3ITFA

Structural basis for the inhibitory function of the cpxp adaptor protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Periplasmic adaptor protein cpxP
publication title Structural Basis for Two-component System Inhibition and Pilus Sensing by the Auxiliary CpxP Protein.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr.
total genus 34
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3itfA00
3EPVA 2Y3BA 2Y39A 2Y3DA 3QZCA 3ZG1A 2Y3GA 3LAYA 3OEOA 3ITFA 2Y3HA 3O39A
chains in the Genus database with same CATH superfamily
3DAFA 4KBLA 3UGOA 1A7DA 3DE8A 2IBFA 1Q0DA 1Z6AA 4NY3A 4PJLA 4KI2A 2YL3A 2HJ3A 1GM5A 1BBHA 2Q9BA 1ZHTA 2M4EA 4NCQA 1FFTC 2LK4A 3G50A 1YJGA 2VC9A 1D0YA 1HE9A 2XL6A 3C8GD 1BR1A 3LLIA 3JYHA 3AGUA 3QMKA 3U0CA 1BZ4A 1LM3B 1RCPA 4RDAA 1D0ZA 4F4BA 2ZXPA 3HNJA 2HV7A 3W4YA 3B0PA 2WVOA 2BL2A 1M2OA 5GPGB 5L0GA 2L81A 1EKYA 1MMGA 3B0UX 1DOWA 1UG7A 2XSEA 1RJ9A 1HY5A 2Q9CA 2ZD9A 3ABLC 4LLEA 4P9FA 1NG1A 3AQBA 4GQHA 1FMWA 3AG3C 1VLSA 3AG4C 3L34A 3EG9B 4JCHA 1TR2A 2XS8A 3LNRA 1T5OA 4DXWA 3LS1A 4OIRF 3L8IA 3V5YA 3FDQA 1Q0FA 3SXYA 4OIPF 1SR2A 1EA8A 1Z23A 2Z15A 2WZGA 1G8XA 3ECSA 2XRHA 3IQCA 3SZRA 5E3CA 5COFA 3ITFA 4FAPB 4UDVA 3K1IA 3FHDA 3O10A 4P9TA 5DLJA 1R4TA 3HLZA 4MVZA 4PK4A 3AJMA 1TWCA 4C3BA 4MVQA 2H7BA 4NC3A 4G7OF 3JTLO 2P61A 3T4RA 3X1OA 2PFDA 1RJ9B 1CGME 1LPEA 2EINC 3GWNA 3R2PA 1ORYA 3JRTA 1GGQA 3OA1A 4CS8A 2A68F 4MS2A 4CSAA 1NU7D 2EPNA 3C8GA 4JJFA 2KQ9A 2Y3HA 3AG2C 2PX3A 2HSQA 2Q00A 2O9XA 2QY9A 2XL4A 2YL0A 4I44A 2VH3A 2XLHA 2XM4A 1C02A 2NSFA 4NTFA 5A6BD 2R7WA 1JMWA 3KL4A 3PCVA 4U5DE 4DBRA 1ZVZA 2WZLA 4I3MA 4OIQF 4GYTA 4EWCA 3QVYA 4JTAB 2A6HF 4PJMA 4MVSA 2FAPB 4WGYA 4CIPA 3DJNB 4BJ5A 2DYRC 4XPXA 3VYWA 2KW3C 2PF4E 3KKBA 1N1CA 1T01A 4WGZA 2X0CA 2Y39A 2R7VA 1RKEA 3T6JA 3GM1A 2ICWG 2J45A 5L0CA 1ZW2A 3TOMA 2H7OA 1MNEA 2IXPA 1CPQA 1DOVA 5BQGA 3C8GB 4XLNF 5AC4A 1WATA 5L0IA 3MBGA 2C04A 2XL8A 3QZCA 5HSWA 1Q0GA 4PR9A 1YZAA 3RFYA 2KNHA 1NLXA 4X0RA 4LACB 2OOCA 3C63A 3MX3A 4HFKB 1ORJA 4JZAA 3N2ZB 2HSBA 4XPYA 3ZDLA 1TWHA 4BJTA 3EFOA 4JW1A 1WTYA 3ATPA 2IXNA 2LP4A 1MMAA 1K40A 4N06A 4U5HA 3RYLA 3IQTA 3KH2A 2TMVP 4Z9HA 3Q6NA 3K1HA 5A6AA 4LDQA 1GQAA 2UUHA 2BC5A 2RSEB 1JAFA 5JSLA 2DYSC 3DMDA 3QTHA 4JKVA 5F5HA 3U3FA 1RKEB 5BQHA 4YWQA 2P6VA 3SXZA 1HE1A 5COMA 5DQZA 3TOLA 5EHHA 3LUTB 5B3SC 4JTCB 1D1CA 2ASRA 3L8JA 3TK0A 4E7SA 1JRAA 1Q0KA 2AWYA 3JCUQ 1LE4A 2R7TA 4LLCA 3DE9A 3F46A 2R03A 4IGGA 3DWWA 2EILC 2NPUA 4MTGA 1FMVA 2ZXOA 1I4YA 3NKDA 1B68A 3LNMB 3AG1C 2XLEA 5JUAA 2M64A 1JPNA 4IRUA 2Y69C 4JCZA 3US6A 3GWLA 3FAPB 3JSZA 5KYUA 2ZXWC 4QI2A 1FTSA 4IAOA 4J7YA 4CS8C 1C17M 256BA 2A0BA 2YVKA 4YK5A 4YL1A 2PP4A 3SEOA 3U3BA 2NUPA 2L6HA 1U6HA 4I1OB 2HS5A 4IARA 1K04A 3C62A 3R7CA 5AC5A 3H65A 3PDMP 5EGYA 3S0XA 4EKWA 1QKRA 2Y3GA 3RKOF 3ZWIA 3NMIA 4BJ6A 1LVKA 3Q7LA 1JPJA 3EGDB 4E0HA 5A6JA 5L0HA 3VM6A 2A1DD 2GA0A 1IZMA 2EIMC 4JTDB 4KNWA 2CYDA 4J32B 2WL8A 4YT8A 5L3QA 1H9TA 3C18A 3KPHA 4U5FE 4Q5SF 1LI7A 3U8VA 1ZZPA 5KYUB 1SZIA 2A0UA 3FMSA 1ZU5A 2VCCA 3ZG1A 4D4XA 2LCHA 4WABA 3UMHA 5DS5A 3AQCA 1LS1A 3FAJA 3U5SA 4AX2A 4EIYA 4L6RA 3JRMO 2XLWA 5DS6A 3EH2A 3GANA 4AK9A 4NTBA 1TQGA 2XLOA 2YRFA 1M6TA 4O79A 2J0WA 3EG9A 4HE8D 1F1MA 3M79A 3RF3A 3EHNA 3J06A 3UNGC 3OWTA 2C03A 1LE2A 4CS9A 3AOUA 2ZPAA 1WWPA 2CW0F 1J8YF 2OJED 2WZFA 2KGOA 5D92A 1OCZC 4XTKA 3TD7A 3M4BA 2UUIA 4HEAJ 3G4ZA 1QLEC 5B1BC 3MLGA 4AE4A 4EBJA 1QZXA 2J0XA 1IW7F 2L6GA 1EI7A 1YA7O 1TKNA 3TQOA 3HKKA 1NBBA 3G4XA 1M2VA 3NYLA 3BEHA 1LKXA 4JURI 4OD4A 3KYIA 3FOOA 4MW8A 1BR4A 1OQCA 2CGEA 2RD9A 2PNOA 2IOQA 2QNLA 2AP3A 3DI5A 5T3WA 5L3VA 4MVMA 4G78A 1D1AA 1SYQA 3GM3A 5CIVA 4B6IA 1ZW3A 3DJUB 1Y6DA 4CS7A 4ULVA 5KYWA 1KNYA 1O5HA 2OU6A 3FOPA 1E83A 4AE4B 2NUTA 1U89A 1AUEA 4IAQA 4GEHA 3HNIA 4DRIB 3RW0A 5JLIA 1LI5A 1M2VB 1ORSC 2KSFA 1M56C 2A69F 2VB6A 2MYSA 1H6GA 4K7BA 1A7VA 3ASOC 4JJGA 2WB7A 1VMAA 4MQ9F 4JRZA 2VCAA 2OEVA 2YKZA 2OJQA 4U5GA 2L6FA 3RIPA 3ZTMA 2J7PD 4LDRA 3ASNC 3IHUA 3U8PA 1E86A 1ZHWA 1V4AA 2NG1A 3UMIA 5AGFA 2D5RB 1YDIA 3ABMC 4MVUA 2R02A 5KYWB 4CSAC 3NKEA 4BG0A 4ULWA 3IPMO 3FXHA 3V7OA 4O6YA 2NUTB 4JEAA 3B0VC 1NZEA 3RVYA 3SXMA 2YHSA 1S05A 1YARO 3F47A 1ZHZA 4XWJA 4YT2A 5JVEA 3AGTA 5A6KA 4CS9C 3IEEA 1MMNA 2CNWD 2HMQA 3WHNA 2JPUA 4BEJA 3K7DA 4K1OA 1T6UA 2R25A 3LEOA 1A41A 2XXAA 2YL1A 4PJNA 4KNVA 3CZ6A 3HTKC 4EHPA 4MVRA 2EPKX 2R7UA 3I5QA 1A7EA 4Q4ZF 4HFFB 4DRHB 1VK5A 1G4US 3QW1A 3W8IA 1TFKB 3S84A 1QVXA 1QSPA 5T1DB 3GEEA 2OQMA 1I5NA 1YLMA 3GM2A 3RQGA 3BRJA 3VAYA 3LEVA 3DKAA 2PBEA 4BEMJ 3A11A 3M1CB 2EIJC 1AVOB 4XQ1A 2J8WA 1SF8A 2EPMX 1E84A 3GODA 1O87A 1ZU4A 1NU9C 2R7OA 3DD7A 4XLPF 4PFPA 3SNHA 4K0DA 5A6BA 3PMRA 3EGDA 5BQIA 2DGJA 2J9WA 2X51A 4E7ZA 4G7ZF 1XWJA 3K1IC 2IM8A 3N24A 2H8AA 2XXAB 4ANJA 3NDBB 1PV3A 1VYKA 1BR2A 3A9CA 4ER9A 1LS4A 2W4BA 4PFOA 3RQEA 3PHF2 1WN0A 4IWBA 3UGPA 5D91A 4W8PA 2Q7RA 4OIOF 1A0BA 4H4KC 4I1MA 1HW2A 4ZLDA 2V3CC 1JOGA 1OCRC 2QTVA 2YLGA 3HNKA 2W9YA 3CEXA 4JEBA 4W8KA 1WGWA 3DAGA 2L9JA 4O7GA 4WJ0A 5KYXA 1D1BA 4LERA 1RKCA 1RXQA 2V26A 1MQVA 4JVSA 4N6HA 5DQTA 2YQYA 3W2WA 1HMOA 4JIOA 3U2MA 1APCA 1JR8A 2JX0A 5CI8A 3VRCA 4P6IC 2Y3BA 3ZC4A 1BDJB 4EUKB 1UFBA 4J30B 4BJ5C 5B3IA 1V54C 2MHRA 5KYNA 1YAUO 2BE5F 5JS5A 1CGOA 2FGYA 2KYHA 2WVQA 4O6NA 5E33A 4U9DA 3O6XA 3EH1A 4FX5A 4C3EA 3POVA 2R7XA 1QPUA 4D4NA 1HW1A 2VASA 4BPMA 4IJJA 3L0IA 1H7IA 1OKKD 1ZYRF 1NSGB 1OR2A 4JE9A 5E3AA 3U2LA 5FCLA 2XLMA 1T6QA 2OEXA 3KMIA 4ONSA 3ZVRA 3K6BA 1WOLA 2D4UA 2B0JA 2W4MA 1VB5A 3SXKA 2HFIA 5F5FA 2G62A 2ZXRA 4CDVA 1D0XA 4N6CA 3L1MA 3NMKA 3TJ6A 3U9MA 1H9GA 1OW7A 1YYJA 4G7HF 3QW0A 3LLKA 4J7TA 1ST6A 2G3VA 2YEVA 3B29A 3MYFA 2AWCA 5L0JA 1V74B 1OW8A 1XZPA 3JZ0A 3O55A 5T3TA 3EPVA 4IB4A 1SMYF 1WASA 5IY5C 4LDKA 4CX9A 3W2VA 1TFOB 5JRAA 1E85A 1XZQA 1CPRA 3RVZA 2CCYA 4EBKA 4C7OA 4YL0A 2YLIA 1KTMA 2B0HA 3KYJA 2KJGA 4OINF 1KU2A 2L7AA 3ZQVA 3X2QC 3T6BA 1OXKA 4MTFA 3SP1A 2J9BA 5EK0A 4MNDA 3LESA 1I4ZA 3B71A 3CSKA 2WVNA 4YL3A 5E2QA 4BJ6C 2F22A 5K0IA 1OKKA 2J9UA 3S9OA 1O3UA 3T6GB 3NMJA 4XEFA 3HJCA 5L0DA 3MYIA 2HMZA 3EJNA 2YZSA 3RQFA 2HZ8A 3DXJF 4CBEA 3LS0A 1FR0A 1OR3A 4U9EA 3ZTZA 1VYIA 4AL1A 4DVYP 4C7OB 4U5EE 4DJ9A 4ZLCA 3CQZA 3S27A 1YYXA 1OW6A 4YT4A 3I5PA 1NFOA 1EQ1A 1K05A 2HJMA 2P0NA 4XPWA 4CDAA 1S7ZA 4Z9IA 2YL7A 5JP7A 3SYNA 3V5XA 2A6EF 4C3DA 3MFNA 3EQLF 3E70C 1Z3IX 2LSEA 1Z7Qc 3O39A 2KK1A 3K33A 1Y4CA 3GORA 5B1AC 4KC9A 3WAQA 2MWQA 2P7VA 2EIKC 1YA9A 4MW3A 1Q0MA 2Q9AA 3ABKC 3ZSUA 1OCCC 4G0HA 3DM9B 5TJ5E 4DBQA 2R9RB 4E18A 2XLVA 4YN0B 1HMDA 2IYLD 4YJWA 1E2XA 3EZIA 4AL0A 1FFHA 4RD9A 1FAPB 3NYMA 3UMKA 2XS1A 1VTMP 3VF0A 1PD1A 3JYYA 3K66A 5COGA 1GS9A 2PX0A 3JT1A 3NRHA 3S28A 4NTAA 3FVYA 4M63A 2JD3A 2HUJA 3S29A 3WG7C 1PD0A 4JC7A 3WODF 5L0FA 2J9VA 5BUOA 3IQ5A 2NSGA 2R7QA 4R32A 3ZIBA 1TWGA 3IQ6A 2CDQA 4NQFA 2G3KA 2J7PA 4DVZA 4O6MA 3LAYA 3C8ZA 1V55C 3JSEO 3ZQYA 2GAQA 1W2WA 2DI3A 1LIHA 4PJJA 5KYXB 2XLDA 2QLAA 4BJ1A 2I8BA 1VOMA 4QDLA 4DOZA 5DS4A 3DZAA 1M57C 2KC3A 2IXOA 4PACA 5HV9A 4A4AA 3W8HA 1Z5ZA 3LJBA 4RBNA 1U0BB 2IXMA 2AU5A 4U5CE 2DB4A 5JT4A 2EPOA 1L7CA 2I15A 5DVWA 2R7RA 2QE9A 1J8MF 4N4WA 3GEHA 3S90A 2CNWA 2QUPA 3EZHA 2YWAA 1RMVA 1T9KA 1OXBA 3EGXA 4FWVA 1G5ZA 1QQ3A 2HKVA 3B9QA 4XEKA 3M4CA 2GFHA 3E9VA 1OCOC 4YT5A 5F28E 2FFHA 2LFFA 1AEPA 3CAXA 2EPLX 2LQGA 2W45A 4XEVA 3TJ5A 5KYYA 4H54A 3C7JA 3I4UA 1G4WR 1TWAA 3EHMA 3UR3C 2Y3DA 1VLTA 2LIGA 3Q6MA 4Z9JA 3TULA 4QI0A 3EFOB 2J46A 1MNDA 3Q7GA 1CGNA 2GWWA 5FZTA 2R7SA 2HV6A 4MVOA 1NFNA 2H7VC 3HNLA 3H2VA 1Z63A 1ZHYA 4U5BE 3GEIA 4EBBA 3NYJA 2XM0A 3H2UA 4E0IA 3V5ZA 2E87A 3N0TA 4OD5A 3U9JA 4CJGA 4MTOA 4CDYA 3EGXB 1C03A 1R5ID 2YLDA 3NG1A 2R05A 5CI9A 1T6IA 4Q7CA 1L3PA 2P1AA 4CJOA 5A69A 5KYYB 4E17A 2ETSA 2OKUA 2OG2A 3DM5A 1FNTc 4A2NB 1MMDA 3OEOA 2Q3TA 2VCBA 3M15A 1PCXA 3QVZA 4CIHA 1ZHXA 3RH3A 2LFDA 2AVKA 1YVIA 2Q4FA 4FESA 3T9OA 2NUPB 2GDCA 2LD6A 4DRJB 1YZCA 2OCCC
chains in the Genus database with same CATH topology
3DAFA 4KBLA 3UGOA 4PJLA 1Z6AA 4NY3A 4KI2A 2Q9BA 1ZHTA 2M4EA 1FFTC 1D0YA 1BR1A 3LLIA 3JYHA 3QMKA 4RDAA 1D0ZA 4F4BA 2ZXPA 2HV7A 3B0PA 2WVOA 1M2OA 2L81A 1MMGA 3B0UX 2XSEA 1RJ9A 2Q9CA 3ABLC 4LLEA 1NG1A 3AQBA 1FMWA 3AG3C 3AG4C 3L34A 3EG9B 4JCHA 1TR2A 3LNRA 3LS1A 4OIRF 3FDQA 4OIPF 1Z23A 2Z15A 2WZGA 1G8XA 3ECSA 2XRHA 3SZRA 5E3CA 3ITFA 3FHDA 5DLJA 3HLZA 4PK4A 1TWCA 4C3BA 2H7BA 4G7OF 3T4RA 3X1OA 2PFDA 1RJ9B 2EINC 4CS8A 3JRTA 3OA1A 4CSAA 2A68F 1NU7D 4JJFA 2KQ9A 2Y3HA 3AG2C 2PX3A 2QY9A 2O9XA 2XL4A 4I44A 5KYXA 2VH3A 2R7WA 3KL4A 4U5DE 4DBRA 4I3MA 2WZLA 4OIQF 4GYTA 4EWCA 2A6HF 4PJMA 3DJNB 4BJ5A 2DYRC 3VYWA 2KW3C 2PF4E 3KKBA 1N1CA 2Y39A 2R7VA 3T6JA 2J45A 2H7OA 1MNEA 2IXPA 4XLNF 2C04A 5HSWA 3QZCA 3RFYA 2KNHA 4X0RA 4LACB 3MX3A 4HFKB 4JZAA 3N2ZB 1TWHA 4BJTA 3EFOA 4JW1A 3RYLA 2IXNA 4N06A 1MMAA 4U5HA 3KH2A 3Q6NA 3K1HA 2DYSC 3DMDA 5F5HA 4YWQA 2P6VA 5DQZA 5EHHA 5B3SC 1D1CA 4E7SA 3JCUQ 2R7TA 4LLCA 3F46A 2EILC 1FMVA 2ZXOA 3NKDA 3AG1C 1JPNA 4IRUA 2Y69C 3JSZA 5KYUA 2ZXWC 4QI2A 1FTSA 4IAOA 4CS8C 2PP4A 3SEOA 2NUPA 4I1OB 3H65A 5EGYA 3S0XA 2Y3GA 3RKOF 4BJ6A 1LVKA 3Q7LA 1JPJA 3EGDB 2A1DD 1IZMA 2EIMC 4KNWA 4J32B 2WL8A 4YT8A 5L3QA 4U5FE 4Q5SF 5KYUB 1SZIA 3ZG1A 1ZU5A 3UMHA 5DS5A 3AQCA 1LS1A 3FAJA 4AX2A 5DS6A 3EH2A 3GANA 4AK9A 4O79A 2J0WA 3EG9A 4HE8D 3EHNA 3UNGC 3OWTA 2C03A 4CS9A 2ZPAA 2CW0F 1J8YF 2WZFA 2KGOA 5D92A 1OCZC 4XTKA 3TD7A 4HEAJ 1QLEC 5B1BC 3MLGA 4AE4A 1QZXA 2J0XA 1IW7F 1TKNA 1M2VA 3NYLA 4OD4A 1LKXA 4JURI 1BR4A 2CGEA 2IOQA 5T3WA 5L3VA 1D1AA 4B6IA 3DJUB 4CS7A 5KYWA 1O5HA 4AE4B 2NUTA 4GEHA 1M2VB 1M56C 2A69F 2VB6A 2MYSA 4K7BA 3ASOC 4JJGA 2WB7A 1VMAA 4MQ9F 4U5GA 3RIPA 2J7PD 3ASNC 1ZHWA 2NG1A 3UMIA 2D5RB 3ABMC 5KYWB 4CSAC 3NKEA 4BG0A 4ULWA 3V7OA 4O6YA 2NUTB 3B0VC 1NZEA 2YHSA 3F47A 1ZHZA 4XWJA 4YT2A 4CS9C 3IEEA 1MMNA 2CNWD 4BEJA 3K7DA 2XXAA 4PJNA 4KNVA 3CZ6A 3HTKC 2R7UA 3I5QA 4Q4ZF 4HFFB 1VK5A 3W8IA 5T1DB 3VAYA 3LEVA 3M1CB 2EIJC 1SF8A 3GODA 1O87A 1ZU4A 1NU9C 2R7OA 3DD7A 4XLPF 4PFPA 3SNHA 4K0DA 3PMRA 3EGDA 4G7ZF 2DGJA 2J9WA 2X51A 4E7ZA 2XXAB 3K1IC 3N24A 4ANJA 3NDBB 1VYKA 1BR2A 2W4BA 4PFOA 3PHF2 4IWBA 3UGPA 5D91A 4OIOF 4I1MA 4H4KC 4ZLDA 2V3CC 1OCRC 2QTVA 4W8KA 2W9YA 1WGWA 3DAGA 2L9JA 4O7GA 4WJ0A 1D1BA 4LERA 4JVSA 2V26A 5DQTA 3W2WA 5CI8A 4P6IC 2Y3BA 3ZC4A 4J30B 4BJ5C 1V54C 5KYNA 2BE5F 2FGYA 2WVQA 4O6NA 5E33A 3O6XA 3EH1A 4FX5A 4C3EA 3POVA 2R7XA 2VASA 4IJJA 3L0IA 1OKKD 1ZYRF 5E3AA 5FCLA 3KMIA 3ZVRA 3K6BA 2B0JA 2W4MA 5F5FA 2G62A 2ZXRA 1D0XA 4G7HF 3LLKA 1ST6A 2G3VA 2YEVA 5T3TA 3EPVA 1SMYF 5IY5C 3W2VA 4C7OA 2KJGA 4OINF 1KU2A 3X2QC 3T6BA 3SP1A 4MNDA 3LESA 3CSKA 2WVNA 5E2QA 4BJ6C 1OKKA 2J9UA 3HJCA 3EJNA 2YZSA 3DXJF 4CBEA 3LS0A 1VYIA 4DVYP 4C7OB 4U5EE 4ZLCA 3CQZA 3S27A 4YT4A 3I5PA 1S7ZA 3SYNA 4C3DA 2A6EF 3EQLF 3E70C 1Z3IX 2LSEA 3O39A 3K33A 5B1AC 4KC9A 2MWQA 2P7VA 2EIKC 2Q9AA 3ABKC 3ZSUA 1OCCC 4G0HA 3DM9B 4DBQA 4YN0B 4YJWA 2IYLD 3EZIA 1FFHA 4RD9A 3NYMA 3UMKA 1PD1A 3K66A 2PX0A 3JT1A 3S28A 3NRHA 3S29A 3FVYA 4M63A 2JD3A 3WG7C 1PD0A 3WODF 2J9VA 5BUOA 2R7QA 3ZIBA 1TWGA 2CDQA 2G3KA 2J7PA 4DVZA 4O6MA 3LAYA 1V55C 1W2WA 5KYXB 4BJ1A 2I8BA 1VOMA 4QDLA 4DOZA 5DS4A 3DZAA 1M57C 2IXOA 3W8HA 1Z5ZA 3LJBA 4RBNA 2IXMA 4U5CE 5DVWA 2R7RA 1J8MF 2CNWA 3EZHA 3EGXA 4FWVA 3B9QA 2GFHA 3E9VA 1OCOC 4YT5A 2FFHA 2W45A 5KYYA 3I4UA 1TWAA 3EHMA 3UR3C 2Y3DA 3Q6MA 4QI0A 3EFOB 2J46A 1MNDA 3Q7GA 2R7SA 2HV6A 2H7VC 1Z63A 1ZHYA 4U5BE 4EBBA 3NYJA 2E87A 3N0TA 4OD5A 3EGXB 3NG1A 5CI9A 4Q7CA 5KYYB 3DM5A 2OG2A 4A2NB 1MMDA 3OEOA 2Q3TA 1PCXA 4CIHA 1ZHXA 3RH3A 4FESA 2NUPB 4PJJA 2OCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EPV A;  2Y3B A;  2Y39 A;  2Y3D A;  3QZC A;  3ZG1 A;  2Y3G A;  3LAY A;  3OEO A;  3ITF A;  2Y3H A;  3O39 A; 
#chains in the Genus database with same CATH topology
 3DAF A;  4KBL A;  3UGO A;  1A7D A;  3DE8 A;  2IBF A;  1Q0D A;  1Z6A A;  4NY3 A;  4PJL A;  4KI2 A;  2YL3 A;  2HJ3 A;  1GM5 A;  1BBH A;  2Q9B A;  1ZHT A;  2M4E A;  4NCQ A;  1FFT C;  2LK4 A;  3G50 A;  1YJG A;  2VC9 A;  1D0Y A;  1HE9 A;  2XL6 A;  3C8G D;  1BR1 A;  3LLI A;  3JYH A;  3AGU A;  3QMK A;  3U0C A;  1BZ4 A;  1LM3 B;  1RCP A;  4RDA A;  1D0Z A;  4F4B A;  2ZXP A;  3HNJ A;  2HV7 A;  3W4Y A;  3B0P A;  2WVO A;  2BL2 A;  1M2O A;  5GPG B;  5L0G A;  2L81 A;  1EKY A;  1MMG A;  3B0U X;  1DOW A;  1UG7 A;  2XSE A;  1RJ9 A;  1HY5 A;  2Q9C A;  2ZD9 A;  3ABL C;  4LLE A;  4P9F A;  1NG1 A;  3AQB A;  4GQH A;  1FMW A;  3AG3 C;  1VLS A;  3AG4 C;  3L34 A;  3EG9 B;  4JCH A;  1TR2 A;  2XS8 A;  3LNR A;  1T5O A;  4DXW A;  3LS1 A;  4OIR F;  3L8I A;  3V5Y A;  3FDQ A;  1Q0F A;  3SXY A;  4OIP F;  1SR2 A;  1EA8 A;  1Z23 A;  2Z15 A;  2WZG A;  1G8X A;  3ECS A;  2XRH A;  3IQC A;  3SZR A;  5E3C A;  5COF A;  3ITF A;  4FAP B;  4UDV A;  3K1I A;  3FHD A;  3O10 A;  4P9T A;  5DLJ A;  1R4T A;  3HLZ A;  4MVZ A;  4PK4 A;  3AJM A;  1TWC A;  4C3B A;  4MVQ A;  2H7B A;  4NC3 A;  4G7O F;  3JTL O;  2P61 A;  3T4R A;  3X1O A;  2PFD A;  1RJ9 B;  1CGM E;  1LPE A;  2EIN C;  3GWN A;  3R2P A;  1ORY A;  3JRT A;  1GGQ A;  3OA1 A;  4CS8 A;  2A68 F;  4MS2 A;  4CSA A;  1NU7 D;  2EPN A;  3C8G A;  4JJF A;  2KQ9 A;  2Y3H A;  3AG2 C;  2PX3 A;  2HSQ A;  2Q00 A;  2O9X A;  2QY9 A;  2XL4 A;  2YL0 A;  4I44 A;  2VH3 A;  2XLH A;  2XM4 A;  1C02 A;  2NSF A;  4NTF A;  5A6B D;  2R7W A;  1JMW A;  3KL4 A;  3PCV A;  4U5D E;  4DBR A;  1ZVZ A;  2WZL A;  4I3M A;  4OIQ F;  4GYT A;  4EWC A;  3QVY A;  4JTA B;  2A6H F;  4PJM A;  4MVS A;  2FAP B;  4WGY A;  4CIP A;  3DJN B;  4BJ5 A;  2DYR C;  4XPX A;  3VYW A;  2KW3 C;  2PF4 E;  3KKB A;  1N1C A;  1T01 A;  4WGZ A;  2X0C A;  2Y39 A;  2R7V A;  1RKE A;  3T6J A;  3GM1 A;  2ICW G;  2J45 A;  5L0C A;  1ZW2 A;  3TOM A;  2H7O A;  1MNE A;  2IXP A;  1CPQ A;  1DOV A;  5BQG A;  3C8G B;  4XLN F;  5AC4 A;  1WAT A;  5L0I A;  3MBG A;  2C04 A;  2XL8 A;  3QZC A;  5HSW A;  1Q0G A;  4PR9 A;  1YZA A;  3RFY A;  2KNH A;  1NLX A;  4X0R A;  4LAC B;  2OOC A;  3C63 A;  3MX3 A;  4HFK B;  1ORJ A;  4JZA A;  3N2Z B;  2HSB A;  4XPY A;  3ZDL A;  1TWH A;  4BJT A;  3EFO A;  4JW1 A;  1WTY A;  3ATP A;  2IXN A;  2LP4 A;  1MMA A;  1K40 A;  4N06 A;  4U5H A;  3RYL A;  3IQT A;  3KH2 A;  2TMV P;  4Z9H A;  3Q6N A;  3K1H A;  5A6A A;  4LDQ A;  1GQA A;  2UUH A;  2BC5 A;  2RSE B;  1JAF A;  5JSL A;  2DYS C;  3DMD A;  3QTH A;  4JKV A;  5F5H A;  3U3F A;  1RKE B;  5BQH A;  4YWQ A;  2P6V A;  3SXZ A;  1HE1 A;  5COM A;  5DQZ A;  3TOL A;  5EHH A;  3LUT B;  5B3S C;  4JTC B;  1D1C A;  2ASR A;  3L8J A;  3TK0 A;  4E7S A;  1JRA A;  1Q0K A;  2AWY A;  3JCU Q;  1LE4 A;  2R7T A;  4LLC A;  3DE9 A;  3F46 A;  2R03 A;  4IGG A;  3DWW A;  2EIL C;  2NPU A;  4MTG A;  1FMV A;  2ZXO A;  1I4Y A;  3NKD A;  1B68 A;  3LNM B;  3AG1 C;  2XLE A;  5JUA A;  2M64 A;  1JPN A;  4IRU A;  2Y69 C;  4JCZ A;  3US6 A;  3GWL A;  3FAP B;  3JSZ A;  5KYU A;  2ZXW C;  4QI2 A;  1FTS A;  4IAO A;  4J7Y A;  4CS8 C;  1C17 M;  256B A;  2A0B A;  2YVK A;  4YK5 A;  4YL1 A;  2PP4 A;  3SEO A;  3U3B A;  2NUP A;  2L6H A;  1U6H A;  4I1O B;  2HS5 A;  4IAR A;  1K04 A;  3C62 A;  3R7C A;  5AC5 A;  3H65 A;  3PDM P;  5EGY A;  3S0X A;  4EKW A;  1QKR A;  2Y3G A;  3RKO F;  3ZWI A;  3NMI A;  4BJ6 A;  1LVK A;  3Q7L A;  1JPJ A;  3EGD B;  4E0H A;  5A6J A;  5L0H A;  3VM6 A;  2A1D D;  2GA0 A;  1IZM A;  2EIM C;  4JTD B;  4KNW A;  2CYD A;  4J32 B;  2WL8 A;  4YT8 A;  5L3Q A;  1H9T A;  3C18 A;  3KPH A;  4U5F E;  4Q5S F;  1LI7 A;  3U8V A;  1ZZP A;  5KYU B;  1SZI A;  2A0U A;  3FMS A;  1ZU5 A;  2VCC A;  3ZG1 A;  4D4X A;  2LCH A;  4WAB A;  3UMH A;  5DS5 A;  3AQC A;  1LS1 A;  3FAJ A;  3U5S A;  4AX2 A;  4EIY A;  4L6R A;  3JRM O;  2XLW A;  5DS6 A;  3EH2 A;  3GAN A;  4AK9 A;  4NTB A;  1TQG A;  2XLO A;  2YRF A;  1M6T A;  4O79 A;  2J0W A;  3EG9 A;  4HE8 D;  1F1M A;  3M79 A;  3RF3 A;  3EHN A;  3J06 A;  3UNG C;  3OWT A;  2C03 A;  1LE2 A;  4CS9 A;  3AOU A;  2ZPA A;  1WWP A;  2CW0 F;  1J8Y F;  2OJE D;  2WZF A;  2KGO A;  5D92 A;  1OCZ C;  4XTK A;  3TD7 A;  3M4B A;  2UUI A;  4HEA J;  3G4Z A;  1QLE C;  5B1B C;  3MLG A;  4AE4 A;  4EBJ A;  1QZX A;  2J0X A;  1IW7 F;  2L6G A;  1EI7 A;  1YA7 O;  1TKN A;  3TQO A;  3HKK A;  1NBB A;  3G4X A;  1M2V A;  3NYL A;  3BEH A;  1LKX A;  4JUR I;  4OD4 A;  3KYI A;  3FOO A;  4MW8 A;  1BR4 A;  1OQC A;  2CGE A;  2RD9 A;  2PNO A;  2IOQ A;  2QNL A;  2AP3 A;  3DI5 A;  5T3W A;  5L3V A;  4MVM A;  4G78 A;  1D1A A;  1SYQ A;  3GM3 A;  5CIV A;  4B6I A;  1ZW3 A;  3DJU B;  1Y6D A;  4CS7 A;  4ULV A;  5KYW A;  1KNY A;  1O5H A;  2OU6 A;  3FOP A;  1E83 A;  4AE4 B;  2NUT A;  1U89 A;  1AUE A;  4IAQ A;  4GEH A;  3HNI A;  4DRI B;  3RW0 A;  5JLI A;  1LI5 A;  1M2V B;  1ORS C;  2KSF A;  1M56 C;  2A69 F;  2VB6 A;  2MYS A;  1H6G A;  4K7B A;  1A7V A;  3ASO C;  4JJG A;  2WB7 A;  1VMA A;  4MQ9 F;  4JRZ A;  2VCA A;  2OEV A;  2YKZ A;  2OJQ A;  4U5G A;  2L6F A;  3RIP A;  3ZTM A;  2J7P D;  4LDR A;  3ASN C;  3IHU A;  3U8P A;  1E86 A;  1ZHW A;  1V4A A;  2NG1 A;  3UMI A;  5AGF A;  2D5R B;  1YDI A;  3ABM C;  4MVU A;  2R02 A;  5KYW B;  4CSA C;  3NKE A;  4BG0 A;  4ULW A;  3IPM O;  3FXH A;  3V7O A;  4O6Y A;  2NUT B;  4JEA A;  3B0V C;  1NZE A;  3RVY A;  3SXM A;  2YHS A;  1S05 A;  1YAR O;  3F47 A;  1ZHZ A;  4XWJ A;  4YT2 A;  5JVE A;  3AGT A;  5A6K A;  4CS9 C;  3IEE A;  1MMN A;  2CNW D;  2HMQ A;  3WHN A;  2JPU A;  4BEJ A;  3K7D A;  4K1O A;  1T6U A;  2R25 A;  3LEO A;  1A41 A;  2XXA A;  2YL1 A;  4PJN A;  4KNV A;  3CZ6 A;  3HTK C;  4EHP A;  4MVR A;  2EPK X;  2R7U A;  3I5Q A;  1A7E A;  4Q4Z F;  4HFF B;  4DRH B;  1VK5 A;  1G4U S;  3QW1 A;  3W8I A;  1TFK B;  3S84 A;  1QVX A;  1QSP A;  5T1D B;  3GEE A;  2OQM A;  1I5N A;  1YLM A;  3GM2 A;  3RQG A;  3BRJ A;  3VAY A;  3LEV A;  3DKA A;  2PBE A;  4BEM J;  3A11 A;  3M1C B;  2EIJ C;  1AVO B;  4XQ1 A;  2J8W A;  1SF8 A;  2EPM X;  1E84 A;  3GOD A;  1O87 A;  1ZU4 A;  1NU9 C;  2R7O A;  3DD7 A;  4XLP F;  4PFP A;  3SNH A;  4K0D A;  5A6B A;  3PMR A;  3EGD A;  5BQI A;  2DGJ A;  2J9W A;  2X51 A;  4E7Z A;  4G7Z F;  1XWJ A;  3K1I C;  2IM8 A;  3N24 A;  2H8A A;  2XXA B;  4ANJ A;  3NDB B;  1PV3 A;  1VYK A;  1BR2 A;  3A9C A;  4ER9 A;  1LS4 A;  2W4B A;  4PFO A;  3RQE A;  3PHF 2;  1WN0 A;  4IWB A;  3UGP A;  5D91 A;  4W8P A;  2Q7R A;  4OIO F;  1A0B A;  4H4K C;  4I1M A;  1HW2 A;  4ZLD A;  2V3C C;  1JOG A;  1OCR C;  2QTV A;  2YLG A;  3HNK A;  2W9Y A;  3CEX A;  4JEB A;  4W8K A;  1WGW A;  3DAG A;  2L9J A;  4O7G A;  4WJ0 A;  5KYX A;  1D1B A;  4LER A;  1RKC A;  1RXQ A;  2V26 A;  1MQV A;  4JVS A;  4N6H A;  5DQT A;  2YQY A;  3W2W A;  1HMO A;  4JIO A;  3U2M A;  1APC A;  1JR8 A;  2JX0 A;  5CI8 A;  3VRC A;  4P6I C;  2Y3B A;  3ZC4 A;  1BDJ B;  4EUK B;  1UFB A;  4J30 B;  4BJ5 C;  5B3I A;  1V54 C;  2MHR A;  5KYN A;  1YAU O;  2BE5 F;  5JS5 A;  1CGO A;  2FGY A;  2KYH A;  2WVQ A;  4O6N A;  5E33 A;  4U9D A;  3O6X A;  3EH1 A;  4FX5 A;  4C3E A;  3POV A;  2R7X A;  1QPU A;  4D4N A;  1HW1 A;  2VAS A;  4BPM A;  4IJJ A;  3L0I A;  1H7I A;  1OKK D;  1ZYR F;  1NSG B;  1OR2 A;  4JE9 A;  5E3A A;  3U2L A;  5FCL A;  2XLM A;  1T6Q A;  2OEX A;  3KMI A;  4ONS A;  3ZVR A;  3K6B A;  1WOL A;  2D4U A;  2B0J A;  2W4M A;  1VB5 A;  3SXK A;  2HFI A;  5F5F A;  2G62 A;  2ZXR A;  4CDV A;  1D0X A;  4N6C A;  3L1M A;  3NMK A;  3TJ6 A;  3U9M A;  1H9G A;  1OW7 A;  1YYJ A;  4G7H F;  3QW0 A;  3LLK A;  4J7T A;  1ST6 A;  2G3V A;  2YEV A;  3B29 A;  3MYF A;  2AWC A;  5L0J A;  1V74 B;  1OW8 A;  1XZP A;  3JZ0 A;  3O55 A;  5T3T A;  3EPV A;  4IB4 A;  1SMY F;  1WAS A;  5IY5 C;  4LDK A;  4CX9 A;  3W2V A;  1TFO B;  5JRA A;  1E85 A;  1XZQ A;  1CPR A;  3RVZ A;  2CCY A;  4EBK A;  4C7O A;  4YL0 A;  2YLI A;  1KTM A;  2B0H A;  3KYJ A;  2KJG A;  4OIN F;  1KU2 A;  2L7A A;  3ZQV A;  3X2Q C;  3T6B A;  1OXK A;  4MTF A;  3SP1 A;  2J9B A;  5EK0 A;  4MND A;  3LES A;  1I4Z A;  3B71 A;  3CSK A;  2WVN A;  4YL3 A;  5E2Q A;  4BJ6 C;  2F22 A;  5K0I A;  1OKK A;  2J9U A;  3S9O A;  1O3U A;  3T6G B;  3NMJ A;  4XEF A;  3HJC A;  5L0D A;  3MYI A;  2HMZ A;  3EJN A;  2YZS A;  3RQF A;  2HZ8 A;  3DXJ F;  4CBE A;  3LS0 A;  1FR0 A;  1OR3 A;  4U9E A;  3ZTZ A;  1VYI A;  4AL1 A;  4DVY P;  4C7O B;  4U5E E;  4DJ9 A;  4ZLC A;  3CQZ A;  3S27 A;  1YYX A;  1OW6 A;  4YT4 A;  3I5P A;  1NFO A;  1EQ1 A;  1K05 A;  2HJM A;  2P0N A;  4XPW A;  4CDA A;  1S7Z A;  4Z9I A;  2YL7 A;  5JP7 A;  3SYN A;  3V5X A;  2A6E F;  4C3D A;  3MFN A;  3EQL F;  3E70 C;  1Z3I X;  2LSE A;  1Z7Q c;  3O39 A;  2KK1 A;  3K33 A;  1Y4C A;  3GOR A;  5B1A C;  4KC9 A;  3WAQ A;  2MWQ A;  2P7V A;  2EIK C;  1YA9 A;  4MW3 A;  1Q0M A;  2Q9A A;  3ABK C;  3ZSU A;  1OCC C;  4G0H A;  3DM9 B;  5TJ5 E;  4DBQ A;  2R9R B;  4E18 A;  2XLV A;  4YN0 B;  1HMD A;  2IYL D;  4YJW A;  1E2X A;  3EZI A;  4AL0 A;  1FFH A;  4RD9 A;  1FAP B;  3NYM A;  3UMK A;  2XS1 A;  1VTM P;  3VF0 A;  1PD1 A;  3JYY A;  3K66 A;  5COG A;  1GS9 A;  2PX0 A;  3JT1 A;  3NRH A;  3S28 A;  4NTA A;  3FVY A;  4M63 A;  2JD3 A;  2HUJ A;  3S29 A;  3WG7 C;  1PD0 A;  4JC7 A;  3WOD F;  5L0F A;  2J9V A;  5BUO A;  3IQ5 A;  2NSG A;  2R7Q A;  4R32 A;  3ZIB A;  1TWG A;  3IQ6 A;  2CDQ A;  4NQF A;  2G3K A;  2J7P A;  4DVZ A;  4O6M A;  3LAY A;  3C8Z A;  1V55 C;  3JSE O;  3ZQY A;  2GAQ A;  1W2W A;  2DI3 A;  1LIH A;  4PJJ A;  5KYX B;  2XLD A;  2QLA A;  4BJ1 A;  2I8B A;  1VOM A;  4QDL A;  4DOZ A;  5DS4 A;  3DZA A;  1M57 C;  2KC3 A;  2IXO A;  4PAC A;  5HV9 A;  4A4A A;  3W8H A;  1Z5Z A;  3LJB A;  4RBN A;  1U0B B;  2IXM A;  2AU5 A;  4U5C E;  2DB4 A;  5JT4 A;  2EPO A;  1L7C A;  2I15 A;  5DVW A;  2R7R A;  2QE9 A;  1J8M F;  4N4W A;  3GEH A;  3S90 A;  2CNW A;  2QUP A;  3EZH A;  2YWA A;  1RMV A;  1T9K A;  1OXB A;  3EGX A;  4FWV A;  1G5Z A;  1QQ3 A;  2HKV A;  3B9Q A;  4XEK A;  3M4C A;  2GFH A;  3E9V A;  1OCO C;  4YT5 A;  5F28 E;  2FFH A;  2LFF A;  1AEP A;  3CAX A;  2EPL X;  2LQG A;  2W45 A;  4XEV A;  3TJ5 A;  5KYY A;  4H54 A;  3C7J A;  3I4U A;  1G4W R;  1TWA A;  3EHM A;  3UR3 C;  2Y3D A;  1VLT A;  2LIG A;  3Q6M A;  4Z9J A;  3TUL A;  4QI0 A;  3EFO B;  2J46 A;  1MND A;  3Q7G A;  1CGN A;  2GWW A;  5FZT A;  2R7S A;  2HV6 A;  4MVO A;  1NFN A;  2H7V C;  3HNL A;  3H2V A;  1Z63 A;  1ZHY A;  4U5B E;  3GEI A;  4EBB A;  3NYJ A;  2XM0 A;  3H2U A;  4E0I A;  3V5Z A;  2E87 A;  3N0T A;  4OD5 A;  3U9J A;  4CJG A;  4MTO A;  4CDY A;  3EGX B;  1C03 A;  1R5I D;  2YLD A;  3NG1 A;  2R05 A;  5CI9 A;  1T6I A;  4Q7C A;  1L3P A;  2P1A A;  4CJO A;  5A69 A;  5KYY B;  4E17 A;  2ETS A;  2OKU A;  2OG2 A;  3DM5 A;  1FNT c;  4A2N B;  1MMD A;  3OEO A;  2Q3T A;  2VCB A;  3M15 A;  1PCX A;  3QVZ A;  4CIH A;  1ZHX A;  3RH3 A;  2LFD A;  2AVK A;  1YVI A;  2Q4F A;  4FES A;  3T9O A;  2NUP B;  2GDC A;  2LD6 A;  4DRJ B;  1YZC A;  2OCC C; 
#chains in the Genus database with same CATH homology
 3DAF A;  4KBL A;  3UGO A;  4PJL A;  1Z6A A;  4NY3 A;  4KI2 A;  2Q9B A;  1ZHT A;  2M4E A;  1FFT C;  1D0Y A;  1BR1 A;  3LLI A;  3JYH A;  3QMK A;  4RDA A;  1D0Z A;  4F4B A;  2ZXP A;  2HV7 A;  3B0P A;  2WVO A;  1M2O A;  2L81 A;  1MMG A;  3B0U X;  2XSE A;  1RJ9 A;  2Q9C A;  3ABL C;  4LLE A;  1NG1 A;  3AQB A;  1FMW A;  3AG3 C;  3AG4 C;  3L34 A;  3EG9 B;  4JCH A;  1TR2 A;  3LNR A;  3LS1 A;  4OIR F;  3FDQ A;  4OIP F;  1Z23 A;  2Z15 A;  2WZG A;  1G8X A;  3ECS A;  2XRH A;  3SZR A;  5E3C A;  3ITF A;  3FHD A;  5DLJ A;  3HLZ A;  4PK4 A;  1TWC A;  4C3B A;  2H7B A;  4G7O F;  3T4R A;  3X1O A;  2PFD A;  1RJ9 B;  2EIN C;  4CS8 A;  3JRT A;  3OA1 A;  4CSA A;  2A68 F;  1NU7 D;  4JJF A;  2KQ9 A;  2Y3H A;  3AG2 C;  2PX3 A;  2QY9 A;  2O9X A;  2XL4 A;  4I44 A;  5KYX A;  2VH3 A;  2R7W A;  3KL4 A;  4U5D E;  4DBR A;  4I3M A;  2WZL A;  4OIQ F;  4GYT A;  4EWC A;  2A6H F;  4PJM A;  3DJN B;  4BJ5 A;  2DYR C;  3VYW A;  2KW3 C;  2PF4 E;  3KKB A;  1N1C A;  2Y39 A;  2R7V A;  3T6J A;  2J45 A;  2H7O A;  1MNE A;  2IXP A;  4XLN F;  2C04 A;  5HSW A;  3QZC A;  3RFY A;  2KNH A;  4X0R A;  4LAC B;  3MX3 A;  4HFK B;  4JZA A;  3N2Z B;  1TWH A;  4BJT A;  3EFO A;  4JW1 A;  3RYL A;  2IXN A;  4N06 A;  1MMA A;  4U5H A;  3KH2 A;  3Q6N A;  3K1H A;  2DYS C;  3DMD A;  5F5H A;  4YWQ A;  2P6V A;  5DQZ A;  5EHH A;  5B3S C;  1D1C A;  4E7S A;  3JCU Q;  2R7T A;  4LLC A;  3F46 A;  2EIL C;  1FMV A;  2ZXO A;  3NKD A;  3AG1 C;  1JPN A;  4IRU A;  2Y69 C;  3JSZ A;  5KYU A;  2ZXW C;  4QI2 A;  1FTS A;  4IAO A;  4CS8 C;  2PP4 A;  3SEO A;  2NUP A;  4I1O B;  3H65 A;  5EGY A;  3S0X A;  2Y3G A;  3RKO F;  4BJ6 A;  1LVK A;  3Q7L A;  1JPJ A;  3EGD B;  2A1D D;  1IZM A;  2EIM C;  4KNW A;  4J32 B;  2WL8 A;  4YT8 A;  5L3Q A;  4U5F E;  4Q5S F;  5KYU B;  1SZI A;  3ZG1 A;  1ZU5 A;  3UMH A;  5DS5 A;  3AQC A;  1LS1 A;  3FAJ A;  4AX2 A;  5DS6 A;  3EH2 A;  3GAN A;  4AK9 A;  4O79 A;  2J0W A;  3EG9 A;  4HE8 D;  3EHN A;  3UNG C;  3OWT A;  2C03 A;  4CS9 A;  2ZPA A;  2CW0 F;  1J8Y F;  2WZF A;  2KGO A;  5D92 A;  1OCZ C;  4XTK A;  3TD7 A;  4HEA J;  1QLE C;  5B1B C;  3MLG A;  4AE4 A;  1QZX A;  2J0X A;  1IW7 F;  1TKN A;  1M2V A;  3NYL A;  4OD4 A;  1LKX A;  4JUR I;  1BR4 A;  2CGE A;  2IOQ A;  5T3W A;  5L3V A;  1D1A A;  4B6I A;  3DJU B;  4CS7 A;  5KYW A;  1O5H A;  4AE4 B;  2NUT A;  4GEH A;  1M2V B;  1M56 C;  2A69 F;  2VB6 A;  2MYS A;  4K7B A;  3ASO C;  4JJG A;  2WB7 A;  1VMA A;  4MQ9 F;  4U5G A;  3RIP A;  2J7P D;  3ASN C;  1ZHW A;  2NG1 A;  3UMI A;  2D5R B;  3ABM C;  5KYW B;  4CSA C;  3NKE A;  4BG0 A;  4ULW A;  3V7O A;  4O6Y A;  2NUT B;  3B0V C;  1NZE A;  2YHS A;  3F47 A;  1ZHZ A;  4XWJ A;  4YT2 A;  4CS9 C;  3IEE A;  1MMN A;  2CNW D;  4BEJ A;  3K7D A;  2XXA A;  4PJN A;  4KNV A;  3CZ6 A;  3HTK C;  2R7U A;  3I5Q A;  4Q4Z F;  4HFF B;  1VK5 A;  3W8I A;  5T1D B;  3VAY A;  3LEV A;  3M1C B;  2EIJ C;  1SF8 A;  3GOD A;  1O87 A;  1ZU4 A;  1NU9 C;  2R7O A;  3DD7 A;  4XLP F;  4PFP A;  3SNH A;  4K0D A;  3PMR A;  3EGD A;  4G7Z F;  2DGJ A;  2J9W A;  2X51 A;  4E7Z A;  2XXA B;  3K1I C;  3N24 A;  4ANJ A;  3NDB B;  1VYK A;  1BR2 A;  2W4B A;  4PFO A;  3PHF 2;  4IWB A;  3UGP A;  5D91 A;  4OIO F;  4I1M A;  4H4K C;  4ZLD A;  2V3C C;  1OCR C;  2QTV A;  4W8K A;  2W9Y A;  1WGW A;  3DAG A;  2L9J A;  4O7G A;  4WJ0 A;  1D1B A;  4LER A;  4JVS A;  2V26 A;  5DQT A;  3W2W A;  5CI8 A;  4P6I C;  2Y3B A;  3ZC4 A;  4J30 B;  4BJ5 C;  1V54 C;  5KYN A;  2BE5 F;  2FGY A;  2WVQ A;  4O6N A;  5E33 A;  3O6X A;  3EH1 A;  4FX5 A;  4C3E A;  3POV A;  2R7X A;  2VAS A;  4IJJ A;  3L0I A;  1OKK D;  1ZYR F;  5E3A A;  5FCL A;  3KMI A;  3ZVR A;  3K6B A;  2B0J A;  2W4M A;  5F5F A;  2G62 A;  2ZXR A;  1D0X A;  4G7H F;  3LLK A;  1ST6 A;  2G3V A;  2YEV A;  5T3T A;  3EPV A;  1SMY F;  5IY5 C;  3W2V A;  4C7O A;  2KJG A;  4OIN F;  1KU2 A;  3X2Q C;  3T6B A;  3SP1 A;  4MND A;  3LES A;  3CSK A;  2WVN A;  5E2Q A;  4BJ6 C;  1OKK A;  2J9U A;  3HJC A;  3EJN A;  2YZS A;  3DXJ F;  4CBE A;  3LS0 A;  1VYI A;  4DVY P;  4C7O B;  4U5E E;  4ZLC A;  3CQZ A;  3S27 A;  4YT4 A;  3I5P A;  1S7Z A;  3SYN A;  4C3D A;  2A6E F;  3EQL F;  3E70 C;  1Z3I X;  2LSE A;  3O39 A;  3K33 A;  5B1A C;  4KC9 A;  2MWQ A;  2P7V A;  2EIK C;  2Q9A A;  3ABK C;  3ZSU A;  1OCC C;  4G0H A;  3DM9 B;  4DBQ A;  4YN0 B;  4YJW A;  2IYL D;  3EZI A;  1FFH A;  4RD9 A;  3NYM A;  3UMK A;  1PD1 A;  3K66 A;  2PX0 A;  3JT1 A;  3S28 A;  3NRH A;  3S29 A;  3FVY A;  4M63 A;  2JD3 A;  3WG7 C;  1PD0 A;  3WOD F;  2J9V A;  5BUO A;  2R7Q A;  3ZIB A;  1TWG A;  2CDQ A;  2G3K A;  2J7P A;  4DVZ A;  4O6M A;  3LAY A;  1V55 C;  1W2W A;  5KYX B;  4BJ1 A;  2I8B A;  1VOM A;  4QDL A;  4DOZ A;  5DS4 A;  3DZA A;  1M57 C;  2IXO A;  3W8H A;  1Z5Z A;  3LJB A;  4RBN A;  2IXM A;  4U5C E;  5DVW A;  2R7R A;  1J8M F;  2CNW A;  3EZH A;  3EGX A;  4FWV A;  3B9Q A;  2GFH A;  3E9V A;  1OCO C;  4YT5 A;  2FFH A;  2W45 A;  5KYY A;  3I4U A;  1TWA A;  3EHM A;  3UR3 C;  2Y3D A;  3Q6M A;  4QI0 A;  3EFO B;  2J46 A;  1MND A;  3Q7G A;  2R7S A;  2HV6 A;  2H7V C;  1Z63 A;  1ZHY A;  4U5B E;  4EBB A;  3NYJ A;  2E87 A;  3N0T A;  4OD5 A;  3EGX B;  3NG1 A;  5CI9 A;  4Q7C A;  5KYY B;  3DM5 A;  2OG2 A;  4A2N B;  1MMD A;  3OEO A;  2Q3T A;  1PCX A;  4CIH A;  1ZHX A;  3RH3 A;  4FES A;  2NUP B;  4PJJ A;  2OCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...