1RKCA

Human vinculin head (1-258) in complex with talin's vinculin binding site 3 (residues 1944-1969)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
258
structure length
258
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vinculin activation by talin through helical bundle conversion
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords Vinculin
total genus 86
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2003-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1rkcA01
3MYIA 1QKRA 4K1OA 2X0CA 3TJ5A 1L7CA 2L7AA 2LQGA 3RF3A 5L0FA 1RKEB 3H2VA 1T01A 1ZW3A 4DJ9A 5L0CA 3S90A 1U89A 4W8PA 1TR2A 2GDCA 2HSQA 3T6GB 2IBFA 3TJ6A 2B0HA 4ONSA 1XWJA 3H2UA 4E18A 1RKEA 4E17A 5L0GA 3VF0A 1RKCA 4IGGA 5L0DA 4PR9A 2GWWA 5L0HA 1DOVA 4P9TA 1YDIA 1ZVZA 4EHPA 1DOWA 5L0JA 5FZTA 1U6HA 5L0IA 1SYQA 1ZW2A 3ZDLA 1ST6A 1H6GA
chains in the Genus database with same CATH superfamily
2W45A 4LLCA 3KKBA 4XPXA 4N4WA 1K05A 3AG4C 3O55A 3U8VA 2YVKA 2A6HF 3SXZA 4AL0A 2LK4A 3U2MA 2HMZA 3H2VA 3JT1A 4J30B 3EGXA 5L0CA 1D1AA 4P9FA 1E86A 5HV9A 3O39A 4NY3A 3SZRA 3NKDA 5JRAA 2CCYA 3NMIA 1KNYA 2GFHA 2PX0A 1Q0GA 5BUOA 4G7HF 4WABA 4IB4A 1H9GA 2A1DD 2HUJA 2CW0F 3S0XA 2XXAB 2HSBA 4I1MA 2VH3A 3DMDA 4F4BA 3NYMA 4U5FE 3B29A 4LERA 1B68A 4PR9A 1RJ9A 5BQIA 5L0HA 3ASOC 4I1OB 4A2NB 4KC9A 4CS7A 5B3IA 3FAPB 4KNVA 4JTAB 4OD4A 4PACA 1FFTC 4JJFA 4MVOA 3ZWIA 3BEHA 2YHSA 3MLGA 3TK0A 2J46A 1YZAA 5JSLA 1GGQA 2XRHA 4EBKA 4ER9A 5DQTA 3EFOB 2YRFA 3KL4A 2H7BA 5COMA 4CJOA 2MYSA 1G4US 1BR2A 3UMIA 4CSAA 4PJJA 4MQ9F 4BJ5C 1TFOB 2QE9A 4MVZA 4JE9A 2HMQA 2CGEA 2OOCA 3GEEA 3C7JA 1I4ZA 5F5FA 1YA7O 3QVYA 5KYYA 1FMVA 3QMKA 4JTDB 2R7XA 4PFOA 1YJGA 3CEXA 3VF0A 1MNDA 1T6IA 2HV6A 3GORA 3AJMA 4C3DA 3X2QC 1D0YA 1WOLA 1Z63A 3U3BA 4A4AA 3PDMP 3TQOA 1U0BB 5DQZA 1G5ZA 1VYKA 1ZU5A 2LSEA 3HNKA 4ULWA 1EKYA 4U5BE 2WVQA 3SXYA 3FOPA 3ZDLA 1FAPB 2OJED 3B0PA 3DI5A 4CS8C 4E18A 3S29A 1OR2A 5B1BC 4HFKB 3RF3A 2L7AA 3U5SA 3JYHA 3LAYA 2ICWG 5L0FA 1G4WR 4FWVA 1C02A 1Z7Qc 3B0UX 3DAFA 2G62A 2J0XA 3EG9A 3LNMB 3A9CA 2M64A 3EHNA 3F46A 1YARO 1LIHA 3U9MA 2WL8A 1V55C 1ZHYA 2Y3HA 4NCQA 4ZLCA 3IQ5A 2XS1A 1TWGA 3EG9B 2EIJC 4JJGA 1EQ1A 3EJNA 2YLGA 3CQZA 1Z3IX 2EILC 2VCAA 4K7BA 1BZ4A 1OCCC 3QW1A 3TULA 2WVNA 2XM4A 3CSKA 2A68F 3K33A 3U3FA 4JEAA 1S7ZA 4U5CE 2R7RA 4W8KA 1HE9A 2Q7RA 1U6HA 4EIYA 3WODF 2VB6A 2PNOA 1HY5A 4RDAA 1GQAA 4QI0A 4YWQA 3ABMC 4D4NA 3MYIA 2X0CA 4E7SA 2YL0A 4HE8D 3ZQYA 4OIPF 1CPRA 4AL1A 4HFFB 1PCXA 2J9BA 3M1CB 5L3QA 2C03A 4J7TA 5GPGB 4U9EA 4BJ1A 2Y3GA 5JS5A 4W8PA 3K1IA 1Z23A 3JSZA 2V3CC 3C63A 2IBFA 4GQHA 2KW3C 3IPMO 4JEBA 4U9DA 3T6BA 1BR4A 3RYLA 4E17A 3EGDA 4GYTA 4PJLA 1VB5A 4NC3A 1JMWA 5DS5A 4XPYA 2HJ3A 3DWWA 1LKXA 1T6UA 3VRCA 4P9TA 3L8JA 5IY5C 5FZTA 1JOGA 1SMYF 4YT2A 2AP3A 4JKVA 3LS1A 4YT5A 4DRJB 2LP4A 2YWAA 1NFNA 5KYNA 1LI5A 2AWCA 2OEXA 4DOZA 3J06A 1OW7A 1APCA 2ZXPA 5COFA 5AGFA 3FOOA 4XPWA 1KU2A 1VLSA 3MX3A 2J0WA 1YLMA 1TKNA 4N06A 1ZHZA 3HNLA 4XWJA 2XL4A 2XLOA 4NTFA 2EINC 1XZPA 2Q3TA 1XWJA 4NQFA 2JPUA 1RKEA 2R05A 3V5ZA 5BQHA 2V26A 4JW1A 3RKOF 4UDVA 1KTMA 2WZGA 2LCHA 3RQEA 4B6IA 4EKWA 2NPUA 4YT8A 3JZ0A 1QPUA 4IAQA 1V54C 2L6GA 3S28A 4C7OB 4NTBA 1DOVA 1MMDA 5L0JA 3B0VC 2J7PA 5FCLA 3Q7GA 5KYXB 2TMVP 1A41A 2R7OA 1M56C 1CPQA 2G3KA 3Q7LA 4CSAC 3US6A 2YL3A 1ST6A 2L6FA 1RMVA 1YVIA 3ZIBA 1MQVA 1JAFA 3QTHA 1V74B 1ZHWA 3NMJA 1NU9C 5CI9A 2R7TA 2CYDA 5JLIA 1WWPA 2F22A 1AEPA 1LI7A 3ASNC 3HTKC 3LUTB 4MW3A 1OW8A 2R7QA 3F47A 4Z9HA 3U8PA 5EHHA 2A6EF 4E0IA 1M6TA 1SZIA 1TR2A 2GDCA 3IQTA 2D4UA 2YLIA 2EPNA 1D1BA 4G78A 2OU6A 3KMIA 4PFPA 2Y39A 5AC5A 1C17M 1NLXA 1OCRC 3AQCA 4EBJA 5T3WA 1A7DA 1T6QA 1Q0FA 5AC4A 4ZLDA 2GA0A 2Q9AA 2W4BA 1NFOA 3V7OA 3GEHA 3GM3A 4DBQA 1E85A 3UR3C 3QVZA 2LFFA 2NSGA 1UG7A 3NG1A 1FNTc 5E3CA 4H54A 5A6BD 4AE4A 5CIVA 4GEHA 1PD0A 2QNLA 5JVEA 3RW0A 5K0IA 1YZCA 1FTSA 1ORJA 3EZHA 1U89A 4Q4ZF 2JD3A 1CGME 3G4ZA 1T9KA 1TWHA 1OCZC 3DXJF 4G7ZF 1WN0A 2QY9A 4JIOA 5L0GA 3I4UA 2RSEB 3RQGA 1LE4A 1XZQA 4JVSA 4OIOF 1PV3A 2WZLA 2AVKA 3LESA 2ZD9A 2EPOA 2Q00A 4JURI 4LDKA 1QLEC 4PK4A 1ZZPA 1ZU4A 2HV7A 2Y69C 3L34A 5BQGA 2FFHA 3SEOA 3DKAA 2XLMA 3EFOA 3VYWA 3W2WA 3AGTA 2R7SA 3FDQA 3EH1A 2HZ8A 1VTMP 2HFIA 5E2QA 2EPMX 3SXMA 1QZXA 4BEJA 3AQBA 2NUPB 2LQGA 1RKEB 4RD9A 1QQ3A 2P1AA 1NU7D 1E83A 4C3EA 4O6MA 1Y4CA 4FESA 1T5OA 2O9XA 4JCHA 2BC5A 4ULVA 3WAQA 4EWCA 3Q6MA 4CIPA 4AE4B 3FHDA 1FR0A 3OEOA 3U0CA 3GEIA 3IHUA 4J32B 2IXOA 1VLTA 2XLHA 1OXKA 4K0DA 1E2XA 3O10A 3T6JA 2CNWD 2XS8A 2X51A 2DYRC 2OEVA 2OQMA 2R25A 4WGYA 4AX2A 3DM9B 4PJNA 5F28E 2KK1A 3ABKC 4MNDA 4CDAA 4DVZA 1GM5A 4CS9C 3VAYA 4IARA 3B9QA 4KI2A 3FAJA 1YYJA 1ZW2A 1MNEA 3N2ZB 5F5HA 2BL2A 4JC7A 3EPVA 1CGNA 3QZCA 4L6RA 4Z9IA 2EIMC 2I15A 2WB7A 3EQLF 4XLNF 3ZC4A 2VASA 2R03A 3T9OA 2EPLX 1LS4A 3GM2A 3UGPA 4DJ9A 3S90A 5DVWA 3T4RA 3ECSA 4P6IC 1D0ZA 2XLDA 1AVOB 2YZSA 1OKKA 1QVXA 3M4CA 3NMKA 1M2VA 1TQGA 4I44A 4OIQF 3E70C 3IEEA 2IXMA 3UMKA 1MMAA 1V4AA 1G8XA 3HJCA 4X0RA 3C8GA 256BA 2Q4FA 4XEFA 1LVKA 3JRMO 5T1DB 5KYXA 2AWYA 1R4TA 3A11A 2EPKX 5A6JA 3M4BA 1IZMA 4Q5SF 3U9JA 5EK0A 2MHRA 2FGYA 2IXNA 2PX3A 5L3VA 2DI3A 3EH2A 1OCOC 2IXPA 2XL8A 4CBEA 2R7UA 3GWLA 1NSGB 2YEVA 1NBBA 1Q0KA 3TJ5A 3C62A 1CGOA 4WJ0A 1VMAA 2YL7A 4IAOA 1LPEA 3JTLO 3GODA 1HMOA 4BJ6A 2KC3A 3PCVA 3GM1A 5A6AA 2HKVA 4BPMA 2HSQA 2J45A 4BJTA 4IRUA 4RBNA 3HNJA 4I3MA 4XEVA 3OWTA 1SF8A 1WASA 1O3UA 2PBEA 4IWBA 2H8AA 1ORYA 2W4MA 4LDRA 1AUEA 3IQ6A 2P7VA 4OD5A 5TJ5E 4EHPA 5KYUB 2OJQA 1LS1A 3MYFA 3JSEO 3TOMA 5A69A 2XXAA 4FX5A 4Q7CA 2FAPB 4LACB 5DLJA 2P61A 5HSWA 2IYLD 5E3AA 2D5RB 3MFNA 3WG7C 1L7CA 1A0BA 2CDQA 3AGUA 4M63A 4O79A 4U5EE 3LJBA 2KGOA 3KH2A 4JZAA 5KYYB 3POVA 3G50A 5A6BA 3M15A 3L8IA 3K7DA 3ITFA 3TOLA 5DS6A 3EZIA 3H2UA 1FMWA 4KNWA 2ETSA 3ZQVA 1YA9A 3K66A 2L81A 3HKKA 5L0DA 3K6BA 3K1HA 2BE5F 5JUAA 3QW0A 3DE9A 2HS5A 2A69F 3EHMA 1YDIA 1ZVZA 1NZEA 2YL1A 4MVRA 3PHF2 1J8YF 1K40A 1EI7A 1NG1A 2C04A 2UUIA 3NYJA 3LLIA 1RJ9B 2EIKC 4Z9JA 3G4XA 2ZPAA 1I4YA 4XQ1A 5KYUA 3SNHA 3V5XA 1JPJA 4J7YA 3JCUQ 3RQFA 4BJ5A 2Q9BA 3DE8A 4G0HA 4MTFA 1YYXA 3C8ZA 1MMNA 5E33A 2QLAA 2ASRA 3ZTMA 4CIHA 1WGWA 1M2VB 3W2VA 1HMDA 4OIRF 2ZXWC 2NUPA 1A7EA 2R02A 4DBRA 3IQCA 5D91A 2J9WA 4WGZA 3T6GB 2XLWA 3TJ6A 3EGXB 1OKKD 4CDVA 2B0HA 2PFDA 2PP4A 2NUTA 5A6KA 3C18A 5COGA 4DRHB 4XTKA 3FMSA 4N6HA 4LDQA 1D1CA 2A0BA 4IGGA 3JYYA 1PD1A 3GWNA 4MS2A 2L6HA 2WZFA 2CNWA 3N0TA 3V5YA 1OR3A 3DZAA 3K1IC 3ATPA 1OXBA 1BBHA 1H6GA 3AG1C 3UMHA 4ANJA 2Y3DA 3L1MA 4QI2A 4YL0A 3LEVA 4MVQA 4MTOA 4XEKA 4O6YA 2OG2A 3KYIA 3NDBB 5KYWA 4YN0B 2NG1A 3CZ6A 3RIPA 2Z15A 3L0IA 3EGDB 4YK5A 4DXWA 4DVYP 1VYIA 1W2WA 1BR1A 2I8BA 2LFDA 2RD9A 2P0NA 1O87A 3DD7A 2ZXRA 3RH3A 3KYJA 1R5ID 2B0JA 4EUKB 1RKCA 2NSFA 4HEAJ 5B1AC 1YAUO 3RVZA 2GWWA 2WVOA 1ZHTA 5T3TA 4BJ6C 4AK9A 3DJUB 3UNGC 4BG0A 1OW6A 1WATA 4CDYA 1HW2A 2KNHA 1SYQA 4BEMJ 2UUHA 3C8GB 1Z6AA 1VOMA 2YLDA 3KPHA 1M57C 3RVYA 2Q9CA 1A7VA 1EA8A 4CX9A 2QUPA 1O5HA 1ZHXA 1E84A 5CI8A 3ZG1A 3NKEA 3E9VA 2KYHA 1F1MA 4U5DE 1ZW3A 2XM0A 4LLEA 3R2PA 2J9VA 1TWCA 2W9YA 3CAXA 1TFKB 2J9UA 1ORSC 2H7VC 4CS8A 1IW7F 5B3SC 3S9OA 1BDJB 3ABLC 3X1OA 2JX0A 5KYWB 4PJMA 2XLEA 3ZVRA 3NRHA 3FVYA 3NYLA 4MVUA 2AU5A 1UFBA 1Z5ZA 2H7OA 3JRTA 4MW8A 5D92A 1Y6DA 3DM5A 3Q6NA 4MVSA 2R9RB 4U5GA 3W8HA 4DRIB 2KQ9A 4E7ZA 5L0IA 1N1CA 2M4EA 2XSEA 1Q0DA 1JPNA 4FAPB 1MMGA 2XLVA 1JRAA 3S27A 3U2LA 5JT4A 1VK5A 2DYSC 3AOUA 3SXKA 2IOQA 2LIGA 2MWQA 1I5NA 1K04A 1FFHA 2J7PD 2NUTB 4KBLA 4YL3A 1QSPA 3M79A 4MTGA 3PMRA 4OINF 3LNRA 4U5HA 3TD7A 1JR8A 4EBBA 4D4XA 3I5PA 4O6NA 1S05A 3S84A 2OKUA 4YL1A 3W8IA 1HW1A 2KSFA 1GS9A 1LE2A 4XLPF 2Y3BA 3ZTZA 1D0XA 2R7VA 1WTYA 2R7WA 1TWAA 2A0UA 2IM8A 3WHNA 2VCCA 4R32A 3O6XA 2OCCC 2XL6A 2DGJA 1SR2A 4NTAA 3SYNA 3N24A 4O7GA 1L3PA 3SP1A 2PF4E 4C7OA 2LD6A 3HLZA 4YJWA 1QKRA 2HJMA 4K1OA 4E0HA 5EGYA 2QTVA 4JCZA 1RCPA 2J8WA 3FXHA 2VC9A 4QDLA 1RXQA 1H7IA 3DAGA 3GANA 3AG3C 3LS0A 4N6CA 1T01A 5JP7A 1J8MF 3W4YA 3VM6A 3C8GD 4MVMA 2DB4A 4IJJA 4JTCB 4YT4A 1ZYRF 2YKZA 2L9JA 2VCBA 3B71A 3MBGA 3R7CA 4C3BA 3DJNB 1H9TA 1M2OA 4ONSA 2G3VA 3UGOA 1LM3B 2E87A 2P6VA 4CS9A 3LEOA 2KJGA 4H4KC 1OQCA 3H65A 3OA1A 3HNIA 3I5QA 2ZXOA 3ZSUA 3LLKA 3AG2C 1C03A 5DS4A 1DOWA 2YQYA 4CJGA 4G7OF 2GAQA 4JRZA 3RFYA 1HE1A 3BRJA 1Q0MA
chains in the Genus database with same CATH topology
3MYIA 1QKRA 4K1OA 2X0CA 3TJ5A 1L7CA 2L7AA 2LQGA 3RF3A 5L0FA 1RKEB 3H2VA 1T01A 1ZW3A 4DJ9A 5L0CA 3S90A 1U89A 4W8PA 1TR2A 2GDCA 2HSQA 3T6GB 2IBFA 3TJ6A 2B0HA 4ONSA 1XWJA 3H2UA 4E18A 1RKEA 4E17A 5L0GA 3VF0A 1RKCA 4IGGA 5L0DA 4PR9A 2GWWA 5L0HA 1DOVA 4P9TA 1YDIA 1ZVZA 4EHPA 1DOWA 5L0JA 5FZTA 1U6HA 5L0IA 1SYQA 1ZW2A 3ZDLA 1ST6A 1H6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYI A;  1QKR A;  4K1O A;  2X0C A;  3TJ5 A;  1L7C A;  2L7A A;  2LQG A;  3RF3 A;  5L0F A;  1RKE B;  3H2V A;  1T01 A;  1ZW3 A;  4DJ9 A;  5L0C A;  3S90 A;  1U89 A;  4W8P A;  1TR2 A;  2GDC A;  2HSQ A;  3T6G B;  2IBF A;  3TJ6 A;  2B0H A;  4ONS A;  1XWJ A;  3H2U A;  4E18 A;  1RKE A;  4E17 A;  5L0G A;  3VF0 A;  1RKC A;  4IGG A;  5L0D A;  4PR9 A;  2GWW A;  5L0H A;  1DOV A;  4P9T A;  1YDI A;  1ZVZ A;  4EHP A;  1DOW A;  5L0J A;  5FZT A;  1U6H A;  5L0I A;  1SYQ A;  1ZW2 A;  3ZDL A;  1ST6 A;  1H6G A; 
#chains in the Genus database with same CATH topology
 2W45 A;  4LLC A;  3KKB A;  4XPX A;  4N4W A;  1K05 A;  3AG4 C;  3O55 A;  3U8V A;  2YVK A;  2A6H F;  3SXZ A;  4AL0 A;  2LK4 A;  3U2M A;  2HMZ A;  3H2V A;  3JT1 A;  4J30 B;  3EGX A;  5L0C A;  1D1A A;  4P9F A;  1E86 A;  5HV9 A;  3O39 A;  4NY3 A;  3SZR A;  3NKD A;  5JRA A;  2CCY A;  3NMI A;  1KNY A;  2GFH A;  2PX0 A;  1Q0G A;  5BUO A;  4G7H F;  4WAB A;  4IB4 A;  1H9G A;  2A1D D;  2HUJ A;  2CW0 F;  3S0X A;  2XXA B;  2HSB A;  4I1M A;  2VH3 A;  3DMD A;  4F4B A;  3NYM A;  4U5F E;  3B29 A;  4LER A;  1B68 A;  4PR9 A;  1RJ9 A;  5BQI A;  5L0H A;  3ASO C;  4I1O B;  4A2N B;  4KC9 A;  4CS7 A;  5B3I A;  3FAP B;  4KNV A;  4JTA B;  4OD4 A;  4PAC A;  1FFT C;  4JJF A;  4MVO A;  3ZWI A;  3BEH A;  2YHS A;  3MLG A;  3TK0 A;  2J46 A;  1YZA A;  5JSL A;  1GGQ A;  2XRH A;  4EBK A;  4ER9 A;  5DQT A;  3EFO B;  2YRF A;  3KL4 A;  2H7B A;  5COM A;  4CJO A;  2MYS A;  1G4U S;  1BR2 A;  3UMI A;  4CSA A;  4PJJ A;  4MQ9 F;  4BJ5 C;  1TFO B;  2QE9 A;  4MVZ A;  4JE9 A;  2HMQ A;  2CGE A;  2OOC A;  3GEE A;  3C7J A;  1I4Z A;  5F5F A;  1YA7 O;  3QVY A;  5KYY A;  1FMV A;  3QMK A;  4JTD B;  2R7X A;  4PFO A;  1YJG A;  3CEX A;  3VF0 A;  1MND A;  1T6I A;  2HV6 A;  3GOR A;  3AJM A;  4C3D A;  3X2Q C;  1D0Y A;  1WOL A;  1Z63 A;  3U3B A;  4A4A A;  3PDM P;  3TQO A;  1U0B B;  5DQZ A;  1G5Z A;  1VYK A;  1ZU5 A;  2LSE A;  3HNK A;  4ULW A;  1EKY A;  4U5B E;  2WVQ A;  3SXY A;  3FOP A;  3ZDL A;  1FAP B;  2OJE D;  3B0P A;  3DI5 A;  4CS8 C;  4E18 A;  3S29 A;  1OR2 A;  5B1B C;  4HFK B;  3RF3 A;  2L7A A;  3U5S A;  3JYH A;  3LAY A;  2ICW G;  5L0F A;  1G4W R;  4FWV A;  1C02 A;  1Z7Q c;  3B0U X;  3DAF A;  2G62 A;  2J0X A;  3EG9 A;  3LNM B;  3A9C A;  2M64 A;  3EHN A;  3F46 A;  1YAR O;  1LIH A;  3U9M A;  2WL8 A;  1V55 C;  1ZHY A;  2Y3H A;  4NCQ A;  4ZLC A;  3IQ5 A;  2XS1 A;  1TWG A;  3EG9 B;  2EIJ C;  4JJG A;  1EQ1 A;  3EJN A;  2YLG A;  3CQZ A;  1Z3I X;  2EIL C;  2VCA A;  4K7B A;  1BZ4 A;  1OCC C;  3QW1 A;  3TUL A;  2WVN A;  2XM4 A;  3CSK A;  2A68 F;  3K33 A;  3U3F A;  4JEA A;  1S7Z A;  4U5C E;  2R7R A;  4W8K A;  1HE9 A;  2Q7R A;  1U6H A;  4EIY A;  3WOD F;  2VB6 A;  2PNO A;  1HY5 A;  4RDA A;  1GQA A;  4QI0 A;  4YWQ A;  3ABM C;  4D4N A;  3MYI A;  2X0C A;  4E7S A;  2YL0 A;  4HE8 D;  3ZQY A;  4OIP F;  1CPR A;  4AL1 A;  4HFF B;  1PCX A;  2J9B A;  3M1C B;  5L3Q A;  2C03 A;  4J7T A;  5GPG B;  4U9E A;  4BJ1 A;  2Y3G A;  5JS5 A;  4W8P A;  3K1I A;  1Z23 A;  3JSZ A;  2V3C C;  3C63 A;  2IBF A;  4GQH A;  2KW3 C;  3IPM O;  4JEB A;  4U9D A;  3T6B A;  1BR4 A;  3RYL A;  4E17 A;  3EGD A;  4GYT A;  4PJL A;  1VB5 A;  4NC3 A;  1JMW A;  5DS5 A;  4XPY A;  2HJ3 A;  3DWW A;  1LKX A;  1T6U A;  3VRC A;  4P9T A;  3L8J A;  5IY5 C;  5FZT A;  1JOG A;  1SMY F;  4YT2 A;  2AP3 A;  4JKV A;  3LS1 A;  4YT5 A;  4DRJ B;  2LP4 A;  2YWA A;  1NFN A;  5KYN A;  1LI5 A;  2AWC A;  2OEX A;  4DOZ A;  3J06 A;  1OW7 A;  1APC A;  2ZXP A;  5COF A;  5AGF A;  3FOO A;  4XPW A;  1KU2 A;  1VLS A;  3MX3 A;  2J0W A;  1YLM A;  1TKN A;  4N06 A;  1ZHZ A;  3HNL A;  4XWJ A;  2XL4 A;  2XLO A;  4NTF A;  2EIN C;  1XZP A;  2Q3T A;  1XWJ A;  4NQF A;  2JPU A;  1RKE A;  2R05 A;  3V5Z A;  5BQH A;  2V26 A;  4JW1 A;  3RKO F;  4UDV A;  1KTM A;  2WZG A;  2LCH A;  3RQE A;  4B6I A;  4EKW A;  2NPU A;  4YT8 A;  3JZ0 A;  1QPU A;  4IAQ A;  1V54 C;  2L6G A;  3S28 A;  4C7O B;  4NTB A;  1DOV A;  1MMD A;  5L0J A;  3B0V C;  2J7P A;  5FCL A;  3Q7G A;  5KYX B;  2TMV P;  1A41 A;  2R7O A;  1M56 C;  1CPQ A;  2G3K A;  3Q7L A;  4CSA C;  3US6 A;  2YL3 A;  1ST6 A;  2L6F A;  1RMV A;  1YVI A;  3ZIB A;  1MQV A;  1JAF A;  3QTH A;  1V74 B;  1ZHW A;  3NMJ A;  1NU9 C;  5CI9 A;  2R7T A;  2CYD A;  5JLI A;  1WWP A;  2F22 A;  1AEP A;  1LI7 A;  3ASN C;  3HTK C;  3LUT B;  4MW3 A;  1OW8 A;  2R7Q A;  3F47 A;  4Z9H A;  3U8P A;  5EHH A;  2A6E F;  4E0I A;  1M6T A;  1SZI A;  1TR2 A;  2GDC A;  3IQT A;  2D4U A;  2YLI A;  2EPN A;  1D1B A;  4G78 A;  2OU6 A;  3KMI A;  4PFP A;  2Y39 A;  5AC5 A;  1C17 M;  1NLX A;  1OCR C;  3AQC A;  4EBJ A;  5T3W A;  1A7D A;  1T6Q A;  1Q0F A;  5AC4 A;  4ZLD A;  2GA0 A;  2Q9A A;  2W4B A;  1NFO A;  3V7O A;  3GEH A;  3GM3 A;  4DBQ A;  1E85 A;  3UR3 C;  3QVZ A;  2LFF A;  2NSG A;  1UG7 A;  3NG1 A;  1FNT c;  5E3C A;  4H54 A;  5A6B D;  4AE4 A;  5CIV A;  4GEH A;  1PD0 A;  2QNL A;  5JVE A;  3RW0 A;  5K0I A;  1YZC A;  1FTS A;  1ORJ A;  3EZH A;  1U89 A;  4Q4Z F;  2JD3 A;  1CGM E;  3G4Z A;  1T9K A;  1TWH A;  1OCZ C;  3DXJ F;  4G7Z F;  1WN0 A;  2QY9 A;  4JIO A;  5L0G A;  3I4U A;  2RSE B;  3RQG A;  1LE4 A;  1XZQ A;  4JVS A;  4OIO F;  1PV3 A;  2WZL A;  2AVK A;  3LES A;  2ZD9 A;  2EPO A;  2Q00 A;  4JUR I;  4LDK A;  1QLE C;  4PK4 A;  1ZZP A;  1ZU4 A;  2HV7 A;  2Y69 C;  3L34 A;  5BQG A;  2FFH A;  3SEO A;  3DKA A;  2XLM A;  3EFO A;  3VYW A;  3W2W A;  3AGT A;  2R7S A;  3FDQ A;  3EH1 A;  2HZ8 A;  1VTM P;  2HFI A;  5E2Q A;  2EPM X;  3SXM A;  1QZX A;  4BEJ A;  3AQB A;  2NUP B;  2LQG A;  1RKE B;  4RD9 A;  1QQ3 A;  2P1A A;  1NU7 D;  1E83 A;  4C3E A;  4O6M A;  1Y4C A;  4FES A;  1T5O A;  2O9X A;  4JCH A;  2BC5 A;  4ULV A;  3WAQ A;  4EWC A;  3Q6M A;  4CIP A;  4AE4 B;  3FHD A;  1FR0 A;  3OEO A;  3U0C A;  3GEI A;  3IHU A;  4J32 B;  2IXO A;  1VLT A;  2XLH A;  1OXK A;  4K0D A;  1E2X A;  3O10 A;  3T6J A;  2CNW D;  2XS8 A;  2X51 A;  2DYR C;  2OEV A;  2OQM A;  2R25 A;  4WGY A;  4AX2 A;  3DM9 B;  4PJN A;  5F28 E;  2KK1 A;  3ABK C;  4MND A;  4CDA A;  4DVZ A;  1GM5 A;  4CS9 C;  3VAY A;  4IAR A;  3B9Q A;  4KI2 A;  3FAJ A;  1YYJ A;  1ZW2 A;  1MNE A;  3N2Z B;  5F5H A;  2BL2 A;  4JC7 A;  3EPV A;  1CGN A;  3QZC A;  4L6R A;  4Z9I A;  2EIM C;  2I15 A;  2WB7 A;  3EQL F;  4XLN F;  3ZC4 A;  2VAS A;  2R03 A;  3T9O A;  2EPL X;  1LS4 A;  3GM2 A;  3UGP A;  4DJ9 A;  3S90 A;  5DVW A;  3T4R A;  3ECS A;  4P6I C;  1D0Z A;  2XLD A;  1AVO B;  2YZS A;  1OKK A;  1QVX A;  3M4C A;  3NMK A;  1M2V A;  1TQG A;  4I44 A;  4OIQ F;  3E70 C;  3IEE A;  2IXM A;  3UMK A;  1MMA A;  1V4A A;  1G8X A;  3HJC A;  4X0R A;  3C8G A;  256B A;  2Q4F A;  4XEF A;  1LVK A;  3JRM O;  5T1D B;  5KYX A;  2AWY A;  1R4T A;  3A11 A;  2EPK X;  5A6J A;  3M4B A;  1IZM A;  4Q5S F;  3U9J A;  5EK0 A;  2MHR A;  2FGY A;  2IXN A;  2PX3 A;  5L3V A;  2DI3 A;  3EH2 A;  1OCO C;  2IXP A;  2XL8 A;  4CBE A;  2R7U A;  3GWL A;  1NSG B;  2YEV A;  1NBB A;  1Q0K A;  3TJ5 A;  3C62 A;  1CGO A;  4WJ0 A;  1VMA A;  2YL7 A;  4IAO A;  1LPE A;  3JTL O;  3GOD A;  1HMO A;  4BJ6 A;  2KC3 A;  3PCV A;  3GM1 A;  5A6A A;  2HKV A;  4BPM A;  2HSQ A;  2J45 A;  4BJT A;  4IRU A;  4RBN A;  3HNJ A;  4I3M A;  4XEV A;  3OWT A;  1SF8 A;  1WAS A;  1O3U A;  2PBE A;  4IWB A;  2H8A A;  1ORY A;  2W4M A;  4LDR A;  1AUE A;  3IQ6 A;  2P7V A;  4OD5 A;  5TJ5 E;  4EHP A;  5KYU B;  2OJQ A;  1LS1 A;  3MYF A;  3JSE O;  3TOM A;  5A69 A;  2XXA A;  4FX5 A;  4Q7C A;  2FAP B;  4LAC B;  5DLJ A;  2P61 A;  5HSW A;  2IYL D;  5E3A A;  2D5R B;  3MFN A;  3WG7 C;  1L7C A;  1A0B A;  2CDQ A;  3AGU A;  4M63 A;  4O79 A;  4U5E E;  3LJB A;  2KGO A;  3KH2 A;  4JZA A;  5KYY B;  3POV A;  3G50 A;  5A6B A;  3M15 A;  3L8I A;  3K7D A;  3ITF A;  3TOL A;  5DS6 A;  3EZI A;  3H2U A;  1FMW A;  4KNW A;  2ETS A;  3ZQV A;  1YA9 A;  3K66 A;  2L81 A;  3HKK A;  5L0D A;  3K6B A;  3K1H A;  2BE5 F;  5JUA A;  3QW0 A;  3DE9 A;  2HS5 A;  2A69 F;  3EHM A;  1YDI A;  1ZVZ A;  1NZE A;  2YL1 A;  4MVR A;  3PHF 2;  1J8Y F;  1K40 A;  1EI7 A;  1NG1 A;  2C04 A;  2UUI A;  3NYJ A;  3LLI A;  1RJ9 B;  2EIK C;  4Z9J A;  3G4X A;  2ZPA A;  1I4Y A;  4XQ1 A;  5KYU A;  3SNH A;  3V5X A;  1JPJ A;  4J7Y A;  3JCU Q;  3RQF A;  4BJ5 A;  2Q9B A;  3DE8 A;  4G0H A;  4MTF A;  1YYX A;  3C8Z A;  1MMN A;  5E33 A;  2QLA A;  2ASR A;  3ZTM A;  4CIH A;  1WGW A;  1M2V B;  3W2V A;  1HMD A;  4OIR F;  2ZXW C;  2NUP A;  1A7E A;  2R02 A;  4DBR A;  3IQC A;  5D91 A;  2J9W A;  4WGZ A;  3T6G B;  2XLW A;  3TJ6 A;  3EGX B;  1OKK D;  4CDV A;  2B0H A;  2PFD A;  2PP4 A;  2NUT A;  5A6K A;  3C18 A;  5COG A;  4DRH B;  4XTK A;  3FMS A;  4N6H A;  4LDQ A;  1D1C A;  2A0B A;  4IGG A;  3JYY A;  1PD1 A;  3GWN A;  4MS2 A;  2L6H A;  2WZF A;  2CNW A;  3N0T A;  3V5Y A;  1OR3 A;  3DZA A;  3K1I C;  3ATP A;  1OXB A;  1BBH A;  1H6G A;  3AG1 C;  3UMH A;  4ANJ A;  2Y3D A;  3L1M A;  4QI2 A;  4YL0 A;  3LEV A;  4MVQ A;  4MTO A;  4XEK A;  4O6Y A;  2OG2 A;  3KYI A;  3NDB B;  5KYW A;  4YN0 B;  2NG1 A;  3CZ6 A;  3RIP A;  2Z15 A;  3L0I A;  3EGD B;  4YK5 A;  4DXW A;  4DVY P;  1VYI A;  1W2W A;  1BR1 A;  2I8B A;  2LFD A;  2RD9 A;  2P0N A;  1O87 A;  3DD7 A;  2ZXR A;  3RH3 A;  3KYJ A;  1R5I D;  2B0J A;  4EUK B;  1RKC A;  2NSF A;  4HEA J;  5B1A C;  1YAU O;  3RVZ A;  2GWW A;  2WVO A;  1ZHT A;  5T3T A;  4BJ6 C;  4AK9 A;  3DJU B;  3UNG C;  4BG0 A;  1OW6 A;  1WAT A;  4CDY A;  1HW2 A;  2KNH A;  1SYQ A;  4BEM J;  2UUH A;  3C8G B;  1Z6A A;  1VOM A;  2YLD A;  3KPH A;  1M57 C;  3RVY A;  2Q9C A;  1A7V A;  1EA8 A;  4CX9 A;  2QUP A;  1O5H A;  1ZHX A;  1E84 A;  5CI8 A;  3ZG1 A;  3NKE A;  3E9V A;  2KYH A;  1F1M A;  4U5D E;  1ZW3 A;  2XM0 A;  4LLE A;  3R2P A;  2J9V A;  1TWC A;  2W9Y A;  3CAX A;  1TFK B;  2J9U A;  1ORS C;  2H7V C;  4CS8 A;  1IW7 F;  5B3S C;  3S9O A;  1BDJ B;  3ABL C;  3X1O A;  2JX0 A;  5KYW B;  4PJM A;  2XLE A;  3ZVR A;  3NRH A;  3FVY A;  3NYL A;  4MVU A;  2AU5 A;  1UFB A;  1Z5Z A;  2H7O A;  3JRT A;  4MW8 A;  5D92 A;  1Y6D A;  3DM5 A;  3Q6N A;  4MVS A;  2R9R B;  4U5G A;  3W8H A;  4DRI B;  2KQ9 A;  4E7Z A;  5L0I A;  1N1C A;  2M4E A;  2XSE A;  1Q0D A;  1JPN A;  4FAP B;  1MMG A;  2XLV A;  1JRA A;  3S27 A;  3U2L A;  5JT4 A;  1VK5 A;  2DYS C;  3AOU A;  3SXK A;  2IOQ A;  2LIG A;  2MWQ A;  1I5N A;  1K04 A;  1FFH A;  2J7P D;  2NUT B;  4KBL A;  4YL3 A;  1QSP A;  3M79 A;  4MTG A;  3PMR A;  4OIN F;  3LNR A;  4U5H A;  3TD7 A;  1JR8 A;  4EBB A;  4D4X A;  3I5P A;  4O6N A;  1S05 A;  3S84 A;  2OKU A;  4YL1 A;  3W8I A;  1HW1 A;  2KSF A;  1GS9 A;  1LE2 A;  4XLP F;  2Y3B A;  3ZTZ A;  1D0X A;  2R7V A;  1WTY A;  2R7W A;  1TWA A;  2A0U A;  2IM8 A;  3WHN A;  2VCC A;  4R32 A;  3O6X A;  2OCC C;  2XL6 A;  2DGJ A;  1SR2 A;  4NTA A;  3SYN A;  3N24 A;  4O7G A;  1L3P A;  3SP1 A;  2PF4 E;  4C7O A;  2LD6 A;  3HLZ A;  4YJW A;  1QKR A;  2HJM A;  4K1O A;  4E0H A;  5EGY A;  2QTV A;  4JCZ A;  1RCP A;  2J8W A;  3FXH A;  2VC9 A;  4QDL A;  1RXQ A;  1H7I A;  3DAG A;  3GAN A;  3AG3 C;  3LS0 A;  4N6C A;  1T01 A;  5JP7 A;  1J8M F;  3W4Y A;  3VM6 A;  3C8G D;  4MVM A;  2DB4 A;  4IJJ A;  4JTC B;  4YT4 A;  1ZYR F;  2YKZ A;  2L9J A;  2VCB A;  3B71 A;  3MBG A;  3R7C A;  4C3B A;  3DJN B;  1H9T A;  1M2O A;  4ONS A;  2G3V A;  3UGO A;  1LM3 B;  2E87 A;  2P6V A;  4CS9 A;  3LEO A;  2KJG A;  4H4K C;  1OQC A;  3H65 A;  3OA1 A;  3HNI A;  3I5Q A;  2ZXO A;  3ZSU A;  3LLK A;  3AG2 C;  1C03 A;  5DS4 A;  1DOW A;  2YQY A;  4CJG A;  4G7O F;  2GAQ A;  4JRZ A;  3RFY A;  1HE1 A;  3BRJ A;  1Q0M A; 
#chains in the Genus database with same CATH homology
 3MYI A;  1QKR A;  4K1O A;  2X0C A;  3TJ5 A;  1L7C A;  2L7A A;  2LQG A;  3RF3 A;  5L0F A;  1RKE B;  3H2V A;  1T01 A;  1ZW3 A;  4DJ9 A;  5L0C A;  3S90 A;  1U89 A;  4W8P A;  1TR2 A;  2GDC A;  2HSQ A;  3T6G B;  2IBF A;  3TJ6 A;  2B0H A;  4ONS A;  1XWJ A;  3H2U A;  4E18 A;  1RKE A;  4E17 A;  5L0G A;  3VF0 A;  1RKC A;  4IGG A;  5L0D A;  4PR9 A;  2GWW A;  5L0H A;  1DOV A;  4P9T A;  1YDI A;  1ZVZ A;  4EHP A;  1DOW A;  5L0J A;  5FZT A;  1U6H A;  5L0I A;  1SYQ A;  1ZW2 A;  3ZDL A;  1ST6 A;  1H6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...