3ITFA

Structural basis for the inhibitory function of the cpxp adaptor protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic adaptor protein cpxP
publication title Structural Basis for Two-component System Inhibition and Pilus Sensing by the Auxiliary CpxP Protein.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr.
molecule tags Signaling protein
total genus 34
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3itfA00
3O39A 3ZG1A 3ITFA 3LAYA 3QZCA 2Y39A 2Y3BA 2Y3DA 2Y3GA 2Y3HA 3OEOA 3EPVA
chains in the Genus database with same CATH superfamily
2OJED 1HMOA 4OIQF 4E0HA 5JS5A 1LI7A 2R7UA 1VOMA 5L3QA 3OEOA 4UDVA 2IBFA 1NU7D 4ULWA 5A6AA 3CZ6A 4CS8C 1LPEA 1E85A 1Z5ZA 2IXNA 3EGXA 3FOPA 2R7VA 2YZSA 2WB7A 1YZAA 2YRFA 4JEBA 1GQAA 2NUTB 4JJGA 4DXWA 3L34A 1H9TA 1FTSA 2D4UA 4BJTA 3SXYA 4CDYA 3QZCA 3ZQYA 4D4NA 3TK0A 4MW3A 5K0IA 5BQHA 3B0PA 4KNWA 4N6HA 4U5GA 3DM9B 4YL3A 3UR3C 4OIRF 1YA7O 2QLAA 2H7BA 3PHF2 1G5ZA 2R7OA 3JSEO 2LIGA 5KYXB 1E84A 1RMVA 3US6A 1ZHTA 5KYUB 2AU5A 4MVRA 4PK4A 3AG1C 1VYIA 4XPXA 3I5PA 3TOMA 1C02A 2KNHA 1LS1A 5E2QA 3LLKA 1VLTA 3ZVRA 2L81A 4AE4B 2HMZA 4CS7A 3F47A 3Q6MA 1SYQA 1TFOB 1FAPB 2ASRA 3QTHA 4JRZA 4N6CA 3JCUQ 2W4MA 3O55A 4OINF 4P9TA 4Q4ZF 4O6NA 1OQCA 5F5HA 5DQZA 3TULA 4FX5A 4W8PA 2A0UA 5JSLA 3RYLA 3T4RA 3V7OA 4JKVA 4DRJB 1MNEA 1OW8A 3BRJA 3AQCA 4G78A 3U2MA 1TWAA 3DZAA 4DRIB 2R7WA 2RD9A 2YL1A 3EGDA 3LEVA 3RH3A 2J9UA 5A69A 3GEHA 1O5HA 5KYWB 1D1BA 1JPNA 1YA9A 3HLZA 2DYRC 1OCRC 4MTGA 1PD1A 3AG4C 2P7VA 2XLMA 1VK5A 2M4EA 3O10A 2X51A 1OW6A 3CQZA 3JRTA 1YYXA 4LLEA 1YJGA 3BEHA 3GM1A 4MVZA 3U8PA 4YT2A 1NLXA 1YLMA 1FMWA 1OR3A 2MHRA 3EZIA 3SYNA 5F5FA 5KYYA 1YYJA 1TKNA 3SEOA 3W2WA 3VRCA 2MYSA 5T3TA 2J45A 2WL8A 3NYMA 2J9BA 3Q6NA 4OIPF 3ZQVA 1G8XA 1FR0A 2GA0A 1E83A 3EH1A 4K7BA 1NSGB 3C8ZA 1M56C 1AEPA 2EPLX 5F28E 1SR2A 3NDBB 3S28A 2Q9AA 4XLNF 3L0IA 4CS8A 2A6HF 5CIVA 1L3PA 4JCZA 4J7TA 1C03A 5COMA 2XL8A 1D0XA 2NUPB 1LI5A 1V54C 4I3MA 3FVYA 3SXMA 4EBJA 2R7TA 2MWQA 3WODF 2R25A 3JRMO 2GAQA 4OD4A 2HV7A 4JZAA 3FDQA 4JW1A 1CGME 1OCZC 1PCXA 3EZHA 2JX0A 3MYIA 3AGTA 2H7VC 3UMIA 2A68F 2EILC 3C62A 3M1CB 1ZYRF 4R32A 3ATPA 3FAPB 3H2UA 1FMVA 3ZG1A 2B0HA 1QQ3A 4L6RA 2QE9A 1G4WR 1I4YA 3AOUA 4JURI 4YJWA 3PCVA 4WGZA 3U0CA 1Q0DA 4PACA 2WZFA 1TQGA 1KTMA 1ORYA 3RW0A 5EK0A 3JTLO 4D4XA 4CIHA 2FFHA 1T01A 2PP4A 5L0DA 4JTCB 2V3CC 4W8KA 2VH3A 1O3UA 4ONSA 1DOWA 4CBEA 4XEFA 4MVUA 3C8GA 1Y6DA 4NY3A 4A2NB 4AL1A 1XWJA 1H7IA 1I4ZA 3W4YA 3ZIBA 1A7DA 2W45A 3GM2A 1VTMP 2YL7A 1F1MA 3KYJA 4PJJA 1CPQA 4E7SA 3LNMB 4M63A 4U9EA 2VC9A 2B0JA 1J8MF 4YN0B 1W2WA 3C8GD 1QSPA 3S29A 1JMWA 3V5ZA 4XPYA 1QZXA 1V4AA 4I1MA 4N4WA 5B1AC 3WAQA 4A4AA 1T6QA 4B6IA 3HKKA 3Q7GA 4E17A 4OIOF 2IXPA 3LUTB 4KNVA 3DAGA 2UUIA 1EI7A 2YVKA 2XM4A 1M2VB 1MQVA 4U9DA 3KYIA 3U9JA 3L8IA 3DWWA 1OKKA 3I5QA 4C3EA 4BEMJ 1KNYA 4JCHA 5KYNA 4YWQA 1YZCA 3B0UX 3LS1A 3B9QA 1RKEA 3QVZA 2LFFA 2HUJA 1GS9A 5D92A 3TD7A 3T6JA 2DYSC 5JUAA 4C7OB 4U5CE 5L0GA 5DLJA 1GM5A 1JAFA 4JTDB 3V5YA 3B0VC 2R02A 3ABLC 1JOGA 1OKKD 3K6BA 5COGA 4YT8A 1C17M 1CGOA 4WABA 5A6JA 5AC4A 1YAUO 4CDVA 3KKBA 2WZGA 3QW0A 4BG0A 1ZHYA 4HFFB 1SMYF 2OU6A 4MTOA 2KC3A 3ZTZA 4CJGA 5DS6A 4G7ZF 5E33A 3POVA 3RQFA 4JJFA 1PD0A 2WVQA 4BJ6C 1ZHXA 3EJNA 1KU2A 5JLIA 3RQGA 4HFKB 3K66A 3VAYA 4FWVA 4U5EE 4G7OF 3N0TA 1NU9C 2C03A 1CPRA 3FXHA 1A41A 2H8AA 3IEEA 3K1IC 4PJLA 2Y3HA 4EBBA 4MVSA 2A6EF 4QI0A 2QY9A 3ABMC 3M4BA 1U89A 2ETSA 3DI5A 3O39A 4FESA 2E87A 4GQHA 4LLCA 4DOZA 5B3IA 5IY5C 2UUHA 1JR8A 3EFOA 3MX3A 1T6IA 4MNDA 4MQ9F 4YK5A 4EHPA 1WTYA 2Y3GA 2ZXOA 2OG2A 4EUKB 1NBBA 1NFOA 3QW1A 4IAOA 4U5DE 4O7GA 3ZTMA 3U3FA 2G3KA 4FAPB 3AJMA 2DB4A 2KW3C 3EG9A 1D0YA 3N2ZB 4U5BE 2L6HA 3ZC4A 5L0FA 1NZEA 2WVNA 2R03A 3PMRA 4LDRA 2PFDA 1CGNA 3J06A 4ZLDA 1MMDA 3TQOA 3T6GB 3LJBA 1HE9A 1FFHA 3DE8A 1XZPA 3GWLA 3I4UA 1D0ZA 1RCPA 2OKUA 4Z9JA 5L0JA 3JYYA 1LM3B 1RJ9A 1I5NA 5HSWA 4KBLA 2HKVA 3DJNB 2EPOA 3FAJA 2LK4A 2Z15A 4O6YA 5AGFA 1QLEC 5L0CA 2P6VA 1VLSA 2J8WA 2XLDA 2HFIA 4XEVA 2Q00A 3KMIA 4NTBA 3ZWIA 4U5FE 1VB5A 2V26A 3EHNA 3T6BA 2L6GA 4AK9A 3N24A 1DOVA 1BR1A 1D1AA 3EPVA 4JE9A 2NSGA 2NPUA 5JRAA 4I44A 3LLIA 4HEAJ 1MNDA 1ZW2A 2ZD9A 3C63A 2L9JA 5HV9A 1ZHWA 2VASA 3EH2A 3JYHA 4ZLCA 3C8GB 2BC5A 3QVYA 4IRUA 5JP7A 2KYHA 4RDAA 2I8BA 4BJ1A 3ASNC 2PX3A 2NUTA 3E70C 4U5HA 4MVQA 5CI9A 1WOLA 3HJCA 5EGYA 1BBHA 2AWYA 1IW7F 2YLGA 4IARA 1WN0A 2Q3TA 4H54A 1Q0MA 3G4XA 4BJ5C 2IXMA 4CIPA 2HJ3A 3U5SA 5KYXA 2D5RB 3LS0A 3GWNA 3JZ0A 4DRHB 4E7ZA 3K1IA 2XXAB 5KYUA 4G7HF 3C18A 2IOQA 4K1OA 5T3WA 1V55C 5L3VA 4MVOA 3NKDA 1U6HA 3W8IA 1M2OA 3H2VA 4AE4A 2M64A 4NQFA 2WVOA 1WWPA 2W9YA 4KC9A 2FAPB 2VCAA 4XWJA 1ORJA 2JD3A 5TJ5E 2L6FA 1R4TA 4NTFA 3UNGC 3C7JA 3NMKA 2PNOA 4O6MA 3IPMO 3EHMA 1Z23A 3KH2A 3IHUA 4LACB 1N1CA 2J46A 3B29A 3DE9A 3DD7A 3EGXB 3S90A 4QI2A 2A69F 4PR9A 3LEOA 3O6XA 5L0IA 2QUPA 2XL6A 5KYWA 2LFDA 3ZSUA 3E9VA 3TJ5A 2Q9CA 3IQCA 1XZQA 2A0BA 1A7EA 4E0IA 1OXKA 5KYYB 2GFHA 3DKAA 2H7OA 2O9XA 2HSBA 4N06A 3L1MA 5GPGB 2R05A 4LERA 1BDJB 1NFNA 3DXJF 1OR2A 3NYLA 2ZXWC 1UG7A 1U0BB 2IM8A 2DGJA 3DM5A 1LVKA 3S84A 2ZXRA 3R7CA 2R7RA 1OCOC 4JIOA 1V74B 2AP3A 2BL2A 2XSEA 4C3BA 2TMVP 4PFOA 4EWCA 3EG9B 4Z9IA 2FGYA 1HMDA 2KK1A 4XEKA 5B1BC 4IWBA 2WZLA 4IJJA 5A6BA 1TWCA 3UMKA 4EBKA 1SZIA 4K0DA 1HW1A 1Y4CA 1BR2A 1LKXA 1RXQA 3RVYA 2NUPA 2JPUA 4XPWA 4P6IC 1YDIA 4IB4A 1ST6A 1QPUA 3EGDB 2J0WA 3KL4A 2EPMX 1Z3IX 3F46A 3LNRA 4ANJA 4DBQA 4F4BA 5A6BD 1BZ4A 4MTFA 3ITFA 2QTVA 4GEHA 1Z6AA 3RKOF 5EHHA 1HY5A 2CNWA 2J9WA 1AVOB 2OJQA 1APCA 1S7ZA 3CAXA 3AGUA 4RBNA 1VYKA 4BJ5A 2RSEB 4DVZA 1FFTC 2AVKA 2LP4A 4CSAC 3GEIA 1WATA 2R9RB 3QMKA 3UMHA 5T1DB 1H9GA 2ICWG 2XLWA 1Z7Qc 4MVMA 3M79A 3OA1A 2GWWA 3A9CA 2LD6A 1T6UA 4X0RA 3X1OA 1D1CA 1EA8A 2CNWD 1NG1A 1S05A 2CYDA 1JPJA 2DI3A 2VCCA 3MLGA 2X0CA 1K05A 4O79A 5D91A 1TWHA 2LQGA 1B68A 3U9MA 2PX0A 4BPMA 1WGWA 1MMNA 3RFYA 4PJNA 1JRAA 4EIYA 5L0HA 2W4BA 3M4CA 3WG7C 1M57C 2HV6A 3GANA 3NG1A 4MW8A 2XS8A 1R5ID 2CW0F 2Y69C 2YQYA 4DJ9A 2YL0A 1OXBA 2CGEA 3K1HA 4XTKA 4CJOA 2XLVA 1K40A 2Y39A 4HE8D 2OOCA 3S0XA 3CEXA 3GORA 5E3CA 2EIKC 2ZXPA 3IQTA 3PDMP 1M6TA 4ULVA 3RIPA 3VM6A 4CS9C 5FZTA 1YARO 1ZVZA 3ECSA 5DS4A 4QDLA 3K7DA 4NC3A 4C3DA 2EPNA 4E18A 2IYLD 4C7OA 2HS5A 2OEXA 2OEVA 3KPHA 5JVEA 4AX2A 2LSEA 4J30B 3U8VA 1M2VA 1Q0GA 3K33A 4J32B 1E2XA 3W2VA 1H6GA 4P9FA 2NG1A 2VCBA 1EKYA 5DQTA 2XL4A 3NMIA 1UFBA 2HSQA 4YT4A 2CDQA 3AG3C 4OD5A 2P61A 1WASA 3MYFA 1FNTc 4YL0A 1HE1A 3A11A 1QVXA 4AL0A 3GEEA 3SXZA 3VYWA 2J0XA 2YL3A 3WHNA 1T9KA 2NSFA 3B71A 4Z9HA 3T9OA 4H4KC 2A1DD 2F22A 4JTAB 3SP1A 3HTKC 1PV3A 2XLHA 3M15A 4IAQA 3ZDLA 1ZU5A 2CCYA 1TWGA 2J7PA 2KGOA 3L8JA 3ASOC 3Q7LA 3NRHA 1K04A 4CSAA 3V5XA 4BJ6A 3LESA 2AWCA 3EQLF 2EINC 1ZZPA 1IZMA 2YLDA 3MBGA 4WGYA 3DJUB 3UGOA 1ZU4A 3NMJA 2XS1A 1A0BA 2PF4E 2Y3BA 3MFNA 4GYTA 3RQEA 1YVIA 2J7PD 4YL1A 2I15A 3RF3A 1VMAA 2R7SA 2KQ9A 2HZ8A 1T5OA 2KSFA 4DVYP 4XLPF 1EQ1A 4CX9A 1RKEB 3VF0A 4EKWA 4CDAA 3HNIA 1LS4A 2YLIA 3DAFA 4XQ1A 5COFA 4JC7A 1Q0FA 3FHDA 3HNJA 3SZRA 4BEJA 4YT5A 3CSKA 4LDQA 2YEVA 2C04A 1QKRA 3S9OA 1ZW3A 3W8HA 2Q9BA 1MMAA 2R7QA 5DS5A 1ORSC 1TR2A 3IQ6A 2ZPAA 1A7VA 3R2PA 2OCCC 2YWAA 5CI8A 3U2LA 2HJMA 4CS9A 2HMQA 3DMDA 2EIJC 4PFPA 3ABKC 2XM0A 2OQMA 2Q4FA 1G4US 256BA 3HNKA 2XLEA 4J7YA 5DVWA 5BUOA 1L7CA 3UGPA 2EIMC 3LAYA 2YHSA 4LDKA 1LE4A 3TJ6A 3OWTA 5E3AA 1E86A 3GM3A 1Z63A 2EPKX 1LIHA 4PJMA 4G0HA 5B3SC 2L7AA 4NCQA 3EFOB 3FMSA 2LCHA 1Q0KA 2BE5F 4JEAA 3SXKA 4JVSA 2Y3DA 2R7XA 3NKEA 4MS2A 1J8YF 2XLOA 3AG2C 5BQGA 2QNLA 3JT1A 1MMGA 3X2QC 5AC5A 1HW2A 1AUEA 4RD9A 3TOLA 4IGGA 1OW7A 2XRHA 4NTAA 3RVZA 1OCCC 3SNHA 4ER9A 2G62A 2KJGA 2VB6A 3AQBA 3IQ5A 2IXOA 3G50A 4I1OB 2J9VA 1SF8A 1O87A 2PBEA 3G4ZA 1BR4A 1RJ9B 1TFKB 4Q7CA 2GDCA 2P0NA 4WJ0A 4DBRA 2YKZA 5A6KA 5FCLA 3GODA 2XXAA 2G3VA 1GGQA 1RKCA 1ZHZA 4KI2A 3HNLA 3S27A 3JSZA 3H65A 2Q7RA 3NYJA 5JT4A 3U3BA 2P1AA 5BQIA 1LE2A 3FOOA 4Q5SF
chains in the Genus database with same CATH topology
4OIQF 2R7UA 1VOMA 5L3QA 3OEOA 1NU7D 4ULWA 3CZ6A 4CS8C 1Z5ZA 2IXNA 3EGXA 2R7VA 2YZSA 2WB7A 4JJGA 2NUTB 3L34A 1FTSA 4BJTA 3QZCA 3B0PA 4KNWA 4U5GA 3DM9B 3UR3C 4OIRF 2H7BA 3PHF2 2R7OA 5KYXB 1ZHTA 5KYUB 4PK4A 3AG1C 1VYIA 3I5PA 2KNHA 3ZVRA 1LS1A 5E2QA 3LLKA 2L81A 4AE4B 4CS7A 3F47A 3Q6MA 3JCUQ 2W4MA 4OINF 4Q4ZF 4O6NA 5DQZA 5F5HA 4FX5A 3T4RA 3RYLA 3V7OA 1MNEA 3AQCA 1TWAA 3DZAA 2R7WA 3LEVA 3EGDA 3RH3A 2J9UA 1O5HA 5KYWB 1D1BA 1JPNA 3HLZA 2DYRC 1OCRC 1PD1A 3AG4C 2P7VA 1VK5A 2M4EA 3CQZA 2X51A 3JRTA 4LLEA 4YT2A 1FMWA 3EZIA 3SYNA 5F5FA 5KYYA 3W2WA 1TKNA 3SEOA 2MYSA 5T3TA 2J45A 2WL8A 3NYMA 3Q6NA 4OIPF 1G8XA 3EH1A 4K7BA 1M56C 3NDBB 3S28A 2Q9AA 4XLNF 3L0IA 4CS8A 2A6HF 1D0XA 2NUPB 1V54C 4I3MA 3FVYA 2R7TA 2MWQA 3WODF 4OD4A 3FDQA 2HV7A 4JZAA 4JW1A 1OCZC 1PCXA 3EZHA 2H7VC 3UMIA 2A68F 2EILC 3M1CB 1ZYRF 1FMVA 3ZG1A 4JURI 4YJWA 2WZFA 4CIHA 2FFHA 2PP4A 2V3CC 4W8KA 2VH3A 4CBEA 4NY3A 4A2NB 3ZIBA 2W45A 4PJJA 4E7SA 4M63A 4YN0B 2B0JA 1J8MF 1W2WA 3S29A 1QZXA 4I1MA 4C7OB 5B1AC 4B6IA 4OIOF 3Q7GA 2IXPA 4KNVA 3DAGA 1M2VB 1OKKA 3I5QA 4C3EA 4JCHA 5KYNA 4YWQA 3B0UX 3LS1A 3B9QA 3TD7A 3T6JA 5D92A 2DYSC 4U5CE 5DLJA 3B0VC 3ABLC 1OKKD 3K6BA 4YT8A 3KKBA 2WZGA 4BG0A 1ZHYA 4HFFB 1SMYF 3POVA 5DS6A 4G7ZF 5E33A 4JJFA 1PD0A 2WVQA 4BJ6C 1ZHXA 3EJNA 1KU2A 4HFKB 3K66A 3VAYA 4FWVA 4U5EE 4G7OF 3N0TA 1NU9C 2C03A 3K1IC 4PJLA 3IEEA 2Y3HA 4EBBA 4QI0A 2A6EF 5KYYB 2QY9A 3ABMC 4FESA 3O39A 4LLCA 4DOZA 2E87A 5IY5C 3EFOA 3MX3A 4MNDA 4MQ9F 2Y3GA 2ZXOA 2OG2A 4IAOA 4U5DE 4O7GA 2G3KA 3EG9A 2KW3C 3ZC4A 1D0YA 3N2ZB 4U5BE 1NZEA 2WVNA 3PMRA 2PFDA 4ZLDA 1MMDA 3LJBA 1FFHA 3I4UA 1D0ZA 1RJ9A 5HSWA 4KBLA 3DJNB 3FAJA 4O6YA 2Z15A 1QLEC 2P6VA 3KMIA 4U5FE 2V26A 3EHNA 3T6BA 4AK9A 3N24A 1BR1A 1D1AA 3EPVA 4I44A 3LLIA 4HEAJ 1MNDA 2L9JA 1ZHWA 2VASA 3EH2A 3JYHA 4ZLCA 4IRUA 4RDAA 2I8BA 4BJ1A 3ASNC 2PX3A 2NUTA 3E70C 4U5HA 5CI9A 5EGYA 3HJCA 1IW7F 2Q3TA 4BJ5C 2IXMA 5KYXA 2D5RB 3LS0A 2XXAB 4E7ZA 5KYUA 4G7HF 2IOQA 5T3WA 1V55C 5L3VA 3W8IA 3NKDA 1M2OA 4AE4A 2WVOA 2W9YA 4KC9A 4XWJA 2JD3A 3UNGC 4O6MA 3EHMA 1Z23A 3KH2A 4LACB 1N1CA 2J46A 4QI2A 3DD7A 3EGXB 2A69F 3O6XA 5KYWA 3ZSUA 3E9VA 2Q9CA 2GFHA 2H7OA 2O9XA 4N06A 4LERA 3DXJF 3NYLA 2ZXWC 2DGJA 3DM5A 1LVKA 2ZXRA 2R7RA 1OCOC 2XSEA 4C3BA 4PFOA 4EWCA 3EG9B 2FGYA 5B1BC 4IWBA 2WZLA 4IJJA 1TWCA 3UMKA 1SZIA 4K0DA 1BR2A 1LKXA 2NUPA 4P6IC 3LNRA 3KL4A 1ST6A 3EGDB 2J0WA 4ANJA 1Z3IX 3F46A 4DBQA 4F4BA 3ITFA 2QTVA 4GEHA 1Z6AA 3RKOF 5EHHA 2CNWA 2J9WA 4RBNA 1S7ZA 4BJ5A 1VYKA 4DVZA 4CSAC 1FFTC 3UMHA 3QMKA 5T1DB 3OA1A 4X0RA 3S0XA 3X1OA 1D1CA 2CNWD 3MLGA 1NG1A 1JPJA 4O79A 5D91A 1TWHA 2PX0A 1WGWA 1MMNA 3RFYA 4PJNA 2W4BA 3WG7C 1M57C 3NG1A 2HV6A 3GANA 2CW0F 2Y69C 4XTKA 2CGEA 3K1HA 2Y39A 4HE8D 5E3CA 2EIKC 2ZXPA 3RIPA 4CS9C 5DS4A 3ECSA 4QDLA 3K7DA 4C3DA 2IYLD 4C7OA 4AX2A 2LSEA 4J30B 1M2VA 3K33A 4J32B 3W2VA 2NG1A 5DQTA 2XL4A 4YT4A 2CDQA 3AG3C 4OD5A 3VYWA 2J0XA 4H4KC 2A1DD 3SP1A 3HTKC 1ZU5A 1TWGA 2J7PA 2KGOA 3ASOC 3Q7LA 3NRHA 4CSAA 4BJ6A 3LESA 3EQLF 2EINC 1IZMA 3UGOA 3DJUB 1ZU4A 2PF4E 2Y3BA 4GYTA 2J7PD 1VMAA 2R7SA 2KQ9A 4DVYP 4XLPF 3DAFA 3SZRA 4BEJA 3FHDA 4YT5A 3CSKA 2YEVA 2C04A 3W8HA 2Q9BA 1MMAA 2R7QA 5DS5A 1TR2A 2ZPAA 2OCCC 5CI8A 4CS9A 3DMDA 2EIJC 4PFPA 3ABKC 5DVWA 5BUOA 3UGPA 2EIMC 3LAYA 2YHSA 3OWTA 5E3AA 1Z63A 4PJMA 4G0HA 5B3SC 3EFOB 2BE5F 4JVSA 2Y3DA 2R7XA 3NKEA 1J8YF 3AG2C 3JT1A 1MMGA 3X2QC 4RD9A 2XRHA 1OCCC 3SNHA 2G62A 2KJGA 2VB6A 3AQBA 2IXOA 4I1OB 2J9VA 1SF8A 1O87A 1BR4A 1RJ9B 5FCLA 4Q7CA 4DBRA 4WJ0A 3GODA 2XXAA 2G3VA 1ZHZA 4KI2A 3S27A 3JSZA 3H65A 3NYJA 4Q5SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O39 A;  3ZG1 A;  3ITF A;  3LAY A;  3QZC A;  2Y39 A;  2Y3B A;  2Y3D A;  2Y3G A;  2Y3H A;  3OEO A;  3EPV A; 
#chains in the Genus database with same CATH topology
 2OJE D;  1HMO A;  4OIQ F;  4E0H A;  5JS5 A;  1LI7 A;  2R7U A;  1VOM A;  5L3Q A;  3OEO A;  4UDV A;  2IBF A;  1NU7 D;  4ULW A;  5A6A A;  3CZ6 A;  4CS8 C;  1LPE A;  1E85 A;  1Z5Z A;  2IXN A;  3EGX A;  3FOP A;  2R7V A;  2YZS A;  2WB7 A;  1YZA A;  2YRF A;  4JEB A;  1GQA A;  2NUT B;  4JJG A;  4DXW A;  3L34 A;  1H9T A;  1FTS A;  2D4U A;  4BJT A;  3SXY A;  4CDY A;  3QZC A;  3ZQY A;  4D4N A;  3TK0 A;  4MW3 A;  5K0I A;  5BQH A;  3B0P A;  4KNW A;  4N6H A;  4U5G A;  3DM9 B;  4YL3 A;  3UR3 C;  4OIR F;  1YA7 O;  2QLA A;  2H7B A;  3PHF 2;  1G5Z A;  2R7O A;  3JSE O;  2LIG A;  5KYX B;  1E84 A;  1RMV A;  3US6 A;  1ZHT A;  5KYU B;  2AU5 A;  4MVR A;  4PK4 A;  3AG1 C;  1VYI A;  4XPX A;  3I5P A;  3TOM A;  1C02 A;  2KNH A;  1LS1 A;  5E2Q A;  3LLK A;  1VLT A;  3ZVR A;  2L81 A;  4AE4 B;  2HMZ A;  4CS7 A;  3F47 A;  3Q6M A;  1SYQ A;  1TFO B;  1FAP B;  2ASR A;  3QTH A;  4JRZ A;  4N6C A;  3JCU Q;  2W4M A;  3O55 A;  4OIN F;  4P9T A;  4Q4Z F;  4O6N A;  1OQC A;  5F5H A;  5DQZ A;  3TUL A;  4FX5 A;  4W8P A;  2A0U A;  5JSL A;  3RYL A;  3T4R A;  3V7O A;  4JKV A;  4DRJ B;  1MNE A;  1OW8 A;  3BRJ A;  3AQC A;  4G78 A;  3U2M A;  1TWA A;  3DZA A;  4DRI B;  2R7W A;  2RD9 A;  2YL1 A;  3EGD A;  3LEV A;  3RH3 A;  2J9U A;  5A69 A;  3GEH A;  1O5H A;  5KYW B;  1D1B A;  1JPN A;  1YA9 A;  3HLZ A;  2DYR C;  1OCR C;  4MTG A;  1PD1 A;  3AG4 C;  2P7V A;  2XLM A;  1VK5 A;  2M4E A;  3O10 A;  2X51 A;  1OW6 A;  3CQZ A;  3JRT A;  1YYX A;  4LLE A;  1YJG A;  3BEH A;  3GM1 A;  4MVZ A;  3U8P A;  4YT2 A;  1NLX A;  1YLM A;  1FMW A;  1OR3 A;  2MHR A;  3EZI A;  3SYN A;  5F5F A;  5KYY A;  1YYJ A;  1TKN A;  3SEO A;  3W2W A;  3VRC A;  2MYS A;  5T3T A;  2J45 A;  2WL8 A;  3NYM A;  2J9B A;  3Q6N A;  4OIP F;  3ZQV A;  1G8X A;  1FR0 A;  2GA0 A;  1E83 A;  3EH1 A;  4K7B A;  1NSG B;  3C8Z A;  1M56 C;  1AEP A;  2EPL X;  5F28 E;  1SR2 A;  3NDB B;  3S28 A;  2Q9A A;  4XLN F;  3L0I A;  4CS8 A;  2A6H F;  5CIV A;  1L3P A;  4JCZ A;  4J7T A;  1C03 A;  5COM A;  2XL8 A;  1D0X A;  2NUP B;  1LI5 A;  1V54 C;  4I3M A;  3FVY A;  3SXM A;  4EBJ A;  2R7T A;  2MWQ A;  3WOD F;  2R25 A;  3JRM O;  2GAQ A;  4OD4 A;  2HV7 A;  4JZA A;  3FDQ A;  4JW1 A;  1CGM E;  1OCZ C;  1PCX A;  3EZH A;  2JX0 A;  3MYI A;  3AGT A;  2H7V C;  3UMI A;  2A68 F;  2EIL C;  3C62 A;  3M1C B;  1ZYR F;  4R32 A;  3ATP A;  3FAP B;  3H2U A;  1FMV A;  3ZG1 A;  2B0H A;  1QQ3 A;  4L6R A;  2QE9 A;  1G4W R;  1I4Y A;  3AOU A;  4JUR I;  4YJW A;  3PCV A;  4WGZ A;  3U0C A;  1Q0D A;  4PAC A;  2WZF A;  1TQG A;  1KTM A;  1ORY A;  3RW0 A;  5EK0 A;  3JTL O;  4D4X A;  4CIH A;  2FFH A;  1T01 A;  2PP4 A;  5L0D A;  4JTC B;  2V3C C;  4W8K A;  2VH3 A;  1O3U A;  4ONS A;  1DOW A;  4CBE A;  4XEF A;  4MVU A;  3C8G A;  1Y6D A;  4NY3 A;  4A2N B;  4AL1 A;  1XWJ A;  1H7I A;  1I4Z A;  3W4Y A;  3ZIB A;  1A7D A;  2W45 A;  3GM2 A;  1VTM P;  2YL7 A;  1F1M A;  3KYJ A;  4PJJ A;  1CPQ A;  4E7S A;  3LNM B;  4M63 A;  4U9E A;  2VC9 A;  2B0J A;  1J8M F;  4YN0 B;  1W2W A;  3C8G D;  1QSP A;  3S29 A;  1JMW A;  3V5Z A;  4XPY A;  1QZX A;  1V4A A;  4I1M A;  4N4W A;  5B1A C;  3WAQ A;  4A4A A;  1T6Q A;  4B6I A;  3HKK A;  3Q7G A;  4E17 A;  4OIO F;  2IXP A;  3LUT B;  4KNV A;  3DAG A;  2UUI A;  1EI7 A;  2YVK A;  2XM4 A;  1M2V B;  1MQV A;  4U9D A;  3KYI A;  3U9J A;  3L8I A;  3DWW A;  1OKK A;  3I5Q A;  4C3E A;  4BEM J;  1KNY A;  4JCH A;  5KYN A;  4YWQ A;  1YZC A;  3B0U X;  3LS1 A;  3B9Q A;  1RKE A;  3QVZ A;  2LFF A;  2HUJ A;  1GS9 A;  5D92 A;  3TD7 A;  3T6J A;  2DYS C;  5JUA A;  4C7O B;  4U5C E;  5L0G A;  5DLJ A;  1GM5 A;  1JAF A;  4JTD B;  3V5Y A;  3B0V C;  2R02 A;  3ABL C;  1JOG A;  1OKK D;  3K6B A;  5COG A;  4YT8 A;  1C17 M;  1CGO A;  4WAB A;  5A6J A;  5AC4 A;  1YAU O;  4CDV A;  3KKB A;  2WZG A;  3QW0 A;  4BG0 A;  1ZHY A;  4HFF B;  1SMY F;  2OU6 A;  4MTO A;  2KC3 A;  3ZTZ A;  4CJG A;  5DS6 A;  4G7Z F;  5E33 A;  3POV A;  3RQF A;  4JJF A;  1PD0 A;  2WVQ A;  4BJ6 C;  1ZHX A;  3EJN A;  1KU2 A;  5JLI A;  3RQG A;  4HFK B;  3K66 A;  3VAY A;  4FWV A;  4U5E E;  4G7O F;  3N0T A;  1NU9 C;  2C03 A;  1CPR A;  3FXH A;  1A41 A;  2H8A A;  3IEE A;  3K1I C;  4PJL A;  2Y3H A;  4EBB A;  4MVS A;  2A6E F;  4QI0 A;  2QY9 A;  3ABM C;  3M4B A;  1U89 A;  2ETS A;  3DI5 A;  3O39 A;  4FES A;  2E87 A;  4GQH A;  4LLC A;  4DOZ A;  5B3I A;  5IY5 C;  2UUH A;  1JR8 A;  3EFO A;  3MX3 A;  1T6I A;  4MND A;  4MQ9 F;  4YK5 A;  4EHP A;  1WTY A;  2Y3G A;  2ZXO A;  2OG2 A;  4EUK B;  1NBB A;  1NFO A;  3QW1 A;  4IAO A;  4U5D E;  4O7G A;  3ZTM A;  3U3F A;  2G3K A;  4FAP B;  3AJM A;  2DB4 A;  2KW3 C;  3EG9 A;  1D0Y A;  3N2Z B;  4U5B E;  2L6H A;  3ZC4 A;  5L0F A;  1NZE A;  2WVN A;  2R03 A;  3PMR A;  4LDR A;  2PFD A;  1CGN A;  3J06 A;  4ZLD A;  1MMD A;  3TQO A;  3T6G B;  3LJB A;  1HE9 A;  1FFH A;  3DE8 A;  1XZP A;  3GWL A;  3I4U A;  1D0Z A;  1RCP A;  2OKU A;  4Z9J A;  5L0J A;  3JYY A;  1LM3 B;  1RJ9 A;  1I5N A;  5HSW A;  4KBL A;  2HKV A;  3DJN B;  2EPO A;  3FAJ A;  2LK4 A;  2Z15 A;  4O6Y A;  5AGF A;  1QLE C;  5L0C A;  2P6V A;  1VLS A;  2J8W A;  2XLD A;  2HFI A;  4XEV A;  2Q00 A;  3KMI A;  4NTB A;  3ZWI A;  4U5F E;  1VB5 A;  2V26 A;  3EHN A;  3T6B A;  2L6G A;  4AK9 A;  3N24 A;  1DOV A;  1BR1 A;  1D1A A;  3EPV A;  4JE9 A;  2NSG A;  2NPU A;  5JRA A;  4I44 A;  3LLI A;  4HEA J;  1MND A;  1ZW2 A;  2ZD9 A;  3C63 A;  2L9J A;  5HV9 A;  1ZHW A;  2VAS A;  3EH2 A;  3JYH A;  4ZLC A;  3C8G B;  2BC5 A;  3QVY A;  4IRU A;  5JP7 A;  2KYH A;  4RDA A;  2I8B A;  4BJ1 A;  3ASN C;  2PX3 A;  2NUT A;  3E70 C;  4U5H A;  4MVQ A;  5CI9 A;  1WOL A;  3HJC A;  5EGY A;  1BBH A;  2AWY A;  1IW7 F;  2YLG A;  4IAR A;  1WN0 A;  2Q3T A;  4H54 A;  1Q0M A;  3G4X A;  4BJ5 C;  2IXM A;  4CIP A;  2HJ3 A;  3U5S A;  5KYX A;  2D5R B;  3LS0 A;  3GWN A;  3JZ0 A;  4DRH B;  4E7Z A;  3K1I A;  2XXA B;  5KYU A;  4G7H F;  3C18 A;  2IOQ A;  4K1O A;  5T3W A;  1V55 C;  5L3V A;  4MVO A;  3NKD A;  1U6H A;  3W8I A;  1M2O A;  3H2V A;  4AE4 A;  2M64 A;  4NQF A;  2WVO A;  1WWP A;  2W9Y A;  4KC9 A;  2FAP B;  2VCA A;  4XWJ A;  1ORJ A;  2JD3 A;  5TJ5 E;  2L6F A;  1R4T A;  4NTF A;  3UNG C;  3C7J A;  3NMK A;  2PNO A;  4O6M A;  3IPM O;  3EHM A;  1Z23 A;  3KH2 A;  3IHU A;  4LAC B;  1N1C A;  2J46 A;  3B29 A;  3DE9 A;  3DD7 A;  3EGX B;  3S90 A;  4QI2 A;  2A69 F;  4PR9 A;  3LEO A;  3O6X A;  5L0I A;  2QUP A;  2XL6 A;  5KYW A;  2LFD A;  3ZSU A;  3E9V A;  3TJ5 A;  2Q9C A;  3IQC A;  1XZQ A;  2A0B A;  1A7E A;  4E0I A;  1OXK A;  5KYY B;  2GFH A;  3DKA A;  2H7O A;  2O9X A;  2HSB A;  4N06 A;  3L1M A;  5GPG B;  2R05 A;  4LER A;  1BDJ B;  1NFN A;  3DXJ F;  1OR2 A;  3NYL A;  2ZXW C;  1UG7 A;  1U0B B;  2IM8 A;  2DGJ A;  3DM5 A;  1LVK A;  3S84 A;  2ZXR A;  3R7C A;  2R7R A;  1OCO C;  4JIO A;  1V74 B;  2AP3 A;  2BL2 A;  2XSE A;  4C3B A;  2TMV P;  4PFO A;  4EWC A;  3EG9 B;  4Z9I A;  2FGY A;  1HMD A;  2KK1 A;  4XEK A;  5B1B C;  4IWB A;  2WZL A;  4IJJ A;  5A6B A;  1TWC A;  3UMK A;  4EBK A;  1SZI A;  4K0D A;  1HW1 A;  1Y4C A;  1BR2 A;  1LKX A;  1RXQ A;  3RVY A;  2NUP A;  2JPU A;  4XPW A;  4P6I C;  1YDI A;  4IB4 A;  1ST6 A;  1QPU A;  3EGD B;  2J0W A;  3KL4 A;  2EPM X;  1Z3I X;  3F46 A;  3LNR A;  4ANJ A;  4DBQ A;  4F4B A;  5A6B D;  1BZ4 A;  4MTF A;  3ITF A;  2QTV A;  4GEH A;  1Z6A A;  3RKO F;  5EHH A;  1HY5 A;  2CNW A;  2J9W A;  1AVO B;  2OJQ A;  1APC A;  1S7Z A;  3CAX A;  3AGU A;  4RBN A;  1VYK A;  4BJ5 A;  2RSE B;  4DVZ A;  1FFT C;  2AVK A;  2LP4 A;  4CSA C;  3GEI A;  1WAT A;  2R9R B;  3QMK A;  3UMH A;  5T1D B;  1H9G A;  2ICW G;  2XLW A;  1Z7Q c;  4MVM A;  3M79 A;  3OA1 A;  2GWW A;  3A9C A;  2LD6 A;  1T6U A;  4X0R A;  3X1O A;  1D1C A;  1EA8 A;  2CNW D;  1NG1 A;  1S05 A;  2CYD A;  1JPJ A;  2DI3 A;  2VCC A;  3MLG A;  2X0C A;  1K05 A;  4O79 A;  5D91 A;  1TWH A;  2LQG A;  1B68 A;  3U9M A;  2PX0 A;  4BPM A;  1WGW A;  1MMN A;  3RFY A;  4PJN A;  1JRA A;  4EIY A;  5L0H A;  2W4B A;  3M4C A;  3WG7 C;  1M57 C;  2HV6 A;  3GAN A;  3NG1 A;  4MW8 A;  2XS8 A;  1R5I D;  2CW0 F;  2Y69 C;  2YQY A;  4DJ9 A;  2YL0 A;  1OXB A;  2CGE A;  3K1H A;  4XTK A;  4CJO A;  2XLV A;  1K40 A;  2Y39 A;  4HE8 D;  2OOC A;  3S0X A;  3CEX A;  3GOR A;  5E3C A;  2EIK C;  2ZXP A;  3IQT A;  3PDM P;  1M6T A;  4ULV A;  3RIP A;  3VM6 A;  4CS9 C;  5FZT A;  1YAR O;  1ZVZ A;  3ECS A;  5DS4 A;  4QDL A;  3K7D A;  4NC3 A;  4C3D A;  2EPN A;  4E18 A;  2IYL D;  4C7O A;  2HS5 A;  2OEX A;  2OEV A;  3KPH A;  5JVE A;  4AX2 A;  2LSE A;  4J30 B;  3U8V A;  1M2V A;  1Q0G A;  3K33 A;  4J32 B;  1E2X A;  3W2V A;  1H6G A;  4P9F A;  2NG1 A;  2VCB A;  1EKY A;  5DQT A;  2XL4 A;  3NMI A;  1UFB A;  2HSQ A;  4YT4 A;  2CDQ A;  3AG3 C;  4OD5 A;  2P61 A;  1WAS A;  3MYF A;  1FNT c;  4YL0 A;  1HE1 A;  3A11 A;  1QVX A;  4AL0 A;  3GEE A;  3SXZ A;  3VYW A;  2J0X A;  2YL3 A;  3WHN A;  1T9K A;  2NSF A;  3B71 A;  4Z9H A;  3T9O A;  4H4K C;  2A1D D;  2F22 A;  4JTA B;  3SP1 A;  3HTK C;  1PV3 A;  2XLH A;  3M15 A;  4IAQ A;  3ZDL A;  1ZU5 A;  2CCY A;  1TWG A;  2J7P A;  2KGO A;  3L8J A;  3ASO C;  3Q7L A;  3NRH A;  1K04 A;  4CSA A;  3V5X A;  4BJ6 A;  3LES A;  2AWC A;  3EQL F;  2EIN C;  1ZZP A;  1IZM A;  2YLD A;  3MBG A;  4WGY A;  3DJU B;  3UGO A;  1ZU4 A;  3NMJ A;  2XS1 A;  1A0B A;  2PF4 E;  2Y3B A;  3MFN A;  4GYT A;  3RQE A;  1YVI A;  2J7P D;  4YL1 A;  2I15 A;  3RF3 A;  1VMA A;  2R7S A;  2KQ9 A;  2HZ8 A;  1T5O A;  2KSF A;  4DVY P;  4XLP F;  1EQ1 A;  4CX9 A;  1RKE B;  3VF0 A;  4EKW A;  4CDA A;  3HNI A;  1LS4 A;  2YLI A;  3DAF A;  4XQ1 A;  5COF A;  4JC7 A;  1Q0F A;  3FHD A;  3HNJ A;  3SZR A;  4BEJ A;  4YT5 A;  3CSK A;  4LDQ A;  2YEV A;  2C04 A;  1QKR A;  3S9O A;  1ZW3 A;  3W8H A;  2Q9B A;  1MMA A;  2R7Q A;  5DS5 A;  1ORS C;  1TR2 A;  3IQ6 A;  2ZPA A;  1A7V A;  3R2P A;  2OCC C;  2YWA A;  5CI8 A;  3U2L A;  2HJM A;  4CS9 A;  2HMQ A;  3DMD A;  2EIJ C;  4PFP A;  3ABK C;  2XM0 A;  2OQM A;  2Q4F A;  1G4U S;  256B A;  3HNK A;  2XLE A;  4J7Y A;  5DVW A;  5BUO A;  1L7C A;  3UGP A;  2EIM C;  3LAY A;  2YHS A;  4LDK A;  1LE4 A;  3TJ6 A;  3OWT A;  5E3A A;  1E86 A;  3GM3 A;  1Z63 A;  2EPK X;  1LIH A;  4PJM A;  4G0H A;  5B3S C;  2L7A A;  4NCQ A;  3EFO B;  3FMS A;  2LCH A;  1Q0K A;  2BE5 F;  4JEA A;  3SXK A;  4JVS A;  2Y3D A;  2R7X A;  3NKE A;  4MS2 A;  1J8Y F;  2XLO A;  3AG2 C;  5BQG A;  2QNL A;  3JT1 A;  1MMG A;  3X2Q C;  5AC5 A;  1HW2 A;  1AUE A;  4RD9 A;  3TOL A;  4IGG A;  1OW7 A;  2XRH A;  4NTA A;  3RVZ A;  1OCC C;  3SNH A;  4ER9 A;  2G62 A;  2KJG A;  2VB6 A;  3AQB A;  3IQ5 A;  2IXO A;  3G50 A;  4I1O B;  2J9V A;  1SF8 A;  1O87 A;  2PBE A;  3G4Z A;  1BR4 A;  1RJ9 B;  1TFK B;  4Q7C A;  2GDC A;  2P0N A;  4WJ0 A;  4DBR A;  2YKZ A;  5A6K A;  5FCL A;  3GOD A;  2XXA A;  2G3V A;  1GGQ A;  1RKC A;  1ZHZ A;  4KI2 A;  3HNL A;  3S27 A;  3JSZ A;  3H65 A;  2Q7R A;  3NYJ A;  5JT4 A;  3U3B A;  2P1A A;  5BQI A;  1LE2 A;  3FOO A;  4Q5S F; 
#chains in the Genus database with same CATH homology
 4OIQ F;  2R7U A;  1VOM A;  5L3Q A;  3OEO A;  1NU7 D;  4ULW A;  3CZ6 A;  4CS8 C;  1Z5Z A;  2IXN A;  3EGX A;  2R7V A;  2YZS A;  2WB7 A;  4JJG A;  2NUT B;  3L34 A;  1FTS A;  4BJT A;  3QZC A;  3B0P A;  4KNW A;  4U5G A;  3DM9 B;  3UR3 C;  4OIR F;  2H7B A;  3PHF 2;  2R7O A;  5KYX B;  1ZHT A;  5KYU B;  4PK4 A;  3AG1 C;  1VYI A;  3I5P A;  2KNH A;  3ZVR A;  1LS1 A;  5E2Q A;  3LLK A;  2L81 A;  4AE4 B;  4CS7 A;  3F47 A;  3Q6M A;  3JCU Q;  2W4M A;  4OIN F;  4Q4Z F;  4O6N A;  5DQZ A;  5F5H A;  4FX5 A;  3T4R A;  3RYL A;  3V7O A;  1MNE A;  3AQC A;  1TWA A;  3DZA A;  2R7W A;  3LEV A;  3EGD A;  3RH3 A;  2J9U A;  1O5H A;  5KYW B;  1D1B A;  1JPN A;  3HLZ A;  2DYR C;  1OCR C;  1PD1 A;  3AG4 C;  2P7V A;  1VK5 A;  2M4E A;  3CQZ A;  2X51 A;  3JRT A;  4LLE A;  4YT2 A;  1FMW A;  3EZI A;  3SYN A;  5F5F A;  5KYY A;  3W2W A;  1TKN A;  3SEO A;  2MYS A;  5T3T A;  2J45 A;  2WL8 A;  3NYM A;  3Q6N A;  4OIP F;  1G8X A;  3EH1 A;  4K7B A;  1M56 C;  3NDB B;  3S28 A;  2Q9A A;  4XLN F;  3L0I A;  4CS8 A;  2A6H F;  1D0X A;  2NUP B;  1V54 C;  4I3M A;  3FVY A;  2R7T A;  2MWQ A;  3WOD F;  4OD4 A;  3FDQ A;  2HV7 A;  4JZA A;  4JW1 A;  1OCZ C;  1PCX A;  3EZH A;  2H7V C;  3UMI A;  2A68 F;  2EIL C;  3M1C B;  1ZYR F;  1FMV A;  3ZG1 A;  4JUR I;  4YJW A;  2WZF A;  4CIH A;  2FFH A;  2PP4 A;  2V3C C;  4W8K A;  2VH3 A;  4CBE A;  4NY3 A;  4A2N B;  3ZIB A;  2W45 A;  4PJJ A;  4E7S A;  4M63 A;  4YN0 B;  2B0J A;  1J8M F;  1W2W A;  3S29 A;  1QZX A;  4I1M A;  4C7O B;  5B1A C;  4B6I A;  4OIO F;  3Q7G A;  2IXP A;  4KNV A;  3DAG A;  1M2V B;  1OKK A;  3I5Q A;  4C3E A;  4JCH A;  5KYN A;  4YWQ A;  3B0U X;  3LS1 A;  3B9Q A;  3TD7 A;  3T6J A;  5D92 A;  2DYS C;  4U5C E;  5DLJ A;  3B0V C;  3ABL C;  1OKK D;  3K6B A;  4YT8 A;  3KKB A;  2WZG A;  4BG0 A;  1ZHY A;  4HFF B;  1SMY F;  3POV A;  5DS6 A;  4G7Z F;  5E33 A;  4JJF A;  1PD0 A;  2WVQ A;  4BJ6 C;  1ZHX A;  3EJN A;  1KU2 A;  4HFK B;  3K66 A;  3VAY A;  4FWV A;  4U5E E;  4G7O F;  3N0T A;  1NU9 C;  2C03 A;  3K1I C;  4PJL A;  3IEE A;  2Y3H A;  4EBB A;  4QI0 A;  2A6E F;  5KYY B;  2QY9 A;  3ABM C;  4FES A;  3O39 A;  4LLC A;  4DOZ A;  2E87 A;  5IY5 C;  3EFO A;  3MX3 A;  4MND A;  4MQ9 F;  2Y3G A;  2ZXO A;  2OG2 A;  4IAO A;  4U5D E;  4O7G A;  2G3K A;  3EG9 A;  2KW3 C;  3ZC4 A;  1D0Y A;  3N2Z B;  4U5B E;  1NZE A;  2WVN A;  3PMR A;  2PFD A;  4ZLD A;  1MMD A;  3LJB A;  1FFH A;  3I4U A;  1D0Z A;  1RJ9 A;  5HSW A;  4KBL A;  3DJN B;  3FAJ A;  4O6Y A;  2Z15 A;  1QLE C;  2P6V A;  3KMI A;  4U5F E;  2V26 A;  3EHN A;  3T6B A;  4AK9 A;  3N24 A;  1BR1 A;  1D1A A;  3EPV A;  4I44 A;  3LLI A;  4HEA J;  1MND A;  2L9J A;  1ZHW A;  2VAS A;  3EH2 A;  3JYH A;  4ZLC A;  4IRU A;  4RDA A;  2I8B A;  4BJ1 A;  3ASN C;  2PX3 A;  2NUT A;  3E70 C;  4U5H A;  5CI9 A;  5EGY A;  3HJC A;  1IW7 F;  2Q3T A;  4BJ5 C;  2IXM A;  5KYX A;  2D5R B;  3LS0 A;  2XXA B;  4E7Z A;  5KYU A;  4G7H F;  2IOQ A;  5T3W A;  1V55 C;  5L3V A;  3W8I A;  3NKD A;  1M2O A;  4AE4 A;  2WVO A;  2W9Y A;  4KC9 A;  4XWJ A;  2JD3 A;  3UNG C;  4O6M A;  3EHM A;  1Z23 A;  3KH2 A;  4LAC B;  1N1C A;  2J46 A;  4QI2 A;  3DD7 A;  3EGX B;  2A69 F;  3O6X A;  5KYW A;  3ZSU A;  3E9V A;  2Q9C A;  2GFH A;  2H7O A;  2O9X A;  4N06 A;  4LER A;  3DXJ F;  3NYL A;  2ZXW C;  2DGJ A;  3DM5 A;  1LVK A;  2ZXR A;  2R7R A;  1OCO C;  2XSE A;  4C3B A;  4PFO A;  4EWC A;  3EG9 B;  2FGY A;  5B1B C;  4IWB A;  2WZL A;  4IJJ A;  1TWC A;  3UMK A;  1SZI A;  4K0D A;  1BR2 A;  1LKX A;  2NUP A;  4P6I C;  3LNR A;  3KL4 A;  1ST6 A;  3EGD B;  2J0W A;  4ANJ A;  1Z3I X;  3F46 A;  4DBQ A;  4F4B A;  3ITF A;  2QTV A;  4GEH A;  1Z6A A;  3RKO F;  5EHH A;  2CNW A;  2J9W A;  4RBN A;  1S7Z A;  4BJ5 A;  1VYK A;  4DVZ A;  4CSA C;  1FFT C;  3UMH A;  3QMK A;  5T1D B;  3OA1 A;  4X0R A;  3S0X A;  3X1O A;  1D1C A;  2CNW D;  3MLG A;  1NG1 A;  1JPJ A;  4O79 A;  5D91 A;  1TWH A;  2PX0 A;  1WGW A;  1MMN A;  3RFY A;  4PJN A;  2W4B A;  3WG7 C;  1M57 C;  3NG1 A;  2HV6 A;  3GAN A;  2CW0 F;  2Y69 C;  4XTK A;  2CGE A;  3K1H A;  2Y39 A;  4HE8 D;  5E3C A;  2EIK C;  2ZXP A;  3RIP A;  4CS9 C;  5DS4 A;  3ECS A;  4QDL A;  3K7D A;  4C3D A;  2IYL D;  4C7O A;  4AX2 A;  2LSE A;  4J30 B;  1M2V A;  3K33 A;  4J32 B;  3W2V A;  2NG1 A;  5DQT A;  2XL4 A;  4YT4 A;  2CDQ A;  3AG3 C;  4OD5 A;  3VYW A;  2J0X A;  4H4K C;  2A1D D;  3SP1 A;  3HTK C;  1ZU5 A;  1TWG A;  2J7P A;  2KGO A;  3ASO C;  3Q7L A;  3NRH A;  4CSA A;  4BJ6 A;  3LES A;  3EQL F;  2EIN C;  1IZM A;  3UGO A;  3DJU B;  1ZU4 A;  2PF4 E;  2Y3B A;  4GYT A;  2J7P D;  1VMA A;  2R7S A;  2KQ9 A;  4DVY P;  4XLP F;  3DAF A;  3SZR A;  4BEJ A;  3FHD A;  4YT5 A;  3CSK A;  2YEV A;  2C04 A;  3W8H A;  2Q9B A;  1MMA A;  2R7Q A;  5DS5 A;  1TR2 A;  2ZPA A;  2OCC C;  5CI8 A;  4CS9 A;  3DMD A;  2EIJ C;  4PFP A;  3ABK C;  5DVW A;  5BUO A;  3UGP A;  2EIM C;  3LAY A;  2YHS A;  3OWT A;  5E3A A;  1Z63 A;  4PJM A;  4G0H A;  5B3S C;  3EFO B;  2BE5 F;  4JVS A;  2Y3D A;  2R7X A;  3NKE A;  1J8Y F;  3AG2 C;  3JT1 A;  1MMG A;  3X2Q C;  4RD9 A;  2XRH A;  1OCC C;  3SNH A;  2G62 A;  2KJG A;  2VB6 A;  3AQB A;  2IXO A;  4I1O B;  2J9V A;  1SF8 A;  1O87 A;  1BR4 A;  1RJ9 B;  5FCL A;  4Q7C A;  4DBR A;  4WJ0 A;  3GOD A;  2XXA A;  2G3V A;  1ZHZ A;  4KI2 A;  3S27 A;  3JSZ A;  3H65 A;  3NYJ A;  4Q5S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...