1QSPA

Crystal structure of the yeast phosphorelay protein ypd1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
TIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conservation of structure and function among histidine-containing phosphotransfer (HPt) domains as revealed by the crystal structure of YPD1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords YPD1
total genus 62
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1qspA00
1Y6DA 1A0BA 1SR2A 1TQGA 4G78A 1BDJB 3KYJA 2LCHA 4EUKB 1OXKA 1C03A 1I5NA 4PACA 2OOCA 1QSPA 2A0BA 2LP4A 3US6A 3MYFA 2R25A 3KYIA 1OXBA 1YVIA 2Q4FA 2LD6A 1FR0A 1WN0A 3U3BA 3IQTA 1C02A
chains in the Genus database with same CATH superfamily
2X0CA 4MTFA 2WZGA 2LFFA 1BDJB 3O39A 1WGWA 4IJJA 4CS9C 2LCHA 3LNMB 1MQVA 2GA0A 3EHMA 5BQGA 4MVQA 3HKKA 1M2VA 2XM0A 4JZAA 1Z63A 3QMKA 1F1MA 3FOOA 3IHUA 4PJLA 2OEVA 3F47A 2WL8A 3NMIA 3OWTA 3RH3A 3S27A 4YT8A 2WVNA 3EGXB 3US6A 2QTVA 2A6HF 1ZYRF 1L7CA 2OKUA 2PF4E 3HNKA 1WWPA 3G4XA 1PD0A 3KPHA 4CJOA 1LKXA 5F5HA 3DKAA 1J8YF 1EI7A 1Y4CA 2FGYA 5KYXA 1OKKD 2IYLD 3AG3C 2HFIA 3ABLC 3AOUA 4MVRA 4W8PA 3Q6NA 5TJ5E 1W2WA 3TOLA 4EWCA 2YL3A 3JSZA 2FAPB 2WZLA 3K33A 3KMIA 1V55C 3QW0A 3ZIBA 1M2OA 3AG1C 4N6CA 5JP7A 3C62A 1Z3IX 3RW0A 3U8VA 1YYXA 4D4XA 1NLXA 4CDYA 2EPMX 5D91A 4EHPA 5DS6A 1S05A 1L3PA 2DI3A 1U6HA 3F46A 3HLZA 1ZW3A 3AG2C 1OXKA 1XWJA 2CCYA 3FMSA 2NUTB 3GODA 3K66A 4NTAA 1VK5A 3H2UA 1A7VA 4LACB 5D92A 1SZIA 1TWCA 2OEXA 5DS4A 4U5HA 2VCBA 2NUPA 2HJ3A 2KYHA 3DZAA 4G0HA 4MTOA 2QE9A 5E33A 2F22A 3C18A 3FHDA 4LDRA 4JW1A 2HMQA 3N24A 4J32B 3AGUA 5HSWA 1GGQA 2HS5A 2IOQA 3S9OA 1VTMP 2A6EF 2LD6A 3V7OA 3R2PA 2Q9AA 3MBGA 3DM5A 2EIJC 4O6MA 4I1OB 3WAQA 2R7QA 1LE4A 2RD9A 4LDQA 1MMAA 3ZSUA 4KC9A 4ULVA 3ZTMA 1VB5A 5T3TA 1T6UA 2JPUA 3KKBA 3ZQYA 4XEKA 4CS8C 2ZPAA 5JUAA 4JRZA 1JMWA 4KNWA 4AL0A 5KYUB 3K1HA 4BEMJ 3GEHA 1AEPA 1YYJA 1ZHWA 2P0NA 3JT1A 3NMJA 2QY9A 4CS8A 3DMDA 4P9TA 3R7CA 2W4MA 3ASOC 4R32A 5JT4A 3NKEA 2ZXPA 4Z9HA 5KYWB 3T9OA 1ZHZA 1JAFA 3K1IA 3W4YA 2L81A 3QVZA 5KYYA 3NDBB 1O5HA 2EIKC 2W9YA 2R05A 3LLIA 3EGDB 1Q0DA 3PDMP 4OD4A 2VCCA 3PMRA 4CSAA 1R4TA 5JS5A 1ZW2A 4NTBA 2D5RB 2GFHA 2OJQA 3B9QA 4K1OA 2XLVA 1SR2A 4EBJA 1M56C 3UMHA 3W2WA 4MTGA 1LS4A 4G78A 4DXWA 3ASNC 1FTSA 2DYRC 4BJ6C 4L6RA 4DBQA 1J8MF 2AVKA 1MNEA 5A6BA 4N06A 3S90A 1RKEB 2OJED 4PACA 5GPGB 4WABA 5L0CA 1G8XA 2ZXRA 4FESA 3RKOF 1T6IA 3IPMO 2XL4A 4XEFA 5KYUA 4ANJA 2O9XA 2Y3DA 1M2VB 4RD9A 4E7SA 1LPEA 3IQ5A 2Q9CA 3TD7A 2W4BA 1SF8A 5A6BD 5COFA 1XZQA 2H7VC 4BJ1A 1FR0A 3B29A 3S84A 3MFNA 2Z15A 2IXOA 3U3BA 3ZWIA 4DRIB 4JEAA 1FMVA 3VRCA 1LE2A 3RFYA 1APCA 3EQLF 3KYJA 4J7YA 2ZXWC 3GM1A 4U9EA 1TFKB 3GWLA 3IQCA 4OIQF 2DYSC 4NY3A 1SMYF 4YJWA 2L6GA 3T6JA 2YQYA 4U5BE 1OCCC 2PFDA 3OA1A 5KYNA 1E2XA 3AQCA 4PFPA 3NYMA 2KNHA 3LAYA 3HTKC 3EZIA 3EFOB 1A7EA 3K1IC 3LJBA 2R7XA 3HJCA 2C04A 4U5DE 1GQAA 2IXPA 3SNHA 3X1OA 2R7OA 2AWCA 2PP4A 2Q4FA 4OD5A 1H6GA 1NG1A 4J7TA 4MS2A 4NTFA 4LLEA 3GM2A 3WHNA 3I4UA 4XLNF 1WN0A 1WOLA 2IBFA 3O55A 4H4KC 1Q0MA 2ICWG 2W45A 3QTHA 3RF3A 1EKYA 4IAOA 2XRHA 2C03A 1JPJA 2HJMA 4U5CE 1T9KA 3K7DA 4LERA 3MYIA 2ZXOA 1AUEA 4G7ZF 5E3CA 2XLOA 3G4ZA 1YDIA 4BJ5C 4CBEA 4ER9A 4NC3A 3DE9A 2A0BA 1K40A 3C63A 3C8GA 1OR3A 1D0XA 5T1DB 4A2NB 3S29A 1K04A 2IM8A 3EH2A 1LS1A 4N6HA 5E2QA 3FDQA 4PR9A 3EZHA 4U5EE 1O87A 5B1AC 2R7TA 2XLWA 1D0ZA 2FFHA 1ZHYA 5EK0A 4E18A 2V3CC 3KH2A 5A6KA 3AGTA 2EPLX 3SXKA 4JCHA 5HV9A 1K05A 1TWAA 2CYDA 3I5PA 4IARA 4IB4A 1BR1A 3NMKA 3PCVA 4ULWA 1NSGB 3I5QA 4Q5SF 4JTCB 4WGYA 1EA8A 4Q4ZF 2NPUA 3RIPA 1MNDA 3SZRA 4OIOF 2M64A 2YL0A 2NUTA 4YWQA 3Q7GA 4C3DA 3QZCA 4AE4B 4YT2A 3ZVRA 2B0HA 2GAQA 1YAUO 2PNOA 5KYYB 2YHSA 3AJMA 4AE4A 3Q7LA 1HMOA 2TMVP 3DWWA 4XWJA 2YLGA 1VYKA 1D1BA 2Q00A 5DLJA 2XSEA 5L0JA 2QUPA 1KU2A 3GANA 3MYFA 4K0DA 2P61A 2WB7A 3DM9B 3LUTB 4EBBA 1RJ9A 1D0YA 1D1CA 3TK0A 1AVOB 3H2VA 3LLKA 4PJMA 4DJ9A 1ZVZA 3L34A 4DRHB 2V26A 4GQHA 5BUOA 3FAPB 4C7OA 3SYNA 3H65A 3JRMO 2J45A 3TJ6A 3UMKA 3E9VA 4AX2A 5A6AA 1KTMA 3LS1A 1OQCA 1YZCA 2E87A 3B0PA 4FX5A 4QI0A 3UR3C 1JOGA 3DE8A 4XQ1A 4YL0A 2R03A 1OKKA 2WZFA 1M6TA 4YK5A 2G3VA 2OOCA 3ZDLA 2UUIA 1QLEC 2LP4A 4XPWA 4ONSA 1TFOB 1TR2A 3GEIA 4MVMA 3U5SA 1PD1A 1QVXA 1VYIA 1QPUA 2XL8A 1IZMA 4O6YA 1VMAA 2DB4A 4OIRF 1WTYA 2CNWD 3B0UX 4KI2A 4YL1A 1OCZC 4QDLA 2R7RA 3U9MA 2PBEA 2AP3A 2GWWA 4P9FA 5DS5A 1OR2A 5F5FA 4FAPB 1M57C 3KL4A 4E17A 3TOMA 3WODF 4H54A 4EIYA 1I4ZA 4IAQA 4DRJB 2R7VA 4CS9A 1TQGA 3N2ZB 3SXZA 2ETSA 1N1CA 2Y3GA 2J46A 3MLGA 5DQTA 1V74B 4EUKB 3EPVA 3DI5A 3NRHA 3PHF2 4LLCA 2Q7RA 4G7OF 1H9GA 1ZU5A 3A11A 3LESA 1Z23A 3RQFA 2I15A 3O6XA 4LDKA 1CPRA 2A68F 3FAJA 2XLMA 2L6FA 3DD7A 1NBBA 4EBKA 4HEAJ 3T6GB 5L0IA 1WASA 3JRTA 1YZAA 1YARO 2X51A 3V5XA 3B0VC 1FFTC 1NZEA 2CGEA 1YVIA 2EPOA 2P6VA 5IY5C 2HUJA 2J9BA 2XLDA 1CPQA 2XL6A 4XTKA 3VF0A 2DGJA 2J7PD 4C3BA 2QNLA 2KQ9A 2NUPB 1E86A 1FFHA 1TWHA 3CZ6A 2IXNA 3ITFA 1ST6A 2JD3A 1FAPB 3DAGA 3RQGA 2HSBA 5AC4A 1ZHTA 3ZG1A 4DOZA 2YZSA 1YA7O 4XEVA 2AWYA 3DJUB 2KGOA 2XM4A 3ZQVA 1PV3A 2A1DD 5CIVA 1A7DA 1C17M 1PCXA 2AU5A 2XLEA 4C3EA 4JEBA 4JIOA 3UMIA 4DBRA 1YLMA 3UNGC 1EQ1A 4AK9A 5JLIA 2MHRA 2R02A 1NU9C 4HE8D 3E70C 1MMGA 4PJNA 4CIPA 1O3UA 3JCUQ 4I44A 5L0HA 4MVSA 4MW8A 4W8KA 3Q6MA 256BA 3ABMC 3BRJA 5E3AA 2HV7A 3DAFA 3HNJA 4IGGA 5BQHA 5A69A 4ZLDA 2R9RB 5DQZA 2EPNA 1Y6DA 1Q0KA 1YJGA 3AQBA 4GEHA 2P7VA 2L9JA 5FZTA 4DVZA 2J0WA 1E85A 4O7GA 2VH3A 2YWAA 4BG0A 4E7ZA 1Z7Qc 1JPNA 1G4US 3ATPA 4JTDB 3GEEA 4YN0B 3ABKC 3X2QC 2LIGA 1RJ9B 1H9TA 4KBLA 1BR2A 1Z6AA 3U2LA 1V54C 1VOMA 1U89A 3EHNA 3QVYA 3GM3A 2H7BA 1OW8A 2OU6A 1I4YA 3JZ0A 2JX0A 4M63A 5B3IA 4J30B 2G3KA 2I8BA 2KW3C 4JJGA 4MW3A 1VLSA 2YVKA 5AC5A 5K0IA 2P1AA 1RMVA 4O79A 1ZZPA 1GS9A 3V5ZA 3ZC4A 3SEOA 5CI9A 3K6BA 3EJNA 5T3WA 5DVWA 4F4BA 1TWGA 2CDQA 1ORSC 3GORA 3EFOA 4EKWA 5KYWA 1ORYA 1OW6A 4CSAC 1NU7D 2A0UA 3DJNB 1MMNA 1SYQA 1E84A 2XLHA 1D1AA 4D4NA 4YT4A 1FMWA 4FWVA 2J9WA 2LQGA 4BJ6A 4AL1A 1DOWA 3QW1A 1C03A 3NG1A 2Y69C 1JRAA 1H7IA 2HMZA 1QSPA 4JVSA 1G5ZA 4BEJA 3CSKA 1WATA 1UFBA 3EGXA 3GWNA 4Z9IA 3CAXA 2BC5A 2RSEB 2VB6A 5BQIA 4N4WA 3NYLA 3KYIA 4RBNA 2HZ8A 3FXHA 3S0XA 1RCPA 4CDAA 5KYXB 3L1MA 1BBHA 4JE9A 2NSGA 2J0XA 2L6HA 3JSEO 4X0RA 3IQ6A 4PK4A 4Z9JA 1ZU4A 3RVZA 1CGME 1RXQA 3M15A 2R7UA 3SXYA 4JCZA 3RQEA 3J06A 4RDAA 4CX9A 2KC3A 3ECSA 5F28E 2NSFA 1YA9A 2OQMA 4CDVA 3EH1A 3HNLA 1FNTc 5L0DA 1Q0FA 3U2MA 1KNYA 2G62A 3NYJA 4PFOA 2J8WA 3BEHA 3M4CA 2J9UA 2Q9BA 2L7AA 5EGYA 1CGNA 3V5YA 3JYHA 4WGZA 2A69F 3EG9B 1Q0GA 4MVUA 2PX3A 3C8ZA 3VAYA 3ZTZA 1OXBA 3W2VA 2KSFA 2J9VA 1LM3B 1JR8A 1LI7A 5AGFA 5L0GA 1LIHA 4Q7CA 3UGOA 3LS0A 1R5ID 2QLAA 2XXAA 2EINC 3W8IA 4C7OB 2CW0F 3C8GB 3U3FA 5B3SC 3HNIA 4A4AA 4WJ0A 4BJTA 2VASA 3L8IA 3NKDA 4CJGA 2M4EA 2YRFA 3T4RA 4BJ5A 2UUHA 1Z5ZA 4HFFB 2HV6A 2B0JA 2HSQA 1HW1A 2KJGA 2LSEA 1T01A 4MVOA 4XLPF 3VYWA 3B71A 5B1BC 2EPKX 4K7BA 4U5GA 4QI2A 4JC7A 2R25A 2KK1A 1HE1A 1LVKA 1ORJA 1TKNA 2ASRA 3WG7C 1LI5A 1HE9A 1CGOA 4HFKB 1G4WR 2H8AA 3S28A 3TULA 1BR4A 3C8GD 2XS1A 4U9DA 3IEEA 4O6NA 3FVYA 1A0BA 3MX3A 2OG2A 4P6IC 4PJJA 3OEOA 5COGA 2XXAB 4E0HA 3EGDA 1HW2A 2MYSA 1U0BB 1MMDA 1OW7A 3O10A 1OCOC 4JTAB 4UDVA 1HY5A 2YL7A 3FOPA 3M1CB 3SXMA 2MWQA 1B68A 5CI8A 5JSLA 5A6JA 1OCRC 2YEVA 2Y3BA 4MNDA 4IRUA 3U9JA 3W8HA 4CS7A 3SP1A 2IXMA 1S7ZA 1NFOA 4GYTA 5L0FA 3L0IA 2Q3TA 4I3MA 4MQ9F 4OINF 3LNRA 3VM6A 4BPMA 3U0CA 4DVYP 3LEVA 1T5OA 4JURI 4IWBA 3A9CA 4NCQA 3RYLA 2R7WA 1DOVA 2ZD9A 2NG1A 1A41A 5JRAA 2LK4A 1VLTA 3M4BA 1QQ3A 2Y39A 3C7JA 4JJFA 5FCLA 1E83A 2YLDA 1HMDA 3IQTA 2PX0A 4XPXA 2XS8A 1IW7F 2HKVA 3JTLO 3TJ5A 2H7OA 4XPYA 4YT5A 1T6QA 2J7PA 2GDCA 4YL3A 1QZXA 5EHHA 1XZPA 1ZHXA 3TQOA 2WVOA 3T6BA 3CEXA 3EG9A 1I5NA 5COMA 4E0IA 4G7HF 1GM5A 1RKCA 2R7SA 3UGPA 3U8PA 3RVYA 5L3VA 2D4UA 4ZLCA 3POVA 2VC9A 3DXJF 3L8JA 1NFNA 4KNVA 4OIPF 1BZ4A 3LEOA 1RKEA 4I1MA 2WVQA 2CNWA 2OCCC 4MVZA 4B6IA 5JVEA 2YL1A 2VCAA 3JYYA 3AG4C 2BL2A 1V4AA 3CQZA 2Y3HA 2YLIA 1QKRA 2BE5F 2EIMC 3N0TA 4U5FE 2YKZA 3G50A 4CIHA 1UG7A 2LFDA 4JKVA 4NQFA 5L3QA 3M79A 2EILC 1C02A
chains in the Genus database with same CATH topology
1Y6DA 1A0BA 1SR2A 1TQGA 4G78A 1BDJB 3KYJA 2LCHA 4EUKB 1OXKA 1C03A 1I5NA 4PACA 2OOCA 1QSPA 2A0BA 2LP4A 3US6A 3MYFA 2R25A 3KYIA 1OXBA 1YVIA 2Q4FA 2LD6A 1FR0A 1WN0A 3U3BA 3IQTA 1C02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6D A;  1A0B A;  1SR2 A;  1TQG A;  4G78 A;  1BDJ B;  3KYJ A;  2LCH A;  4EUK B;  1OXK A;  1C03 A;  1I5N A;  4PAC A;  2OOC A;  1QSP A;  2A0B A;  2LP4 A;  3US6 A;  3MYF A;  2R25 A;  3KYI A;  1OXB A;  1YVI A;  2Q4F A;  2LD6 A;  1FR0 A;  1WN0 A;  3U3B A;  3IQT A;  1C02 A; 
#chains in the Genus database with same CATH topology
 2X0C A;  4MTF A;  2WZG A;  2LFF A;  1BDJ B;  3O39 A;  1WGW A;  4IJJ A;  4CS9 C;  2LCH A;  3LNM B;  1MQV A;  2GA0 A;  3EHM A;  5BQG A;  4MVQ A;  3HKK A;  1M2V A;  2XM0 A;  4JZA A;  1Z63 A;  3QMK A;  1F1M A;  3FOO A;  3IHU A;  4PJL A;  2OEV A;  3F47 A;  2WL8 A;  3NMI A;  3OWT A;  3RH3 A;  3S27 A;  4YT8 A;  2WVN A;  3EGX B;  3US6 A;  2QTV A;  2A6H F;  1ZYR F;  1L7C A;  2OKU A;  2PF4 E;  3HNK A;  1WWP A;  3G4X A;  1PD0 A;  3KPH A;  4CJO A;  1LKX A;  5F5H A;  3DKA A;  1J8Y F;  1EI7 A;  1Y4C A;  2FGY A;  5KYX A;  1OKK D;  2IYL D;  3AG3 C;  2HFI A;  3ABL C;  3AOU A;  4MVR A;  4W8P A;  3Q6N A;  5TJ5 E;  1W2W A;  3TOL A;  4EWC A;  2YL3 A;  3JSZ A;  2FAP B;  2WZL A;  3K33 A;  3KMI A;  1V55 C;  3QW0 A;  3ZIB A;  1M2O A;  3AG1 C;  4N6C A;  5JP7 A;  3C62 A;  1Z3I X;  3RW0 A;  3U8V A;  1YYX A;  4D4X A;  1NLX A;  4CDY A;  2EPM X;  5D91 A;  4EHP A;  5DS6 A;  1S05 A;  1L3P A;  2DI3 A;  1U6H A;  3F46 A;  3HLZ A;  1ZW3 A;  3AG2 C;  1OXK A;  1XWJ A;  2CCY A;  3FMS A;  2NUT B;  3GOD A;  3K66 A;  4NTA A;  1VK5 A;  3H2U A;  1A7V A;  4LAC B;  5D92 A;  1SZI A;  1TWC A;  2OEX A;  5DS4 A;  4U5H A;  2VCB A;  2NUP A;  2HJ3 A;  2KYH A;  3DZA A;  4G0H A;  4MTO A;  2QE9 A;  5E33 A;  2F22 A;  3C18 A;  3FHD A;  4LDR A;  4JW1 A;  2HMQ A;  3N24 A;  4J32 B;  3AGU A;  5HSW A;  1GGQ A;  2HS5 A;  2IOQ A;  3S9O A;  1VTM P;  2A6E F;  2LD6 A;  3V7O A;  3R2P A;  2Q9A A;  3MBG A;  3DM5 A;  2EIJ C;  4O6M A;  4I1O B;  3WAQ A;  2R7Q A;  1LE4 A;  2RD9 A;  4LDQ A;  1MMA A;  3ZSU A;  4KC9 A;  4ULV A;  3ZTM A;  1VB5 A;  5T3T A;  1T6U A;  2JPU A;  3KKB A;  3ZQY A;  4XEK A;  4CS8 C;  2ZPA A;  5JUA A;  4JRZ A;  1JMW A;  4KNW A;  4AL0 A;  5KYU B;  3K1H A;  4BEM J;  3GEH A;  1AEP A;  1YYJ A;  1ZHW A;  2P0N A;  3JT1 A;  3NMJ A;  2QY9 A;  4CS8 A;  3DMD A;  4P9T A;  3R7C A;  2W4M A;  3ASO C;  4R32 A;  5JT4 A;  3NKE A;  2ZXP A;  4Z9H A;  5KYW B;  3T9O A;  1ZHZ A;  1JAF A;  3K1I A;  3W4Y A;  2L81 A;  3QVZ A;  5KYY A;  3NDB B;  1O5H A;  2EIK C;  2W9Y A;  2R05 A;  3LLI A;  3EGD B;  1Q0D A;  3PDM P;  4OD4 A;  2VCC A;  3PMR A;  4CSA A;  1R4T A;  5JS5 A;  1ZW2 A;  4NTB A;  2D5R B;  2GFH A;  2OJQ A;  3B9Q A;  4K1O A;  2XLV A;  1SR2 A;  4EBJ A;  1M56 C;  3UMH A;  3W2W A;  4MTG A;  1LS4 A;  4G78 A;  4DXW A;  3ASN C;  1FTS A;  2DYR C;  4BJ6 C;  4L6R A;  4DBQ A;  1J8M F;  2AVK A;  1MNE A;  5A6B A;  4N06 A;  3S90 A;  1RKE B;  2OJE D;  4PAC A;  5GPG B;  4WAB A;  5L0C A;  1G8X A;  2ZXR A;  4FES A;  3RKO F;  1T6I A;  3IPM O;  2XL4 A;  4XEF A;  5KYU A;  4ANJ A;  2O9X A;  2Y3D A;  1M2V B;  4RD9 A;  4E7S A;  1LPE A;  3IQ5 A;  2Q9C A;  3TD7 A;  2W4B A;  1SF8 A;  5A6B D;  5COF A;  1XZQ A;  2H7V C;  4BJ1 A;  1FR0 A;  3B29 A;  3S84 A;  3MFN A;  2Z15 A;  2IXO A;  3U3B A;  3ZWI A;  4DRI B;  4JEA A;  1FMV A;  3VRC A;  1LE2 A;  3RFY A;  1APC A;  3EQL F;  3KYJ A;  4J7Y A;  2ZXW C;  3GM1 A;  4U9E A;  1TFK B;  3GWL A;  3IQC A;  4OIQ F;  2DYS C;  4NY3 A;  1SMY F;  4YJW A;  2L6G A;  3T6J A;  2YQY A;  4U5B E;  1OCC C;  2PFD A;  3OA1 A;  5KYN A;  1E2X A;  3AQC A;  4PFP A;  3NYM A;  2KNH A;  3LAY A;  3HTK C;  3EZI A;  3EFO B;  1A7E A;  3K1I C;  3LJB A;  2R7X A;  3HJC A;  2C04 A;  4U5D E;  1GQA A;  2IXP A;  3SNH A;  3X1O A;  2R7O A;  2AWC A;  2PP4 A;  2Q4F A;  4OD5 A;  1H6G A;  1NG1 A;  4J7T A;  4MS2 A;  4NTF A;  4LLE A;  3GM2 A;  3WHN A;  3I4U A;  4XLN F;  1WN0 A;  1WOL A;  2IBF A;  3O55 A;  4H4K C;  1Q0M A;  2ICW G;  2W45 A;  3QTH A;  3RF3 A;  1EKY A;  4IAO A;  2XRH A;  2C03 A;  1JPJ A;  2HJM A;  4U5C E;  1T9K A;  3K7D A;  4LER A;  3MYI A;  2ZXO A;  1AUE A;  4G7Z F;  5E3C A;  2XLO A;  3G4Z A;  1YDI A;  4BJ5 C;  4CBE A;  4ER9 A;  4NC3 A;  3DE9 A;  2A0B A;  1K40 A;  3C63 A;  3C8G A;  1OR3 A;  1D0X A;  5T1D B;  4A2N B;  3S29 A;  1K04 A;  2IM8 A;  3EH2 A;  1LS1 A;  4N6H A;  5E2Q A;  3FDQ A;  4PR9 A;  3EZH A;  4U5E E;  1O87 A;  5B1A C;  2R7T A;  2XLW A;  1D0Z A;  2FFH A;  1ZHY A;  5EK0 A;  4E18 A;  2V3C C;  3KH2 A;  5A6K A;  3AGT A;  2EPL X;  3SXK A;  4JCH A;  5HV9 A;  1K05 A;  1TWA A;  2CYD A;  3I5P A;  4IAR A;  4IB4 A;  1BR1 A;  3NMK A;  3PCV A;  4ULW A;  1NSG B;  3I5Q A;  4Q5S F;  4JTC B;  4WGY A;  1EA8 A;  4Q4Z F;  2NPU A;  3RIP A;  1MND A;  3SZR A;  4OIO F;  2M64 A;  2YL0 A;  2NUT A;  4YWQ A;  3Q7G A;  4C3D A;  3QZC A;  4AE4 B;  4YT2 A;  3ZVR A;  2B0H A;  2GAQ A;  1YAU O;  2PNO A;  5KYY B;  2YHS A;  3AJM A;  4AE4 A;  3Q7L A;  1HMO A;  2TMV P;  3DWW A;  4XWJ A;  2YLG A;  1VYK A;  1D1B A;  2Q00 A;  5DLJ A;  2XSE A;  5L0J A;  2QUP A;  1KU2 A;  3GAN A;  3MYF A;  4K0D A;  2P61 A;  2WB7 A;  3DM9 B;  3LUT B;  4EBB A;  1RJ9 A;  1D0Y A;  1D1C A;  3TK0 A;  1AVO B;  3H2V A;  3LLK A;  4PJM A;  4DJ9 A;  1ZVZ A;  3L34 A;  4DRH B;  2V26 A;  4GQH A;  5BUO A;  3FAP B;  4C7O A;  3SYN A;  3H65 A;  3JRM O;  2J45 A;  3TJ6 A;  3UMK A;  3E9V A;  4AX2 A;  5A6A A;  1KTM A;  3LS1 A;  1OQC A;  1YZC A;  2E87 A;  3B0P A;  4FX5 A;  4QI0 A;  3UR3 C;  1JOG A;  3DE8 A;  4XQ1 A;  4YL0 A;  2R03 A;  1OKK A;  2WZF A;  1M6T A;  4YK5 A;  2G3V A;  2OOC A;  3ZDL A;  2UUI A;  1QLE C;  2LP4 A;  4XPW A;  4ONS A;  1TFO B;  1TR2 A;  3GEI A;  4MVM A;  3U5S A;  1PD1 A;  1QVX A;  1VYI A;  1QPU A;  2XL8 A;  1IZM A;  4O6Y A;  1VMA A;  2DB4 A;  4OIR F;  1WTY A;  2CNW D;  3B0U X;  4KI2 A;  4YL1 A;  1OCZ C;  4QDL A;  2R7R A;  3U9M A;  2PBE A;  2AP3 A;  2GWW A;  4P9F A;  5DS5 A;  1OR2 A;  5F5F A;  4FAP B;  1M57 C;  3KL4 A;  4E17 A;  3TOM A;  3WOD F;  4H54 A;  4EIY A;  1I4Z A;  4IAQ A;  4DRJ B;  2R7V A;  4CS9 A;  1TQG A;  3N2Z B;  3SXZ A;  2ETS A;  1N1C A;  2Y3G A;  2J46 A;  3MLG A;  5DQT A;  1V74 B;  4EUK B;  3EPV A;  3DI5 A;  3NRH A;  3PHF 2;  4LLC A;  2Q7R A;  4G7O F;  1H9G A;  1ZU5 A;  3A11 A;  3LES A;  1Z23 A;  3RQF A;  2I15 A;  3O6X A;  4LDK A;  1CPR A;  2A68 F;  3FAJ A;  2XLM A;  2L6F A;  3DD7 A;  1NBB A;  4EBK A;  4HEA J;  3T6G B;  5L0I A;  1WAS A;  3JRT A;  1YZA A;  1YAR O;  2X51 A;  3V5X A;  3B0V C;  1FFT C;  1NZE A;  2CGE A;  1YVI A;  2EPO A;  2P6V A;  5IY5 C;  2HUJ A;  2J9B A;  2XLD A;  1CPQ A;  2XL6 A;  4XTK A;  3VF0 A;  2DGJ A;  2J7P D;  4C3B A;  2QNL A;  2KQ9 A;  2NUP B;  1E86 A;  1FFH A;  1TWH A;  3CZ6 A;  2IXN A;  3ITF A;  1ST6 A;  2JD3 A;  1FAP B;  3DAG A;  3RQG A;  2HSB A;  5AC4 A;  1ZHT A;  3ZG1 A;  4DOZ A;  2YZS A;  1YA7 O;  4XEV A;  2AWY A;  3DJU B;  2KGO A;  2XM4 A;  3ZQV A;  1PV3 A;  2A1D D;  5CIV A;  1A7D A;  1C17 M;  1PCX A;  2AU5 A;  2XLE A;  4C3E A;  4JEB A;  4JIO A;  3UMI A;  4DBR A;  1YLM A;  3UNG C;  1EQ1 A;  4AK9 A;  5JLI A;  2MHR A;  2R02 A;  1NU9 C;  4HE8 D;  3E70 C;  1MMG A;  4PJN A;  4CIP A;  1O3U A;  3JCU Q;  4I44 A;  5L0H A;  4MVS A;  4MW8 A;  4W8K A;  3Q6M A;  256B A;  3ABM C;  3BRJ A;  5E3A A;  2HV7 A;  3DAF A;  3HNJ A;  4IGG A;  5BQH A;  5A69 A;  4ZLD A;  2R9R B;  5DQZ A;  2EPN A;  1Y6D A;  1Q0K A;  1YJG A;  3AQB A;  4GEH A;  2P7V A;  2L9J A;  5FZT A;  4DVZ A;  2J0W A;  1E85 A;  4O7G A;  2VH3 A;  2YWA A;  4BG0 A;  4E7Z A;  1Z7Q c;  1JPN A;  1G4U S;  3ATP A;  4JTD B;  3GEE A;  4YN0 B;  3ABK C;  3X2Q C;  2LIG A;  1RJ9 B;  1H9T A;  4KBL A;  1BR2 A;  1Z6A A;  3U2L A;  1V54 C;  1VOM A;  1U89 A;  3EHN A;  3QVY A;  3GM3 A;  2H7B A;  1OW8 A;  2OU6 A;  1I4Y A;  3JZ0 A;  2JX0 A;  4M63 A;  5B3I A;  4J30 B;  2G3K A;  2I8B A;  2KW3 C;  4JJG A;  4MW3 A;  1VLS A;  2YVK A;  5AC5 A;  5K0I A;  2P1A A;  1RMV A;  4O79 A;  1ZZP A;  1GS9 A;  3V5Z A;  3ZC4 A;  3SEO A;  5CI9 A;  3K6B A;  3EJN A;  5T3W A;  5DVW A;  4F4B A;  1TWG A;  2CDQ A;  1ORS C;  3GOR A;  3EFO A;  4EKW A;  5KYW A;  1ORY A;  1OW6 A;  4CSA C;  1NU7 D;  2A0U A;  3DJN B;  1MMN A;  1SYQ A;  1E84 A;  2XLH A;  1D1A A;  4D4N A;  4YT4 A;  1FMW A;  4FWV A;  2J9W A;  2LQG A;  4BJ6 A;  4AL1 A;  1DOW A;  3QW1 A;  1C03 A;  3NG1 A;  2Y69 C;  1JRA A;  1H7I A;  2HMZ A;  1QSP A;  4JVS A;  1G5Z A;  4BEJ A;  3CSK A;  1WAT A;  1UFB A;  3EGX A;  3GWN A;  4Z9I A;  3CAX A;  2BC5 A;  2RSE B;  2VB6 A;  5BQI A;  4N4W A;  3NYL A;  3KYI A;  4RBN A;  2HZ8 A;  3FXH A;  3S0X A;  1RCP A;  4CDA A;  5KYX B;  3L1M A;  1BBH A;  4JE9 A;  2NSG A;  2J0X A;  2L6H A;  3JSE O;  4X0R A;  3IQ6 A;  4PK4 A;  4Z9J A;  1ZU4 A;  3RVZ A;  1CGM E;  1RXQ A;  3M15 A;  2R7U A;  3SXY A;  4JCZ A;  3RQE A;  3J06 A;  4RDA A;  4CX9 A;  2KC3 A;  3ECS A;  5F28 E;  2NSF A;  1YA9 A;  2OQM A;  4CDV A;  3EH1 A;  3HNL A;  1FNT c;  5L0D A;  1Q0F A;  3U2M A;  1KNY A;  2G62 A;  3NYJ A;  4PFO A;  2J8W A;  3BEH A;  3M4C A;  2J9U A;  2Q9B A;  2L7A A;  5EGY A;  1CGN A;  3V5Y A;  3JYH A;  4WGZ A;  2A69 F;  3EG9 B;  1Q0G A;  4MVU A;  2PX3 A;  3C8Z A;  3VAY A;  3ZTZ A;  1OXB A;  3W2V A;  2KSF A;  2J9V A;  1LM3 B;  1JR8 A;  1LI7 A;  5AGF A;  5L0G A;  1LIH A;  4Q7C A;  3UGO A;  3LS0 A;  1R5I D;  2QLA A;  2XXA A;  2EIN C;  3W8I A;  4C7O B;  2CW0 F;  3C8G B;  3U3F A;  5B3S C;  3HNI A;  4A4A A;  4WJ0 A;  4BJT A;  2VAS A;  3L8I A;  3NKD A;  4CJG A;  2M4E A;  2YRF A;  3T4R A;  4BJ5 A;  2UUH A;  1Z5Z A;  4HFF B;  2HV6 A;  2B0J A;  2HSQ A;  1HW1 A;  2KJG A;  2LSE A;  1T01 A;  4MVO A;  4XLP F;  3VYW A;  3B71 A;  5B1B C;  2EPK X;  4K7B A;  4U5G A;  4QI2 A;  4JC7 A;  2R25 A;  2KK1 A;  1HE1 A;  1LVK A;  1ORJ A;  1TKN A;  2ASR A;  3WG7 C;  1LI5 A;  1HE9 A;  1CGO A;  4HFK B;  1G4W R;  2H8A A;  3S28 A;  3TUL A;  1BR4 A;  3C8G D;  2XS1 A;  4U9D A;  3IEE A;  4O6N A;  3FVY A;  1A0B A;  3MX3 A;  2OG2 A;  4P6I C;  4PJJ A;  3OEO A;  5COG A;  2XXA B;  4E0H A;  3EGD A;  1HW2 A;  2MYS A;  1U0B B;  1MMD A;  1OW7 A;  3O10 A;  1OCO C;  4JTA B;  4UDV A;  1HY5 A;  2YL7 A;  3FOP A;  3M1C B;  3SXM A;  2MWQ A;  1B68 A;  5CI8 A;  5JSL A;  5A6J A;  1OCR C;  2YEV A;  2Y3B A;  4MND A;  4IRU A;  3U9J A;  3W8H A;  4CS7 A;  3SP1 A;  2IXM A;  1S7Z A;  1NFO A;  4GYT A;  5L0F A;  3L0I A;  2Q3T A;  4I3M A;  4MQ9 F;  4OIN F;  3LNR A;  3VM6 A;  4BPM A;  3U0C A;  4DVY P;  3LEV A;  1T5O A;  4JUR I;  4IWB A;  3A9C A;  4NCQ A;  3RYL A;  2R7W A;  1DOV A;  2ZD9 A;  2NG1 A;  1A41 A;  5JRA A;  2LK4 A;  1VLT A;  3M4B A;  1QQ3 A;  2Y39 A;  3C7J A;  4JJF A;  5FCL A;  1E83 A;  2YLD A;  1HMD A;  3IQT A;  2PX0 A;  4XPX A;  2XS8 A;  1IW7 F;  2HKV A;  3JTL O;  3TJ5 A;  2H7O A;  4XPY A;  4YT5 A;  1T6Q A;  2J7P A;  2GDC A;  4YL3 A;  1QZX A;  5EHH A;  1XZP A;  1ZHX A;  3TQO A;  2WVO A;  3T6B A;  3CEX A;  3EG9 A;  1I5N A;  5COM A;  4E0I A;  4G7H F;  1GM5 A;  1RKC A;  2R7S A;  3UGP A;  3U8P A;  3RVY A;  5L3V A;  2D4U A;  4ZLC A;  3POV A;  2VC9 A;  3DXJ F;  3L8J A;  1NFN A;  4KNV A;  4OIP F;  1BZ4 A;  3LEO A;  1RKE A;  4I1M A;  2WVQ A;  2CNW A;  2OCC C;  4MVZ A;  4B6I A;  5JVE A;  2YL1 A;  2VCA A;  3JYY A;  3AG4 C;  2BL2 A;  1V4A A;  3CQZ A;  2Y3H A;  2YLI A;  1QKR A;  2BE5 F;  2EIM C;  3N0T A;  4U5F E;  2YKZ A;  3G50 A;  4CIH A;  1UG7 A;  2LFD A;  4JKV A;  4NQF A;  5L3Q A;  3M79 A;  2EIL C;  1C02 A; 
#chains in the Genus database with same CATH homology
 1Y6D A;  1A0B A;  1SR2 A;  1TQG A;  4G78 A;  1BDJ B;  3KYJ A;  2LCH A;  4EUK B;  1OXK A;  1C03 A;  1I5N A;  4PAC A;  2OOC A;  1QSP A;  2A0B A;  2LP4 A;  3US6 A;  3MYF A;  2R25 A;  3KYI A;  1OXB A;  1YVI A;  2Q4F A;  2LD6 A;  1FR0 A;  1WN0 A;  3U3B A;  3IQT A;  1C02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...