1QSPA

Crystal structure of the yeast phosphorelay protein ypd1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
165
structure length
165
Chain Sequence
TIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELDNLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDEDDEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords YPD1
publication title Conservation of structure and function among histidine-containing phosphotransfer (HPt) domains as revealed by the crystal structure of YPD1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1qspA00
1SR2A 2LP4A 2Q4FA 1BDJB 1Y6DA 1OXKA 3KYIA 4G78A 1TQGA 1A0BA 1C02A 1I5NA 4EUKB 3MYFA 2LD6A 1C03A 2R25A 2LCHA 3KYJA 2OOCA 3IQTA 1FR0A 4PACA 3US6A 1QSPA 1WN0A 1OXBA 1YVIA 2A0BA 3U3BA
chains in the Genus database with same CATH superfamily
1LM3B 4BJ6C 4QI0A 4XEVA 4CX9A 1BDJB 2WL8A 4CDYA 3V7OA 4YWQA 1E83A 1HW1A 1YA7O 2XSEA 3IPMO 3C62A 4NTBA 2W9YA 2R7XA 1U89A 3LJBA 1L3PA 2LSEA 2YQYA 4JVSA 1ZHXA 2B0JA 4JCZA 1XZPA 1JAFA 3KKBA 3RKOF 1BR4A 1SYQA 1GM5A 1QZXA 3NDBB 1VMAA 1WATA 4RDAA 1H9GA 3I5QA 1Z5ZA 3S29A 2DYRC 2HV7A 5EK0A 2M64A 2A0UA 3EHMA 3TOLA 4YT4A 5L3QA 2XRHA 3HNJA 5A6BD 4IB4A 3CZ6A 1C17M 5EGYA 2L6HA 3GEIA 3M4BA 2CYDA 1UFBA 2PP4A 2YEVA 1R5ID 5B1AC 3T6GB 2H7BA 5JSLA 1E2XA 1OW8A 3NYMA 4CS8A 4YT2A 4ER9A 4J7TA 3N0TA 1TWAA 4E18A 3EQLF 1CGNA 1OKKA 2P1AA 4LDKA 4UDVA 4JJFA 3SZRA 2EIJC 4BEMJ 2KGOA 3NMIA 1OCOC 4R32A 4G7OF 4WJ0A 4FWVA 3C18A 4J32B 4EHPA 1RJ9B 3GEEA 4O6NA 2LIGA 2EPKX 1OCRC 2LFFA 2VCCA 3AG2C 3HNLA 4GYTA 5DLJA 2KK1A 3G4ZA 3O39A 4KBLA 5JVEA 2R03A 2EIMC 4C7OB 1FNTc 2C04A 256BA 2QE9A 5K0IA 4G7ZF 5TJ5E 4U5EE 4ONSA 2L7AA 3DE9A 1KU2A 4LLCA 3WG7C 2KW3C 1ZW3A 4HFFB 2KYHA 4CJOA 4W8KA 2A6HF 2Y3DA 1C02A 2LFDA 2YKZA 2YL3A 3G50A 3NYLA 2HJMA 4W8PA 2KQ9A 3KH2A 4CS9A 1SF8A 2RSEB 4F4BA 3LLIA 4M63A 2A68F 4I3MA 1APCA 3L1MA 4XEFA 3RIPA 3VRCA 1KNYA 3KYJA 4ZLCA 1RJ9A 2HUJA 3LS1A 4XEKA 4CS8C 2FAPB 3QTHA 2V3CC 4PACA 4QI2A 2L81A 3RF3A 2H7OA 3V5ZA 4EBJA 4C7OA 1QSPA 3GORA 1IZMA 1A7VA 1HW2A 5HV9A 1MMGA 2HJ3A 2LP4A 3JSZA 1U0BB 5FCLA 2HZ8A 3HTKC 1H6GA 1ORJA 3Q6MA 1ZYRF 4JW1A 4N06A 4E0IA 1A41A 3FOOA 2J7PA 2M4EA 4XPXA 2L6FA 5E3CA 5DS6A 3DKAA 3E70C 2WZGA 3H2VA 1AVOB 1M2VB 3X2QC 4EUKB 2XM0A 3VYWA 1O5HA 3GWNA 4DXWA 5A6KA 2HMQA 3ZQYA 2Q9AA 1D1BA 2F22A 3LUTB 2Q9CA 1Z7Qc 5L0FA 3L0IA 1G8XA 3M1CB 3HKKA 1FR0A 4U5FE 3V5YA 1JMWA 2YL1A 3AGUA 1RXQA 3L8IA 3L8JA 3NRHA 4MVUA 2Q7RA 3ZTMA 4OIQF 1JRAA 3W8IA 1H9TA 1S05A 5E3AA 1LE4A 2ETSA 3B29A 5BQIA 1ZU5A 3JCUQ 1AUEA 1NU9C 3NMJA 4MW8A 4N4WA 3DAFA 4CS9C 3SNHA 2KJGA 4YT5A 1SMYF 4B6IA 2I15A 5E2QA 1D1AA 2OJQA 2A69F 4DOZA 1E86A 1ZHTA 2OCCC 3U0CA 3QVZA 4MTOA 1I5NA 1LS4A 1IW7F 3AG3C 3NKEA 5KYWB 1VYKA 3ZWIA 1M2VA 2PFDA 1PCXA 2PF4E 1FFTC 2R9RB 2PX3A 2R7QA 2YRFA 4MVZA 4NQFA 1V55C 2LCHA 2J46A 2W45A 3Q6NA 4QDLA 1LVKA 1T01A 1YA9A 1A7EA 1MMAA 2YHSA 4J30B 4CIPA 4IAQA 2EPLX 4CBEA 3WAQA 1G4WR 4CJGA 3C8ZA 1NBBA 3US6A 3U3FA 3B71A 2GAQA 1MMNA 5T1DB 2IM8A 2A1DD 3I5PA 3TQOA 1WN0A 2V26A 5COMA 2QTVA 4NC3A 4I1OB 4FESA 4O6MA 3DI5A 5CI8A 1CGOA 3M4CA 2Q4FA 4BG0A 2XLMA 3HNKA 2O9XA 1A7DA 1PD0A 1T6QA 2PX0A 3JSEO 3EH2A 5KYUB 4DRIB 1J8MF 2CDQA 2OU6A 2P0NA 3AQBA 3BEHA 3JTLO 4JE9A 1SZIA 1VYIA 4K0DA 3TOMA 3L34A 3SXMA 3MYFA 2Y69C 4RBNA 3RQFA 1YDIA 2LD6A 4WGZA 4DBQA 2G62A 1YZCA 2D5RB 2I8BA 3LAYA 4X0RA 4EBBA 1OW6A 1TFKB 3RVZA 4BJTA 4DRHB 5A6BA 3LLKA 1L7CA 3ABKC 2XLVA 4PR9A 5D92A 4G7HF 3U8PA 4MW3A 3ECSA 3GM3A 3SEOA 2H7VC 3K1IA 4FX5A 1K40A 3B0PA 3FMSA 3DJUB 2IOQA 3JRTA 4AE4B 4I44A 2ZD9A 2J9UA 3HJCA 2G3KA 3K6BA 4Q4ZF 3SP1A 3OA1A 4NTAA 3IQ5A 3EFOA 1G4US 2VCBA 4IRUA 3J06A 4XQ1A 3IHUA 2YL7A 3SXKA 3U9MA 5KYUA 3UGOA 2C03A 2JX0A 3HNIA 3O55A 1AEPA 2QUPA 2R7TA 1HE9A 2HS5A 3DWWA 3GM1A 1LS1A 1BR1A 3IEEA 3ZVRA 4EBKA 4MVQA 3S0XA 1F1MA 2VASA 4MTGA 1RMVA 3GM2A 5DS4A 2BL2A 2Q3TA 1OCCC 4KNVA 5FZTA 1PD1A 4JKVA 1E85A 4PFPA 2EPMX 2NSFA 3K1HA 3NMKA 5L0JA 2ZXOA 4AE4A 3NKDA 1Q0FA 4OIOF 3GODA 4IGGA 4HEAJ 3EZIA 1GQAA 4P9FA 5L0HA 3F46A 1FMWA 2VCAA 1OKKD 3QW1A 3QZCA 4NCQA 3TK0A 1Q0DA 1TWCA 1ZU4A 5B1BC 5JRAA 3FDQA 3RH3A 5F5FA 2B0HA 2AU5A 4U5BE 3ZDLA 2QNLA 1RCPA 2DB4A 2MHRA 1EA8A 2WB7A 4U9DA 3K1IC 3ZQVA 4A2NB 2DI3A 3UMHA 5E33A 3W2VA 1OCZC 2XS1A 1T6IA 1VLTA 3IQTA 1N1CA 3IQ6A 4HE8D 2KNHA 1O3UA 4U9EA 5T3TA 2W4MA 2Y3BA 3TJ5A 3FXHA 2XM4A 3RYLA 2CNWA 5A6AA 1OR3A 1V74B 2EILC 2P6VA 3FAPB 4PJLA 3U2LA 4G0HA 4CIHA 4LDQA 3QVYA 2Q9BA 1CGME 2A0BA 4GQHA 4JURI 3QMKA 4MVOA 3DJNB 1KTMA 2J9BA 1FFHA 1XZQA 1Z3IX 2HKVA 3DM5A 4YL3A 2X0CA 4Z9IA 4JIOA 4O6YA 4LDRA 3UGPA 5DQZA 1TQGA 1TKNA 3O10A 1Z63A 3TULA 2L9JA 2YL0A 2YLIA 4NY3A 1VOMA 4E0HA 3H2UA 5BQGA 5DVWA 3E9VA 3NYJA 3GANA 3ZTZA 1FMVA 3ASNC 1MMDA 1ORYA 2OQMA 3I4UA 2R7RA 3AQCA 1RKEB 5L0GA 2OEVA 4LACB 1U6HA 4PJMA 5GPGB 3AG4C 4KI2A 2XLOA 3M15A 3K33A 2Y3HA 1YYJA 3R2PA 3WODF 2YVKA 5KYWA 3Q7LA 1V4AA 1NG1A 2NSGA 4KC9A 3CAXA 2J9WA 3S28A 2OG2A 2R7UA 3TJ6A 3K7DA 2HSQA 4OD5A 3DMDA 4JJGA 2CGEA 2QLAA 2HFIA 2YZSA 4MVSA 1OXKA 2AWYA 1LI5A 1BZ4A 4XWJA 4DVYP 5AC4A 4OINF 1HMOA 2HMZA 4EKWA 3LESA 2D4UA 2IXMA 1LPEA 2YLDA 2R7SA 2UUIA 3UR3C 5EHHA 2P7VA 2R7VA 2OJED 1OQCA 5CI9A 3RQEA 3DE8A 5COFA 5COGA 4OD4A 2G3VA 3T6JA 1GS9A 3PMRA 5JS5A 1W2WA 2XL6A 1NZEA 4H4KC 4JEAA 4XPYA 2GWWA 1M56C 2KC3A 3JRMO 3SXZA 1YJGA 1EQ1A 1TWGA 1RKEA 4YN0B 3T6BA 3ZC4A 5A6JA 3VM6A 1FAPB 3C7JA 2A6EF 3UMIA 3ZG1A 4YT8A 4XTKA 1ZHWA 3K66A 1LKXA 2ZXWC 4E17A 1WASA 3N24A 2CW0F 5L0CA 1BR2A 2NUTB 2DGJA 1LE2A 1ZHYA 3ZIBA 5HSWA 1Y6DA 2NPUA 2WVOA 3C63A 3EFOB 4XLNF 4D4XA 3IQCA 4JRZA 1UG7A 5KYXB 3SXYA 3JYYA 4U5HA 4AK9A 4YJWA 2WVQA 2R02A 3GEHA 4AL0A 4BJ5A 3S90A 3VAYA 3POVA 1Q0GA 1D0YA 3R7CA 2AWCA 3Q7GA 1HE1A 4FAPB 1YAUO 4HFKB 4IWBA 3UNGC 4MS2A 2HSBA 4PFOA 4CDAA 1YLMA 3CEXA 3EHNA 1TWHA 4LERA 3JT1A 5AC5A 3PHF2 1MNEA 2XXAB 2J0XA 2W4BA 2GFHA 3U3BA 3EJNA 4OIPF 2WZLA 3CQZA 4NTFA 3U9JA 1HMDA 3FAJA 5A69A 2J9VA 2R7OA 3MBGA 3B0UX 4U5DE 5JUAA 3C8GD 1ZZPA 2J0WA 3NG1A 1B68A 1NLXA 2NUTA 3VF0A 3KYIA 2YLGA 4G78A 4DBRA 4E7SA 2RD9A 1NFOA 2NUPB 1Q0KA 3EGDB 1JOGA 3JZ0A 4JEBA 2VB6A 3ABLC 5F28E 1M2OA 1Z23A 3X1OA 1ZVZA 1H7IA 1ZW2A 3EGXA 5KYXA 3S84A 2AVKA 2R25A 1C03A 1PV3A 3ITFA 2PNOA 5L0IA 1YARO 3LEOA 2PBEA 1D0XA 4OIRF 4EIYA 1QKRA 5KYYB 2IBFA 3LS0A 4N6CA 1NU7D 3KPHA 2TMVP 4MNDA 5B3SC 1VB5A 1T5OA 2LQGA 2VH3A 3ATPA 2XLWA 4JTCB 5BUOA 4MQ9F 4E7ZA 1I4YA 1T6UA 3AG1C 3AJMA 4MTFA 2ASRA 2IXOA 5D91A 3S9OA 2WVNA 3W2WA 2XXAA 1QVXA 1ORSC 1DOVA 2KSFA 3RQGA 4D4NA 1FTSA 2XS8A 1WTYA 4Z9HA 2E87A 4JTDB 2VC9A 4C3EA 3FHDA 4BJ5C 1Y4CA 1TR2A 3FOPA 3LEVA 1VLSA 2NUPA 3EGDA 4IARA 3DAGA 3MFNA 3MYIA 3SYNA 2BC5A 3PDMP 1HY5A 3BRJA 5AGFA 1EI7A 1M6TA 4JZAA 2JPUA 3G4XA 4I1MA 4Z9JA 4BEJA 4DVZA 1E84A 1YZAA 2WZFA 1NSGB 2JD3A 3HLZA 4Q7CA 2EPOA 2L6GA 3ZSUA 1GGQA 1EKYA 2DYSC 3EG9B 5F5HA 1Q0MA 4IJJA 1LI7A 2FFHA 5KYYA 3ABMC 4C3DA 1QQ3A 3MX3A 2XLHA 1J8YF 3KL4A 3KMIA 4ANJA 4IAOA 4WABA 1OW7A 1OXBA 1YVIA 2ICWG 2YWAA 3ASOC 3EZHA 4JC7A 4C3BA 2OKUA 4XPWA 2ZXRA 3AGTA 1K05A 1CPRA 3UMKA 1T9KA 1VK5A 1ZHZA 3A9CA 1RKCA 3T9OA 1JR8A 4ZLDA 4N6HA 2FGYA 2GA0A 2BE5F 2XL4A 3WHNA 1QLEC 4CSAA 4LLEA 4L6RA 2R05A 2XL8A 2GDCA 4O79A 1WWPA 2MYSA 1JPJA 2Z15A 1MQVA 3H65A 4K1OA 4U5CE 4A4AA 4CS7A 4PJJA 3U8VA 3B0VC 2EPNA 1G5ZA 3N2ZB 3EG9A 2OEXA 2ZPAA 3S27A 5DQTA 5JP7A 2Q00A 3U2MA 1QPUA 2CNWD 3RVYA 3B9QA 2EINC 2IXPA 1M57C 1SR2A 1BBHA 4YL0A 3AOUA 1Z6AA 4PJNA 4ULVA 1OR2A 1WGWA 1NFNA 2UUHA 4MVMA 4CDVA 4EWCA 1VTMP 4Q5SF 1XWJA 1ST6A 3DD7A 4GEHA 2CCYA 2ZXPA 3EPVA 4MVRA 4AX2A 2R7WA 4BJ6A 1D0ZA 1DOWA 4WGYA 2J7PD 4DRJB 2XLDA 2P61A 3DM9B 1CPQA 2NG1A 2Y39A 3F47A 4P9TA 2HV6A 3JYHA 4RD9A 3T4RA 5CIVA 3LNMB 5IY5C 3RW0A 5L3VA 5DS5A 3QW0A 3RFYA 1MNDA 3OWTA 1TFOB 1O87A 2EIKC 1K04A 1LIHA 3DZAA 1V54C 1S7ZA 2MWQA 4U5GA 4YK5A 3C8GB 2AP3A 3DXJF 3M79A 4BJ1A 3W4YA 4O7GA 4DJ9A 3CSKA 2LK4A 3PCVA 3LNRA 4PK4A 3FVYA 4CSAC 4BPMA 2X51A 1R4TA 5T3WA 4JCHA 4ULWA 1A0BA 4KNWA 2IXNA 3EGXB 4AL1A 2J45A 1WOLA 5BQHA 3A11A 3V5XA 5KYNA 3U5SA 2Y3GA 4J7YA 4JTAB 4P6IC 2OOCA 5JLIA 2J8WA 4YL1A 3GWLA 2XLEA 2H8AA 3OEOA 3O6XA 3W8HA 1JPNA 3TD7A 2IYLD 5JT4A 1D1CA 4H54A 3MLGA 4XLPF 3EH1A 5B3IA 2QY9A 5L0DA 1I4ZA 1YYXA 3C8GA 4K7BA
chains in the Genus database with same CATH topology
1SR2A 2LP4A 2Q4FA 1BDJB 1Y6DA 1OXKA 3KYIA 4G78A 1TQGA 1A0BA 1C02A 1I5NA 4EUKB 3MYFA 2LD6A 1C03A 2R25A 2LCHA 3KYJA 2OOCA 3IQTA 1FR0A 4PACA 3US6A 1QSPA 1WN0A 1OXBA 1YVIA 2A0BA 3U3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR2 A;  2LP4 A;  2Q4F A;  1BDJ B;  1Y6D A;  1OXK A;  3KYI A;  4G78 A;  1TQG A;  1A0B A;  1C02 A;  1I5N A;  4EUK B;  3MYF A;  2LD6 A;  1C03 A;  2R25 A;  2LCH A;  3KYJ A;  2OOC A;  3IQT A;  1FR0 A;  4PAC A;  3US6 A;  1QSP A;  1WN0 A;  1OXB A;  1YVI A;  2A0B A;  3U3B A; 
#chains in the Genus database with same CATH topology
 1LM3 B;  4BJ6 C;  4QI0 A;  4XEV A;  4CX9 A;  1BDJ B;  2WL8 A;  4CDY A;  3V7O A;  4YWQ A;  1E83 A;  1HW1 A;  1YA7 O;  2XSE A;  3IPM O;  3C62 A;  4NTB A;  2W9Y A;  2R7X A;  1U89 A;  3LJB A;  1L3P A;  2LSE A;  2YQY A;  4JVS A;  1ZHX A;  2B0J A;  4JCZ A;  1XZP A;  1JAF A;  3KKB A;  3RKO F;  1BR4 A;  1SYQ A;  1GM5 A;  1QZX A;  3NDB B;  1VMA A;  1WAT A;  4RDA A;  1H9G A;  3I5Q A;  1Z5Z A;  3S29 A;  2DYR C;  2HV7 A;  5EK0 A;  2M64 A;  2A0U A;  3EHM A;  3TOL A;  4YT4 A;  5L3Q A;  2XRH A;  3HNJ A;  5A6B D;  4IB4 A;  3CZ6 A;  1C17 M;  5EGY A;  2L6H A;  3GEI A;  3M4B A;  2CYD A;  1UFB A;  2PP4 A;  2YEV A;  1R5I D;  5B1A C;  3T6G B;  2H7B A;  5JSL A;  1E2X A;  1OW8 A;  3NYM A;  4CS8 A;  4YT2 A;  4ER9 A;  4J7T A;  3N0T A;  1TWA A;  4E18 A;  3EQL F;  1CGN A;  1OKK A;  2P1A A;  4LDK A;  4UDV A;  4JJF A;  3SZR A;  2EIJ C;  4BEM J;  2KGO A;  3NMI A;  1OCO C;  4R32 A;  4G7O F;  4WJ0 A;  4FWV A;  3C18 A;  4J32 B;  4EHP A;  1RJ9 B;  3GEE A;  4O6N A;  2LIG A;  2EPK X;  1OCR C;  2LFF A;  2VCC A;  3AG2 C;  3HNL A;  4GYT A;  5DLJ A;  2KK1 A;  3G4Z A;  3O39 A;  4KBL A;  5JVE A;  2R03 A;  2EIM C;  4C7O B;  1FNT c;  2C04 A;  256B A;  2QE9 A;  5K0I A;  4G7Z F;  5TJ5 E;  4U5E E;  4ONS A;  2L7A A;  3DE9 A;  1KU2 A;  4LLC A;  3WG7 C;  2KW3 C;  1ZW3 A;  4HFF B;  2KYH A;  4CJO A;  4W8K A;  2A6H F;  2Y3D A;  1C02 A;  2LFD A;  2YKZ A;  2YL3 A;  3G50 A;  3NYL A;  2HJM A;  4W8P A;  2KQ9 A;  3KH2 A;  4CS9 A;  1SF8 A;  2RSE B;  4F4B A;  3LLI A;  4M63 A;  2A68 F;  4I3M A;  1APC A;  3L1M A;  4XEF A;  3RIP A;  3VRC A;  1KNY A;  3KYJ A;  4ZLC A;  1RJ9 A;  2HUJ A;  3LS1 A;  4XEK A;  4CS8 C;  2FAP B;  3QTH A;  2V3C C;  4PAC A;  4QI2 A;  2L81 A;  3RF3 A;  2H7O A;  3V5Z A;  4EBJ A;  4C7O A;  1QSP A;  3GOR A;  1IZM A;  1A7V A;  1HW2 A;  5HV9 A;  1MMG A;  2HJ3 A;  2LP4 A;  3JSZ A;  1U0B B;  5FCL A;  2HZ8 A;  3HTK C;  1H6G A;  1ORJ A;  3Q6M A;  1ZYR F;  4JW1 A;  4N06 A;  4E0I A;  1A41 A;  3FOO A;  2J7P A;  2M4E A;  4XPX A;  2L6F A;  5E3C A;  5DS6 A;  3DKA A;  3E70 C;  2WZG A;  3H2V A;  1AVO B;  1M2V B;  3X2Q C;  4EUK B;  2XM0 A;  3VYW A;  1O5H A;  3GWN A;  4DXW A;  5A6K A;  2HMQ A;  3ZQY A;  2Q9A A;  1D1B A;  2F22 A;  3LUT B;  2Q9C A;  1Z7Q c;  5L0F A;  3L0I A;  1G8X A;  3M1C B;  3HKK A;  1FR0 A;  4U5F E;  3V5Y A;  1JMW A;  2YL1 A;  3AGU A;  1RXQ A;  3L8I A;  3L8J A;  3NRH A;  4MVU A;  2Q7R A;  3ZTM A;  4OIQ F;  1JRA A;  3W8I A;  1H9T A;  1S05 A;  5E3A A;  1LE4 A;  2ETS A;  3B29 A;  5BQI A;  1ZU5 A;  3JCU Q;  1AUE A;  1NU9 C;  3NMJ A;  4MW8 A;  4N4W A;  3DAF A;  4CS9 C;  3SNH A;  2KJG A;  4YT5 A;  1SMY F;  4B6I A;  2I15 A;  5E2Q A;  1D1A A;  2OJQ A;  2A69 F;  4DOZ A;  1E86 A;  1ZHT A;  2OCC C;  3U0C A;  3QVZ A;  4MTO A;  1I5N A;  1LS4 A;  1IW7 F;  3AG3 C;  3NKE A;  5KYW B;  1VYK A;  3ZWI A;  1M2V A;  2PFD A;  1PCX A;  2PF4 E;  1FFT C;  2R9R B;  2PX3 A;  2R7Q A;  2YRF A;  4MVZ A;  4NQF A;  1V55 C;  2LCH A;  2J46 A;  2W45 A;  3Q6N A;  4QDL A;  1LVK A;  1T01 A;  1YA9 A;  1A7E A;  1MMA A;  2YHS A;  4J30 B;  4CIP A;  4IAQ A;  2EPL X;  4CBE A;  3WAQ A;  1G4W R;  4CJG A;  3C8Z A;  1NBB A;  3US6 A;  3U3F A;  3B71 A;  2GAQ A;  1MMN A;  5T1D B;  2IM8 A;  2A1D D;  3I5P A;  3TQO A;  1WN0 A;  2V26 A;  5COM A;  2QTV A;  4NC3 A;  4I1O B;  4FES A;  4O6M A;  3DI5 A;  5CI8 A;  1CGO A;  3M4C A;  2Q4F A;  4BG0 A;  2XLM A;  3HNK A;  2O9X A;  1A7D A;  1PD0 A;  1T6Q A;  2PX0 A;  3JSE O;  3EH2 A;  5KYU B;  4DRI B;  1J8M F;  2CDQ A;  2OU6 A;  2P0N A;  3AQB A;  3BEH A;  3JTL O;  4JE9 A;  1SZI A;  1VYI A;  4K0D A;  3TOM A;  3L34 A;  3SXM A;  3MYF A;  2Y69 C;  4RBN A;  3RQF A;  1YDI A;  2LD6 A;  4WGZ A;  4DBQ A;  2G62 A;  1YZC A;  2D5R B;  2I8B A;  3LAY A;  4X0R A;  4EBB A;  1OW6 A;  1TFK B;  3RVZ A;  4BJT A;  4DRH B;  5A6B A;  3LLK A;  1L7C A;  3ABK C;  2XLV A;  4PR9 A;  5D92 A;  4G7H F;  3U8P A;  4MW3 A;  3ECS A;  3GM3 A;  3SEO A;  2H7V C;  3K1I A;  4FX5 A;  1K40 A;  3B0P A;  3FMS A;  3DJU B;  2IOQ A;  3JRT A;  4AE4 B;  4I44 A;  2ZD9 A;  2J9U A;  3HJC A;  2G3K A;  3K6B A;  4Q4Z F;  3SP1 A;  3OA1 A;  4NTA A;  3IQ5 A;  3EFO A;  1G4U S;  2VCB A;  4IRU A;  3J06 A;  4XQ1 A;  3IHU A;  2YL7 A;  3SXK A;  3U9M A;  5KYU A;  3UGO A;  2C03 A;  2JX0 A;  3HNI A;  3O55 A;  1AEP A;  2QUP A;  2R7T A;  1HE9 A;  2HS5 A;  3DWW A;  3GM1 A;  1LS1 A;  1BR1 A;  3IEE A;  3ZVR A;  4EBK A;  4MVQ A;  3S0X A;  1F1M A;  2VAS A;  4MTG A;  1RMV A;  3GM2 A;  5DS4 A;  2BL2 A;  2Q3T A;  1OCC C;  4KNV A;  5FZT A;  1PD1 A;  4JKV A;  1E85 A;  4PFP A;  2EPM X;  2NSF A;  3K1H A;  3NMK A;  5L0J A;  2ZXO A;  4AE4 A;  3NKD A;  1Q0F A;  4OIO F;  3GOD A;  4IGG A;  4HEA J;  3EZI A;  1GQA A;  4P9F A;  5L0H A;  3F46 A;  1FMW A;  2VCA A;  1OKK D;  3QW1 A;  3QZC A;  4NCQ A;  3TK0 A;  1Q0D A;  1TWC A;  1ZU4 A;  5B1B C;  5JRA A;  3FDQ A;  3RH3 A;  5F5F A;  2B0H A;  2AU5 A;  4U5B E;  3ZDL A;  2QNL A;  1RCP A;  2DB4 A;  2MHR A;  1EA8 A;  2WB7 A;  4U9D A;  3K1I C;  3ZQV A;  4A2N B;  2DI3 A;  3UMH A;  5E33 A;  3W2V A;  1OCZ C;  2XS1 A;  1T6I A;  1VLT A;  3IQT A;  1N1C A;  3IQ6 A;  4HE8 D;  2KNH A;  1O3U A;  4U9E A;  5T3T A;  2W4M A;  2Y3B A;  3TJ5 A;  3FXH A;  2XM4 A;  3RYL A;  2CNW A;  5A6A A;  1OR3 A;  1V74 B;  2EIL C;  2P6V A;  3FAP B;  4PJL A;  3U2L A;  4G0H A;  4CIH A;  4LDQ A;  3QVY A;  2Q9B A;  1CGM E;  2A0B A;  4GQH A;  4JUR I;  3QMK A;  4MVO A;  3DJN B;  1KTM A;  2J9B A;  1FFH A;  1XZQ A;  1Z3I X;  2HKV A;  3DM5 A;  4YL3 A;  2X0C A;  4Z9I A;  4JIO A;  4O6Y A;  4LDR A;  3UGP A;  5DQZ A;  1TQG A;  1TKN A;  3O10 A;  1Z63 A;  3TUL A;  2L9J A;  2YL0 A;  2YLI A;  4NY3 A;  1VOM A;  4E0H A;  3H2U A;  5BQG A;  5DVW A;  3E9V A;  3NYJ A;  3GAN A;  3ZTZ A;  1FMV A;  3ASN C;  1MMD A;  1ORY A;  2OQM A;  3I4U A;  2R7R A;  3AQC A;  1RKE B;  5L0G A;  2OEV A;  4LAC B;  1U6H A;  4PJM A;  5GPG B;  3AG4 C;  4KI2 A;  2XLO A;  3M15 A;  3K33 A;  2Y3H A;  1YYJ A;  3R2P A;  3WOD F;  2YVK A;  5KYW A;  3Q7L A;  1V4A A;  1NG1 A;  2NSG A;  4KC9 A;  3CAX A;  2J9W A;  3S28 A;  2OG2 A;  2R7U A;  3TJ6 A;  3K7D A;  2HSQ A;  4OD5 A;  3DMD A;  4JJG A;  2CGE A;  2QLA A;  2HFI A;  2YZS A;  4MVS A;  1OXK A;  2AWY A;  1LI5 A;  1BZ4 A;  4XWJ A;  4DVY P;  5AC4 A;  4OIN F;  1HMO A;  2HMZ A;  4EKW A;  3LES A;  2D4U A;  2IXM A;  1LPE A;  2YLD A;  2R7S A;  2UUI A;  3UR3 C;  5EHH A;  2P7V A;  2R7V A;  2OJE D;  1OQC A;  5CI9 A;  3RQE A;  3DE8 A;  5COF A;  5COG A;  4OD4 A;  2G3V A;  3T6J A;  1GS9 A;  3PMR A;  5JS5 A;  1W2W A;  2XL6 A;  1NZE A;  4H4K C;  4JEA A;  4XPY A;  2GWW A;  1M56 C;  2KC3 A;  3JRM O;  3SXZ A;  1YJG A;  1EQ1 A;  1TWG A;  1RKE A;  4YN0 B;  3T6B A;  3ZC4 A;  5A6J A;  3VM6 A;  1FAP B;  3C7J A;  2A6E F;  3UMI A;  3ZG1 A;  4YT8 A;  4XTK A;  1ZHW A;  3K66 A;  1LKX A;  2ZXW C;  4E17 A;  1WAS A;  3N24 A;  2CW0 F;  5L0C A;  1BR2 A;  2NUT B;  2DGJ A;  1LE2 A;  1ZHY A;  3ZIB A;  5HSW A;  1Y6D A;  2NPU A;  2WVO A;  3C63 A;  3EFO B;  4XLN F;  4D4X A;  3IQC A;  4JRZ A;  1UG7 A;  5KYX B;  3SXY A;  3JYY A;  4U5H A;  4AK9 A;  4YJW A;  2WVQ A;  2R02 A;  3GEH A;  4AL0 A;  4BJ5 A;  3S90 A;  3VAY A;  3POV A;  1Q0G A;  1D0Y A;  3R7C A;  2AWC A;  3Q7G A;  1HE1 A;  4FAP B;  1YAU O;  4HFK B;  4IWB A;  3UNG C;  4MS2 A;  2HSB A;  4PFO A;  4CDA A;  1YLM A;  3CEX A;  3EHN A;  1TWH A;  4LER A;  3JT1 A;  5AC5 A;  3PHF 2;  1MNE A;  2XXA B;  2J0X A;  2W4B A;  2GFH A;  3U3B A;  3EJN A;  4OIP F;  2WZL A;  3CQZ A;  4NTF A;  3U9J A;  1HMD A;  3FAJ A;  5A69 A;  2J9V A;  2R7O A;  3MBG A;  3B0U X;  4U5D E;  5JUA A;  3C8G D;  1ZZP A;  2J0W A;  3NG1 A;  1B68 A;  1NLX A;  2NUT A;  3VF0 A;  3KYI A;  2YLG A;  4G78 A;  4DBR A;  4E7S A;  2RD9 A;  1NFO A;  2NUP B;  1Q0K A;  3EGD B;  1JOG A;  3JZ0 A;  4JEB A;  2VB6 A;  3ABL C;  5F28 E;  1M2O A;  1Z23 A;  3X1O A;  1ZVZ A;  1H7I A;  1ZW2 A;  3EGX A;  5KYX A;  3S84 A;  2AVK A;  2R25 A;  1C03 A;  1PV3 A;  3ITF A;  2PNO A;  5L0I A;  1YAR O;  3LEO A;  2PBE A;  1D0X A;  4OIR F;  4EIY A;  1QKR A;  5KYY B;  2IBF A;  3LS0 A;  4N6C A;  1NU7 D;  3KPH A;  2TMV P;  4MND A;  5B3S C;  1VB5 A;  1T5O A;  2LQG A;  2VH3 A;  3ATP A;  2XLW A;  4JTC B;  5BUO A;  4MQ9 F;  4E7Z A;  1I4Y A;  1T6U A;  3AG1 C;  3AJM A;  4MTF A;  2ASR A;  2IXO A;  5D91 A;  3S9O A;  2WVN A;  3W2W A;  2XXA A;  1QVX A;  1ORS C;  1DOV A;  2KSF A;  3RQG A;  4D4N A;  1FTS A;  2XS8 A;  1WTY A;  4Z9H A;  2E87 A;  4JTD B;  2VC9 A;  4C3E A;  3FHD A;  4BJ5 C;  1Y4C A;  1TR2 A;  3FOP A;  3LEV A;  1VLS A;  2NUP A;  3EGD A;  4IAR A;  3DAG A;  3MFN A;  3MYI A;  3SYN A;  2BC5 A;  3PDM P;  1HY5 A;  3BRJ A;  5AGF A;  1EI7 A;  1M6T A;  4JZA A;  2JPU A;  3G4X A;  4I1M A;  4Z9J A;  4BEJ A;  4DVZ A;  1E84 A;  1YZA A;  2WZF A;  1NSG B;  2JD3 A;  3HLZ A;  4Q7C A;  2EPO A;  2L6G A;  3ZSU A;  1GGQ A;  1EKY A;  2DYS C;  3EG9 B;  5F5H A;  1Q0M A;  4IJJ A;  1LI7 A;  2FFH A;  5KYY A;  3ABM C;  4C3D A;  1QQ3 A;  3MX3 A;  2XLH A;  1J8Y F;  3KL4 A;  3KMI A;  4ANJ A;  4IAO A;  4WAB A;  1OW7 A;  1OXB A;  1YVI A;  2ICW G;  2YWA A;  3ASO C;  3EZH A;  4JC7 A;  4C3B A;  2OKU A;  4XPW A;  2ZXR A;  3AGT A;  1K05 A;  1CPR A;  3UMK A;  1T9K A;  1VK5 A;  1ZHZ A;  3A9C A;  1RKC A;  3T9O A;  1JR8 A;  4ZLD A;  4N6H A;  2FGY A;  2GA0 A;  2BE5 F;  2XL4 A;  3WHN A;  1QLE C;  4CSA A;  4LLE A;  4L6R A;  2R05 A;  2XL8 A;  2GDC A;  4O79 A;  1WWP A;  2MYS A;  1JPJ A;  2Z15 A;  1MQV A;  3H65 A;  4K1O A;  4U5C E;  4A4A A;  4CS7 A;  4PJJ A;  3U8V A;  3B0V C;  2EPN A;  1G5Z A;  3N2Z B;  3EG9 A;  2OEX A;  2ZPA A;  3S27 A;  5DQT A;  5JP7 A;  2Q00 A;  3U2M A;  1QPU A;  2CNW D;  3RVY A;  3B9Q A;  2EIN C;  2IXP A;  1M57 C;  1SR2 A;  1BBH A;  4YL0 A;  3AOU A;  1Z6A A;  4PJN A;  4ULV A;  1OR2 A;  1WGW A;  1NFN A;  2UUH A;  4MVM A;  4CDV A;  4EWC A;  1VTM P;  4Q5S F;  1XWJ A;  1ST6 A;  3DD7 A;  4GEH A;  2CCY A;  2ZXP A;  3EPV A;  4MVR A;  4AX2 A;  2R7W A;  4BJ6 A;  1D0Z A;  1DOW A;  4WGY A;  2J7P D;  4DRJ B;  2XLD A;  2P61 A;  3DM9 B;  1CPQ A;  2NG1 A;  2Y39 A;  3F47 A;  4P9T A;  2HV6 A;  3JYH A;  4RD9 A;  3T4R A;  5CIV A;  3LNM B;  5IY5 C;  3RW0 A;  5L3V A;  5DS5 A;  3QW0 A;  3RFY A;  1MND A;  3OWT A;  1TFO B;  1O87 A;  2EIK C;  1K04 A;  1LIH A;  3DZA A;  1V54 C;  1S7Z A;  2MWQ A;  4U5G A;  4YK5 A;  3C8G B;  2AP3 A;  3DXJ F;  3M79 A;  4BJ1 A;  3W4Y A;  4O7G A;  4DJ9 A;  3CSK A;  2LK4 A;  3PCV A;  3LNR A;  4PK4 A;  3FVY A;  4CSA C;  4BPM A;  2X51 A;  1R4T A;  5T3W A;  4JCH A;  4ULW A;  1A0B A;  4KNW A;  2IXN A;  3EGX B;  4AL1 A;  2J45 A;  1WOL A;  5BQH A;  3A11 A;  3V5X A;  5KYN A;  3U5S A;  2Y3G A;  4J7Y A;  4JTA B;  4P6I C;  2OOC A;  5JLI A;  2J8W A;  4YL1 A;  3GWL A;  2XLE A;  2H8A A;  3OEO A;  3O6X A;  3W8H A;  1JPN A;  3TD7 A;  2IYL D;  5JT4 A;  1D1C A;  4H54 A;  3MLG A;  4XLP F;  3EH1 A;  5B3I A;  2QY9 A;  5L0D A;  1I4Z A;  1YYX A;  3C8G A;  4K7B A; 
#chains in the Genus database with same CATH homology
 1SR2 A;  2LP4 A;  2Q4F A;  1BDJ B;  1Y6D A;  1OXK A;  3KYI A;  4G78 A;  1TQG A;  1A0B A;  1C02 A;  1I5N A;  4EUK B;  3MYF A;  2LD6 A;  1C03 A;  2R25 A;  2LCH A;  3KYJ A;  2OOC A;  3IQT A;  1FR0 A;  4PAC A;  3US6 A;  1QSP A;  1WN0 A;  1OXB A;  1YVI A;  2A0B A;  3U3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...