3ITFA

Structural basis for the inhibitory function of the cpxp adaptor protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
111
structure length
111
Chain Sequence
STQSHMFDGISLTEHQRQQMRDLMQQARHEQPPVNVSELETMHRLVTAENFDENAVRAQAEKMANEQIARQVEMAKVRNQMYRLLTPEQQAVLNEKHQQRMEQLRDVTQWQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Two-component System Inhibition and Pilus Sensing by the Auxiliary CpxP Protein.
pubmed doi rcsb
source organism Escherichia coli str. k-12 substr.
molecule tags Signaling protein
molecule keywords Periplasmic adaptor protein cpxP
total genus 34
structure length 111
sequence length 111
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07813 LTXXQ LTXXQ motif family protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1490 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3itfA00
3O39A 2Y3DA 3QZCA 3EPVA 2Y3GA 3ITFA 3OEOA 2Y3HA 3LAYA 2Y39A 2Y3BA 3ZG1A
chains in the Genus database with same CATH superfamily
2WZLA 4IGGA 4PJNA 2CGEA 1MQVA 2D4UA 2NSFA 4J7TA 3CEXA 3T6JA 2KC3A 3KMIA 4A2NB 2PF4E 3JRMO 2NPUA 4G78A 2AVKA 2Q9CA 4KC9A 3ZTZA 2OJQA 2HMQA 3I5PA 3JCUQ 2YRFA 5E3CA 5JLIA 4PFOA 1APCA 3AG3C 1OKKA 3FMSA 5A6BA 3DJUB 2XS8A 4IJJA 4AE4A 4DBRA 5L3QA 4A4AA 1RJ9A 5L0HA 3EH2A 2HSQA 2QNLA 3DM9B 2YL0A 3CSKA 3MYFA 5T1DB 4JEAA 3DM5A 1FAPB 3H2UA 3ZQVA 2Q4FA 1TR2A 2L81A 4ZLDA 3GODA 3O10A 2JX0A 3ZG1A 3U9JA 3WHNA 2Y3DA 5E3AA 1TWGA 4HFKB 2QUPA 2Q3TA 4ONSA 1AEPA 1YLMA 1Z5ZA 3RVZA 4E0HA 1VTMP 1M2VA 3LLKA 5KYXB 1K05A 2J0WA 3S28A 1I4ZA 5KYWB 4XTKA 3SXKA 5DS6A 2OJED 2QE9A 1ST6A 1W2WA 2VCCA 3HLZA 3R2PA 4IWBA 2UUIA 4DVZA 2AP3A 3HNIA 4C7OB 1ZW3A 5T3WA 4MTGA 2D5RB 2WZGA 5F28E 3NMIA 1EI7A 2JPUA 2J8WA 4K1OA 3BRJA 5E2QA 4BPMA 3GEIA 5B1AC 4MVUA 3AOUA 4JKVA 2R7VA 1V54C 3M4CA 4XEVA 4HFFB 1Z3IX 4QI0A 2IYLD 2KW3C 5DVWA 3UMIA 3JRTA 4O7GA 1WOLA 3T4RA 4DJ9A 1M56C 4WJ0A 3UR3C 1IW7F 2NSGA 3IQCA 3NYJA 3PMRA 3J06A 4OIRF 1OCOC 1H9GA 2XLOA 4CSAA 4Z9HA 4BJ1A 3RYLA 1OW7A 3JZ0A 1MMNA 3EQLF 3NRHA 4BJTA 5BQGA 3E70C 4LDKA 1OXBA 1Z7Qc 2HJMA 4U5GA 4JE9A 4G0HA 3DKAA 3UGOA 3F47A 4EBKA 3G4ZA 4HEAJ 5GPGB 3Q6MA 4JZAA 2LIGA 3S27A 3ZIBA 4BJ6C 2YEVA 1ORJA 5BQHA 3GWNA 3SNHA 4U5BE 2ZXPA 4WGZA 2PX0A 3JYYA 2J9UA 2YWAA 1T6IA 4MVSA 4W8KA 3SEOA 1L3PA 2LQGA 3T6GB 5A6KA 4DOZA 4BEJA 1QZXA 1JMWA 3LEVA 2IXOA 2EPKX 2A69F 4CS8A 2EIJC 4DRIB 4E7SA 2GFHA 5F5FA 2Y3HA 1LI7A 3O55A 4NTAA 3B0UX 2C03A 3HTKC 3Q6NA 1ZU5A 4MQ9F 4JVSA 2HZ8A 4F4BA 1MMGA 5CI9A 1G5ZA 3C8GA 3M15A 1TWAA 3ZTMA 4EWCA 2ZD9A 2CNWD 3IQ5A 2P61A 2CDQA 2YQYA 2P6VA 4E0IA 1TKNA 5JS5A 4Q5SF 1JR8A 4XPXA 4AL1A 5KYUB 1NBBA 2Y69C 1T6UA 3VM6A 1PD0A 2HKVA 2GDCA 3A11A 1ORSC 1D1AA 1Z23A 2NUTB 2L6FA 4N6CA 2IXPA 4C3BA 4U9EA 2LCHA 4BEMJ 1HMOA 5COGA 1C17M 4CSAC 1RMVA 1KTMA 2WB7A 3TD7A 3EG9A 3JSZA 3RFYA 2VH3A 4YT8A 4B6IA 2O9XA 2V3CC 1ZU4A 3I4UA 3V5ZA 4E18A 4ULWA 3CZ6A 4ZLCA 2XLMA 3LNMB 4D4XA 2YL7A 3PCVA 1YVIA 1VOMA 4XLPF 1YJGA 4N6HA 5DS4A 5E33A 1E85A 2YLDA 3SZRA 4CS9A 1S7ZA 1S05A 3LS1A 4Z9IA 5DQTA 2A0BA 4U5EE 2OU6A 1VYKA 3S90A 4MVZA 1O87A 3ASOC 2IM8A 5DLJA 2NG1A 4OD5A 4XEFA 1N1CA 4WGYA 2CW0F 1D1CA 2J7PD 2G3VA 3US6A 3RKOF 1K04A 3Q7GA 1XWJA 2DYSC 3K66A 4CS9C 4YL1A 3AGUA 4BJ6A 4PACA 3U8VA 2NUPB 3ATPA 2WL8A 3AG1C 1DOVA 1PD1A 4D4NA 5IY5C 3QZCA 1ZHTA 2MYSA 4LLEA 4MS2A 5BQIA 1ZHYA 5EK0A 5CI8A 3JYHA 2OEXA 3DE8A 4MW3A 5EHHA 2KGOA 2R02A 1FTSA 3T6BA 3GEEA 1FMVA 1VLSA 3VYWA 1QKRA 2W4MA 256BA 3MBGA 3W8IA 3H2VA 1ZVZA 4OIOF 1PCXA 2OCCC 3GM1A 1HW1A 1HE9A 3VF0A 3EJNA 5B3SC 4CDAA 3ITFA 2IXNA 1GQAA 2YKZA 3TK0A 2XLHA 2H7OA 4O6MA 2WVQA 4HE8D 5BUOA 1NFOA 2J7PA 4KBLA 2KQ9A 3QVYA 2W4BA 4I1OB 1NU9C 1E83A 3DMDA 1Z63A 2A68F 4EBBA 4U9DA 4YT2A 1YAUO 1GM5A 2BL2A 2PP4A 5CIVA 1SR2A 1K40A 1A0BA 2H7BA 1QSPA 2OG2A 3FXHA 3QTHA 5FZTA 5DQZA 2DI3A 1OXKA 2Q9BA 3ZWIA 4EIYA 2LK4A 4FX5A 3WAQA 3BEHA 2Y3BA 3C8GD 1LE4A 1EQ1A 2NUPA 2KNHA 3UNGC 4MNDA 1YYJA 3G4XA 2XXAA 2Q00A 4BJ5C 4JCZA 3MLGA 3RH3A 4CX9A 1RKEA 2B0JA 1ZW2A 3DAFA 2J46A 4IRUA 3RIPA 3V5XA 3B0VC 1EA8A 2IOQA 4U5DE 4JCHA 1CPQA 1D1BA 2XM4A 3NYMA 1LS1A 2XLDA 4NC3A 3DAGA 4NY3A 2PX3A 1A7DA 1CPRA 3M1CB 3JSEO 3Q7LA 4NQFA 4CJGA 4R32A 1G8XA 2LP4A 3RQEA 4EKWA 2PNOA 3FDQA 3ASNC 3U2LA 2XL6A 5AC4A 3QMKA 3TQOA 5JT4A 3K33A 4IB4A 1H7IA 2R7RA 3ZSUA 2PBEA 3F46A 4CS7A 5A6JA 1OW6A 3EG9B 2XLWA 1XZQA 3KYIA 2I15A 4QI2A 3CAXA 2R7XA 1ZZPA 3N2ZB 1OCCC 4XWJA 3EPVA 2AWYA 2R7UA 1D0XA 2DB4A 4CBEA 4C3EA 1E86A 2B0HA 3JTLO 1NSGB 1I4YA 3EGXB 4I1MA 5KYUA 3FOPA 4PFPA 3WODF 4NCQA 4G7ZF 1V55C 3AQCA 2ZXWC 2GA0A 2P7VA 1QPUA 3IQTA 4U5CE 2J9VA 1O3UA 4KNVA 2EILC 3LAYA 4JC7A 2MHRA 1Q0KA 1E2XA 2WZFA 1OR3A 2QTVA 2R9RB 1DOWA 2R05A 3RF3A 5KYWA 1U6HA 4ANJA 4CS8C 3NYLA 2VCAA 5KYXA 4JTDB 2J0XA 4FESA 4KNWA 3EHMA 2ASRA 2ZPAA 1C02A 3GM2A 3GM3A 5A69A 1M57C 2H7VC 1Q0FA 2YVKA 1JPNA 2TMVP 3HNKA 5EGYA 3SP1A 3QW1A 2IXMA 5KYYB 2R7TA 4WABA 1J8YF 1FMWA 4O79A 3NG1A 4JRZA 4N06A 3B9QA 5L0DA 3C18A 2JD3A 1TWCA 4JIOA 4U5HA 1XZPA 4X0RA 3PHF2 2F22A 1R5ID 1TWHA 1RKEB 3AQBA 2HV7A 4EHPA 3NKDA 3TOLA 4E17A 3N24A 1OQCA 2DYRC 5AGFA 3UMHA 2VCBA 1RKCA 2XXAB 2P0NA 1GGQA 1D0YA 4XPYA 3GWLA 2BE5F 2XLEA 1OW8A 1KU2A 3AG4C 3C62A 5HSWA 3S84A 4JTAB 1Y6DA 2RD9A 4NTFA 2DGJA 2OOCA 3K7DA 3T9OA 5D92A 4JEBA 3W8HA 4EBJA 4Z9JA 3EGDB 4K0DA 3TULA 1G4US 3VRCA 1G4WR 1OCZC 2FGYA 2LD6A 4I3MA 4DBQA 4AX2A 4MW8A 5FCLA 3S0XA 4UDVA 3AGTA 4AL0A 3W2VA 1UFBA 1FR0A 1L7CA 4YL3A 4KI2A 2Q9AA 4JW1A 3U3FA 2A6HF 4BG0A 3M79A 2YLIA 2J45A 1R4TA 1T5OA 1WTYA 2EPLX 4H54A 1AVOB 3K6BA 1A7EA 4CJOA 2RSEB 4MVQA 4JJFA 2IBFA 1WATA 2OKUA 2PFDA 3QVZA 1BBHA 1NU7D 4O6NA 5JUAA 3EH1A 1EKYA 1YZAA 1HW2A 2A6EF 3G50A 1SYQA 2EPMX 4GEHA 4N4WA 2L7AA 4DXWA 1MNEA 2R25A 2VASA 3AJMA 2HMZA 5L0GA 1TQGA 2E87A 5L0JA 2YL1A 2EIMC 1JOGA 3KKBA 4CIHA 1O5HA 2VC9A 1Q0MA 2LFDA 3KYJA 1YA9A 2M4EA 1VK5A 3IEEA 2Z15A 1A7VA 5JP7A 2L6HA 3K1IC 3VAYA 4YT4A 1JPJA 1UG7A 4JTCB 1V74B 2ZXRA 5L0IA 4PJMA 4BJ5A 2MWQA 4E7ZA 2CNWA 3EFOA 1M6TA 3LLIA 5JVEA 1WWPA 2KK1A 5D91A 1LVKA 1JAFA 2XRHA 3GORA 2GWWA 4FWVA 3K1HA 1J8MF 1LPEA 4J7YA 1H6GA 1T6QA 3V7OA 1A41A 1RJ9B 3C8ZA 2AU5A 4LERA 1OKKD 4XQ1A 3K1IA 1LIHA 1OR2A 4XLNF 3R7CA 1SF8A 1MMAA 1TFOB 1LE2A 1ORYA 3DE9A 3ECSA 3LUTB 3M4BA 3DJNB 3RQFA 3SXYA 2QY9A 2X51A 2ZXOA 3X1OA 5A6AA 3PDMP 3H65A 4PJJA 2X0CA 2HS5A 3X2QC 1PV3A 3RW0A 3N0TA 4M63A 4P9FA 2A0UA 2W45A 3MYIA 5HV9A 2EPOA 5A6BD 3OA1A 4FAPB 1HE1A 5L0CA 2YL3A 5JSLA 2NUTA 3GEHA 1HY5A 3GANA 3NMJA 1F1MA 2H8AA 4GQHA 1CGNA 1D0ZA 3L8JA 3ZC4A 1YA7O 2XSEA 2OEVA 2R7OA 3FAJA 3CQZA 3IPMO 2HUJA 2L6GA 3LNRA 3SXZA 4PK4A 3L0IA 3UGPA 2W9YA 2R03A 2YZSA 2ICWG 2J9WA 2G62A 3L8IA 1ZHZA 4PJLA 3ABLC 1BR4A 4OINF 3C8GB 3U3BA 3MFNA 3ZDLA 4C3DA 3U0CA 2J9BA 3EHNA 2M64A 1VMAA 4IAOA 3C7JA 4G7HF 4JURI 1BZ4A 2VB6A 3TJ5A 3ABKC 1FFTC 2ETSA 2G3KA 4OD4A 3I5QA 2YLGA 3OEOA 4W8PA 4YL0A 1NLXA 3LJBA 4QDLA 2HSBA 4MVOA 2A1DD 5KYYA 3SYNA 2LFFA 3KPHA 1YDIA 4YK5A 2XL4A 3KH2A 4XPWA 1KNYA 5DS5A 2Y39A 4YJWA 1MNDA 3MX3A 2R7SA 3TOMA 1GS9A 1WGWA 1Y4CA 5KYNA 1NZEA 4DVYP 4MTOA 2LSEA 1E84A 4LLCA 4P6IC 2YHSA 3HNJA 4LDQA 1QLEC 3UMKA 3O6XA 2Y3GA 3ABMC 3HJCA 3U8PA 5B1BC 1RXQA 3HNLA 2L9JA 3LS0A 1YYXA 3DZAA 1Q0GA 3FVYA 4EUKB 4LACB 3U9MA 3EGXA 3B0PA 1MMDA 3NMKA 4RD9A 1M2OA 2QLAA 4I44A 1B68A 3HKKA 4CDYA 1U89A 1T01A 3OWTA 1T9KA 1Q0DA 3DI5A 3EZHA 5T3TA 3RQGA 3V5YA 3FAPB 1LI5A 4RDAA 1SMYF 3LESA 4K7BA 4YWQA 2R7WA 3POVA 2WVNA 1VB5A 1OCRC 1QQ3A 3L1MA 3NKEA 4XEKA 1LKXA 2UUHA 3IQ6A 4PR9A 4MVMA 4IAQA 4OIPF 2XM0A 3E9VA 3KL4A 3O39A 4L6RA 2AWCA 1WN0A 2HJ3A 3W2WA 2R7QA 5AC5A 3ZVRA 4C7OA 1QVXA 1VLTA 4J32B 2EINC 4Q4ZF 4U5FE 3B29A 1AUEA 3B71A 4ULVA 2V26A 3AG2C 4CIPA 5K0IA 1RCPA 3RVYA 1LM3B 3ZQYA 3EFOB 3A9CA 2CCYA 4OIQF 1BDJB 4NTBA 1C03A 2KSFA 4O6YA 1M2VB 1CGME 1VYIA 5JRAA 2BC5A 2CYDA 3S9OA 3FOOA 4CDVA 4YN0B 4DRHB 4GYTA 1FNTc 1LS4A 1ZHXA 3WG7C 2I8BA 2FFHA 5COFA 3JT1A 2KJGA 3U2MA 5L0FA 2WVOA 4H4KC 4MVRA 1CGOA 1I5NA 1TFKB 5TJ5E 1WASA 2XL8A 2HFIA 4P9TA 4Q7CA 4YT5A 1BR2A 2P1AA 3S29A 4AK9A 4G7OF 2XLVA 4RBNA 3EZIA 5COMA 3TJ6A 2Q7RA 1YARO 1ZHWA 3U5SA 1IZMA 2KYHA 3L34A 4AE4B 2GAQA 3QW0A 4J30B 4DRJB 1ZYRF 1H9TA 3IHUA 5F5HA 1JRAA 1NG1A 3NDBB 5B3IA 1HMDA 1YZCA 2EIKC 3C63A 4IARA 2OQMA 1FFHA 3W4YA 4ER9A 3SXMA 1BR1A 2C04A 3DD7A 3FHDA 5L3VA 1NFNA 1V4AA 2EPNA 4JJGA 4LDRA 1U0BB 1Z6AA 2XS1A 4MTFA 3LEOA 2HV6A 3DWWA 1SZIA 2FAPB 3DXJF 3EGDA
chains in the Genus database with same CATH topology
2WZLA 4PJNA 2CGEA 3T6JA 3KMIA 4A2NB 2PF4E 4KC9A 2Q9CA 3I5PA 3JCUQ 5E3CA 4PFOA 3AG3C 1OKKA 3DJUB 4IJJA 4AE4A 4DBRA 5L3QA 1RJ9A 3EH2A 3DM9B 3CSKA 5T1DB 3DM5A 1TR2A 2L81A 4ZLDA 3GODA 3ZG1A 2Y3DA 5E3AA 1TWGA 4HFKB 2Q3TA 1Z5ZA 1M2VA 3LLKA 5KYXB 2J0WA 3S28A 5KYWB 4XTKA 5DS6A 1ST6A 1W2WA 4IWBA 3HLZA 4DVZA 4C7OB 5T3WA 2D5RB 2WZGA 5E2QA 5B1AC 2R7VA 1V54C 4HFFB 1Z3IX 4QI0A 2IYLD 2KW3C 5DVWA 3UMIA 3JRTA 4O7GA 3T4RA 1M56C 4WJ0A 3UR3C 1IW7F 3PMRA 3NYJA 4OIRF 1OCOC 4CSAA 4BJ1A 3RYLA 1MMNA 3EQLF 3NRHA 4BJTA 3E70C 4U5GA 4G0HA 3UGOA 3F47A 4HEAJ 3Q6MA 4JZAA 3S27A 3ZIBA 4BJ6C 2YEVA 3SNHA 4U5BE 2ZXPA 2PX0A 2J9UA 4W8KA 3SEOA 4DOZA 4BEJA 1QZXA 4E7SA 3LEVA 2IXOA 2A69F 4CS8A 2EIJC 2GFHA 5F5FA 2Y3HA 3B0UX 2C03A 3HTKC 3Q6NA 1ZU5A 4MQ9F 4JVSA 1MMGA 5CI9A 1TWAA 4EWCA 2CNWD 2CDQA 2P6VA 1TKNA 5KYUB 2Y69C 1PD0A 4Q5SF 4C3BA 1D1AA 1Z23A 2NUTB 2IXPA 4CSAC 2WB7A 3TD7A 3EG9A 3JSZA 3RFYA 2VH3A 4YT8A 4B6IA 2O9XA 2V3CC 1ZU4A 3I4UA 4ULWA 3CZ6A 4ZLCA 4XLPF 1VOMA 5DS4A 5E33A 3SZRA 4CS9A 1S7ZA 3LS1A 5DQTA 4U5EE 1VYKA 1O87A 3ASOC 5DLJA 2NG1A 4OD5A 1N1CA 2CW0F 1D1CA 2J7PD 2G3VA 3RKOF 3Q7GA 3K66A 2DYSC 4CS9C 4BJ6A 2NUPB 2WL8A 3AG1C 5IY5C 1PD1A 3QZCA 1ZHTA 2MYSA 4LLEA 1ZHYA 5CI8A 3JYHA 5EHHA 2KGOA 3T6BA 1FTSA 1FMVA 3VYWA 2W4MA 3W8IA 4OIOF 1PCXA 2OCCC 3EJNA 5B3SC 3ITFA 2IXNA 2H7OA 4O6MA 2WVQA 4HE8D 5BUOA 2J7PA 4KBLA 2KQ9A 2W4BA 4I1OB 1NU9C 1Z63A 3DMDA 2A68F 4EBBA 4YT2A 2PP4A 2H7BA 2OG2A 5DQZA 2Q9BA 4FX5A 2Y3BA 2NUPA 2KNHA 3UNGC 4MNDA 2XXAA 4BJ5C 3MLGA 3RH3A 2B0JA 4IRUA 3DAFA 2J46A 3B0VC 3RIPA 2IOQA 4U5DE 4JCHA 1D1BA 3NYMA 1LS1A 3DAGA 4NY3A 2PX3A 3M1CB 3Q7LA 1G8XA 3FDQA 3ASNC 3QMKA 3K33A 2R7RA 3ZSUA 3F46A 4CS7A 3EG9B 4QI2A 2R7XA 3N2ZB 1OCCC 4XWJA 3EPVA 2R7UA 1D0XA 4CBEA 4C3EA 3EGXB 4I1MA 5KYUA 4PFPA 3WODF 4G7ZF 1V55C 3AQCA 2ZXWC 2P7VA 4U5CE 2J9VA 4KNVA 2EILC 3LAYA 2WZFA 2QTVA 5KYWA 4ANJA 4CS8C 3NYLA 5KYXA 2J0XA 4FESA 4KNWA 3EHMA 2ZPAA 1M57C 2H7VC 1JPNA 5EGYA 3SP1A 2IXMA 5KYYB 2R7TA 1J8YF 1FMWA 4O79A 3NG1A 4N06A 3B9QA 4U5HA 2JD3A 1TWCA 4X0RA 3PHF2 1TWHA 3AQBA 2HV7A 3NKDA 3N24A 2DYRC 3UMHA 2XXAB 1D0YA 2BE5F 5HSWA 1KU2A 3AG4C 4F4BA 2DGJA 3K7DA 5D92A 3W8HA 3EGDB 4K0DA 1OCZC 2FGYA 4I3MA 4DBQA 4AX2A 5FCLA 3S0XA 3W2VA 4KI2A 2Q9AA 4JW1A 2A6HF 4BG0A 2J45A 3K6BA 4JJFA 2PFDA 1NU7D 4O6NA 3EH1A 2A6EF 4GEHA 1MNEA 2VASA 2E87A 2EIMC 3KKBA 4CIHA 1O5HA 2M4EA 1VK5A 3IEEA 2Z15A 3K1IC 3VAYA 4YT4A 1JPJA 2ZXRA 4PJMA 4BJ5A 2MWQA 4E7ZA 2CNWA 3EFOA 3LLIA 5D91A 1LVKA 2XRHA 4FWVA 3K1HA 1J8MF 3V7OA 1RJ9B 4LERA 4XLNF 1OKKD 1SF8A 1MMAA 3ECSA 3DJNB 2QY9A 2X51A 2ZXOA 3X1OA 3H65A 4PJJA 3X2QC 3N0TA 4M63A 2W45A 3OA1A 2NUTA 3GANA 1D0ZA 3ZC4A 2XSEA 2R7OA 3FAJA 3CQZA 3LNRA 4PK4A 3L0IA 3UGPA 2W9YA 2YZSA 2J9WA 2G62A 1ZHZA 4PJLA 3ABLC 1BR4A 4OINF 4C3DA 3EHNA 4IAOA 1VMAA 4G7HF 4JURI 2VB6A 3ABKC 1FFTC 2G3KA 4OD4A 3I5QA 3OEOA 3LJBA 4QDLA 2A1DD 5KYYA 3SYNA 2XL4A 3KH2A 5DS5A 2Y39A 4YJWA 1MNDA 3MX3A 2R7SA 1WGWA 5KYNA 1NZEA 4DVYP 2LSEA 4LLCA 4P6IC 2YHSA 1QLEC 3UMKA 3O6XA 2Y3GA 3ABMC 3HJCA 5B1BC 2L9JA 3LS0A 3FVYA 3DZAA 4LACB 3EGXA 3B0PA 1MMDA 4RD9A 1M2OA 4I44A 3OWTA 5T3TA 3EZHA 4RDAA 1SMYF 3LESA 4K7BA 4YWQA 2R7WA 3POVA 2WVNA 1OCRC 3NKEA 1LKXA 4OIPF 3O39A 3E9VA 3KL4A 3W2WA 2R7QA 4C7OA 3ZVRA 4J32B 2EINC 4Q4ZF 4U5FE 2V26A 3AG2C 3EFOB 4OIQF 4O6YA 1M2VB 1VYIA 4YN0B 4GYTA 1ZHXA 3WG7C 2I8BA 2FFHA 3JT1A 2KJGA 2WVOA 4H4KC 4Q7CA 4YT5A 3S29A 1BR2A 4G7OF 4AK9A 4RBNA 3EZIA 1ZHWA 1IZMA 3L34A 4AE4B 4J30B 1ZYRF 5F5HA 1NG1A 3NDBB 2EIKC 1FFHA 1BR1A 2C04A 3DD7A 3FHDA 5L3VA 4JJGA 1Z6AA 2HV6A 1SZIA 3DXJF 3EGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O39 A;  2Y3D A;  3QZC A;  3EPV A;  2Y3G A;  3ITF A;  3OEO A;  2Y3H A;  3LAY A;  2Y39 A;  2Y3B A;  3ZG1 A; 
#chains in the Genus database with same CATH topology
 2WZL A;  4IGG A;  4PJN A;  2CGE A;  1MQV A;  2D4U A;  2NSF A;  4J7T A;  3CEX A;  3T6J A;  2KC3 A;  3KMI A;  4A2N B;  2PF4 E;  3JRM O;  2NPU A;  4G78 A;  2AVK A;  2Q9C A;  4KC9 A;  3ZTZ A;  2OJQ A;  2HMQ A;  3I5P A;  3JCU Q;  2YRF A;  5E3C A;  5JLI A;  4PFO A;  1APC A;  3AG3 C;  1OKK A;  3FMS A;  5A6B A;  3DJU B;  2XS8 A;  4IJJ A;  4AE4 A;  4DBR A;  5L3Q A;  4A4A A;  1RJ9 A;  5L0H A;  3EH2 A;  2HSQ A;  2QNL A;  3DM9 B;  2YL0 A;  3CSK A;  3MYF A;  5T1D B;  4JEA A;  3DM5 A;  1FAP B;  3H2U A;  3ZQV A;  2Q4F A;  1TR2 A;  2L81 A;  4ZLD A;  3GOD A;  3O10 A;  2JX0 A;  3ZG1 A;  3U9J A;  3WHN A;  2Y3D A;  5E3A A;  1TWG A;  4HFK B;  2QUP A;  2Q3T A;  4ONS A;  1AEP A;  1YLM A;  1Z5Z A;  3RVZ A;  4E0H A;  1VTM P;  1M2V A;  3LLK A;  5KYX B;  1K05 A;  2J0W A;  3S28 A;  1I4Z A;  5KYW B;  4XTK A;  3SXK A;  5DS6 A;  2OJE D;  2QE9 A;  1ST6 A;  1W2W A;  2VCC A;  3HLZ A;  3R2P A;  4IWB A;  2UUI A;  4DVZ A;  2AP3 A;  3HNI A;  4C7O B;  1ZW3 A;  5T3W A;  4MTG A;  2D5R B;  2WZG A;  5F28 E;  3NMI A;  1EI7 A;  2JPU A;  2J8W A;  4K1O A;  3BRJ A;  5E2Q A;  4BPM A;  3GEI A;  5B1A C;  4MVU A;  3AOU A;  4JKV A;  2R7V A;  1V54 C;  3M4C A;  4XEV A;  4HFF B;  1Z3I X;  4QI0 A;  2IYL D;  2KW3 C;  5DVW A;  3UMI A;  3JRT A;  4O7G A;  1WOL A;  3T4R A;  4DJ9 A;  1M56 C;  4WJ0 A;  3UR3 C;  1IW7 F;  2NSG A;  3IQC A;  3NYJ A;  3PMR A;  3J06 A;  4OIR F;  1OCO C;  1H9G A;  2XLO A;  4CSA A;  4Z9H A;  4BJ1 A;  3RYL A;  1OW7 A;  3JZ0 A;  1MMN A;  3EQL F;  3NRH A;  4BJT A;  5BQG A;  3E70 C;  4LDK A;  1OXB A;  1Z7Q c;  2HJM A;  4U5G A;  4JE9 A;  4G0H A;  3DKA A;  3UGO A;  3F47 A;  4EBK A;  3G4Z A;  4HEA J;  5GPG B;  3Q6M A;  4JZA A;  2LIG A;  3S27 A;  3ZIB A;  4BJ6 C;  2YEV A;  1ORJ A;  5BQH A;  3GWN A;  3SNH A;  4U5B E;  2ZXP A;  4WGZ A;  2PX0 A;  3JYY A;  2J9U A;  2YWA A;  1T6I A;  4MVS A;  4W8K A;  3SEO A;  1L3P A;  2LQG A;  3T6G B;  5A6K A;  4DOZ A;  4BEJ A;  1QZX A;  1JMW A;  3LEV A;  2IXO A;  2EPK X;  2A69 F;  4CS8 A;  2EIJ C;  4DRI B;  4E7S A;  2GFH A;  5F5F A;  2Y3H A;  1LI7 A;  3O55 A;  4NTA A;  3B0U X;  2C03 A;  3HTK C;  3Q6N A;  1ZU5 A;  4MQ9 F;  4JVS A;  2HZ8 A;  4F4B A;  1MMG A;  5CI9 A;  1G5Z A;  3C8G A;  3M15 A;  1TWA A;  3ZTM A;  4EWC A;  2ZD9 A;  2CNW D;  3IQ5 A;  2P61 A;  2CDQ A;  2YQY A;  2P6V A;  4E0I A;  1TKN A;  5JS5 A;  4Q5S F;  1JR8 A;  4XPX A;  4AL1 A;  5KYU B;  1NBB A;  2Y69 C;  1T6U A;  3VM6 A;  1PD0 A;  2HKV A;  2GDC A;  3A11 A;  1ORS C;  1D1A A;  1Z23 A;  2NUT B;  2L6F A;  4N6C A;  2IXP A;  4C3B A;  4U9E A;  2LCH A;  4BEM J;  1HMO A;  5COG A;  1C17 M;  4CSA C;  1RMV A;  1KTM A;  2WB7 A;  3TD7 A;  3EG9 A;  3JSZ A;  3RFY A;  2VH3 A;  4YT8 A;  4B6I A;  2O9X A;  2V3C C;  1ZU4 A;  3I4U A;  3V5Z A;  4E18 A;  4ULW A;  3CZ6 A;  4ZLC A;  2XLM A;  3LNM B;  4D4X A;  2YL7 A;  3PCV A;  1YVI A;  1VOM A;  4XLP F;  1YJG A;  4N6H A;  5DS4 A;  5E33 A;  1E85 A;  2YLD A;  3SZR A;  4CS9 A;  1S7Z A;  1S05 A;  3LS1 A;  4Z9I A;  5DQT A;  2A0B A;  4U5E E;  2OU6 A;  1VYK A;  3S90 A;  4MVZ A;  1O87 A;  3ASO C;  2IM8 A;  5DLJ A;  2NG1 A;  4OD5 A;  4XEF A;  1N1C A;  4WGY A;  2CW0 F;  1D1C A;  2J7P D;  2G3V A;  3US6 A;  3RKO F;  1K04 A;  3Q7G A;  1XWJ A;  2DYS C;  3K66 A;  4CS9 C;  4YL1 A;  3AGU A;  4BJ6 A;  4PAC A;  3U8V A;  2NUP B;  3ATP A;  2WL8 A;  3AG1 C;  1DOV A;  1PD1 A;  4D4N A;  5IY5 C;  3QZC A;  1ZHT A;  2MYS A;  4LLE A;  4MS2 A;  5BQI A;  1ZHY A;  5EK0 A;  5CI8 A;  3JYH A;  2OEX A;  3DE8 A;  4MW3 A;  5EHH A;  2KGO A;  2R02 A;  1FTS A;  3T6B A;  3GEE A;  1FMV A;  1VLS A;  3VYW A;  1QKR A;  2W4M A;  256B A;  3MBG A;  3W8I A;  3H2V A;  1ZVZ A;  4OIO F;  1PCX A;  2OCC C;  3GM1 A;  1HW1 A;  1HE9 A;  3VF0 A;  3EJN A;  5B3S C;  4CDA A;  3ITF A;  2IXN A;  1GQA A;  2YKZ A;  3TK0 A;  2XLH A;  2H7O A;  4O6M A;  2WVQ A;  4HE8 D;  5BUO A;  1NFO A;  2J7P A;  4KBL A;  2KQ9 A;  3QVY A;  2W4B A;  4I1O B;  1NU9 C;  1E83 A;  3DMD A;  1Z63 A;  2A68 F;  4EBB A;  4U9D A;  4YT2 A;  1YAU O;  1GM5 A;  2BL2 A;  2PP4 A;  5CIV A;  1SR2 A;  1K40 A;  1A0B A;  2H7B A;  1QSP A;  2OG2 A;  3FXH A;  3QTH A;  5FZT A;  5DQZ A;  2DI3 A;  1OXK A;  2Q9B A;  3ZWI A;  4EIY A;  2LK4 A;  4FX5 A;  3WAQ A;  3BEH A;  2Y3B A;  3C8G D;  1LE4 A;  1EQ1 A;  2NUP A;  2KNH A;  3UNG C;  4MND A;  1YYJ A;  3G4X A;  2XXA A;  2Q00 A;  4BJ5 C;  4JCZ A;  3MLG A;  3RH3 A;  4CX9 A;  1RKE A;  2B0J A;  1ZW2 A;  3DAF A;  2J46 A;  4IRU A;  3RIP A;  3V5X A;  3B0V C;  1EA8 A;  2IOQ A;  4U5D E;  4JCH A;  1CPQ A;  1D1B A;  2XM4 A;  3NYM A;  1LS1 A;  2XLD A;  4NC3 A;  3DAG A;  4NY3 A;  2PX3 A;  1A7D A;  1CPR A;  3M1C B;  3JSE O;  3Q7L A;  4NQF A;  4CJG A;  4R32 A;  1G8X A;  2LP4 A;  3RQE A;  4EKW A;  2PNO A;  3FDQ A;  3ASN C;  3U2L A;  2XL6 A;  5AC4 A;  3QMK A;  3TQO A;  5JT4 A;  3K33 A;  4IB4 A;  1H7I A;  2R7R A;  3ZSU A;  2PBE A;  3F46 A;  4CS7 A;  5A6J A;  1OW6 A;  3EG9 B;  2XLW A;  1XZQ A;  3KYI A;  2I15 A;  4QI2 A;  3CAX A;  2R7X A;  1ZZP A;  3N2Z B;  1OCC C;  4XWJ A;  3EPV A;  2AWY A;  2R7U A;  1D0X A;  2DB4 A;  4CBE A;  4C3E A;  1E86 A;  2B0H A;  3JTL O;  1NSG B;  1I4Y A;  3EGX B;  4I1M A;  5KYU A;  3FOP A;  4PFP A;  3WOD F;  4NCQ A;  4G7Z F;  1V55 C;  3AQC A;  2ZXW C;  2GA0 A;  2P7V A;  1QPU A;  3IQT A;  4U5C E;  2J9V A;  1O3U A;  4KNV A;  2EIL C;  3LAY A;  4JC7 A;  2MHR A;  1Q0K A;  1E2X A;  2WZF A;  1OR3 A;  2QTV A;  2R9R B;  1DOW A;  2R05 A;  3RF3 A;  5KYW A;  1U6H A;  4ANJ A;  4CS8 C;  3NYL A;  2VCA A;  5KYX A;  4JTD B;  2J0X A;  4FES A;  4KNW A;  3EHM A;  2ASR A;  2ZPA A;  1C02 A;  3GM2 A;  3GM3 A;  5A69 A;  1M57 C;  2H7V C;  1Q0F A;  2YVK A;  1JPN A;  2TMV P;  3HNK A;  5EGY A;  3SP1 A;  3QW1 A;  2IXM A;  5KYY B;  2R7T A;  4WAB A;  1J8Y F;  1FMW A;  4O79 A;  3NG1 A;  4JRZ A;  4N06 A;  3B9Q A;  5L0D A;  3C18 A;  2JD3 A;  1TWC A;  4JIO A;  4U5H A;  1XZP A;  4X0R A;  3PHF 2;  2F22 A;  1R5I D;  1TWH A;  1RKE B;  3AQB A;  2HV7 A;  4EHP A;  3NKD A;  3TOL A;  4E17 A;  3N24 A;  1OQC A;  2DYR C;  5AGF A;  3UMH A;  2VCB A;  1RKC A;  2XXA B;  2P0N A;  1GGQ A;  1D0Y A;  4XPY A;  3GWL A;  2BE5 F;  2XLE A;  1OW8 A;  1KU2 A;  3AG4 C;  3C62 A;  5HSW A;  3S84 A;  4JTA B;  1Y6D A;  2RD9 A;  4NTF A;  2DGJ A;  2OOC A;  3K7D A;  3T9O A;  5D92 A;  4JEB A;  3W8H A;  4EBJ A;  4Z9J A;  3EGD B;  4K0D A;  3TUL A;  1G4U S;  3VRC A;  1G4W R;  1OCZ C;  2FGY A;  2LD6 A;  4I3M A;  4DBQ A;  4AX2 A;  4MW8 A;  5FCL A;  3S0X A;  4UDV A;  3AGT A;  4AL0 A;  3W2V A;  1UFB A;  1FR0 A;  1L7C A;  4YL3 A;  4KI2 A;  2Q9A A;  4JW1 A;  3U3F A;  2A6H F;  4BG0 A;  3M79 A;  2YLI A;  2J45 A;  1R4T A;  1T5O A;  1WTY A;  2EPL X;  4H54 A;  1AVO B;  3K6B A;  1A7E A;  4CJO A;  2RSE B;  4MVQ A;  4JJF A;  2IBF A;  1WAT A;  2OKU A;  2PFD A;  3QVZ A;  1BBH A;  1NU7 D;  4O6N A;  5JUA A;  3EH1 A;  1EKY A;  1YZA A;  1HW2 A;  2A6E F;  3G50 A;  1SYQ A;  2EPM X;  4GEH A;  4N4W A;  2L7A A;  4DXW A;  1MNE A;  2R25 A;  2VAS A;  3AJM A;  2HMZ A;  5L0G A;  1TQG A;  2E87 A;  5L0J A;  2YL1 A;  2EIM C;  1JOG A;  3KKB A;  4CIH A;  1O5H A;  2VC9 A;  1Q0M A;  2LFD A;  3KYJ A;  1YA9 A;  2M4E A;  1VK5 A;  3IEE A;  2Z15 A;  1A7V A;  5JP7 A;  2L6H A;  3K1I C;  3VAY A;  4YT4 A;  1JPJ A;  1UG7 A;  4JTC B;  1V74 B;  2ZXR A;  5L0I A;  4PJM A;  4BJ5 A;  2MWQ A;  4E7Z A;  2CNW A;  3EFO A;  1M6T A;  3LLI A;  5JVE A;  1WWP A;  2KK1 A;  5D91 A;  1LVK A;  1JAF A;  2XRH A;  3GOR A;  2GWW A;  4FWV A;  3K1H A;  1J8M F;  1LPE A;  4J7Y A;  1H6G A;  1T6Q A;  3V7O A;  1A41 A;  1RJ9 B;  3C8Z A;  2AU5 A;  4LER A;  1OKK D;  4XQ1 A;  3K1I A;  1LIH A;  1OR2 A;  4XLN F;  3R7C A;  1SF8 A;  1MMA A;  1TFO B;  1LE2 A;  1ORY A;  3DE9 A;  3ECS A;  3LUT B;  3M4B A;  3DJN B;  3RQF A;  3SXY A;  2QY9 A;  2X51 A;  2ZXO A;  3X1O A;  5A6A A;  3PDM P;  3H65 A;  4PJJ A;  2X0C A;  2HS5 A;  3X2Q C;  1PV3 A;  3RW0 A;  3N0T A;  4M63 A;  4P9F A;  2A0U A;  2W45 A;  3MYI A;  5HV9 A;  2EPO A;  5A6B D;  3OA1 A;  4FAP B;  1HE1 A;  5L0C A;  2YL3 A;  5JSL A;  2NUT A;  3GEH A;  1HY5 A;  3GAN A;  3NMJ A;  1F1M A;  2H8A A;  4GQH A;  1CGN A;  1D0Z A;  3L8J A;  3ZC4 A;  1YA7 O;  2XSE A;  2OEV A;  2R7O A;  3FAJ A;  3CQZ A;  3IPM O;  2HUJ A;  2L6G A;  3LNR A;  3SXZ A;  4PK4 A;  3L0I A;  3UGP A;  2W9Y A;  2R03 A;  2YZS A;  2ICW G;  2J9W A;  2G62 A;  3L8I A;  1ZHZ A;  4PJL A;  3ABL C;  1BR4 A;  4OIN F;  3C8G B;  3U3B A;  3MFN A;  3ZDL A;  4C3D A;  3U0C A;  2J9B A;  3EHN A;  2M64 A;  1VMA A;  4IAO A;  3C7J A;  4G7H F;  4JUR I;  1BZ4 A;  2VB6 A;  3TJ5 A;  3ABK C;  1FFT C;  2ETS A;  2G3K A;  4OD4 A;  3I5Q A;  2YLG A;  3OEO A;  4W8P A;  4YL0 A;  1NLX A;  3LJB A;  4QDL A;  2HSB A;  4MVO A;  2A1D D;  5KYY A;  3SYN A;  2LFF A;  3KPH A;  1YDI A;  4YK5 A;  2XL4 A;  3KH2 A;  4XPW A;  1KNY A;  5DS5 A;  2Y39 A;  4YJW A;  1MND A;  3MX3 A;  2R7S A;  3TOM A;  1GS9 A;  1WGW A;  1Y4C A;  5KYN A;  1NZE A;  4DVY P;  4MTO A;  2LSE A;  1E84 A;  4LLC A;  4P6I C;  2YHS A;  3HNJ A;  4LDQ A;  1QLE C;  3UMK A;  3O6X A;  2Y3G A;  3ABM C;  3HJC A;  3U8P A;  5B1B C;  1RXQ A;  3HNL A;  2L9J A;  3LS0 A;  1YYX A;  3DZA A;  1Q0G A;  3FVY A;  4EUK B;  4LAC B;  3U9M A;  3EGX A;  3B0P A;  1MMD A;  3NMK A;  4RD9 A;  1M2O A;  2QLA A;  4I44 A;  1B68 A;  3HKK A;  4CDY A;  1U89 A;  1T01 A;  3OWT A;  1T9K A;  1Q0D A;  3DI5 A;  3EZH A;  5T3T A;  3RQG A;  3V5Y A;  3FAP B;  1LI5 A;  4RDA A;  1SMY F;  3LES A;  4K7B A;  4YWQ A;  2R7W A;  3POV A;  2WVN A;  1VB5 A;  1OCR C;  1QQ3 A;  3L1M A;  3NKE A;  4XEK A;  1LKX A;  2UUH A;  3IQ6 A;  4PR9 A;  4MVM A;  4IAQ A;  4OIP F;  2XM0 A;  3E9V A;  3KL4 A;  3O39 A;  4L6R A;  2AWC A;  1WN0 A;  2HJ3 A;  3W2W A;  2R7Q A;  5AC5 A;  3ZVR A;  4C7O A;  1QVX A;  1VLT A;  4J32 B;  2EIN C;  4Q4Z F;  4U5F E;  3B29 A;  1AUE A;  3B71 A;  4ULV A;  2V26 A;  3AG2 C;  4CIP A;  5K0I A;  1RCP A;  3RVY A;  1LM3 B;  3ZQY A;  3EFO B;  3A9C A;  2CCY A;  4OIQ F;  1BDJ B;  4NTB A;  1C03 A;  2KSF A;  4O6Y A;  1M2V B;  1CGM E;  1VYI A;  5JRA A;  2BC5 A;  2CYD A;  3S9O A;  3FOO A;  4CDV A;  4YN0 B;  4DRH B;  4GYT A;  1FNT c;  1LS4 A;  1ZHX A;  3WG7 C;  2I8B A;  2FFH A;  5COF A;  3JT1 A;  2KJG A;  3U2M A;  5L0F A;  2WVO A;  4H4K C;  4MVR A;  1CGO A;  1I5N A;  1TFK B;  5TJ5 E;  1WAS A;  2XL8 A;  2HFI A;  4P9T A;  4Q7C A;  4YT5 A;  1BR2 A;  2P1A A;  3S29 A;  4AK9 A;  4G7O F;  2XLV A;  4RBN A;  3EZI A;  5COM A;  3TJ6 A;  2Q7R A;  1YAR O;  1ZHW A;  3U5S A;  1IZM A;  2KYH A;  3L34 A;  4AE4 B;  2GAQ A;  3QW0 A;  4J30 B;  4DRJ B;  1ZYR F;  1H9T A;  3IHU A;  5F5H A;  1JRA A;  1NG1 A;  3NDB B;  5B3I A;  1HMD A;  1YZC A;  2EIK C;  3C63 A;  4IAR A;  2OQM A;  1FFH A;  3W4Y A;  4ER9 A;  3SXM A;  1BR1 A;  2C04 A;  3DD7 A;  3FHD A;  5L3V A;  1NFN A;  1V4A A;  2EPN A;  4JJG A;  4LDR A;  1U0B B;  1Z6A A;  2XS1 A;  4MTF A;  3LEO A;  2HV6 A;  3DWW A;  1SZI A;  2FAP B;  3DXJ F;  3EGD A; 
#chains in the Genus database with same CATH homology
 2WZL A;  4PJN A;  2CGE A;  3T6J A;  3KMI A;  4A2N B;  2PF4 E;  4KC9 A;  2Q9C A;  3I5P A;  3JCU Q;  5E3C A;  4PFO A;  3AG3 C;  1OKK A;  3DJU B;  4IJJ A;  4AE4 A;  4DBR A;  5L3Q A;  1RJ9 A;  3EH2 A;  3DM9 B;  3CSK A;  5T1D B;  3DM5 A;  1TR2 A;  2L81 A;  4ZLD A;  3GOD A;  3ZG1 A;  2Y3D A;  5E3A A;  1TWG A;  4HFK B;  2Q3T A;  1Z5Z A;  1M2V A;  3LLK A;  5KYX B;  2J0W A;  3S28 A;  5KYW B;  4XTK A;  5DS6 A;  1ST6 A;  1W2W A;  4IWB A;  3HLZ A;  4DVZ A;  4C7O B;  5T3W A;  2D5R B;  2WZG A;  5E2Q A;  5B1A C;  2R7V A;  1V54 C;  4HFF B;  1Z3I X;  4QI0 A;  2IYL D;  2KW3 C;  5DVW A;  3UMI A;  3JRT A;  4O7G A;  3T4R A;  1M56 C;  4WJ0 A;  3UR3 C;  1IW7 F;  3PMR A;  3NYJ A;  4OIR F;  1OCO C;  4CSA A;  4BJ1 A;  3RYL A;  1MMN A;  3EQL F;  3NRH A;  4BJT A;  3E70 C;  4U5G A;  4G0H A;  3UGO A;  3F47 A;  4HEA J;  3Q6M A;  4JZA A;  3S27 A;  3ZIB A;  4BJ6 C;  2YEV A;  3SNH A;  4U5B E;  2ZXP A;  2PX0 A;  2J9U A;  4W8K A;  3SEO A;  4DOZ A;  4BEJ A;  1QZX A;  4E7S A;  3LEV A;  2IXO A;  2A69 F;  4CS8 A;  2EIJ C;  2GFH A;  5F5F A;  2Y3H A;  3B0U X;  2C03 A;  3HTK C;  3Q6N A;  1ZU5 A;  4MQ9 F;  4JVS A;  1MMG A;  5CI9 A;  1TWA A;  4EWC A;  2CNW D;  2CDQ A;  2P6V A;  1TKN A;  5KYU B;  2Y69 C;  1PD0 A;  4Q5S F;  4C3B A;  1D1A A;  1Z23 A;  2NUT B;  2IXP A;  4CSA C;  2WB7 A;  3TD7 A;  3EG9 A;  3JSZ A;  3RFY A;  2VH3 A;  4YT8 A;  4B6I A;  2O9X A;  2V3C C;  1ZU4 A;  3I4U A;  4ULW A;  3CZ6 A;  4ZLC A;  4XLP F;  1VOM A;  5DS4 A;  5E33 A;  3SZR A;  4CS9 A;  1S7Z A;  3LS1 A;  5DQT A;  4U5E E;  1VYK A;  1O87 A;  3ASO C;  5DLJ A;  2NG1 A;  4OD5 A;  1N1C A;  2CW0 F;  1D1C A;  2J7P D;  2G3V A;  3RKO F;  3Q7G A;  3K66 A;  2DYS C;  4CS9 C;  4BJ6 A;  2NUP B;  2WL8 A;  3AG1 C;  5IY5 C;  1PD1 A;  3QZC A;  1ZHT A;  2MYS A;  4LLE A;  1ZHY A;  5CI8 A;  3JYH A;  5EHH A;  2KGO A;  3T6B A;  1FTS A;  1FMV A;  3VYW A;  2W4M A;  3W8I A;  4OIO F;  1PCX A;  2OCC C;  3EJN A;  5B3S C;  3ITF A;  2IXN A;  2H7O A;  4O6M A;  2WVQ A;  4HE8 D;  5BUO A;  2J7P A;  4KBL A;  2KQ9 A;  2W4B A;  4I1O B;  1NU9 C;  1Z63 A;  3DMD A;  2A68 F;  4EBB A;  4YT2 A;  2PP4 A;  2H7B A;  2OG2 A;  5DQZ A;  2Q9B A;  4FX5 A;  2Y3B A;  2NUP A;  2KNH A;  3UNG C;  4MND A;  2XXA A;  4BJ5 C;  3MLG A;  3RH3 A;  2B0J A;  4IRU A;  3DAF A;  2J46 A;  3B0V C;  3RIP A;  2IOQ A;  4U5D E;  4JCH A;  1D1B A;  3NYM A;  1LS1 A;  3DAG A;  4NY3 A;  2PX3 A;  3M1C B;  3Q7L A;  1G8X A;  3FDQ A;  3ASN C;  3QMK A;  3K33 A;  2R7R A;  3ZSU A;  3F46 A;  4CS7 A;  3EG9 B;  4QI2 A;  2R7X A;  3N2Z B;  1OCC C;  4XWJ A;  3EPV A;  2R7U A;  1D0X A;  4CBE A;  4C3E A;  3EGX B;  4I1M A;  5KYU A;  4PFP A;  3WOD F;  4G7Z F;  1V55 C;  3AQC A;  2ZXW C;  2P7V A;  4U5C E;  2J9V A;  4KNV A;  2EIL C;  3LAY A;  2WZF A;  2QTV A;  5KYW A;  4ANJ A;  4CS8 C;  3NYL A;  5KYX A;  2J0X A;  4FES A;  4KNW A;  3EHM A;  2ZPA A;  1M57 C;  2H7V C;  1JPN A;  5EGY A;  3SP1 A;  2IXM A;  5KYY B;  2R7T A;  1J8Y F;  1FMW A;  4O79 A;  3NG1 A;  4N06 A;  3B9Q A;  4U5H A;  2JD3 A;  1TWC A;  4X0R A;  3PHF 2;  1TWH A;  3AQB A;  2HV7 A;  3NKD A;  3N24 A;  2DYR C;  3UMH A;  2XXA B;  1D0Y A;  2BE5 F;  5HSW A;  1KU2 A;  3AG4 C;  4F4B A;  2DGJ A;  3K7D A;  5D92 A;  3W8H A;  3EGD B;  4K0D A;  1OCZ C;  2FGY A;  4I3M A;  4DBQ A;  4AX2 A;  5FCL A;  3S0X A;  3W2V A;  4KI2 A;  2Q9A A;  4JW1 A;  2A6H F;  4BG0 A;  2J45 A;  3K6B A;  4JJF A;  2PFD A;  1NU7 D;  4O6N A;  3EH1 A;  2A6E F;  4GEH A;  1MNE A;  2VAS A;  2E87 A;  2EIM C;  3KKB A;  4CIH A;  1O5H A;  2M4E A;  1VK5 A;  3IEE A;  2Z15 A;  3K1I C;  3VAY A;  4YT4 A;  1JPJ A;  2ZXR A;  4PJM A;  4BJ5 A;  2MWQ A;  4E7Z A;  2CNW A;  3EFO A;  3LLI A;  5D91 A;  1LVK A;  2XRH A;  4FWV A;  3K1H A;  1J8M F;  3V7O A;  1RJ9 B;  4LER A;  4XLN F;  1OKK D;  1SF8 A;  1MMA A;  3ECS A;  3DJN B;  2QY9 A;  2X51 A;  2ZXO A;  3X1O A;  3H65 A;  4PJJ A;  3X2Q C;  3N0T A;  4M63 A;  2W45 A;  3OA1 A;  2NUT A;  3GAN A;  1D0Z A;  3ZC4 A;  2XSE A;  2R7O A;  3FAJ A;  3CQZ A;  3LNR A;  4PK4 A;  3L0I A;  3UGP A;  2W9Y A;  2YZS A;  2J9W A;  2G62 A;  1ZHZ A;  4PJL A;  3ABL C;  1BR4 A;  4OIN F;  4C3D A;  3EHN A;  4IAO A;  1VMA A;  4G7H F;  4JUR I;  2VB6 A;  3ABK C;  1FFT C;  2G3K A;  4OD4 A;  3I5Q A;  3OEO A;  3LJB A;  4QDL A;  2A1D D;  5KYY A;  3SYN A;  2XL4 A;  3KH2 A;  5DS5 A;  2Y39 A;  4YJW A;  1MND A;  3MX3 A;  2R7S A;  1WGW A;  5KYN A;  1NZE A;  4DVY P;  2LSE A;  4LLC A;  4P6I C;  2YHS A;  1QLE C;  3UMK A;  3O6X A;  2Y3G A;  3ABM C;  3HJC A;  5B1B C;  2L9J A;  3LS0 A;  3FVY A;  3DZA A;  4LAC B;  3EGX A;  3B0P A;  1MMD A;  4RD9 A;  1M2O A;  4I44 A;  3OWT A;  5T3T A;  3EZH A;  4RDA A;  1SMY F;  3LES A;  4K7B A;  4YWQ A;  2R7W A;  3POV A;  2WVN A;  1OCR C;  3NKE A;  1LKX A;  4OIP F;  3O39 A;  3E9V A;  3KL4 A;  3W2W A;  2R7Q A;  4C7O A;  3ZVR A;  4J32 B;  2EIN C;  4Q4Z F;  4U5F E;  2V26 A;  3AG2 C;  3EFO B;  4OIQ F;  4O6Y A;  1M2V B;  1VYI A;  4YN0 B;  4GYT A;  1ZHX A;  3WG7 C;  2I8B A;  2FFH A;  3JT1 A;  2KJG A;  2WVO A;  4H4K C;  4Q7C A;  4YT5 A;  3S29 A;  1BR2 A;  4G7O F;  4AK9 A;  4RBN A;  3EZI A;  1ZHW A;  1IZM A;  3L34 A;  4AE4 B;  4J30 B;  1ZYR F;  5F5H A;  1NG1 A;  3NDB B;  2EIK C;  1FFH A;  1BR1 A;  2C04 A;  3DD7 A;  3FHD A;  5L3V A;  4JJG A;  1Z6A A;  2HV6 A;  1SZI A;  3DXJ F;  3EGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...