;  2ZXO A;  4CDV A;  4A4A A;  2YEV A;  5D92 A;  1T01 A;  1M56 C;  5L0I A;  2X51 A;  4I3M A;  4OD4 A;  1QLE C;  4N4W A;  3SXZ A;  1EQ1 A;  4XPY A;  4E17 A;  1TR2 A;  2R7W A;  2QTV A;  3M15 A;  3NG1 A;  2LCH A;  3G4Z A;  4K0D A;  4U5H A;  1O5H A;  2DYR C;  1G4U S;  2R02 A;  1I5N A;  1ZZP A;  2EPN A;  1A41 A;  2YHS A;  3JTL O;  3PMR A;  2VB6 A;  4MTF A;  4NQF A;  1QZX A;  2R25 A;  3C7J A;  4RD9 A;  2L81 A;  5COM A;  5JRA A;  4QI2 A;  1TWC A;  4LAC B;  4E18 A;  1WAT A;  1VB5 A;  2XLO A;  3CZ6 A;  5B1B C;  3ECS A;  5AC4 A;  4C7O A;  1LVK A; 
#chains in the Genus database with same CATH homology
 1Y6D A;  3KYJ A;  3US6 A;  1C02 A;  4G78 A;  3KYI A;  1A0B A;  1OXB A;  4PAC A;  1SR2 A;  1C03 A;  3IQT A;  1TQG A;  2LCH A;  3MYF A;  1I5N A;  2A0B A;  2LP4 A;  1FR0 A;  1YVI A;  1BDJ B;  2LD6 A;  2R25 A;  1OXK A;  2OOC A;  1QSP A;  4EUK B;  2Q4F A;  1WN0 A;  3U3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...