1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
1L7CA 1RKEA 2LQGA 5L0IA 4W8PA 3H2UA 1DOVA 3VF0A 2L7AA 3RF3A 5L0CA 1TR2A 5L0DA 2IBFA 4IGGA 2GDCA 5L0FA 1T01A 1DOWA 1U6HA 5FZTA 4E18A 3ZDLA 2HSQA 3TJ5A 1RKCA 2GWWA 5L0GA 5L0HA 1ZW2A 3TJ6A 1RKEB 1XWJA 4PR9A 3S90A 3MYIA 4E17A 2B0HA 4EHPA 1ZW3A 1U89A 1ZVZA 3T6GB 4DJ9A 1H6GA 3H2VA 1YDIA 4P9TA 1ST6A 5L0JA 4ONSA 2X0CA 4K1OA 1SYQA 1QKRA
chains in the Genus database with same CATH superfamily
1I4ZA 2Q3TA 3KPHA 3TOLA 4ULVA 4CDVA 1JPJA 3S84A 4MNDA 1VLSA 3Q7LA 2JD3A 4JTCB 3VAYA 4F4BA 5L0CA 1J8YF 1MNEA 1RJ9A 1WASA 2A68F 4J7TA 4ANJA 4CS8A 3O10A 2HMZA 2R7UA 3AG3C 2HV7A 3E70C 1M56C 2QUPA 3V5YA 4YN0B 1EQ1A 4G7HF 2WVOA 4LERA 1PD1A 2XLOA 2EIKC 3TJ6A 2R7RA 1EA8A 2PF4E 5T3WA 1FR0A 2XRHA 2G3VA 4Q4ZF 1ZZPA 2L6FA 2HSBA 2NSGA 1O5HA 2WVNA 3M4CA 4IRUA 1LI5A 1CGME 3LNRA 1RJ9B 3QVZA 3N2ZB 3UMKA 1M6TA 2CCYA 4MW3A 1S05A 3AQBA 3SP1A 1JMWA 1O3UA 1H9GA 2O9XA 3DWWA 4OIPF 1CPQA 2W4MA 2EPNA 5CI8A 5B1BC 3IEEA 3VYWA 1BR1A 1TFKB 2Q9AA 3LEOA 2C03A 3RVYA 3NYJA 4G7ZF 3US6A 4XPXA 3LS1A 5JS5A 1QPUA 3U2LA 2E87A 4BJTA 3ITFA 4C7OA 4PFPA 3TJ5A 1LVKA 2VASA 3QZCA 1NBBA 4YL0A 3U9JA 2YLDA 4G78A 2IXMA 2VCAA 4AE4B 2ZD9A 4CS8C 4DRIB 4E7ZA 4EWCA 2PBEA 1JR8A 2VB6A 1G4US 5BQGA 3FMSA 2HZ8A 1EI7A 2R7SA 4L6RA 3SXYA 3JT1A 4MW8A 4J7YA 5B1AC 1R5ID 4X0RA 2KK1A 4I3MA 3PCVA 3DM5A 4CJOA 5F28E 2Y39A 3L8IA 2A0UA 1ZHZA 4O6NA 3T6GB 3M4BA 2XLVA 2Y3BA 2R7TA 3RKOF 5B3IA 2RD9A 1F1MA 2GA0A 1OCCC 2WZGA 2XM0A 2YL7A 3KYIA 4ONSA 1WN0A 4WGYA 3W4YA 4BJ6A 5L0JA 2LFDA 1I4YA 2AWYA 2AWCA 1E86A 2J9WA 5CI9A 1JRAA 3EZIA 2XLDA 1ZHXA 1T01A 2FGYA 3K6BA 1NLXA 1Z63A 3VRCA 3ZDLA 3U3BA 4YWQA 4JJFA 3GORA 4LLCA 1Z7Qc 256BA 4ULWA 5F5HA 1ZU5A 1MQVA 1ZW2A 2A0BA 3HKKA 2L9JA 4M63A 1NU7D 4N6HA 3F46A 4I44A 2R7WA 1Y6DA 3B29A 3GM3A 1C02A 1PV3A 3JSEO 4XEKA 3DI5A 3DMDA 2ZXWC 3DE9A 1C03A 3NMKA 4H54A 5KYYA 2Q7RA 2W45A 4EUKB 1GQAA 1NG1A 2IXNA 5KYNA 1YLMA 2KW3C 1RKEA 2D5RB 5L0IA 3IQ5A 2R03A 2WL8A 2Y3GA 4JKVA 2WZLA 4BJ6C 5JT4A 4EKWA 4EBKA 3FDQA 4IGGA 2B0JA 4KI2A 1FNTc 2H8AA 1TWHA 5B3SC 3FXHA 1N1CA 4P6IC 1OR3A 2EPMX 4BG0A 4A4AA 1JOGA 4U5DE 3F47A 3C18A 1ZHWA 4D4XA 3JYYA 1RKEB 5KYWB 5JVEA 1YA7O 1E85A 1D1AA 2HV6A 2PNOA 3C8GD 1Q0GA 2KJGA 4CS9C 4U9DA 1VOMA 2OG2A 3W2VA 4E17A 2YQYA 3FAJA 3O39A 1YAUO 3EGDA 4Q5SF 1BR2A 1Z3IX 3TD7A 3JTLO 3LNMB 1Q0FA 2AP3A 2J46A 5A6BD 2G3KA 4XEFA 1S7ZA 4U5HA 1E83A 3IQTA 3ZTMA 4W8PA 2R7QA 2R7OA 2NG1A 3W8HA 2LQGA 1K05A 1A7EA 3DM9B 1T6UA 2VCCA 4FAPB 1TQGA 2R7XA 3K7DA 2DI3A 3AG1C 4XQ1A 1HMOA 1TR2A 3EPVA 3U2MA 1QQ3A 3GWLA 3DXJF 3NDBB 4I1MA 1JPNA 5JSLA 4OIQF 2H7BA 1VYKA 1TWAA 3PDMP 5DVWA 5JRAA 3UGOA 2F22A 4FESA 3T6JA 1LM3B 1XZPA 3GODA 4IAQA 3S90A 2WVQA 4U9EA 4ZLCA 3WG7C 3UMIA 4IJJA 4NTAA 2KGOA 2OKUA 3CSKA 4GEHA 1YA9A 1WOLA 1H6GA 4PJMA 1QLEC 3T4RA 1APCA 4CSAA 5AGFA 4P9TA 1SF8A 2RSEB 3NKDA 5TJ5E 4U5GA 5A6BA 2MHRA 3EG9A 4NTBA 1HE9A 4DBRA 1VMAA 1KU2A 4DOZA 2I15A 3H2UA 1T9KA 4MVMA 5BQIA 5KYUA 2QE9A 3HLZA 4U5BE 1U6HA 2OJED 1YYXA 3I5QA 1Q0MA 4LDQA 4K7BA 2OCCC 3ATPA 4YL1A 4AL0A 1RKCA 2IYLD 3C62A 3EFOA 3EG9B 3KKBA 2A69F 1D1BA 3H65A 3V5XA 2G62A 3L1MA 1GS9A 2Z15A 3EZHA 2AVKA 3ASOC 3ABLC 3NYMA 3WHNA 3JCUQ 3I5PA 4HFKB 4AX2A 5T3TA 1LI7A 1NFOA 4PK4A 5KYUB 4LLEA 2PX3A 1NFNA 2QTVA 4KC9A 4MTOA 4XEVA 4J32B 1SMYF 4JURI 5D91A 2PFDA 1B68A 1WTYA 2IXOA 3EFOB 3QW0A 4C3DA 1V74B 4K1OA 3B71A 1QKRA 2XS1A 1FAPB 3C8ZA 4DRJB 4A2NB 4CSAC 2YVKA 3KMIA 1RMVA 1E2XA 3K1IA 4U5CE 4MS2A 2ZXOA 4XPYA 3ZQVA 1VB5A 2OQMA 2BC5A 3JZ0A 3K66A 4NC3A 4GQHA 1H9TA 4JTDB 1LPEA 4JCZA 4CJGA 5KYXA 4R32A 4WABA 2ZXRA 3DZAA 5AC4A 2WB7A 2MWQA 3FOPA 2IOQA 4MVZA 2EPKX 1OR2A 5E3AA 4AK9A 2Y3HA 3B0PA 3UNGC 3R2PA 3JRTA 4IB4A 3RFYA 3SZRA 3U0CA 2HJ3A 1NU9C 1PD0A 1AEPA 1OXBA 1Q0KA 4NCQA 4NTFA 4UDVA 3ZIBA 2I8BA 3RIPA 5KYXB 3Q6MA 1G4WR 4JC7A 4C7OB 1V54C 3M15A 2IM8A 3U8PA 5EHHA 3S29A 4CDYA 4ER9A 1JAFA 2YZSA 1YARO 3GANA 4YT5A 2HMQA 2W4BA 5DLJA 4E0HA 4XLNF 5L3VA 4G7OF 4QI2A 3SXZA 3QVYA 2YKZA 3PMRA 3EJNA 2NSFA 3UMHA 2TMVP 1AUEA 4ZLDA 1DOWA 3AJMA 2XLHA 3R7CA 4PFOA 3LLKA 3RVZA 3MYFA 3A9CA 1VYIA 2KSFA 1BDJB 3NG1A 2C04A 2KNHA 2P61A 1LE4A 5A6AA 2BE5F 2OU6A 3U8VA 1HW2A 2EILC 3POVA 1BZ4A 1E84A 2LIGA 5IY5C 1YYJA 2Q9CA 4HEAJ 3W2WA 4EBJA 2EPLX 4WGZA 4OINF 4CS7A 3ZG1A 3Q6NA 2HKVA 1MMNA 3CAXA 2OEXA 1K04A 4OD5A 1LE2A 2J7PD 3QTHA 1U0BB 1YVIA 1WGWA 2YWAA 1I5NA 5A69A 3QMKA 4HE8D 4GYTA 4BJ5A 5L3QA 3JYHA 4JE9A 3OWTA 4RBNA 1DOVA 1FFHA 1VK5A 2L7AA 3FOOA 3EHNA 3G4XA 3EGXA 3NKEA 3C7JA 5BUOA 4JRZA 3ZC4A 1ZHTA 2D4UA 3KYJA 5GPGB 4DBQA 5KYYB 4N6CA 4RDAA 3UR3C 4XPWA 4Q7CA 2LK4A 4RD9A 2ICWG 3LAYA 2BL2A 4U5EE 3RQFA 4E0IA 2H7OA 2KC3A 3SYNA 3MYIA 4BPMA 5HV9A 1OCZC 1AVOB 2XL4A 3E9VA 2YLIA 4JEBA 4JW1A 5E3CA 2ETSA 4PJNA 3ZQYA 1OW8A 1OCOC 1ZVZA 3EGXB 1CPRA 1MMGA 3AG4C 3H2VA 5E2QA 3GEEA 2XLEA 2AU5A 3RH3A 2NUPA 2CYDA 3AQCA 5L0HA 3L0IA 2P0NA 4U5FE 3SEOA 2PP4A 1ORJA 2CGEA 1D0YA 2HUJA 1A7DA 1MMDA 1FFTC 2EIJC 3EGDB 4C3BA 3IQCA 3IPMO 2QLAA 1C17M 4LDRA 3CQZA 1RXQA 4YK5A 3NRHA 2NUPB 3MFNA 1G8XA 1XWJA 2R9RB 3AOUA 4E7SA 2MYSA 2XLWA 5BQHA 3C8GA 2Q00A 2B0HA 3ABMC 4JCHA 1ORYA 4JTAB 2XXAA 5K0IA 1G5ZA 1TFOB 4CDAA 1MMAA 3G4ZA 3L8JA 4I1OB 3S27A 5A6JA 3M1CB 2NUTA 2DYRC 4MVSA 4YL3A 2HJMA 2Y69C 1M2VA 4O79A 2QY9A 2CW0F 2WZFA 1OXKA 3AG2C 2V3CC 3LLIA 2J0WA 1OQCA 3FAPB 2R25A 3G50A 2VH3A 1H7IA 2YL3A 3HTKC 2UUHA 4IAOA 4PJLA 3J06A 2ZPAA 4LACB 1GGQA 5E33A 2GAQA 2J0XA 2L6HA 2GWWA 3DD7A 3BEHA 1CGNA 3NMJA 1M2VB 3ZWIA 5HSWA 1W2WA 2OOCA 2OEVA 3HNKA 3HNJA 3LUTB 3OEOA 4IWBA 3AGTA 1OW6A 2GFHA 2Q4FA 4NY3A 1OW7A 2M4EA 1HMDA 1QSPA 4DJ9A 3O55A 1A7VA 3SXKA 3LS0A 1UFBA 2KQ9A 1LIHA 1VLTA 4QDLA 2P7VA 4DVZA 1V55C 3ZVRA 1IZMA 2DYSC 2PX0A 1PCXA 3ASNC 5COFA 1L7CA 4C3EA 4OIRF 4YT2A 2R05A 2Y3DA 4MVQA 1D1CA 4CX9A 2OJQA 4MVRA 5L0DA 2IBFA 4JIOA 1LKXA 4BEMJ 1TWCA 2R7VA 4KNWA 1LS4A 2LP4A 4N4WA 2ZXPA 1NZEA 4B6IA 1D0XA 2YEVA 3HJCA 4JJGA 4O6MA 1GM5A 2J45A 3I4UA 1M2OA 3Q7GA 3PHF2 3HNLA 3OA1A 2JPUA 3NMIA 2A6HF 4FWVA 4G0HA 3U3FA 5AC5A 3B0VC 4FX5A 3B0UX 2XL8A 3JRMO 3S9OA 4EHPA 1U89A 4KBLA 3W8IA 4CIPA 1KTMA 4HFFB 3EHMA 4LDKA 3O6XA 4AE4A 1BR4A 4EIYA 3K1HA 3ZTZA 1SYQA 1T6IA 2CNWD 2XL6A 1Z5ZA 3LJBA 1OKKD 1R4TA 2L81A 2P6VA 1Q0DA 2YL0A 3GM1A 2YL1A 3KH2A 4H4KC 1V4AA 3QW1A 3MX3A 2R02A 4MTFA 3RF3A 1ORSC 5EK0A 3RW0A 3VF0A 4YT4A 2GDCA 3S0XA 1ZHYA 3T6BA 1J8MF 1D0ZA 1Z23A 1XZQA 4E18A 2UUIA 2LFFA 4MVOA 2CDQA 3K1IC 2V26A 1A41A 4JEAA 3WODF 3LEVA 2EPOA 5JLIA 3IQ6A 2VC9A 5DS4A 4EBBA 2JX0A 1BBHA 1YZAA 4AL1A 1WATA 1FTSA 4PJJA 1T5OA 1KNYA 1QVXA 4K0DA 3UGPA 2YLGA 5D92A 1HY5A 5DS6A 3N24A 3TK0A 1NSGB 3MLGA 2J9VA 4BJ1A 1EKYA 2CNWA 4J30B 1OKKA 1SR2A 2VCBA 3ZSUA 5DQTA 1VTMP 3A11A 4NQFA 3L34A 2A6EF 2EINC 2J9BA 3MBGA 3RYLA 3LESA 2J8WA 2Q9BA 3C63A 2XS8A 2M64A 4CS9A 5A6KA 2LCHA 3CZ6A 1M57C 3JSZA 4JZAA 5L0GA 2IXPA 4CIHA 4DRHB 3NYLA 3GWNA 3FHDA 4N06A 3TOMA 2P1AA 2X51A 3RQGA 4XTKA 3SNHA 3M79A 1TKNA 2J9UA 1OCRC 1ZW3A 4CBEA 5T1DB 1Z6AA 5JUAA 1HW1A 3X1OA 4BEJA 3ABKC 1ST6A 4OD4A 5KYWA 2J7PA 3CEXA 3WAQA 2LSEA 2EIMC 3B9QA 1ZYRF 3EH1A 4XWJA 5CIVA 1YZCA 2H7VC 1YJGA 4D4NA 4Z9JA 2KYHA 2YHSA 3S28A 4DXWA 1TWGA 3T9OA 1IW7F 3U5SA 5FZTA 4BJ5C 2YRFA 2HSQA 1A0BA 3BRJA 3DAGA 3TQOA 4MQ9F 4MVUA 4P9FA 2XM4A 1WWPA 1CGOA 3EQLF 2LD6A 2DGJA 2HS5A 1HE1A 3K33A 4PR9A 4YT8A 3DJNB 5COGA 4O6YA 2L6GA 1L3PA 3AGUA 2ASRA 3DKAA 4MTGA 3DAFA 3X2QC 4DVYP 4IARA 2NPUA 3RQEA 3GEHA 3TULA 1YDIA 4JVSA 1FMVA 3V7OA 4O7GA 1LS1A 4Z9HA 2XLMA 3DJUB 3SXMA 2DB4A 1K40A 4KNVA 3C8GB 3KL4A 2XSEA 4YJWA 5L0FA 5FCLA 2HFIA 3GEIA 1O87A 2QNLA 4XLPF 2XXAB 4WJ0A 1QZXA 2FFHA 1UG7A 3N0TA 4PACA 3V5ZA 1RCPA 3VM6A 5EGYA 1Y4CA 1T6QA 2NUTB 5JP7A 1MNDA 3IHUA 5DQZA 3GM2A 5DS5A 1SZIA 4OIOF 4Z9IA 2FAPB 1ZU4A 3ECSA 3FVYA 5F5FA 5COMA 3HNIA 3EH2A 2A1DD 4QI0A 4W8KA 1FMWA 3U9MA 3DE8A 2W9YA 2X0CA
chains in the Genus database with same CATH topology
1L7CA 1RKEA 2LQGA 5L0IA 4W8PA 3H2UA 1DOVA 3VF0A 2L7AA 3RF3A 5L0CA 1TR2A 5L0DA 2IBFA 4IGGA 2GDCA 5L0FA 1T01A 1DOWA 1U6HA 5FZTA 4E18A 3ZDLA 2HSQA 3TJ5A 1RKCA 2GWWA 5L0GA 5L0HA 1ZW2A 3TJ6A 1RKEB 1XWJA 4PR9A 3S90A 3MYIA 4E17A 2B0HA 4EHPA 1ZW3A 1U89A 1ZVZA 3T6GB 4DJ9A 1H6GA 3H2VA 1YDIA 4P9TA 1ST6A 5L0JA 4ONSA 2X0CA 4K1OA 1SYQA 1QKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7C A;  1RKE A;  2LQG A;  5L0I A;  4W8P A;  3H2U A;  1DOV A;  3VF0 A;  2L7A A;  3RF3 A;  5L0C A;  1TR2 A;  5L0D A;  2IBF A;  4IGG A;  2GDC A;  5L0F A;  1T01 A;  1DOW A;  1U6H A;  5FZT A;  4E18 A;  3ZDL A;  2HSQ A;  3TJ5 A;  1RKC A;  2GWW A;  5L0G A;  5L0H A;  1ZW2 A;  3TJ6 A;  1RKE B;  1XWJ A;  4PR9 A;  3S90 A;  3MYI A;  4E17 A;  2B0H A;  4EHP A;  1ZW3 A;  1U89 A;  1ZVZ A;  3T6G B;  4DJ9 A;  1H6G A;  3H2V A;  1YDI A;  4P9T A;  1ST6 A;  5L0J A;  4ONS A;  2X0C A;  4K1O A;  1SYQ A;  1QKR A; 
#chains in the Genus database with same CATH topology
 1I4Z A;  2Q3T A;  3KPH A;  3TOL A;  4ULV A;  4CDV A;  1JPJ A;  3S84 A;  4MND A;  1VLS A;  3Q7L A;  2JD3 A;  4JTC B;  3VAY A;  4F4B A;  5L0C A;  1J8Y F;  1MNE A;  1RJ9 A;  1WAS A;  2A68 F;  4J7T A;  4ANJ A;  4CS8 A;  3O10 A;  2HMZ A;  2R7U A;  3AG3 C;  2HV7 A;  3E70 C;  1M56 C;  2QUP A;  3V5Y A;  4YN0 B;  1EQ1 A;  4G7H F;  2WVO A;  4LER A;  1PD1 A;  2XLO A;  2EIK C;  3TJ6 A;  2R7R A;  1EA8 A;  2PF4 E;  5T3W A;  1FR0 A;  2XRH A;  2G3V A;  4Q4Z F;  1ZZP A;  2L6F A;  2HSB A;  2NSG A;  1O5H A;  2WVN A;  3M4C A;  4IRU A;  1LI5 A;  1CGM E;  3LNR A;  1RJ9 B;  3QVZ A;  3N2Z B;  3UMK A;  1M6T A;  2CCY A;  4MW3 A;  1S05 A;  3AQB A;  3SP1 A;  1JMW A;  1O3U A;  1H9G A;  2O9X A;  3DWW A;  4OIP F;  1CPQ A;  2W4M A;  2EPN A;  5CI8 A;  5B1B C;  3IEE A;  3VYW A;  1BR1 A;  1TFK B;  2Q9A A;  3LEO A;  2C03 A;  3RVY A;  3NYJ A;  4G7Z F;  3US6 A;  4XPX A;  3LS1 A;  5JS5 A;  1QPU A;  3U2L A;  2E87 A;  4BJT A;  3ITF A;  4C7O A;  4PFP A;  3TJ5 A;  1LVK A;  2VAS A;  3QZC A;  1NBB A;  4YL0 A;  3U9J A;  2YLD A;  4G78 A;  2IXM A;  2VCA A;  4AE4 B;  2ZD9 A;  4CS8 C;  4DRI B;  4E7Z A;  4EWC A;  2PBE A;  1JR8 A;  2VB6 A;  1G4U S;  5BQG A;  3FMS A;  2HZ8 A;  1EI7 A;  2R7S A;  4L6R A;  3SXY A;  3JT1 A;  4MW8 A;  4J7Y A;  5B1A C;  1R5I D;  4X0R A;  2KK1 A;  4I3M A;  3PCV A;  3DM5 A;  4CJO A;  5F28 E;  2Y39 A;  3L8I A;  2A0U A;  1ZHZ A;  4O6N A;  3T6G B;  3M4B A;  2XLV A;  2Y3B A;  2R7T A;  3RKO F;  5B3I A;  2RD9 A;  1F1M A;  2GA0 A;  1OCC C;  2WZG A;  2XM0 A;  2YL7 A;  3KYI A;  4ONS A;  1WN0 A;  4WGY A;  3W4Y A;  4BJ6 A;  5L0J A;  2LFD A;  1I4Y A;  2AWY A;  2AWC A;  1E86 A;  2J9W A;  5CI9 A;  1JRA A;  3EZI A;  2XLD A;  1ZHX A;  1T01 A;  2FGY A;  3K6B A;  1NLX A;  1Z63 A;  3VRC A;  3ZDL A;  3U3B A;  4YWQ A;  4JJF A;  3GOR A;  4LLC A;  1Z7Q c;  256B A;  4ULW A;  5F5H A;  1ZU5 A;  1MQV A;  1ZW2 A;  2A0B A;  3HKK A;  2L9J A;  4M63 A;  1NU7 D;  4N6H A;  3F46 A;  4I44 A;  2R7W A;  1Y6D A;  3B29 A;  3GM3 A;  1C02 A;  1PV3 A;  3JSE O;  4XEK A;  3DI5 A;  3DMD A;  2ZXW C;  3DE9 A;  1C03 A;  3NMK A;  4H54 A;  5KYY A;  2Q7R A;  2W45 A;  4EUK B;  1GQA A;  1NG1 A;  2IXN A;  5KYN A;  1YLM A;  2KW3 C;  1RKE A;  2D5R B;  5L0I A;  3IQ5 A;  2R03 A;  2WL8 A;  2Y3G A;  4JKV A;  2WZL A;  4BJ6 C;  5JT4 A;  4EKW A;  4EBK A;  3FDQ A;  4IGG A;  2B0J A;  4KI2 A;  1FNT c;  2H8A A;  1TWH A;  5B3S C;  3FXH A;  1N1C A;  4P6I C;  1OR3 A;  2EPM X;  4BG0 A;  4A4A A;  1JOG A;  4U5D E;  3F47 A;  3C18 A;  1ZHW A;  4D4X A;  3JYY A;  1RKE B;  5KYW B;  5JVE A;  1YA7 O;  1E85 A;  1D1A A;  2HV6 A;  2PNO A;  3C8G D;  1Q0G A;  2KJG A;  4CS9 C;  4U9D A;  1VOM A;  2OG2 A;  3W2V A;  4E17 A;  2YQY A;  3FAJ A;  3O39 A;  1YAU O;  3EGD A;  4Q5S F;  1BR2 A;  1Z3I X;  3TD7 A;  3JTL O;  3LNM B;  1Q0F A;  2AP3 A;  2J46 A;  5A6B D;  2G3K A;  4XEF A;  1S7Z A;  4U5H A;  1E83 A;  3IQT A;  3ZTM A;  4W8P A;  2R7Q A;  2R7O A;  2NG1 A;  3W8H A;  2LQG A;  1K05 A;  1A7E A;  3DM9 B;  1T6U A;  2VCC A;  4FAP B;  1TQG A;  2R7X A;  3K7D A;  2DI3 A;  3AG1 C;  4XQ1 A;  1HMO A;  1TR2 A;  3EPV A;  3U2M A;  1QQ3 A;  3GWL A;  3DXJ F;  3NDB B;  4I1M A;  1JPN A;  5JSL A;  4OIQ F;  2H7B A;  1VYK A;  1TWA A;  3PDM P;  5DVW A;  5JRA A;  3UGO A;  2F22 A;  4FES A;  3T6J A;  1LM3 B;  1XZP A;  3GOD A;  4IAQ A;  3S90 A;  2WVQ A;  4U9E A;  4ZLC A;  3WG7 C;  3UMI A;  4IJJ A;  4NTA A;  2KGO A;  2OKU A;  3CSK A;  4GEH A;  1YA9 A;  1WOL A;  1H6G A;  4PJM A;  1QLE C;  3T4R A;  1APC A;  4CSA A;  5AGF A;  4P9T A;  1SF8 A;  2RSE B;  3NKD A;  5TJ5 E;  4U5G A;  5A6B A;  2MHR A;  3EG9 A;  4NTB A;  1HE9 A;  4DBR A;  1VMA A;  1KU2 A;  4DOZ A;  2I15 A;  3H2U A;  1T9K A;  4MVM A;  5BQI A;  5KYU A;  2QE9 A;  3HLZ A;  4U5B E;  1U6H A;  2OJE D;  1YYX A;  3I5Q A;  1Q0M A;  4LDQ A;  4K7B A;  2OCC C;  3ATP A;  4YL1 A;  4AL0 A;  1RKC A;  2IYL D;  3C62 A;  3EFO A;  3EG9 B;  3KKB A;  2A69 F;  1D1B A;  3H65 A;  3V5X A;  2G62 A;  3L1M A;  1GS9 A;  2Z15 A;  3EZH A;  2AVK A;  3ASO C;  3ABL C;  3NYM A;  3WHN A;  3JCU Q;  3I5P A;  4HFK B;  4AX2 A;  5T3T A;  1LI7 A;  1NFO A;  4PK4 A;  5KYU B;  4LLE A;  2PX3 A;  1NFN A;  2QTV A;  4KC9 A;  4MTO A;  4XEV A;  4J32 B;  1SMY F;  4JUR I;  5D91 A;  2PFD A;  1B68 A;  1WTY A;  2IXO A;  3EFO B;  3QW0 A;  4C3D A;  1V74 B;  4K1O A;  3B71 A;  1QKR A;  2XS1 A;  1FAP B;  3C8Z A;  4DRJ B;  4A2N B;  4CSA C;  2YVK A;  3KMI A;  1RMV A;  1E2X A;  3K1I A;  4U5C E;  4MS2 A;  2ZXO A;  4XPY A;  3ZQV A;  1VB5 A;  2OQM A;  2BC5 A;  3JZ0 A;  3K66 A;  4NC3 A;  4GQH A;  1H9T A;  4JTD B;  1LPE A;  4JCZ A;  4CJG A;  5KYX A;  4R32 A;  4WAB A;  2ZXR A;  3DZA A;  5AC4 A;  2WB7 A;  2MWQ A;  3FOP A;  2IOQ A;  4MVZ A;  2EPK X;  1OR2 A;  5E3A A;  4AK9 A;  2Y3H A;  3B0P A;  3UNG C;  3R2P A;  3JRT A;  4IB4 A;  3RFY A;  3SZR A;  3U0C A;  2HJ3 A;  1NU9 C;  1PD0 A;  1AEP A;  1OXB A;  1Q0K A;  4NCQ A;  4NTF A;  4UDV A;  3ZIB A;  2I8B A;  3RIP A;  5KYX B;  3Q6M A;  1G4W R;  4JC7 A;  4C7O B;  1V54 C;  3M15 A;  2IM8 A;  3U8P A;  5EHH A;  3S29 A;  4CDY A;  4ER9 A;  1JAF A;  2YZS A;  1YAR O;  3GAN A;  4YT5 A;  2HMQ A;  2W4B A;  5DLJ A;  4E0H A;  4XLN F;  5L3V A;  4G7O F;  4QI2 A;  3SXZ A;  3QVY A;  2YKZ A;  3PMR A;  3EJN A;  2NSF A;  3UMH A;  2TMV P;  1AUE A;  4ZLD A;  1DOW A;  3AJM A;  2XLH A;  3R7C A;  4PFO A;  3LLK A;  3RVZ A;  3MYF A;  3A9C A;  1VYI A;  2KSF A;  1BDJ B;  3NG1 A;  2C04 A;  2KNH A;  2P61 A;  1LE4 A;  5A6A A;  2BE5 F;  2OU6 A;  3U8V A;  1HW2 A;  2EIL C;  3POV A;  1BZ4 A;  1E84 A;  2LIG A;  5IY5 C;  1YYJ A;  2Q9C A;  4HEA J;  3W2W A;  4EBJ A;  2EPL X;  4WGZ A;  4OIN F;  4CS7 A;  3ZG1 A;  3Q6N A;  2HKV A;  1MMN A;  3CAX A;  2OEX A;  1K04 A;  4OD5 A;  1LE2 A;  2J7P D;  3QTH A;  1U0B B;  1YVI A;  1WGW A;  2YWA A;  1I5N A;  5A69 A;  3QMK A;  4HE8 D;  4GYT A;  4BJ5 A;  5L3Q A;  3JYH A;  4JE9 A;  3OWT A;  4RBN A;  1DOV A;  1FFH A;  1VK5 A;  2L7A A;  3FOO A;  3EHN A;  3G4X A;  3EGX A;  3NKE A;  3C7J A;  5BUO A;  4JRZ A;  3ZC4 A;  1ZHT A;  2D4U A;  3KYJ A;  5GPG B;  4DBQ A;  5KYY B;  4N6C A;  4RDA A;  3UR3 C;  4XPW A;  4Q7C A;  2LK4 A;  4RD9 A;  2ICW G;  3LAY A;  2BL2 A;  4U5E E;  3RQF A;  4E0I A;  2H7O A;  2KC3 A;  3SYN A;  3MYI A;  4BPM A;  5HV9 A;  1OCZ C;  1AVO B;  2XL4 A;  3E9V A;  2YLI A;  4JEB A;  4JW1 A;  5E3C A;  2ETS A;  4PJN A;  3ZQY A;  1OW8 A;  1OCO C;  1ZVZ A;  3EGX B;  1CPR A;  1MMG A;  3AG4 C;  3H2V A;  5E2Q A;  3GEE A;  2XLE A;  2AU5 A;  3RH3 A;  2NUP A;  2CYD A;  3AQC A;  5L0H A;  3L0I A;  2P0N A;  4U5F E;  3SEO A;  2PP4 A;  1ORJ A;  2CGE A;  1D0Y A;  2HUJ A;  1A7D A;  1MMD A;  1FFT C;  2EIJ C;  3EGD B;  4C3B A;  3IQC A;  3IPM O;  2QLA A;  1C17 M;  4LDR A;  3CQZ A;  1RXQ A;  4YK5 A;  3NRH A;  2NUP B;  3MFN A;  1G8X A;  1XWJ A;  2R9R B;  3AOU A;  4E7S A;  2MYS A;  2XLW A;  5BQH A;  3C8G A;  2Q00 A;  2B0H A;  3ABM C;  4JCH A;  1ORY A;  4JTA B;  2XXA A;  5K0I A;  1G5Z A;  1TFO B;  4CDA A;  1MMA A;  3G4Z A;  3L8J A;  4I1O B;  3S27 A;  5A6J A;  3M1C B;  2NUT A;  2DYR C;  4MVS A;  4YL3 A;  2HJM A;  2Y69 C;  1M2V A;  4O79 A;  2QY9 A;  2CW0 F;  2WZF A;  1OXK A;  3AG2 C;  2V3C C;  3LLI A;  2J0W A;  1OQC A;  3FAP B;  2R25 A;  3G50 A;  2VH3 A;  1H7I A;  2YL3 A;  3HTK C;  2UUH A;  4IAO A;  4PJL A;  3J06 A;  2ZPA A;  4LAC B;  1GGQ A;  5E33 A;  2GAQ A;  2J0X A;  2L6H A;  2GWW A;  3DD7 A;  3BEH A;  1CGN A;  3NMJ A;  1M2V B;  3ZWI A;  5HSW A;  1W2W A;  2OOC A;  2OEV A;  3HNK A;  3HNJ A;  3LUT B;  3OEO A;  4IWB A;  3AGT A;  1OW6 A;  2GFH A;  2Q4F A;  4NY3 A;  1OW7 A;  2M4E A;  1HMD A;  1QSP A;  4DJ9 A;  3O55 A;  1A7V A;  3SXK A;  3LS0 A;  1UFB A;  2KQ9 A;  1LIH A;  1VLT A;  4QDL A;  2P7V A;  4DVZ A;  1V55 C;  3ZVR A;  1IZM A;  2DYS C;  2PX0 A;  1PCX A;  3ASN C;  5COF A;  1L7C A;  4C3E A;  4OIR F;  4YT2 A;  2R05 A;  2Y3D A;  4MVQ A;  1D1C A;  4CX9 A;  2OJQ A;  4MVR A;  5L0D A;  2IBF A;  4JIO A;  1LKX A;  4BEM J;  1TWC A;  2R7V A;  4KNW A;  1LS4 A;  2LP4 A;  4N4W A;  2ZXP A;  1NZE A;  4B6I A;  1D0X A;  2YEV A;  3HJC A;  4JJG A;  4O6M A;  1GM5 A;  2J45 A;  3I4U A;  1M2O A;  3Q7G A;  3PHF 2;  3HNL A;  3OA1 A;  2JPU A;  3NMI A;  2A6H F;  4FWV A;  4G0H A;  3U3F A;  5AC5 A;  3B0V C;  4FX5 A;  3B0U X;  2XL8 A;  3JRM O;  3S9O A;  4EHP A;  1U89 A;  4KBL A;  3W8I A;  4CIP A;  1KTM A;  4HFF B;  3EHM A;  4LDK A;  3O6X A;  4AE4 A;  1BR4 A;  4EIY A;  3K1H A;  3ZTZ A;  1SYQ A;  1T6I A;  2CNW D;  2XL6 A;  1Z5Z A;  3LJB A;  1OKK D;  1R4T A;  2L81 A;  2P6V A;  1Q0D A;  2YL0 A;  3GM1 A;  2YL1 A;  3KH2 A;  4H4K C;  1V4A A;  3QW1 A;  3MX3 A;  2R02 A;  4MTF A;  3RF3 A;  1ORS C;  5EK0 A;  3RW0 A;  3VF0 A;  4YT4 A;  2GDC A;  3S0X A;  1ZHY A;  3T6B A;  1J8M F;  1D0Z A;  1Z23 A;  1XZQ A;  4E18 A;  2UUI A;  2LFF A;  4MVO A;  2CDQ A;  3K1I C;  2V26 A;  1A41 A;  4JEA A;  3WOD F;  3LEV A;  2EPO A;  5JLI A;  3IQ6 A;  2VC9 A;  5DS4 A;  4EBB A;  2JX0 A;  1BBH A;  1YZA A;  4AL1 A;  1WAT A;  1FTS A;  4PJJ A;  1T5O A;  1KNY A;  1QVX A;  4K0D A;  3UGP A;  2YLG A;  5D92 A;  1HY5 A;  5DS6 A;  3N24 A;  3TK0 A;  1NSG B;  3MLG A;  2J9V A;  4BJ1 A;  1EKY A;  2CNW A;  4J30 B;  1OKK A;  1SR2 A;  2VCB A;  3ZSU A;  5DQT A;  1VTM P;  3A11 A;  4NQF A;  3L34 A;  2A6E F;  2EIN C;  2J9B A;  3MBG A;  3RYL A;  3LES A;  2J8W A;  2Q9B A;  3C63 A;  2XS8 A;  2M64 A;  4CS9 A;  5A6K A;  2LCH A;  3CZ6 A;  1M57 C;  3JSZ A;  4JZA A;  5L0G A;  2IXP A;  4CIH A;  4DRH B;  3NYL A;  3GWN A;  3FHD A;  4N06 A;  3TOM A;  2P1A A;  2X51 A;  3RQG A;  4XTK A;  3SNH A;  3M79 A;  1TKN A;  2J9U A;  1OCR C;  1ZW3 A;  4CBE A;  5T1D B;  1Z6A A;  5JUA A;  1HW1 A;  3X1O A;  4BEJ A;  3ABK C;  1ST6 A;  4OD4 A;  5KYW A;  2J7P A;  3CEX A;  3WAQ A;  2LSE A;  2EIM C;  3B9Q A;  1ZYR F;  3EH1 A;  4XWJ A;  5CIV A;  1YZC A;  2H7V C;  1YJG A;  4D4N A;  4Z9J A;  2KYH A;  2YHS A;  3S28 A;  4DXW A;  1TWG A;  3T9O A;  1IW7 F;  3U5S A;  5FZT A;  4BJ5 C;  2YRF A;  2HSQ A;  1A0B A;  3BRJ A;  3DAG A;  3TQO A;  4MQ9 F;  4MVU A;  4P9F A;  2XM4 A;  1WWP A;  1CGO A;  3EQL F;  2LD6 A;  2DGJ A;  2HS5 A;  1HE1 A;  3K33 A;  4PR9 A;  4YT8 A;  3DJN B;  5COG A;  4O6Y A;  2L6G A;  1L3P A;  3AGU A;  2ASR A;  3DKA A;  4MTG A;  3DAF A;  3X2Q C;  4DVY P;  4IAR A;  2NPU A;  3RQE A;  3GEH A;  3TUL A;  1YDI A;  4JVS A;  1FMV A;  3V7O A;  4O7G A;  1LS1 A;  4Z9H A;  2XLM A;  3DJU B;  3SXM A;  2DB4 A;  1K40 A;  4KNV A;  3C8G B;  3KL4 A;  2XSE A;  4YJW A;  5L0F A;  5FCL A;  2HFI A;  3GEI A;  1O87 A;  2QNL A;  4XLP F;  2XXA B;  4WJ0 A;  1QZX A;  2FFH A;  1UG7 A;  3N0T A;  4PAC A;  3V5Z A;  1RCP A;  3VM6 A;  5EGY A;  1Y4C A;  1T6Q A;  2NUT B;  5JP7 A;  1MND A;  3IHU A;  5DQZ A;  3GM2 A;  5DS5 A;  1SZI A;  4OIO F;  4Z9I A;  2FAP B;  1ZU4 A;  3ECS A;  3FVY A;  5F5F A;  5COM A;  3HNI A;  3EH2 A;  2A1D D;  4QI0 A;  4W8K A;  1FMW A;  3U9M A;  3DE8 A;  2W9Y A;  2X0C A; 
#chains in the Genus database with same CATH homology
 1L7C A;  1RKE A;  2LQG A;  5L0I A;  4W8P A;  3H2U A;  1DOV A;  3VF0 A;  2L7A A;  3RF3 A;  5L0C A;  1TR2 A;  5L0D A;  2IBF A;  4IGG A;  2GDC A;  5L0F A;  1T01 A;  1DOW A;  1U6H A;  5FZT A;  4E18 A;  3ZDL A;  2HSQ A;  3TJ5 A;  1RKC A;  2GWW A;  5L0G A;  5L0H A;  1ZW2 A;  3TJ6 A;  1RKE B;  1XWJ A;  4PR9 A;  3S90 A;  3MYI A;  4E17 A;  2B0H A;  4EHP A;  1ZW3 A;  1U89 A;  1ZVZ A;  3T6G B;  4DJ9 A;  1H6G A;  3H2V A;  1YDI A;  4P9T A;  1ST6 A;  5L0J A;  4ONS A;  2X0C A;  4K1O A;  1SYQ A;  1QKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...