1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
1RKCA 2X0CA 3H2VA 3RF3A 2IBFA 5L0DA 4P9TA 1T01A 1QKRA 3TJ5A 1TR2A 1H6GA 1YDIA 2GWWA 2B0HA 5FZTA 4K1OA 3ZDLA 3S90A 4DJ9A 1RKEB 1ST6A 1L7CA 1DOWA 5L0FA 1RKEA 1ZVZA 1DOVA 2HSQA 3H2UA 1XWJA 1ZW2A 4ONSA 3MYIA 5L0GA 1U6HA 3TJ6A 4EHPA 2GDCA 2LQGA 5L0CA 3VF0A 3T6GB 5L0IA 1ZW3A 4W8PA 4E18A 5L0JA 4IGGA 2L7AA 4PR9A 1U89A 5L0HA 1SYQA 4E17A
chains in the Genus database with same CATH superfamily
3DE9A 4XWJA 1JRAA 4N6CA 5L3VA 5EGYA 5L0DA 2IXNA 3KYJA 1FTSA 1T6UA 3Q6NA 3TJ5A 3FDQA 3TQOA 4Z9IA 5FCLA 3NMIA 4DJ9A 4OINF 1ZZPA 1ORJA 5T1DB 1CGME 3ZSUA 4Q4ZF 4U5HA 3S84A 1OR2A 1WASA 2NUPB 3Q6MA 1EI7A 3S29A 5HSWA 3FOPA 5L3QA 2J8WA 4G7ZF 5D92A 3SNHA 1VLTA 2OKUA 2LQGA 2JD3A 2AVKA 2HJMA 2NUTB 1YVIA 4JEBA 1OXBA 2IM8A 3GEHA 2CGEA 3ABKC 2NUTA 5B3IA 4KBLA 4NTAA 2L7AA 2NPUA 3NYMA 3ATPA 4QDLA 3CQZA 5DVWA 4N6HA 5DQZA 1YARO 1C17M 3T6JA 2J7PA 4Q5SF 3DKAA 3ZWIA 4YWQA 2XLMA 1S7ZA 4LLCA 3V7OA 3I5QA 4MNDA 4MTFA 4IAQA 3VRCA 4O6NA 3FMSA 3HNKA 3GEEA 4X0RA 4KNWA 4CBEA 3L0IA 4O79A 4C7OB 1LE4A 5COGA 1I4ZA 4NC3A 1SR2A 2P0NA 4C7OA 4G7OF 2J9WA 2XLWA 3QVYA 2VCAA 2HMQA 3ASOC 1OKKA 5GPGB 1O87A 4DRHB 2NSGA 1BBHA 2KK1A 3IQCA 4O6MA 5KYNA 4CSAC 1G4US 4JCHA 3RQEA 2R7OA 3NRHA 1BDJB 2H8AA 2BE5F 2XL4A 3DMDA 3PCVA 1MNEA 3QVZA 2VCBA 1Q0KA 5A6KA 3C8ZA 2XS8A 1SMYF 5BQHA 4AE4B 1D0ZA 2EILC 1VYKA 2R9RB 1A7VA 3FAJA 5KYUB 3EHNA 5E3AA 1NSGB 3MYFA 4AE4A 1QVXA 5KYUA 3KMIA 3B0UX 1LI5A 2I15A 5F28E 4BEMJ 1OQCA 2AWYA 3GWNA 1E83A 2ZPAA 3GWLA 2J46A 3KL4A 4U5GA 1Z23A 1OCCC 3IQTA 3K1IA 4XPWA 4YL3A 4OD4A 3QW0A 1GGQA 4JKVA 3U3FA 1XWJA 1TFKB 2HV6A 5L0GA 3SEOA 4FWVA 2L6GA 2MWQA 5B3SC 1VLSA 3PHF2 3MFNA 5DS5A 2B0JA 1CGNA 3DZAA 1E86A 2YLDA 1G5ZA 2L81A 4JIOA 3LEVA 3GODA 2XLVA 4JURI 4HFKB 4XPXA 2R7QA 4KI2A 1XZPA 1FNTc 1M56C 3LJBA 3RQFA 1WTYA 2J9BA 1O3UA 1H7IA 1UG7A 2YRFA 1J8YF 1Q0MA 2Q9AA 1MQVA 3EH2A 3NYLA 4GQHA 4QI0A 2YEVA 4JTAB 3ABLC 4PFOA 5CIVA 2VB6A 2NSFA 2EPNA 2W4BA 4ANJA 1M57C 2DI3A 2WZGA 3O10A 4BJ5C 2G62A 3CAXA 2R02A 3G50A 2WZLA 4CX9A 3J06A 3IHUA 4IB4A 2R03A 4MVOA 1K04A 3H2UA 5BQIA 4F4BA 2QLAA 2XL8A 4M63A 4YL0A 1YJGA 1LKXA 3JRTA 4KC9A 5A6JA 3GEIA 1VTMP 1HW2A 4EUKB 1SF8A 2Y3BA 3EH1A 1T9KA 4CS8A 5T3WA 4E7ZA 1V74B 2JPUA 3HKKA 4CJGA 3IQ5A 3TOLA 1Q0GA 4XLPF 2LD6A 2YL1A 3ECSA 3F47A 4IAOA 3PDMP 2AP3A 1OCOC 3C62A 3DWWA 3KKBA 2KSFA 1NU9C 2QTVA 3TULA 4IARA 3NMKA 3O6XA 2NG1A 1KNYA 2PBEA 2CYDA 4U9EA 2EPOA 1E84A 4K1OA 1Z3IX 2EINC 3RFYA 1Q0DA 1LI7A 2E87A 3JTLO 3EJNA 2H7OA 2MHRA 3LS1A 2FAPB 1IZMA 5EK0A 1KU2A 5DS6A 3M4BA 4LDQA 5DLJA 3KH2A 4BG0A 4I3MA 2QE9A 5L0CA 4HFFB 2QUPA 4BPMA 1Z6AA 3U9JA 1C03A 3JZ0A 3M15A 1O5HA 1M2VB 4DVYP 5AC4A 1U89A 1HY5A 1MMAA 2LK4A 4E17A 1EA8A 1ORYA 3BRJA 3M1CB 1ZHYA 1OW8A 2H7VC 4GEHA 3Q7LA 4HE8D 3T9OA 2FGYA 3DAGA 3DJUB 3M4CA 3G4XA 2RD9A 2W9YA 4Q7CA 2EPKX 1K40A 3KPHA 1OW7A 2ZD9A 4H4KC 3ZG1A 4C3BA 4MVZA 5A6BA 1D0XA 3N2ZB 3KYIA 2ICWG 2R05A 3RH3A 3WG7C 4EKWA 1G8XA 2PFDA 2J45A 4YK5A 1UFBA 2P1AA 4LACB 2Y3GA 3X1OA 2IOQA 3K1IC 1ZW2A 2YL3A 1T5OA 2PX3A 1N1CA 2A6EF 2CDQA 2HMZA 1PD1A 2J0WA 3L8IA 4O6YA 3RYLA 3TJ6A 3VF0A 3W8IA 3LAYA 3UMIA 3T4RA 2Q9CA 4K0DA 4U5FE 1C02A 2O9XA 3UGOA 3BEHA 1Y6DA 4PR9A 1FMWA 4MVMA 2KNHA 4XTKA 1SYQA 3LLIA 4IRUA 3RVYA 1QQ3A 2IXMA 3HJCA 1MMNA 1Z5ZA 3CSKA 3AOUA 5CI8A 1FAPB 3LNRA 2HZ8A 3QMKA 3GM3A 1CPRA 3F46A 4IJJA 2L6FA 4H54A 3E70C 4KNVA 3L1MA 1H9GA 4OIRF 1BZ4A 4O7GA 2GWWA 3C18A 3K33A 4FX5A 2PP4A 1PD0A 4U5BE 4W8KA 4XPYA 3LNMB 4DBQA 4WGYA 2IXOA 4MTOA 1G4WR 3B71A 4C3DA 1RMVA 1JMWA 2KYHA 2H7BA 3C8GB 3IEEA 1NFNA 1DOVA 1JAFA 1M2OA 3JCUQ 4CJOA 1WWPA 1EQ1A 1TWAA 2VH3A 3C8GA 3LEOA 4MTGA 2R7XA 1YA9A 4BJ6A 4YT2A 5B1AC 1D1AA 1AVOB 1QZXA 2RSEB 2CW0F 2IXPA 4EBJA 2A0BA 4CS8C 4DRJB 4EWCA 3UR3C 4JW1A 3O39A 3QZCA 2D4UA 2BL2A 2LSEA 1B68A 1AEPA 3FHDA 3AQBA 1ORSC 4K7BA 4YT5A 3DD7A 4AK9A 3GM2A 4QI2A 3S27A 2ZXWC 4UDVA 2GFHA 2Q4FA 2F22A 3SZRA 2R7RA 2DB4A 1SZIA 4ZLDA 3HNJA 2OG2A 3JT1A 1YZCA 2JX0A 3L34A 2EIJC 4HEAJ 4YT4A 3K7DA 2V3CC 4PK4A 4I1MA 4OIOF 3C7JA 1A0BA 4JEAA 2Q9BA 2WVOA 3OA1A 3DJNB 1VYIA 3MYIA 3FAPB 2YHSA 3ZQVA 2FFHA 3UGPA 1BR2A 2LFDA 3JYHA 4E0HA 1YYXA 2XRHA 3MLGA 3FVYA 3SXZA 1D0YA 3E9VA 2Y69C 4OD5A 2R25A 4JCZA 4N4WA 1WATA 3H2VA 3RF3A 1FR0A 1YA7O 2XLHA 1JOGA 3RIPA 1OR3A 1HMOA 3EZHA 4JTCB 3NG1A 1ZHZA 3RQGA 1XZQA 3SXMA 3AG2C 3ZIBA 2QNLA 4AL0A 2A6HF 4ULWA 2YLGA 2OCCC 2XL6A 1ZHTA 1FMVA 3W2WA 3RW0A 3S28A 2WVNA 3DAFA 1A41A 1I5NA 2DGJA 4RBNA 4CS7A 5JLIA 3S0XA 1TWCA 1V54C 1ZW3A 2EIKC 2Y3HA 2X51A 3HNIA 1CGOA 2KQ9A 4MQ9F 2Y39A 3S9OA 3U3BA 2DYSC 3DE8A 3MBGA 1QKRA 4C3EA 5L0HA 3SP1A 3POVA 3ZTMA 4P9TA 1T01A 2XXAB 4U5DE 4WJ0A 3U5SA 2J7PD 4AX2A 3K6BA 2XXAA 2YLIA 5AGFA 5F5FA 3U9MA 1GM5A 3N0TA 2LCHA 3NYJA 1ST6A 4U5CE 3NDBB 1LPEA 2A68F 2KC3A 4DBRA 1APCA 4NCQA 4DXWA 4JJFA 4G78A 2ETSA 1OCRC 3U8VA 1ZU5A 5COFA 2R7VA 3DM9B 1OKKD 3EZIA 4BJ6C 3JSEO 5KYXB 3O55A 1HW1A 5JRAA 3ZC4A 5KYXA 4E18A 5L0JA 1Z7Qc 4IGGA 3TK0A 3NKDA 2J9VA 1HE9A 1ZYRF 1JPJA 4PACA 3ITFA 1RKCA 3C63A 5JP7A 4B6IA 1HMDA 3WAQA 3ASNC 4MVSA 3ABMC 4BEJA 1H6GA 4EIYA 1RXQA 1ZHWA 4EBBA 2DYRC 1LVKA 4NTFA 5B1BC 5FZTA 3V5YA 1J8MF 1TFOB 4MVRA 5IY5C 2PX0A 3FOOA 3V5XA 2KGOA 2Q7RA 3OWTA 1TQGA 2OJED 2Z15A 3NKEA 4JZAA 2HV7A 2W4MA 2VC9A 5COMA 4E0IA 4YT8A 1E85A 3AJMA 4ONSA 2EIMC 2HKVA 1YYJA 1T6QA 2GDCA 2OU6A 5AC5A 4BJ1A 4DVZA 4CSAA 1VOMA 3B9QA 3PMRA 3X2QC 2WZFA 4U5EE 5E33A 4ULVA 4DOZA 1I4YA 2OQMA 1NFOA 2XM0A 3LLKA 2ASRA 256BA 2CNWD 3B0VC 3N24A 2WVQA 3JSZA 4MVUA 2R7TA 3K66A 1OXKA 1Z63A 5BUOA 3SXYA 1D1BA 2OOCA 4CDYA 2G3VA 1W2WA 4PJJA 1TR2A 2LFFA 3HNLA 4BJ5A 4J32B 1LIHA 2XS1A 4NQFA 2P61A 3IQ6A 2YVKA 1RCPA 3VAYA 1S05A 3ZDLA 4Z9JA 3EPVA 1L7CA 4DRIB 2GAQA 1H9TA 2I8BA 1YAUO 4CS9A 3LS0A 2Q3TA 2YL7A 1ZHXA 2NUPA 1YZAA 4EHPA 3DM5A 3A9CA 2C04A 1BR1A 2KW3C 2XLOA 3VM6A 1QSPA 4LDRA 3T6GB 2A0UA 2L9JA 5EHHA 5HV9A 4PFPA 3MX3A 4MW8A 4W8PA 1VB5A 3AG1C 2R7UA 5K0IA 1HE1A 2ZXPA 4I44A 4ER9A 4A2NB 4G7HF 4JTDB 2EPLX 2HUJA 2KJGA 2X0CA 1RJ9B 2ZXRA 4CDAA 2EPMX 2YL0A 4L6RA 3RVZA 1MMGA 3DI5A 4A4AA 4D4XA 3RKOF 4LDKA 4YL1A 3H65A 1RJ9A 1A7EA 3HTKC 3US6A 3FXHA 5JT4A 4I1OB 1WOLA 4PJMA 4J7YA 4R32A 5D91A 3U2MA 3VYWA 2B0HA 4OIPF 3IPMO 2YKZA 1RKEB 2L6HA 3A11A 1Q0FA 4CIHA 1RKEA 1QPUA 2M64A 2HSQA 3CEXA 4FESA 1IW7F 1E2XA 1VMAA 1U0BB 1U6HA 2R7SA 3EGDB 3U0CA 1R5ID 1LM3B 4P9FA 1JPNA 1WN0A 1LS4A 3EGDA 5L0IA 2BC5A 3W2VA 2GA0A 4JC7A 1TWHA 4MS2A 3SXKA 2VCCA 3G4ZA 1LE2A 3TOMA 4RDAA 4J30B 1WGWA 2HSBA 2WL8A 3GM1A 1FFTC 1M6TA 1EKYA 2UUIA 3ZVRA 1ZU4A 1KTMA 3AQCA 2UUHA 1AUEA 5KYWB 1F1MA 4XLNF 2IYLD 2J9UA 4RD9A 4BJTA 1TKNA 1V55C 2AU5A 5JUAA 5KYWA 3WODF 5A6BD 2HS5A 4LLEA 3AG3C 3AGUA 4PJNA 3ZQYA 1MMDA 4U9DA 4CIPA 2XLEA 2OEVA 3UMHA 1NG1A 2XSEA 4YJWA 5CI9A 1QLEC 2QY9A 2MYSA 4WABA 1NBBA 1K05A 4XQ1A 4XEKA 2CNWA 2CCYA 2OJQA 2XM4A 3JRMO 3R7CA 3I4UA 3DXJF 5A69A 1NZEA 5JSLA 3CZ6A 1V4AA 4JRZA 3OEOA 2OEXA 2XLDA 3EHMA 4G0HA 4N06A 4XEFA 5BQGA 2YQYA 4E7SA 3V5ZA 2G3KA 1VK5A 1T6IA 1YDIA 3AGTA 2YZSA 3LESA 3U2LA 1JR8A 2LP4A 1R4TA 1LS1A 1Y4CA 4AL1A 3Q7GA 3W8HA 1FFHA 3EGXB 3QTHA 2D5RB 4NTBA 5JS5A 3S90A 3GORA 2A69F 1DOWA 3EGXA 3M79A 4PJLA 1NU7D 2YWAA 1YLMA 3U8PA 2HJ3A 4JJGA 1D1CA 2C03A 1GQAA 3EQLF 3EG9B 3GANA 4MW3A 4CS9C 3C8GD 4CDVA 3SYNA 5JVEA 4MVQA 4Z9HA 5F5HA 1TWGA 3HLZA 5KYYB 1GS9A 3EG9A 3L8JA 5T3TA 1A7DA 4EBKA 2A1DD 5DS4A 5KYYA 4ZLCA 4XEVA 5E2QA 3TD7A 4WGZA 3WHNA 4D4NA 5TJ5E 2IBFA 3ZTZA 3W4YA 3EFOB 2Y3DA 3JYYA 4OIQF 1BR4A 2TMVP 2P6VA 3EFOA 2W45A 3LUTB 5DQTA 4GYTA 2J0XA 1L3PA 4JE9A 5A6AA 2PNOA 5L0FA 4LERA 1PCXA 3UNGC 2VASA 1PV3A 1ZVZA 4P6IC 3B29A 3B0PA 4J7TA 3UMKA 2R7WA 2AWCA 3R2PA 2LIGA 2V26A 3AG4C 4JVSA 4FAPB 1OCZC 2Q00A 2WB7A 2P7VA 3NMJA 3K1HA 4NY3A 4IWBA 2HFIA 1MNDA 2ZXOA 1NLXA 3QW1A 3T6BA 5E3CA 2M4EA 1OW6A 3I5PA 4YN0B 2PF4E 1M2VA 1CPQA
chains in the Genus database with same CATH topology
1RKCA 2X0CA 3H2VA 3RF3A 2IBFA 5L0DA 4P9TA 1T01A 1QKRA 3TJ5A 1TR2A 1H6GA 1YDIA 2GWWA 2B0HA 5FZTA 4K1OA 3ZDLA 3S90A 4DJ9A 1RKEB 1ST6A 1L7CA 1DOWA 5L0FA 1RKEA 1ZVZA 1DOVA 2HSQA 3H2UA 1XWJA 1ZW2A 4ONSA 3MYIA 5L0GA 1U6HA 3TJ6A 4EHPA 2GDCA 2LQGA 5L0CA 3VF0A 3T6GB 5L0IA 1ZW3A 4W8PA 4E18A 5L0JA 4IGGA 2L7AA 4PR9A 1U89A 5L0HA 1SYQA 4E17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKC A;  2X0C A;  3H2V A;  3RF3 A;  2IBF A;  5L0D A;  4P9T A;  1T01 A;  1QKR A;  3TJ5 A;  1TR2 A;  1H6G A;  1YDI A;  2GWW A;  2B0H A;  5FZT A;  4K1O A;  3ZDL A;  3S90 A;  4DJ9 A;  1RKE B;  1ST6 A;  1L7C A;  1DOW A;  5L0F A;  1RKE A;  1ZVZ A;  1DOV A;  2HSQ A;  3H2U A;  1XWJ A;  1ZW2 A;  4ONS A;  3MYI A;  5L0G A;  1U6H A;  3TJ6 A;  4EHP A;  2GDC A;  2LQG A;  5L0C A;  3VF0 A;  3T6G B;  5L0I A;  1ZW3 A;  4W8P A;  4E18 A;  5L0J A;  4IGG A;  2L7A A;  4PR9 A;  1U89 A;  5L0H A;  1SYQ A;  4E17 A; 
#chains in the Genus database with same CATH topology
 3DE9 A;  4XWJ A;  1JRA A;  4N6C A;  5L3V A;  5EGY A;  5L0D A;  2IXN A;  3KYJ A;  1FTS A;  1T6U A;  3Q6N A;  3TJ5 A;  3FDQ A;  3TQO A;  4Z9I A;  5FCL A;  3NMI A;  4DJ9 A;  4OIN F;  1ZZP A;  1ORJ A;  5T1D B;  1CGM E;  3ZSU A;  4Q4Z F;  4U5H A;  3S84 A;  1OR2 A;  1WAS A;  2NUP B;  3Q6M A;  1EI7 A;  3S29 A;  5HSW A;  3FOP A;  5L3Q A;  2J8W A;  4G7Z F;  5D92 A;  3SNH A;  1VLT A;  2OKU A;  2LQG A;  2JD3 A;  2AVK A;  2HJM A;  2NUT B;  1YVI A;  4JEB A;  1OXB A;  2IM8 A;  3GEH A;  2CGE A;  3ABK C;  2NUT A;  5B3I A;  4KBL A;  4NTA A;  2L7A A;  2NPU A;  3NYM A;  3ATP A;  4QDL A;  3CQZ A;  5DVW A;  4N6H A;  5DQZ A;  1YAR O;  1C17 M;  3T6J A;  2J7P A;  4Q5S F;  3DKA A;  3ZWI A;  4YWQ A;  2XLM A;  1S7Z A;  4LLC A;  3V7O A;  3I5Q A;  4MND A;  4MTF A;  4IAQ A;  3VRC A;  4O6N A;  3FMS A;  3HNK A;  3GEE A;  4X0R A;  4KNW A;  4CBE A;  3L0I A;  4O79 A;  4C7O B;  1LE4 A;  5COG A;  1I4Z A;  4NC3 A;  1SR2 A;  2P0N A;  4C7O A;  4G7O F;  2J9W A;  2XLW A;  3QVY A;  2VCA A;  2HMQ A;  3ASO C;  1OKK A;  5GPG B;  1O87 A;  4DRH B;  2NSG A;  1BBH A;  2KK1 A;  3IQC A;  4O6M A;  5KYN A;  4CSA C;  1G4U S;  4JCH A;  3RQE A;  2R7O A;  3NRH A;  1BDJ B;  2H8A A;  2BE5 F;  2XL4 A;  3DMD A;  3PCV A;  1MNE A;  3QVZ A;  2VCB A;  1Q0K A;  5A6K A;  3C8Z A;  2XS8 A;  1SMY F;  5BQH A;  4AE4 B;  1D0Z A;  2EIL C;  1VYK A;  2R9R B;  1A7V A;  3FAJ A;  5KYU B;  3EHN A;  5E3A A;  1NSG B;  3MYF A;  4AE4 A;  1QVX A;  5KYU A;  3KMI A;  3B0U X;  1LI5 A;  2I15 A;  5F28 E;  4BEM J;  1OQC A;  2AWY A;  3GWN A;  1E83 A;  2ZPA A;  3GWL A;  2J46 A;  3KL4 A;  4U5G A;  1Z23 A;  1OCC C;  3IQT A;  3K1I A;  4XPW A;  4YL3 A;  4OD4 A;  3QW0 A;  1GGQ A;  4JKV A;  3U3F A;  1XWJ A;  1TFK B;  2HV6 A;  5L0G A;  3SEO A;  4FWV A;  2L6G A;  2MWQ A;  5B3S C;  1VLS A;  3PHF 2;  3MFN A;  5DS5 A;  2B0J A;  1CGN A;  3DZA A;  1E86 A;  2YLD A;  1G5Z A;  2L81 A;  4JIO A;  3LEV A;  3GOD A;  2XLV A;  4JUR I;  4HFK B;  4XPX A;  2R7Q A;  4KI2 A;  1XZP A;  1FNT c;  1M56 C;  3LJB A;  3RQF A;  1WTY A;  2J9B A;  1O3U A;  1H7I A;  1UG7 A;  2YRF A;  1J8Y F;  1Q0M A;  2Q9A A;  1MQV A;  3EH2 A;  3NYL A;  4GQH A;  4QI0 A;  2YEV A;  4JTA B;  3ABL C;  4PFO A;  5CIV A;  2VB6 A;  2NSF A;  2EPN A;  2W4B A;  4ANJ A;  1M57 C;  2DI3 A;  2WZG A;  3O10 A;  4BJ5 C;  2G62 A;  3CAX A;  2R02 A;  3G50 A;  2WZL A;  4CX9 A;  3J06 A;  3IHU A;  4IB4 A;  2R03 A;  4MVO A;  1K04 A;  3H2U A;  5BQI A;  4F4B A;  2QLA A;  2XL8 A;  4M63 A;  4YL0 A;  1YJG A;  1LKX A;  3JRT A;  4KC9 A;  5A6J A;  3GEI A;  1VTM P;  1HW2 A;  4EUK B;  1SF8 A;  2Y3B A;  3EH1 A;  1T9K A;  4CS8 A;  5T3W A;  4E7Z A;  1V74 B;  2JPU A;  3HKK A;  4CJG A;  3IQ5 A;  3TOL A;  1Q0G A;  4XLP F;  2LD6 A;  2YL1 A;  3ECS A;  3F47 A;  4IAO A;  3PDM P;  2AP3 A;  1OCO C;  3C62 A;  3DWW A;  3KKB A;  2KSF A;  1NU9 C;  2QTV A;  3TUL A;  4IAR A;  3NMK A;  3O6X A;  2NG1 A;  1KNY A;  2PBE A;  2CYD A;  4U9E A;  2EPO A;  1E84 A;  4K1O A;  1Z3I X;  2EIN C;  3RFY A;  1Q0D A;  1LI7 A;  2E87 A;  3JTL O;  3EJN A;  2H7O A;  2MHR A;  3LS1 A;  2FAP B;  1IZM A;  5EK0 A;  1KU2 A;  5DS6 A;  3M4B A;  4LDQ A;  5DLJ A;  3KH2 A;  4BG0 A;  4I3M A;  2QE9 A;  5L0C A;  4HFF B;  2QUP A;  4BPM A;  1Z6A A;  3U9J A;  1C03 A;  3JZ0 A;  3M15 A;  1O5H A;  1M2V B;  4DVY P;  5AC4 A;  1U89 A;  1HY5 A;  1MMA A;  2LK4 A;  4E17 A;  1EA8 A;  1ORY A;  3BRJ A;  3M1C B;  1ZHY A;  1OW8 A;  2H7V C;  4GEH A;  3Q7L A;  4HE8 D;  3T9O A;  2FGY A;  3DAG A;  3DJU B;  3M4C A;  3G4X A;  2RD9 A;  2W9Y A;  4Q7C A;  2EPK X;  1K40 A;  3KPH A;  1OW7 A;  2ZD9 A;  4H4K C;  3ZG1 A;  4C3B A;  4MVZ A;  5A6B A;  1D0X A;  3N2Z B;  3KYI A;  2ICW G;  2R05 A;  3RH3 A;  3WG7 C;  4EKW A;  1G8X A;  2PFD A;  2J45 A;  4YK5 A;  1UFB A;  2P1A A;  4LAC B;  2Y3G A;  3X1O A;  2IOQ A;  3K1I C;  1ZW2 A;  2YL3 A;  1T5O A;  2PX3 A;  1N1C A;  2A6E F;  2CDQ A;  2HMZ A;  1PD1 A;  2J0W A;  3L8I A;  4O6Y A;  3RYL A;  3TJ6 A;  3VF0 A;  3W8I A;  3LAY A;  3UMI A;  3T4R A;  2Q9C A;  4K0D A;  4U5F E;  1C02 A;  2O9X A;  3UGO A;  3BEH A;  1Y6D A;  4PR9 A;  1FMW A;  4MVM A;  2KNH A;  4XTK A;  1SYQ A;  3LLI A;  4IRU A;  3RVY A;  1QQ3 A;  2IXM A;  3HJC A;  1MMN A;  1Z5Z A;  3CSK A;  3AOU A;  5CI8 A;  1FAP B;  3LNR A;  2HZ8 A;  3QMK A;  3GM3 A;  1CPR A;  3F46 A;  4IJJ A;  2L6F A;  4H54 A;  3E70 C;  4KNV A;  3L1M A;  1H9G A;  4OIR F;  1BZ4 A;  4O7G A;  2GWW A;  3C18 A;  3K33 A;  4FX5 A;  2PP4 A;  1PD0 A;  4U5B E;  4W8K A;  4XPY A;  3LNM B;  4DBQ A;  4WGY A;  2IXO A;  4MTO A;  1G4W R;  3B71 A;  4C3D A;  1RMV A;  1JMW A;  2KYH A;  2H7B A;  3C8G B;  3IEE A;  1NFN A;  1DOV A;  1JAF A;  1M2O A;  3JCU Q;  4CJO A;  1WWP A;  1EQ1 A;  1TWA A;  2VH3 A;  3C8G A;  3LEO A;  4MTG A;  2R7X A;  1YA9 A;  4BJ6 A;  4YT2 A;  5B1A C;  1D1A A;  1AVO B;  1QZX A;  2RSE B;  2CW0 F;  2IXP A;  4EBJ A;  2A0B A;  4CS8 C;  4DRJ B;  4EWC A;  3UR3 C;  4JW1 A;  3O39 A;  3QZC A;  2D4U A;  2BL2 A;  2LSE A;  1B68 A;  1AEP A;  3FHD A;  3AQB A;  1ORS C;  4K7B A;  4YT5 A;  3DD7 A;  4AK9 A;  3GM2 A;  4QI2 A;  3S27 A;  2ZXW C;  4UDV A;  2GFH A;  2Q4F A;  2F22 A;  3SZR A;  2R7R A;  2DB4 A;  1SZI A;  4ZLD A;  3HNJ A;  2OG2 A;  3JT1 A;  1YZC A;  2JX0 A;  3L34 A;  2EIJ C;  4HEA J;  4YT4 A;  3K7D A;  2V3C C;  4PK4 A;  4I1M A;  4OIO F;  3C7J A;  1A0B A;  4JEA A;  2Q9B A;  2WVO A;  3OA1 A;  3DJN B;  1VYI A;  3MYI A;  3FAP B;  2YHS A;  3ZQV A;  2FFH A;  3UGP A;  1BR2 A;  2LFD A;  3JYH A;  4E0H A;  1YYX A;  2XRH A;  3MLG A;  3FVY A;  3SXZ A;  1D0Y A;  3E9V A;  2Y69 C;  4OD5 A;  2R25 A;  4JCZ A;  4N4W A;  1WAT A;  3H2V A;  3RF3 A;  1FR0 A;  1YA7 O;  2XLH A;  1JOG A;  3RIP A;  1OR3 A;  1HMO A;  3EZH A;  4JTC B;  3NG1 A;  1ZHZ A;  3RQG A;  1XZQ A;  3SXM A;  3AG2 C;  3ZIB A;  2QNL A;  4AL0 A;  2A6H F;  4ULW A;  2YLG A;  2OCC C;  2XL6 A;  1ZHT A;  1FMV A;  3W2W A;  3RW0 A;  3S28 A;  2WVN A;  3DAF A;  1A41 A;  1I5N A;  2DGJ A;  4RBN A;  4CS7 A;  5JLI A;  3S0X A;  1TWC A;  1V54 C;  1ZW3 A;  2EIK C;  2Y3H A;  2X51 A;  3HNI A;  1CGO A;  2KQ9 A;  4MQ9 F;  2Y39 A;  3S9O A;  3U3B A;  2DYS C;  3DE8 A;  3MBG A;  1QKR A;  4C3E A;  5L0H A;  3SP1 A;  3POV A;  3ZTM A;  4P9T A;  1T01 A;  2XXA B;  4U5D E;  4WJ0 A;  3U5S A;  2J7P D;  4AX2 A;  3K6B A;  2XXA A;  2YLI A;  5AGF A;  5F5F A;  3U9M A;  1GM5 A;  3N0T A;  2LCH A;  3NYJ A;  1ST6 A;  4U5C E;  3NDB B;  1LPE A;  2A68 F;  2KC3 A;  4DBR A;  1APC A;  4NCQ A;  4DXW A;  4JJF A;  4G78 A;  2ETS A;  1OCR C;  3U8V A;  1ZU5 A;  5COF A;  2R7V A;  3DM9 B;  1OKK D;  3EZI A;  4BJ6 C;  3JSE O;  5KYX B;  3O55 A;  1HW1 A;  5JRA A;  3ZC4 A;  5KYX A;  4E18 A;  5L0J A;  1Z7Q c;  4IGG A;  3TK0 A;  3NKD A;  2J9V A;  1HE9 A;  1ZYR F;  1JPJ A;  4PAC A;  3ITF A;  1RKC A;  3C63 A;  5JP7 A;  4B6I A;  1HMD A;  3WAQ A;  3ASN C;  4MVS A;  3ABM C;  4BEJ A;  1H6G A;  4EIY A;  1RXQ A;  1ZHW A;  4EBB A;  2DYR C;  1LVK A;  4NTF A;  5B1B C;  5FZT A;  3V5Y A;  1J8M F;  1TFO B;  4MVR A;  5IY5 C;  2PX0 A;  3FOO A;  3V5X A;  2KGO A;  2Q7R A;  3OWT A;  1TQG A;  2OJE D;  2Z15 A;  3NKE A;  4JZA A;  2HV7 A;  2W4M A;  2VC9 A;  5COM A;  4E0I A;  4YT8 A;  1E85 A;  3AJM A;  4ONS A;  2EIM C;  2HKV A;  1YYJ A;  1T6Q A;  2GDC A;  2OU6 A;  5AC5 A;  4BJ1 A;  4DVZ A;  4CSA A;  1VOM A;  3B9Q A;  3PMR A;  3X2Q C;  2WZF A;  4U5E E;  5E33 A;  4ULV A;  4DOZ A;  1I4Y A;  2OQM A;  1NFO A;  2XM0 A;  3LLK A;  2ASR A;  256B A;  2CNW D;  3B0V C;  3N24 A;  2WVQ A;  3JSZ A;  4MVU A;  2R7T A;  3K66 A;  1OXK A;  1Z63 A;  5BUO A;  3SXY A;  1D1B A;  2OOC A;  4CDY A;  2G3V A;  1W2W A;  4PJJ A;  1TR2 A;  2LFF A;  3HNL A;  4BJ5 A;  4J32 B;  1LIH A;  2XS1 A;  4NQF A;  2P61 A;  3IQ6 A;  2YVK A;  1RCP A;  3VAY A;  1S05 A;  3ZDL A;  4Z9J A;  3EPV A;  1L7C A;  4DRI B;  2GAQ A;  1H9T A;  2I8B A;  1YAU O;  4CS9 A;  3LS0 A;  2Q3T A;  2YL7 A;  1ZHX A;  2NUP A;  1YZA A;  4EHP A;  3DM5 A;  3A9C A;  2C04 A;  1BR1 A;  2KW3 C;  2XLO A;  3VM6 A;  1QSP A;  4LDR A;  3T6G B;  2A0U A;  2L9J A;  5EHH A;  5HV9 A;  4PFP A;  3MX3 A;  4MW8 A;  4W8P A;  1VB5 A;  3AG1 C;  2R7U A;  5K0I A;  1HE1 A;  2ZXP A;  4I44 A;  4ER9 A;  4A2N B;  4G7H F;  4JTD B;  2EPL X;  2HUJ A;  2KJG A;  2X0C A;  1RJ9 B;  2ZXR A;  4CDA A;  2EPM X;  2YL0 A;  4L6R A;  3RVZ A;  1MMG A;  3DI5 A;  4A4A A;  4D4X A;  3RKO F;  4LDK A;  4YL1 A;  3H65 A;  1RJ9 A;  1A7E A;  3HTK C;  3US6 A;  3FXH A;  5JT4 A;  4I1O B;  1WOL A;  4PJM A;  4J7Y A;  4R32 A;  5D91 A;  3U2M A;  3VYW A;  2B0H A;  4OIP F;  3IPM O;  2YKZ A;  1RKE B;  2L6H A;  3A11 A;  1Q0F A;  4CIH A;  1RKE A;  1QPU A;  2M64 A;  2HSQ A;  3CEX A;  4FES A;  1IW7 F;  1E2X A;  1VMA A;  1U0B B;  1U6H A;  2R7S A;  3EGD B;  3U0C A;  1R5I D;  1LM3 B;  4P9F A;  1JPN A;  1WN0 A;  1LS4 A;  3EGD A;  5L0I A;  2BC5 A;  3W2V A;  2GA0 A;  4JC7 A;  1TWH A;  4MS2 A;  3SXK A;  2VCC A;  3G4Z A;  1LE2 A;  3TOM A;  4RDA A;  4J30 B;  1WGW A;  2HSB A;  2WL8 A;  3GM1 A;  1FFT C;  1M6T A;  1EKY A;  2UUI A;  3ZVR A;  1ZU4 A;  1KTM A;  3AQC A;  2UUH A;  1AUE A;  5KYW B;  1F1M A;  4XLN F;  2IYL D;  2J9U A;  4RD9 A;  4BJT A;  1TKN A;  1V55 C;  2AU5 A;  5JUA A;  5KYW A;  3WOD F;  5A6B D;  2HS5 A;  4LLE A;  3AG3 C;  3AGU A;  4PJN A;  3ZQY A;  1MMD A;  4U9D A;  4CIP A;  2XLE A;  2OEV A;  3UMH A;  1NG1 A;  2XSE A;  4YJW A;  5CI9 A;  1QLE C;  2QY9 A;  2MYS A;  4WAB A;  1NBB A;  1K05 A;  4XQ1 A;  4XEK A;  2CNW A;  2CCY A;  2OJQ A;  2XM4 A;  3JRM O;  3R7C A;  3I4U A;  3DXJ F;  5A69 A;  1NZE A;  5JSL A;  3CZ6 A;  1V4A A;  4JRZ A;  3OEO A;  2OEX A;  2XLD A;  3EHM A;  4G0H A;  4N06 A;  4XEF A;  5BQG A;  2YQY A;  4E7S A;  3V5Z A;  2G3K A;  1VK5 A;  1T6I A;  1YDI A;  3AGT A;  2YZS A;  3LES A;  3U2L A;  1JR8 A;  2LP4 A;  1R4T A;  1LS1 A;  1Y4C A;  4AL1 A;  3Q7G A;  3W8H A;  1FFH A;  3EGX B;  3QTH A;  2D5R B;  4NTB A;  5JS5 A;  3S90 A;  3GOR A;  2A69 F;  1DOW A;  3EGX A;  3M79 A;  4PJL A;  1NU7 D;  2YWA A;  1YLM A;  3U8P A;  2HJ3 A;  4JJG A;  1D1C A;  2C03 A;  1GQA A;  3EQL F;  3EG9 B;  3GAN A;  4MW3 A;  4CS9 C;  3C8G D;  4CDV A;  3SYN A;  5JVE A;  4MVQ A;  4Z9H A;  5F5H A;  1TWG A;  3HLZ A;  5KYY B;  1GS9 A;  3EG9 A;  3L8J A;  5T3T A;  1A7D A;  4EBK A;  2A1D D;  5DS4 A;  5KYY A;  4ZLC A;  4XEV A;  5E2Q A;  3TD7 A;  4WGZ A;  3WHN A;  4D4N A;  5TJ5 E;  2IBF A;  3ZTZ A;  3W4Y A;  3EFO B;  2Y3D A;  3JYY A;  4OIQ F;  1BR4 A;  2TMV P;  2P6V A;  3EFO A;  2W45 A;  3LUT B;  5DQT A;  4GYT A;  2J0X A;  1L3P A;  4JE9 A;  5A6A A;  2PNO A;  5L0F A;  4LER A;  1PCX A;  3UNG C;  2VAS A;  1PV3 A;  1ZVZ A;  4P6I C;  3B29 A;  3B0P A;  4J7T A;  3UMK A;  2R7W A;  2AWC A;  3R2P A;  2LIG A;  2V26 A;  3AG4 C;  4JVS A;  4FAP B;  1OCZ C;  2Q00 A;  2WB7 A;  2P7V A;  3NMJ A;  3K1H A;  4NY3 A;  4IWB A;  2HFI A;  1MND A;  2ZXO A;  1NLX A;  3QW1 A;  3T6B A;  5E3C A;  2M4E A;  1OW6 A;  3I5P A;  4YN0 B;  2PF4 E;  1M2V A;  1CPQ A; 
#chains in the Genus database with same CATH homology
 1RKC A;  2X0C A;  3H2V A;  3RF3 A;  2IBF A;  5L0D A;  4P9T A;  1T01 A;  1QKR A;  3TJ5 A;  1TR2 A;  1H6G A;  1YDI A;  2GWW A;  2B0H A;  5FZT A;  4K1O A;  3ZDL A;  3S90 A;  4DJ9 A;  1RKE B;  1ST6 A;  1L7C A;  1DOW A;  5L0F A;  1RKE A;  1ZVZ A;  1DOV A;  2HSQ A;  3H2U A;  1XWJ A;  1ZW2 A;  4ONS A;  3MYI A;  5L0G A;  1U6H A;  3TJ6 A;  4EHP A;  2GDC A;  2LQG A;  5L0C A;  3VF0 A;  3T6G B;  5L0I A;  1ZW3 A;  4W8P A;  4E18 A;  5L0J A;  4IGG A;  2L7A A;  4PR9 A;  1U89 A;  5L0H A;  1SYQ A;  4E17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...