1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
b'MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
1XWJA 1SYQA 5L0HA 4E17A 5L0CA 1RKEA 2B0HA 3RF3A 1ZW3A 1T01A 4PR9A 3S90A 1L7CA 4K1OA 1U89A 4ONSA 3TJ5A 1ZVZA 2LQGA 5L0GA 1ST6A 1TR2A 4IGGA 4P9TA 4W8PA 3T6GB 1ZW2A 3TJ6A 3ZDLA 5L0JA 3H2UA 2GDCA 3H2VA 3MYIA 1U6HA 2IBFA 5FZTA 4E18A 5L0DA 3VF0A 5L0FA 4DJ9A 4EHPA 5L0IA 2X0CA 1RKCA 1RKEB 2HSQA 1DOVA 2GWWA 1QKRA 1H6GA 1DOWA 2L7AA 1YDIA
chains in the Genus database with same CATH superfamily
1BR2A 5AC5A 2J7PD 2YVKA 4CDYA 4BJ6A 3O6XA 3EGXA 4U9EA 1TKNA 4OIOF 2BL2A 1LE4A 5IY5C 4IAOA 3Q7LA 3S0XA 3U2MA 3RKOF 3KKBA 3LESA 1JPNA 5T3WA 1LE2A 5A6BA 3MFNA 1GS9A 4QI2A 4PFOA 2I15A 2EPOA 3NKEA 4JW1A 2P61A 3ZTMA 1C02A 1ZHTA 4JEBA 3DE9A 1WOLA 4YN0B 3FOPA 1GM5A 4BJ6C 1D0XA 3QMKA 3ZWIA 1SZIA 4O79A 4DJ9A 5EHHA 4JTAB 1PD1A 4NY3A 4CSAA 1JAFA 2PX0A 3B71A 3C8GD 3FVYA 5DS6A 1JPJA 1PV3A 1OR3A 4JURI 2CCYA 2QTVA 3MLGA 4JJGA 2Y3BA 5DLJA 2VCAA 5JS5A 1Z63A 5EK0A 3EPVA 3V5YA 2AWYA 3ZTZA 2P7VA 3ECSA 1I4YA 3SXMA 1OKKD 1S05A 5L0GA 5A6AA 2WZGA 5B1BC 3IQCA 4CSAC 4U5GA 1MNDA 3CQZA 2J0XA 2XLOA 3JYHA 3KPHA 1NLXA 2EPNA 2J0WA 3WG7C 4EUKB 3U2LA 3W2VA 4MNDA 4N6CA 1U6HA 1EA8A 2KNHA 1TFOB 3DAGA 2R7UA 1LPEA 3CZ6A 2YLIA 3AG4C 3HNKA 4NTAA 2R7TA 2L6FA 1LVKA 2XM4A 3DAFA 3M4CA 2R7VA 1PCXA 5B3SC 5KYNA 3AG1C 4PACA 2HJ3A 4A4AA 1A7EA 2J9BA 5L0HA 3AGTA 4JRZA 2GA0A 1OR2A 1K04A 4U5BE 3SXKA 4GQHA 3F47A 5KYXB 1H9TA 1Q0MA 4JIOA 5DQTA 3JRTA 3ASNC 4I1OB 2Y3HA 3DM5A 2IXNA 3UGOA 3B9QA 4I44A 1O3UA 2KC3A 3A11A 1AEPA 5A6BD 2HMQA 3EHNA 3R7CA 5D91A 1QQ3A 4AK9A 4J30B 3CAXA 4J7YA 1JOGA 1OQCA 4LLCA 3Q6MA 3E9VA 3S27A 3LUTB 4CBEA 1RKEB 4OD4A 4N06A 1FFTC 1NZEA 3AOUA 1DOVA 4KNWA 4X0RA 5B1AC 5BQHA 4OIPF 3UMIA 2XL4A 3FAJA 4P6IC 4E17A 1LKXA 5L0CA 2B0HA 4IB4A 2L6HA 2O9XA 3UR3C 1LI5A 2OKUA 5GPGB 4CX9A 4EIYA 2XLHA 4C3DA 4RDAA 3POVA 3LNRA 4JVSA 4XLNF 3RFYA 3X1OA 4EWCA 1R5ID 3T6BA 3IQTA 3JSEO 4XEVA 4XPYA 4B6IA 4W8PA 1ZU4A 1RXQA 4LERA 4OIRF 5L0JA 1RJ9A 3AGUA 3ZQYA 3U0CA 2EINC 3KYIA 3TOMA 3L0IA 2MWQA 3S28A 4MTFA 5TJ5E 4BJ5A 4F4BA 3U3FA 5KYWB 2A0BA 1Q0KA 3ABMC 2LFDA 3ITFA 2A6EF 4IJJA 2A0UA 2LK4A 3U9JA 2OOCA 4MS2A 2H8AA 1Z5ZA 1VB5A 2G3VA 3SEOA 1HMDA 4LACB 4CS7A 4C7OB 1LS1A 2CGEA 4Q7CA 2J46A 1W2WA 5JT4A 2LSEA 3S90A 3DKAA 2WVQA 4KNVA 4HEAJ 4K7BA 3NMKA 2BE5F 3EG9B 3HNIA 3SNHA 3T6GB 4DVZA 2HKVA 5DQZA 1MMDA 1ZHWA 4EKWA 5KYXA 2C04A 2PF4E 4DVYP 3GEHA 1A0BA 1M57C 3GWNA 1T9KA 3OA1A 3EFOB 4U9DA 1JMWA 5FZTA 3U8VA 4CDVA 3O39A 4AE4B 1D1BA 4AL0A 3LJBA 4JZAA 1E83A 4G7HF 4L6RA 2XL6A 1V54C 4QI0A 2EIJC 4YWQA 1NU7D 4YT2A 3FHDA 4LDKA 1F1MA 5KYUB 1XWJA 2L81A 4J7TA 1SYQA 4ULVA 4AL1A 2KSFA 2J45A 1RKEA 1V55C 2R7OA 3HNJA 2HJMA 3RH3A 3SZRA 4IAQA 3TQOA 3K1IA 2CNWA 1EI7A 1NU9C 2UUHA 3BRJA 4HFFB 4O6MA 5AGFA 2PNOA 2YWAA 5F28E 2HZ8A 2QE9A 2VASA 1Y6DA 3QW1A 4WJ0A 3LEOA 4XEFA 3OEOA 3JYYA 2AVKA 3WAQA 4U5EE 3N2ZB 4JEAA 4YL0A 3ASOC 2XLVA 2HMZA 3GM2A 4ANJA 1G5ZA 1ZHZA 3K1IC 2VCBA 1Q0DA 2VB6A 2W4MA 1ZHXA 3C7JA 3DI5A 2DGJA 2RD9A 3HKKA 5E3AA 3G4XA 3UMKA 4A2NB 1KNYA 4MVMA 1FMVA 1QVXA 1FFHA 4KC9A 4I3MA 5KYWA 1D0YA 1JRAA 1A7DA 2NUPB 1J8MF 4MVZA 2V3CC 2DI3A 3RF3A 1CGME 5JUAA 2A1DD 1NG1A 2XS1A 1H7IA 3NKDA 3FAPB 5COFA 3IEEA 5JP7A 1RJ9B 4C7OA 3KL4A 2IOQA 1E2XA 1FAPB 1WN0A 1ZZPA 2WB7A 2YL0A 4IGGA 4GEHA 4J32B 2EILC 4MTOA 4IWBA 3FDQA 4XLPF 3EJNA 3ZG1A 2MYSA 1B68A 3C8ZA 2Y3GA 2R25A 4RD9A 1WATA 3C63A 1FNTc 2JPUA 3PHF2 3F46A 2YQYA 3T4RA 3NMJA 3NG1A 1ZU5A 2HV7A 3EG9A 3WHNA 2A69F 4Q5SF 1M2OA 1TWCA 2JX0A 2GFHA 2W45A 5JSLA 1T5OA 2GAQA 1A7VA 4PJJA 2H7VC 3K66A 3MBGA 1CGOA 2YL7A 2ZXRA 3ZSUA 3EFOA 2L7AA 1YDIA 1G8XA 3JSZA 3ATPA 4IARA 3ZIBA 1VMAA 4AE4A 4DRJB 3US6A 4WGZA 4CIPA 5EGYA 2MHRA 4MTGA 3K33A 4CJOA 3EGDB 2IXOA 5BQIA 2Q3TA 2J9UA 3RQEA 2J8WA 1UG7A 1L7CA 1HY5A 5KYUA 3K1HA 4PK4A 4EBKA 1J8YF 2IM8A 3EZHA 3U5SA 1Z3IX 1LM3B 3O10A 4MW3A 1SR2A 4GYTA 2Z15A 1T6IA 1TFKB 3H2UA 1MQVA 2Q9CA 4C3BA 3UGPA 1E86A 2NSGA 4Q4ZF 4NQFA 3RVYA 3X2QC 3CSKA 3PDMP 1IW7F 2V26A 3G4ZA 2R7RA 5L0IA 3B0PA 1AVOB 4IRUA 3I5PA 1BR4A 3JCUQ 3IQ5A 2XLEA 4YL1A 4G78A 3LEVA 4UDVA 2R7SA 1H6GA 3M15A 2EPLX 2OCCC 2R7XA 3NMIA 4U5DE 2HV6A 1VYKA 4P9FA 4AX2A 3KMIA 1CGNA 1V4AA 2P1AA 3V5XA 2QNLA 1M6TA 1M2VB 4CS8A 3DMDA 4CS9A 1V74B 1QZXA 2XRHA 3NYJA 4PR9A 2ZXPA 3BEHA 4CDAA 1S7ZA 5DS5A 1TWHA 4G7ZF 2XXAB 4JCHA 5K0IA 3VYWA 5AC4A 1K40A 2NUPA 4JTDB 4NTBA 1BZ4A 1ORSC 5D92A 1YZAA 1OCCC 4U5FE 3B0UX 2LFFA 4U5HA 1KU2A 2QLAA 4XQ1A 3GM3A 4D4NA 4E0IA 1EKYA 1C17M 1VLSA 1YA7O 4YJWA 3RYLA 1GGQA 4E7SA 1Q0GA 2A68F 1BDJB 1QLEC 1BBHA 2A6HF 4I1MA 2XL8A 3UNGC 2TMVP 2WZFA 2PFDA 2BC5A 3R2PA 4ER9A 3JRMO 1YVIA 4MVQA 3GEIA 2ZXWC 1OCOC 2EIMC 4QDLA 2IYLD 4C3EA 4ULWA 1R4TA 1OCRC 2VCCA 1ZVZA 2LQGA 4PFPA 5DVWA 4BJ5C 2D5RB 2FGYA 1APCA 1LS4A 1CPQA 2DYRC 2RSEB 3EGDA 3LLIA 3NYLA 4G7OF 2YLGA 5DS4A 2CW0F 3V5ZA 5JRAA 3VRCA 2GDCA 4MVSA 4OIQF 1G4WR 1NBBA 2YL3A 4XPWA 3OWTA 4XWJA 3O55A 2OJED 3HJCA 3VF0A 3LS0A 2KJGA 3W4YA 4YT5A 1MMNA 3B29A 4W8KA 2PX3A 3NYMA 4PJMA 3SYNA 3N0TA 4N6HA 2PP4A 1I4ZA 1QKRA 1LI7A 3W8HA 1TWAA 2C03A 3I4UA 5CI9A 4DBQA 5BUOA 3QZCA 1WASA 3DD7A 1Z6AA 4KBLA 4JKVA 3U9MA 2NG1A 2IXMA 3QVZA 4BJ1A 2YHSA 2R05A 2ZD9A 2B0JA 2ZPAA 3HTKC 4E0HA 1FMWA 3ABKC 4YT8A 3GORA 4ONSA 5A69A 2D4UA 4LLEA 1BR1A 5T3TA 2X51A 2AU5A 1MNEA 2P0NA 5E3CA 1M2VA 3IPMO 3VM6A 5L0FA 2G3KA 2XS8A 3M1CB 2NUTB 3JTLO 2UUIA 5HSWA 4ZLDA 1T6UA 3AG2C 1RCPA 5E33A 2L9JA 2XXAA 4JTCB 4WGYA 3TK0A 4BEJA 2YEVA 1E85A 3A9CA 2Q7RA 4BG0A 3LS1A 4EHPA 3UMHA 2EPKX 3QW0A 2Y69C 1LIHA 1QSPA 3RIPA 3SP1A 4O6YA 3DE8A 2XLMA 4NC3A 3FOOA 2OG2A 3AQCA 1L3PA 2AWCA 5CI8A 3RVZA 1TQGA 2M4EA 2XM0A 3AJMA 2R03A 1YZCA 1C03A 4N4WA 4DBRA 3B0VC 3PCVA 3QTHA 3RQFA 5CIVA 3LLKA 3TULA 2G62A 2QUPA 3LAYA 2ASRA 1SF8A 1OW7A 2Q9AA 5E2QA 4P9TA 5JLIA 2WVNA 4U5CE 1ZW2A 1YYXA 2XSEA 4O6NA 3TJ6A 2HUJA 3K6BA 2P6VA 4JE9A 2WVOA 1NSGB 4JC7A 2DB4A 1G4US 3AQBA 3T6JA 2YKZA 4E18A 1H9GA 2CYDA 2VH3A 3FMSA 4PJLA 3H65A 5T1DB 1MMGA 5BQGA 1HMOA 4R32A 3CEXA 2GWWA 1A41A 4DOZA 4LDQA 1HE9A 3SXYA 3S84A 2KGOA 2DYSC 2CDQA 5COMA 1UFBA 1ORJA 1ZW3A 2YRFA 2EPMX 1I5NA 4MW8A 2HFIA 4CJGA 1RMVA 1GQAA 1VK5A 1U89A 1FTSA 3Q6NA 3C8GB 2CNWD 4HE8D 4WABA 4D4XA 2W9YA 4NCQA 4Z9HA 1HW1A 3GEEA 4FWVA 3GANA 3U8PA 3NDBB 4BEMJ 1EQ1A 2NSFA 1OCZC 4KI2A 3L1MA 1TWGA 1OW6A 2J9VA 2Q00A 1YAUO 1WTYA 3KH2A 1ORYA 1RKCA 1D1CA 256BA 1JR8A 2WL8A 3FXHA 2NUTA 3PMRA 2Y3DA 2LP4A 4XEKA 1XZQA 3L8IA 3S9OA 3MYFA 2ETSA 3S29A 3W8IA 2OU6A 2E87A 1DOWA 2YZSA 3ABLC 3DJNB 3IHUA 3L34A 4M63A 2Q9BA 4YL3A 2LCHA 2H7OA 4BPMA 5KYYB 2R7WA 1NFOA 4DXWA 3C62A 3G50A 2OJQA 2L6GA 1SMYF 3GODA 1VOMA 1NFNA 2WZLA 4LDRA 3AG3C 1O5HA 3DZAA 3IQ6A 4NTFA 3RQGA 5F5FA 1YYJA 5HV9A 3EQLF 2LIGA 3NRHA 2LD6A 1ST6A 4FAPB 4XTKA 2YL1A 4JCZA 3M79A 5L3VA 1OXBA 2M64A 1YARO 1VLTA 1N1CA 2Q4FA 4PJNA 2PBEA 1O87A 2VC9A 2IBFA 3JT1A 4FX5A 1ZYRF 1AUEA 1D1AA 2FAPB 3EH1A 3EZIA 4CS8C 3M4BA 1Z23A 3ZVRA 2JD3A 4XPXA 4CS9C 3EGXB 2J7PA 4OD5A 3SXZA 2YLDA 2OEXA 5JVEA 3Q7GA 2EIKC 3EH2A 5A6JA 2XLWA 4CIHA 1KTMA 4DRIB 4EBBA 4O7GA 3I5QA 1WWPA 2H7BA 2W4BA 4OINF 1VTMP 4K0DA 5B3IA 2ICWG 2R9RB 2XLDA 2IXPA 3U3BA 1YLMA 4RBNA 3DXJF 3T9OA 1HW2A 1Q0FA 5A6KA 4HFKB 4K1OA 4EBJA 1YJGA 3TD7A 4JJFA 5F5HA 3J06A 1HE1A 3DJUB 2HSBA 3K7DA 4H4KC 4BJTA 3H2VA 2OQMA 3JZ0A 1Z7Qc 4MVUA 5L0DA 2ZXOA 3C8GA 2HS5A 3GWLA 5L3QA 4H54A 4YT4A 1IZMA 1PD0A 3HLZA 4DRHB 3VAYA 3QVYA 1VYIA 4G0HA 3HNLA 1D0ZA 3N24A 1T6QA 3LNMB 2J9WA 3WODF 4E7ZA 1WGWA 1U0BB 2AP3A 4ZLCA 3V7OA 3ZQVA 1T01A 1OKKA 2I8BA 2FFHA 2KK1A 1XZPA 1CPRA 4MQ9F 3TOLA 3E70C 3L8JA 3C18A 4YK5A 5KYYA 1E84A 3TJ5A 2QY9A 2R02A 3EHMA 2KW3C 1TR2A 1M56C 2KYHA 3DWWA 2F22A 2Y39A 1MMAA 3DM9B 5COGA 4Z9IA 3ZDLA 1FR0A 3MYIA 1YA9A 1ZHYA 2NPUA 1K05A 1OXKA 3KYJA 3RW0A 3W2WA 3GM1A 2X0CA 1Y4CA 3ZC4A 1OW8A 1QPUA 2R7QA 2HSQA 2KQ9A 4MVOA 5FCLA 4MVRA 4FESA 4Z9JA 2OEVA 3MX3A
chains in the Genus database with same CATH topology
1XWJA 1SYQA 5L0HA 4E17A 5L0CA 1RKEA 2B0HA 3RF3A 1ZW3A 1T01A 4PR9A 3S90A 1L7CA 4K1OA 1U89A 4ONSA 3TJ5A 1ZVZA 2LQGA 5L0GA 1ST6A 1TR2A 4IGGA 4P9TA 4W8PA 3T6GB 1ZW2A 3TJ6A 3ZDLA 5L0JA 3H2UA 2GDCA 3H2VA 3MYIA 1U6HA 2IBFA 5FZTA 4E18A 5L0DA 3VF0A 5L0FA 4DJ9A 4EHPA 5L0IA 2X0CA 1RKCA 1RKEB 2HSQA 1DOVA 2GWWA 1QKRA 1H6GA 1DOWA 2L7AA 1YDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWJ A;  1SYQ A;  5L0H A;  4E17 A;  5L0C A;  1RKE A;  2B0H A;  3RF3 A;  1ZW3 A;  1T01 A;  4PR9 A;  3S90 A;  1L7C A;  4K1O A;  1U89 A;  4ONS A;  3TJ5 A;  1ZVZ A;  2LQG A;  5L0G A;  1ST6 A;  1TR2 A;  4IGG A;  4P9T A;  4W8P A;  3T6G B;  1ZW2 A;  3TJ6 A;  3ZDL A;  5L0J A;  3H2U A;  2GDC A;  3H2V A;  3MYI A;  1U6H A;  2IBF A;  5FZT A;  4E18 A;  5L0D A;  3VF0 A;  5L0F A;  4DJ9 A;  4EHP A;  5L0I A;  2X0C A;  1RKC A;  1RKE B;  2HSQ A;  1DOV A;  2GWW A;  1QKR A;  1H6G A;  1DOW A;  2L7A A;  1YDI A; 
#chains in the Genus database with same CATH topology
 1BR2 A;  5AC5 A;  2J7P D;  2YVK A;  4CDY A;  4BJ6 A;  3O6X A;  3EGX A;  4U9E A;  1TKN A;  4OIO F;  2BL2 A;  1LE4 A;  5IY5 C;  4IAO A;  3Q7L A;  3S0X A;  3U2M A;  3RKO F;  3KKB A;  3LES A;  1JPN A;  5T3W A;  1LE2 A;  5A6B A;  3MFN A;  1GS9 A;  4QI2 A;  4PFO A;  2I15 A;  2EPO A;  3NKE A;  4JW1 A;  2P61 A;  3ZTM A;  1C02 A;  1ZHT A;  4JEB A;  3DE9 A;  1WOL A;  4YN0 B;  3FOP A;  1GM5 A;  4BJ6 C;  1D0X A;  3QMK A;  3ZWI A;  1SZI A;  4O79 A;  4DJ9 A;  5EHH A;  4JTA B;  1PD1 A;  4NY3 A;  4CSA A;  1JAF A;  2PX0 A;  3B71 A;  3C8G D;  3FVY A;  5DS6 A;  1JPJ A;  1PV3 A;  1OR3 A;  4JUR I;  2CCY A;  2QTV A;  3MLG A;  4JJG A;  2Y3B A;  5DLJ A;  2VCA A;  5JS5 A;  1Z63 A;  5EK0 A;  3EPV A;  3V5Y A;  2AWY A;  3ZTZ A;  2P7V A;  3ECS A;  1I4Y A;  3SXM A;  1OKK D;  1S05 A;  5L0G A;  5A6A A;  2WZG A;  5B1B C;  3IQC A;  4CSA C;  4U5G A;  1MND A;  3CQZ A;  2J0X A;  2XLO A;  3JYH A;  3KPH A;  1NLX A;  2EPN A;  2J0W A;  3WG7 C;  4EUK B;  3U2L A;  3W2V A;  4MND A;  4N6C A;  1U6H A;  1EA8 A;  2KNH A;  1TFO B;  3DAG A;  2R7U A;  1LPE A;  3CZ6 A;  2YLI A;  3AG4 C;  3HNK A;  4NTA A;  2R7T A;  2L6F A;  1LVK A;  2XM4 A;  3DAF A;  3M4C A;  2R7V A;  1PCX A;  5B3S C;  5KYN A;  3AG1 C;  4PAC A;  2HJ3 A;  4A4A A;  1A7E A;  2J9B A;  5L0H A;  3AGT A;  4JRZ A;  2GA0 A;  1OR2 A;  1K04 A;  4U5B E;  3SXK A;  4GQH A;  3F47 A;  5KYX B;  1H9T A;  1Q0M A;  4JIO A;  5DQT A;  3JRT A;  3ASN C;  4I1O B;  2Y3H A;  3DM5 A;  2IXN A;  3UGO A;  3B9Q A;  4I44 A;  1O3U A;  2KC3 A;  3A11 A;  1AEP A;  5A6B D;  2HMQ A;  3EHN A;  3R7C A;  5D91 A;  1QQ3 A;  4AK9 A;  4J30 B;  3CAX A;  4J7Y A;  1JOG A;  1OQC A;  4LLC A;  3Q6M A;  3E9V A;  3S27 A;  3LUT B;  4CBE A;  1RKE B;  4OD4 A;  4N06 A;  1FFT C;  1NZE A;  3AOU A;  1DOV A;  4KNW A;  4X0R A;  5B1A C;  5BQH A;  4OIP F;  3UMI A;  2XL4 A;  3FAJ A;  4P6I C;  4E17 A;  1LKX A;  5L0C A;  2B0H A;  4IB4 A;  2L6H A;  2O9X A;  3UR3 C;  1LI5 A;  2OKU A;  5GPG B;  4CX9 A;  4EIY A;  2XLH A;  4C3D A;  4RDA A;  3POV A;  3LNR A;  4JVS A;  4XLN F;  3RFY A;  3X1O A;  4EWC A;  1R5I D;  3T6B A;  3IQT A;  3JSE O;  4XEV A;  4XPY A;  4B6I A;  4W8P A;  1ZU4 A;  1RXQ A;  4LER A;  4OIR F;  5L0J A;  1RJ9 A;  3AGU A;  3ZQY A;  3U0C A;  2EIN C;  3KYI A;  3TOM A;  3L0I A;  2MWQ A;  3S28 A;  4MTF A;  5TJ5 E;  4BJ5 A;  4F4B A;  3U3F A;  5KYW B;  2A0B A;  1Q0K A;  3ABM C;  2LFD A;  3ITF A;  2A6E F;  4IJJ A;  2A0U A;  2LK4 A;  3U9J A;  2OOC A;  4MS2 A;  2H8A A;  1Z5Z A;  1VB5 A;  2G3V A;  3SEO A;  1HMD A;  4LAC B;  4CS7 A;  4C7O B;  1LS1 A;  2CGE A;  4Q7C A;  2J46 A;  1W2W A;  5JT4 A;  2LSE A;  3S90 A;  3DKA A;  2WVQ A;  4KNV A;  4HEA J;  4K7B A;  3NMK A;  2BE5 F;  3EG9 B;  3HNI A;  3SNH A;  3T6G B;  4DVZ A;  2HKV A;  5DQZ A;  1MMD A;  1ZHW A;  4EKW A;  5KYX A;  2C04 A;  2PF4 E;  4DVY P;  3GEH A;  1A0B A;  1M57 C;  3GWN A;  1T9K A;  3OA1 A;  3EFO B;  4U9D A;  1JMW A;  5FZT A;  3U8V A;  4CDV A;  3O39 A;  4AE4 B;  1D1B A;  4AL0 A;  3LJB A;  4JZA A;  1E83 A;  4G7H F;  4L6R A;  2XL6 A;  1V54 C;  4QI0 A;  2EIJ C;  4YWQ A;  1NU7 D;  4YT2 A;  3FHD A;  4LDK A;  1F1M A;  5KYU B;  1XWJ A;  2L81 A;  4J7T A;  1SYQ A;  4ULV A;  4AL1 A;  2KSF A;  2J45 A;  1RKE A;  1V55 C;  2R7O A;  3HNJ A;  2HJM A;  3RH3 A;  3SZR A;  4IAQ A;  3TQO A;  3K1I A;  2CNW A;  1EI7 A;  1NU9 C;  2UUH A;  3BRJ A;  4HFF B;  4O6M A;  5AGF A;  2PNO A;  2YWA A;  5F28 E;  2HZ8 A;  2QE9 A;  2VAS A;  1Y6D A;  3QW1 A;  4WJ0 A;  3LEO A;  4XEF A;  3OEO A;  3JYY A;  2AVK A;  3WAQ A;  4U5E E;  3N2Z B;  4JEA A;  4YL0 A;  3ASO C;  2XLV A;  2HMZ A;  3GM2 A;  4ANJ A;  1G5Z A;  1ZHZ A;  3K1I C;  2VCB A;  1Q0D A;  2VB6 A;  2W4M A;  1ZHX A;  3C7J A;  3DI5 A;  2DGJ A;  2RD9 A;  3HKK A;  5E3A A;  3G4X A;  3UMK A;  4A2N B;  1KNY A;  4MVM A;  1FMV A;  1QVX A;  1FFH A;  4KC9 A;  4I3M A;  5KYW A;  1D0Y A;  1JRA A;  1A7D A;  2NUP B;  1J8M F;  4MVZ A;  2V3C C;  2DI3 A;  3RF3 A;  1CGM E;  5JUA A;  2A1D D;  1NG1 A;  2XS1 A;  1H7I A;  3NKD A;  3FAP B;  5COF A;  3IEE A;  5JP7 A;  1RJ9 B;  4C7O A;  3KL4 A;  2IOQ A;  1E2X A;  1FAP B;  1WN0 A;  1ZZP A;  2WB7 A;  2YL0 A;  4IGG A;  4GEH A;  4J32 B;  2EIL C;  4MTO A;  4IWB A;  3FDQ A;  4XLP F;  3EJN A;  3ZG1 A;  2MYS A;  1B68 A;  3C8Z A;  2Y3G A;  2R25 A;  4RD9 A;  1WAT A;  3C63 A;  1FNT c;  2JPU A;  3PHF 2;  3F46 A;  2YQY A;  3T4R A;  3NMJ A;  3NG1 A;  1ZU5 A;  2HV7 A;  3EG9 A;  3WHN A;  2A69 F;  4Q5S F;  1M2O A;  1TWC A;  2JX0 A;  2GFH A;  2W45 A;  5JSL A;  1T5O A;  2GAQ A;  1A7V A;  4PJJ A;  2H7V C;  3K66 A;  3MBG A;  1CGO A;  2YL7 A;  2ZXR A;  3ZSU A;  3EFO A;  2L7A A;  1YDI A;  1G8X A;  3JSZ A;  3ATP A;  4IAR A;  3ZIB A;  1VMA A;  4AE4 A;  4DRJ B;  3US6 A;  4WGZ A;  4CIP A;  5EGY A;  2MHR A;  4MTG A;  3K33 A;  4CJO A;  3EGD B;  2IXO A;  5BQI A;  2Q3T A;  2J9U A;  3RQE A;  2J8W A;  1UG7 A;  1L7C A;  1HY5 A;  5KYU A;  3K1H A;  4PK4 A;  4EBK A;  1J8Y F;  2IM8 A;  3EZH A;  3U5S A;  1Z3I X;  1LM3 B;  3O10 A;  4MW3 A;  1SR2 A;  4GYT A;  2Z15 A;  1T6I A;  1TFK B;  3H2U A;  1MQV A;  2Q9C A;  4C3B A;  3UGP A;  1E86 A;  2NSG A;  4Q4Z F;  4NQF A;  3RVY A;  3X2Q C;  3CSK A;  3PDM P;  1IW7 F;  2V26 A;  3G4Z A;  2R7R A;  5L0I A;  3B0P A;  1AVO B;  4IRU A;  3I5P A;  1BR4 A;  3JCU Q;  3IQ5 A;  2XLE A;  4YL1 A;  4G78 A;  3LEV A;  4UDV A;  2R7S A;  1H6G A;  3M15 A;  2EPL X;  2OCC C;  2R7X A;  3NMI A;  4U5D E;  2HV6 A;  1VYK A;  4P9F A;  4AX2 A;  3KMI A;  1CGN A;  1V4A A;  2P1A A;  3V5X A;  2QNL A;  1M6T A;  1M2V B;  4CS8 A;  3DMD A;  4CS9 A;  1V74 B;  1QZX A;  2XRH A;  3NYJ A;  4PR9 A;  2ZXP A;  3BEH A;  4CDA A;  1S7Z A;  5DS5 A;  1TWH A;  4G7Z F;  2XXA B;  4JCH A;  5K0I A;  3VYW A;  5AC4 A;  1K40 A;  2NUP A;  4JTD B;  4NTB A;  1BZ4 A;  1ORS C;  5D92 A;  1YZA A;  1OCC C;  4U5F E;  3B0U X;  2LFF A;  4U5H A;  1KU2 A;  2QLA A;  4XQ1 A;  3GM3 A;  4D4N A;  4E0I A;  1EKY A;  1C17 M;  1VLS A;  1YA7 O;  4YJW A;  3RYL A;  1GGQ A;  4E7S A;  1Q0G A;  2A68 F;  1BDJ B;  1QLE C;  1BBH A;  2A6H F;  4I1M A;  2XL8 A;  3UNG C;  2TMV P;  2WZF A;  2PFD A;  2BC5 A;  3R2P A;  4ER9 A;  3JRM O;  1YVI A;  4MVQ A;  3GEI A;  2ZXW C;  1OCO C;  2EIM C;  4QDL A;  2IYL D;  4C3E A;  4ULW A;  1R4T A;  1OCR C;  2VCC A;  1ZVZ A;  2LQG A;  4PFP A;  5DVW A;  4BJ5 C;  2D5R B;  2FGY A;  1APC A;  1LS4 A;  1CPQ A;  2DYR C;  2RSE B;  3EGD A;  3LLI A;  3NYL A;  4G7O F;  2YLG A;  5DS4 A;  2CW0 F;  3V5Z A;  5JRA A;  3VRC A;  2GDC A;  4MVS A;  4OIQ F;  1G4W R;  1NBB A;  2YL3 A;  4XPW A;  3OWT A;  4XWJ A;  3O55 A;  2OJE D;  3HJC A;  3VF0 A;  3LS0 A;  2KJG A;  3W4Y A;  4YT5 A;  1MMN A;  3B29 A;  4W8K A;  2PX3 A;  3NYM A;  4PJM A;  3SYN A;  3N0T A;  4N6H A;  2PP4 A;  1I4Z A;  1QKR A;  1LI7 A;  3W8H A;  1TWA A;  2C03 A;  3I4U A;  5CI9 A;  4DBQ A;  5BUO A;  3QZC A;  1WAS A;  3DD7 A;  1Z6A A;  4KBL A;  4JKV A;  3U9M A;  2NG1 A;  2IXM A;  3QVZ A;  4BJ1 A;  2YHS A;  2R05 A;  2ZD9 A;  2B0J A;  2ZPA A;  3HTK C;  4E0H A;  1FMW A;  3ABK C;  4YT8 A;  3GOR A;  4ONS A;  5A69 A;  2D4U A;  4LLE A;  1BR1 A;  5T3T A;  2X51 A;  2AU5 A;  1MNE A;  2P0N A;  5E3C A;  1M2V A;  3IPM O;  3VM6 A;  5L0F A;  2G3K A;  2XS8 A;  3M1C B;  2NUT B;  3JTL O;  2UUI A;  5HSW A;  4ZLD A;  1T6U A;  3AG2 C;  1RCP A;  5E33 A;  2L9J A;  2XXA A;  4JTC B;  4WGY A;  3TK0 A;  4BEJ A;  2YEV A;  1E85 A;  3A9C A;  2Q7R A;  4BG0 A;  3LS1 A;  4EHP A;  3UMH A;  2EPK X;  3QW0 A;  2Y69 C;  1LIH A;  1QSP A;  3RIP A;  3SP1 A;  4O6Y A;  3DE8 A;  2XLM A;  4NC3 A;  3FOO A;  2OG2 A;  3AQC A;  1L3P A;  2AWC A;  5CI8 A;  3RVZ A;  1TQG A;  2M4E A;  2XM0 A;  3AJM A;  2R03 A;  1YZC A;  1C03 A;  4N4W A;  4DBR A;  3B0V C;  3PCV A;  3QTH A;  3RQF A;  5CIV A;  3LLK A;  3TUL A;  2G62 A;  2QUP A;  3LAY A;  2ASR A;  1SF8 A;  1OW7 A;  2Q9A A;  5E2Q A;  4P9T A;  5JLI A;  2WVN A;  4U5C E;  1ZW2 A;  1YYX A;  2XSE A;  4O6N A;  3TJ6 A;  2HUJ A;  3K6B A;  2P6V A;  4JE9 A;  2WVO A;  1NSG B;  4JC7 A;  2DB4 A;  1G4U S;  3AQB A;  3T6J A;  2YKZ A;  4E18 A;  1H9G A;  2CYD A;  2VH3 A;  3FMS A;  4PJL A;  3H65 A;  5T1D B;  1MMG A;  5BQG A;  1HMO A;  4R32 A;  3CEX A;  2GWW A;  1A41 A;  4DOZ A;  4LDQ A;  1HE9 A;  3SXY A;  3S84 A;  2KGO A;  2DYS C;  2CDQ A;  5COM A;  1UFB A;  1ORJ A;  1ZW3 A;  2YRF A;  2EPM X;  1I5N A;  4MW8 A;  2HFI A;  4CJG A;  1RMV A;  1GQA A;  1VK5 A;  1U89 A;  1FTS A;  3Q6N A;  3C8G B;  2CNW D;  4HE8 D;  4WAB A;  4D4X A;  2W9Y A;  4NCQ A;  4Z9H A;  1HW1 A;  3GEE A;  4FWV A;  3GAN A;  3U8P A;  3NDB B;  4BEM J;  1EQ1 A;  2NSF A;  1OCZ C;  4KI2 A;  3L1M A;  1TWG A;  1OW6 A;  2J9V A;  2Q00 A;  1YAU O;  1WTY A;  3KH2 A;  1ORY A;  1RKC A;  1D1C A;  256B A;  1JR8 A;  2WL8 A;  3FXH A;  2NUT A;  3PMR A;  2Y3D A;  2LP4 A;  4XEK A;  1XZQ A;  3L8I A;  3S9O A;  3MYF A;  2ETS A;  3S29 A;  3W8I A;  2OU6 A;  2E87 A;  1DOW A;  2YZS A;  3ABL C;  3DJN B;  3IHU A;  3L34 A;  4M63 A;  2Q9B A;  4YL3 A;  2LCH A;  2H7O A;  4BPM A;  5KYY B;  2R7W A;  1NFO A;  4DXW A;  3C62 A;  3G50 A;  2OJQ A;  2L6G A;  1SMY F;  3GOD A;  1VOM A;  1NFN A;  2WZL A;  4LDR A;  3AG3 C;  1O5H A;  3DZA A;  3IQ6 A;  4NTF A;  3RQG A;  5F5F A;  1YYJ A;  5HV9 A;  3EQL F;  2LIG A;  3NRH A;  2LD6 A;  1ST6 A;  4FAP B;  4XTK A;  2YL1 A;  4JCZ A;  3M79 A;  5L3V A;  1OXB A;  2M64 A;  1YAR O;  1VLT A;  1N1C A;  2Q4F A;  4PJN A;  2PBE A;  1O87 A;  2VC9 A;  2IBF A;  3JT1 A;  4FX5 A;  1ZYR F;  1AUE A;  1D1A A;  2FAP B;  3EH1 A;  3EZI A;  4CS8 C;  3M4B A;  1Z23 A;  3ZVR A;  2JD3 A;  4XPX A;  4CS9 C;  3EGX B;  2J7P A;  4OD5 A;  3SXZ A;  2YLD A;  2OEX A;  5JVE A;  3Q7G A;  2EIK C;  3EH2 A;  5A6J A;  2XLW A;  4CIH A;  1KTM A;  4DRI B;  4EBB A;  4O7G A;  3I5Q A;  1WWP A;  2H7B A;  2W4B A;  4OIN F;  1VTM P;  4K0D A;  5B3I A;  2ICW G;  2R9R B;  2XLD A;  2IXP A;  3U3B A;  1YLM A;  4RBN A;  3DXJ F;  3T9O A;  1HW2 A;  1Q0F A;  5A6K A;  4HFK B;  4K1O A;  4EBJ A;  1YJG A;  3TD7 A;  4JJF A;  5F5H A;  3J06 A;  1HE1 A;  3DJU B;  2HSB A;  3K7D A;  4H4K C;  4BJT A;  3H2V A;  2OQM A;  3JZ0 A;  1Z7Q c;  4MVU A;  5L0D A;  2ZXO A;  3C8G A;  2HS5 A;  3GWL A;  5L3Q A;  4H54 A;  4YT4 A;  1IZM A;  1PD0 A;  3HLZ A;  4DRH B;  3VAY A;  3QVY A;  1VYI A;  4G0H A;  3HNL A;  1D0Z A;  3N24 A;  1T6Q A;  3LNM B;  2J9W A;  3WOD F;  4E7Z A;  1WGW A;  1U0B B;  2AP3 A;  4ZLC A;  3V7O A;  3ZQV A;  1T01 A;  1OKK A;  2I8B A;  2FFH A;  2KK1 A;  1XZP A;  1CPR A;  4MQ9 F;  3TOL A;  3E70 C;  3L8J A;  3C18 A;  4YK5 A;  5KYY A;  1E84 A;  3TJ5 A;  2QY9 A;  2R02 A;  3EHM A;  2KW3 C;  1TR2 A;  1M56 C;  2KYH A;  3DWW A;  2F22 A;  2Y39 A;  1MMA A;  3DM9 B;  5COG A;  4Z9I A;  3ZDL A;  1FR0 A;  3MYI A;  1YA9 A;  1ZHY A;  2NPU A;  1K05 A;  1OXK A;  3KYJ A;  3RW0 A;  3W2W A;  3GM1 A;  2X0C A;  1Y4C A;  3ZC4 A;  1OW8 A;  1QPU A;  2R7Q A;  2HSQ A;  2KQ9 A;  4MVO A;  5FCL A;  4MVR A;  4FES A;  4Z9J A;  2OEV A;  3MX3 A; 
#chains in the Genus database with same CATH homology
 1XWJ A;  1SYQ A;  5L0H A;  4E17 A;  5L0C A;  1RKE A;  2B0H A;  3RF3 A;  1ZW3 A;  1T01 A;  4PR9 A;  3S90 A;  1L7C A;  4K1O A;  1U89 A;  4ONS A;  3TJ5 A;  1ZVZ A;  2LQG A;  5L0G A;  1ST6 A;  1TR2 A;  4IGG A;  4P9T A;  4W8P A;  3T6G B;  1ZW2 A;  3TJ6 A;  3ZDL A;  5L0J A;  3H2U A;  2GDC A;  3H2V A;  3MYI A;  1U6H A;  2IBF A;  5FZT A;  4E18 A;  5L0D A;  3VF0 A;  5L0F A;  4DJ9 A;  4EHP A;  5L0I A;  2X0C A;  1RKC A;  1RKE B;  2HSQ A;  1DOV A;  2GWW A;  1QKR A;  1H6G A;  1DOW A;  2L7A A;  1YDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...