1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
3ZDLA 1RKCA 2GDCA 3RF3A 4EHPA 5L0FA 1U89A 4DJ9A 4P9TA 4K1OA 2L7AA 3TJ6A 1QKRA 1YDIA 5L0HA 3H2VA 4PR9A 1U6HA 1ZVZA 3MYIA 1SYQA 5L0GA 1XWJA 1RKEA 2X0CA 5L0CA 1RKEB 1TR2A 4W8PA 2HSQA 2B0HA 3TJ5A 4E17A 1T01A 1DOWA 5L0IA 1ZW2A 5L0DA 1L7CA 5FZTA 5L0JA 3H2UA 3S90A 4ONSA 2LQGA 1DOVA 3T6GB 4E18A 3VF0A 1ST6A 2IBFA 1H6GA 4IGGA 1ZW3A 2GWWA
chains in the Genus database with same CATH superfamily
2GDCA 4XEFA 1GM5A 2V26A 2AU5A 3C8GD 3E70C 2PBEA 1U89A 1TWCA 3I5PA 3O10A 4IAQA 4XEVA 4YL3A 5D92A 4DJ9A 2XLMA 4D4XA 2J7PD 2R7UA 1MMAA 3HLZA 3SNHA 2VASA 4LACB 2A1DD 2R03A 3ZSUA 2Q7RA 2OQMA 1CGOA 1XZPA 4JVSA 1PD0A 2XL8A 3K33A 4DRHB 2R7VA 3UR3C 3IQTA 5GPGB 2PFDA 1OW8A 2CGEA 3M79A 1ORJA 1T5OA 3X1OA 1RJ9B 3MFNA 2DB4A 5JP7A 3DWWA 4N4WA 4DBRA 1Z63A 1FAPB 1QPUA 3U9MA 4PACA 3TOLA 2Q9AA 2R7XA 2XLWA 4U5GA 3SEOA 4W8KA 2L9JA 4EHPA 1D0ZA 3JRTA 2KGOA 2EPKX 1K40A 1QKRA 3L0IA 1RCPA 3TULA 4LDRA 3MYIA 4NTFA 3ECSA 3H65A 3LEOA 4XPWA 5KYWB 4CIPA 4LERA 3KKBA 1T6QA 2FAPB 3DE9A 3RYLA 4KNVA 1FMWA 1YLMA 2B0HA 1T01A 2HFIA 1K04A 1O5HA 4LDKA 4MVUA 4BJ1A 4EBBA 3EHMA 3FAJA 2J45A 1MNDA 4WJ0A 1BR4A 1UG7A 1XZQA 3N0TA 4YL0A 2LFFA 3UNGC 1TWAA 4PJMA 4M63A 4N06A 1JPNA 2J8WA 3AQBA 4MVOA 2YL7A 4BJTA 4G78A 5KYYA 2WVOA 2PX0A 2R7RA 1VMAA 2IBFA 4IGGA 4E7SA 2L6FA 1M56C 2L6GA 3LAYA 4XTKA 2XS8A 3EZHA 3MLGA 4GYTA 3LS1A 3FMSA 1M2VA 4U5FE 4WABA 4A4AA 4BJ6C 3EFOA 5KYXA 4RDAA 2ASRA 4CBEA 3A11A 1LI7A 1RKEA 5L0CA 4IRUA 4JZAA 2EIJC 1AVOB 1NSGB 4E17A 2WVQA 4MTOA 4K0DA 1M2OA 1W2WA 4JIOA 4XLNF 1LIHA 1AEPA 4FAPB 1TFKB 3US6A 5JVEA 1CGME 3TOMA 5D91A 1U0BB 5L0JA 2IXOA 2Q3TA 3S28A 4Q4ZF 4O7GA 4AE4B 1Q0KA 2C03A 4CSAA 2EPMX 2P1AA 2P0NA 2UUIA 2XLOA 1H6GA 3GWNA 2OOCA 3DJUB 1V4AA 1WGWA 5L3VA 3AG1C 3NMKA 4E0HA 3T4RA 4O79A 3U3FA 3S27A 4CS8C 4ZLDA 4BPMA 2LFDA 5F5FA 3EPVA 3SXYA 3NYJA 1OCRC 2J9WA 4JC7A 4R32A 2QLAA 1A7VA 2VC9A 5JLIA 1Y6DA 3ABMC 1A41A 1MMGA 2YLGA 1SR2A 4MTFA 1OQCA 2A0UA 2YL1A 3K66A 1TR2A 4DOZA 2HSQA 4JEBA 2A69F 4YN0B 1N1CA 1DOWA 1BBHA 3E9VA 1EI7A 2J9UA 1L7CA 1VK5A 1FFTC 1KU2A 3O55A 2OG2A 2VCCA 2J9VA 2KQ9A 3RVYA 1TFOB 1V54C 2YHSA 2R7TA 3WODF 3RW0A 3LESA 2R7SA 3SZRA 1CGNA 2ICWG 3ZG1A 1YZAA 3N2ZB 4EBKA 3CZ6A 4OIRF 1ZW3A 3EGDA 3SXKA 2JPUA 4KBLA 2VH3A 5DLJA 4EWCA 3EZIA 3U8PA 3FOOA 2Q9CA 4DRJB 5A6BA 3RKOF 3DM5A 5BQIA 3MYFA 3ZIBA 2GFHA 2P61A 3DAGA 3B0VC 2CW0F 2QNLA 3EH1A 4CS9C 1J8MF 1OXKA 3K1IA 4K7BA 3TJ5A 4NTBA 4MS2A 3WHNA 1ZHYA 2G3VA 5COMA 3RIPA 1JRAA 5JT4A 2XL4A 1LVKA 2F22A 1YA7O 4EUKB 1TQGA 2NG1A 3C7JA 5AC5A 2MWQA 3IQCA 1TWHA 1JPJA 4MVRA 2J9BA 1D1AA 3JYYA 4C3DA 2YEVA 4ER9A 3EH2A 3T6GB 3NDBB 1PCXA 1I4ZA 1S05A 2LSEA 3TD7A 5DQTA 4P6IC 3S9OA 3SP1A 4PFOA 3T9OA 4BJ5A 1V55C 5T1DB 4JCZA 2WZGA 4DVYP 5K0IA 4P9FA 4WGYA 2R05A 3T6BA 4BEJA 3L1MA 1YYJA 1F1MA 1M2VB 2YVKA 5E3CA 4YL1A 3RQFA 5JRAA 1VOMA 2MHRA 4K1OA 2CDQA 4H4KC 4QDLA 5L0HA 3MBGA 5KYXB 4XWJA 1ZVZA 1JR8A 1O3UA 2NUTB 4O6MA 4C7OA 4HFFB 4NC3A 4PFPA 4YT8A 2FGYA 3EG9A 1WTYA 1H9GA 1I5NA 2KYHA 4I1MA 1ZW2A 3RQGA 2DI3A 1HMDA 1A7DA 1QQ3A 3FHDA 3EQLF 2OCCC 3U2LA 3KYJA 2NSGA 3W8HA 4ONSA 3R7CA 1ZHTA 3VAYA 1HW1A 2IM8A 1VLTA 2HSBA 4D4NA 3WG7C 3ZC4A 1QSPA 2WZLA 4MNDA 1R5ID 4JEAA 3L8JA 4G7HF 5CIVA 1IW7F 2YLDA 1OCOC 3ASNC 2YL3A 3B71A 3NRHA 4KI2A 3FAPB 2A6HF 4HE8D 3U9JA 1NU7D 2B0JA 4JJGA 1TWGA 3WAQA 2A68F 3KYIA 3N24A 2UUHA 4EIYA 2NUPA 3RFYA 5CI9A 1QLEC 2KC3A 3HNJA 4IARA 2ETSA 2EIMC 3G50A 4W8PA 2GWWA 1FFHA 4X0RA 4U5CE 4EBJA 5DS6A 1LI5A 3C18A 3C8ZA 3AOUA 3EGXB 3G4XA 1OW7A 4GEHA 2GA0A 1NBBA 2IXNA 3NG1A 3U2MA 3W4YA 3ZTMA 1PV3A 3R2PA 4LLEA 2LP4A 1NLXA 4YT4A 2Y39A 2G3KA 2XS1A 1ZU5A 3HJCA 1C17M 4E18A 3V5YA 4NTAA 3DZAA 1ST6A 2AVKA 1NFOA 2KJGA 3GORA 4DRIB 3Q6MA 1Z23A 1YA9A 2M64A 2R02A 3A9CA 4PJJA 3KH2A 2DYSC 1R4TA 4ANJA 4C3EA 3JSZA 4ZLCA 3NYMA 2GAQA 3JT1A 2HV6A 3CAXA 4AK9A 2EIKC 2OEXA 4J7YA 4B6IA 3LEVA 1Q0DA 3M4CA 4Q7CA 3PHF2 1SYQA 1WWPA 2VB6A 1VTMP 2R9RB 2HUJA 3F47A 2CYDA 2XL6A 1SZIA 3QW0A 3KL4A 3AQCA 4I44A 4G7ZF 2R25A 3LNRA 5HV9A 2XLHA 3C8GB 3LLKA 3B9QA 2CNWD 2P6VA 2YKZA 3HNIA 2LIGA 2EILC 2H8AA 4FESA 3UMKA 1Y4CA 3ABKC 1APCA 4FWVA 3FDQA 5COFA 5JS5A 1DOVA 1E2XA 1FMVA 4Z9IA 4IJJA 2QTVA 1BZ4A 3ZTZA 2EPOA 4XPYA 2IXMA 4U5BE 3X2QC 4BG0A 1WOLA 2R7QA 2L7AA 2KSFA 1YDIA 1ZHZA 1VB5A 3V5XA 3HNLA 3W8IA 4EKWA 1U6HA 3B0UX 4C7OB 3DM9B 2MYSA 2PF4E 4U9DA 5F5HA 3ZQVA 5IY5C 2JD3A 2WZFA 3EG9B 1D0YA 4CIHA 3DKAA 5B3SC 3FXHA 5DS5A 4U5HA 5EGYA 3W2WA 3B29A 2E87A 4NCQA 1JMWA 2QUPA 1A0BA 3DMDA 3JSEO 4IAOA 1ZYRF 1TKNA 5CI8A 3NYLA 1OW6A 4XEKA 4OIOF 4Q5SF 3GEHA 2HMZA 3M4BA 2Q4FA 1GQAA 5BQGA 1M57C 2LQGA 3VM6A 5B1BC 3S84A 3IQ5A 1EKYA 4OD4A 4RD9A 3SYNA 1H7IA 4HEAJ 4BJ6A 4CJOA 3VF0A 4DXWA 256BA 3EHNA 5TJ5E 3HKKA 4JCHA 3C62A 4LDQA 1C03A 3S0XA 4OINF 2HS5A 3ITFA 1OKKA 4N6HA 2M4EA 1G5ZA 1Z5ZA 1OR3A 3ASOC 2I15A 2OKUA 4U5DE 4XLPF 1SMYF 2OU6A 5B3IA 2D5RB 2ZPAA 3IEEA 4J7TA 4YT5A 2XXAA 3RH3A 1LS1A 3G4ZA 3SXZA 3ZQYA 5L0IA 2H7OA 2XM4A 2XRHA 2QY9A 1NZEA 4UDVA 2EPNA 1ZHWA 5BUOA 1OKKD 3KPHA 1QZXA 2HJMA 4JTCB 4CS8A 1OCZC 5KYNA 3QVYA 3GM1A 2O9XA 3QMKA 3DAFA 3VYWA 2WB7A 3EJNA 5A6JA 4IWBA 1AUEA 4MVZA 5KYYB 3C63A 2XM0A 1WASA 3IHUA 2J46A 3U3BA 2H7VC 3AGTA 2YRFA 1BR2A 4MQ9F 2BC5A 1D1CA 2WVNA 2L6HA 3NKDA 2W9YA 3UMHA 2EPLX 3V7OA 1CPQA 2CCYA 2PNOA 2LK4A 3EFOB 4LLCA 5E2QA 5L0GA 2P7VA 1VYIA 4WGZA 1RKEB 3KMIA 2A0BA 4PJNA 4JTDB 3RQEA 3NKEA 4PJLA 3U5SA 1LKXA 1NFNA 2Y3BA 1HW2A 5DVWA 5FZTA 3ZVRA 3W2VA 3ATPA 3M1CB 2H7BA 3GANA 1WATA 1GS9A 1LE2A 1T9KA 1LM3B 3GWLA 1E86A 1O87A 1M6TA 2DGJA 2OJQA 3MX3A 3NMJA 1L3PA 1YZCA 3IPMO 2QE9A 3GEEA 3U0CA 3AGUA 3PDMP 4HFKB 4CS9A 5T3WA 1E85A 1V74B 4U5EE 4KC9A 2LD6A 3CEXA 2W4BA 3QTHA 4NY3A 4OD5A 3UMIA 4G7OF 2YL0A 1FR0A 2L81A 1WN0A 1E83A 2VCAA 1A7EA 1XWJA 3S29A 5BQHA 3LNMB 1Z6AA 4MVSA 3AG4C 4U9EA 4AL1A 5A69A 1S7ZA 1C02A 3PCVA 5AGFA 5DQZA 3CSKA 4MVMA 1HE1A 1BDJB 1QVXA 2C04A 1UFBA 4CDVA 4IB4A 2J0XA 1G8XA 4I1OB 3RVZA 1ORYA 1RMVA 1GGQA 4NQFA 2Y3HA 1I4YA 2HKVA 2KK1A 3I5QA 2XLDA 3QZCA 4E0IA 1YVIA 3JRMO 3O6XA 1ZU4A 5E33A 2OJED 4YWQA 2Q00A 2AWCA 1Z3IX 1LS4A 5AC4A 3EGDB 2ZXRA 4GQHA 3DI5A 4H54A 2KW3C 1JAFA 1SF8A 1MQVA 2CNWA 1ORSC 4P9TA 4CSAC 5JUAA 3H2VA 3LS0A 1J8YF 1YYXA 2W45A 3Q7LA 1EQ1A 5KYUA 2XXAB 3SXMA 2D4UA 2ZXPA 1HMOA 5F28E 5L0DA 2HV7A 2XSEA 4Z9HA 4E7ZA 4N6CA 4O6YA 1IZMA 4L6RA 4CDAA 4OIPF 3UGPA 2R7OA 3H2UA 3BRJA 4MTGA 2HMQA 2I8BA 2NSFA 4RBNA 3QVZA 3OEOA 4JJFA 1OCCC 3GODA 4XPXA 3L8IA 2YLIA 4J30B 2TMVP 2IXPA 3M15A 2BE5F 4YJWA 1D0XA 1HY5A 2ZXWC 4BEMJ 4CS7A 5L3QA 2J0WA 1Q0GA 2XLEA 3TJ6A 3T6JA 1Q0MA 1YJGA 4PK4A 1NU9C 2XLVA 2IOQA 1MNEA 3GEIA 3VRCA 3HTKC 1OXBA 4I3MA 2NUTA 1KTMA 1ZZPA 1JOGA 2X0CA 3POVA 2Y3GA 4QI2A 3L34A 4XQ1A 5B1AC 5HSWA 2VCBA 2X51A 3DE8A 4MVQA 3ABLC 3AJMA 1EA8A 5A6KA 2YWAA 2R7WA 1RJ9A 4JE9A 4JRZA 2V3CC 1B68A 3K1IC 4MW3A 1RXQA 4YT2A 2YZSA 3Q6NA 1HE9A 4MW8A 4C3BA 4CJGA 1D1BA 3FVYA 5DS4A 1Z7Qc 2HZ8A 1G4WR 3HNKA 1RKCA 2A6EF 4ULVA 3RF3A 3ZDLA 2NPUA 2OEVA 5L0FA 3LUTB 1LE4A 5EK0A 3AG3C 1G4US 3F46A 3OWTA 5COGA 4QI0A 4F4BA 4BJ5C 1YAUO 2JX0A 4AX2A 2Z15A 2FFHA 2NUPB 5KYWA 1Q0FA 1BR1A 2PX3A 3U8VA 1T6IA 3JZ0A 1LPEA 2Y3DA 5A6AA 1H9TA 3EGXA 3GM3A 3LJBA 3Q7GA 4YK5A 3B0PA 3DXJF 2DYRC 4JURI 3AG2C 3K1HA 5T3TA 1OR2A 4O6NA 4KNWA 3I4UA 4CX9A 3J06A 3DD7A 4A2NB 3QW1A 5JSLA 1FNTc 2Q9BA 2RSEB 4OIQF 4FX5A 3JYHA 3K6BA 2LCHA 2W4MA 3DJNB 3PMRA 2Y69C 2ZXOA 4J32B 3GM2A 4JW1A 2WL8A 1PD1A 2BL2A 1NG1A 1E84A 1YARO 1CPRA 3BEHA 4PR9A 4DVZA 2AP3A 1T6UA 3O39A 4JKVA 4CDYA 4ULWA 3LLIA 4DBQA 1VLSA 3IQ6A 4G0HA 3V5ZA 5EHHA 2G62A 5KYUB 1MMDA 1ZHXA 1K05A 1VYKA 2EINC 3JTLO 3C8GA 1KNYA 2AWYA 3K7DA 2YQYA 2ZD9A 4JTAB 5FCLA 3FOPA 3UGOA 2J7PA 3CQZA 3ZWIA 5A6BD 3S90A 2RD9A 5E3AA 3OA1A 3TK0A 4Z9JA 1FTSA 2PP4A 4AL0A 4AE4A 3JCUQ 2HJ3A 3TQOA 2IYLD 2KNHA 3NMIA 1MMNA
chains in the Genus database with same CATH topology
3ZDLA 1RKCA 2GDCA 3RF3A 4EHPA 5L0FA 1U89A 4DJ9A 4P9TA 4K1OA 2L7AA 3TJ6A 1QKRA 1YDIA 5L0HA 3H2VA 4PR9A 1U6HA 1ZVZA 3MYIA 1SYQA 5L0GA 1XWJA 1RKEA 2X0CA 5L0CA 1RKEB 1TR2A 4W8PA 2HSQA 2B0HA 3TJ5A 4E17A 1T01A 1DOWA 5L0IA 1ZW2A 5L0DA 1L7CA 5FZTA 5L0JA 3H2UA 3S90A 4ONSA 2LQGA 1DOVA 3T6GB 4E18A 3VF0A 1ST6A 2IBFA 1H6GA 4IGGA 1ZW3A 2GWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDL A;  1RKC A;  2GDC A;  3RF3 A;  4EHP A;  5L0F A;  1U89 A;  4DJ9 A;  4P9T A;  4K1O A;  2L7A A;  3TJ6 A;  1QKR A;  1YDI A;  5L0H A;  3H2V A;  4PR9 A;  1U6H A;  1ZVZ A;  3MYI A;  1SYQ A;  5L0G A;  1XWJ A;  1RKE A;  2X0C A;  5L0C A;  1RKE B;  1TR2 A;  4W8P A;  2HSQ A;  2B0H A;  3TJ5 A;  4E17 A;  1T01 A;  1DOW A;  5L0I A;  1ZW2 A;  5L0D A;  1L7C A;  5FZT A;  5L0J A;  3H2U A;  3S90 A;  4ONS A;  2LQG A;  1DOV A;  3T6G B;  4E18 A;  3VF0 A;  1ST6 A;  2IBF A;  1H6G A;  4IGG A;  1ZW3 A;  2GWW A; 
#chains in the Genus database with same CATH topology
 2GDC A;  4XEF A;  1GM5 A;  2V26 A;  2AU5 A;  3C8G D;  3E70 C;  2PBE A;  1U89 A;  1TWC A;  3I5P A;  3O10 A;  4IAQ A;  4XEV A;  4YL3 A;  5D92 A;  4DJ9 A;  2XLM A;  4D4X A;  2J7P D;  2R7U A;  1MMA A;  3HLZ A;  3SNH A;  2VAS A;  4LAC B;  2A1D D;  2R03 A;  3ZSU A;  2Q7R A;  2OQM A;  1CGO A;  1XZP A;  4JVS A;  1PD0 A;  2XL8 A;  3K33 A;  4DRH B;  2R7V A;  3UR3 C;  3IQT A;  5GPG B;  2PFD A;  1OW8 A;  2CGE A;  3M79 A;  1ORJ A;  1T5O A;  3X1O A;  1RJ9 B;  3MFN A;  2DB4 A;  5JP7 A;  3DWW A;  4N4W A;  4DBR A;  1Z63 A;  1FAP B;  1QPU A;  3U9M A;  4PAC A;  3TOL A;  2Q9A A;  2R7X A;  2XLW A;  4U5G A;  3SEO A;  4W8K A;  2L9J A;  4EHP A;  1D0Z A;  3JRT A;  2KGO A;  2EPK X;  1K40 A;  1QKR A;  3L0I A;  1RCP A;  3TUL A;  4LDR A;  3MYI A;  4NTF A;  3ECS A;  3H65 A;  3LEO A;  4XPW A;  5KYW B;  4CIP A;  4LER A;  3KKB A;  1T6Q A;  2FAP B;  3DE9 A;  3RYL A;  4KNV A;  1FMW A;  1YLM A;  2B0H A;  1T01 A;  2HFI A;  1K04 A;  1O5H A;  4LDK A;  4MVU A;  4BJ1 A;  4EBB A;  3EHM A;  3FAJ A;  2J45 A;  1MND A;  4WJ0 A;  1BR4 A;  1UG7 A;  1XZQ A;  3N0T A;  4YL0 A;  2LFF A;  3UNG C;  1TWA A;  4PJM A;  4M63 A;  4N06 A;  1JPN A;  2J8W A;  3AQB A;  4MVO A;  2YL7 A;  4BJT A;  4G78 A;  5KYY A;  2WVO A;  2PX0 A;  2R7R A;  1VMA A;  2IBF A;  4IGG A;  4E7S A;  2L6F A;  1M56 C;  2L6G A;  3LAY A;  4XTK A;  2XS8 A;  3EZH A;  3MLG A;  4GYT A;  3LS1 A;  3FMS A;  1M2V A;  4U5F E;  4WAB A;  4A4A A;  4BJ6 C;  3EFO A;  5KYX A;  4RDA A;  2ASR A;  4CBE A;  3A11 A;  1LI7 A;  1RKE A;  5L0C A;  4IRU A;  4JZA A;  2EIJ C;  1AVO B;  1NSG B;  4E17 A;  2WVQ A;  4MTO A;  4K0D A;  1M2O A;  1W2W A;  4JIO A;  4XLN F;  1LIH A;  1AEP A;  4FAP B;  1TFK B;  3US6 A;  5JVE A;  1CGM E;  3TOM A;  5D91 A;  1U0B B;  5L0J A;  2IXO A;  2Q3T A;  3S28 A;  4Q4Z F;  4O7G A;  4AE4 B;  1Q0K A;  2C03 A;  4CSA A;  2EPM X;  2P1A A;  2P0N A;  2UUI A;  2XLO A;  1H6G A;  3GWN A;  2OOC A;  3DJU B;  1V4A A;  1WGW A;  5L3V A;  3AG1 C;  3NMK A;  4E0H A;  3T4R A;  4O79 A;  3U3F A;  3S27 A;  4CS8 C;  4ZLD A;  4BPM A;  2LFD A;  5F5F A;  3EPV A;  3SXY A;  3NYJ A;  1OCR C;  2J9W A;  4JC7 A;  4R32 A;  2QLA A;  1A7V A;  2VC9 A;  5JLI A;  1Y6D A;  3ABM C;  1A41 A;  1MMG A;  2YLG A;  1SR2 A;  4MTF A;  1OQC A;  2A0U A;  2YL1 A;  3K66 A;  1TR2 A;  4DOZ A;  2HSQ A;  4JEB A;  2A69 F;  4YN0 B;  1N1C A;  1DOW A;  1BBH A;  3E9V A;  1EI7 A;  2J9U A;  1L7C A;  1VK5 A;  1FFT C;  1KU2 A;  3O55 A;  2OG2 A;  2VCC A;  2J9V A;  2KQ9 A;  3RVY A;  1TFO B;  1V54 C;  2YHS A;  2R7T A;  3WOD F;  3RW0 A;  3LES A;  2R7S A;  3SZR A;  1CGN A;  2ICW G;  3ZG1 A;  1YZA A;  3N2Z B;  4EBK A;  3CZ6 A;  4OIR F;  1ZW3 A;  3EGD A;  3SXK A;  2JPU A;  4KBL A;  2VH3 A;  5DLJ A;  4EWC A;  3EZI A;  3U8P A;  3FOO A;  2Q9C A;  4DRJ B;  5A6B A;  3RKO F;  3DM5 A;  5BQI A;  3MYF A;  3ZIB A;  2GFH A;  2P61 A;  3DAG A;  3B0V C;  2CW0 F;  2QNL A;  3EH1 A;  4CS9 C;  1J8M F;  1OXK A;  3K1I A;  4K7B A;  3TJ5 A;  4NTB A;  4MS2 A;  3WHN A;  1ZHY A;  2G3V A;  5COM A;  3RIP A;  1JRA A;  5JT4 A;  2XL4 A;  1LVK A;  2F22 A;  1YA7 O;  4EUK B;  1TQG A;  2NG1 A;  3C7J A;  5AC5 A;  2MWQ A;  3IQC A;  1TWH A;  1JPJ A;  4MVR A;  2J9B A;  1D1A A;  3JYY A;  4C3D A;  2YEV A;  4ER9 A;  3EH2 A;  3T6G B;  3NDB B;  1PCX A;  1I4Z A;  1S05 A;  2LSE A;  3TD7 A;  5DQT A;  4P6I C;  3S9O A;  3SP1 A;  4PFO A;  3T9O A;  4BJ5 A;  1V55 C;  5T1D B;  4JCZ A;  2WZG A;  4DVY P;  5K0I A;  4P9F A;  4WGY A;  2R05 A;  3T6B A;  4BEJ A;  3L1M A;  1YYJ A;  1F1M A;  1M2V B;  2YVK A;  5E3C A;  4YL1 A;  3RQF A;  5JRA A;  1VOM A;  2MHR A;  4K1O A;  2CDQ A;  4H4K C;  4QDL A;  5L0H A;  3MBG A;  5KYX B;  4XWJ A;  1ZVZ A;  1JR8 A;  1O3U A;  2NUT B;  4O6M A;  4C7O A;  4HFF B;  4NC3 A;  4PFP A;  4YT8 A;  2FGY A;  3EG9 A;  1WTY A;  1H9G A;  1I5N A;  2KYH A;  4I1M A;  1ZW2 A;  3RQG A;  2DI3 A;  1HMD A;  1A7D A;  1QQ3 A;  3FHD A;  3EQL F;  2OCC C;  3U2L A;  3KYJ A;  2NSG A;  3W8H A;  4ONS A;  3R7C A;  1ZHT A;  3VAY A;  1HW1 A;  2IM8 A;  1VLT A;  2HSB A;  4D4N A;  3WG7 C;  3ZC4 A;  1QSP A;  2WZL A;  4MND A;  1R5I D;  4JEA A;  3L8J A;  4G7H F;  5CIV A;  1IW7 F;  2YLD A;  1OCO C;  3ASN C;  2YL3 A;  3B71 A;  3NRH A;  4KI2 A;  3FAP B;  2A6H F;  4HE8 D;  3U9J A;  1NU7 D;  2B0J A;  4JJG A;  1TWG A;  3WAQ A;  2A68 F;  3KYI A;  3N24 A;  2UUH A;  4EIY A;  2NUP A;  3RFY A;  5CI9 A;  1QLE C;  2KC3 A;  3HNJ A;  4IAR A;  2ETS A;  2EIM C;  3G50 A;  4W8P A;  2GWW A;  1FFH A;  4X0R A;  4U5C E;  4EBJ A;  5DS6 A;  1LI5 A;  3C18 A;  3C8Z A;  3AOU A;  3EGX B;  3G4X A;  1OW7 A;  4GEH A;  2GA0 A;  1NBB A;  2IXN A;  3NG1 A;  3U2M A;  3W4Y A;  3ZTM A;  1PV3 A;  3R2P A;  4LLE A;  2LP4 A;  1NLX A;  4YT4 A;  2Y39 A;  2G3K A;  2XS1 A;  1ZU5 A;  3HJC A;  1C17 M;  4E18 A;  3V5Y A;  4NTA A;  3DZA A;  1ST6 A;  2AVK A;  1NFO A;  2KJG A;  3GOR A;  4DRI B;  3Q6M A;  1Z23 A;  1YA9 A;  2M64 A;  2R02 A;  3A9C A;  4PJJ A;  3KH2 A;  2DYS C;  1R4T A;  4ANJ A;  4C3E A;  3JSZ A;  4ZLC A;  3NYM A;  2GAQ A;  3JT1 A;  2HV6 A;  3CAX A;  4AK9 A;  2EIK C;  2OEX A;  4J7Y A;  4B6I A;  3LEV A;  1Q0D A;  3M4C A;  4Q7C A;  3PHF 2;  1SYQ A;  1WWP A;  2VB6 A;  1VTM P;  2R9R B;  2HUJ A;  3F47 A;  2CYD A;  2XL6 A;  1SZI A;  3QW0 A;  3KL4 A;  3AQC A;  4I44 A;  4G7Z F;  2R25 A;  3LNR A;  5HV9 A;  2XLH A;  3C8G B;  3LLK A;  3B9Q A;  2CNW D;  2P6V A;  2YKZ A;  3HNI A;  2LIG A;  2EIL C;  2H8A A;  4FES A;  3UMK A;  1Y4C A;  3ABK C;  1APC A;  4FWV A;  3FDQ A;  5COF A;  5JS5 A;  1DOV A;  1E2X A;  1FMV A;  4Z9I A;  4IJJ A;  2QTV A;  1BZ4 A;  3ZTZ A;  2EPO A;  4XPY A;  2IXM A;  4U5B E;  3X2Q C;  4BG0 A;  1WOL A;  2R7Q A;  2L7A A;  2KSF A;  1YDI A;  1ZHZ A;  1VB5 A;  3V5X A;  3HNL A;  3W8I A;  4EKW A;  1U6H A;  3B0U X;  4C7O B;  3DM9 B;  2MYS A;  2PF4 E;  4U9D A;  5F5H A;  3ZQV A;  5IY5 C;  2JD3 A;  2WZF A;  3EG9 B;  1D0Y A;  4CIH A;  3DKA A;  5B3S C;  3FXH A;  5DS5 A;  4U5H A;  5EGY A;  3W2W A;  3B29 A;  2E87 A;  4NCQ A;  1JMW A;  2QUP A;  1A0B A;  3DMD A;  3JSE O;  4IAO A;  1ZYR F;  1TKN A;  5CI8 A;  3NYL A;  1OW6 A;  4XEK A;  4OIO F;  4Q5S F;  3GEH A;  2HMZ A;  3M4B A;  2Q4F A;  1GQA A;  5BQG A;  1M57 C;  2LQG A;  3VM6 A;  5B1B C;  3S84 A;  3IQ5 A;  1EKY A;  4OD4 A;  4RD9 A;  3SYN A;  1H7I A;  4HEA J;  4BJ6 A;  4CJO A;  3VF0 A;  4DXW A;  256B A;  3EHN A;  5TJ5 E;  3HKK A;  4JCH A;  3C62 A;  4LDQ A;  1C03 A;  3S0X A;  4OIN F;  2HS5 A;  3ITF A;  1OKK A;  4N6H A;  2M4E A;  1G5Z A;  1Z5Z A;  1OR3 A;  3ASO C;  2I15 A;  2OKU A;  4U5D E;  4XLP F;  1SMY F;  2OU6 A;  5B3I A;  2D5R B;  2ZPA A;  3IEE A;  4J7T A;  4YT5 A;  2XXA A;  3RH3 A;  1LS1 A;  3G4Z A;  3SXZ A;  3ZQY A;  5L0I A;  2H7O A;  2XM4 A;  2XRH A;  2QY9 A;  1NZE A;  4UDV A;  2EPN A;  1ZHW A;  5BUO A;  1OKK D;  3KPH A;  1QZX A;  2HJM A;  4JTC B;  4CS8 A;  1OCZ C;  5KYN A;  3QVY A;  3GM1 A;  2O9X A;  3QMK A;  3DAF A;  3VYW A;  2WB7 A;  3EJN A;  5A6J A;  4IWB A;  1AUE A;  4MVZ A;  5KYY B;  3C63 A;  2XM0 A;  1WAS A;  3IHU A;  2J46 A;  3U3B A;  2H7V C;  3AGT A;  2YRF A;  1BR2 A;  4MQ9 F;  2BC5 A;  1D1C A;  2WVN A;  2L6H A;  3NKD A;  2W9Y A;  3UMH A;  2EPL X;  3V7O A;  1CPQ A;  2CCY A;  2PNO A;  2LK4 A;  3EFO B;  4LLC A;  5E2Q A;  5L0G A;  2P7V A;  1VYI A;  4WGZ A;  1RKE B;  3KMI A;  2A0B A;  4PJN A;  4JTD B;  3RQE A;  3NKE A;  4PJL A;  3U5S A;  1LKX A;  1NFN A;  2Y3B A;  1HW2 A;  5DVW A;  5FZT A;  3ZVR A;  3W2V A;  3ATP A;  3M1C B;  2H7B A;  3GAN A;  1WAT A;  1GS9 A;  1LE2 A;  1T9K A;  1LM3 B;  3GWL A;  1E86 A;  1O87 A;  1M6T A;  2DGJ A;  2OJQ A;  3MX3 A;  3NMJ A;  1L3P A;  1YZC A;  3IPM O;  2QE9 A;  3GEE A;  3U0C A;  3AGU A;  3PDM P;  4HFK B;  4CS9 A;  5T3W A;  1E85 A;  1V74 B;  4U5E E;  4KC9 A;  2LD6 A;  3CEX A;  2W4B A;  3QTH A;  4NY3 A;  4OD5 A;  3UMI A;  4G7O F;  2YL0 A;  1FR0 A;  2L81 A;  1WN0 A;  1E83 A;  2VCA A;  1A7E A;  1XWJ A;  3S29 A;  5BQH A;  3LNM B;  1Z6A A;  4MVS A;  3AG4 C;  4U9E A;  4AL1 A;  5A69 A;  1S7Z A;  1C02 A;  3PCV A;  5AGF A;  5DQZ A;  3CSK A;  4MVM A;  1HE1 A;  1BDJ B;  1QVX A;  2C04 A;  1UFB A;  4CDV A;  4IB4 A;  2J0X A;  1G8X A;  4I1O B;  3RVZ A;  1ORY A;  1RMV A;  1GGQ A;  4NQF A;  2Y3H A;  1I4Y A;  2HKV A;  2KK1 A;  3I5Q A;  2XLD A;  3QZC A;  4E0I A;  1YVI A;  3JRM O;  3O6X A;  1ZU4 A;  5E33 A;  2OJE D;  4YWQ A;  2Q00 A;  2AWC A;  1Z3I X;  1LS4 A;  5AC4 A;  3EGD B;  2ZXR A;  4GQH A;  3DI5 A;  4H54 A;  2KW3 C;  1JAF A;  1SF8 A;  1MQV A;  2CNW A;  1ORS C;  4P9T A;  4CSA C;  5JUA A;  3H2V A;  3LS0 A;  1J8Y F;  1YYX A;  2W45 A;  3Q7L A;  1EQ1 A;  5KYU A;  2XXA B;  3SXM A;  2D4U A;  2ZXP A;  1HMO A;  5F28 E;  5L0D A;  2HV7 A;  2XSE A;  4Z9H A;  4E7Z A;  4N6C A;  4O6Y A;  1IZM A;  4L6R A;  4CDA A;  4OIP F;  3UGP A;  2R7O A;  3H2U A;  3BRJ A;  4MTG A;  2HMQ A;  2I8B A;  2NSF A;  4RBN A;  3QVZ A;  3OEO A;  4JJF A;  1OCC C;  3GOD A;  4XPX A;  3L8I A;  2YLI A;  4J30 B;  2TMV P;  2IXP A;  3M15 A;  2BE5 F;  4YJW A;  1D0X A;  1HY5 A;  2ZXW C;  4BEM J;  4CS7 A;  5L3Q A;  2J0W A;  1Q0G A;  2XLE A;  3TJ6 A;  3T6J A;  1Q0M A;  1YJG A;  4PK4 A;  1NU9 C;  2XLV A;  2IOQ A;  1MNE A;  3GEI A;  3VRC A;  3HTK C;  1OXB A;  4I3M A;  2NUT A;  1KTM A;  1ZZP A;  1JOG A;  2X0C A;  3POV A;  2Y3G A;  4QI2 A;  3L34 A;  4XQ1 A;  5B1A C;  5HSW A;  2VCB A;  2X51 A;  3DE8 A;  4MVQ A;  3ABL C;  3AJM A;  1EA8 A;  5A6K A;  2YWA A;  2R7W A;  1RJ9 A;  4JE9 A;  4JRZ A;  2V3C C;  1B68 A;  3K1I C;  4MW3 A;  1RXQ A;  4YT2 A;  2YZS A;  3Q6N A;  1HE9 A;  4MW8 A;  4C3B A;  4CJG A;  1D1B A;  3FVY A;  5DS4 A;  1Z7Q c;  2HZ8 A;  1G4W R;  3HNK A;  1RKC A;  2A6E F;  4ULV A;  3RF3 A;  3ZDL A;  2NPU A;  2OEV A;  5L0F A;  3LUT B;  1LE4 A;  5EK0 A;  3AG3 C;  1G4U S;  3F46 A;  3OWT A;  5COG A;  4QI0 A;  4F4B A;  4BJ5 C;  1YAU O;  2JX0 A;  4AX2 A;  2Z15 A;  2FFH A;  2NUP B;  5KYW A;  1Q0F A;  1BR1 A;  2PX3 A;  3U8V A;  1T6I A;  3JZ0 A;  1LPE A;  2Y3D A;  5A6A A;  1H9T A;  3EGX A;  3GM3 A;  3LJB A;  3Q7G A;  4YK5 A;  3B0P A;  3DXJ F;  2DYR C;  4JUR I;  3AG2 C;  3K1H A;  5T3T A;  1OR2 A;  4O6N A;  4KNW A;  3I4U A;  4CX9 A;  3J06 A;  3DD7 A;  4A2N B;  3QW1 A;  5JSL A;  1FNT c;  2Q9B A;  2RSE B;  4OIQ F;  4FX5 A;  3JYH A;  3K6B A;  2LCH A;  2W4M A;  3DJN B;  3PMR A;  2Y69 C;  2ZXO A;  4J32 B;  3GM2 A;  4JW1 A;  2WL8 A;  1PD1 A;  2BL2 A;  1NG1 A;  1E84 A;  1YAR O;  1CPR A;  3BEH A;  4PR9 A;  4DVZ A;  2AP3 A;  1T6U A;  3O39 A;  4JKV A;  4CDY A;  4ULW A;  3LLI A;  4DBQ A;  1VLS A;  3IQ6 A;  4G0H A;  3V5Z A;  5EHH A;  2G62 A;  5KYU B;  1MMD A;  1ZHX A;  1K05 A;  1VYK A;  2EIN C;  3JTL O;  3C8G A;  1KNY A;  2AWY A;  3K7D A;  2YQY A;  2ZD9 A;  4JTA B;  5FCL A;  3FOP A;  3UGO A;  2J7P A;  3CQZ A;  3ZWI A;  5A6B D;  3S90 A;  2RD9 A;  5E3A A;  3OA1 A;  3TK0 A;  4Z9J A;  1FTS A;  2PP4 A;  4AL0 A;  4AE4 A;  3JCU Q;  2HJ3 A;  3TQO A;  2IYL D;  2KNH A;  3NMI A;  1MMN A; 
#chains in the Genus database with same CATH homology
 3ZDL A;  1RKC A;  2GDC A;  3RF3 A;  4EHP A;  5L0F A;  1U89 A;  4DJ9 A;  4P9T A;  4K1O A;  2L7A A;  3TJ6 A;  1QKR A;  1YDI A;  5L0H A;  3H2V A;  4PR9 A;  1U6H A;  1ZVZ A;  3MYI A;  1SYQ A;  5L0G A;  1XWJ A;  1RKE A;  2X0C A;  5L0C A;  1RKE B;  1TR2 A;  4W8P A;  2HSQ A;  2B0H A;  3TJ5 A;  4E17 A;  1T01 A;  1DOW A;  5L0I A;  1ZW2 A;  5L0D A;  1L7C A;  5FZT A;  5L0J A;  3H2U A;  3S90 A;  4ONS A;  2LQG A;  1DOV A;  3T6G B;  4E18 A;  3VF0 A;  1ST6 A;  2IBF A;  1H6G A;  4IGG A;  1ZW3 A;  2GWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...