3ITFA

Structural basis for the inhibitory function of the cpxp adaptor protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
b'STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic adaptor protein cpxP
publication title Structural Basis for Two-component System Inhibition and Pilus Sensing by the Auxiliary CpxP Protein.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr.
molecule tags Signaling protein
total genus 34
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3itfA00
3O39A 3QZCA 3ZG1A 2Y3HA 2Y39A 3ITFA 3LAYA 3EPVA 2Y3BA 2Y3DA 3OEOA 2Y3GA
chains in the Genus database with same CATH superfamily
2LCHA 2J7PA 3US6A 5B1AC 1HMDA 3GEEA 5L3VA 3DE9A 4JJGA 2R9RB 5DVWA 1EI7A 2LD6A 1VB5A 3U9JA 3L0IA 4YL3A 1MMNA 2X0CA 2VCAA 5L0DA 3ZIBA 5KYYB 1Z63A 4YT5A 1TWAA 1ORYA 3IQ6A 2XL8A 4CIPA 1SR2A 4HE8D 3HJCA 3FAJA 3AGTA 4ZLDA 1TR2A 2OJED 3EGDA 5EHHA 2WZFA 3LLIA 1YYXA 2AU5A 2Y69C 2RSEB 3DWWA 4AL0A 2KGOA 4JKVA 1QKRA 5GPGB 2R7OA 2P1AA 3AG2C 3GANA 1ORJA 2GDCA 1J8YF 2XLWA 4HFFB 4JRZA 1RKEA 2J9VA 1KNYA 3JRMO 3O10A 1ORSC 3EGXB 2YZSA 3QMKA 2LFFA 1HW1A 3RH3A 2R02A 4E7SA 3LNRA 4LDKA 5E2QA 5KYWA 2A0BA 5D91A 5B3SC 1FNTc 1G8XA 1ST6A 2OQMA 2Y3DA 4CS8C 1A7DA 5COGA 2R03A 2Q4FA 4YJWA 2NUPA 3U3BA 1G4WR 2TMVP 1LE2A 1OKKD 2PBEA 3AGUA 3NMJA 2GFHA 4Z9HA 4E0HA 3KYJA 1YJGA 2ZXOA 1YVIA 3TOMA 3W8HA 2GWWA 3IEEA 3N0TA 3E70C 1Q0KA 2ASRA 3JSZA 2XXAA 2CYDA 5JSLA 3GM1A 5KYXB 3FXHA 3LUTB 3AG1C 4IJJA 1UFBA 2M4EA 3EFOB 4OIQF 4EBJA 1A7VA 2R7TA 1WTYA 4FESA 4Q4ZF 1VOMA 2H7VC 2DB4A 3PDMP 4HFKB 4NTBA 2OEXA 3MYIA 1S05A 3TJ5A 2L6FA 3KMIA 3UR3C 1HE1A 3DAFA 4D4NA 4G7HF 2J7PD 4IAQA 4DRJB 3U5SA 1HMOA 3ATPA 2J0XA 4ER9A 1B68A 1WN0A 4EWCA 4XQ1A 1LPEA 1WATA 5FZTA 2W4MA 1JPJA 2Y3GA 3HNLA 3RW0A 2LFDA 5DLJA 3MX3A 2PX0A 3U3FA 1MMDA 2ETSA 4G0HA 3L1MA 3EGDB 2YL3A 3EHMA 3TJ6A 3U9MA 1A0BA 2AWYA 4OD5A 2XLHA 2CGEA 2W4BA 3CAXA 3CEXA 4YK5A 5AC4A 3NMKA 3G4ZA 4JC7A 3UMIA 4CDVA 1QLEC 5D92A 3DI5A 3ZQYA 4XTKA 2QNLA 5JP7A 3BEHA 2XLDA 2L81A 5F28E 3QW0A 3TQOA 1VLSA 1TWCA 4P6IC 2MYSA 4I44A 4NQFA 1FFTC 3X1OA 3OEOA 4RDAA 5E3CA 5A6AA 2KSFA 4MW3A 1AEPA 4JCHA 1GGQA 2YLIA 3MBGA 1DOVA 3QZCA 4EKWA 1M56C 2HS5A 4JCZA 1LS4A 5T3TA 3JYYA 1CPQA 2GA0A 2Q9AA 4EIYA 1LIHA 4KI2A 2IOQA 3WHNA 3K33A 2G62A 3FMSA 2EPOA 2XM0A 2I15A 2YL1A 2RD9A 2WVNA 4BJ1A 2XXAB 3GODA 3UNGC 2C04A 1NU7D 2A0UA 2EILC 4JURI 2VASA 3RVZA 3LESA 3DKAA 4FX5A 3M4CA 2XS1A 1J8MF 2WL8A 2R7RA 2DYRC 4YT8A 1WASA 5FCLA 3H2UA 1PD1A 1YZAA 4XPWA 1WWPA 2AWCA 3MYFA 1YLMA 4AK9A 2FGYA 2A68F 3F47A 3Q6NA 2LSEA 2YRFA 3M4BA 2IBFA 4MVQA 2CNWA 3Q7GA 1ZHYA 3QVYA 3RQEA 1U0BB 2IM8A 1MQVA 1V74B 3WG7C 2R7VA 3FHDA 4O6YA 3S28A 3RYLA 4BJ6C 4DRIB 4YN0B 1EA8A 1ZU4A 2XLMA 1K04A 4D4XA 3FVYA 4N4WA 3W2WA 1W2WA 3WAQA 3MFNA 4AX2A 3EJNA 4MVSA 1CGOA 4IB4A 1JMWA 5L0FA 5BUOA 4CSAC 5KYUA 4YWQA 2WVOA 3CSKA 2A6EF 1ZVZA 3B71A 3TK0A 1VLTA 3AQCA 4I1OB 2VCCA 1FR0A 2A1DD 1MMAA 3R7CA 3S0XA 2XLVA 5L0CA 1M2VA 5T1DB 1T5OA 1HE9A 1DOWA 4G78A 1L3PA 4AL1A 4LDQA 3U8VA 2L9JA 3UGPA 1RJ9A 2L7AA 2QUPA 3O39A 5E3AA 5F5FA 2LIGA 2AP3A 2IXNA 4RD9A 4K7BA 2HV7A 4BEMJ 1ZHWA 1M2OA 1APCA 1I5NA 3B0UX 1XWJA 1ZW2A 2H7BA 2H7OA 2G3KA 3C8ZA 2ZXPA 4ULVA 1MNEA 1K40A 2J45A 3V5YA 1E84A 3DZAA 4U5GA 2Q7RA 4CS9C 4XEKA 4G7ZF 1K05A 2P0NA 1IZMA 1V55C 4XWJA 4CIHA 4CSAA 2L6GA 3O55A 1TWGA 4F4BA 1RCPA 3T6GB 1LE4A 4YT2A 1T6UA 3GM3A 1NU9C 1YYJA 1ZHXA 2XLEA 3FOPA 3CQZA 3Q7LA 4WGZA 2YQYA 3SZRA 3T4RA 5BQHA 2PX3A 3JYHA 5CIVA 4EBBA 5A69A 4EUKB 1TFOB 4H54A 5BQIA 1C02A 4PFPA 4KNVA 2R7XA 1IW7F 3ZTMA 1M57C 2QLAA 4OIRF 2KK1A 3L8IA 3H65A 4U5FE 1QVXA 3V5XA 256BA 3K1IC 4BJTA 2PP4A 1M6TA 2WB7A 1NZEA 1LM3B 4PACA 3EQLF 3N2ZB 4FWVA 2NUTA 1A7EA 3SEOA 2EIKC 3U8PA 4CX9A 5EGYA 4GQHA 4BJ5C 1YARO 1D0YA 4CS9A 4CS7A 2J0WA 3LS0A 4ONSA 3S27A 5KYUB 4C3BA 5L0IA 5CI8A 1UG7A 3NG1A 3B29A 2EPLX 2PF4E 3F46A 4JTCB 4EHPA 2R7WA 1I4YA 3ASOC 3C62A 1LI7A 3DMDA 1ZHTA 3QTHA 3Q6MA 1M2VB 3C63A 1Y4CA 3HTKC 4XLNF 4CS8A 2R7UA 3IQ5A 2Q9CA 1Y6DA 2IYLD 1H9GA 1HW2A 3NDBB 1RJ9B 2ZXWC 3C8GA 4IRUA 4ULWA 2R25A 4LACB 3MLGA 1FMVA 2I8BA 2KW3C 3JTLO 4QDLA 4GEHA 5T3WA 1C03A 1NLXA 3LNMB 2MHRA 4CDYA 1PD0A 3K6BA 1JAFA 4A4AA 3K1IA 1OCOC 4YT4A 3K1HA 4JTAB 3A9CA 3GORA 4LLEA 1ZW3A 4E7ZA 3POVA 2Q3TA 3PCVA 4B6IA 5DS5A 1RKCA 3EZHA 3ABKC 5B1BC 4DVZA 4MVOA 3ABMC 3O6XA 4OD4A 4CJOA 5JUAA 1RKEB 4BJ5A 2KYHA 3X2QC 3RQGA 1QQ3A 3VM6A 2BC5A 4I3MA 5F5HA 2YEVA 3R2PA 3M79A 4U9EA 2R05A 2UUHA 5KYWB 2W9YA 2YL7A 4N06A 3FDQA 2EPMX 1D0ZA 2HSBA 3IPMO 3LS1A 4LLCA 3W8IA 3TULA 1E2XA 3I4UA 1Z3IX 3KPHA 4JIOA 4XEVA 1EKYA 1KU2A 2XLOA 1T9KA 2IXMA 4JW1A 2HUJA 2NUPB 4DBRA 1OW8A 4Q5SF 1SMYF 2KC3A 3VRCA 2PFDA 3B9QA 2HSQA 3VYWA 4GYTA 5A6BA 3N24A 1BBHA 1XZQA 2QY9A 1YDIA 4PJLA 3DM9B 1PCXA 1GS9A 3GWLA 1ZHZA 2J9WA 4Z9IA 3ZWIA 2Y3HA 3JCUQ 4DRHB 2EPNA 2R7SA 4N6HA 2DYSC 2W45A 1LVKA 3CZ6A 3RKOF 3T6BA 2YKZA 3KH2A 2WZGA 3ZTZA 2XS8A 4C3EA 1AVOB 4MTOA 3SXMA 1ZYRF 2KQ9A 4JE9A 4PK4A 4G7OF 5L3QA 4CJGA 1MMGA 4P9FA 2J46A 1U89A 2BL2A 1JOGA 3JSEO 4YL0A 2QTVA 4CDAA 4M63A 2A6HF 3UGOA 4PR9A 2OG2A 2OKUA 1OR3A 3GM2A 3IQCA 3ITFA 2GAQA 4JZAA 3V5ZA 3LEVA 4MVRA 4W8PA 4WGYA 3RFYA 1LI5A 1E83A 4IWBA 1NSGB 1YA9A 3KL4A 2KNHA 4NC3A 2V3CC 1R5ID 3DD7A 3JRTA 4NTFA 2XL4A 3I5PA 4DXWA 1G4US 4MNDA 3IQTA 4DOZA 3RIPA 3HLZA 4ZLCA 2P7VA 1ZZPA 2C03A 3VF0A 1RXQA 1D1BA 1N1CA 3AG4C 3J06A 2UUIA 2NSGA 2Q9BA 3UMHA 3NYLA 2NG1A 4XPYA 3ZQVA 2VB6A 4C7OA 2P61A 4MVZA 4XLPF 2IXOA 3EG9A 1U6HA 1RMVA 3ABLC 4JVSA 1H6GA 1OKKA 2FFHA 4IAOA 2EIMC 5COMA 2EIJC 5K0IA 4HEAJ 1OR2A 3LJBA 3PHF2 3OA1A 3W2VA 1OCRC 1QSPA 1BR2A 2HJMA 4EBKA 4KC9A 3GEHA 3HNIA 3NYJA 3HNJA 3ZDLA 2VH3A 1D0XA 2LK4A 1QPUA 3EFOA 4O79A 3S9OA 4O6NA 3U2MA 3WODF 2ZXRA 2B0JA 3IHUA 1YAUO 4NCQA 4N6CA 3SXYA 4E0IA 5DS6A 4DJ9A 2ZD9A 3I5QA 4U5DE 4UDVA 2LQGA 5B3IA 3SP1A 1SYQA 4BJ6A 4Q7CA 3GEIA 1D1CA 3EZIA 1FAPB 3SXKA 2WZLA 3KKBA 2DGJA 4R32A 3OWTA 2Y39A 2J8WA 1OXBA 2OOCA 2Y3BA 1I4ZA 1MNDA 1T6QA 3AG3C 5JRAA 2YVKA 3S29A 4MQ9F 5AC5A 1CPRA 4QI0A 1BZ4A 2HFIA 3DE8A 1BDJB 4LERA 4PJNA 5COFA 1OQCA 2HJ3A 2XL6A 2CW0F 3NRHA 2CNWD 3M1CB 4U5EE 3JZ0A 1OCCC 3EH2A 4U5HA 2J9UA 1LS1A 1Q0MA 1V4AA 2V26A 3KYIA 3PMRA 4JEBA 1BR1A 2YLDA 4MVMA 4O6MA 3TD7A 4A2NB 3U0CA 4PJMA 1JR8A 2JD3A 3DM5A 1VYKA 2CCYA 4C3DA 1NG1A 4J7TA 1E85A 1F1MA 1VMAA 4O7GA 3W4YA 1PV3A 4P9TA 3SYNA 1KTMA 4X0RA 2NSFA 2IXPA 2DI3A 1FFHA 3A11A 4IGGA 3V7OA 1D1AA 3ECSA 4PJJA 4C7OB 4E18A 4BEJA 3C18A 2JX0A 3EG9B 4YL1A 1G5ZA 4MW8A 1Z7Qc 5L0JA 1OW7A 5EK0A 2J9BA 4K0DA 1E86A 2XRHA 2FAPB 2H8AA 1L7CA 3HNKA 4FAPB 3H2VA 1H9TA 1Z5ZA 3UMKA 1O87A 2BE5F 3RQFA 1A41A 1FMWA 2YWAA 5L0GA 2QE9A 1T01A 3G50A 4AE4A 1Q0FA 1R4TA 1XZPA 2L6HA 1VK5A 2OU6A 2G3VA 5AGFA 5IY5C 2VC9A 3DJUB 4J32B 4ANJA 2F22A 3K7DA 2YHSA 2HZ8A 3ZVRA 3S90A 1SF8A 4J30B 2X51A 3LEOA 4DBQA 4MS2A 3AQBA 5DQZA 3L8JA 4NY3A 3VAYA 1TKNA 4J7YA 1GM5A 1HY5A 3HKKA 2OEVA 2HKVA 2Z15A 1Q0DA 3LLKA 2EINC 2OJQA 5JLIA 1JPNA 4W8KA 4JJFA 1OXKA 3S84A 3FOOA 2XSEA 4LDRA 2ZPAA 1VYIA 1AUEA 2MWQA 3DJNB 1GQAA 3EHNA 3AJMA 3K66A 1NFOA 3LAYA 4U5CE 3RVYA 4DVYP 3NKEA 4BPMA 5DS4A 1V54C 4MTFA 3SXZA 2AVKA 5DQTA 1TWHA 3DXJF 3ZC4A 1Z23A 1CGME 2JPUA 1CGNA 2NUTB 2B0HA 1Q0GA 4CBEA 1TQGA 1WOLA 2P6VA 2KJGA 4JTDB 3TOLA 5HV9A 1VTMP 1H7IA 2E87A 3JT1A 3E9VA 4U9DA 4XEFA 3C7JA 5KYYA 1FTSA 4OIOF 4MTGA 1JRAA 3T9OA 3QW1A 2YL0A 4H4KC 2HMZA 3U2LA 4K1OA 2A69F 4WABA 1TFKB 3AOUA 2O9XA 2WVQA 2XM4A 3B0PA 2Q00A 4XPXA 4OINF 1YA7O 1C17M 1OW6A 2D4UA 3C8GD 4IARA 3C8GB 3NMIA 5BQGA 2ICWG 5E33A 4OIPF 2LP4A 2PNOA 3EGXA 4L6RA 1O3UA 4I1MA 3ZSUA 2HV6A 3FAPB 4E17A 2OCCC 1SZIA 1BR4A 1OCZC 2EPKX 3NKDA 5JVEA 4Z9JA 4AE4B 4RBNA 3ASNC 2VCBA 4U5BE 4NTAA 2YLGA 4PFOA 3DAGA 1QZXA 5JS5A 3BRJA 3G4XA 3RF3A 1T6IA 3M15A 4KBLA 5L0HA 1YZCA 3EPVA 4QI2A 1NBBA 1Z6AA 3GWNA 3QVZA 5TJ5E 4KNWA 3NYMA 3ZG1A 3B0VC 1ZU5A 5A6KA 3T6JA 5KYNA 5KYXA 5HSWA 2M64A 1NFNA 5JT4A 1S7ZA 2D5RB 3EH1A 2HMQA 2R7QA 4BG0A 5A6JA 2CDQA 5A6BD 1WGWA 4MVUA 2NPUA 4WJ0A 1O5HA 3L34A 4JEAA 3SNHA 1LKXA 5CI9A 1EQ1A
chains in the Genus database with same CATH topology
2J7PA 5B1AC 5L3VA 4JJGA 5DVWA 3L0IA 1MMNA 1Z63A 3ZIBA 5KYYB 4YT5A 1TWAA 4HE8D 3HJCA 3FAJA 4ZLDA 1TR2A 3EGDA 5EHHA 2WZFA 3LLIA 2Y69C 2KGOA 2R7OA 3AG2C 3GANA 1J8YF 4HFFB 2J9VA 3EGXB 2YZSA 3QMKA 3RH3A 4E7SA 3LNRA 5E2QA 5KYWA 5D91A 5B3SC 1G8XA 1ST6A 2Y3DA 4CS8C 4YJWA 2NUPA 1OKKD 2GFHA 2ZXOA 3W8HA 3IEEA 3N0TA 3E70C 2XXAA 3JSZA 5KYXB 4IJJA 3AG1C 2M4EA 3EFOB 4OIQF 2R7TA 4FESA 4Q4ZF 1VOMA 2H7VC 4HFKB 4G7HF 3KMIA 3UR3C 3DAFA 2J7PD 2J0XA 4EWCA 2W4MA 1JPJA 2Y3GA 5DLJA 3MX3A 2PX0A 1MMDA 4G0HA 3EGDB 3EHMA 4OD5A 2CGEA 2W4BA 3UMIA 1QLEC 5D92A 4XTKA 2L81A 1TWCA 4P6IC 2MYSA 4I44A 1FFTC 3X1OA 3OEOA 4RDAA 5E3CA 4JCHA 3QZCA 1M56C 5T3TA 2Q9AA 4KI2A 2IOQA 3K33A 2G62A 2WVNA 4BJ1A 2XXAB 3GODA 3UNGC 2C04A 1NU7D 2EILC 4JURI 2VASA 3LESA 4FX5A 1J8MF 2WL8A 2R7RA 2DYRC 4YT8A 5FCLA 1PD1A 4AK9A 2FGYA 2A68F 3F47A 3Q6NA 2LSEA 2CNWA 3Q7GA 1ZHYA 3WG7C 2R7VA 3FHDA 4O6YA 3S28A 3RYLA 4BJ6C 4YN0B 1ZU4A 3FVYA 3W2WA 1W2WA 4AX2A 3EJNA 5BUOA 4CSAC 5KYUA 4YWQA 2WVOA 3CSKA 2A6EF 3AQCA 4I1OB 2A1DD 1MMAA 3S0XA 1M2VA 5T1DB 3UGPA 2L9JA 1RJ9A 3O39A 5E3AA 5F5FA 2IXNA 4RD9A 4K7BA 2HV7A 1ZHWA 1M2OA 3B0UX 2H7OA 2H7BA 2G3KA 2ZXPA 1MNEA 2J45A 3DZAA 4U5GA 4CS9C 4G7ZF 4XWJA 1IZMA 1V55C 4CSAA 4CIHA 1TWGA 4F4BA 4YT2A 1NU9C 1ZHXA 3Q7LA 3T4RA 3CQZA 3SZRA 2PX3A 3JYHA 4EBBA 4PFPA 4KNVA 2R7XA 1IW7F 1M57C 4OIRF 3H65A 4U5FE 3K1IC 4BJTA 2PP4A 2WB7A 1NZEA 3EQLF 3N2ZB 4FWVA 2NUTA 3SEOA 2EIKC 5EGYA 4BJ5C 4CS9A 1D0YA 4CS7A 2J0WA 3LS0A 3S27A 5KYUB 4C3BA 5CI8A 3NG1A 3F46A 2PF4E 2R7WA 3ASOC 3DMDA 1ZHTA 3Q6MA 1M2VB 3HTKC 4XLNF 4CS8A 2R7UA 2Q9CA 2IYLD 3NDBB 1RJ9B 2ZXWC 4IRUA 4ULWA 4LACB 3MLGA 1FMVA 2I8BA 2KW3C 5T3WA 4QDLA 4GEHA 1PD0A 3K6BA 1OCOC 4YT4A 3K1HA 4LLEA 4E7ZA 3POVA 2Q3TA 4B6IA 5DS5A 5B1BC 3EZHA 3ABKC 4DVZA 3ABMC 3O6XA 4OD4A 4BJ5A 4I3MA 5F5HA 2YEVA 5KYWB 3FDQA 2W9YA 4N06A 1D0ZA 3LS1A 4LLCA 3W8IA 3I4UA 1Z3IX 1KU2A 2IXMA 4JW1A 2NUPB 4DBRA 1SMYF 2PFDA 3B9QA 3VYWA 4GYTA 3N24A 2QY9A 4PJLA 3DM9B 1PCXA 1ZHZA 2J9WA 2Y3HA 3JCUQ 2R7SA 2DYSC 2W45A 1LVKA 3CZ6A 3RKOF 3T6BA 3KH2A 2WZGA 4C3EA 1ZYRF 2KQ9A 4PK4A 4G7OF 5L3QA 1MMGA 2J46A 2QTVA 4M63A 2A6HF 3UGOA 2OG2A 3ITFA 4JZAA 3LEVA 3RFYA 4IWBA 3KL4A 2V3CC 2KNHA 3DD7A 3JRTA 2XL4A 3I5PA 4MNDA 4DOZA 3RIPA 3HLZA 4ZLCA 2P7VA 2C03A 3AG4C 1N1CA 1D1BA 2Q9BA 3UMHA 3NYLA 2NG1A 2VB6A 4C7OA 4XLPF 2IXOA 3EG9A 3ABLC 4JVSA 1OKKA 2FFHA 4IAOA 2EIMC 2EIJC 4HEAJ 3LJBA 3PHF2 3OA1A 3W2VA 1OCRC 1BR2A 4KC9A 3NYJA 2VH3A 1D0XA 4O79A 3EFOA 4BJ6A 4O6NA 3WODF 5DS6A 2ZXRA 2B0JA 3I5QA 4U5DE 3SP1A 4Q7CA 1D1CA 3EZIA 2WZLA 3KKBA 2DGJA 3OWTA 2Y39A 2Y3BA 1MNDA 3AG3C 3S29A 4MQ9F 4QI0A 4LERA 4PJNA 2CW0F 3NRHA 2CNWD 3M1CB 4U5EE 1OCCC 3EH2A 4U5HA 2J9UA 1LS1A 4Q5SF 2V26A 3PMRA 3TD7A 1BR1A 4O6MA 4A2NB 4PJMA 3DM5A 2JD3A 1VYKA 4C3DA 1NG1A 1VMAA 4O7GA 3SYNA 4X0RA 2IXPA 1FFHA 3V7OA 1D1AA 3ECSA 4PJJA 4C7OB 4BEJA 3EG9B 4K0DA 2XRHA 1Z5ZA 3UMKA 1O87A 2BE5F 1FMWA 4AE4A 1VK5A 5IY5C 2G3VA 3DJUB 4J32B 4ANJA 3K7DA 2YHSA 3ZVRA 1SF8A 4J30B 2X51A 4DBQA 5DQZA 3AQBA 4NY3A 3VAYA 1TKNA 2Z15A 3LLKA 2EINC 1JPNA 4W8KA 4JJFA 2XSEA 2ZPAA 1VYIA 3LAYA 2MWQA 3DJNB 3EHNA 3K66A 4U5CE 3X2QC 4DVYP 3NKEA 5DS4A 1V54C 5DQTA 1TWHA 3DXJF 3ZC4A 1Z23A 2NUTB 4CBEA 2P6VA 2KJGA 2E87A 3JT1A 3E9VA 5KYYA 1FTSA 4OIOF 4H4KC 2A69F 2O9XA 2WVQA 3B0PA 4OINF 4OIPF 5E33A 3EGXA 4I1MA 3ZSUA 2HV6A 2OCCC 1SZIA 1BR4A 1OCZC 3NKDA 4AE4B 4RBNA 3ASNC 4U5BE 4PFOA 3DAGA 1QZXA 4KBLA 4QI2A 3EPVA 1Z6AA 3ZG1A 4KNWA 3NYMA 3B0VC 1ZU5A 5KYNA 3T6JA 5KYXA 5HSWA 1S7ZA 2D5RB 3EH1A 2R7QA 4BG0A 2CDQA 1WGWA 4WJ0A 1O5HA 3L34A 3SNHA 1LKXA 5CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O39 A;  3QZC A;  3ZG1 A;  2Y3H A;  2Y39 A;  3ITF A;  3LAY A;  3EPV A;  2Y3B A;  2Y3D A;  3OEO A;  2Y3G A; 
#chains in the Genus database with same CATH topology
 2LCH A;  2J7P A;  3US6 A;  5B1A C;  1HMD A;  3GEE A;  5L3V A;  3DE9 A;  4JJG A;  2R9R B;  5DVW A;  1EI7 A;  2LD6 A;  1VB5 A;  3U9J A;  3L0I A;  4YL3 A;  1MMN A;  2X0C A;  2VCA A;  5L0D A;  3ZIB A;  5KYY B;  1Z63 A;  4YT5 A;  1TWA A;  1ORY A;  3IQ6 A;  2XL8 A;  4CIP A;  1SR2 A;  4HE8 D;  3HJC A;  3FAJ A;  3AGT A;  4ZLD A;  1TR2 A;  2OJE D;  3EGD A;  5EHH A;  2WZF A;  3LLI A;  1YYX A;  2AU5 A;  2Y69 C;  2RSE B;  3DWW A;  4AL0 A;  2KGO A;  4JKV A;  1QKR A;  5GPG B;  2R7O A;  2P1A A;  3AG2 C;  3GAN A;  1ORJ A;  2GDC A;  1J8Y F;  2XLW A;  4HFF B;  4JRZ A;  1RKE A;  2J9V A;  1KNY A;  3JRM O;  3O10 A;  1ORS C;  3EGX B;  2YZS A;  3QMK A;  2LFF A;  1HW1 A;  3RH3 A;  2R02 A;  4E7S A;  3LNR A;  4LDK A;  5E2Q A;  5KYW A;  2A0B A;  5D91 A;  5B3S C;  1FNT c;  1G8X A;  1ST6 A;  2OQM A;  2Y3D A;  4CS8 C;  1A7D A;  5COG A;  2R03 A;  2Q4F A;  4YJW A;  2NUP A;  3U3B A;  1G4W R;  2TMV P;  1LE2 A;  1OKK D;  2PBE A;  3AGU A;  3NMJ A;  2GFH A;  4Z9H A;  4E0H A;  3KYJ A;  1YJG A;  2ZXO A;  1YVI A;  3TOM A;  3W8H A;  2GWW A;  3IEE A;  3N0T A;  3E70 C;  1Q0K A;  2ASR A;  3JSZ A;  2XXA A;  2CYD A;  5JSL A;  3GM1 A;  5KYX B;  3FXH A;  3LUT B;  3AG1 C;  4IJJ A;  1UFB A;  2M4E A;  3EFO B;  4OIQ F;  4EBJ A;  1A7V A;  2R7T A;  1WTY A;  4FES A;  4Q4Z F;  1VOM A;  2H7V C;  2DB4 A;  3PDM P;  4HFK B;  4NTB A;  2OEX A;  3MYI A;  1S05 A;  3TJ5 A;  2L6F A;  3KMI A;  3UR3 C;  1HE1 A;  3DAF A;  4D4N A;  4G7H F;  2J7P D;  4IAQ A;  4DRJ B;  3U5S A;  1HMO A;  3ATP A;  2J0X A;  4ER9 A;  1B68 A;  1WN0 A;  4EWC A;  4XQ1 A;  1LPE A;  1WAT A;  5FZT A;  2W4M A;  1JPJ A;  2Y3G A;  3HNL A;  3RW0 A;  2LFD A;  5DLJ A;  3MX3 A;  2PX0 A;  3U3F A;  1MMD A;  2ETS A;  4G0H A;  3L1M A;  3EGD B;  2YL3 A;  3EHM A;  3TJ6 A;  3U9M A;  1A0B A;  2AWY A;  4OD5 A;  2XLH A;  2CGE A;  2W4B A;  3CAX A;  3CEX A;  4YK5 A;  5AC4 A;  3NMK A;  3G4Z A;  4JC7 A;  3UMI A;  4CDV A;  1QLE C;  5D92 A;  3DI5 A;  3ZQY A;  4XTK A;  2QNL A;  5JP7 A;  3BEH A;  2XLD A;  2L81 A;  5F28 E;  3QW0 A;  3TQO A;  1VLS A;  1TWC A;  4P6I C;  2MYS A;  4I44 A;  4NQF A;  1FFT C;  3X1O A;  3OEO A;  4RDA A;  5E3C A;  5A6A A;  2KSF A;  4MW3 A;  1AEP A;  4JCH A;  1GGQ A;  2YLI A;  3MBG A;  1DOV A;  3QZC A;  4EKW A;  1M56 C;  2HS5 A;  4JCZ A;  1LS4 A;  5T3T A;  3JYY A;  1CPQ A;  2GA0 A;  2Q9A A;  4EIY A;  1LIH A;  4KI2 A;  2IOQ A;  3WHN A;  3K33 A;  2G62 A;  3FMS A;  2EPO A;  2XM0 A;  2I15 A;  2YL1 A;  2RD9 A;  2WVN A;  4BJ1 A;  2XXA B;  3GOD A;  3UNG C;  2C04 A;  1NU7 D;  2A0U A;  2EIL C;  4JUR I;  2VAS A;  3RVZ A;  3LES A;  3DKA A;  4FX5 A;  3M4C A;  2XS1 A;  1J8M F;  2WL8 A;  2R7R A;  2DYR C;  4YT8 A;  1WAS A;  5FCL A;  3H2U A;  1PD1 A;  1YZA A;  4XPW A;  1WWP A;  2AWC A;  3MYF A;  1YLM A;  4AK9 A;  2FGY A;  2A68 F;  3F47 A;  3Q6N A;  2LSE A;  2YRF A;  3M4B A;  2IBF A;  4MVQ A;  2CNW A;  3Q7G A;  1ZHY A;  3QVY A;  3RQE A;  1U0B B;  2IM8 A;  1MQV A;  1V74 B;  3WG7 C;  2R7V A;  3FHD A;  4O6Y A;  3S28 A;  3RYL A;  4BJ6 C;  4DRI B;  4YN0 B;  1EA8 A;  1ZU4 A;  2XLM A;  1K04 A;  4D4X A;  3FVY A;  4N4W A;  3W2W A;  1W2W A;  3WAQ A;  3MFN A;  4AX2 A;  3EJN A;  4MVS A;  1CGO A;  4IB4 A;  1JMW A;  5L0F A;  5BUO A;  4CSA C;  5KYU A;  4YWQ A;  2WVO A;  3CSK A;  2A6E F;  1ZVZ A;  3B71 A;  3TK0 A;  1VLT A;  3AQC A;  4I1O B;  2VCC A;  1FR0 A;  2A1D D;  1MMA A;  3R7C A;  3S0X A;  2XLV A;  5L0C A;  1M2V A;  5T1D B;  1T5O A;  1HE9 A;  1DOW A;  4G78 A;  1L3P A;  4AL1 A;  4LDQ A;  3U8V A;  2L9J A;  3UGP A;  1RJ9 A;  2L7A A;  2QUP A;  3O39 A;  5E3A A;  5F5F A;  2LIG A;  2AP3 A;  2IXN A;  4RD9 A;  4K7B A;  2HV7 A;  4BEM J;  1ZHW A;  1M2O A;  1APC A;  1I5N A;  3B0U X;  1XWJ A;  1ZW2 A;  2H7B A;  2H7O A;  2G3K A;  3C8Z A;  2ZXP A;  4ULV A;  1MNE A;  1K40 A;  2J45 A;  3V5Y A;  1E84 A;  3DZA A;  4U5G A;  2Q7R A;  4CS9 C;  4XEK A;  4G7Z F;  1K05 A;  2P0N A;  1IZM A;  1V55 C;  4XWJ A;  4CIH A;  4CSA A;  2L6G A;  3O55 A;  1TWG A;  4F4B A;  1RCP A;  3T6G B;  1LE4 A;  4YT2 A;  1T6U A;  3GM3 A;  1NU9 C;  1YYJ A;  1ZHX A;  2XLE A;  3FOP A;  3CQZ A;  3Q7L A;  4WGZ A;  2YQY A;  3SZR A;  3T4R A;  5BQH A;  2PX3 A;  3JYH A;  5CIV A;  4EBB A;  5A69 A;  4EUK B;  1TFO B;  4H54 A;  5BQI A;  1C02 A;  4PFP A;  4KNV A;  2R7X A;  1IW7 F;  3ZTM A;  1M57 C;  2QLA A;  4OIR F;  2KK1 A;  3L8I A;  3H65 A;  4U5F E;  1QVX A;  3V5X A;  256B A;  3K1I C;  4BJT A;  2PP4 A;  1M6T A;  2WB7 A;  1NZE A;  1LM3 B;  4PAC A;  3EQL F;  3N2Z B;  4FWV A;  2NUT A;  1A7E A;  3SEO A;  2EIK C;  3U8P A;  4CX9 A;  5EGY A;  4GQH A;  4BJ5 C;  1YAR O;  1D0Y A;  4CS9 A;  4CS7 A;  2J0W A;  3LS0 A;  4ONS A;  3S27 A;  5KYU B;  4C3B A;  5L0I A;  5CI8 A;  1UG7 A;  3NG1 A;  3B29 A;  2EPL X;  2PF4 E;  3F46 A;  4JTC B;  4EHP A;  2R7W A;  1I4Y A;  3ASO C;  3C62 A;  1LI7 A;  3DMD A;  1ZHT A;  3QTH A;  3Q6M A;  1M2V B;  3C63 A;  1Y4C A;  3HTK C;  4XLN F;  4CS8 A;  2R7U A;  3IQ5 A;  2Q9C A;  1Y6D A;  2IYL D;  1H9G A;  1HW2 A;  3NDB B;  1RJ9 B;  2ZXW C;  3C8G A;  4IRU A;  4ULW A;  2R25 A;  4LAC B;  3MLG A;  1FMV A;  2I8B A;  2KW3 C;  3JTL O;  4QDL A;  4GEH A;  5T3W A;  1C03 A;  1NLX A;  3LNM B;  2MHR A;  4CDY A;  1PD0 A;  3K6B A;  1JAF A;  4A4A A;  3K1I A;  1OCO C;  4YT4 A;  3K1H A;  4JTA B;  3A9C A;  3GOR A;  4LLE A;  1ZW3 A;  4E7Z A;  3POV A;  2Q3T A;  3PCV A;  4B6I A;  5DS5 A;  1RKC A;  3EZH A;  3ABK C;  5B1B C;  4DVZ A;  4MVO A;  3ABM C;  3O6X A;  4OD4 A;  4CJO A;  5JUA A;  1RKE B;  4BJ5 A;  2KYH A;  3X2Q C;  3RQG A;  1QQ3 A;  3VM6 A;  2BC5 A;  4I3M A;  5F5H A;  2YEV A;  3R2P A;  3M79 A;  4U9E A;  2R05 A;  2UUH A;  5KYW B;  2W9Y A;  2YL7 A;  4N06 A;  3FDQ A;  2EPM X;  1D0Z A;  2HSB A;  3IPM O;  3LS1 A;  4LLC A;  3W8I A;  3TUL A;  1E2X A;  3I4U A;  1Z3I X;  3KPH A;  4JIO A;  4XEV A;  1EKY A;  1KU2 A;  2XLO A;  1T9K A;  2IXM A;  4JW1 A;  2HUJ A;  2NUP B;  4DBR A;  1OW8 A;  4Q5S F;  1SMY F;  2KC3 A;  3VRC A;  2PFD A;  3B9Q A;  2HSQ A;  3VYW A;  4GYT A;  5A6B A;  3N24 A;  1BBH A;  1XZQ A;  2QY9 A;  1YDI A;  4PJL A;  3DM9 B;  1PCX A;  1GS9 A;  3GWL A;  1ZHZ A;  2J9W A;  4Z9I A;  3ZWI A;  2Y3H A;  3JCU Q;  4DRH B;  2EPN A;  2R7S A;  4N6H A;  2DYS C;  2W45 A;  1LVK A;  3CZ6 A;  3RKO F;  3T6B A;  2YKZ A;  3KH2 A;  2WZG A;  3ZTZ A;  2XS8 A;  4C3E A;  1AVO B;  4MTO A;  3SXM A;  1ZYR F;  2KQ9 A;  4JE9 A;  4PK4 A;  4G7O F;  5L3Q A;  4CJG A;  1MMG A;  4P9F A;  2J46 A;  1U89 A;  2BL2 A;  1JOG A;  3JSE O;  4YL0 A;  2QTV A;  4CDA A;  4M63 A;  2A6H F;  3UGO A;  4PR9 A;  2OG2 A;  2OKU A;  1OR3 A;  3GM2 A;  3IQC A;  3ITF A;  2GAQ A;  4JZA A;  3V5Z A;  3LEV A;  4MVR A;  4W8P A;  4WGY A;  3RFY A;  1LI5 A;  1E83 A;  4IWB A;  1NSG B;  1YA9 A;  3KL4 A;  2KNH A;  4NC3 A;  2V3C C;  1R5I D;  3DD7 A;  3JRT A;  4NTF A;  2XL4 A;  3I5P A;  4DXW A;  1G4U S;  4MND A;  3IQT A;  4DOZ A;  3RIP A;  3HLZ A;  4ZLC A;  2P7V A;  1ZZP A;  2C03 A;  3VF0 A;  1RXQ A;  1D1B A;  1N1C A;  3AG4 C;  3J06 A;  2UUI A;  2NSG A;  2Q9B A;  3UMH A;  3NYL A;  2NG1 A;  4XPY A;  3ZQV A;  2VB6 A;  4C7O A;  2P61 A;  4MVZ A;  4XLP F;  2IXO A;  3EG9 A;  1U6H A;  1RMV A;  3ABL C;  4JVS A;  1H6G A;  1OKK A;  2FFH A;  4IAO A;  2EIM C;  5COM A;  2EIJ C;  5K0I A;  4HEA J;  1OR2 A;  3LJB A;  3PHF 2;  3OA1 A;  3W2V A;  1OCR C;  1QSP A;  1BR2 A;  2HJM A;  4EBK A;  4KC9 A;  3GEH A;  3HNI A;  3NYJ A;  3HNJ A;  3ZDL A;  2VH3 A;  1D0X A;  2LK4 A;  1QPU A;  3EFO A;  4O79 A;  3S9O A;  4O6N A;  3U2M A;  3WOD F;  2ZXR A;  2B0J A;  3IHU A;  1YAU O;  4NCQ A;  4N6C A;  3SXY A;  4E0I A;  5DS6 A;  4DJ9 A;  2ZD9 A;  3I5Q A;  4U5D E;  4UDV A;  2LQG A;  5B3I A;  3SP1 A;  1SYQ A;  4BJ6 A;  4Q7C A;  3GEI A;  1D1C A;  3EZI A;  1FAP B;  3SXK A;  2WZL A;  3KKB A;  2DGJ A;  4R32 A;  3OWT A;  2Y39 A;  2J8W A;  1OXB A;  2OOC A;  2Y3B A;  1I4Z A;  1MND A;  1T6Q A;  3AG3 C;  5JRA A;  2YVK A;  3S29 A;  4MQ9 F;  5AC5 A;  1CPR A;  4QI0 A;  1BZ4 A;  2HFI A;  3DE8 A;  1BDJ B;  4LER A;  4PJN A;  5COF A;  1OQC A;  2HJ3 A;  2XL6 A;  2CW0 F;  3NRH A;  2CNW D;  3M1C B;  4U5E E;  3JZ0 A;  1OCC C;  3EH2 A;  4U5H A;  2J9U A;  1LS1 A;  1Q0M A;  1V4A A;  2V26 A;  3KYI A;  3PMR A;  4JEB A;  1BR1 A;  2YLD A;  4MVM A;  4O6M A;  3TD7 A;  4A2N B;  3U0C A;  4PJM A;  1JR8 A;  2JD3 A;  3DM5 A;  1VYK A;  2CCY A;  4C3D A;  1NG1 A;  4J7T A;  1E85 A;  1F1M A;  1VMA A;  4O7G A;  3W4Y A;  1PV3 A;  4P9T A;  3SYN A;  1KTM A;  4X0R A;  2NSF A;  2IXP A;  2DI3 A;  1FFH A;  3A11 A;  4IGG A;  3V7O A;  1D1A A;  3ECS A;  4PJJ A;  4C7O B;  4E18 A;  4BEJ A;  3C18 A;  2JX0 A;  3EG9 B;  4YL1 A;  1G5Z A;  4MW8 A;  1Z7Q c;  5L0J A;  1OW7 A;  5EK0 A;  2J9B A;  4K0D A;  1E86 A;  2XRH A;  2FAP B;  2H8A A;  1L7C A;  3HNK A;  4FAP B;  3H2V A;  1H9T A;  1Z5Z A;  3UMK A;  1O87 A;  2BE5 F;  3RQF A;  1A41 A;  1FMW A;  2YWA A;  5L0G A;  2QE9 A;  1T01 A;  3G50 A;  4AE4 A;  1Q0F A;  1R4T A;  1XZP A;  2L6H A;  1VK5 A;  2OU6 A;  2G3V A;  5AGF A;  5IY5 C;  2VC9 A;  3DJU B;  4J32 B;  4ANJ A;  2F22 A;  3K7D A;  2YHS A;  2HZ8 A;  3ZVR A;  3S90 A;  1SF8 A;  4J30 B;  2X51 A;  3LEO A;  4DBQ A;  4MS2 A;  3AQB A;  5DQZ A;  3L8J A;  4NY3 A;  3VAY A;  1TKN A;  4J7Y A;  1GM5 A;  1HY5 A;  3HKK A;  2OEV A;  2HKV A;  2Z15 A;  1Q0D A;  3LLK A;  2EIN C;  2OJQ A;  5JLI A;  1JPN A;  4W8K A;  4JJF A;  1OXK A;  3S84 A;  3FOO A;  2XSE A;  4LDR A;  2ZPA A;  1VYI A;  1AUE A;  2MWQ A;  3DJN B;  1GQA A;  3EHN A;  3AJM A;  3K66 A;  1NFO A;  3LAY A;  4U5C E;  3RVY A;  4DVY P;  3NKE A;  4BPM A;  5DS4 A;  1V54 C;  4MTF A;  3SXZ A;  2AVK A;  5DQT A;  1TWH A;  3DXJ F;  3ZC4 A;  1Z23 A;  1CGM E;  2JPU A;  1CGN A;  2NUT B;  2B0H A;  1Q0G A;  4CBE A;  1TQG A;  1WOL A;  2P6V A;  2KJG A;  4JTD B;  3TOL A;  5HV9 A;  1VTM P;  1H7I A;  2E87 A;  3JT1 A;  3E9V A;  4U9D A;  4XEF A;  3C7J A;  5KYY A;  1FTS A;  4OIO F;  4MTG A;  1JRA A;  3T9O A;  3QW1 A;  2YL0 A;  4H4K C;  2HMZ A;  3U2L A;  4K1O A;  2A69 F;  4WAB A;  1TFK B;  3AOU A;  2O9X A;  2WVQ A;  2XM4 A;  3B0P A;  2Q00 A;  4XPX A;  4OIN F;  1YA7 O;  1C17 M;  1OW6 A;  2D4U A;  3C8G D;  4IAR A;  3C8G B;  3NMI A;  5BQG A;  2ICW G;  5E33 A;  4OIP F;  2LP4 A;  2PNO A;  3EGX A;  4L6R A;  1O3U A;  4I1M A;  3ZSU A;  2HV6 A;  3FAP B;  4E17 A;  2OCC C;  1SZI A;  1BR4 A;  1OCZ C;  2EPK X;  3NKD A;  5JVE A;  4Z9J A;  4AE4 B;  4RBN A;  3ASN C;  2VCB A;  4U5B E;  4NTA A;  2YLG A;  4PFO A;  3DAG A;  1QZX A;  5JS5 A;  3BRJ A;  3G4X A;  3RF3 A;  1T6I A;  3M15 A;  4KBL A;  5L0H A;  1YZC A;  3EPV A;  4QI2 A;  1NBB A;  1Z6A A;  3GWN A;  3QVZ A;  5TJ5 E;  4KNW A;  3NYM A;  3ZG1 A;  3B0V C;  1ZU5 A;  5A6K A;  3T6J A;  5KYN A;  5KYX A;  5HSW A;  2M64 A;  1NFN A;  5JT4 A;  1S7Z A;  2D5R B;  3EH1 A;  2HMQ A;  2R7Q A;  4BG0 A;  5A6J A;  2CDQ A;  5A6B D;  1WGW A;  4MVU A;  2NPU A;  4WJ0 A;  1O5H A;  3L34 A;  4JEA A;  3SNH A;  1LKX A;  5CI9 A;  1EQ1 A; 
#chains in the Genus database with same CATH homology
 2J7P A;  5B1A C;  5L3V A;  4JJG A;  5DVW A;  3L0I A;  1MMN A;  1Z63 A;  3ZIB A;  5KYY B;  4YT5 A;  1TWA A;  4HE8 D;  3HJC A;  3FAJ A;  4ZLD A;  1TR2 A;  3EGD A;  5EHH A;  2WZF A;  3LLI A;  2Y69 C;  2KGO A;  2R7O A;  3AG2 C;  3GAN A;  1J8Y F;  4HFF B;  2J9V A;  3EGX B;  2YZS A;  3QMK A;  3RH3 A;  4E7S A;  3LNR A;  5E2Q A;  5KYW A;  5D91 A;  5B3S C;  1G8X A;  1ST6 A;  2Y3D A;  4CS8 C;  4YJW A;  2NUP A;  1OKK D;  2GFH A;  2ZXO A;  3W8H A;  3IEE A;  3N0T A;  3E70 C;  2XXA A;  3JSZ A;  5KYX B;  4IJJ A;  3AG1 C;  2M4E A;  3EFO B;  4OIQ F;  2R7T A;  4FES A;  4Q4Z F;  1VOM A;  2H7V C;  4HFK B;  4G7H F;  3KMI A;  3UR3 C;  3DAF A;  2J7P D;  2J0X A;  4EWC A;  2W4M A;  1JPJ A;  2Y3G A;  5DLJ A;  3MX3 A;  2PX0 A;  1MMD A;  4G0H A;  3EGD B;  3EHM A;  4OD5 A;  2CGE A;  2W4B A;  3UMI A;  1QLE C;  5D92 A;  4XTK A;  2L81 A;  1TWC A;  4P6I C;  2MYS A;  4I44 A;  1FFT C;  3X1O A;  3OEO A;  4RDA A;  5E3C A;  4JCH A;  3QZC A;  1M56 C;  5T3T A;  2Q9A A;  4KI2 A;  2IOQ A;  3K33 A;  2G62 A;  2WVN A;  4BJ1 A;  2XXA B;  3GOD A;  3UNG C;  2C04 A;  1NU7 D;  2EIL C;  4JUR I;  2VAS A;  3LES A;  4FX5 A;  1J8M F;  2WL8 A;  2R7R A;  2DYR C;  4YT8 A;  5FCL A;  1PD1 A;  4AK9 A;  2FGY A;  2A68 F;  3F47 A;  3Q6N A;  2LSE A;  2CNW A;  3Q7G A;  1ZHY A;  3WG7 C;  2R7V A;  3FHD A;  4O6Y A;  3S28 A;  3RYL A;  4BJ6 C;  4YN0 B;  1ZU4 A;  3FVY A;  3W2W A;  1W2W A;  4AX2 A;  3EJN A;  5BUO A;  4CSA C;  5KYU A;  4YWQ A;  2WVO A;  3CSK A;  2A6E F;  3AQC A;  4I1O B;  2A1D D;  1MMA A;  3S0X A;  1M2V A;  5T1D B;  3UGP A;  2L9J A;  1RJ9 A;  3O39 A;  5E3A A;  5F5F A;  2IXN A;  4RD9 A;  4K7B A;  2HV7 A;  1ZHW A;  1M2O A;  3B0U X;  2H7O A;  2H7B A;  2G3K A;  2ZXP A;  1MNE A;  2J45 A;  3DZA A;  4U5G A;  4CS9 C;  4G7Z F;  4XWJ A;  1IZM A;  1V55 C;  4CSA A;  4CIH A;  1TWG A;  4F4B A;  4YT2 A;  1NU9 C;  1ZHX A;  3Q7L A;  3T4R A;  3CQZ A;  3SZR A;  2PX3 A;  3JYH A;  4EBB A;  4PFP A;  4KNV A;  2R7X A;  1IW7 F;  1M57 C;  4OIR F;  3H65 A;  4U5F E;  3K1I C;  4BJT A;  2PP4 A;  2WB7 A;  1NZE A;  3EQL F;  3N2Z B;  4FWV A;  2NUT A;  3SEO A;  2EIK C;  5EGY A;  4BJ5 C;  4CS9 A;  1D0Y A;  4CS7 A;  2J0W A;  3LS0 A;  3S27 A;  5KYU B;  4C3B A;  5CI8 A;  3NG1 A;  3F46 A;  2PF4 E;  2R7W A;  3ASO C;  3DMD A;  1ZHT A;  3Q6M A;  1M2V B;  3HTK C;  4XLN F;  4CS8 A;  2R7U A;  2Q9C A;  2IYL D;  3NDB B;  1RJ9 B;  2ZXW C;  4IRU A;  4ULW A;  4LAC B;  3MLG A;  1FMV A;  2I8B A;  2KW3 C;  5T3W A;  4QDL A;  4GEH A;  1PD0 A;  3K6B A;  1OCO C;  4YT4 A;  3K1H A;  4LLE A;  4E7Z A;  3POV A;  2Q3T A;  4B6I A;  5DS5 A;  5B1B C;  3EZH A;  3ABK C;  4DVZ A;  3ABM C;  3O6X A;  4OD4 A;  4BJ5 A;  4I3M A;  5F5H A;  2YEV A;  5KYW B;  3FDQ A;  2W9Y A;  4N06 A;  1D0Z A;  3LS1 A;  4LLC A;  3W8I A;  3I4U A;  1Z3I X;  1KU2 A;  2IXM A;  4JW1 A;  2NUP B;  4DBR A;  1SMY F;  2PFD A;  3B9Q A;  3VYW A;  4GYT A;  3N24 A;  2QY9 A;  4PJL A;  3DM9 B;  1PCX A;  1ZHZ A;  2J9W A;  2Y3H A;  3JCU Q;  2R7S A;  2DYS C;  2W45 A;  1LVK A;  3CZ6 A;  3RKO F;  3T6B A;  3KH2 A;  2WZG A;  4C3E A;  1ZYR F;  2KQ9 A;  4PK4 A;  4G7O F;  5L3Q A;  1MMG A;  2J46 A;  2QTV A;  4M63 A;  2A6H F;  3UGO A;  2OG2 A;  3ITF A;  4JZA A;  3LEV A;  3RFY A;  4IWB A;  3KL4 A;  2V3C C;  2KNH A;  3DD7 A;  3JRT A;  2XL4 A;  3I5P A;  4MND A;  4DOZ A;  3RIP A;  3HLZ A;  4ZLC A;  2P7V A;  2C03 A;  3AG4 C;  1N1C A;  1D1B A;  2Q9B A;  3UMH A;  3NYL A;  2NG1 A;  2VB6 A;  4C7O A;  4XLP F;  2IXO A;  3EG9 A;  3ABL C;  4JVS A;  1OKK A;  2FFH A;  4IAO A;  2EIM C;  2EIJ C;  4HEA J;  3LJB A;  3PHF 2;  3OA1 A;  3W2V A;  1OCR C;  1BR2 A;  4KC9 A;  3NYJ A;  2VH3 A;  1D0X A;  4O79 A;  3EFO A;  4BJ6 A;  4O6N A;  3WOD F;  5DS6 A;  2ZXR A;  2B0J A;  3I5Q A;  4U5D E;  3SP1 A;  4Q7C A;  1D1C A;  3EZI A;  2WZL A;  3KKB A;  2DGJ A;  3OWT A;  2Y39 A;  2Y3B A;  1MND A;  3AG3 C;  3S29 A;  4MQ9 F;  4QI0 A;  4LER A;  4PJN A;  2CW0 F;  3NRH A;  2CNW D;  3M1C B;  4U5E E;  1OCC C;  3EH2 A;  4U5H A;  2J9U A;  1LS1 A;  4Q5S F;  2V26 A;  3PMR A;  3TD7 A;  1BR1 A;  4O6M A;  4A2N B;  4PJM A;  3DM5 A;  2JD3 A;  1VYK A;  4C3D A;  1NG1 A;  1VMA A;  4O7G A;  3SYN A;  4X0R A;  2IXP A;  1FFH A;  3V7O A;  1D1A A;  3ECS A;  4PJJ A;  4C7O B;  4BEJ A;  3EG9 B;  4K0D A;  2XRH A;  1Z5Z A;  3UMK A;  1O87 A;  2BE5 F;  1FMW A;  4AE4 A;  1VK5 A;  5IY5 C;  2G3V A;  3DJU B;  4J32 B;  4ANJ A;  3K7D A;  2YHS A;  3ZVR A;  1SF8 A;  4J30 B;  2X51 A;  4DBQ A;  5DQZ A;  3AQB A;  4NY3 A;  3VAY A;  1TKN A;  2Z15 A;  3LLK A;  2EIN C;  1JPN A;  4W8K A;  4JJF A;  2XSE A;  2ZPA A;  1VYI A;  3LAY A;  2MWQ A;  3DJN B;  3EHN A;  3K66 A;  4U5C E;  3X2Q C;  4DVY P;  3NKE A;  5DS4 A;  1V54 C;  5DQT A;  1TWH A;  3DXJ F;  3ZC4 A;  1Z23 A;  2NUT B;  4CBE A;  2P6V A;  2KJG A;  2E87 A;  3JT1 A;  3E9V A;  5KYY A;  1FTS A;  4OIO F;  4H4K C;  2A69 F;  2O9X A;  2WVQ A;  3B0P A;  4OIN F;  4OIP F;  5E33 A;  3EGX A;  4I1M A;  3ZSU A;  2HV6 A;  2OCC C;  1SZI A;  1BR4 A;  1OCZ C;  3NKD A;  4AE4 B;  4RBN A;  3ASN C;  4U5B E;  4PFO A;  3DAG A;  1QZX A;  4KBL A;  4QI2 A;  3EPV A;  1Z6A A;  3ZG1 A;  4KNW A;  3NYM A;  3B0V C;  1ZU5 A;  5KYN A;  3T6J A;  5KYX A;  5HSW A;  1S7Z A;  2D5R B;  3EH1 A;  2R7Q A;  4BG0 A;  2CDQ A;  1WGW A;  4WJ0 A;  1O5H A;  3L34 A;  3SNH A;  1LKX A;  5CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...