1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
5L0DA 1T01A 4E18A 5L0IA 5FZTA 2L7AA 2GDCA 3MYIA 3H2UA 4E17A 4EHPA 5L0CA 1U89A 1XWJA 5L0GA 5L0HA 3TJ6A 5L0JA 5L0FA 2GWWA 2B0HA 1L7CA 1ZW3A 1ZVZA 2HSQA 3ZDLA 1RKCA 4ONSA 1RKEA 2IBFA 4W8PA 1U6HA 3TJ5A 1DOWA 4K1OA 1H6GA 4DJ9A 4IGGA 3T6GB 1SYQA 3H2VA 4P9TA 1QKRA 2X0CA 3VF0A 1YDIA 1ZW2A 1DOVA 4PR9A 1TR2A 2LQGA 1RKEB 1ST6A 3RF3A 3S90A
chains in the Genus database with same CATH superfamily
3RQEA 1BBHA 1VYIA 1E86A 2QY9A 5K0IA 2R03A 2KK1A 5L3QA 5L0CA 4JEAA 2J46A 1KNYA 3U8VA 4CS9C 4D4XA 1C02A 2J8WA 2YKZA 3MBGA 3AQCA 4GYTA 4XEFA 2YQYA 4DRHB 1OXBA 2YEVA 1Z3IX 1PV3A 1ZYRF 2QE9A 1TWAA 2RD9A 2IOQA 4KI2A 3O39A 1EI7A 2XLHA 3TK0A 1HMOA 3AQBA 5L3VA 2M4EA 1E83A 3BRJA 1AVOB 1NG1A 1GGQA 1Q0DA 2J7PA 4XLPF 4ER9A 4O7GA 4OIPF 2Y3BA 2HV6A 1WN0A 1PD0A 2Z15A 3TQOA 5T3TA 2VH3A 2W9YA 3IPMO 1QQ3A 1ZW2A 3C8ZA 3DAFA 3MX3A 3K6BA 2LQGA 3RFYA 3PHF2 3AOUA 3LJBA 2IXMA 2LIGA 1TWCA 3L1MA 3MYFA 4MQ9F 1Z7Qc 4WGZA 3VAYA 3EGDB 2XL4A 3LEOA 4DVZA 4GQHA 3JYYA 1OCCC 2C03A 4BJ5C 4B6IA 4CBEA 4YT2A 2I15A 4N06A 3JRMO 3NYLA 3WG7C 4BJ5A 4PJLA 3ABKC 5A6JA 2XS8A 5BQGA 3C7JA 3K1IA 1SMYF 4YL0A 2VB6A 4JE9A 3T9OA 256BA 2VASA 3AGTA 2A1DD 1MNDA 2KQ9A 2IBFA 3RW0A 3OEOA 2LSEA 4EWCA 1YA7O 3NKEA 2D4UA 4C7OB 3KL4A 3AG1C 1G4US 4XPWA 3C18A 2NSGA 1Q0GA 3IEEA 2IM8A 4JCHA 1HY5A 4KBLA 4EKWA 4G7ZF 2AWCA 3HNIA 4MVUA 2J45A 4CS8C 3RF3A 3IQCA 1Y4CA 2YL1A 1OCOC 3KYJA 1WTYA 3R7CA 3C8GB 1Z6AA 5EHHA 4XPYA 1SF8A 3US6A 2AVKA 1M6TA 2XL8A 1A7DA 2OCCC 4K7BA 5KYUA 2EIKC 3RH3A 4C3EA 4JJGA 2J9WA 2QUPA 3FAPB 2ZXPA 2R7XA 4NCQA 2YHSA 2ZXRA 3GANA 3IHUA 3JSEO 3ZDLA 1A0BA 2L81A 5TJ5E 3SXKA 4Q5SF 3HKKA 2PX3A 2Q3TA 3PCVA 5JUAA 2J9BA 3ABLC 1M57C 3LAYA 5F5HA 5A69A 1HE9A 1U0BB 5DLJA 3AJMA 4IGGA 2Y3GA 4E0HA 1Z63A 1LS1A 3JRTA 2ZXWC 3LNMB 4JURI 1IW7F 2XRHA 2JPUA 3VRCA 4MVOA 4HEAJ 3HTKC 1GQAA 3J06A 2R7TA 4DXWA 4ULWA 5D92A 3GEHA 1YAUO 2WZGA 2R7VA 5F5FA 2I8BA 4N6CA 2OEVA 1KU2A 3QW1A 3JCUQ 2OOCA 2XLOA 4U5DE 4CS7A 3WAQA 3LUTB 2YL7A 5KYWA 4ULVA 1ZHZA 1LI5A 2J0XA 3S0XA 4E7ZA 4JVSA 1J8MF 1LPEA 1HE1A 1NFNA 2GA0A 2OEXA 1D0YA 2OKUA 2H7VC 2UUIA 1S7ZA 3M15A 3QVZA 4ONSA 2XXAA 2AU5A 4BEMJ 5KYXA 2R7OA 2DB4A 3B9QA 3C62A 3EG9B 3FAJA 2G3KA 3OA1A 4K1OA 4CDYA 4JTAB 3PDMP 1LE2A 3EQLF 3H2VA 2NG1A 4YWQA 2P6VA 1Q0FA 4LACB 2XSEA 3KPHA 3F47A 4F4BA 1GS9A 2EILC 1ZU5A 1CPQA 3AGUA 2EPNA 3IQTA 4XTKA 1XWJA 3ASOC 4AL0A 2J0WA 3T6BA 4YN0B 2QNLA 4H4KC 4ANJA 4AX2A 4C7OA 3N24A 4NQFA 2LK4A 2BC5A 2J9VA 1NFOA 3L8JA 4PFPA 1K05A 3AG3C 1E85A 4R32A 4LDRA 1NBBA 2Y39A 2XLEA 3QW0A 4MTFA 1OKKD 1RKEA 3CQZA 4O6NA 5E33A 3RQFA 3T4RA 1R5ID 3TJ5A 3NMKA 2VCBA 1I5NA 4O6MA 5KYNA 3M4BA 1AUEA 1JR8A 2W45A 2H8AA 4IAOA 5E2QA 3W8IA 3S28A 4FWVA 1ZHXA 1E2XA 5COFA 4C3BA 2GFHA 1UG7A 3MLGA 1W2WA 5A6AA 2XL6A 1VMAA 3RKOF 5A6BA 4ZLCA 2LP4A 4CJOA 3LLIA 4U9DA 4YL3A 3U9MA 1D1AA 4MW8A 4OIRF 1GM5A 3ZTMA 1LIHA 1V74B 1M56C 1Y6DA 2DYSC 4BJ6A 2R7WA 1OCZC 2QLAA 1WASA 4O79A 2WZFA 3UGPA 3C8GA 4LERA 4I3MA 4RBNA 4PJMA 4OINF 3SZRA 3I5PA 2OG2A 4DVYP 1QPUA 3C63A 2WVQA 2HMQA 3IQ6A 4JTDB 1LE4A 2NUTA 3EJNA 3GM2A 1ZHWA 4PJNA 4IARA 1TQGA 3EFOB 3RQGA 5B3IA 2R7RA 1RKEB 4I1OB 4MW3A 4G7OF 1VB5A 3WODF 3FHDA 5IY5C 1NSGB 4YJWA 5FZTA 4E18A 3A11A 5L0IA 1RMVA 1A7EA 2A69F 3POVA 2NUPB 3FOOA 4J32B 3U2LA 5L0JA 3DXJF 5JVEA 1S05A 2EIJC 3G4XA 1OR3A 2R9RB 3WHNA 4BG0A 3U0CA 3EH2A 2P7VA 1L7CA 2R25A 4JTCB 1Q0MA 1ORYA 3DM5A 1YJGA 3F46A 3EGDA 4NC3A 2OU6A 4IB4A 4PACA 3NYMA 3U2MA 1CGOA 1K40A 1OCRC 3EFOA 3U5SA 4MNDA 1A7VA 3SYNA 3ZWIA 2XS1A 5BUOA 4ZLDA 3KYIA 4NTAA 1E84A 3AG4C 4JC7A 3G4ZA 3DJUB 5KYUB 1C03A 2L6HA 3FXHA 2CCYA 3DAGA 3N2ZB 3DMDA 1T5OA 4MVQA 4NTFA 4CIPA 4OIOF 2IXPA 4BPMA 4RDAA 3B0UX 1T9KA 1APCA 2WVOA 3I5QA 2PFDA 1F1MA 5DQTA 4DOZA 1FFHA 4EIYA 1BR4A 1BZ4A 1M2VB 3KH2A 1T01A 3SEOA 3RYLA 1MMAA 2XLWA 4HFFB 2JX0A 2A0UA 2GDCA 4G0HA 4IJJA 4XWJA 4GEHA 3UNGC 1QLEC 1U89A 1UFBA 3I4UA 4C3DA 5KYWB 1K04A 3DD7A 2D5RB 2IYLD 3FOPA 3K7DA 4U5GA 4PK4A 5AGFA 4XLNF 3SXMA 3TJ6A 1HMDA 3V5YA 2XXAB 1VLSA 4Q7CA 2DYRC 4XEVA 3EPVA 1EKYA 3ATPA 3GWLA 3NMJA 3SP1A 3TD7A 4UDVA 2NUPA 3K1IC 1DOWA 4YL1A 3O10A 3CSKA 3S27A 4U5EE 1ZU4A 2NPUA 1QKRA 1PD1A 4P9FA 3VF0A 2ZD9A 2ZXOA 1WWPA 4JRZA 4PR9A 4BJ1A 4IRUA 2C04A 3LS0A 2KYHA 3CZ6A 4QI0A 2FAPB 3R2PA 3M4CA 3Q7GA 3CAXA 2DGJA 1JPNA 4OIQF 1ORSC 2HSBA 5B3SC 4LLEA 3V5XA 5KYYB 2LCHA 1H9TA 4HFKB 5DVWA 2ICWG 2YZSA 3KMIA 1CGNA 1MMDA 4AL1A 5A6KA 3HNKA 3Q6NA 4X0RA 3UMHA 4EUKB 1T6IA 1OKKA 2DI3A 1YARO 5AC4A 2OQMA 4FESA 3E70C 2FGYA 1FMWA 4MVRA 1WOLA 1RCPA 3NMIA 3S84A 3B71A 3AG2C 3ZTZA 3EG9A 3U3BA 2ZPAA 1G4WR 4KC9A 4LLCA 4JZAA 1HW1A 2X0CA 1FNTc 1YYJA 2EINC 3LESA 3LS1A 3DKAA 1ST6A 2Q9BA 2R7QA 3FDQA 3GEIA 1ZZPA 3NKDA 2HZ8A 1BR1A 1PCXA 2NSFA 2P1AA 3E9VA 1O5HA 2B0JA 4FX5A 2AP3A 3ZIBA 2YL0A 3CEXA 3EHMA 4J7YA 4QI2A 2XLVA 2IXOA 2MHRA 4RD9A 1H7IA 2HSQA 3UMKA 1VOMA 3EGXA 2EPKX 1VLTA 3LEVA 5DS5A 4W8KA 4W8PA 2NUTB 3ZQYA 4A4AA 3W2VA 2CNWD 3ZSUA 4YT5A 2FFHA 1QSPA 1ZHYA 4DRJB 3DE8A 1R4TA 2MWQA 2PF4E 3UMIA 1YVIA 5L0DA 3S9OA 2M64A 3L34A 4CS9A 3UGOA 5EK0A 1G5ZA 2KNHA 1V55C 5L0GA 1AEPA 2VC9A 2LFDA 4AE4B 2R7UA 1NZEA 3TULA 4QDLA 5KYXB 3G50A 4BJ6C 4WABA 2V26A 1IZMA 2OJQA 4FAPB 5L0FA 2R7SA 1ZW3A 3GEEA 1QVXA 1LI7A 3QZCA 1NU7D 2R02A 2YLIA 1OW7A 3DE9A 2TMVP 2PP4A 2BE5F 2HJ3A 4O6YA 5JT4A 3B0VC 1FMVA 1YZCA 5COMA 1M2OA 3Q6MA 2KSFA 1TWHA 1TR2A 4J7TA 2VCCA 3NRHA 1XZPA 3PMRA 5A6BD 3HNLA 4OD5A 1Z5ZA 4U5CE 4YT4A 1OW6A 2CW0F 2EPOA 5JS5A 3X1OA 2LFFA 1CPRA 4PFOA 1MQVA 4IWBA 3SNHA 4LDKA 3RIPA 2IXNA 5B1BC 4DBRA 2H7OA 1YLMA 5CI9A 3HNJA 5HSWA 2A68F 2RSEB 1D1BA 4JW1A 2XLDA 1TFOB 3DWWA 2KGOA 1XZQA 2L9JA 4M63A 4YK5A 5F28E 4JKVA 2L6GA 1Q0KA 1JOGA 2KC3A 1JAFA 1FAPB 2KW3C 3UR3C 4EBKA 3W2WA 3O55A 3GORA 3ZC4A 3T6GB 1SYQA 1OXKA 4U5FE 4AE4A 4EBJA 1BDJB 2X51A 3ASNC 5CIVA 2GAQA 1A41A 4CS8A 4OD4A 2CGEA 4YT8A 4MVMA 2XLMA 5JSLA 2PX0A 1OQCA 4CIHA 1QZXA 3ABMC 3U8PA 4CJGA 4L6RA 1EQ1A 1B68A 4K0DA 2WZLA 4CDAA 1OR2A 4MS2A 5E3CA 3H2UA 4EBBA 5L0HA 3S29A 3DJNB 1L3PA 1LM3B 1MMGA 2YL3A 5BQIA 5GPGB 3FMSA 3KKBA 2YWAA 2GWWA 2HJMA 2B0HA 3A9CA 4BJTA 1G8XA 3GM1A 4MVZA 3GWNA 5DS4A 1FTSA 3OWTA 3H65A 4Q4ZF 2WB7A 3V5ZA 4JJFA 2HUJA 3MFNA 2XM4A 4P6IC 3V7OA 3W8HA 5EGYA 3JTLO 5HV9A 2Q00A 3QVYA 2J7PD 4DRIB 2VCAA 4IAQA 4KNVA 5JRAA 2AWYA 2Q9AA 3RVYA 5FCLA 4AK9A 1DOVA 1EA8A 3DZAA 3DI5A 4E0IA 1C17M 1VYKA 1U6HA 2A6EF 3ECSA 1O3UA 2XM0A 2BL2A 3VM6A 2H7BA 2Q4FA 2P61A 2L7AA 1JMWA 3HLZA 1RXQA 2ETSA 1ORJA 2UUHA 2MYSA 4H54A 5DQZA 4MTGA 3TOLA 2R05A 3JSZA 4NY3A 4A2NB 2HMZA 3LLKA 2EPMX 5BQHA 4N4WA 1I4YA 1RKCA 1CGME 3L0IA 4U9EA 4E7SA 3L8IA 3ZG1A 3ZVRA 1TFKB 1V4AA 3IQ5A 3B0PA 5T1DB 5E3AA 1H6GA 4DJ9A 1BR2A 2PBEA 4KNWA 4Z9HA 4N6HA 1LVKA 2PNOA 1YDIA 2CNWA 1J8YF 3NG1A 4CDVA 4CSAC 4CX9A 3W4YA 2WVNA 4CSAA 2HS5A 2LD6A 3EGXB 3JT1A 2WL8A 2EIMC 2JD3A 3ITFA 5JLIA 5DS6A 2Y69C 2YLGA 5T3WA 2W4MA 1Z23A 2HV7A 4G78A 4JIOA 2A6HF 4E17A 4Z9IA 1D0ZA 4WJ0A 1VTMP 1LS4A 2W4BA 3NDBB 5COGA 1D0XA 1KTMA 1FR0A 1NLXA 2Q9CA 2YVKA 3U9JA 4WGYA 3VYWA 1I4ZA 1ZVZA 2A0BA 3RVZA 4DBQA 3GODA 3FVYA 1RJ9A 5D91A 1OW8A 3HJCA 4JCZA 5CI8A 2F22A 2L6FA 3K66A 4XPXA 4Z9JA 1LKXA 3EHNA 1MNEA 1TKNA 2Y3HA 3B29A 4XEKA 3ZQVA 1YZAA 4J30B 1H9GA 1SR2A 2KJGA 4MTOA 3SXZA 4JEBA 1WATA 4P9TA 4G7HF 2O9XA 3SXYA 4HE8D 1ZHTA 1O87A 4U5HA 3T6JA 3U3FA 1M2VA 2P0NA 1TWGA 3EH1A 1YYXA 3DM9B 4U5BE 5AC5A 1V54C 3M79A 3TOMA 2Y3DA 2QTVA 2G62A 3K33A 2HKVA 3BEHA 3MYIA 1JPJA 5JP7A 4EHPA 4LDQA 1MMNA 2OJED 1N1CA 1VK5A 3GM3A 3M1CB 3Q7LA 2Q7RA 5KYYA 1RJ9B 2YLDA 3EZIA 4PJJA 2EPLX 1D1CA 3LNRA 4I1MA 5B1AC 2HFIA 3C8GD 2V3CC 2J9UA 3K1HA 3EZHA 3N0TA 4XQ1A 1HW2A 1WGWA 4I44A 3QTHA 3O6XA 3NYJA 2E87A 1YA9A 4BEJA 2ASRA 2CDQA 1NU9C 1T6UA 1SZIA 2YRFA 3JZ0A 4MVSA 2CYDA 1JRAA 4NTBA 3X2QC 3JYHA 1FFTC 3QMKA 2G3VA 4D4NA 1T6QA 3S90A
chains in the Genus database with same CATH topology
5L0DA 1T01A 4E18A 5L0IA 5FZTA 2L7AA 2GDCA 3MYIA 3H2UA 4E17A 4EHPA 5L0CA 1U89A 1XWJA 5L0GA 5L0HA 3TJ6A 5L0JA 5L0FA 2GWWA 2B0HA 1L7CA 1ZW3A 1ZVZA 2HSQA 3ZDLA 1RKCA 4ONSA 1RKEA 2IBFA 4W8PA 1U6HA 3TJ5A 1DOWA 4K1OA 1H6GA 4DJ9A 4IGGA 3T6GB 1SYQA 3H2VA 4P9TA 1QKRA 2X0CA 3VF0A 1YDIA 1ZW2A 1DOVA 4PR9A 1TR2A 2LQGA 1RKEB 1ST6A 3RF3A 3S90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0D A;  1T01 A;  4E18 A;  5L0I A;  5FZT A;  2L7A A;  2GDC A;  3MYI A;  3H2U A;  4E17 A;  4EHP A;  5L0C A;  1U89 A;  1XWJ A;  5L0G A;  5L0H A;  3TJ6 A;  5L0J A;  5L0F A;  2GWW A;  2B0H A;  1L7C A;  1ZW3 A;  1ZVZ A;  2HSQ A;  3ZDL A;  1RKC A;  4ONS A;  1RKE A;  2IBF A;  4W8P A;  1U6H A;  3TJ5 A;  1DOW A;  4K1O A;  1H6G A;  4DJ9 A;  4IGG A;  3T6G B;  1SYQ A;  3H2V A;  4P9T A;  1QKR A;  2X0C A;  3VF0 A;  1YDI A;  1ZW2 A;  1DOV A;  4PR9 A;  1TR2 A;  2LQG A;  1RKE B;  1ST6 A;  3RF3 A;  3S90 A; 
#chains in the Genus database with same CATH topology
 3RQE A;  1BBH A;  1VYI A;  1E86 A;  2QY9 A;  5K0I A;  2R03 A;  2KK1 A;  5L3Q A;  5L0C A;  4JEA A;  2J46 A;  1KNY A;  3U8V A;  4CS9 C;  4D4X A;  1C02 A;  2J8W A;  2YKZ A;  3MBG A;  3AQC A;  4GYT A;  4XEF A;  2YQY A;  4DRH B;  1OXB A;  2YEV A;  1Z3I X;  1PV3 A;  1ZYR F;  2QE9 A;  1TWA A;  2RD9 A;  2IOQ A;  4KI2 A;  3O39 A;  1EI7 A;  2XLH A;  3TK0 A;  1HMO A;  3AQB A;  5L3V A;  2M4E A;  1E83 A;  3BRJ A;  1AVO B;  1NG1 A;  1GGQ A;  1Q0D A;  2J7P A;  4XLP F;  4ER9 A;  4O7G A;  4OIP F;  2Y3B A;  2HV6 A;  1WN0 A;  1PD0 A;  2Z15 A;  3TQO A;  5T3T A;  2VH3 A;  2W9Y A;  3IPM O;  1QQ3 A;  1ZW2 A;  3C8Z A;  3DAF A;  3MX3 A;  3K6B A;  2LQG A;  3RFY A;  3PHF 2;  3AOU A;  3LJB A;  2IXM A;  2LIG A;  1TWC A;  3L1M A;  3MYF A;  4MQ9 F;  1Z7Q c;  4WGZ A;  3VAY A;  3EGD B;  2XL4 A;  3LEO A;  4DVZ A;  4GQH A;  3JYY A;  1OCC C;  2C03 A;  4BJ5 C;  4B6I A;  4CBE A;  4YT2 A;  2I15 A;  4N06 A;  3JRM O;  3NYL A;  3WG7 C;  4BJ5 A;  4PJL A;  3ABK C;  5A6J A;  2XS8 A;  5BQG A;  3C7J A;  3K1I A;  1SMY F;  4YL0 A;  2VB6 A;  4JE9 A;  3T9O A;  256B A;  2VAS A;  3AGT A;  2A1D D;  1MND A;  2KQ9 A;  2IBF A;  3RW0 A;  3OEO A;  2LSE A;  4EWC A;  1YA7 O;  3NKE A;  2D4U A;  4C7O B;  3KL4 A;  3AG1 C;  1G4U S;  4XPW A;  3C18 A;  2NSG A;  1Q0G A;  3IEE A;  2IM8 A;  4JCH A;  1HY5 A;  4KBL A;  4EKW A;  4G7Z F;  2AWC A;  3HNI A;  4MVU A;  2J45 A;  4CS8 C;  3RF3 A;  3IQC A;  1Y4C A;  2YL1 A;  1OCO C;  3KYJ A;  1WTY A;  3R7C A;  3C8G B;  1Z6A A;  5EHH A;  4XPY A;  1SF8 A;  3US6 A;  2AVK A;  1M6T A;  2XL8 A;  1A7D A;  2OCC C;  4K7B A;  5KYU A;  2EIK C;  3RH3 A;  4C3E A;  4JJG A;  2J9W A;  2QUP A;  3FAP B;  2ZXP A;  2R7X A;  4NCQ A;  2YHS A;  2ZXR A;  3GAN A;  3IHU A;  3JSE O;  3ZDL A;  1A0B A;  2L81 A;  5TJ5 E;  3SXK A;  4Q5S F;  3HKK A;  2PX3 A;  2Q3T A;  3PCV A;  5JUA A;  2J9B A;  3ABL C;  1M57 C;  3LAY A;  5F5H A;  5A69 A;  1HE9 A;  1U0B B;  5DLJ A;  3AJM A;  4IGG A;  2Y3G A;  4E0H A;  1Z63 A;  1LS1 A;  3JRT A;  2ZXW C;  3LNM B;  4JUR I;  1IW7 F;  2XRH A;  2JPU A;  3VRC A;  4MVO A;  4HEA J;  3HTK C;  1GQA A;  3J06 A;  2R7T A;  4DXW A;  4ULW A;  5D92 A;  3GEH A;  1YAU O;  2WZG A;  2R7V A;  5F5F A;  2I8B A;  4N6C A;  2OEV A;  1KU2 A;  3QW1 A;  3JCU Q;  2OOC A;  2XLO A;  4U5D E;  4CS7 A;  3WAQ A;  3LUT B;  2YL7 A;  5KYW A;  4ULV A;  1ZHZ A;  1LI5 A;  2J0X A;  3S0X A;  4E7Z A;  4JVS A;  1J8M F;  1LPE A;  1HE1 A;  1NFN A;  2GA0 A;  2OEX A;  1D0Y A;  2OKU A;  2H7V C;  2UUI A;  1S7Z A;  3M15 A;  3QVZ A;  4ONS A;  2XXA A;  2AU5 A;  4BEM J;  5KYX A;  2R7O A;  2DB4 A;  3B9Q A;  3C62 A;  3EG9 B;  3FAJ A;  2G3K A;  3OA1 A;  4K1O A;  4CDY A;  4JTA B;  3PDM P;  1LE2 A;  3EQL F;  3H2V A;  2NG1 A;  4YWQ A;  2P6V A;  1Q0F A;  4LAC B;  2XSE A;  3KPH A;  3F47 A;  4F4B A;  1GS9 A;  2EIL C;  1ZU5 A;  1CPQ A;  3AGU A;  2EPN A;  3IQT A;  4XTK A;  1XWJ A;  3ASO C;  4AL0 A;  2J0W A;  3T6B A;  4YN0 B;  2QNL A;  4H4K C;  4ANJ A;  4AX2 A;  4C7O A;  3N24 A;  4NQF A;  2LK4 A;  2BC5 A;  2J9V A;  1NFO A;  3L8J A;  4PFP A;  1K05 A;  3AG3 C;  1E85 A;  4R32 A;  4LDR A;  1NBB A;  2Y39 A;  2XLE A;  3QW0 A;  4MTF A;  1OKK D;  1RKE A;  3CQZ A;  4O6N A;  5E33 A;  3RQF A;  3T4R A;  1R5I D;  3TJ5 A;  3NMK A;  2VCB A;  1I5N A;  4O6M A;  5KYN A;  3M4B A;  1AUE A;  1JR8 A;  2W45 A;  2H8A A;  4IAO A;  5E2Q A;  3W8I A;  3S28 A;  4FWV A;  1ZHX A;  1E2X A;  5COF A;  4C3B A;  2GFH A;  1UG7 A;  3MLG A;  1W2W A;  5A6A A;  2XL6 A;  1VMA A;  3RKO F;  5A6B A;  4ZLC A;  2LP4 A;  4CJO A;  3LLI A;  4U9D A;  4YL3 A;  3U9M A;  1D1A A;  4MW8 A;  4OIR F;  1GM5 A;  3ZTM A;  1LIH A;  1V74 B;  1M56 C;  1Y6D A;  2DYS C;  4BJ6 A;  2R7W A;  1OCZ C;  2QLA A;  1WAS A;  4O79 A;  2WZF A;  3UGP A;  3C8G A;  4LER A;  4I3M A;  4RBN A;  4PJM A;  4OIN F;  3SZR A;  3I5P A;  2OG2 A;  4DVY P;  1QPU A;  3C63 A;  2WVQ A;  2HMQ A;  3IQ6 A;  4JTD B;  1LE4 A;  2NUT A;  3EJN A;  3GM2 A;  1ZHW A;  4PJN A;  4IAR A;  1TQG A;  3EFO B;  3RQG A;  5B3I A;  2R7R A;  1RKE B;  4I1O B;  4MW3 A;  4G7O F;  1VB5 A;  3WOD F;  3FHD A;  5IY5 C;  1NSG B;  4YJW A;  5FZT A;  4E18 A;  3A11 A;  5L0I A;  1RMV A;  1A7E A;  2A69 F;  3POV A;  2NUP B;  3FOO A;  4J32 B;  3U2L A;  5L0J A;  3DXJ F;  5JVE A;  1S05 A;  2EIJ C;  3G4X A;  1OR3 A;  2R9R B;  3WHN A;  4BG0 A;  3U0C A;  3EH2 A;  2P7V A;  1L7C A;  2R25 A;  4JTC B;  1Q0M A;  1ORY A;  3DM5 A;  1YJG A;  3F46 A;  3EGD A;  4NC3 A;  2OU6 A;  4IB4 A;  4PAC A;  3NYM A;  3U2M A;  1CGO A;  1K40 A;  1OCR C;  3EFO A;  3U5S A;  4MND A;  1A7V A;  3SYN A;  3ZWI A;  2XS1 A;  5BUO A;  4ZLD A;  3KYI A;  4NTA A;  1E84 A;  3AG4 C;  4JC7 A;  3G4Z A;  3DJU B;  5KYU B;  1C03 A;  2L6H A;  3FXH A;  2CCY A;  3DAG A;  3N2Z B;  3DMD A;  1T5O A;  4MVQ A;  4NTF A;  4CIP A;  4OIO F;  2IXP A;  4BPM A;  4RDA A;  3B0U X;  1T9K A;  1APC A;  2WVO A;  3I5Q A;  2PFD A;  1F1M A;  5DQT A;  4DOZ A;  1FFH A;  4EIY A;  1BR4 A;  1BZ4 A;  1M2V B;  3KH2 A;  1T01 A;  3SEO A;  3RYL A;  1MMA A;  2XLW A;  4HFF B;  2JX0 A;  2A0U A;  2GDC A;  4G0H A;  4IJJ A;  4XWJ A;  4GEH A;  3UNG C;  1QLE C;  1U89 A;  1UFB A;  3I4U A;  4C3D A;  5KYW B;  1K04 A;  3DD7 A;  2D5R B;  2IYL D;  3FOP A;  3K7D A;  4U5G A;  4PK4 A;  5AGF A;  4XLN F;  3SXM A;  3TJ6 A;  1HMD A;  3V5Y A;  2XXA B;  1VLS A;  4Q7C A;  2DYR C;  4XEV A;  3EPV A;  1EKY A;  3ATP A;  3GWL A;  3NMJ A;  3SP1 A;  3TD7 A;  4UDV A;  2NUP A;  3K1I C;  1DOW A;  4YL1 A;  3O10 A;  3CSK A;  3S27 A;  4U5E E;  1ZU4 A;  2NPU A;  1QKR A;  1PD1 A;  4P9F A;  3VF0 A;  2ZD9 A;  2ZXO A;  1WWP A;  4JRZ A;  4PR9 A;  4BJ1 A;  4IRU A;  2C04 A;  3LS0 A;  2KYH A;  3CZ6 A;  4QI0 A;  2FAP B;  3R2P A;  3M4C A;  3Q7G A;  3CAX A;  2DGJ A;  1JPN A;  4OIQ F;  1ORS C;  2HSB A;  5B3S C;  4LLE A;  3V5X A;  5KYY B;  2LCH A;  1H9T A;  4HFK B;  5DVW A;  2ICW G;  2YZS A;  3KMI A;  1CGN A;  1MMD A;  4AL1 A;  5A6K A;  3HNK A;  3Q6N A;  4X0R A;  3UMH A;  4EUK B;  1T6I A;  1OKK A;  2DI3 A;  1YAR O;  5AC4 A;  2OQM A;  4FES A;  3E70 C;  2FGY A;  1FMW A;  4MVR A;  1WOL A;  1RCP A;  3NMI A;  3S84 A;  3B71 A;  3AG2 C;  3ZTZ A;  3EG9 A;  3U3B A;  2ZPA A;  1G4W R;  4KC9 A;  4LLC A;  4JZA A;  1HW1 A;  2X0C A;  1FNT c;  1YYJ A;  2EIN C;  3LES A;  3LS1 A;  3DKA A;  1ST6 A;  2Q9B A;  2R7Q A;  3FDQ A;  3GEI A;  1ZZP A;  3NKD A;  2HZ8 A;  1BR1 A;  1PCX A;  2NSF A;  2P1A A;  3E9V A;  1O5H A;  2B0J A;  4FX5 A;  2AP3 A;  3ZIB A;  2YL0 A;  3CEX A;  3EHM A;  4J7Y A;  4QI2 A;  2XLV A;  2IXO A;  2MHR A;  4RD9 A;  1H7I A;  2HSQ A;  3UMK A;  1VOM A;  3EGX A;  2EPK X;  1VLT A;  3LEV A;  5DS5 A;  4W8K A;  4W8P A;  2NUT B;  3ZQY A;  4A4A A;  3W2V A;  2CNW D;  3ZSU A;  4YT5 A;  2FFH A;  1QSP A;  1ZHY A;  4DRJ B;  3DE8 A;  1R4T A;  2MWQ A;  2PF4 E;  3UMI A;  1YVI A;  5L0D A;  3S9O A;  2M64 A;  3L34 A;  4CS9 A;  3UGO A;  5EK0 A;  1G5Z A;  2KNH A;  1V55 C;  5L0G A;  1AEP A;  2VC9 A;  2LFD A;  4AE4 B;  2R7U A;  1NZE A;  3TUL A;  4QDL A;  5KYX B;  3G50 A;  4BJ6 C;  4WAB A;  2V26 A;  1IZM A;  2OJQ A;  4FAP B;  5L0F A;  2R7S A;  1ZW3 A;  3GEE A;  1QVX A;  1LI7 A;  3QZC A;  1NU7 D;  2R02 A;  2YLI A;  1OW7 A;  3DE9 A;  2TMV P;  2PP4 A;  2BE5 F;  2HJ3 A;  4O6Y A;  5JT4 A;  3B0V C;  1FMV A;  1YZC A;  5COM A;  1M2O A;  3Q6M A;  2KSF A;  1TWH A;  1TR2 A;  4J7T A;  2VCC A;  3NRH A;  1XZP A;  3PMR A;  5A6B D;  3HNL A;  4OD5 A;  1Z5Z A;  4U5C E;  4YT4 A;  1OW6 A;  2CW0 F;  2EPO A;  5JS5 A;  3X1O A;  2LFF A;  1CPR A;  4PFO A;  1MQV A;  4IWB A;  3SNH A;  4LDK A;  3RIP A;  2IXN A;  5B1B C;  4DBR A;  2H7O A;  1YLM A;  5CI9 A;  3HNJ A;  5HSW A;  2A68 F;  2RSE B;  1D1B A;  4JW1 A;  2XLD A;  1TFO B;  3DWW A;  2KGO A;  1XZQ A;  2L9J A;  4M63 A;  4YK5 A;  5F28 E;  4JKV A;  2L6G A;  1Q0K A;  1JOG A;  2KC3 A;  1JAF A;  1FAP B;  2KW3 C;  3UR3 C;  4EBK A;  3W2W A;  3O55 A;  3GOR A;  3ZC4 A;  3T6G B;  1SYQ A;  1OXK A;  4U5F E;  4AE4 A;  4EBJ A;  1BDJ B;  2X51 A;  3ASN C;  5CIV A;  2GAQ A;  1A41 A;  4CS8 A;  4OD4 A;  2CGE A;  4YT8 A;  4MVM A;  2XLM A;  5JSL A;  2PX0 A;  1OQC A;  4CIH A;  1QZX A;  3ABM C;  3U8P A;  4CJG A;  4L6R A;  1EQ1 A;  1B68 A;  4K0D A;  2WZL A;  4CDA A;  1OR2 A;  4MS2 A;  5E3C A;  3H2U A;  4EBB A;  5L0H A;  3S29 A;  3DJN B;  1L3P A;  1LM3 B;  1MMG A;  2YL3 A;  5BQI A;  5GPG B;  3FMS A;  3KKB A;  2YWA A;  2GWW A;  2HJM A;  2B0H A;  3A9C A;  4BJT A;  1G8X A;  3GM1 A;  4MVZ A;  3GWN A;  5DS4 A;  1FTS A;  3OWT A;  3H65 A;  4Q4Z F;  2WB7 A;  3V5Z A;  4JJF A;  2HUJ A;  3MFN A;  2XM4 A;  4P6I C;  3V7O A;  3W8H A;  5EGY A;  3JTL O;  5HV9 A;  2Q00 A;  3QVY A;  2J7P D;  4DRI B;  2VCA A;  4IAQ A;  4KNV A;  5JRA A;  2AWY A;  2Q9A A;  3RVY A;  5FCL A;  4AK9 A;  1DOV A;  1EA8 A;  3DZA A;  3DI5 A;  4E0I A;  1C17 M;  1VYK A;  1U6H A;  2A6E F;  3ECS A;  1O3U A;  2XM0 A;  2BL2 A;  3VM6 A;  2H7B A;  2Q4F A;  2P61 A;  2L7A A;  1JMW A;  3HLZ A;  1RXQ A;  2ETS A;  1ORJ A;  2UUH A;  2MYS A;  4H54 A;  5DQZ A;  4MTG A;  3TOL A;  2R05 A;  3JSZ A;  4NY3 A;  4A2N B;  2HMZ A;  3LLK A;  2EPM X;  5BQH A;  4N4W A;  1I4Y A;  1RKC A;  1CGM E;  3L0I A;  4U9E A;  4E7S A;  3L8I A;  3ZG1 A;  3ZVR A;  1TFK B;  1V4A A;  3IQ5 A;  3B0P A;  5T1D B;  5E3A A;  1H6G A;  4DJ9 A;  1BR2 A;  2PBE A;  4KNW A;  4Z9H A;  4N6H A;  1LVK A;  2PNO A;  1YDI A;  2CNW A;  1J8Y F;  3NG1 A;  4CDV A;  4CSA C;  4CX9 A;  3W4Y A;  2WVN A;  4CSA A;  2HS5 A;  2LD6 A;  3EGX B;  3JT1 A;  2WL8 A;  2EIM C;  2JD3 A;  3ITF A;  5JLI A;  5DS6 A;  2Y69 C;  2YLG A;  5T3W A;  2W4M A;  1Z23 A;  2HV7 A;  4G78 A;  4JIO A;  2A6H F;  4E17 A;  4Z9I A;  1D0Z A;  4WJ0 A;  1VTM P;  1LS4 A;  2W4B A;  3NDB B;  5COG A;  1D0X A;  1KTM A;  1FR0 A;  1NLX A;  2Q9C A;  2YVK A;  3U9J A;  4WGY A;  3VYW A;  1I4Z A;  1ZVZ A;  2A0B A;  3RVZ A;  4DBQ A;  3GOD A;  3FVY A;  1RJ9 A;  5D91 A;  1OW8 A;  3HJC A;  4JCZ A;  5CI8 A;  2F22 A;  2L6F A;  3K66 A;  4XPX A;  4Z9J A;  1LKX A;  3EHN A;  1MNE A;  1TKN A;  2Y3H A;  3B29 A;  4XEK A;  3ZQV A;  1YZA A;  4J30 B;  1H9G A;  1SR2 A;  2KJG A;  4MTO A;  3SXZ A;  4JEB A;  1WAT A;  4P9T A;  4G7H F;  2O9X A;  3SXY A;  4HE8 D;  1ZHT A;  1O87 A;  4U5H A;  3T6J A;  3U3F A;  1M2V A;  2P0N A;  1TWG A;  3EH1 A;  1YYX A;  3DM9 B;  4U5B E;  5AC5 A;  1V54 C;  3M79 A;  3TOM A;  2Y3D A;  2QTV A;  2G62 A;  3K33 A;  2HKV A;  3BEH A;  3MYI A;  1JPJ A;  5JP7 A;  4EHP A;  4LDQ A;  1MMN A;  2OJE D;  1N1C A;  1VK5 A;  3GM3 A;  3M1C B;  3Q7L A;  2Q7R A;  5KYY A;  1RJ9 B;  2YLD A;  3EZI A;  4PJJ A;  2EPL X;  1D1C A;  3LNR A;  4I1M A;  5B1A C;  2HFI A;  3C8G D;  2V3C C;  2J9U A;  3K1H A;  3EZH A;  3N0T A;  4XQ1 A;  1HW2 A;  1WGW A;  4I44 A;  3QTH A;  3O6X A;  3NYJ A;  2E87 A;  1YA9 A;  4BEJ A;  2ASR A;  2CDQ A;  1NU9 C;  1T6U A;  1SZI A;  2YRF A;  3JZ0 A;  4MVS A;  2CYD A;  1JRA A;  4NTB A;  3X2Q C;  3JYH A;  1FFT C;  3QMK A;  2G3V A;  4D4N A;  1T6Q A;  3S90 A; 
#chains in the Genus database with same CATH homology
 5L0D A;  1T01 A;  4E18 A;  5L0I A;  5FZT A;  2L7A A;  2GDC A;  3MYI A;  3H2U A;  4E17 A;  4EHP A;  5L0C A;  1U89 A;  1XWJ A;  5L0G A;  5L0H A;  3TJ6 A;  5L0J A;  5L0F A;  2GWW A;  2B0H A;  1L7C A;  1ZW3 A;  1ZVZ A;  2HSQ A;  3ZDL A;  1RKC A;  4ONS A;  1RKE A;  2IBF A;  4W8P A;  1U6H A;  3TJ5 A;  1DOW A;  4K1O A;  1H6G A;  4DJ9 A;  4IGG A;  3T6G B;  1SYQ A;  3H2V A;  4P9T A;  1QKR A;  2X0C A;  3VF0 A;  1YDI A;  1ZW2 A;  1DOV A;  4PR9 A;  1TR2 A;  2LQG A;  1RKE B;  1ST6 A;  3RF3 A;  3S90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...