3ITFA

Structural basis for the inhibitory function of the cpxp adaptor protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic adaptor protein cpxP
publication title Structural Basis for Two-component System Inhibition and Pilus Sensing by the Auxiliary CpxP Protein.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr.
molecule tags Signaling protein
total genus 34
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3itfA00
3QZCA 2Y3DA 3ITFA 3O39A 2Y3GA 2Y3BA 3LAYA 2Y3HA 2Y39A 3OEOA 3ZG1A 3EPVA
chains in the Genus database with same CATH superfamily
4ZLCA 1SMYF 1NFNA 2NG1A 1LS4A 3VYWA 3AGTA 2H7OA 3EGXA 1G8XA 4IARA 4O6NA 2PFDA 1U0BB 1G4WR 5E3CA 2R05A 4XLPF 4C7OA 3HLZA 2X0CA 3BRJA 4OIQF 3B0VC 1VLTA 4DRHB 4YT4A 3DZAA 4EKWA 3A11A 2ZPAA 2LFDA 5JS5A 2CDQA 4YK5A 2WZFA 3K1IA 2Y39A 1NG1A 1M56C 3NKDA 4O7GA 3RQEA 3PHF2 4AE4B 1WATA 3HJCA 1EQ1A 1T6UA 3EFOA 2XLOA 2G3VA 2XLHA 2QLAA 4NTBA 4U5EE 3RF3A 3NYMA 3SZRA 1V74B 3DMDA 4YT5A 4QI0A 3GODA 3SP1A 1VYKA 4XPYA 3IHUA 4MTGA 4BJ6C 3I5PA 2XLDA 3NRHA 3DD7A 4ULWA 2YWAA 5T3TA 3C8GB 2IXOA 3TQOA 5FCLA 3UGPA 2R7VA 3CQZA 4MNDA 3TD7A 5TJ5E 2GWWA 2PBEA 3EG9A 4XLNF 1VYIA 5F5HA 4DVYP 4IAOA 4IJJA 4KNVA 3ZQYA 1Z7Qc 1YDIA 3IQ5A 2JD3A 3NG1A 4NTFA 3C7JA 3O10A 2P1AA 3SXMA 1ORYA 3ASNC 2QUPA 1NSGB 3ASOC 1MMGA 2AU5A 3GEIA 4RBNA 5DS6A 2KJGA 3EGDA 3S0XA 1RJ9A 1BR2A 4PJLA 5BQHA 3B9QA 1T9KA 1ZZPA 1VOMA 2M64A 2YL0A 3LAYA 2A0BA 3W2VA 2Q9BA 3EGXB 3JT1A 1C03A 4U5CE 2G3KA 3TJ6A 2KC3A 5CIVA 4HEAJ 4C3BA 1FTSA 3C8GD 3DM5A 3JCUQ 3FHDA 5CI8A 1H6GA 5B1BC 4YT2A 1KTMA 1ZHWA 2DB4A 2P61A 3HKKA 4DRIB 2W9YA 5EGYA 4Z9IA 2AWCA 2XS1A 4JVSA 3NMJA 1D0YA 4J7YA 2M4EA 4G7HF 4NCQA 3G4ZA 1E86A 2OEXA 5DVWA 1ZHZA 1H9GA 1AUEA 2XM0A 3EFOB 3JRMO 5A6KA 3B29A 4LDQA 3UMHA 2FGYA 1AEPA 3G50A 5EK0A 1MMDA 5T1DB 5IY5C 5L0GA 2HV6A 2O9XA 1BR1A 3ITFA 4N4WA 1R5ID 256BA 5JSLA 3Q6MA 3LEVA 2D5RB 3V7OA 2G62A 1E83A 4NY3A 5KYNA 3GM3A 3EG9B 4MTOA 3W2WA 1OW7A 4XEVA 5A69A 1YYJA 1KU2A 4MVMA 5E3AA 3U9MA 4JEBA 3LLKA 4IAQA 3GORA 1JPNA 1OW6A 1MQVA 1V54C 1EA8A 1FNTc 2HJ3A 3H2UA 4XQ1A 2XL8A 1TKNA 2ZXOA 1RJ9B 3EGDB 1Z23A 1H7IA 1NU7D 2GFHA 4MVRA 3V5ZA 1NBBA 4CBEA 1LVKA 1F1MA 4DBQA 1OXBA 2ZXPA 1S7ZA 3CEXA 3UNGC 1HE9A 3KYJA 1DOVA 3HNJA 4PJMA 1BZ4A 3RH3A 1ZYRF 1J8YF 1TWGA 3SYNA 3TJ5A 3U9JA 3T6BA 4JEAA 5L0CA 4FAPB 4JTAB 3S84A 5BQIA 4BG0A 4KNWA 1FAPB 2YZSA 4BJ5C 3ABKC 3T6GB 5HV9A 3AGUA 1ZHTA 1WWPA 4IWBA 2Y3DA 4MVUA 1U6HA 1ORJA 2LFFA 1ZHXA 3DKAA 3FMSA 2R7WA 3F47A 1GM5A 1Q0DA 2ASRA 3GM2A 2LK4A 1JR8A 3FAPB 4XWJA 1Y4CA 4XPXA 1WTYA 2HKVA 1UG7A 3AJMA 2YL1A 4BJ6A 5B3IA 3EHNA 1OR2A 1OR3A 3HTKC 4DBRA 4CX9A 3K6BA 2EPMX 2YLDA 2HFIA 4N6HA 3T4RA 4CDAA 3UGOA 4PJNA 2H8AA 3E70C 3U3FA 4A2NB 2L7AA 2XL4A 3QW0A 4EUKB 4YL3A 3IQ6A 3M1CB 2P6VA 5L3QA 4Q4ZF 1QKRA 3DAGA 4ANJA 4J30B 1OKKA 3LNRA 4LDRA 3QVZA 4LERA 2B0HA 3WAQA 4OIPF 2DYSC 1YAUO 4MTFA 3SXKA 3PMRA 5KYYA 1FFTC 3LESA 2A6HF 3SNHA 3AG3C 3PDMP 4E18A 2MYSA 1TFOB 4UDVA 2KQ9A 3M79A 1SR2A 2OJQA 2YVKA 3E9VA 4IGGA 1JAFA 4OD4A 5JRAA 1LE2A 2WL8A 1T6QA 2R7XA 2J9BA 2WB7A 1RKEA 1VB5A 2J46A 5A6JA 3QTHA 3A9CA 1TWHA 1FR0A 3ZSUA 4NTAA 1D1CA 3L1MA 1LKXA 3RKOF 3IPMO 4PACA 4DRJB 1IW7F 4NQFA 1YLMA 4QI2A 1HY5A 3ABMC 3RW0A 1V55C 2XLMA 3MYFA 4U5HA 1G4US 1XWJA 4FWVA 4U5GA 1ZVZA 4D4NA 3NDBB 2J0WA 4E7SA 1G5ZA 1A0BA 2L81A 1DOWA 4K0DA 2JX0A 3HNIA 2IBFA 2R7QA 1MNEA 2CYDA 1FMVA 2OG2A 3K1HA 3R7CA 4AL0A 4GQHA 4OIOF 2YLGA 2XXAA 1WGWA 1I5NA 1FMWA 1A7VA 5DLJA 2UUIA 2R7OA 3LUTB 3R2PA 2LQGA 5K0IA 4G7OF 3I4UA 1S05A 3IQTA 1ST6A 4CDVA 1T5OA 2BL2A 2NPUA 1Z5ZA 1W2WA 3RQGA 1A7EA 1D0ZA 2HMZA 1HMDA 2BC5A 2HJMA 2P0NA 4OD5A 4XTKA 1PD1A 1VMAA 2LSEA 3ECSA 1QZXA 2W4BA 4MVSA 3U2MA 5T3WA 1Q0FA 3O55A 3VRCA 1YJGA 3RQFA 1O87A 4C7OB 1L3PA 2VASA 3N24A 1I4ZA 4PK4A 3M15A 4P9FA 1HE1A 1LS1A 3IEEA 2HV7A 3KKBA 4BJ1A 5D92A 2IM8A 2Q9CA 4MW8A 3FVYA 3HNLA 5AC4A 5JUAA 4R32A 2AWYA 4WGYA 1RKEB 5A6BA 5L0DA 2EPNA 3J06A 5COMA 3LEOA 3S28A 2J9UA 2J8WA 4KI2A 4JKVA 3VF0A 3EHMA 3VM6A 1TR2A 4K1OA 3TULA 2BE5F 5BQGA 1OW8A 4BJ5A 5F5FA 2XS8A 1OKKD 2XRHA 3NKEA 3SXZA 3FAJA 1TWAA 1LM3B 1HW1A 3CSKA 4EBBA 1MNDA 2EPLX 2NSFA 2Y3BA 3CZ6A 4YN0B 4JJGA 4JW1A 4CJOA 4H54A 3GEHA 1OCOC 3KMIA 3PCVA 1QQ3A 2KYHA 3C18A 3F46A 2R7TA 2C04A 2QE9A 2OKUA 2VCCA 2YEVA 2JPUA 4KC9A 4LACB 3LLIA 3ZVRA 4MVZA 5CI9A 4J32B 5HSWA 1ORSC 4EBKA 1R4TA 2XXAB 3K66A 2XSEA 2LD6A 4Q7CA 4RD9A 5F28E 1E2XA 1UFBA 1ZW2A 2L6HA 2KNHA 2R25A 3U8VA 3RVYA 4ZLDA 1GS9A 2EIKC 3ABLC 4B6IA 1SF8A 5KYWA 2ETSA 1O3UA 2A1DD 4G0HA 2HSQA 5AGFA 5DS5A 1TFKB 4YWQA 3U8PA 1YARO 3OWTA 3WODF 4I3MA 3RVZA 3EZIA 4XPWA 1OCRC 5DQTA 2NSGA 2XLEA 3L34A 1WOLA 2Q3TA 2ZXWC 5E33A 3DJUB 3V5XA 2DI3A 1V4AA 2A68F 1QVXA 1J8MF 2FAPB 4CS9C 4EIYA 5L0IA 2TMVP 1VLSA 3DAFA 5L3VA 2OU6A 3O6XA 3ZTZA 1T6IA 1BDJB 2MWQA 4JURI 3AOUA 1Q0MA 1M6TA 4BEMJ 3C8ZA 3DWWA 1I4YA 2I15A 1PCXA 4KBLA 3LJBA 2PP4A 3O39A 4JTDB 3MFNA 4L6RA 4JIOA 4OIRF 1Q0GA 1QSPA 1JMWA 1Y6DA 1YVIA 2KW3C 2ZXRA 3ATPA 3U0CA 2V26A 4MS2A 5AC5A 3POVA 4O6MA 4YL1A 1MMNA 4C3EA 2Z15A 1RKCA 3FOOA 4LDKA 2YL3A 4QDLA 3T6JA 2YRFA 2KK1A 3DE8A 4MVQA 2LP4A 2R03A 2VH3A 2Y3HA 5B1AC 1GGQA 1MMAA 1NZEA 3JYYA 4NC3A 1E85A 5D91A 4D4XA 5A6BD 4JTCB 2Q00A 1ZU4A 1XZQA 3AG2C 3DM9B 4OINF 1K05A 3UMKA 4A4AA 3ZG1A 2EINC 5BUOA 1YZCA 2CGEA 2EPKX 2R02A 2WZLA 2XL6A 1JPJA 2EILC 4O6YA 2CNWA 1WN0A 3S90A 1APCA 1C02A 3ZTMA 5JT4A 4RDAA 4WJ0A 2WVOA 1L7CA 3EZHA 1TQGA 4F4BA 2Q7RA 3S9OA 3FDQA 3X2QC 2H7VC 3B71A 3RYLA 5L0JA 3S27A 3TOLA 1M2OA 3EPVA 2J7PA 3AQCA 3M4CA 3X1OA 2A0UA 1M57C 3L8IA 3MX3A 2WZGA 1EKYA 4JCZA 2IOQA 5EHHA 4PFPA 3EH2A 1OXKA 3OA1A 4P9TA 3JRTA 3ZIBA 3G4XA 4FX5A 4YT8A 2E87A 2GAQA 4U9EA 4CS8C 3U3BA 3QW1A 4CS7A 3JTLO 1RCPA 3JZ0A 4JRZA 1NLXA 1PV3A 3QZCA 2W45A 4HFKB 5DQZA 5E2QA 3W8HA 1U89A 2RSEB 1YA9A 4YJWA 2NUPA 2GA0A 4E0IA 2HZ8A 3FOPA 5COFA 4DXWA 2PF4E 2OJED 4BJTA 3EH1A 3JSEO 4MQ9F 1D0XA 1JRAA 3HNKA 3NYLA 4U5DE 2NUTA 1A7DA 1YZAA 4CSAC 3AG1C 4CIHA 4E7ZA 2Y69C 4ULVA 2IYLD 2PNOA 2Q4FA 2R7UA 4DJ9A 1RMVA 3KPHA 4HE8D 3Q7GA 4K7BA 5KYYB 4U9DA 4U5FE 2R7RA 2AVKA 3L0IA 4CDYA 4Q5SF 1B68A 4XEKA 1CPRA 2IXNA 3EQLF 2EIJC 4G7ZF 1NU9C 2H7BA 4BEJA 3W8IA 3NYJA 1Z63A 2IXPA 1C17M 1LPEA 1ZW3A 2CCYA 2VCBA 3AQBA 3GANA 1OQCA 4AK9A 4GYTA 3DI5A 1CGME 1XZPA 1JOGA 2OOCA 2W4MA 3MBGA 4G78A 2EPOA 4N6CA 2OQMA 3U5SA 3LS1A 3WG7C 2ICWG 3OEOA 4CS9A 3VAYA 2WVQA 2L6FA 1EI7A 3MLGA 2LCHA 4WABA 2R7SA 1CPQA 4JCHA 1A41A 1ZHYA 3C62A 2CNWD 3N2ZB 4LLEA 3W4YA 4EHPA 4FESA 2GDCA 5GPGB 2V3CC 5L0FA 1Z3IX 2Q9AA 3H65A 4DVZA 3K1IC 2HMQA 1WASA 4MVOA 3QMKA 4Z9JA 2XM4A 3GWNA 1Z6AA 2NUPB 2J7PD 1M2VA 3H2VA 3NMKA 4JC7A 5B3SC 2KSFA 1CGOA 2Y3GA 2YKZA 2XLWA 4I44A 3DJNB 2A69F 3KYIA 3RIPA 2B0JA 2LIGA 2NUTB 2YHSA 2C03A 3M4BA 4PJJA 1D1BA 1YYXA 3U2LA 5JLIA 2J0XA 1O5HA 2IXMA 4IB4A 4IRUA 4U5BE 2QNLA 4CJGA 3KH2A 4ER9A 3K7DA 2I8BA 2QTVA 3Q7LA 3SEOA 2L6GA 3WHNA 4CIPA 4XEFA 1KNYA 3IQCA 5FZTA 3TK0A 5KYUA 3I5QA 1LI5A 1LI7A 4ONSA 4WGZA 4MW3A 3K33A 1H9TA 2P7VA 5JP7A 5KYXA 4GEHA 1LE4A 4N06A 1TWCA 1PD0A 4HFFB 1OCZC 1VK5A 2D4UA 2HUJA 2RD9A 2VCAA 2KGOA 2UUHA 3TOMA 1RXQA 5JVEA 2YLIA 4E17A 1QPUA 1YA7O 3AG4C 3S29A 3ZQVA 1E84A 3LNMB 2QY9A 1GQAA 3V5YA 1D1AA 3ZC4A 2R9RB 3Q6NA 4BPMA 4I1OB 5DS4A 5L0HA 2HSBA 3L8JA 2MHRA 3KL4A 1OCCC 2J45A 2WVNA 1AVOB 1SZIA 3JSZA 5COGA 2OEVA 4CS8A 3ZWIA 1SYQA 1IZMA 4JE9A 3LS0A 4X0RA 4H4KC 4EWCA 1NFOA 1Q0KA 1LIHA 2EIMC 4PFOA 2FFHA 4LLCA 4Z9HA 3SXYA 4DOZA 1CGNA 2OCCC 4PR9A 3UR3C 3GEEA 3GWLA 4AE4A 2PX0A 1M2VB 1T01A 3EJNA 3US6A 2PX3A 2YL7A 3GM1A 1K40A 2J9VA 4J7TA 1VTMP 1ZU5A 2J9WA 2VC9A 4I1MA 3T9OA 3C63A 4JJFA 2XLVA 2DYRC 1K04A 3ZDLA 4W8PA 3RFYA 4C3DA 3NMIA 1FFHA 4EBJA 3JYHA 5KYWB 3BEHA 2CW0F 4CSAA 2HS5A 1BR4A 3C8GA 3DE9A 4W8KA 2A6EF 3MYIA 4P6IC 3UMIA 4E0HA 2ZD9A 5KYUB 3B0PA 2L9JA 2F22A 3FXHA 4JZAA 1N1CA 4AL1A 2VB6A 2X51A 1QLEC 5KYXB 1HW2A 1BBHA 1HMOA 3DXJF 2DGJA 4YL0A 4AX2A 4O79A 4M63A 3B0UX 2AP3A 5A6AA 2YQYA 3QVYA 3CAXA 3N0TA
chains in the Genus database with same CATH topology
4ZLCA 1SMYF 2NG1A 3VYWA 2H7OA 3EGXA 1G8XA 4O6NA 2PFDA 5E3CA 4XLPF 4C7OA 3HLZA 4OIQF 3B0VC 4YT4A 3DZAA 2ZPAA 2CDQA 2WZFA 3NKDA 2Y39A 1NG1A 1M56C 4O7GA 3PHF2 4AE4B 3HJCA 3EFOA 2G3VA 4U5EE 3NYMA 4YT5A 3DMDA 4QI0A 3GODA 3SP1A 1VYKA 4BJ6C 3I5PA 3NRHA 4ULWA 3DD7A 5FCLA 3UGPA 5T3TA 2IXOA 2R7VA 3CQZA 4MNDA 3TD7A 3EG9A 4XLNF 1VYIA 5F5HA 4DVYP 4IAOA 4IJJA 4KNVA 2JD3A 3NG1A 3ASNC 3ASOC 5DS6A 1MMGA 4RBNA 2KJGA 3EGDA 3S0XA 1RJ9A 1BR2A 4PJLA 3B9QA 1VOMA 3LAYA 3W2VA 2Q9BA 3EGXB 3JT1A 4U5CE 2G3KA 4HEAJ 4C3BA 1FTSA 3DM5A 3JCUQ 3FHDA 5CI8A 5B1BC 4YT2A 1ZHWA 2W9YA 5EGYA 4JVSA 1D0YA 2M4EA 4G7HF 5DVWA 1ZHZA 3EFOB 3UMHA 2FGYA 5T1DB 5IY5C 1MMDA 2HV6A 2O9XA 1BR1A 3ITFA 3Q6MA 3LEVA 2D5RB 3V7OA 2G62A 4NY3A 5KYNA 3EG9B 3W2WA 1KU2A 5E3AA 3LLKA 1JPNA 1V54C 2ZXOA 1TKNA 3EGDB 1RJ9B 4CBEA 1Z23A 2GFHA 1NU7D 1LVKA 4DBQA 2ZXPA 1S7ZA 3UNGC 4PJMA 3RH3A 1ZYRF 1J8YF 1TWGA 3SYNA 3T6BA 4BG0A 4KNWA 2YZSA 4BJ5C 3ABKC 1ZHTA 4IWBA 2Y3DA 1ZHXA 2R7WA 3F47A 4XWJA 4BJ6A 3EHNA 3HTKC 4DBRA 3K6BA 3T4RA 3UGOA 4A2NB 3E70C 2XL4A 3M1CB 2P6VA 5L3QA 4Q4ZF 3DAGA 4ANJA 4J30B 1OKKA 3LNRA 4OIPF 4LERA 2DYSC 3PMRA 5KYYA 1FFTC 3LESA 2A6HF 3SNHA 3AG3C 2MYSA 2KQ9A 3E9VA 4OD4A 2WL8A 2R7XA 2WB7A 2J46A 1TWHA 3ZSUA 1D1CA 3RKOF 1LKXA 1IW7F 4QI2A 3ABMC 1V55C 4U5HA 3NDBB 4U5GA 4FWVA 2J0WA 4E7SA 2L81A 4K0DA 2R7QA 1MNEA 1FMVA 2OG2A 3K1HA 2XXAA 1WGWA 1FMWA 5DLJA 2R7OA 4G7OF 3I4UA 1ST6A 1Z5ZA 1W2WA 1D0ZA 4OD5A 4XTKA 1PD1A 1VMAA 2LSEA 3ECSA 1QZXA 2W4BA 5T3WA 1O87A 4C7OB 2VASA 3N24A 4PK4A 1LS1A 3IEEA 2HV7A 3KKBA 4BJ1A 5D92A 2Q9CA 3FVYA 3S28A 2J9UA 4KI2A 3EHMA 1TR2A 2BE5F 4BJ5A 5F5FA 1OKKD 2XRHA 3NKEA 3FAJA 1TWAA 3CSKA 4EBBA 1MNDA 2Y3BA 3CZ6A 4YN0B 4JJGA 4JW1A 1OCOC 3KMIA 3F46A 2R7TA 2C04A 2YEVA 3ZVRA 4KC9A 4LACB 3LLIA 5CI9A 4J32B 2XXAB 3K66A 2XSEA 4Q7CA 4RD9A 2KNHA 4ZLDA 2EIKC 3ABLC 4B6IA 1SF8A 5KYWA 2A1DD 4G0HA 5DS5A 4YWQA 3OWTA 3WODF 4I3MA 3EZIA 1OCRC 5DQTA 3L34A 5E33A 2Q3TA 2ZXWC 3DJUB 2A68F 4CS9C 1J8MF 3DAFA 5L3VA 3O6XA 2MWQA 4JURI 1PCXA 4KBLA 3LJBA 2PP4A 3O39A 4OIRF 5HSWA 2KW3C 2ZXRA 2V26A 3POVA 4O6MA 1MMNA 4C3EA 2Z15A 3T6JA 4QDLA 2Y3HA 2VH3A 5B1AC 1NZEA 1MMAA 5D91A 1ZU4A 3AG2C 3DM9B 4OINF 3UMKA 3ZG1A 2EINC 5BUOA 4O6YA 2CGEA 2WZLA 4PJNA 3SZRA 1JPJA 2EILC 2CNWA 4RDAA 4WJ0A 2WVOA 3EZHA 4F4BA 3FDQA 3X2QC 2H7VC 3RYLA 3S27A 1M2OA 3EPVA 2J7PA 3AQCA 3X1OA 1M57C 3MX3A 2WZGA 2IOQA 5EHHA 4PFPA 3EH2A 3OA1A 3JRTA 3ZIBA 4FX5A 4YT8A 2E87A 4CS8C 4CS7A 3QZCA 2W45A 4HFKB 5DQZA 5E2QA 3W8HA 4YJWA 2NUPA 2PF4E 4BJTA 3EH1A 4MQ9F 1D0XA 3NYLA 4U5DE 2NUTA 4CSAC 3AG1C 4CIHA 4E7ZA 2Y69C 2IYLD 2R7UA 4HE8D 3Q7GA 4K7BA 5KYYB 2R7RA 4U5FE 4Q5SF 3L0IA 2IXNA 3EQLF 2EIJC 4G7ZF 1NU9C 2H7BA 4BEJA 3W8IA 3NYJA 1Z63A 2IXPA 3GANA 4AK9A 3AQBA 4GYTA 2W4MA 3WG7C 3LS1A 3OEOA 4CS9A 3VAYA 2WVQA 3MLGA 2R7SA 4JCHA 4LLEA 1ZHYA 3N2ZB 2CNWD 4FESA 2V3CC 1Z3IX 2Q9AA 3H65A 4DVZA 3K1IC 3QMKA 1Z6AA 2NUPB 2J7PD 1M2VA 5B3SC 2Y3GA 4I44A 3DJNB 2A69F 3RIPA 2B0JA 2YHSA 2NUTB 4PJJA 2C03A 1D1BA 2J0XA 1O5HA 2IXMA 4IRUA 4U5BE 3KH2A 3K7DA 2I8BA 2QTVA 3Q7LA 3SEOA 5KYUA 3I5QA 3K33A 2P7VA 5KYXA 4GEHA 4N06A 1TWCA 1PD0A 4HFFB 1OCZC 1VK5A 2KGOA 3AG4C 3S29A 2QY9A 1D1AA 3ZC4A 3Q6NA 5DS4A 4I1OB 3KL4A 1OCCC 2J45A 2WVNA 1SZIA 3JSZA 4CS8A 1IZMA 4X0RA 3LS0A 4H4KC 4EWCA 2EIMC 4PFOA 2FFHA 4LLCA 4DOZA 2OCCC 3UR3C 4AE4A 2PX0A 1M2VB 3EJNA 2PX3A 2J9VA 1ZU5A 2J9WA 4I1MA 4JJFA 2DYRC 3RFYA 4C3DA 1FFHA 3JYHA 5KYWB 2CW0F 4CSAA 1BR4A 4W8KA 2A6EF 4P6IC 3UMIA 5KYUB 3B0PA 2L9JA 4OIOF 4JZAA 1N1CA 2VB6A 2X51A 1QLEC 5KYXB 3DXJF 2DGJA 4AX2A 4O79A 4M63A 3B0UX 3N0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZC A;  2Y3D A;  3ITF A;  3O39 A;  2Y3G A;  2Y3B A;  3LAY A;  2Y3H A;  2Y39 A;  3OEO A;  3ZG1 A;  3EPV A; 
#chains in the Genus database with same CATH topology
 4ZLC A;  1SMY F;  1NFN A;  2NG1 A;  1LS4 A;  3VYW A;  3AGT A;  2H7O A;  3EGX A;  1G8X A;  4IAR A;  4O6N A;  2PFD A;  1U0B B;  1G4W R;  5E3C A;  2R05 A;  4XLP F;  4C7O A;  3HLZ A;  2X0C A;  3BRJ A;  4OIQ F;  3B0V C;  1VLT A;  4DRH B;  4YT4 A;  3DZA A;  4EKW A;  3A11 A;  2ZPA A;  2LFD A;  5JS5 A;  2CDQ A;  4YK5 A;  2WZF A;  3K1I A;  2Y39 A;  1NG1 A;  1M56 C;  3NKD A;  4O7G A;  3RQE A;  3PHF 2;  4AE4 B;  1WAT A;  3HJC A;  1EQ1 A;  1T6U A;  3EFO A;  2XLO A;  2G3V A;  2XLH A;  2QLA A;  4NTB A;  4U5E E;  3RF3 A;  3NYM A;  3SZR A;  1V74 B;  3DMD A;  4YT5 A;  4QI0 A;  3GOD A;  3SP1 A;  1VYK A;  4XPY A;  3IHU A;  4MTG A;  4BJ6 C;  3I5P A;  2XLD A;  3NRH A;  3DD7 A;  4ULW A;  2YWA A;  5T3T A;  3C8G B;  2IXO A;  3TQO A;  5FCL A;  3UGP A;  2R7V A;  3CQZ A;  4MND A;  3TD7 A;  5TJ5 E;  2GWW A;  2PBE A;  3EG9 A;  4XLN F;  1VYI A;  5F5H A;  4DVY P;  4IAO A;  4IJJ A;  4KNV A;  3ZQY A;  1Z7Q c;  1YDI A;  3IQ5 A;  2JD3 A;  3NG1 A;  4NTF A;  3C7J A;  3O10 A;  2P1A A;  3SXM A;  1ORY A;  3ASN C;  2QUP A;  1NSG B;  3ASO C;  1MMG A;  2AU5 A;  3GEI A;  4RBN A;  5DS6 A;  2KJG A;  3EGD A;  3S0X A;  1RJ9 A;  1BR2 A;  4PJL A;  5BQH A;  3B9Q A;  1T9K A;  1ZZP A;  1VOM A;  2M64 A;  2YL0 A;  3LAY A;  2A0B A;  3W2V A;  2Q9B A;  3EGX B;  3JT1 A;  1C03 A;  4U5C E;  2G3K A;  3TJ6 A;  2KC3 A;  5CIV A;  4HEA J;  4C3B A;  1FTS A;  3C8G D;  3DM5 A;  3JCU Q;  3FHD A;  5CI8 A;  1H6G A;  5B1B C;  4YT2 A;  1KTM A;  1ZHW A;  2DB4 A;  2P61 A;  3HKK A;  4DRI B;  2W9Y A;  5EGY A;  4Z9I A;  2AWC A;  2XS1 A;  4JVS A;  3NMJ A;  1D0Y A;  4J7Y A;  2M4E A;  4G7H F;  4NCQ A;  3G4Z A;  1E86 A;  2OEX A;  5DVW A;  1ZHZ A;  1H9G A;  1AUE A;  2XM0 A;  3EFO B;  3JRM O;  5A6K A;  3B29 A;  4LDQ A;  3UMH A;  2FGY A;  1AEP A;  3G50 A;  5EK0 A;  1MMD A;  5T1D B;  5IY5 C;  5L0G A;  2HV6 A;  2O9X A;  1BR1 A;  3ITF A;  4N4W A;  1R5I D;  256B A;  5JSL A;  3Q6M A;  3LEV A;  2D5R B;  3V7O A;  2G62 A;  1E83 A;  4NY3 A;  5KYN A;  3GM3 A;  3EG9 B;  4MTO A;  3W2W A;  1OW7 A;  4XEV A;  5A69 A;  1YYJ A;  1KU2 A;  4MVM A;  5E3A A;  3U9M A;  4JEB A;  3LLK A;  4IAQ A;  3GOR A;  1JPN A;  1OW6 A;  1MQV A;  1V54 C;  1EA8 A;  1FNT c;  2HJ3 A;  3H2U A;  4XQ1 A;  2XL8 A;  1TKN A;  2ZXO A;  1RJ9 B;  3EGD B;  1Z23 A;  1H7I A;  1NU7 D;  2GFH A;  4MVR A;  3V5Z A;  1NBB A;  4CBE A;  1LVK A;  1F1M A;  4DBQ A;  1OXB A;  2ZXP A;  1S7Z A;  3CEX A;  3UNG C;  1HE9 A;  3KYJ A;  1DOV A;  3HNJ A;  4PJM A;  1BZ4 A;  3RH3 A;  1ZYR F;  1J8Y F;  1TWG A;  3SYN A;  3TJ5 A;  3U9J A;  3T6B A;  4JEA A;  5L0C A;  4FAP B;  4JTA B;  3S84 A;  5BQI A;  4BG0 A;  4KNW A;  1FAP B;  2YZS A;  4BJ5 C;  3ABK C;  3T6G B;  5HV9 A;  3AGU A;  1ZHT A;  1WWP A;  4IWB A;  2Y3D A;  4MVU A;  1U6H A;  1ORJ A;  2LFF A;  1ZHX A;  3DKA A;  3FMS A;  2R7W A;  3F47 A;  1GM5 A;  1Q0D A;  2ASR A;  3GM2 A;  2LK4 A;  1JR8 A;  3FAP B;  4XWJ A;  1Y4C A;  4XPX A;  1WTY A;  2HKV A;  1UG7 A;  3AJM A;  2YL1 A;  4BJ6 A;  5B3I A;  3EHN A;  1OR2 A;  1OR3 A;  3HTK C;  4DBR A;  4CX9 A;  3K6B A;  2EPM X;  2YLD A;  2HFI A;  4N6H A;  3T4R A;  4CDA A;  3UGO A;  4PJN A;  2H8A A;  3E70 C;  3U3F A;  4A2N B;  2L7A A;  2XL4 A;  3QW0 A;  4EUK B;  4YL3 A;  3IQ6 A;  3M1C B;  2P6V A;  5L3Q A;  4Q4Z F;  1QKR A;  3DAG A;  4ANJ A;  4J30 B;  1OKK A;  3LNR A;  4LDR A;  3QVZ A;  4LER A;  2B0H A;  3WAQ A;  4OIP F;  2DYS C;  1YAU O;  4MTF A;  3SXK A;  3PMR A;  5KYY A;  1FFT C;  3LES A;  2A6H F;  3SNH A;  3AG3 C;  3PDM P;  4E18 A;  2MYS A;  1TFO B;  4UDV A;  2KQ9 A;  3M79 A;  1SR2 A;  2OJQ A;  2YVK A;  3E9V A;  4IGG A;  1JAF A;  4OD4 A;  5JRA A;  1LE2 A;  2WL8 A;  1T6Q A;  2R7X A;  2J9B A;  2WB7 A;  1RKE A;  1VB5 A;  2J46 A;  5A6J A;  3QTH A;  3A9C A;  1TWH A;  1FR0 A;  3ZSU A;  4NTA A;  1D1C A;  3L1M A;  1LKX A;  3RKO F;  3IPM O;  4PAC A;  4DRJ B;  1IW7 F;  4NQF A;  1YLM A;  4QI2 A;  1HY5 A;  3ABM C;  3RW0 A;  1V55 C;  2XLM A;  3MYF A;  4U5H A;  1G4U S;  1XWJ A;  4FWV A;  4U5G A;  1ZVZ A;  4D4N A;  3NDB B;  2J0W A;  4E7S A;  1G5Z A;  1A0B A;  2L81 A;  1DOW A;  4K0D A;  2JX0 A;  3HNI A;  2IBF A;  2R7Q A;  1MNE A;  2CYD A;  1FMV A;  2OG2 A;  3K1H A;  3R7C A;  4AL0 A;  4GQH A;  4OIO F;  2YLG A;  2XXA A;  1WGW A;  1I5N A;  1FMW A;  1A7V A;  5DLJ A;  2UUI A;  2R7O A;  3LUT B;  3R2P A;  2LQG A;  5K0I A;  4G7O F;  3I4U A;  1S05 A;  3IQT A;  1ST6 A;  4CDV A;  1T5O A;  2BL2 A;  2NPU A;  1Z5Z A;  1W2W A;  3RQG A;  1A7E A;  1D0Z A;  2HMZ A;  1HMD A;  2BC5 A;  2HJM A;  2P0N A;  4OD5 A;  4XTK A;  1PD1 A;  1VMA A;  2LSE A;  3ECS A;  1QZX A;  2W4B A;  4MVS A;  3U2M A;  5T3W A;  1Q0F A;  3O55 A;  3VRC A;  1YJG A;  3RQF A;  1O87 A;  4C7O B;  1L3P A;  2VAS A;  3N24 A;  1I4Z A;  4PK4 A;  3M15 A;  4P9F A;  1HE1 A;  1LS1 A;  3IEE A;  2HV7 A;  3KKB A;  4BJ1 A;  5D92 A;  2IM8 A;  2Q9C A;  4MW8 A;  3FVY A;  3HNL A;  5AC4 A;  5JUA A;  4R32 A;  2AWY A;  4WGY A;  1RKE B;  5A6B A;  5L0D A;  2EPN A;  3J06 A;  5COM A;  3LEO A;  3S28 A;  2J9U A;  2J8W A;  4KI2 A;  4JKV A;  3VF0 A;  3EHM A;  3VM6 A;  1TR2 A;  4K1O A;  3TUL A;  2BE5 F;  5BQG A;  1OW8 A;  4BJ5 A;  5F5F A;  2XS8 A;  1OKK D;  2XRH A;  3NKE A;  3SXZ A;  3FAJ A;  1TWA A;  1LM3 B;  1HW1 A;  3CSK A;  4EBB A;  1MND A;  2EPL X;  2NSF A;  2Y3B A;  3CZ6 A;  4YN0 B;  4JJG A;  4JW1 A;  4CJO A;  4H54 A;  3GEH A;  1OCO C;  3KMI A;  3PCV A;  1QQ3 A;  2KYH A;  3C18 A;  3F46 A;  2R7T A;  2C04 A;  2QE9 A;  2OKU A;  2VCC A;  2YEV A;  2JPU A;  4KC9 A;  4LAC B;  3LLI A;  3ZVR A;  4MVZ A;  5CI9 A;  4J32 B;  5HSW A;  1ORS C;  4EBK A;  1R4T A;  2XXA B;  3K66 A;  2XSE A;  2LD6 A;  4Q7C A;  4RD9 A;  5F28 E;  1E2X A;  1UFB A;  1ZW2 A;  2L6H A;  2KNH A;  2R25 A;  3U8V A;  3RVY A;  4ZLD A;  1GS9 A;  2EIK C;  3ABL C;  4B6I A;  1SF8 A;  5KYW A;  2ETS A;  1O3U A;  2A1D D;  4G0H A;  2HSQ A;  5AGF A;  5DS5 A;  1TFK B;  4YWQ A;  3U8P A;  1YAR O;  3OWT A;  3WOD F;  4I3M A;  3RVZ A;  3EZI A;  4XPW A;  1OCR C;  5DQT A;  2NSG A;  2XLE A;  3L34 A;  1WOL A;  2Q3T A;  2ZXW C;  5E33 A;  3DJU B;  3V5X A;  2DI3 A;  1V4A A;  2A68 F;  1QVX A;  1J8M F;  2FAP B;  4CS9 C;  4EIY A;  5L0I A;  2TMV P;  1VLS A;  3DAF A;  5L3V A;  2OU6 A;  3O6X A;  3ZTZ A;  1T6I A;  1BDJ B;  2MWQ A;  4JUR I;  3AOU A;  1Q0M A;  1M6T A;  4BEM J;  3C8Z A;  3DWW A;  1I4Y A;  2I15 A;  1PCX A;  4KBL A;  3LJB A;  2PP4 A;  3O39 A;  4JTD B;  3MFN A;  4L6R A;  4JIO A;  4OIR F;  1Q0G A;  1QSP A;  1JMW A;  1Y6D A;  1YVI A;  2KW3 C;  2ZXR A;  3ATP A;  3U0C A;  2V26 A;  4MS2 A;  5AC5 A;  3POV A;  4O6M A;  4YL1 A;  1MMN A;  4C3E A;  2Z15 A;  1RKC A;  3FOO A;  4LDK A;  2YL3 A;  4QDL A;  3T6J A;  2YRF A;  2KK1 A;  3DE8 A;  4MVQ A;  2LP4 A;  2R03 A;  2VH3 A;  2Y3H A;  5B1A C;  1GGQ A;  1MMA A;  1NZE A;  3JYY A;  4NC3 A;  1E85 A;  5D91 A;  4D4X A;  5A6B D;  4JTC B;  2Q00 A;  1ZU4 A;  1XZQ A;  3AG2 C;  3DM9 B;  4OIN F;  1K05 A;  3UMK A;  4A4A A;  3ZG1 A;  2EIN C;  5BUO A;  1YZC A;  2CGE A;  2EPK X;  2R02 A;  2WZL A;  2XL6 A;  1JPJ A;  2EIL C;  4O6Y A;  2CNW A;  1WN0 A;  3S90 A;  1APC A;  1C02 A;  3ZTM A;  5JT4 A;  4RDA A;  4WJ0 A;  2WVO A;  1L7C A;  3EZH A;  1TQG A;  4F4B A;  2Q7R A;  3S9O A;  3FDQ A;  3X2Q C;  2H7V C;  3B71 A;  3RYL A;  5L0J A;  3S27 A;  3TOL A;  1M2O A;  3EPV A;  2J7P A;  3AQC A;  3M4C A;  3X1O A;  2A0U A;  1M57 C;  3L8I A;  3MX3 A;  2WZG A;  1EKY A;  4JCZ A;  2IOQ A;  5EHH A;  4PFP A;  3EH2 A;  1OXK A;  3OA1 A;  4P9T A;  3JRT A;  3ZIB A;  3G4X A;  4FX5 A;  4YT8 A;  2E87 A;  2GAQ A;  4U9E A;  4CS8 C;  3U3B A;  3QW1 A;  4CS7 A;  3JTL O;  1RCP A;  3JZ0 A;  4JRZ A;  1NLX A;  1PV3 A;  3QZC A;  2W45 A;  4HFK B;  5DQZ A;  5E2Q A;  3W8H A;  1U89 A;  2RSE B;  1YA9 A;  4YJW A;  2NUP A;  2GA0 A;  4E0I A;  2HZ8 A;  3FOP A;  5COF A;  4DXW A;  2PF4 E;  2OJE D;  4BJT A;  3EH1 A;  3JSE O;  4MQ9 F;  1D0X A;  1JRA A;  3HNK A;  3NYL A;  4U5D E;  2NUT A;  1A7D A;  1YZA A;  4CSA C;  3AG1 C;  4CIH A;  4E7Z A;  2Y69 C;  4ULV A;  2IYL D;  2PNO A;  2Q4F A;  2R7U A;  4DJ9 A;  1RMV A;  3KPH A;  4HE8 D;  3Q7G A;  4K7B A;  5KYY B;  4U9D A;  4U5F E;  2R7R A;  2AVK A;  3L0I A;  4CDY A;  4Q5S F;  1B68 A;  4XEK A;  1CPR A;  2IXN A;  3EQL F;  2EIJ C;  4G7Z F;  1NU9 C;  2H7B A;  4BEJ A;  3W8I A;  3NYJ A;  1Z63 A;  2IXP A;  1C17 M;  1LPE A;  1ZW3 A;  2CCY A;  2VCB A;  3AQB A;  3GAN A;  1OQC A;  4AK9 A;  4GYT A;  3DI5 A;  1CGM E;  1XZP A;  1JOG A;  2OOC A;  2W4M A;  3MBG A;  4G78 A;  2EPO A;  4N6C A;  2OQM A;  3U5S A;  3LS1 A;  3WG7 C;  2ICW G;  3OEO A;  4CS9 A;  3VAY A;  2WVQ A;  2L6F A;  1EI7 A;  3MLG A;  2LCH A;  4WAB A;  2R7S A;  1CPQ A;  4JCH A;  1A41 A;  1ZHY A;  3C62 A;  2CNW D;  3N2Z B;  4LLE A;  3W4Y A;  4EHP A;  4FES A;  2GDC A;  5GPG B;  2V3C C;  5L0F A;  1Z3I X;  2Q9A A;  3H65 A;  4DVZ A;  3K1I C;  2HMQ A;  1WAS A;  4MVO A;  3QMK A;  4Z9J A;  2XM4 A;  3GWN A;  1Z6A A;  2NUP B;  2J7P D;  1M2V A;  3H2V A;  3NMK A;  4JC7 A;  5B3S C;  2KSF A;  1CGO A;  2Y3G A;  2YKZ A;  2XLW A;  4I44 A;  3DJN B;  2A69 F;  3KYI A;  3RIP A;  2B0J A;  2LIG A;  2NUT B;  2YHS A;  2C03 A;  3M4B A;  4PJJ A;  1D1B A;  1YYX A;  3U2L A;  5JLI A;  2J0X A;  1O5H A;  2IXM A;  4IB4 A;  4IRU A;  4U5B E;  2QNL A;  4CJG A;  3KH2 A;  4ER9 A;  3K7D A;  2I8B A;  2QTV A;  3Q7L A;  3SEO A;  2L6G A;  3WHN A;  4CIP A;  4XEF A;  1KNY A;  3IQC A;  5FZT A;  3TK0 A;  5KYU A;  3I5Q A;  1LI5 A;  1LI7 A;  4ONS A;  4WGZ A;  4MW3 A;  3K33 A;  1H9T A;  2P7V A;  5JP7 A;  5KYX A;  4GEH A;  1LE4 A;  4N06 A;  1TWC A;  1PD0 A;  4HFF B;  1OCZ C;  1VK5 A;  2D4U A;  2HUJ A;  2RD9 A;  2VCA A;  2KGO A;  2UUH A;  3TOM A;  1RXQ A;  5JVE A;  2YLI A;  4E17 A;  1QPU A;  1YA7 O;  3AG4 C;  3S29 A;  3ZQV A;  1E84 A;  3LNM B;  2QY9 A;  1GQA A;  3V5Y A;  1D1A A;  3ZC4 A;  2R9R B;  3Q6N A;  4BPM A;  4I1O B;  5DS4 A;  5L0H A;  2HSB A;  3L8J A;  2MHR A;  3KL4 A;  1OCC C;  2J45 A;  2WVN A;  1AVO B;  1SZI A;  3JSZ A;  5COG A;  2OEV A;  4CS8 A;  3ZWI A;  1SYQ A;  1IZM A;  4JE9 A;  3LS0 A;  4X0R A;  4H4K C;  4EWC A;  1NFO A;  1Q0K A;  1LIH A;  2EIM C;  4PFO A;  2FFH A;  4LLC A;  4Z9H A;  3SXY A;  4DOZ A;  1CGN A;  2OCC C;  4PR9 A;  3UR3 C;  3GEE A;  3GWL A;  4AE4 A;  2PX0 A;  1M2V B;  1T01 A;  3EJN A;  3US6 A;  2PX3 A;  2YL7 A;  3GM1 A;  1K40 A;  2J9V A;  4J7T A;  1VTM P;  1ZU5 A;  2J9W A;  2VC9 A;  4I1M A;  3T9O A;  3C63 A;  4JJF A;  2XLV A;  2DYR C;  1K04 A;  3ZDL A;  4W8P A;  3RFY A;  4C3D A;  3NMI A;  1FFH A;  4EBJ A;  3JYH A;  5KYW B;  3BEH A;  2CW0 F;  4CSA A;  2HS5 A;  1BR4 A;  3C8G A;  3DE9 A;  4W8K A;  2A6E F;  3MYI A;  4P6I C;  3UMI A;  4E0H A;  2ZD9 A;  5KYU B;  3B0P A;  2L9J A;  2F22 A;  3FXH A;  4JZA A;  1N1C A;  4AL1 A;  2VB6 A;  2X51 A;  1QLE C;  5KYX B;  1HW2 A;  1BBH A;  1HMO A;  3DXJ F;  2DGJ A;  4YL0 A;  4AX2 A;  4O79 A;  4M63 A;  3B0U X;  2AP3 A;  5A6A A;  2YQY A;  3QVY A;  3CAX A;  3N0T A; 
#chains in the Genus database with same CATH homology
 4ZLC A;  1SMY F;  2NG1 A;  3VYW A;  2H7O A;  3EGX A;  1G8X A;  4O6N A;  2PFD A;  5E3C A;  4XLP F;  4C7O A;  3HLZ A;  4OIQ F;  3B0V C;  4YT4 A;  3DZA A;  2ZPA A;  2CDQ A;  2WZF A;  3NKD A;  2Y39 A;  1NG1 A;  1M56 C;  4O7G A;  3PHF 2;  4AE4 B;  3HJC A;  3EFO A;  2G3V A;  4U5E E;  3NYM A;  4YT5 A;  3DMD A;  4QI0 A;  3GOD A;  3SP1 A;  1VYK A;  4BJ6 C;  3I5P A;  3NRH A;  4ULW A;  3DD7 A;  5FCL A;  3UGP A;  5T3T A;  2IXO A;  2R7V A;  3CQZ A;  4MND A;  3TD7 A;  3EG9 A;  4XLN F;  1VYI A;  5F5H A;  4DVY P;  4IAO A;  4IJJ A;  4KNV A;  2JD3 A;  3NG1 A;  3ASN C;  3ASO C;  5DS6 A;  1MMG A;  4RBN A;  2KJG A;  3EGD A;  3S0X A;  1RJ9 A;  1BR2 A;  4PJL A;  3B9Q A;  1VOM A;  3LAY A;  3W2V A;  2Q9B A;  3EGX B;  3JT1 A;  4U5C E;  2G3K A;  4HEA J;  4C3B A;  1FTS A;  3DM5 A;  3JCU Q;  3FHD A;  5CI8 A;  5B1B C;  4YT2 A;  1ZHW A;  2W9Y A;  5EGY A;  4JVS A;  1D0Y A;  2M4E A;  4G7H F;  5DVW A;  1ZHZ A;  3EFO B;  3UMH A;  2FGY A;  5T1D B;  5IY5 C;  1MMD A;  2HV6 A;  2O9X A;  1BR1 A;  3ITF A;  3Q6M A;  3LEV A;  2D5R B;  3V7O A;  2G62 A;  4NY3 A;  5KYN A;  3EG9 B;  3W2W A;  1KU2 A;  5E3A A;  3LLK A;  1JPN A;  1V54 C;  2ZXO A;  1TKN A;  3EGD B;  1RJ9 B;  4CBE A;  1Z23 A;  2GFH A;  1NU7 D;  1LVK A;  4DBQ A;  2ZXP A;  1S7Z A;  3UNG C;  4PJM A;  3RH3 A;  1ZYR F;  1J8Y F;  1TWG A;  3SYN A;  3T6B A;  4BG0 A;  4KNW A;  2YZS A;  4BJ5 C;  3ABK C;  1ZHT A;  4IWB A;  2Y3D A;  1ZHX A;  2R7W A;  3F47 A;  4XWJ A;  4BJ6 A;  3EHN A;  3HTK C;  4DBR A;  3K6B A;  3T4R A;  3UGO A;  4A2N B;  3E70 C;  2XL4 A;  3M1C B;  2P6V A;  5L3Q A;  4Q4Z F;  3DAG A;  4ANJ A;  4J30 B;  1OKK A;  3LNR A;  4OIP F;  4LER A;  2DYS C;  3PMR A;  5KYY A;  1FFT C;  3LES A;  2A6H F;  3SNH A;  3AG3 C;  2MYS A;  2KQ9 A;  3E9V A;  4OD4 A;  2WL8 A;  2R7X A;  2WB7 A;  2J46 A;  1TWH A;  3ZSU A;  1D1C A;  3RKO F;  1LKX A;  1IW7 F;  4QI2 A;  3ABM C;  1V55 C;  4U5H A;  3NDB B;  4U5G A;  4FWV A;  2J0W A;  4E7S A;  2L81 A;  4K0D A;  2R7Q A;  1MNE A;  1FMV A;  2OG2 A;  3K1H A;  2XXA A;  1WGW A;  1FMW A;  5DLJ A;  2R7O A;  4G7O F;  3I4U A;  1ST6 A;  1Z5Z A;  1W2W A;  1D0Z A;  4OD5 A;  4XTK A;  1PD1 A;  1VMA A;  2LSE A;  3ECS A;  1QZX A;  2W4B A;  5T3W A;  1O87 A;  4C7O B;  2VAS A;  3N24 A;  4PK4 A;  1LS1 A;  3IEE A;  2HV7 A;  3KKB A;  4BJ1 A;  5D92 A;  2Q9C A;  3FVY A;  3S28 A;  2J9U A;  4KI2 A;  3EHM A;  1TR2 A;  2BE5 F;  4BJ5 A;  5F5F A;  1OKK D;  2XRH A;  3NKE A;  3FAJ A;  1TWA A;  3CSK A;  4EBB A;  1MND A;  2Y3B A;  3CZ6 A;  4YN0 B;  4JJG A;  4JW1 A;  1OCO C;  3KMI A;  3F46 A;  2R7T A;  2C04 A;  2YEV A;  3ZVR A;  4KC9 A;  4LAC B;  3LLI A;  5CI9 A;  4J32 B;  2XXA B;  3K66 A;  2XSE A;  4Q7C A;  4RD9 A;  2KNH A;  4ZLD A;  2EIK C;  3ABL C;  4B6I A;  1SF8 A;  5KYW A;  2A1D D;  4G0H A;  5DS5 A;  4YWQ A;  3OWT A;  3WOD F;  4I3M A;  3EZI A;  1OCR C;  5DQT A;  3L34 A;  5E33 A;  2Q3T A;  2ZXW C;  3DJU B;  2A68 F;  4CS9 C;  1J8M F;  3DAF A;  5L3V A;  3O6X A;  2MWQ A;  4JUR I;  1PCX A;  4KBL A;  3LJB A;  2PP4 A;  3O39 A;  4OIR F;  5HSW A;  2KW3 C;  2ZXR A;  2V26 A;  3POV A;  4O6M A;  1MMN A;  4C3E A;  2Z15 A;  3T6J A;  4QDL A;  2Y3H A;  2VH3 A;  5B1A C;  1NZE A;  1MMA A;  5D91 A;  1ZU4 A;  3AG2 C;  3DM9 B;  4OIN F;  3UMK A;  3ZG1 A;  2EIN C;  5BUO A;  4O6Y A;  2CGE A;  2WZL A;  4PJN A;  3SZR A;  1JPJ A;  2EIL C;  2CNW A;  4RDA A;  4WJ0 A;  2WVO A;  3EZH A;  4F4B A;  3FDQ A;  3X2Q C;  2H7V C;  3RYL A;  3S27 A;  1M2O A;  3EPV A;  2J7P A;  3AQC A;  3X1O A;  1M57 C;  3MX3 A;  2WZG A;  2IOQ A;  5EHH A;  4PFP A;  3EH2 A;  3OA1 A;  3JRT A;  3ZIB A;  4FX5 A;  4YT8 A;  2E87 A;  4CS8 C;  4CS7 A;  3QZC A;  2W45 A;  4HFK B;  5DQZ A;  5E2Q A;  3W8H A;  4YJW A;  2NUP A;  2PF4 E;  4BJT A;  3EH1 A;  4MQ9 F;  1D0X A;  3NYL A;  4U5D E;  2NUT A;  4CSA C;  3AG1 C;  4CIH A;  4E7Z A;  2Y69 C;  2IYL D;  2R7U A;  4HE8 D;  3Q7G A;  4K7B A;  5KYY B;  2R7R A;  4U5F E;  4Q5S F;  3L0I A;  2IXN A;  3EQL F;  2EIJ C;  4G7Z F;  1NU9 C;  2H7B A;  4BEJ A;  3W8I A;  3NYJ A;  1Z63 A;  2IXP A;  3GAN A;  4AK9 A;  3AQB A;  4GYT A;  2W4M A;  3WG7 C;  3LS1 A;  3OEO A;  4CS9 A;  3VAY A;  2WVQ A;  3MLG A;  2R7S A;  4JCH A;  4LLE A;  1ZHY A;  3N2Z B;  2CNW D;  4FES A;  2V3C C;  1Z3I X;  2Q9A A;  3H65 A;  4DVZ A;  3K1I C;  3QMK A;  1Z6A A;  2NUP B;  2J7P D;  1M2V A;  5B3S C;  2Y3G A;  4I44 A;  3DJN B;  2A69 F;  3RIP A;  2B0J A;  2YHS A;  2NUT B;  4PJJ A;  2C03 A;  1D1B A;  2J0X A;  1O5H A;  2IXM A;  4IRU A;  4U5B E;  3KH2 A;  3K7D A;  2I8B A;  2QTV A;  3Q7L A;  3SEO A;  5KYU A;  3I5Q A;  3K33 A;  2P7V A;  5KYX A;  4GEH A;  4N06 A;  1TWC A;  1PD0 A;  4HFF B;  1OCZ C;  1VK5 A;  2KGO A;  3AG4 C;  3S29 A;  2QY9 A;  1D1A A;  3ZC4 A;  3Q6N A;  5DS4 A;  4I1O B;  3KL4 A;  1OCC C;  2J45 A;  2WVN A;  1SZI A;  3JSZ A;  4CS8 A;  1IZM A;  4X0R A;  3LS0 A;  4H4K C;  4EWC A;  2EIM C;  4PFO A;  2FFH A;  4LLC A;  4DOZ A;  2OCC C;  3UR3 C;  4AE4 A;  2PX0 A;  1M2V B;  3EJN A;  2PX3 A;  2J9V A;  1ZU5 A;  2J9W A;  4I1M A;  4JJF A;  2DYR C;  3RFY A;  4C3D A;  1FFH A;  3JYH A;  5KYW B;  2CW0 F;  4CSA A;  1BR4 A;  4W8K A;  2A6E F;  4P6I C;  3UMI A;  5KYU B;  3B0P A;  2L9J A;  4OIO F;  4JZA A;  1N1C A;  2VB6 A;  2X51 A;  1QLE C;  5KYX B;  3DXJ F;  2DGJ A;  4AX2 A;  4O79 A;  4M63 A;  3B0U X;  3N0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...