1YZAA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) with the n-terminal helix unfolded
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Redesigned apo-cytochrome b562
publication title Specific non-native hydrophobic interactions in a hidden folding intermediate: implication for protein folding
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yzaA00
5JT4A 3ZTZA 2YL7A 3VRCA 1NBBA 1BBHA 3L1MA 4U9DA 256BA 3TOLA 3M79A 4CJGA 4WGZA 5AGFA 1EKYA 3FOOA 3NMIA 1CPQA 3TOMA 1YYXA 3ZQVA 5JLIA 4IARA 1YZCA 4N6HA 3FOPA 2YKZA 3IQ6A 4CDAA 4CX9A 3IQ5A 3ZWIA 3QVZA 3NMJA 3HNKA 3U8PA 4D4XA 2XL6A 1E86A 2YLGA 3QVYA 5JP7A 4EIYA 1YZAA 1E84A 1CGNA 4JEAA 1S05A 5B3IA 4CJOA 3NMKA 2BC5A 1YYJA 3DE8A 1E85A 5JSLA 1MQVA 4JKVA 3QW1A 4L6RA 3M15A 3M4BA 3C63A 5JS5A 1QQ3A 1CPRA 2YLIA 1GQAA 4NC3A 1CGOA 3HNJA 2YL0A 4JE9A 2XLHA 3ZTMA 1RCPA 2CCYA 3M4CA 5JRAA 3C62A 4ER9A 4CIPA 1E83A 5JVEA 2J8WA 3QW0A 3ZQYA 2XLEA 3HNLA 1M6TA 2XL8A 1QPUA 1A7VA 4U9EA 2XM0A 1LM3B 4IAQA 4IB4A 2QLAA 4CDVA 2XLWA 2XLDA 3DE9A 4ULVA 2YLDA 4CDYA 4D4NA 1JAFA 2XM4A 2YL3A 2J9BA 4N4WA 4JEBA 2XLOA 2XLVA 4WGYA 3HNIA 1APCA 5JUAA 2XLMA 2YL1A
chains in the Genus database with same CATH superfamily
5JT4A 4PJNA 4Z9HA 3DMDA 4M63A 2Q4FA 4DRIB 4EWCA 2FFHA 2ZD9A 3VRCA 1H6GA 1BBHA 1MMNA 2AWCA 3FMSA 3G50A 3JCUQ 2XS8A 3Q6NA 1Q0KA 2H8AA 2HSQA 1C03A 1FTSA 2YHSA 3EH2A 5F5FA 4QI2A 3RVYA 2R7VA 1OKKA 2P1AA 1HMDA 2CW0F 1RJ9A 3UR3C 1WATA 1WWPA 4PJMA 4U5DE 1PD1A 1NU7D 2LIGA 3CQZA 5COFA 4YL3A 4EBBA 3EGXA 4EHPA 4ZLDA 3F47A 3C8GD 4ZLCA 4BJ1A 5JLIA 2VH3A 5T1DB 1T9KA 4IARA 4AX2A 3SXZA 1JPNA 3IPMO 1CGME 2O9XA 1QVXA 1BDJB 2A6EF 3IQ6A 3EPVA 3MBGA 1HE1A 4HEAJ 3S29A 3EH1A 2LD6A 4P6IC 5F5HA 2V26A 4YWQA 1KTMA 1ORYA 4O6NA 2L7AA 3UMHA 3NMJA 3L0IA 2YEVA 2HJ3A 3F46A 3C18A 2YQYA 1I5NA 4PFOA 1VMAA 1ZZPA 3U8PA 3FVYA 3EFOA 2CYDA 2YLGA 1Q0DA 4MTGA 3GEHA 2HKVA 2R25A 5E33A 5BQHA 3NYLA 1Q0MA 3JYYA 4CS8C 5L0HA 3A11A 3TULA 5COMA 3GM3A 2R9RB 2HV6A 2LSEA 5KYYB 4DBRA 3K33A 4K7BA 1VK5A 2B0HA 1E85A 2L6GA 1I4YA 1NZEA 5DS4A 1FAPB 2PF4E 5BUOA 4CSAC 5FCLA 1KNYA 2AWYA 4U5EE 5L0CA 1Z23A 3T6GB 2ZPAA 4XEVA 2XXAA 2J9WA 2J0WA 1IZMA 4MVQA 2DI3A 2J9VA 2DYSC 1H7IA 3OWTA 3RFYA 1UFBA 2X0CA 2L6FA 2A6HF 1QQ3A 3HTKC 3KMIA 3V7OA 2QTVA 2Y3BA 4NTFA 5KYUA 1CPRA 3DAFA 4MVRA 1Z7Qc 3UMIA 3DD7A 4BPMA 1F1MA 1TWGA 1OKKD 3IEEA 5L0JA 2GFHA 1IW7F 2HJMA 4JJGA 4F4BA 1M57C 1WN0A 2RD9A 3HNJA 1Y6DA 5D92A 4YT2A 2IXNA 2ASRA 1LS4A 1Z5ZA 2NG1A 2XLHA 4NTAA 1RCPA 3M4CA 4HFFB 5BQGA 5EHHA 5JRAA 3C62A 3H65A 1QZXA 2W45A 4O6YA 4CS8A 2OEXA 5KYXB 2FGYA 3ATPA 5AC5A 5JVEA 1JR8A 2J8WA 3AQCA 3BRJA 3QW0A 3FDQA 5DQTA 2VCAA 2JX0A 4FWVA 4MNDA 3WAQA 4KBLA 3E70C 1M6TA 1ZVZA 3AG2C 4NTBA 4U9EA 3DM5A 1J8YF 2A0BA 2I15A 1RKEA 1M2VA 2EIMC 2F22A 1QSPA 2HV7A 2X51A 3M1CB 4FX5A 4PJLA 4PK4A 1OQCA 3IHUA 1LI7A 4CSAA 4YT8A 2A69F 4KNWA 3JSZA 4NQFA 1EI7A 1LPEA 3B9QA 1ZHYA 3S84A 1PV3A 1EA8A 5D91A 3O10A 4BEMJ 3DE9A 3LESA 1V55C 4D4NA 3EJNA 3MX3A 2HMQA 1YDIA 2EPNA 2OG2A 4KC9A 2MHRA 3JT1A 3LJBA 3QTHA 4XWJA 3U0CA 3RW0A 2WZLA 2HZ8A 3EQLF 1TQGA 5JUAA 4G0HA 3RYLA 2NUTA 3BEHA 2Z15A 1EQ1A 2ETSA 1ZYRF 2G3VA 1FNTc 1O87A 4GEHA 2YL1A 4RD9A 4CIHA 3PDMP 3ASOC 3VYWA 3JSEO 3T6JA 5E3AA 1D0YA 3V5YA 1SR2A 2R7WA 3QMKA 1MMAA 3S9OA 1T6UA 3O6XA 1YLMA 4NY3A 4D4XA 4E18A 3CAXA 2A68F 4U9DA 4XPWA 4KNVA 5DLJA 3DWWA 1MNEA 3S90A 4J7YA 3TOLA 3M79A 4PFPA 1U0BB 1LE4A 4DVYP 2M64A 2C04A 3K66A 3ITFA 2HS5A 5DQZA 1MNDA 4U5BE 1O5HA 3NMIA 1CPQA 2WVOA 1YYXA 4XPXA 4Z9JA 3ZQVA 1OCCC 3MLGA 3SP1A 3G4ZA 1YZCA 4C3BA 5KYWA 5B1AC 5K0IA 4OIRF 5L0GA 4MW8A 3U2MA 4P9TA 4R32A 3HLZA 3ZWIA 3U9JA 5L3VA 2R03A 2FAPB 4N06A 2NUPA 2KQ9A 4FESA 4XPYA 1ORSC 2ZXRA 3U9MA 1Z3IX 3UNGC 3EG9B 3IQTA 2M4EA 2XL6A 4AE4A 3UGPA 3WG7C 1YAUO 1LE2A 1G4WR 3H2VA 2R7UA 4EIYA 1YZAA 3MFNA 1E84A 3RQEA 2EIKC 2Q9AA 1FFHA 1CGNA 4CS7A 3RQFA 1S05A 4YT4A 3DM9B 3S28A 4CJOA 2BE5F 1VYIA 1LS1A 3LEVA 4JRZA 5EGYA 1SYQA 2XS1A 3DJNB 2A1DD 4G78A 1MQVA 3KYJA 3HJCA 1LKXA 2ICWG 4J30B 3L34A 4MVUA 4L6RA 1UG7A 1D1CA 3LNMB 1BZ4A 4JW1A 1OCZC 4I3MA 5IY5C 3PCVA 2HSBA 4J32B 3FHDA 5L0DA 3GANA 1GM5A 2OCCC 4BJ6C 3NYJA 1RJ9B 3DXJF 2Q7RA 3O39A 1GQAA 4NC3A 3EGXB 5HV9A 1CGOA 4CS9C 4W8KA 1HW2A 2WZFA 4QDLA 3UGOA 4G7ZF 2YL0A 3NYMA 4LACB 2CCYA 5KYNA 3H2UA 4C3EA 2J46A 2QNLA 3L8IA 3EGDA 1LI5A 3WHNA 2VB6A 3ZQYA 2WZGA 3W8HA 4HE8D 3W2VA 2ZXOA 3HNLA 2EPKX 3ECSA 1A7VA 3ABLC 3EZHA 4DRJB 4DVZA 4EKWA 1B68A 2XM0A 3LNRA 1D1AA 1LM3B 1K05A 2OEVA 1SMYF 2VCBA 3T9OA 4IAQA 3ZSUA 3WODF 4EBKA 4C7OA 2J0XA 2H7OA 2IOQA 2A0UA 4IB4A 2QLAA 5T3TA 1SF8A 3HKKA 2XLWA 2XLDA 3ASNC 2YLDA 3MYIA 4JURI 1TWAA 3VAYA 2GA0A 4BJ6A 4H4KC 3ZC4A 3W4YA 3DI5A 3VF0A 3TJ5A 3X2QC 4EBJA 2JPUA 2XM4A 3Q6MA 3GM1A 2YL3A 2GWWA 1FMWA 4JIOA 4CS9A 1HY5A 1O3UA 3TQOA 2XXAB 1NFNA 1VTMP 3J06A 1K04A 2XLVA 4WABA 2WL8A 4WGYA 2GDCA 3U3FA 1TWHA 2JD3A 2XLMA 5COGA 5E2QA 2IXMA 2R7SA 4DJ9A 3CEXA 2VASA 5B1BC 2RSEB 5DS6A 1RMVA 2E87A 2ZXWC 2YRFA 1AUEA 3C8ZA 3R7CA 5KYUB 3OEOA 3DZAA 1OW6A 3G4XA 3GORA 1RXQA 3ZTZA 4E0HA 2AU5A 1YARO 2OU6A 4O7GA 2YL7A 3Q7LA 1NBBA 4JTDB 3X1OA 2YZSA 3B0PA 1T01A 2WVQA 3GEEA 3L1MA 4LLCA 5L3QA 4KI2A 1ZHWA 1PD0A 256BA 2Q9CA 3N24A 4U5HA 1H9GA 4A2NB 3L8JA 2WB7A 3NKEA 1C17M 4I44A 4J7TA 5AC4A 3I5QA 2W4MA 4PR9A 4FAPB 2H7VC 2IM8A 3AQBA 1TR2A 4WGZA 2PP4A 5A6BA 4OIQF 1EKYA 2MYSA 1NU9C 3K6BA 3DAGA 3TD7A 3TOMA 3IQCA 1T6QA 1XZQA 1JRAA 2AP3A 4N6HA 1RKEB 1M2VB 2EILC 3NDBB 1R5ID 4E7ZA 1H9TA 3ABMC 3SEOA 4XLPF 1C02A 4MVSA 3SNHA 1QKRA 2XSEA 3IQ5A 2EPLX 4CX9A 2QUPA 3PMRA 4N6CA 1M56C 1OXKA 3HNKA 3OA1A 3RVZA 3RQGA 3QVYA 2WVNA 3JRMO 1WGWA 5JP7A 3LS0A 3T6BA 1OCRC 4PJJA 3LS1A 1A41A 4H54A 1ORJA 2Y3DA 2LCHA 1BR2A 3R2PA 4JEAA 3W2WA 5B3IA 1ZHXA 3NMKA 4Q4ZF 1DOWA 2W9YA 2CNWD 1V54C 1YYJA 2L6HA 2OOCA 3C8GB 2Q3TA 3DE8A 2LK4A 3Q7GA 4JTCB 2KYHA 4MS2A 4OINF 2QE9A 2D4UA 4XLNF 2Q9BA 2LFFA 2ZXPA 2HUJA 1Z6AA 2R05A 3QW1A 3B29A 3GWLA 4X0RA 3M15A 5L0IA 4BJTA 2R7XA 1AEPA 3C63A 2LFDA 2DYRC 3U8VA 4XTKA 2NSGA 2PX3A 4ONSA 4EUKB 1NLXA 4K1OA 2P0NA 5FZTA 1T5OA 2XRHA 4JVSA 1QLEC 2HMZA 3B71A 4JJFA 2NPUA 4OIOF 2NSFA 3MYFA 3VM6A 3KPHA 3RH3A 3I4UA 1LIHA 2I8BA 4AL0A 4DBQA 1FR0A 1M2OA 4LLEA 2J45A 2R7QA 1XWJA 5A6BD 1U89A 3SXYA 5KYWB 4JCZA 4MVMA 3U3BA 2J7PA 1G4US 3SXMA 1AVOB 2LP4A 2GAQA 4JC7A 1E83A 3JYHA 3C7JA 4O6MA 4BJ5C 2OJQA 3EHMA 3ZIBA 2CGEA 2DGJA 4QI0A 2XLEA 2NUPB 2XL8A 3SZRA 2QY9A 3O55A 4IRUA 4OD4A 2Y3GA 4AE4B 3PHF2 4PACA 4G7HF 1VLTA 3AGUA 4LERA 1Y4CA 3B0VC 3K1IC 2C03A 3S27A 4YL1A 3RF3A 3LEOA 2KGOA 2KJGA 2YWAA 3LLIA 3EZIA 2W4BA 3QZCA 3DKAA 4CDVA 3K7DA 1ST6A 4UDVA 2P6VA 4BG0A 3A9CA 1KU2A 1JAFA 1XZPA 1ZHTA 4Q7CA 4DOZA 4ANJA 1A7EA 5B3SC 2G3KA 5KYYA 3JRTA 2XLOA 3EHNA 1L7CA 1I4ZA 4XEFA 4YK5A 1HMOA 4K0DA 3SYNA 4IJJA 4IGGA 5A69A 1FMVA 2EIJC 1TFOB 2IXOA 2R02A 2J9UA 1GGQA 2KNHA 3GWNA 4DXWA 3FAPB 4OIPF 1OCOC 3N2ZB 1ZW3A 3EFOB 4BJ5A 4E17A 3FAJA 2HFIA 1HW1A 1TWCA 2MWQA 1JPJA 5A6JA 1BR4A 1VB5A 1VLSA 3NG1A 4ULWA 2UUHA 1OXBA 2R7RA 1VOMA 1JOGA 3AG3C 5CI8A 1WOLA 2VC9A 1GS9A 3K1IA 4MVZA 4BEJA 4JCHA 4Q5SF 2J7PD 1D0ZA 2EPOA 3EGDB 2OQMA 1W2WA 2LQGA 4CJGA 5AGFA 3LUTB 1OR2A 2D5RB 3FOOA 5EK0A 3E9VA 1OW7A 3UMKA 3V5XA 3W8IA 4JZAA 1TKNA 5GPGB 5A6AA 2CNWA 2VCCA 3NKDA 3GEIA 3FOPA 4LDRA 2YKZA 4C3DA 4CDAA 3FXHA 5KYXA 2Q00A 4GYTA 1A7DA 2AVKA 3K1HA 3US6A 4NCQA 2EPMX 3B0UX 4MTFA 4C7OB 4YJWA 3QVZA 3V5ZA 4A4AA 5BQIA 3AJMA 2L9JA 1E86A 3CZ6A 3GM2A 2V3CC 2P61A 1WASA 1ZU5A 4MTOA 1G5ZA 3CSKA 3LAYA 2TMVP 1S7ZA 3I5PA 4JTAB 2G62A 1SZIA 4GQHA 3KH2A 2BL2A 3AGTA 5T3WA 4RDAA 2BC5A 5JSLA 5DVWA 2YVKA 4IWBA 1NSGB 2PNOA 4JKVA 1OW8A 4LDQA 3TK0A 3POVA 3KKBA 4MQ9F 3JZ0A 4YN0B 1BR1A 5E3CA 2R7OA 2OKUA 1YA9A 1VYKA 3M4BA 3JTLO 3T4RA 4DRHB 1ZHZA 1TFKB 2KSFA 2Y69C 4E0IA 5CIVA 2L81A 3ZG1A 2Y3HA 5JS5A 1J8MF 1OR3A 5HSWA 1WTYA 3ZDLA 2CDQA 2B0JA 2YLIA 4WJ0A 4MW3A 2UUIA 3AG4C 2XL4A 1YJGA 1G8XA 1LVKA 1R4TA 3KL4A 1DOVA 1D1BA 4AL1A 1HE9A 1Q0GA 2PFDA 1JMWA 1NG1A 1A0BA 1MMDA 1ZW2A 3AOUA 4JE9A 5F28E 3ZTMA 4I1OB 1FFTC 3ZVRA 2DB4A 2IXPA 4I1MA 3U5SA 2KK1A 3N0TA 1E2XA 1MMGA 2NUTB 4Z9IA 4OD5A 4XEKA 4ER9A 4CIPA 1L3PA 3C8GA 2KC3A 3AG1C 3GODA 3RIPA 3S0XA 4MVOA 1Z63A 4IAOA 2IBFA 2PBEA 4RBNA 3RKOF 1QPUA 4CBEA 3KYIA 4U5CE 2R7TA 4E7SA 4P9FA 2PX0A 3SXKA 4YT5A 1ZU4A 4B6IA 2KW3C 1N1CA 5CI9A 1Q0FA 1D0XA 3EG9A 1YA7O 3ABKC 3LLKA 3NRHA 3DJUB 4U5FE 3U2LA 2IYLD 4ULVA 2OJED 5A6KA 4CDYA 4G7OF 1U6HA 1PCXA 1NFOA 4AK9A 1RKCA 4HFKB 2H7BA 4W8PA 2Y39A 1V74B 4XQ1A 2J9BA 5DS5A 4N4WA 4JEBA 1K40A 4U5GA 4LDKA 3HNIA 1APCA 1YVIA 2EINC 4YL0A 5TJ5E 5L0FA 1V4AA 1T6IA 4O79A 3TJ6A 2P7VA
chains in the Genus database with same CATH topology
5JT4A 3ZTZA 2YL7A 3VRCA 1NBBA 1BBHA 3L1MA 4U9DA 256BA 3TOLA 3M79A 4CJGA 4WGZA 5AGFA 1EKYA 3FOOA 3NMIA 1CPQA 3TOMA 1YYXA 3ZQVA 5JLIA 4IARA 1YZCA 4N6HA 3FOPA 2YKZA 3IQ6A 4CDAA 4CX9A 3IQ5A 3ZWIA 3QVZA 3NMJA 3HNKA 3U8PA 4D4XA 2XL6A 1E86A 2YLGA 3QVYA 5JP7A 4EIYA 1YZAA 1E84A 1CGNA 4JEAA 1S05A 5B3IA 4CJOA 3NMKA 2BC5A 1YYJA 3DE8A 1E85A 5JSLA 1MQVA 4JKVA 3QW1A 4L6RA 3M15A 3M4BA 3C63A 5JS5A 1QQ3A 1CPRA 2YLIA 1GQAA 4NC3A 1CGOA 3HNJA 2YL0A 4JE9A 2XLHA 3ZTMA 1RCPA 2CCYA 3M4CA 5JRAA 3C62A 4ER9A 4CIPA 1E83A 5JVEA 2J8WA 3QW0A 3ZQYA 2XLEA 3HNLA 1M6TA 2XL8A 1QPUA 1A7VA 4U9EA 2XM0A 1LM3B 4IAQA 4IB4A 2QLAA 4CDVA 2XLWA 2XLDA 3DE9A 4ULVA 2YLDA 4CDYA 4D4NA 1JAFA 2XM4A 2YL3A 2J9BA 4N4WA 4JEBA 2XLOA 2XLVA 4WGYA 3HNIA 1APCA 5JUAA 2XLMA 2YL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JT4 A;  3ZTZ A;  2YL7 A;  3VRC A;  1NBB A;  1BBH A;  3L1M A;  4U9D A;  256B A;  3TOL A;  3M79 A;  4CJG A;  4WGZ A;  5AGF A;  1EKY A;  3FOO A;  3NMI A;  1CPQ A;  3TOM A;  1YYX A;  3ZQV A;  5JLI A;  4IAR A;  1YZC A;  4N6H A;  3FOP A;  2YKZ A;  3IQ6 A;  4CDA A;  4CX9 A;  3IQ5 A;  3ZWI A;  3QVZ A;  3NMJ A;  3HNK A;  3U8P A;  4D4X A;  2XL6 A;  1E86 A;  2YLG A;  3QVY A;  5JP7 A;  4EIY A;  1YZA A;  1E84 A;  1CGN A;  4JEA A;  1S05 A;  5B3I A;  4CJO A;  3NMK A;  2BC5 A;  1YYJ A;  3DE8 A;  1E85 A;  5JSL A;  1MQV A;  4JKV A;  3QW1 A;  4L6R A;  3M15 A;  3M4B A;  3C63 A;  5JS5 A;  1QQ3 A;  1CPR A;  2YLI A;  1GQA A;  4NC3 A;  1CGO A;  3HNJ A;  2YL0 A;  4JE9 A;  2XLH A;  3ZTM A;  1RCP A;  2CCY A;  3M4C A;  5JRA A;  3C62 A;  4ER9 A;  4CIP A;  1E83 A;  5JVE A;  2J8W A;  3QW0 A;  3ZQY A;  2XLE A;  3HNL A;  1M6T A;  2XL8 A;  1QPU A;  1A7V A;  4U9E A;  2XM0 A;  1LM3 B;  4IAQ A;  4IB4 A;  2QLA A;  4CDV A;  2XLW A;  2XLD A;  3DE9 A;  4ULV A;  2YLD A;  4CDY A;  4D4N A;  1JAF A;  2XM4 A;  2YL3 A;  2J9B A;  4N4W A;  4JEB A;  2XLO A;  2XLV A;  4WGY A;  3HNI A;  1APC A;  5JUA A;  2XLM A;  2YL1 A; 
#chains in the Genus database with same CATH topology
 5JT4 A;  4PJN A;  4Z9H A;  3DMD A;  4M63 A;  2Q4F A;  4DRI B;  4EWC A;  2FFH A;  2ZD9 A;  3VRC A;  1H6G A;  1BBH A;  1MMN A;  2AWC A;  3FMS A;  3G50 A;  3JCU Q;  2XS8 A;  3Q6N A;  1Q0K A;  2H8A A;  2HSQ A;  1C03 A;  1FTS A;  2YHS A;  3EH2 A;  5F5F A;  4QI2 A;  3RVY A;  2R7V A;  1OKK A;  2P1A A;  1HMD A;  2CW0 F;  1RJ9 A;  3UR3 C;  1WAT A;  1WWP A;  4PJM A;  4U5D E;  1PD1 A;  1NU7 D;  2LIG A;  3CQZ A;  5COF A;  4YL3 A;  4EBB A;  3EGX A;  4EHP A;  4ZLD A;  3F47 A;  3C8G D;  4ZLC A;  4BJ1 A;  5JLI A;  2VH3 A;  5T1D B;  1T9K A;  4IAR A;  4AX2 A;  3SXZ A;  1JPN A;  3IPM O;  1CGM E;  2O9X A;  1QVX A;  1BDJ B;  2A6E F;  3IQ6 A;  3EPV A;  3MBG A;  1HE1 A;  4HEA J;  3S29 A;  3EH1 A;  2LD6 A;  4P6I C;  5F5H A;  2V26 A;  4YWQ A;  1KTM A;  1ORY A;  4O6N A;  2L7A A;  3UMH A;  3NMJ A;  3L0I A;  2YEV A;  2HJ3 A;  3F46 A;  3C18 A;  2YQY A;  1I5N A;  4PFO A;  1VMA A;  1ZZP A;  3U8P A;  3FVY A;  3EFO A;  2CYD A;  2YLG A;  1Q0D A;  4MTG A;  3GEH A;  2HKV A;  2R25 A;  5E33 A;  5BQH A;  3NYL A;  1Q0M A;  3JYY A;  4CS8 C;  5L0H A;  3A11 A;  3TUL A;  5COM A;  3GM3 A;  2R9R B;  2HV6 A;  2LSE A;  5KYY B;  4DBR A;  3K33 A;  4K7B A;  1VK5 A;  2B0H A;  1E85 A;  2L6G A;  1I4Y A;  1NZE A;  5DS4 A;  1FAP B;  2PF4 E;  5BUO A;  4CSA C;  5FCL A;  1KNY A;  2AWY A;  4U5E E;  5L0C A;  1Z23 A;  3T6G B;  2ZPA A;  4XEV A;  2XXA A;  2J9W A;  2J0W A;  1IZM A;  4MVQ A;  2DI3 A;  2J9V A;  2DYS C;  1H7I A;  3OWT A;  3RFY A;  1UFB A;  2X0C A;  2L6F A;  2A6H F;  1QQ3 A;  3HTK C;  3KMI A;  3V7O A;  2QTV A;  2Y3B A;  4NTF A;  5KYU A;  1CPR A;  3DAF A;  4MVR A;  1Z7Q c;  3UMI A;  3DD7 A;  4BPM A;  1F1M A;  1TWG A;  1OKK D;  3IEE A;  5L0J A;  2GFH A;  1IW7 F;  2HJM A;  4JJG A;  4F4B A;  1M57 C;  1WN0 A;  2RD9 A;  3HNJ A;  1Y6D A;  5D92 A;  4YT2 A;  2IXN A;  2ASR A;  1LS4 A;  1Z5Z A;  2NG1 A;  2XLH A;  4NTA A;  1RCP A;  3M4C A;  4HFF B;  5BQG A;  5EHH A;  5JRA A;  3C62 A;  3H65 A;  1QZX A;  2W45 A;  4O6Y A;  4CS8 A;  2OEX A;  5KYX B;  2FGY A;  3ATP A;  5AC5 A;  5JVE A;  1JR8 A;  2J8W A;  3AQC A;  3BRJ A;  3QW0 A;  3FDQ A;  5DQT A;  2VCA A;  2JX0 A;  4FWV A;  4MND A;  3WAQ A;  4KBL A;  3E70 C;  1M6T A;  1ZVZ A;  3AG2 C;  4NTB A;  4U9E A;  3DM5 A;  1J8Y F;  2A0B A;  2I15 A;  1RKE A;  1M2V A;  2EIM C;  2F22 A;  1QSP A;  2HV7 A;  2X51 A;  3M1C B;  4FX5 A;  4PJL A;  4PK4 A;  1OQC A;  3IHU A;  1LI7 A;  4CSA A;  4YT8 A;  2A69 F;  4KNW A;  3JSZ A;  4NQF A;  1EI7 A;  1LPE A;  3B9Q A;  1ZHY A;  3S84 A;  1PV3 A;  1EA8 A;  5D91 A;  3O10 A;  4BEM J;  3DE9 A;  3LES A;  1V55 C;  4D4N A;  3EJN A;  3MX3 A;  2HMQ A;  1YDI A;  2EPN A;  2OG2 A;  4KC9 A;  2MHR A;  3JT1 A;  3LJB A;  3QTH A;  4XWJ A;  3U0C A;  3RW0 A;  2WZL A;  2HZ8 A;  3EQL F;  1TQG A;  5JUA A;  4G0H A;  3RYL A;  2NUT A;  3BEH A;  2Z15 A;  1EQ1 A;  2ETS A;  1ZYR F;  2G3V A;  1FNT c;  1O87 A;  4GEH A;  2YL1 A;  4RD9 A;  4CIH A;  3PDM P;  3ASO C;  3VYW A;  3JSE O;  3T6J A;  5E3A A;  1D0Y A;  3V5Y A;  1SR2 A;  2R7W A;  3QMK A;  1MMA A;  3S9O A;  1T6U A;  3O6X A;  1YLM A;  4NY3 A;  4D4X A;  4E18 A;  3CAX A;  2A68 F;  4U9D A;  4XPW A;  4KNV A;  5DLJ A;  3DWW A;  1MNE A;  3S90 A;  4J7Y A;  3TOL A;  3M79 A;  4PFP A;  1U0B B;  1LE4 A;  4DVY P;  2M64 A;  2C04 A;  3K66 A;  3ITF A;  2HS5 A;  5DQZ A;  1MND A;  4U5B E;  1O5H A;  3NMI A;  1CPQ A;  2WVO A;  1YYX A;  4XPX A;  4Z9J A;  3ZQV A;  1OCC C;  3MLG A;  3SP1 A;  3G4Z A;  1YZC A;  4C3B A;  5KYW A;  5B1A C;  5K0I A;  4OIR F;  5L0G A;  4MW8 A;  3U2M A;  4P9T A;  4R32 A;  3HLZ A;  3ZWI A;  3U9J A;  5L3V A;  2R03 A;  2FAP B;  4N06 A;  2NUP A;  2KQ9 A;  4FES A;  4XPY A;  1ORS C;  2ZXR A;  3U9M A;  1Z3I X;  3UNG C;  3EG9 B;  3IQT A;  2M4E A;  2XL6 A;  4AE4 A;  3UGP A;  3WG7 C;  1YAU O;  1LE2 A;  1G4W R;  3H2V A;  2R7U A;  4EIY A;  1YZA A;  3MFN A;  1E84 A;  3RQE A;  2EIK C;  2Q9A A;  1FFH A;  1CGN A;  4CS7 A;  3RQF A;  1S05 A;  4YT4 A;  3DM9 B;  3S28 A;  4CJO A;  2BE5 F;  1VYI A;  1LS1 A;  3LEV A;  4JRZ A;  5EGY A;  1SYQ A;  2XS1 A;  3DJN B;  2A1D D;  4G78 A;  1MQV A;  3KYJ A;  3HJC A;  1LKX A;  2ICW G;  4J30 B;  3L34 A;  4MVU A;  4L6R A;  1UG7 A;  1D1C A;  3LNM B;  1BZ4 A;  4JW1 A;  1OCZ C;  4I3M A;  5IY5 C;  3PCV A;  2HSB A;  4J32 B;  3FHD A;  5L0D A;  3GAN A;  1GM5 A;  2OCC C;  4BJ6 C;  3NYJ A;  1RJ9 B;  3DXJ F;  2Q7R A;  3O39 A;  1GQA A;  4NC3 A;  3EGX B;  5HV9 A;  1CGO A;  4CS9 C;  4W8K A;  1HW2 A;  2WZF A;  4QDL A;  3UGO A;  4G7Z F;  2YL0 A;  3NYM A;  4LAC B;  2CCY A;  5KYN A;  3H2U A;  4C3E A;  2J46 A;  2QNL A;  3L8I A;  3EGD A;  1LI5 A;  3WHN A;  2VB6 A;  3ZQY A;  2WZG A;  3W8H A;  4HE8 D;  3W2V A;  2ZXO A;  3HNL A;  2EPK X;  3ECS A;  1A7V A;  3ABL C;  3EZH A;  4DRJ B;  4DVZ A;  4EKW A;  1B68 A;  2XM0 A;  3LNR A;  1D1A A;  1LM3 B;  1K05 A;  2OEV A;  1SMY F;  2VCB A;  3T9O A;  4IAQ A;  3ZSU A;  3WOD F;  4EBK A;  4C7O A;  2J0X A;  2H7O A;  2IOQ A;  2A0U A;  4IB4 A;  2QLA A;  5T3T A;  1SF8 A;  3HKK A;  2XLW A;  2XLD A;  3ASN C;  2YLD A;  3MYI A;  4JUR I;  1TWA A;  3VAY A;  2GA0 A;  4BJ6 A;  4H4K C;  3ZC4 A;  3W4Y A;  3DI5 A;  3VF0 A;  3TJ5 A;  3X2Q C;  4EBJ A;  2JPU A;  2XM4 A;  3Q6M A;  3GM1 A;  2YL3 A;  2GWW A;  1FMW A;  4JIO A;  4CS9 A;  1HY5 A;  1O3U A;  3TQO A;  2XXA B;  1NFN A;  1VTM P;  3J06 A;  1K04 A;  2XLV A;  4WAB A;  2WL8 A;  4WGY A;  2GDC A;  3U3F A;  1TWH A;  2JD3 A;  2XLM A;  5COG A;  5E2Q A;  2IXM A;  2R7S A;  4DJ9 A;  3CEX A;  2VAS A;  5B1B C;  2RSE B;  5DS6 A;  1RMV A;  2E87 A;  2ZXW C;  2YRF A;  1AUE A;  3C8Z A;  3R7C A;  5KYU B;  3OEO A;  3DZA A;  1OW6 A;  3G4X A;  3GOR A;  1RXQ A;  3ZTZ A;  4E0H A;  2AU5 A;  1YAR O;  2OU6 A;  4O7G A;  2YL7 A;  3Q7L A;  1NBB A;  4JTD B;  3X1O A;  2YZS A;  3B0P A;  1T01 A;  2WVQ A;  3GEE A;  3L1M A;  4LLC A;  5L3Q A;  4KI2 A;  1ZHW A;  1PD0 A;  256B A;  2Q9C A;  3N24 A;  4U5H A;  1H9G A;  4A2N B;  3L8J A;  2WB7 A;  3NKE A;  1C17 M;  4I44 A;  4J7T A;  5AC4 A;  3I5Q A;  2W4M A;  4PR9 A;  4FAP B;  2H7V C;  2IM8 A;  3AQB A;  1TR2 A;  4WGZ A;  2PP4 A;  5A6B A;  4OIQ F;  1EKY A;  2MYS A;  1NU9 C;  3K6B A;  3DAG A;  3TD7 A;  3TOM A;  3IQC A;  1T6Q A;  1XZQ A;  1JRA A;  2AP3 A;  4N6H A;  1RKE B;  1M2V B;  2EIL C;  3NDB B;  1R5I D;  4E7Z A;  1H9T A;  3ABM C;  3SEO A;  4XLP F;  1C02 A;  4MVS A;  3SNH A;  1QKR A;  2XSE A;  3IQ5 A;  2EPL X;  4CX9 A;  2QUP A;  3PMR A;  4N6C A;  1M56 C;  1OXK A;  3HNK A;  3OA1 A;  3RVZ A;  3RQG A;  3QVY A;  2WVN A;  3JRM O;  1WGW A;  5JP7 A;  3LS0 A;  3T6B A;  1OCR C;  4PJJ A;  3LS1 A;  1A41 A;  4H54 A;  1ORJ A;  2Y3D A;  2LCH A;  1BR2 A;  3R2P A;  4JEA A;  3W2W A;  5B3I A;  1ZHX A;  3NMK A;  4Q4Z F;  1DOW A;  2W9Y A;  2CNW D;  1V54 C;  1YYJ A;  2L6H A;  2OOC A;  3C8G B;  2Q3T A;  3DE8 A;  2LK4 A;  3Q7G A;  4JTC B;  2KYH A;  4MS2 A;  4OIN F;  2QE9 A;  2D4U A;  4XLN F;  2Q9B A;  2LFF A;  2ZXP A;  2HUJ A;  1Z6A A;  2R05 A;  3QW1 A;  3B29 A;  3GWL A;  4X0R A;  3M15 A;  5L0I A;  4BJT A;  2R7X A;  1AEP A;  3C63 A;  2LFD A;  2DYR C;  3U8V A;  4XTK A;  2NSG A;  2PX3 A;  4ONS A;  4EUK B;  1NLX A;  4K1O A;  2P0N A;  5FZT A;  1T5O A;  2XRH A;  4JVS A;  1QLE C;  2HMZ A;  3B71 A;  4JJF A;  2NPU A;  4OIO F;  2NSF A;  3MYF A;  3VM6 A;  3KPH A;  3RH3 A;  3I4U A;  1LIH A;  2I8B A;  4AL0 A;  4DBQ A;  1FR0 A;  1M2O A;  4LLE A;  2J45 A;  2R7Q A;  1XWJ A;  5A6B D;  1U89 A;  3SXY A;  5KYW B;  4JCZ A;  4MVM A;  3U3B A;  2J7P A;  1G4U S;  3SXM A;  1AVO B;  2LP4 A;  2GAQ A;  4JC7 A;  1E83 A;  3JYH A;  3C7J A;  4O6M A;  4BJ5 C;  2OJQ A;  3EHM A;  3ZIB A;  2CGE A;  2DGJ A;  4QI0 A;  2XLE A;  2NUP B;  2XL8 A;  3SZR A;  2QY9 A;  3O55 A;  4IRU A;  4OD4 A;  2Y3G A;  4AE4 B;  3PHF 2;  4PAC A;  4G7H F;  1VLT A;  3AGU A;  4LER A;  1Y4C A;  3B0V C;  3K1I C;  2C03 A;  3S27 A;  4YL1 A;  3RF3 A;  3LEO A;  2KGO A;  2KJG A;  2YWA A;  3LLI A;  3EZI A;  2W4B A;  3QZC A;  3DKA A;  4CDV A;  3K7D A;  1ST6 A;  4UDV A;  2P6V A;  4BG0 A;  3A9C A;  1KU2 A;  1JAF A;  1XZP A;  1ZHT A;  4Q7C A;  4DOZ A;  4ANJ A;  1A7E A;  5B3S C;  2G3K A;  5KYY A;  3JRT A;  2XLO A;  3EHN A;  1L7C A;  1I4Z A;  4XEF A;  4YK5 A;  1HMO A;  4K0D A;  3SYN A;  4IJJ A;  4IGG A;  5A69 A;  1FMV A;  2EIJ C;  1TFO B;  2IXO A;  2R02 A;  2J9U A;  1GGQ A;  2KNH A;  3GWN A;  4DXW A;  3FAP B;  4OIP F;  1OCO C;  3N2Z B;  1ZW3 A;  3EFO B;  4BJ5 A;  4E17 A;  3FAJ A;  2HFI A;  1HW1 A;  1TWC A;  2MWQ A;  1JPJ A;  5A6J A;  1BR4 A;  1VB5 A;  1VLS A;  3NG1 A;  4ULW A;  2UUH A;  1OXB A;  2R7R A;  1VOM A;  1JOG A;  3AG3 C;  5CI8 A;  1WOL A;  2VC9 A;  1GS9 A;  3K1I A;  4MVZ A;  4BEJ A;  4JCH A;  4Q5S F;  2J7P D;  1D0Z A;  2EPO A;  3EGD B;  2OQM A;  1W2W A;  2LQG A;  4CJG A;  5AGF A;  3LUT B;  1OR2 A;  2D5R B;  3FOO A;  5EK0 A;  3E9V A;  1OW7 A;  3UMK A;  3V5X A;  3W8I A;  4JZA A;  1TKN A;  5GPG B;  5A6A A;  2CNW A;  2VCC A;  3NKD A;  3GEI A;  3FOP A;  4LDR A;  2YKZ A;  4C3D A;  4CDA A;  3FXH A;  5KYX A;  2Q00 A;  4GYT A;  1A7D A;  2AVK A;  3K1H A;  3US6 A;  4NCQ A;  2EPM X;  3B0U X;  4MTF A;  4C7O B;  4YJW A;  3QVZ A;  3V5Z A;  4A4A A;  5BQI A;  3AJM A;  2L9J A;  1E86 A;  3CZ6 A;  3GM2 A;  2V3C C;  2P61 A;  1WAS A;  1ZU5 A;  4MTO A;  1G5Z A;  3CSK A;  3LAY A;  2TMV P;  1S7Z A;  3I5P A;  4JTA B;  2G62 A;  1SZI A;  4GQH A;  3KH2 A;  2BL2 A;  3AGT A;  5T3W A;  4RDA A;  2BC5 A;  5JSL A;  5DVW A;  2YVK A;  4IWB A;  1NSG B;  2PNO A;  4JKV A;  1OW8 A;  4LDQ A;  3TK0 A;  3POV A;  3KKB A;  4MQ9 F;  3JZ0 A;  4YN0 B;  1BR1 A;  5E3C A;  2R7O A;  2OKU A;  1YA9 A;  1VYK A;  3M4B A;  3JTL O;  3T4R A;  4DRH B;  1ZHZ A;  1TFK B;  2KSF A;  2Y69 C;  4E0I A;  5CIV A;  2L81 A;  3ZG1 A;  2Y3H A;  5JS5 A;  1J8M F;  1OR3 A;  5HSW A;  1WTY A;  3ZDL A;  2CDQ A;  2B0J A;  2YLI A;  4WJ0 A;  4MW3 A;  2UUI A;  3AG4 C;  2XL4 A;  1YJG A;  1G8X A;  1LVK A;  1R4T A;  3KL4 A;  1DOV A;  1D1B A;  4AL1 A;  1HE9 A;  1Q0G A;  2PFD A;  1JMW A;  1NG1 A;  1A0B A;  1MMD A;  1ZW2 A;  3AOU A;  4JE9 A;  5F28 E;  3ZTM A;  4I1O B;  1FFT C;  3ZVR A;  2DB4 A;  2IXP A;  4I1M A;  3U5S A;  2KK1 A;  3N0T A;  1E2X A;  1MMG A;  2NUT B;  4Z9I A;  4OD5 A;  4XEK A;  4ER9 A;  4CIP A;  1L3P A;  3C8G A;  2KC3 A;  3AG1 C;  3GOD A;  3RIP A;  3S0X A;  4MVO A;  1Z63 A;  4IAO A;  2IBF A;  2PBE A;  4RBN A;  3RKO F;  1QPU A;  4CBE A;  3KYI A;  4U5C E;  2R7T A;  4E7S A;  4P9F A;  2PX0 A;  3SXK A;  4YT5 A;  1ZU4 A;  4B6I A;  2KW3 C;  1N1C A;  5CI9 A;  1Q0F A;  1D0X A;  3EG9 A;  1YA7 O;  3ABK C;  3LLK A;  3NRH A;  3DJU B;  4U5F E;  3U2L A;  2IYL D;  4ULV A;  2OJE D;  5A6K A;  4CDY A;  4G7O F;  1U6H A;  1PCX A;  1NFO A;  4AK9 A;  1RKC A;  4HFK B;  2H7B A;  4W8P A;  2Y39 A;  1V74 B;  4XQ1 A;  2J9B A;  5DS5 A;  4N4W A;  4JEB A;  1K40 A;  4U5G A;  4LDK A;  3HNI A;  1APC A;  1YVI A;  2EIN C;  4YL0 A;  5TJ5 E;  5L0F A;  1V4A A;  1T6I A;  4O79 A;  3TJ6 A;  2P7V A; 
#chains in the Genus database with same CATH homology
 5JT4 A;  3ZTZ A;  2YL7 A;  3VRC A;  1NBB A;  1BBH A;  3L1M A;  4U9D A;  256B A;  3TOL A;  3M79 A;  4CJG A;  4WGZ A;  5AGF A;  1EKY A;  3FOO A;  3NMI A;  1CPQ A;  3TOM A;  1YYX A;  3ZQV A;  5JLI A;  4IAR A;  1YZC A;  4N6H A;  3FOP A;  2YKZ A;  3IQ6 A;  4CDA A;  4CX9 A;  3IQ5 A;  3ZWI A;  3QVZ A;  3NMJ A;  3HNK A;  3U8P A;  4D4X A;  2XL6 A;  1E86 A;  2YLG A;  3QVY A;  5JP7 A;  4EIY A;  1YZA A;  1E84 A;  1CGN A;  4JEA A;  1S05 A;  5B3I A;  4CJO A;  3NMK A;  2BC5 A;  1YYJ A;  3DE8 A;  1E85 A;  5JSL A;  1MQV A;  4JKV A;  3QW1 A;  4L6R A;  3M15 A;  3M4B A;  3C63 A;  5JS5 A;  1QQ3 A;  1CPR A;  2YLI A;  1GQA A;  4NC3 A;  1CGO A;  3HNJ A;  2YL0 A;  4JE9 A;  2XLH A;  3ZTM A;  1RCP A;  2CCY A;  3M4C A;  5JRA A;  3C62 A;  4ER9 A;  4CIP A;  1E83 A;  5JVE A;  2J8W A;  3QW0 A;  3ZQY A;  2XLE A;  3HNL A;  1M6T A;  2XL8 A;  1QPU A;  1A7V A;  4U9E A;  2XM0 A;  1LM3 B;  4IAQ A;  4IB4 A;  2QLA A;  4CDV A;  2XLW A;  2XLD A;  3DE9 A;  4ULV A;  2YLD A;  4CDY A;  4D4N A;  1JAF A;  2XM4 A;  2YL3 A;  2J9B A;  4N4W A;  4JEB A;  2XLO A;  2XLV A;  4WGY A;  3HNI A;  1APC A;  5JUA A;  2XLM A;  2YL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...