1QSPA

Crystal structure of the yeast phosphorelay protein ypd1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
TIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YPD1
publication title Conservation of structure and function among histidine-containing phosphotransfer (HPt) domains as revealed by the crystal structure of YPD1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 62
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1qspA00
1A0BA 1BDJB 1C02A 2LCHA 2OOCA 1OXBA 1QSPA 1WN0A 4PACA 4G78A 3MYFA 4EUKB 1Y6DA 1OXKA 2R25A 1TQGA 1SR2A 2A0BA 3KYIA 1C03A 3KYJA 2Q4FA 2LP4A 3U3BA 3IQTA 1I5NA 3US6A 1YVIA 1FR0A 2LD6A
chains in the Genus database with same CATH superfamily
3V5XA 1CGNA 4CX9A 2EIMC 1A7VA 3X2QC 5B1BC 2EPKX 2HSQA 5DLJA 2OJQA 1VLSA 5A6BD 1G5ZA 3NG1A 2LSEA 4P9FA 2YL0A 4MVUA 3LJBA 3S28A 2G3VA 2NUPB 4RD9A 3JSZA 3A11A 3IQ5A 4G78A 4WABA 1BR4A 4YT2A 3JYYA 4EUKB 2OG2A 3L0IA 2HV6A 3EQLF 5E3AA 2L9JA 1A7EA 1TWCA 2H7BA 1PV3A 3EZHA 4C3EA 4OD4A 3EJNA 4NTBA 3C8GA 2LK4A 3M4BA 3GWNA 4J32B 5A6KA 2GWWA 3ZWIA 5IY5C 3NDBB 2A6EF 3UGPA 2BC5A 1YYJA 4YL0A 1O3UA 1JAFA 2ZD9A 1FR0A 4YL3A 3JRMO 4NTAA 1ZW2A 3TQOA 4K7BA 1NU7D 3W8HA 3H2UA 2BE5F 1ZYRF 3FOOA 1RKCA 3RF3A 3U0CA 2R7UA 3LESA 1KNYA 3RQFA 4U5BE 3RW0A 3QVZA 2HFIA 4W8KA 3TJ6A 3HJCA 5JS5A 2XLOA 2R7RA 1MQVA 1FNTc 2ZXRA 3M4CA 4E7SA 1T6QA 4G0HA 4YT8A 3NYLA 4QI2A 1GM5A 1ZVZA 4BPMA 3TOLA 1LPEA 1R4TA 2XLVA 3ITFA 3KYIA 3QMKA 3B29A 4LDQA 3ZC4A 3ZSUA 4CJGA 4KNWA 3G4ZA 3Q7LA 1A41A 3O39A 4DRIB 4JURI 2NUPA 4PR9A 4CS8A 3S84A 4EWCA 3EHNA 4ZLDA 1GGQA 2EPOA 1GS9A 3US6A 2H8AA 4IRUA 3ZVRA 5A6JA 1JMWA 4JVSA 3DD7A 2J7PA 3RFYA 3LEVA 1FMWA 1NZEA 4G7OF 2IXNA 5DS6A 3FVYA 4JZAA 1D0YA 4P6IC 4RBNA 5A69A 3S27A 3QVYA 5DQZA 1QLEC 2FGYA 2MWQA 2G3KA 2OKUA 4XEKA 2CGEA 3IHUA 1M6TA 3R7CA 4Z9HA 3MYFA 3B71A 1LE4A 1WWPA 2CDQA 3U2LA 4C3BA 4JC7A 4E18A 1RMVA 1KTMA 1V74B 4O6NA 5DVWA 3H2VA 1LVKA 4CBEA 4EKWA 3JZ0A 2J9BA 2UUHA 1YARO 4Q5SF 2PX3A 2WZGA 2JX0A 3J06A 1L7CA 4YT4A 4DXWA 1Q0KA 1FFHA 2HUJA 2W4BA 3TOMA 2R7WA 1OCZC 1YA7O 2XLWA 2VB6A 3M1CB 3N0TA 4K1OA 4OD5A 5JP7A 4CDAA 1JRAA 3NYJA 4PFPA 3CEXA 4ULVA 3ABKC 4N6CA 1D1BA 2Y3HA 2TMVP 2VCBA 3U3FA 3AGTA 1MMNA 1WGWA 2RSEB 4LDRA 2IXPA 2A68F 2LQGA 4U5GA 3DJUB 5EK0A 5COMA 3C8ZA 4FWVA 4CIPA 4K0DA 2OQMA 2QUPA 2L6GA 2W9YA 3TJ5A 2RD9A 1U89A 2YL7A 3BEHA 1UG7A 1YYXA 1ST6A 3W2VA 5JUAA 3FHDA 2BL2A 4KNVA 3ABLC 3DMDA 2EIKC 3LNMB 4NTFA 1E86A 3PHF2 5T1DB 1J8YF 3K33A 3S9OA 1SMYF 4KC9A 1ZHYA 1AUEA 3QW1A 2YWAA 4G7HF 1U6HA 2A1DD 2LIGA 3GM1A 3KL4A 4MVMA 3VAYA 3FDQA 1Z63A 3VRCA 2A6HF 3JT1A 4LACB 3UMHA 2KC3A 1Q0GA 5K0IA 3HKKA 2DYRC 4PJJA 3E9VA 1T5OA 1WASA 3SXKA 1N1CA 3NMIA 1Y4CA 3LNRA 1CGOA 4RDAA 2HJ3A 3OA1A 5AC4A 3UGOA 2HSBA 1JOGA 4JE9A 3G4XA 1ZZPA 1WOLA 4HE8D 5AC5A 1ZU4A 1VOMA 4AL0A 3CAXA 4Z9IA 1AVOB 2HV7A 2WB7A 3GEIA 4MVOA 4ULWA 5EGYA 5EHHA 1TFKB 4E0IA 1WTYA 4C7OB 1PCXA 2QE9A 3I5PA 2Y69C 4JJGA 2Y3BA 4CS7A 1FTSA 3ZQYA 4O6YA 3R2PA 2QLAA 3DZAA 3OWTA 3EZIA 3U3BA 1RJ9B 4MVQA 2XSEA 5E33A 2YVKA 3HTKC 2OEVA 3KPHA 1LM3B 5FZTA 1VTMP 1Q0MA 2IXMA 1AEPA 2KSFA 5DQTA 3CQZA 3EGXB 1OR2A 2R05A 2AP3A 2CNWD 5CIVA 2Y39A 1YAUO 4KI2A 2OJED 1MMDA 1NSGB 2XLDA 3GODA 1M2VB 2XLEA 4FESA 2OOCA 3TULA 3B9QA 1LIHA 2A69F 2YLDA 3V5YA 4AL1A 4DBRA 5JRAA 1ZHXA 2HZ8A 2YQYA 4NY3A 1OXBA 1QSPA 1YZCA 4PACA 2GAQA 4QI0A 3L8IA 1O5HA 5CI9A 3T4RA 1LI5A 1LS4A 1XZPA 3WODF 4AE4B 4MTFA 4OIPF 3RQGA 5L0HA 4M63A 2PNOA 4ANJA 4DOZA 2AWCA 2PF4E 4MNDA 4E0HA 2O9XA 4O6MA 1E84A 4GYTA 3C63A 2HMZA 3NRHA 2EILC 5A6BA 4YJWA 4EIYA 4NCQA 4U5CE 5KYWB 1T6UA 1V54C 2QNLA 3EH1A 5E3CA 3U9MA 2LP4A 2X51A 3PCVA 4U9EA 1HE9A 1ZHTA 1T6IA 1HMOA 1G4WR 2IOQA 2R9RB 4JEAA 1BDJB 1NBBA 1YDIA 3T6GB 2ICWG 3ZIBA 4BJTA 4C7OA 2XM4A 1Z5ZA 4HFFB 1XWJA 3ZG1A 1R5ID 1CGME 2L81A 4X0RA 1M57C 2XM0A 2FFHA 2R02A 4AX2A 1H9TA 1T9KA 1RJ9A 3AJMA 1GQAA 3AOUA 1NU9C 1ZHWA 3EGXA 1JPJA 1K04A 2H7OA 4JW1A 2HMQA 3RH3A 3RIPA 1PD0A 4P9TA 4J30B 5BUOA 3DAGA 3B0UX 1M2VA 1CPRA 5KYYB 3I5QA 4YWQA 1J8MF 1E85A 1EA8A 5F5FA 4CDVA 4ZLCA 4MQ9F 1G4US 2IBFA 1C17M 4CS9A 1I4YA 1OCRC 256BA 3WAQA 4EBKA 3WG7C 4AE4A 1TFOB 2PX0A 3G50A 3O10A 4BEJA 2HS5A 4UDVA 2JPUA 3S29A 3AG1C 2YLGA 3HNLA 5KYWA 3SXYA 3M15A 2CCYA 4J7YA 2ZXWC 4U5HA 2X0CA 3HLZA 2Q7RA 1E83A 2J0WA 2H7VC 2YRFA 3ZQVA 2YL3A 4L6RA 3TD7A 1EKYA 3EHMA 1OR3A 2KW3C 3JTLO 2EIJC 1U0BB 4E17A 5F28E 1MNEA 3T6BA 1JPNA 4OIOF 1LE2A 1SF8A 4XPXA 1OCCC 3V7OA 2YEVA 2XLMA 2AVKA 3L34A 1NFOA 1VYKA 2ZXOA 1LKXA 2MYSA 1YJGA 2WL8A 1F1MA 2R7QA 2WVOA 3GEEA 4JIOA 4E7ZA 5BQIA 2YL1A 5KYYA 4IWBA 4PK4A 3ZTZA 1C02A 2WZFA 4ONSA 5COGA 1RKEB 3DXJF 2B0JA 1OCOC 1SZIA 3EH2A 3AGUA 3POVA 4BJ5A 1ZU5A 2OEXA 4CJOA 1DOWA 4OIQF 1QKRA 2I8BA 2J9WA 3AQCA 3QTHA 1Z3IX 1VMAA 4LDKA 4NC3A 3K7DA 1BR2A 3JCUQ 2DI3A 4XQ1A 4DJ9A 3DM5A 2NG1A 4JTCB 2GDCA 2PBEA 2P0NA 2G62A 2A0BA 4IAQA 2YKZA 2XL8A 5DS5A 4MTGA 3VM6A 3S90A 3AG4C 3IQCA 3MX3A 3EG9B 3PDMP 3KMIA 2AWYA 3WHNA 5DS4A 2OU6A 3QZCA 3IQTA 1HW2A 1I5NA 4N4WA 5E2QA 2M64A 2V26A 3HNKA 2CW0F 5GPGB 1IZMA 2AU5A 3EFOB 3ZTMA 3U8VA 2R7TA 5A6AA 4IARA 2QY9A 1K05A 4MVSA 1O87A 3K66A 4MVZA 4CS9C 4N6HA 4D4NA 3T9OA 4DRHB 3FXHA 4XWJA 2EPMX 5BQGA 4EBBA 2P61A 1QZXA 3O55A 4IJJA 3U8PA 4BJ6A 3S0XA 3LS1A 2D4UA 1NFNA 1ORSC 4JCHA 5D92A 5TJ5E 2C04A 4U9DA 5JT4A 1NG1A 2J8WA 4IAOA 5JVEA 1RKEA 1XZQA 3DAFA 3F46A 1D0XA 3K1IA 5KYNA 4KBLA 2J9VA 3KYJA 3DJNB 1RXQA 1QQ3A 4DBQA 4LERA 2W45A 1W2WA 4GQHA 3UR3C 3L8JA 3EGDB 4NQFA 1OKKD 4H4KC 3MBGA 4G7ZF 1ZW3A 4J7TA 2EINC 5KYXB 3CSKA 3FAPB 3A9CA 1D0ZA 3M79A 2HKVA 3EG9A 2LCHA 2VCAA 1FMVA 3LEOA 5COFA 4I1MA 1E2XA 1HW1A 4OINF 5L3QA 3C7JA 4HEAJ 2L7AA 3HNIA 3VF0A 1WN0A 3Q7GA 4U5EE 3DE8A 1JR8A 3DKAA 3EFOA 1H9GA 4PJLA 3U2MA 2MHRA 3SZRA 3AG2C 4H54A 3ECSA 1LS1A 2NPUA 3JSEO 4BJ5C 2KJGA 2CNWA 3ASOC 3LLKA 5T3WA 5L0CA 4JRZA 2Y3GA 2IM8A 2VCCA 1TWHA 5B3IA 1ORJA 2J45A 1H7IA 4DRJB 1TKNA 2VH3A 3AG3C 1EI7A 3MLGA 3U9JA 2GA0A 1Z23A 1BBHA 1QPUA 2P6VA 3TK0A 3PMRA 4D4XA 3C8GD 4JKVA 4XTKA 2KYHA 1H6GA 2Y3DA 1L3PA 4JTAB 5B1AC 2JD3A 1IW7F 3AQBA 2ETSA 2DGJA 3HNJA 3EGDA 3B0PA 2F22A 3CZ6A 1YLMA 3LUTB 1MNDA 2IXOA 3JRTA 1TWGA 3H65A 3JYHA 5KYXA 2CYDA 5L0FA 4CSAA 4DVYP 2J9UA 1Q0FA 1SR2A 1B68A 3FMSA 4BJ6C 1CPQA 3RQEA 4LLCA 4GEHA 1D1AA 3GM3A 1M2OA 5BQHA 4LLEA 2FAPB 1EQ1A 3BRJA 1VLTA 2P1AA 2PFDA 2C03A 3ASNC 2B0HA 4IGGA 2XLHA 3MFNA 5L0DA 4QDLA 1A0BA 4R32A 4MW8A 3K1IC 3MYIA 3RYLA 3W8IA 1A7DA 1VK5A 2NSGA 3Q6NA 3LLIA 4MW3A 3SEOA 3UNGC 1MMGA 3N24A 4PJMA 1T01A 2HJMA 3DWWA 4YK5A 2XL4A 4CDYA 4OIRF 4Z9JA 4A4AA 5L0JA 4AK9A 3B0VC 4BEMJ 4YL1A 1TR2A 2WVNA 2YZSA 2J7PD 3IPMO 4PFOA 3T6JA 2ZPAA 1G8XA 1WATA 3K1HA 4WGYA 4XPYA 3RVZA 5L0GA 2J46A 1TQGA 2ASRA 4I1OB 3OEOA 3DM9B 3C62A 3W4YA 1C03A 4XLNF 3ABMC 3NYMA 1YA9A 2W4MA 5L0IA 2QTVA 1TWAA 1UFBA 2I15A 1Z7Qc 3X1OA 3N2ZB 3ZDLA 2XS1A 1D1CA 3NKEA 2KK1A 2L6FA 1OW7A 2M4EA 4MS2A 4JJFA 2YLIA 3UMIA 4I44A 2R03A 4HFKB 4EBJA 2R7XA 3UMKA 3GANA 5HV9A 1HE1A 4F4BA 2E87A 2Q9AA 3IQ6A 3RVYA 2R7OA 2DB4A 5T3TA 2IYLD 1HY5A 1QVXA 4FX5A 4U5FE 4WJ0A 1HMDA 3SP1A 2A0UA 4MTOA 2DYSC 2OCCC 3EPVA 4B6IA 1Y6DA 3NMJA 4O7GA 4C3DA 3KH2A 3SXZA 3FOPA 1RCPA 3Q6MA 4I3MA 3E70C 4XEFA 5F5HA 5JSLA 2VASA 3NMKA 4XEVA 2LFFA 5D91A 2Z15A 4U5DE 4Q4ZF 2Q4FA 4YT5A 3O6XA 4FAPB 2KQ9A 4Q7CA 4CSAC 1Z6AA 2J0XA 2XRHA 3LS0A 1M56C 5AGFA 1PD1A 5B3SC 5HSWA 2KNHA 2VC9A 1V4AA 3DI5A 2Q00A 2XL6A 3GORA 3K6BA 2EPLX 1SYQA 2XXAB 5KYUB 2NUTB 2YHSA 1VYIA 1FAPB 2UUIA 4IB4A 2V3CC 2GFHA 1BR1A 3U5SA 1Q0DA 5CI8A 1ZHZA 2EPNA 2Q9BA 3GM2A 1YZAA 4DVZA 1OW6A 1APCA 3I4UA 2PP4A 2D5RB 3DE9A 1S7ZA 1I4ZA 5FCLA 4W8PA 2XS8A 4JEBA 4YN0B 3F47A 3RKOF 1K40A 2NSFA 1S05A 1VB5A 3NKDA 4WGZA 3QW0A 1V55C 1FFTC 3GEHA 4CS8C 1BZ4A 3SXMA 1NLXA 4BJ1A 3C8GB 1OQCA 2R7SA 1DOVA 1ORYA 3C18A 1OW8A 2ZXPA 3SNHA 5JLIA 4ER9A 3FAJA 3ATPA 5L3VA 1OKKA 3GWLA 2LFDA 3L1MA 3SYNA 3KKBA 2WVQA 1OXKA 2R25A 4MVRA 3VYWA 4JCZA 4XLPF 4XPWA 4PJNA 2P7VA 4EHPA 3V5ZA 4BG0A 4CIHA 2R7VA 4JTDB 2XXAA 3IEEA 4O79A 5KYUA 2NUTA 4A2NB 4N06A 3LAYA 1KU2A 2KGOA 2L6HA 3W2WA 2Q3TA 1YVIA 2Q9CA 2LD6A 2WZLA 1MMAA 1LI7A
chains in the Genus database with same CATH topology
1A0BA 1BDJB 1C02A 2LCHA 2OOCA 1OXBA 1QSPA 1WN0A 4PACA 4G78A 3MYFA 4EUKB 1Y6DA 1OXKA 2R25A 1TQGA 1SR2A 2A0BA 3KYIA 1C03A 3KYJA 2Q4FA 2LP4A 3U3BA 3IQTA 1I5NA 3US6A 1YVIA 1FR0A 2LD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0B A;  1BDJ B;  1C02 A;  2LCH A;  2OOC A;  1OXB A;  1QSP A;  1WN0 A;  4PAC A;  4G78 A;  3MYF A;  4EUK B;  1Y6D A;  1OXK A;  2R25 A;  1TQG A;  1SR2 A;  2A0B A;  3KYI A;  1C03 A;  3KYJ A;  2Q4F A;  2LP4 A;  3U3B A;  3IQT A;  1I5N A;  3US6 A;  1YVI A;  1FR0 A;  2LD6 A; 
#chains in the Genus database with same CATH topology
 3V5X A;  1CGN A;  4CX9 A;  2EIM C;  1A7V A;  3X2Q C;  5B1B C;  2EPK X;  2HSQ A;  5DLJ A;  2OJQ A;  1VLS A;  5A6B D;  1G5Z A;  3NG1 A;  2LSE A;  4P9F A;  2YL0 A;  4MVU A;  3LJB A;  3S28 A;  2G3V A;  2NUP B;  4RD9 A;  3JSZ A;  3A11 A;  3IQ5 A;  4G78 A;  4WAB A;  1BR4 A;  4YT2 A;  3JYY A;  4EUK B;  2OG2 A;  3L0I A;  2HV6 A;  3EQL F;  5E3A A;  2L9J A;  1A7E A;  1TWC A;  2H7B A;  1PV3 A;  3EZH A;  4C3E A;  4OD4 A;  3EJN A;  4NTB A;  3C8G A;  2LK4 A;  3M4B A;  3GWN A;  4J32 B;  5A6K A;  2GWW A;  3ZWI A;  5IY5 C;  3NDB B;  2A6E F;  3UGP A;  2BC5 A;  1YYJ A;  4YL0 A;  1O3U A;  1JAF A;  2ZD9 A;  1FR0 A;  4YL3 A;  3JRM O;  4NTA A;  1ZW2 A;  3TQO A;  4K7B A;  1NU7 D;  3W8H A;  3H2U A;  2BE5 F;  1ZYR F;  3FOO A;  1RKC A;  3RF3 A;  3U0C A;  2R7U A;  3LES A;  1KNY A;  3RQF A;  4U5B E;  3RW0 A;  3QVZ A;  2HFI A;  4W8K A;  3TJ6 A;  3HJC A;  5JS5 A;  2XLO A;  2R7R A;  1MQV A;  1FNT c;  2ZXR A;  3M4C A;  4E7S A;  1T6Q A;  4G0H A;  4YT8 A;  3NYL A;  4QI2 A;  1GM5 A;  1ZVZ A;  4BPM A;  3TOL A;  1LPE A;  1R4T A;  2XLV A;  3ITF A;  3KYI A;  3QMK A;  3B29 A;  4LDQ A;  3ZC4 A;  3ZSU A;  4CJG A;  4KNW A;  3G4Z A;  3Q7L A;  1A41 A;  3O39 A;  4DRI B;  4JUR I;  2NUP A;  4PR9 A;  4CS8 A;  3S84 A;  4EWC A;  3EHN A;  4ZLD A;  1GGQ A;  2EPO A;  1GS9 A;  3US6 A;  2H8A A;  4IRU A;  3ZVR A;  5A6J A;  1JMW A;  4JVS A;  3DD7 A;  2J7P A;  3RFY A;  3LEV A;  1FMW A;  1NZE A;  4G7O F;  2IXN A;  5DS6 A;  3FVY A;  4JZA A;  1D0Y A;  4P6I C;  4RBN A;  5A69 A;  3S27 A;  3QVY A;  5DQZ A;  1QLE C;  2FGY A;  2MWQ A;  2G3K A;  2OKU A;  4XEK A;  2CGE A;  3IHU A;  1M6T A;  3R7C A;  4Z9H A;  3MYF A;  3B71 A;  1LE4 A;  1WWP A;  2CDQ A;  3U2L A;  4C3B A;  4JC7 A;  4E18 A;  1RMV A;  1KTM A;  1V74 B;  4O6N A;  5DVW A;  3H2V A;  1LVK A;  4CBE A;  4EKW A;  3JZ0 A;  2J9B A;  2UUH A;  1YAR O;  4Q5S F;  2PX3 A;  2WZG A;  2JX0 A;  3J06 A;  1L7C A;  4YT4 A;  4DXW A;  1Q0K A;  1FFH A;  2HUJ A;  2W4B A;  3TOM A;  2R7W A;  1OCZ C;  1YA7 O;  2XLW A;  2VB6 A;  3M1C B;  3N0T A;  4K1O A;  4OD5 A;  5JP7 A;  4CDA A;  1JRA A;  3NYJ A;  4PFP A;  3CEX A;  4ULV A;  3ABK C;  4N6C A;  1D1B A;  2Y3H A;  2TMV P;  2VCB A;  3U3F A;  3AGT A;  1MMN A;  1WGW A;  2RSE B;  4LDR A;  2IXP A;  2A68 F;  2LQG A;  4U5G A;  3DJU B;  5EK0 A;  5COM A;  3C8Z A;  4FWV A;  4CIP A;  4K0D A;  2OQM A;  2QUP A;  2L6G A;  2W9Y A;  3TJ5 A;  2RD9 A;  1U89 A;  2YL7 A;  3BEH A;  1UG7 A;  1YYX A;  1ST6 A;  3W2V A;  5JUA A;  3FHD A;  2BL2 A;  4KNV A;  3ABL C;  3DMD A;  2EIK C;  3LNM B;  4NTF A;  1E86 A;  3PHF 2;  5T1D B;  1J8Y F;  3K33 A;  3S9O A;  1SMY F;  4KC9 A;  1ZHY A;  1AUE A;  3QW1 A;  2YWA A;  4G7H F;  1U6H A;  2A1D D;  2LIG A;  3GM1 A;  3KL4 A;  4MVM A;  3VAY A;  3FDQ A;  1Z63 A;  3VRC A;  2A6H F;  3JT1 A;  4LAC B;  3UMH A;  2KC3 A;  1Q0G A;  5K0I A;  3HKK A;  2DYR C;  4PJJ A;  3E9V A;  1T5O A;  1WAS A;  3SXK A;  1N1C A;  3NMI A;  1Y4C A;  3LNR A;  1CGO A;  4RDA A;  2HJ3 A;  3OA1 A;  5AC4 A;  3UGO A;  2HSB A;  1JOG A;  4JE9 A;  3G4X A;  1ZZP A;  1WOL A;  4HE8 D;  5AC5 A;  1ZU4 A;  1VOM A;  4AL0 A;  3CAX A;  4Z9I A;  1AVO B;  2HV7 A;  2WB7 A;  3GEI A;  4MVO A;  4ULW A;  5EGY A;  5EHH A;  1TFK B;  4E0I A;  1WTY A;  4C7O B;  1PCX A;  2QE9 A;  3I5P A;  2Y69 C;  4JJG A;  2Y3B A;  4CS7 A;  1FTS A;  3ZQY A;  4O6Y A;  3R2P A;  2QLA A;  3DZA A;  3OWT A;  3EZI A;  3U3B A;  1RJ9 B;  4MVQ A;  2XSE A;  5E33 A;  2YVK A;  3HTK C;  2OEV A;  3KPH A;  1LM3 B;  5FZT A;  1VTM P;  1Q0M A;  2IXM A;  1AEP A;  2KSF A;  5DQT A;  3CQZ A;  3EGX B;  1OR2 A;  2R05 A;  2AP3 A;  2CNW D;  5CIV A;  2Y39 A;  1YAU O;  4KI2 A;  2OJE D;  1MMD A;  1NSG B;  2XLD A;  3GOD A;  1M2V B;  2XLE A;  4FES A;  2OOC A;  3TUL A;  3B9Q A;  1LIH A;  2A69 F;  2YLD A;  3V5Y A;  4AL1 A;  4DBR A;  5JRA A;  1ZHX A;  2HZ8 A;  2YQY A;  4NY3 A;  1OXB A;  1QSP A;  1YZC A;  4PAC A;  2GAQ A;  4QI0 A;  3L8I A;  1O5H A;  5CI9 A;  3T4R A;  1LI5 A;  1LS4 A;  1XZP A;  3WOD F;  4AE4 B;  4MTF A;  4OIP F;  3RQG A;  5L0H A;  4M63 A;  2PNO A;  4ANJ A;  4DOZ A;  2AWC A;  2PF4 E;  4MND A;  4E0H A;  2O9X A;  4O6M A;  1E84 A;  4GYT A;  3C63 A;  2HMZ A;  3NRH A;  2EIL C;  5A6B A;  4YJW A;  4EIY A;  4NCQ A;  4U5C E;  5KYW B;  1T6U A;  1V54 C;  2QNL A;  3EH1 A;  5E3C A;  3U9M A;  2LP4 A;  2X51 A;  3PCV A;  4U9E A;  1HE9 A;  1ZHT A;  1T6I A;  1HMO A;  1G4W R;  2IOQ A;  2R9R B;  4JEA A;  1BDJ B;  1NBB A;  1YDI A;  3T6G B;  2ICW G;  3ZIB A;  4BJT A;  4C7O A;  2XM4 A;  1Z5Z A;  4HFF B;  1XWJ A;  3ZG1 A;  1R5I D;  1CGM E;  2L81 A;  4X0R A;  1M57 C;  2XM0 A;  2FFH A;  2R02 A;  4AX2 A;  1H9T A;  1T9K A;  1RJ9 A;  3AJM A;  1GQA A;  3AOU A;  1NU9 C;  1ZHW A;  3EGX A;  1JPJ A;  1K04 A;  2H7O A;  4JW1 A;  2HMQ A;  3RH3 A;  3RIP A;  1PD0 A;  4P9T A;  4J30 B;  5BUO A;  3DAG A;  3B0U X;  1M2V A;  1CPR A;  5KYY B;  3I5Q A;  4YWQ A;  1J8M F;  1E85 A;  1EA8 A;  5F5F A;  4CDV A;  4ZLC A;  4MQ9 F;  1G4U S;  2IBF A;  1C17 M;  4CS9 A;  1I4Y A;  1OCR C;  256B A;  3WAQ A;  4EBK A;  3WG7 C;  4AE4 A;  1TFO B;  2PX0 A;  3G50 A;  3O10 A;  4BEJ A;  2HS5 A;  4UDV A;  2JPU A;  3S29 A;  3AG1 C;  2YLG A;  3HNL A;  5KYW A;  3SXY A;  3M15 A;  2CCY A;  4J7Y A;  2ZXW C;  4U5H A;  2X0C A;  3HLZ A;  2Q7R A;  1E83 A;  2J0W A;  2H7V C;  2YRF A;  3ZQV A;  2YL3 A;  4L6R A;  3TD7 A;  1EKY A;  3EHM A;  1OR3 A;  2KW3 C;  3JTL O;  2EIJ C;  1U0B B;  4E17 A;  5F28 E;  1MNE A;  3T6B A;  1JPN A;  4OIO F;  1LE2 A;  1SF8 A;  4XPX A;  1OCC C;  3V7O A;  2YEV A;  2XLM A;  2AVK A;  3L34 A;  1NFO A;  1VYK A;  2ZXO A;  1LKX A;  2MYS A;  1YJG A;  2WL8 A;  1F1M A;  2R7Q A;  2WVO A;  3GEE A;  4JIO A;  4E7Z A;  5BQI A;  2YL1 A;  5KYY A;  4IWB A;  4PK4 A;  3ZTZ A;  1C02 A;  2WZF A;  4ONS A;  5COG A;  1RKE B;  3DXJ F;  2B0J A;  1OCO C;  1SZI A;  3EH2 A;  3AGU A;  3POV A;  4BJ5 A;  1ZU5 A;  2OEX A;  4CJO A;  1DOW A;  4OIQ F;  1QKR A;  2I8B A;  2J9W A;  3AQC A;  3QTH A;  1Z3I X;  1VMA A;  4LDK A;  4NC3 A;  3K7D A;  1BR2 A;  3JCU Q;  2DI3 A;  4XQ1 A;  4DJ9 A;  3DM5 A;  2NG1 A;  4JTC B;  2GDC A;  2PBE A;  2P0N A;  2G62 A;  2A0B A;  4IAQ A;  2YKZ A;  2XL8 A;  5DS5 A;  4MTG A;  3VM6 A;  3S90 A;  3AG4 C;  3IQC A;  3MX3 A;  3EG9 B;  3PDM P;  3KMI A;  2AWY A;  3WHN A;  5DS4 A;  2OU6 A;  3QZC A;  3IQT A;  1HW2 A;  1I5N A;  4N4W A;  5E2Q A;  2M64 A;  2V26 A;  3HNK A;  2CW0 F;  5GPG B;  1IZM A;  2AU5 A;  3EFO B;  3ZTM A;  3U8V A;  2R7T A;  5A6A A;  4IAR A;  2QY9 A;  1K05 A;  4MVS A;  1O87 A;  3K66 A;  4MVZ A;  4CS9 C;  4N6H A;  4D4N A;  3T9O A;  4DRH B;  3FXH A;  4XWJ A;  2EPM X;  5BQG A;  4EBB A;  2P61 A;  1QZX A;  3O55 A;  4IJJ A;  3U8P A;  4BJ6 A;  3S0X A;  3LS1 A;  2D4U A;  1NFN A;  1ORS C;  4JCH A;  5D92 A;  5TJ5 E;  2C04 A;  4U9D A;  5JT4 A;  1NG1 A;  2J8W A;  4IAO A;  5JVE A;  1RKE A;  1XZQ A;  3DAF A;  3F46 A;  1D0X A;  3K1I A;  5KYN A;  4KBL A;  2J9V A;  3KYJ A;  3DJN B;  1RXQ A;  1QQ3 A;  4DBQ A;  4LER A;  2W45 A;  1W2W A;  4GQH A;  3UR3 C;  3L8J A;  3EGD B;  4NQF A;  1OKK D;  4H4K C;  3MBG A;  4G7Z F;  1ZW3 A;  4J7T A;  2EIN C;  5KYX B;  3CSK A;  3FAP B;  3A9C A;  1D0Z A;  3M79 A;  2HKV A;  3EG9 A;  2LCH A;  2VCA A;  1FMV A;  3LEO A;  5COF A;  4I1M A;  1E2X A;  1HW1 A;  4OIN F;  5L3Q A;  3C7J A;  4HEA J;  2L7A A;  3HNI A;  3VF0 A;  1WN0 A;  3Q7G A;  4U5E E;  3DE8 A;  1JR8 A;  3DKA A;  3EFO A;  1H9G A;  4PJL A;  3U2M A;  2MHR A;  3SZR A;  3AG2 C;  4H54 A;  3ECS A;  1LS1 A;  2NPU A;  3JSE O;  4BJ5 C;  2KJG A;  2CNW A;  3ASO C;  3LLK A;  5T3W A;  5L0C A;  4JRZ A;  2Y3G A;  2IM8 A;  2VCC A;  1TWH A;  5B3I A;  1ORJ A;  2J45 A;  1H7I A;  4DRJ B;  1TKN A;  2VH3 A;  3AG3 C;  1EI7 A;  3MLG A;  3U9J A;  2GA0 A;  1Z23 A;  1BBH A;  1QPU A;  2P6V A;  3TK0 A;  3PMR A;  4D4X A;  3C8G D;  4JKV A;  4XTK A;  2KYH A;  1H6G A;  2Y3D A;  1L3P A;  4JTA B;  5B1A C;  2JD3 A;  1IW7 F;  3AQB A;  2ETS A;  2DGJ A;  3HNJ A;  3EGD A;  3B0P A;  2F22 A;  3CZ6 A;  1YLM A;  3LUT B;  1MND A;  2IXO A;  3JRT A;  1TWG A;  3H65 A;  3JYH A;  5KYX A;  2CYD A;  5L0F A;  4CSA A;  4DVY P;  2J9U A;  1Q0F A;  1SR2 A;  1B68 A;  3FMS A;  4BJ6 C;  1CPQ A;  3RQE A;  4LLC A;  4GEH A;  1D1A A;  3GM3 A;  1M2O A;  5BQH A;  4LLE A;  2FAP B;  1EQ1 A;  3BRJ A;  1VLT A;  2P1A A;  2PFD A;  2C03 A;  3ASN C;  2B0H A;  4IGG A;  2XLH A;  3MFN A;  5L0D A;  4QDL A;  1A0B A;  4R32 A;  4MW8 A;  3K1I C;  3MYI A;  3RYL A;  3W8I A;  1A7D A;  1VK5 A;  2NSG A;  3Q6N A;  3LLI A;  4MW3 A;  3SEO A;  3UNG C;  1MMG A;  3N24 A;  4PJM A;  1T01 A;  2HJM A;  3DWW A;  4YK5 A;  2XL4 A;  4CDY A;  4OIR F;  4Z9J A;  4A4A A;  5L0J A;  4AK9 A;  3B0V C;  4BEM J;  4YL1 A;  1TR2 A;  2WVN A;  2YZS A;  2J7P D;  3IPM O;  4PFO A;  3T6J A;  2ZPA A;  1G8X A;  1WAT A;  3K1H A;  4WGY A;  4XPY A;  3RVZ A;  5L0G A;  2J46 A;  1TQG A;  2ASR A;  4I1O B;  3OEO A;  3DM9 B;  3C62 A;  3W4Y A;  1C03 A;  4XLN F;  3ABM C;  3NYM A;  1YA9 A;  2W4M A;  5L0I A;  2QTV A;  1TWA A;  1UFB A;  2I15 A;  1Z7Q c;  3X1O A;  3N2Z B;  3ZDL A;  2XS1 A;  1D1C A;  3NKE A;  2KK1 A;  2L6F A;  1OW7 A;  2M4E A;  4MS2 A;  4JJF A;  2YLI A;  3UMI A;  4I44 A;  2R03 A;  4HFK B;  4EBJ A;  2R7X A;  3UMK A;  3GAN A;  5HV9 A;  1HE1 A;  4F4B A;  2E87 A;  2Q9A A;  3IQ6 A;  3RVY A;  2R7O A;  2DB4 A;  5T3T A;  2IYL D;  1HY5 A;  1QVX A;  4FX5 A;  4U5F E;  4WJ0 A;  1HMD A;  3SP1 A;  2A0U A;  4MTO A;  2DYS C;  2OCC C;  3EPV A;  4B6I A;  1Y6D A;  3NMJ A;  4O7G A;  4C3D A;  3KH2 A;  3SXZ A;  3FOP A;  1RCP A;  3Q6M A;  4I3M A;  3E70 C;  4XEF A;  5F5H A;  5JSL A;  2VAS A;  3NMK A;  4XEV A;  2LFF A;  5D91 A;  2Z15 A;  4U5D E;  4Q4Z F;  2Q4F A;  4YT5 A;  3O6X A;  4FAP B;  2KQ9 A;  4Q7C A;  4CSA C;  1Z6A A;  2J0X A;  2XRH A;  3LS0 A;  1M56 C;  5AGF A;  1PD1 A;  5B3S C;  5HSW A;  2KNH A;  2VC9 A;  1V4A A;  3DI5 A;  2Q00 A;  2XL6 A;  3GOR A;  3K6B A;  2EPL X;  1SYQ A;  2XXA B;  5KYU B;  2NUT B;  2YHS A;  1VYI A;  1FAP B;  2UUI A;  4IB4 A;  2V3C C;  2GFH A;  1BR1 A;  3U5S A;  1Q0D A;  5CI8 A;  1ZHZ A;  2EPN A;  2Q9B A;  3GM2 A;  1YZA A;  4DVZ A;  1OW6 A;  1APC A;  3I4U A;  2PP4 A;  2D5R B;  3DE9 A;  1S7Z A;  1I4Z A;  5FCL A;  4W8P A;  2XS8 A;  4JEB A;  4YN0 B;  3F47 A;  3RKO F;  1K40 A;  2NSF A;  1S05 A;  1VB5 A;  3NKD A;  4WGZ A;  3QW0 A;  1V55 C;  1FFT C;  3GEH A;  4CS8 C;  1BZ4 A;  3SXM A;  1NLX A;  4BJ1 A;  3C8G B;  1OQC A;  2R7S A;  1DOV A;  1ORY A;  3C18 A;  1OW8 A;  2ZXP A;  3SNH A;  5JLI A;  4ER9 A;  3FAJ A;  3ATP A;  5L3V A;  1OKK A;  3GWL A;  2LFD A;  3L1M A;  3SYN A;  3KKB A;  2WVQ A;  1OXK A;  2R25 A;  4MVR A;  3VYW A;  4JCZ A;  4XLP F;  4XPW A;  4PJN A;  2P7V A;  4EHP A;  3V5Z A;  4BG0 A;  4CIH A;  2R7V A;  4JTD B;  2XXA A;  3IEE A;  4O79 A;  5KYU A;  2NUT A;  4A2N B;  4N06 A;  3LAY A;  1KU2 A;  2KGO A;  2L6H A;  3W2W A;  2Q3T A;  1YVI A;  2Q9C A;  2LD6 A;  2WZL A;  1MMA A;  1LI7 A; 
#chains in the Genus database with same CATH homology
 1A0B A;  1BDJ B;  1C02 A;  2LCH A;  2OOC A;  1OXB A;  1QSP A;  1WN0 A;  4PAC A;  4G78 A;  3MYF A;  4EUK B;  1Y6D A;  1OXK A;  2R25 A;  1TQG A;  1SR2 A;  2A0B A;  3KYI A;  1C03 A;  3KYJ A;  2Q4F A;  2LP4 A;  3U3B A;  3IQT A;  1I5N A;  3US6 A;  1YVI A;  1FR0 A;  2LD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...