1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
1RKEB 1ZVZA 4PR9A 4EHPA 4K1OA 5L0FA 2GDCA 5FZTA 4E18A 4IGGA 1RKCA 1ZW2A 1ST6A 3H2UA 2X0CA 5L0HA 5L0DA 3S90A 3MYIA 2L7AA 1L7CA 5L0GA 5L0JA 1ZW3A 4DJ9A 1YDIA 1QKRA 4W8PA 2B0HA 2HSQA 4P9TA 3T6GB 1U89A 3RF3A 1TR2A 2LQGA 3VF0A 5L0IA 5L0CA 1DOVA 2GWWA 3H2VA 3TJ6A 1U6HA 1RKEA 3ZDLA 1T01A 1XWJA 3TJ5A 1SYQA 2IBFA 1H6GA 4E17A 4ONSA 1DOWA
chains in the Genus database with same CATH superfamily
1QSPA 3O39A 4IB4A 3TOLA 4E0IA 3RVYA 2EPNA 2KC3A 2XLVA 4CX9A 5JLIA 1T9KA 3SXYA 4Q5SF 2Q4FA 4JE9A 2NUTB 5DVWA 4HFFB 1FTSA 2H7BA 3HNKA 1TWHA 4WGZA 1TWGA 1OR2A 1LI7A 2QUPA 3LEVA 4U5FE 4C7OA 2CYDA 2L7AA 2Q9CA 1F1MA 3ABMC 1HE1A 1O87A 1VTMP 2Y3DA 4JRZA 1QKRA 2Q3TA 1ORSC 4IRUA 4MW3A 4G7ZF 4G78A 2LFDA 4CSAC 2LCHA 1EQ1A 4YK5A 1CPRA 3HNIA 4JJFA 2GWWA 3LLKA 1SR2A 2NUPB 1HMDA 1SYQA 2H8AA 2H7OA 2OKUA 3B29A 2P61A 3ZWIA 3FDQA 1GQAA 1OCRC 1CGNA 1E84A 3HLZA 2PBEA 4Q7CA 4CDYA 3S29A 4J30B 2P6VA 4XLNF 4E18A 2LP4A 1UFBA 3EZHA 2JPUA 3IQCA 3EGDB 4DRHB 2P1AA 4AK9A 1MMNA 4NQFA 2QLAA 3C7JA 3DAGA 1SZIA 4RDAA 2IXMA 5KYXA 1BR2A 1YVIA 2YWAA 4CS8A 1IZMA 3JTLO 1PD0A 3IQ5A 3DE9A 4JJGA 4PACA 4UDVA 4CSAA 3B0UX 2Q9BA 4MTGA 3EHMA 5A6JA 4P9TA 2ICWG 1ZHXA 1U89A 3UNGC 4FX5A 3SP1A 1DOVA 1OKKA 4CS8C 2W45A 1YZCA 4XTKA 2EIMC 4CIPA 4FWVA 1V55C 3QW1A 2ZXRA 1W2WA 3FOPA 4K0DA 3RW0A 2J7PD 2ZXOA 3ITFA 3NKDA 3UGPA 4PFOA 3SXKA 2C03A 4QI0A 4K1OA 2EINC 2YVKA 1Q0KA 1I5NA 3U3BA 2G3VA 4M63A 1OXKA 1OCCC 4U5EE 2W4MA 3H65A 2PNOA 2J7PA 1RKCA 256BA 4BJ6A 3ZC4A 5DLJA 3NMJA 4J32B 3AQBA 3S90A 1OKKD 2I15A 2EIJC 3LNRA 2HV7A 1I4ZA 2VCAA 2YQYA 1T6UA 3KMIA 2YLDA 4DBRA 3A11A 1A7VA 1VMAA 2RSEB 5JT4A 2CNWD 4C3EA 1Z5ZA 5DS4A 1G5ZA 2VCCA 3DWWA 3W8IA 1Y4CA 4CS9C 4DRIB 2AVKA 2XS8A 1G4WR 3DM9B 3NYJA 3EG9B 3KPHA 1YA9A 2J45A 4G0HA 4OIRF 5L0FA 2R05A 2HUJA 3LS0A 1H9GA 1H7IA 4MVQA 4KBLA 1D1CA 4DOZA 2FGYA 3WODF 4U9DA 3DXJF 1VYIA 3DJNB 3V5XA 1S05A 3B9QA 1LS4A 3EH1A 5AC5A 5BQGA 4YT4A 3DM5A 5D91A 3JSZA 2QE9A 3AGUA 3C8GB 3DAFA 3EH2A 3FOOA 1D0YA 2OCCC 1QPUA 4HE8D 5L0GA 1L3PA 1MMGA 2XL8A 5FCLA 2HJMA 3IPMO 1Z7Qc 1O5HA 4MW8A 2YRFA 3AG4C 4OIQF 5L0IA 2VC9A 3BEHA 3POVA 1SF8A 4OINF 3UMKA 2ZD9A 3IQTA 2OOCA 3LNMB 2IBFA 1WWPA 2YLIA 3L0IA 4KNWA 4O6MA 4E17A 5B3SC 2IOQA 3ZTZA 4EWCA 5B3IA 4O6NA 3GWNA 4BJ5C 2YL0A 3DMDA 5T1DB 2PX3A 4IAQA 1BR1A 1VLTA 3M15A 2EPKX 4YT8A 3EQLF 4L6RA 3X2QC 3RH3A 5L3VA 3KYJA 1JR8A 1YZAA 2QTVA 1NZEA 1WTYA 4I1OB 2XM0A 2LK4A 5D92A 4EIYA 1KNYA 4U5GA 3W8HA 4G7HF 2NUTA 1G8XA 4O7GA 1OCZC 1HY5A 2FFHA 5JSLA 1D1AA 3T6BA 3N24A 4WABA 4WJ0A 2L6GA 4GQHA 2YLGA 4BEJA 5KYWA 3LLIA 1LPEA 2F22A 3NRHA 3LUTB 3M79A 4O79A 3IEEA 2YEVA 2OU6A 4KC9A 5A6KA 4U5HA 3DKAA 3VAYA 5L0HA 2MYSA 4NTAA 3M4CA 1RKEB 4XPWA 3U5SA 1A41A 3SXMA 1RCPA 3DZAA 5JP7A 2J8WA 3PMRA 4XPXA 2W9YA 5EGYA 3IQ6A 1E83A 2NUPA 4B6IA 1I4YA 2FAPB 3CAXA 3SNHA 4BEMJ 1ST6A 2AP3A 4GEHA 4W8KA 4Z9IA 2R7RA 1Q0FA 5F5FA 3MYFA 1NFOA 4AX2A 1HE9A 5T3WA 1J8MF 3IHUA 5T3TA 2P0NA 2Q7RA 2WVQA 1T6QA 3ECSA 2KJGA 3EFOB 3L8JA 3OA1A 1ZHTA 3GWLA 3FAJA 3NMIA 4MVRA 4JTCB 3C63A 1GS9A 4MVOA 2ZXWC 3T6GB 4EBKA 3ASNC 4LERA 3HTKC 4IARA 3GM2A 1A7DA 2QY9A 4U5DE 1JPNA 3ZSUA 2WVNA 5CIVA 3MLGA 4XPYA 2L6HA 2VH3A 1Z6AA 3RYLA 2PX0A 1LIHA 3TQOA 2HS5A 3K6BA 3LESA 1YJGA 5JUAA 3HNJA 3NYMA 1LKXA 1QVXA 4CIHA 3BRJA 1MMAA 2GA0A 3MX3A 2XLDA 3ATPA 2Y39A 1TQGA 4BPMA 5TJ5E 1A7EA 2YL1A 1L7CA 1MNDA 4PJJA 3K7DA 1FR0A 2V26A 1D0XA 1OW8A 1JAFA 1OW6A 2R7WA 4I44A 1NBBA 5KYYB 3I4UA 4OIPF 2R7VA 4H54A 2R7QA 2J9VA 2HKVA 3VF0A 4ANJA 3KYIA 3M1CB 1WATA 4BJ5A 1RKEA 3EJNA 1E85A 3JCUQ 2XLWA 1A0BA 1Q0GA 2NG1A 2XLHA 4NTBA 1C03A 2KYHA 2V3CC 4EBBA 2A69F 3ABKC 3GODA 1K05A 5COGA 1CPQA 4EBJA 3ASOC 4NCQA 3AQCA 2QNLA 2DB4A 2OQMA 2A6HF 1N1CA 2VB6A 4LDKA 3SEOA 3U2LA 1FMWA 4QDLA 3S28A 3EZIA 1VLSA 1R4TA 1VOMA 2CW0F 4YL3A 3RQEA 2IXNA 2XRHA 1FFHA 3W4YA 3ZG1A 5L0JA 3PHF2 3S0XA 2XXAA 3RQGA 1FNTc 4O6YA 3C8GA 2OG2A 3GM1A 3VYWA 3U3FA 4ZLDA 4MS2A 4C3BA 1WGWA 4JVSA 5A6BD 4JCZA 3ZDLA 2HMQA 5DQTA 3GM3A 2YL3A 1QQ3A 1TKNA 2AU5A 2EPOA 4MQ9F 3R7CA 2CGEA 4ER9A 4PJNA 1CGOA 1SMYF 3Q6MA 4E7SA 3MBGA 1OW7A 3DE8A 4PR9A 1AEPA 4EHPA 4J7YA 2R7OA 1YA7O 3FMSA 4RD9A 5DS5A 2WVOA 1U0BB 1IW7F 1QLEC 1MQVA 1XZPA 1KU2A 3Q6NA 5FZTA 4IGGA 1B68A 4X0RA 5BUOA 2ETSA 3FHDA 4JIOA 4NY3A 1WN0A 3RFYA 1VB5A 2XLMA 3EGXA 2L9JA 5KYUA 2R7XA 1LI5A 1BR4A 2R02A 4DBQA 4U5CE 1G4US 3LS1A 4LACB 3S27A 1AVOB 3TULA 3I5QA 1LVKA 1YDIA 4JW1A 3NKEA 4W8PA 4BJ6C 1M6TA 4IJJA 2HV6A 1Q0MA 2HMZA 2EPMX 5L0CA 3JT1A 1PD1A 3K1IA 1MNEA 2IM8A 4I3MA 1ZYRF 2KK1A 3S9OA 4PK4A 5KYWB 4NC3A 3N0TA 2R7TA 4NTFA 3Q7LA 1ORYA 2OJQA 2PFDA 3RVZA 5JS5A 3B0PA 3KH2A 4JTDB 4JEAA 5KYXB 4DVYP 2EIKC 2Q00A 1YYJA 4MVZA 4AE4A 2IXPA 2Y69C 3R2PA 2NPUA 1RXQA 2M4EA 4GYTA 5F5HA 3MYIA 1LM3B 4MNDA 1ZHWA 3T6JA 3A9CA 4HEAJ 4MVMA 4ULVA 5CI9A 2DYRC 3AG3C 3AG1C 2A1DD 1ORJA 4YWQA 1ZW3A 3C8GD 4QI2A 3F47A 3AJMA 4CBEA 4C7OB 1YARO 3X1OA 3SXZA 5E3AA 3NDBB 2P7VA 3TD7A 4J7TA 2YKZA 2YHSA 3U0CA 3UGOA 3C18A 3NMKA 1T01A 1XWJA 2A0BA 2BC5A 4PFPA 1WASA 3F46A 4HFKB 5K0IA 2YL7A 3C62A 5DS6A 1EKYA 5COFA 3W2VA 2H7VC 3V5YA 3NG1A 4ULWA 5JRAA 3ZQVA 5HV9A 4DVZA 3EHNA 1FMVA 1M2VA 2DI3A 1ZW2A 1FFTC 2J9BA 1CGME 3H2UA 2NSGA 4DJ9A 2GAQA 3L34A 4CJOA 4CS7A 1BDJB 1E2XA 5COMA 1OR3A 1TWAA 2VASA 2IYLD 3UR3C 2LFFA 1YAUO 3GEHA 1FAPB 1PV3A 1YYXA 3OEOA 1HW1A 2YZSA 3DD7A 4MTFA 4WGYA 4C3DA 2WZLA 2KSFA 3LEOA 1H6GA 4ONSA 5KYYA 4YT2A 4Q4ZF 1Z23A 2KQ9A 1RJ9B 1TFOB 2XM4A 2GDCA 1UG7A 2DGJA 5JVEA 1V74B 4XEVA 1Y6DA 3ZIBA 4LDRA 1ZU4A 4FESA 3US6A 3RKOF 3KKBA 3V5ZA 2UUIA 2GFHA 3AG2C 2C04A 3FVYA 5AC4A 1ZZPA 5EK0A 3UMIA 3VRCA 2Y3GA 3JYHA 3EGDA 2XLOA 3GEIA 4I1MA 4FAPB 3B0VC 5BQHA 3WHNA 2XXAB 1M56C 1EA8A 4DRJB 3E70C 3U9MA 3ZTMA 4PJMA 3TJ5A 3U2MA 1OCOC 3U9JA 4YT5A 1JPJA 1V54C 2D4UA 3RIPA 2HFIA 2R9RB 2XLEA 3AOUA 4JCHA 2R7UA 3ABLC 3JRMO 1M2VB 1YLMA 3HKKA 2ZPAA 1M57C 1V4AA 2WZFA 1TFKB 3C8ZA 1O3UA 3JYYA 4H4KC 5HSWA 4MTOA 4BJ1A 1OQCA 2XL6A 2CDQA 4JEBA 2Q9AA 3FXHA 2X0CA 3WAQA 4AL0A 5A6BA 3T9OA 2PF4E 4CS9A 2VCBA 2XS1A 3ZQYA 2IXOA 3G4XA 4YL0A 1H9TA 3LAYA 5KYUB 2W4BA 4MVSA 3N2ZB 1LS1A 2HZ8A 1KTMA 1K04A 1QZXA 4KI2A 3QZCA 2JX0A 4XWJA 1BZ4A 1NSGB 2MHRA 4RBNA 1VK5A 2Y3HA 3CSKA 2A0UA 1TR2A 4DXWA 2PP4A 3H2VA 3M4BA 1U6HA 3TJ6A 3DI5A 1TWCA 1NG1A 4D4NA 2J0XA 5B1BC 2EILC 1BBHA 2KW3C 4JKVA 3WG7C 5GPGB 3B71A 3Q7GA 3O10A 4R32A 2O9XA 1GGQA 1NLXA 2I8BA 3UMHA 1VYKA 3AGTA 4K7BA 1J8YF 1NFNA 2OEVA 2L81A 3QVYA 3K1HA 4N4WA 4A2NB 2A68F 4YJWA 1JRAA 2J9WA 3TK0A 2Z15A 3MFNA 3GANA 1ZU5A 4P6IC 2G3KA 3S84A 2G62A 2J46A 2L6FA 5EHHA 5A69A 4BJTA 2R25A 4U9EA 2LSEA 2EPLX 3JRTA 4CJGA 3JSEO 4N6CA 1RMVA 3V7OA 2E87A 3K1IC 4N06A 3CEXA 1PCXA 5B1AC 3W2WA 1ZHYA 3L8IA 5AGFA 4XEKA 1HW2A 2MWQA 4CDVA 1K40A 3SYNA 5CI8A 2A6EF 3ZVRA 4XEFA 4YL1A 3FAPB 1Z3IX 2OEXA 3EPVA 4N6HA 2XSEA 3SZRA 1EI7A 2AWCA 2R03A 2TMVP 3EGXB 3JZ0A 4JURI 5F28E 5A6AA 2DYSC 3NYLA 4LLEA 3RQFA 3VM6A 2X51A 2J0WA 1GM5A 2R7SA 2OJED 1XZQA 3L1MA 3OWTA 4E0HA 5IY5C 3O6XA 4YN0B 5E3CA 2LD6A 1R5ID 3G4ZA 4ZLCA 2B0JA 4EKWA 5KYNA 1Z63A 4PJLA 4E7ZA 1LE4A 2LIGA 3GEEA 2Y3BA 2CNWA 4JTAB 1C17M 3PCVA 1E86A 4Z9JA 2KNHA 1M2OA 4MVUA 3QW0A 2HSQA 1MMDA 3EG9A 3RF3A 1LE2A 3K33A 3LJBA 4AE4B 1HMOA 2ASRA 5E2QA 3E9VA 4OD4A 4XQ1A 5E33A 4D4XA 1NU9C 2RD9A 4OD5A 2WL8A 3CZ6A 2AWYA 1JMWA 2NSFA 3K66A 4P9FA 3U8PA 3DJUB 4G7OF 1ZVZA 1OXBA 5L3QA 1JOGA 4KNVA 3U8VA 3QMKA 1RJ9A 5DQZA 3GORA 3PDMP 3G50A 2HJ3A 3QTHA 4Z9HA 4JZAA 1T6IA 3TOMA 5L0DA 3QVZA 2KGOA 2HSBA 4JC7A 2D5RB 4CDAA 2J9UA 4U5BE 4A4AA 1APCA 2CCYA 4IAOA 4F4BA 4LDQA 1NU7D 3HNLA 4LLCA 1D1BA 4XLPF 4IWBA 3KL4A 1Q0DA 3T4RA 4OIOF 2JD3A 2B0HA 1WOLA 2BE5F 2WZGA 2XL4A 1S7ZA 1ZHZA 2ZXPA 4EUKB 5BQIA 1C02A 2LQGA 2BL2A 4AL1A 2UUHA 1D0ZA 1T5OA 4BG0A 2WB7A 3HJCA 2M64A 1AUEA 3I5PA 3J06A 3EFOA 3CQZA 3O55A 1DOWA
chains in the Genus database with same CATH topology
1RKEB 1ZVZA 4PR9A 4EHPA 4K1OA 5L0FA 2GDCA 5FZTA 4E18A 4IGGA 1RKCA 1ZW2A 1ST6A 3H2UA 2X0CA 5L0HA 5L0DA 3S90A 3MYIA 2L7AA 1L7CA 5L0GA 5L0JA 1ZW3A 4DJ9A 1YDIA 1QKRA 4W8PA 2B0HA 2HSQA 4P9TA 3T6GB 1U89A 3RF3A 1TR2A 2LQGA 3VF0A 5L0IA 5L0CA 1DOVA 2GWWA 3H2VA 3TJ6A 1U6HA 1RKEA 3ZDLA 1T01A 1XWJA 3TJ5A 1SYQA 2IBFA 1H6GA 4E17A 4ONSA 1DOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKE B;  1ZVZ A;  4PR9 A;  4EHP A;  4K1O A;  5L0F A;  2GDC A;  5FZT A;  4E18 A;  4IGG A;  1RKC A;  1ZW2 A;  1ST6 A;  3H2U A;  2X0C A;  5L0H A;  5L0D A;  3S90 A;  3MYI A;  2L7A A;  1L7C A;  5L0G A;  5L0J A;  1ZW3 A;  4DJ9 A;  1YDI A;  1QKR A;  4W8P A;  2B0H A;  2HSQ A;  4P9T A;  3T6G B;  1U89 A;  3RF3 A;  1TR2 A;  2LQG A;  3VF0 A;  5L0I A;  5L0C A;  1DOV A;  2GWW A;  3H2V A;  3TJ6 A;  1U6H A;  1RKE A;  3ZDL A;  1T01 A;  1XWJ A;  3TJ5 A;  1SYQ A;  2IBF A;  1H6G A;  4E17 A;  4ONS A;  1DOW A; 
#chains in the Genus database with same CATH topology
 1QSP A;  3O39 A;  4IB4 A;  3TOL A;  4E0I A;  3RVY A;  2EPN A;  2KC3 A;  2XLV A;  4CX9 A;  5JLI A;  1T9K A;  3SXY A;  4Q5S F;  2Q4F A;  4JE9 A;  2NUT B;  5DVW A;  4HFF B;  1FTS A;  2H7B A;  3HNK A;  1TWH A;  4WGZ A;  1TWG A;  1OR2 A;  1LI7 A;  2QUP A;  3LEV A;  4U5F E;  4C7O A;  2CYD A;  2L7A A;  2Q9C A;  1F1M A;  3ABM C;  1HE1 A;  1O87 A;  1VTM P;  2Y3D A;  4JRZ A;  1QKR A;  2Q3T A;  1ORS C;  4IRU A;  4MW3 A;  4G7Z F;  4G78 A;  2LFD A;  4CSA C;  2LCH A;  1EQ1 A;  4YK5 A;  1CPR A;  3HNI A;  4JJF A;  2GWW A;  3LLK A;  1SR2 A;  2NUP B;  1HMD A;  1SYQ A;  2H8A A;  2H7O A;  2OKU A;  3B29 A;  2P61 A;  3ZWI A;  3FDQ A;  1GQA A;  1OCR C;  1CGN A;  1E84 A;  3HLZ A;  2PBE A;  4Q7C A;  4CDY A;  3S29 A;  4J30 B;  2P6V A;  4XLN F;  4E18 A;  2LP4 A;  1UFB A;  3EZH A;  2JPU A;  3IQC A;  3EGD B;  4DRH B;  2P1A A;  4AK9 A;  1MMN A;  4NQF A;  2QLA A;  3C7J A;  3DAG A;  1SZI A;  4RDA A;  2IXM A;  5KYX A;  1BR2 A;  1YVI A;  2YWA A;  4CS8 A;  1IZM A;  3JTL O;  1PD0 A;  3IQ5 A;  3DE9 A;  4JJG A;  4PAC A;  4UDV A;  4CSA A;  3B0U X;  2Q9B A;  4MTG A;  3EHM A;  5A6J A;  4P9T A;  2ICW G;  1ZHX A;  1U89 A;  3UNG C;  4FX5 A;  3SP1 A;  1DOV A;  1OKK A;  4CS8 C;  2W45 A;  1YZC A;  4XTK A;  2EIM C;  4CIP A;  4FWV A;  1V55 C;  3QW1 A;  2ZXR A;  1W2W A;  3FOP A;  4K0D A;  3RW0 A;  2J7P D;  2ZXO A;  3ITF A;  3NKD A;  3UGP A;  4PFO A;  3SXK A;  2C03 A;  4QI0 A;  4K1O A;  2EIN C;  2YVK A;  1Q0K A;  1I5N A;  3U3B A;  2G3V A;  4M63 A;  1OXK A;  1OCC C;  4U5E E;  2W4M A;  3H65 A;  2PNO A;  2J7P A;  1RKC A;  256B A;  4BJ6 A;  3ZC4 A;  5DLJ A;  3NMJ A;  4J32 B;  3AQB A;  3S90 A;  1OKK D;  2I15 A;  2EIJ C;  3LNR A;  2HV7 A;  1I4Z A;  2VCA A;  2YQY A;  1T6U A;  3KMI A;  2YLD A;  4DBR A;  3A11 A;  1A7V A;  1VMA A;  2RSE B;  5JT4 A;  2CNW D;  4C3E A;  1Z5Z A;  5DS4 A;  1G5Z A;  2VCC A;  3DWW A;  3W8I A;  1Y4C A;  4CS9 C;  4DRI B;  2AVK A;  2XS8 A;  1G4W R;  3DM9 B;  3NYJ A;  3EG9 B;  3KPH A;  1YA9 A;  2J45 A;  4G0H A;  4OIR F;  5L0F A;  2R05 A;  2HUJ A;  3LS0 A;  1H9G A;  1H7I A;  4MVQ A;  4KBL A;  1D1C A;  4DOZ A;  2FGY A;  3WOD F;  4U9D A;  3DXJ F;  1VYI A;  3DJN B;  3V5X A;  1S05 A;  3B9Q A;  1LS4 A;  3EH1 A;  5AC5 A;  5BQG A;  4YT4 A;  3DM5 A;  5D91 A;  3JSZ A;  2QE9 A;  3AGU A;  3C8G B;  3DAF A;  3EH2 A;  3FOO A;  1D0Y A;  2OCC C;  1QPU A;  4HE8 D;  5L0G A;  1L3P A;  1MMG A;  2XL8 A;  5FCL A;  2HJM A;  3IPM O;  1Z7Q c;  1O5H A;  4MW8 A;  2YRF A;  3AG4 C;  4OIQ F;  5L0I A;  2VC9 A;  3BEH A;  3POV A;  1SF8 A;  4OIN F;  3UMK A;  2ZD9 A;  3IQT A;  2OOC A;  3LNM B;  2IBF A;  1WWP A;  2YLI A;  3L0I A;  4KNW A;  4O6M A;  4E17 A;  5B3S C;  2IOQ A;  3ZTZ A;  4EWC A;  5B3I A;  4O6N A;  3GWN A;  4BJ5 C;  2YL0 A;  3DMD A;  5T1D B;  2PX3 A;  4IAQ A;  1BR1 A;  1VLT A;  3M15 A;  2EPK X;  4YT8 A;  3EQL F;  4L6R A;  3X2Q C;  3RH3 A;  5L3V A;  3KYJ A;  1JR8 A;  1YZA A;  2QTV A;  1NZE A;  1WTY A;  4I1O B;  2XM0 A;  2LK4 A;  5D92 A;  4EIY A;  1KNY A;  4U5G A;  3W8H A;  4G7H F;  2NUT A;  1G8X A;  4O7G A;  1OCZ C;  1HY5 A;  2FFH A;  5JSL A;  1D1A A;  3T6B A;  3N24 A;  4WAB A;  4WJ0 A;  2L6G A;  4GQH A;  2YLG A;  4BEJ A;  5KYW A;  3LLI A;  1LPE A;  2F22 A;  3NRH A;  3LUT B;  3M79 A;  4O79 A;  3IEE A;  2YEV A;  2OU6 A;  4KC9 A;  5A6K A;  4U5H A;  3DKA A;  3VAY A;  5L0H A;  2MYS A;  4NTA A;  3M4C A;  1RKE B;  4XPW A;  3U5S A;  1A41 A;  3SXM A;  1RCP A;  3DZA A;  5JP7 A;  2J8W A;  3PMR A;  4XPX A;  2W9Y A;  5EGY A;  3IQ6 A;  1E83 A;  2NUP A;  4B6I A;  1I4Y A;  2FAP B;  3CAX A;  3SNH A;  4BEM J;  1ST6 A;  2AP3 A;  4GEH A;  4W8K A;  4Z9I A;  2R7R A;  1Q0F A;  5F5F A;  3MYF A;  1NFO A;  4AX2 A;  1HE9 A;  5T3W A;  1J8M F;  3IHU A;  5T3T A;  2P0N A;  2Q7R A;  2WVQ A;  1T6Q A;  3ECS A;  2KJG A;  3EFO B;  3L8J A;  3OA1 A;  1ZHT A;  3GWL A;  3FAJ A;  3NMI A;  4MVR A;  4JTC B;  3C63 A;  1GS9 A;  4MVO A;  2ZXW C;  3T6G B;  4EBK A;  3ASN C;  4LER A;  3HTK C;  4IAR A;  3GM2 A;  1A7D A;  2QY9 A;  4U5D E;  1JPN A;  3ZSU A;  2WVN A;  5CIV A;  3MLG A;  4XPY A;  2L6H A;  2VH3 A;  1Z6A A;  3RYL A;  2PX0 A;  1LIH A;  3TQO A;  2HS5 A;  3K6B A;  3LES A;  1YJG A;  5JUA A;  3HNJ A;  3NYM A;  1LKX A;  1QVX A;  4CIH A;  3BRJ A;  1MMA A;  2GA0 A;  3MX3 A;  2XLD A;  3ATP A;  2Y39 A;  1TQG A;  4BPM A;  5TJ5 E;  1A7E A;  2YL1 A;  1L7C A;  1MND A;  4PJJ A;  3K7D A;  1FR0 A;  2V26 A;  1D0X A;  1OW8 A;  1JAF A;  1OW6 A;  2R7W A;  4I44 A;  1NBB A;  5KYY B;  3I4U A;  4OIP F;  2R7V A;  4H54 A;  2R7Q A;  2J9V A;  2HKV A;  3VF0 A;  4ANJ A;  3KYI A;  3M1C B;  1WAT A;  4BJ5 A;  1RKE A;  3EJN A;  1E85 A;  3JCU Q;  2XLW A;  1A0B A;  1Q0G A;  2NG1 A;  2XLH A;  4NTB A;  1C03 A;  2KYH A;  2V3C C;  4EBB A;  2A69 F;  3ABK C;  3GOD A;  1K05 A;  5COG A;  1CPQ A;  4EBJ A;  3ASO C;  4NCQ A;  3AQC A;  2QNL A;  2DB4 A;  2OQM A;  2A6H F;  1N1C A;  2VB6 A;  4LDK A;  3SEO A;  3U2L A;  1FMW A;  4QDL A;  3S28 A;  3EZI A;  1VLS A;  1R4T A;  1VOM A;  2CW0 F;  4YL3 A;  3RQE A;  2IXN A;  2XRH A;  1FFH A;  3W4Y A;  3ZG1 A;  5L0J A;  3PHF 2;  3S0X A;  2XXA A;  3RQG A;  1FNT c;  4O6Y A;  3C8G A;  2OG2 A;  3GM1 A;  3VYW A;  3U3F A;  4ZLD A;  4MS2 A;  4C3B A;  1WGW A;  4JVS A;  5A6B D;  4JCZ A;  3ZDL A;  2HMQ A;  5DQT A;  3GM3 A;  2YL3 A;  1QQ3 A;  1TKN A;  2AU5 A;  2EPO A;  4MQ9 F;  3R7C A;  2CGE A;  4ER9 A;  4PJN A;  1CGO A;  1SMY F;  3Q6M A;  4E7S A;  3MBG A;  1OW7 A;  3DE8 A;  4PR9 A;  1AEP A;  4EHP A;  4J7Y A;  2R7O A;  1YA7 O;  3FMS A;  4RD9 A;  5DS5 A;  2WVO A;  1U0B B;  1IW7 F;  1QLE C;  1MQV A;  1XZP A;  1KU2 A;  3Q6N A;  5FZT A;  4IGG A;  1B68 A;  4X0R A;  5BUO A;  2ETS A;  3FHD A;  4JIO A;  4NY3 A;  1WN0 A;  3RFY A;  1VB5 A;  2XLM A;  3EGX A;  2L9J A;  5KYU A;  2R7X A;  1LI5 A;  1BR4 A;  2R02 A;  4DBQ A;  4U5C E;  1G4U S;  3LS1 A;  4LAC B;  3S27 A;  1AVO B;  3TUL A;  3I5Q A;  1LVK A;  1YDI A;  4JW1 A;  3NKE A;  4W8P A;  4BJ6 C;  1M6T A;  4IJJ A;  2HV6 A;  1Q0M A;  2HMZ A;  2EPM X;  5L0C A;  3JT1 A;  1PD1 A;  3K1I A;  1MNE A;  2IM8 A;  4I3M A;  1ZYR F;  2KK1 A;  3S9O A;  4PK4 A;  5KYW B;  4NC3 A;  3N0T A;  2R7T A;  4NTF A;  3Q7L A;  1ORY A;  2OJQ A;  2PFD A;  3RVZ A;  5JS5 A;  3B0P A;  3KH2 A;  4JTD B;  4JEA A;  5KYX B;  4DVY P;  2EIK C;  2Q00 A;  1YYJ A;  4MVZ A;  4AE4 A;  2IXP A;  2Y69 C;  3R2P A;  2NPU A;  1RXQ A;  2M4E A;  4GYT A;  5F5H A;  3MYI A;  1LM3 B;  4MND A;  1ZHW A;  3T6J A;  3A9C A;  4HEA J;  4MVM A;  4ULV A;  5CI9 A;  2DYR C;  3AG3 C;  3AG1 C;  2A1D D;  1ORJ A;  4YWQ A;  1ZW3 A;  3C8G D;  4QI2 A;  3F47 A;  3AJM A;  4CBE A;  4C7O B;  1YAR O;  3X1O A;  3SXZ A;  5E3A A;  3NDB B;  2P7V A;  3TD7 A;  4J7T A;  2YKZ A;  2YHS A;  3U0C A;  3UGO A;  3C18 A;  3NMK A;  1T01 A;  1XWJ A;  2A0B A;  2BC5 A;  4PFP A;  1WAS A;  3F46 A;  4HFK B;  5K0I A;  2YL7 A;  3C62 A;  5DS6 A;  1EKY A;  5COF A;  3W2V A;  2H7V C;  3V5Y A;  3NG1 A;  4ULW A;  5JRA A;  3ZQV A;  5HV9 A;  4DVZ A;  3EHN A;  1FMV A;  1M2V A;  2DI3 A;  1ZW2 A;  1FFT C;  2J9B A;  1CGM E;  3H2U A;  2NSG A;  4DJ9 A;  2GAQ A;  3L34 A;  4CJO A;  4CS7 A;  1BDJ B;  1E2X A;  5COM A;  1OR3 A;  1TWA A;  2VAS A;  2IYL D;  3UR3 C;  2LFF A;  1YAU O;  3GEH A;  1FAP B;  1PV3 A;  1YYX A;  3OEO A;  1HW1 A;  2YZS A;  3DD7 A;  4MTF A;  4WGY A;  4C3D A;  2WZL A;  2KSF A;  3LEO A;  1H6G A;  4ONS A;  5KYY A;  4YT2 A;  4Q4Z F;  1Z23 A;  2KQ9 A;  1RJ9 B;  1TFO B;  2XM4 A;  2GDC A;  1UG7 A;  2DGJ A;  5JVE A;  1V74 B;  4XEV A;  1Y6D A;  3ZIB A;  4LDR A;  1ZU4 A;  4FES A;  3US6 A;  3RKO F;  3KKB A;  3V5Z A;  2UUI A;  2GFH A;  3AG2 C;  2C04 A;  3FVY A;  5AC4 A;  1ZZP A;  5EK0 A;  3UMI A;  3VRC A;  2Y3G A;  3JYH A;  3EGD A;  2XLO A;  3GEI A;  4I1M A;  4FAP B;  3B0V C;  5BQH A;  3WHN A;  2XXA B;  1M56 C;  1EA8 A;  4DRJ B;  3E70 C;  3U9M A;  3ZTM A;  4PJM A;  3TJ5 A;  3U2M A;  1OCO C;  3U9J A;  4YT5 A;  1JPJ A;  1V54 C;  2D4U A;  3RIP A;  2HFI A;  2R9R B;  2XLE A;  3AOU A;  4JCH A;  2R7U A;  3ABL C;  3JRM O;  1M2V B;  1YLM A;  3HKK A;  2ZPA A;  1M57 C;  1V4A A;  2WZF A;  1TFK B;  3C8Z A;  1O3U A;  3JYY A;  4H4K C;  5HSW A;  4MTO A;  4BJ1 A;  1OQC A;  2XL6 A;  2CDQ A;  4JEB A;  2Q9A A;  3FXH A;  2X0C A;  3WAQ A;  4AL0 A;  5A6B A;  3T9O A;  2PF4 E;  4CS9 A;  2VCB A;  2XS1 A;  3ZQY A;  2IXO A;  3G4X A;  4YL0 A;  1H9T A;  3LAY A;  5KYU B;  2W4B A;  4MVS A;  3N2Z B;  1LS1 A;  2HZ8 A;  1KTM A;  1K04 A;  1QZX A;  4KI2 A;  3QZC A;  2JX0 A;  4XWJ A;  1BZ4 A;  1NSG B;  2MHR A;  4RBN A;  1VK5 A;  2Y3H A;  3CSK A;  2A0U A;  1TR2 A;  4DXW A;  2PP4 A;  3H2V A;  3M4B A;  1U6H A;  3TJ6 A;  3DI5 A;  1TWC A;  1NG1 A;  4D4N A;  2J0X A;  5B1B C;  2EIL C;  1BBH A;  2KW3 C;  4JKV A;  3WG7 C;  5GPG B;  3B71 A;  3Q7G A;  3O10 A;  4R32 A;  2O9X A;  1GGQ A;  1NLX A;  2I8B A;  3UMH A;  1VYK A;  3AGT A;  4K7B A;  1J8Y F;  1NFN A;  2OEV A;  2L81 A;  3QVY A;  3K1H A;  4N4W A;  4A2N B;  2A68 F;  4YJW A;  1JRA A;  2J9W A;  3TK0 A;  2Z15 A;  3MFN A;  3GAN A;  1ZU5 A;  4P6I C;  2G3K A;  3S84 A;  2G62 A;  2J46 A;  2L6F A;  5EHH A;  5A69 A;  4BJT A;  2R25 A;  4U9E A;  2LSE A;  2EPL X;  3JRT A;  4CJG A;  3JSE O;  4N6C A;  1RMV A;  3V7O A;  2E87 A;  3K1I C;  4N06 A;  3CEX A;  1PCX A;  5B1A C;  3W2W A;  1ZHY A;  3L8I A;  5AGF A;  4XEK A;  1HW2 A;  2MWQ A;  4CDV A;  1K40 A;  3SYN A;  5CI8 A;  2A6E F;  3ZVR A;  4XEF A;  4YL1 A;  3FAP B;  1Z3I X;  2OEX A;  3EPV A;  4N6H A;  2XSE A;  3SZR A;  1EI7 A;  2AWC A;  2R03 A;  2TMV P;  3EGX B;  3JZ0 A;  4JUR I;  5F28 E;  5A6A A;  2DYS C;  3NYL A;  4LLE A;  3RQF A;  3VM6 A;  2X51 A;  2J0W A;  1GM5 A;  2R7S A;  2OJE D;  1XZQ A;  3L1M A;  3OWT A;  4E0H A;  5IY5 C;  3O6X A;  4YN0 B;  5E3C A;  2LD6 A;  1R5I D;  3G4Z A;  4ZLC A;  2B0J A;  4EKW A;  5KYN A;  1Z63 A;  4PJL A;  4E7Z A;  1LE4 A;  2LIG A;  3GEE A;  2Y3B A;  2CNW A;  4JTA B;  1C17 M;  3PCV A;  1E86 A;  4Z9J A;  2KNH A;  1M2O A;  4MVU A;  3QW0 A;  2HSQ A;  1MMD A;  3EG9 A;  3RF3 A;  1LE2 A;  3K33 A;  3LJB A;  4AE4 B;  1HMO A;  2ASR A;  5E2Q A;  3E9V A;  4OD4 A;  4XQ1 A;  5E33 A;  4D4X A;  1NU9 C;  2RD9 A;  4OD5 A;  2WL8 A;  3CZ6 A;  2AWY A;  1JMW A;  2NSF A;  3K66 A;  4P9F A;  3U8P A;  3DJU B;  4G7O F;  1ZVZ A;  1OXB A;  5L3Q A;  1JOG A;  4KNV A;  3U8V A;  3QMK A;  1RJ9 A;  5DQZ A;  3GOR A;  3PDM P;  3G50 A;  2HJ3 A;  3QTH A;  4Z9H A;  4JZA A;  1T6I A;  3TOM A;  5L0D A;  3QVZ A;  2KGO A;  2HSB A;  4JC7 A;  2D5R B;  4CDA A;  2J9U A;  4U5B E;  4A4A A;  1APC A;  2CCY A;  4IAO A;  4F4B A;  4LDQ A;  1NU7 D;  3HNL A;  4LLC A;  1D1B A;  4XLP F;  4IWB A;  3KL4 A;  1Q0D A;  3T4R A;  4OIO F;  2JD3 A;  2B0H A;  1WOL A;  2BE5 F;  2WZG A;  2XL4 A;  1S7Z A;  1ZHZ A;  2ZXP A;  4EUK B;  5BQI A;  1C02 A;  2LQG A;  2BL2 A;  4AL1 A;  2UUH A;  1D0Z A;  1T5O A;  4BG0 A;  2WB7 A;  3HJC A;  2M64 A;  1AUE A;  3I5P A;  3J06 A;  3EFO A;  3CQZ A;  3O55 A;  1DOW A; 
#chains in the Genus database with same CATH homology
 1RKE B;  1ZVZ A;  4PR9 A;  4EHP A;  4K1O A;  5L0F A;  2GDC A;  5FZT A;  4E18 A;  4IGG A;  1RKC A;  1ZW2 A;  1ST6 A;  3H2U A;  2X0C A;  5L0H A;  5L0D A;  3S90 A;  3MYI A;  2L7A A;  1L7C A;  5L0G A;  5L0J A;  1ZW3 A;  4DJ9 A;  1YDI A;  1QKR A;  4W8P A;  2B0H A;  2HSQ A;  4P9T A;  3T6G B;  1U89 A;  3RF3 A;  1TR2 A;  2LQG A;  3VF0 A;  5L0I A;  5L0C A;  1DOV A;  2GWW A;  3H2V A;  3TJ6 A;  1U6H A;  1RKE A;  3ZDL A;  1T01 A;  1XWJ A;  3TJ5 A;  1SYQ A;  2IBF A;  1H6G A;  4E17 A;  4ONS A;  1DOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...