1YZAA

The solution structure of a redesigned apocytochrome b562 (rd-apocyt b562) with the n-terminal helix unfolded
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
ADLEDNDETGNDNGKGGEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTIRAYNQKYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redesigned apo-cytochrome b562
publication title Specific non-native hydrophobic interactions in a hidden folding intermediate: implication for protein folding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 28
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2005-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1yzaA00
2YL0A 3QW0A 1CPQA 1LM3B 1QQ3A 3HNKA 5JRAA 1QPUA 3C63A 3ZQYA 1APCA 2XLVA 1CPRA 2XLEA 2YL1A 3IQ5A 2XM0A 4D4NA 3QW1A 4CJGA 1M6TA 2XLDA 1YZAA 4L6RA 5JUAA 2QLAA 1A7VA 5B3IA 1E84A 5JP7A 4IB4A 4WGYA 3NMJA 4CDYA 3ZQVA 1CGNA 3M4BA 3QVYA 2YKZA 4JKVA 1BBHA 4CX9A 3M79A 4CIPA 1EKYA 1JAFA 2J9BA 3M4CA 1NBBA 2YLIA 2YL3A 4CDAA 4JEAA 4WGZA 2BC5A 3C62A 5JLIA 3HNLA 4EIYA 4ULVA 4IARA 4U9EA 3FOPA 5JT4A 4JEBA 2CCYA 3DE9A 2J8WA 2XLOA 4U9DA 4N6HA 1RCPA 2XL6A 3ZWIA 3VRCA 2XLHA 5JS5A 1YYXA 2YLDA 1E85A 3NMIA 2XM4A 2YL7A 1GQAA 1CGOA 1MQVA 4NC3A 1S05A 3L1MA 4IAQA 5JSLA 1YYJA 3NMKA 3QVZA 2XLWA 4CJOA 3HNJA 3HNIA 4JE9A 4D4XA 1YZCA 3U8PA 1E86A 2XL8A 3IQ6A 3ZTZA 3TOMA 2XLMA 4N4WA 3ZTMA 1E83A 256BA 3FOOA 5AGFA 3DE8A 3TOLA 5JVEA 2YLGA 4ER9A 3M15A 4CDVA
chains in the Genus database with same CATH superfamily
2G3KA 2KSFA 2YRFA 3H2VA 3B29A 1G4WR 3TJ6A 1LM3B 3HNKA 3B0PA 1QSPA 3NKDA 3FVYA 5F5FA 2AP3A 1A0BA 3K7DA 1TFOB 1TWGA 2HS5A 2I15A 3PCVA 2HMZA 3OWTA 4XEKA 2W4MA 2DYRC 2NSGA 5KYUB 1AVOB 1N1CA 1CPRA 4MVOA 4NTAA 4LDQA 1SMYF 3T6GB 2YL1A 4JTAB 5KYWA 4KI2A 3RYLA 4OD5A 1QLEC 1Z23A 1LPEA 1TWAA 1YVIA 3DKAA 2OOCA 3GWLA 3H2UA 1T6IA 1SYQA 1TQGA 2L81A 3C8GD 2R05A 2YZSA 3U8VA 1T9KA 2XLDA 5JUAA 2EIMC 1O5HA 1L3PA 1M2VA 3V5YA 4E17A 5DS5A 1FNTc 3ZC4A 4X0RA 1Q0DA 2Q4FA 2Y39A 3ZQVA 1CGNA 4EBBA 3V7OA 3QVYA 2DGJA 5DS4A 3EH1A 3SP1A 1VB5A 2YKZA 4XEFA 2YQYA 3KYJA 1V55C 1M57C 2JX0A 4JTDB 4LDRA 2R7WA 1YA7O 3KMIA 4AE4A 3PDMP 4LLEA 1EKYA 3LNRA 1JAFA 1ORJA 4HEAJ 3G50A 4O6YA 5F28E 5L0GA 2CW0F 3UMHA 4YWQA 2YLIA 2R7QA 5D91A 4DRIB 1MMGA 3NYLA 4XWJA 3ZDLA 3G4XA 3S84A 3JT1A 3RKOF 3U2MA 1HE1A 2OG2A 1VYKA 2BC5A 4DRHB 1OR2A 2WL8A 5JLIA 4CBEA 3HNLA 4LLCA 4RD9A 3RFYA 4UDVA 2H7OA 4CS8A 3W2WA 4JCZA 2GFHA 4EBJA 2G62A 3O55A 2PF4E 1BR1A 2AWYA 2A6HF 3MX3A 4FX5A 4B6IA 3FOPA 3AG4C 3C8GB 4BEJA 2IXOA 3KH2A 4FESA 3JYYA 3WAQA 2Y69C 4U5GA 3LEVA 2XLOA 1JMWA 4HFKB 4MW3A 4K1OA 1K40A 1I4ZA 3SEOA 3EPVA 4GYTA 2J7PD 2XLHA 3GORA 5JS5A 2NUPB 1CGME 3N2ZB 4G7OF 1OXBA 4DRJB 3B71A 3NMIA 1LI5A 3Q6MA 2HFIA 1GQAA 2ZXRA 1CGOA 3KYIA 1L7CA 2FGYA 3L1MA 5JSLA 3HKKA 4E0HA 1YYJA 2VCCA 1SF8A 1VOMA 5L0JA 1XZQA 2A68F 4CJOA 3VF0A 3HNJA 3EG9B 1BR4A 1MNDA 4MQ9F 4NCQA 2J0XA 4IGGA 1YLMA 1YZCA 5L0FA 3U8PA 5EGYA 3ABMC 3ZTZA 3RQGA 3S9OA 3ASOC 4MVSA 3AJMA 2MHRA 1ZHWA 2B0JA 3ZTMA 5L0CA 4FWVA 3L8JA 1OXKA 3AOUA 3TJ5A 5KYUA 2IOQA 1KU2A 5AGFA 2M64A 3DE8A 3TOLA 3DXJF 1BDJB 4BJTA 2XL4A 4BEMJ 2Z15A 4C3BA 4I3MA 3DAFA 4EWCA 3Q7GA 4JJFA 4U5BE 3SNHA 4PACA 3VAYA 4CDVA 4I44A 3U9JA 2HZ8A 4RBNA 4ANJA 4YJWA 1LS4A 1FFHA 2QTVA 2Y3DA 1M2OA 2AU5A 3EJNA 4PK4A 1MNEA 5COMA 2WZLA 4GEHA 2HUJA 2L6FA 1QPUA 3C63A 3F47A 3A9CA 2Q00A 2J46A 5BQHA 5HSWA 2ZXPA 4C3DA 2FFHA 2XLEA 3T4RA 3U2LA 3MBGA 5T1DB 2QE9A 2QY9A 3C8ZA 3L34A 1MMAA 4PJNA 3ZVRA 4M63A 2OCCC 2OEXA 3AG2C 3SXZA 4YT4A 2G3VA 2PX3A 4L6RA 2R7TA 2LSEA 2EPOA 3O6XA 3Q7LA 3UMKA 1SZIA 2OKUA 4BJ5C 1LIHA 5COFA 4C3EA 4IB4A 4IWBA 1E84A 3DM9B 4WGYA 4EHPA 4PR9A 2LFFA 2J9UA 3C7JA 2EILC 5DQTA 4ZLCA 1WWPA 4AL0A 4DBRA 3IPMO 2ICWG 4EKWA 1Q0FA 2JD3A 2P1AA 2Q9BA 3AG1C 3AQBA 2KGOA 2L6HA 3TK0A 3ZIBA 1BBHA 4MNDA 4Q5SF 3KKBA 4P9FA 3EQLF 1F1MA 3DJUB 3JTLO 3ZSUA 4CX9A 2I8BA 2D4UA 5TJ5E 1VTMP 3EH2A 2EIJC 2J9BA 1JR8A 4E18A 4QI2A 3X2QC 1OW6A 4CDAA 3RH3A 2ASRA 2Y3HA 4JIOA 1V74B 4JEAA 2OU6A 3GWNA 5DLJA 2QUPA 2A0UA 5GPGB 1RKEB 4CS7A 2PP4A 3AGTA 3C8GA 1TKNA 4JW1A 4KNWA 3ECSA 2H7VC 1YDIA 3X1OA 4O6NA 1IW7F 3KPHA 4WGZA 3UGPA 3JRMO 4JURI 4BG0A 1VK5A 3H65A 3K33A 4ULWA 2R7VA 1T01A 1O87A 2XS8A 5HV9A 2BL2A 3F46A 1KTMA 2WZFA 4EIYA 3U0CA 1YA9A 5AC4A 1VYIA 1H9TA 1S7ZA 4Z9IA 3GEIA 1ZW2A 2NUPA 3ASNC 4IRUA 1Z6AA 1ZHYA 3DAGA 2J9VA 2NSFA 3EHMA 3FMSA 4JEBA 5D92A 4AX2A 1HW2A 2HJ3A 3DE9A 1T6QA 2QNLA 3G4ZA 1EA8A 3SXKA 1Y6DA 2IYLD 3I5QA 4IAOA 3SXYA 2EPMX 2CYDA 4U9DA 1YARO 1ORSC 4N6HA 3EGDB 3B0VC 3EZHA 3LESA 2LD6A 3DZAA 4PFOA 5K0IA 4R32A 4I1OB 1JRAA 3EG9A 3FAJA 4HE8D 4H4KC 2GWWA 3HLZA 3VRCA 4XTKA 1V54C 2NPUA 4G78A 2YLDA 1TFKB 1OCZC 2RD9A 4XLNF 3ABKC 1T6UA 3PHF2 1PCXA 2LQGA 3W4YA 2IXMA 3LLIA 1MQVA 4G7ZF 1HMDA 1YAUO 4NTBA 2RSEB 4QI0A 2PBEA 4NC3A 5L0IA 5B3SC 4BJ6A 5E3AA 2W9YA 2J0WA 2R7RA 4U5DE 3QVZA 2XLWA 2V26A 5T3WA 1C02A 1Q0GA 2WVOA 1K05A 3EFOB 3LNMB 2A0BA 1H9GA 2EPKX 4W8KA 3W2VA 1ZZPA 1FMWA 4JC7A 1NU7D 2EIKC 3OEOA 4U5CE 2VCAA 3K66A 3IQCA 1R4TA 3JRTA 1D0ZA 1FAPB 3IQ6A 3L0IA 3NDBB 2OJED 4JCHA 5KYYB 1TR2A 5KYXB 2Q9CA 2P0NA 3E9VA 4DVYP 1D1AA 3MLGA 5CIVA 3JYHA 2VC9A 1IZMA 3FOOA 1WATA 1OQCA 2J7PA 1PV3A 1G8XA 2ETSA 3J06A 2YLGA 5T3TA 3KL4A 1D0YA 4DOZA 4O7GA 5AC5A 3K1IC 5BUOA 4JZAA 2ZXWC 4O79A 1OKKD 2YL0A 3QW0A 1CPQA 4H54A 4YK5A 3BEHA 4OINF 3U9MA 1OKKA 5E3CA 3CSKA 1ZHXA 3W8HA 5JRAA 4A4AA 1WASA 4NTFA 1ZU5A 1O3UA 2CDQA 4DXWA 4XQ1A 1HE9A 2XLVA 5CI8A 4BPMA 1EI7A 1J8YF 1G4US 2DI3A 3NYJA 3JSEO 3IQ5A 4YT8A 2L7AA 1RXQA 5L0DA 2EPLX 2OJQA 4YL0A 4D4NA 3LAYA 1XZPA 1OCRC 1K04A 3E70C 4RDAA 1YZAA 2PNOA 2QLAA 5E2QA 3RVZA 1A7VA 1D0XA 3RF3A 1ZHZA 1Q0KA 1OCOC 4KBLA 4MVZA 3VYWA 1I5NA 4JVSA 4CDYA 4A2NB 2A69F 2CNWD 3MYIA 3M4BA 4LDKA 4ZLDA 3T6JA 2YEVA 4JTCB 5EHHA 1ZYRF 3AG3C 4ONSA 3LEOA 1RKEA 3OA1A 4Z9JA 1BZ4A 3US6A 4K0DA 2Q9AA 1LE4A 2P6VA 3CQZA 3M79A 4JJGA 3QZCA 3HJCA 4U5EE 3R7CA 4KC9A 1NBBA 3LS1A 2FAPB 4CSAC 3FHDA 2KC3A 3O10A 1UFBA 5B1AC 4EBKA 1JPNA 3EZIA 3GANA 4YL3A 1T5OA 2W45A 2EINC 3C62A 2Y3GA 3FDQA 2C04A 5COGA 3JCUQ 2DYSC 4XLPF 3WHNA 1R5ID 3EGDA 5DS6A 5IY5C 4G7HF 4C7OB 2R7XA 4IARA 3MFNA 3CEXA 3K1IA 4QDLA 1E2XA 3TULA 3BRJA 2Y3BA 5E33A 3U3FA 1DOWA 4MVQA 1ZHTA 2CCYA 3DJNB 4MVMA 5F5HA 3VM6A 2PFDA 2NG1A 2VCBA 3CAXA 1WTYA 4G0HA 4IJJA 2LP4A 2J8WA 4U5FE 4E0IA 3I4UA 1G5ZA 1FFTC 1VLSA 4EUKB 1ZVZA 1A7DA 1RJ9B 3U3BA 1WOLA 1ZU4A 3ZWIA 4MVUA 1TWCA 2X51A 3EFOA 2WVNA 4CS8C 3LLKA 3QTHA 1OW7A 5A6BD 2C03A 1Q0MA 2KYHA 4NQFA 4WABA 3L8IA 1QKRA 4K7BA 4E7SA 1SR2A 4PJLA 5KYYA 2YVKA 3FXHA 4KNVA 1HW1A 5KYXA 5B3IA 1V4AA 1EQ1A 2KQ9A 1NLXA 4PFPA 1I4YA 5DQZA 4Q7CA 3DM5A 4J30B 2VH3A 2J45A 4FAPB 2IXPA 2MYSA 3HNIA 4JE9A 4LACB 3V5ZA 3SYNA 3ZG1A 5A6KA 1BR2A 3UGOA 4Q4ZF 4LERA 2XS1A 2XL8A 2HMQA 5DVWA 4DJ9A 1FTSA 1RKCA 1VLTA 3EGXB 2KJGA 2KNHA 5BQGA 2ZD9A 3S28A 3U5SA 3MYFA 1Z63A 4OIPF 1NSGB 2XXAB 4OIQF 2HV6A 3LS0A 2BE5F 4CSAA 4XPXA 1NZEA 3FAPB 4CS9C 4J32B 1C17M 2LCHA 2R9RB 1C03A 1DOVA 2JPUA 3DWWA 4MS2A 1LKXA 2J9WA 3M15A 3WG7C 1D1CA 1NFNA 1NU9C 4BJ5A 2HKVA 3TD7A 3IHUA 2R25A 1QQ3A 2GA0A 4E7ZA 1AUEA 2DB4A 2WZGA 3A11A 2YWAA 3AQCA 4O6MA 3GM2A 4OD4A 4F4BA 2VASA 1AEPA 1XWJA 3GEEA 2P7VA 2ZPAA 4HFFB 3GM3A 2NUTB 2UUHA 1APCA 4JRZA 3V5XA 1MMDA 2H8AA 3ZQYA 3S90A 2LK4A 3ABLC 3EHNA 2IM8A 4YT5A 4AL1A 4YT2A 4CIHA 4OIRF 1Z5ZA 2XM0A 1H6GA 3R2PA 1B68A 2OQMA 2R7OA 3NYMA 5A6JA 2XSEA 4WJ0A 5FCLA 1M56C 2MWQA 3QW1A 1M6TA 4XPYA 4PJJA 1LVKA 2XRHA 3W8IA 2Q7RA 4CJGA 4Z9HA 2LFDA 3DI5A 2IXNA 5JP7A 1HY5A 2GDCA 3ATPA 5L0HA 2V3CC 1JPJA 1ORYA 3NMJA 4I1MA 1J8MF 4MW8A 2X0CA 1A41A 1NG1A 1OR3A 5A6BA 5KYWB 2D5RB 2F22A 3I5PA 4N06A 1U0BB 3Q6NA 4JKVA 4DBQA 2UUIA 3LJBA 3RQFA 1M2VB 5FZTA 1GGQA 4CIPA 4BJ1A 2W4BA 3TQOA 1GM5A 3DMDA 2M4EA 2HV7A 4C7OA 3M4CA 4J7TA 1A7EA 3C18A 3NRHA 2YL3A 4U5HA 4J7YA 4YN0B 4XPWA 3K1HA 4XEVA 5A69A 1VMAA 2YHSA 3AGUA 5KYNA 4AE4B 1OCCC 5CI9A 2P61A 1D1BA 3B9QA 5BQIA 1LI7A 2AWCA 1U89A 4CS9A 5A6AA 3UR3C 2ZXOA 3QMKA 4ULVA 3ITFA 1RJ9A 1TWHA 3HTKC 1QZXA 3IEEA 5L3QA 3N24A 2CNWA 4PJMA 3POVA 4U9EA 1FMVA 3S0XA 4MTGA 5JT4A 2OEVA 1OW8A 2HJMA 1Y4CA 3T9OA 3IQTA 4P9TA 1HMOA 4AK9A 3CZ6A 5L3VA 2R7UA 2R02A 1Z3IX 3RW0A 3T6BA 1U6HA 1UG7A 2B0HA 1RCPA 2XL6A 1WGWA 2GAQA 2TMVP 3O39A 2R7SA 4NY3A 3NKEA 3SZRA 2R03A 3RIPA 1WN0A 2LIGA 2KW3C 2WB7A 3GM1A 3JSZA 1Z7Qc 1QVXA 1W2WA 1YYXA 2WVQA 3S29A 2A1DD 1E85A 1JOGA 1ZW3A 3UMIA 3GODA 1FR0A 4W8PA 2XM4A 2YL7A 3UNGC 1YJGA 3JZ0A 3GEHA 3NG1A 2E87A 3PMRA 3EGXA 1S05A 4IAQA 2VB6A 2CGEA 1RMVA 3NMKA 2L9JA 1MMNA 1GS9A 1KNYA 1LE2A 1LS1A 1PD0A 2KK1A 2XXAA 1H7IA 1ST6A 3K6BA 2L6GA 4D4XA 4MVRA 1PD1A 2HSBA 2A6EF 4DVZA 2HSQA 4MTOA 1E86A 2PX0A 3N0TA 3WODF 3TOMA 2XLMA 3RQEA 2AVKA 4N4WA 3S27A 5EK0A 3RVYA 1E83A 2EPNA 2H7BA 5B1BC 4YL1A 2O9XA 1NFOA 4GQHA 256BA 2IBFA 2NUTA 4MTFA 4P6IC 4N6CA 4OIOF 3B0UX 4BJ6C 3LUTB 5JVEA 3M1CB 3DD7A 4ER9A 2Q3TA 3SXMA
chains in the Genus database with same CATH topology
2YL0A 3QW0A 1CPQA 1LM3B 1QQ3A 3HNKA 5JRAA 1QPUA 3C63A 3ZQYA 1APCA 2XLVA 1CPRA 2XLEA 2YL1A 3IQ5A 2XM0A 4D4NA 3QW1A 4CJGA 1M6TA 2XLDA 1YZAA 4L6RA 5JUAA 2QLAA 1A7VA 5B3IA 1E84A 5JP7A 4IB4A 4WGYA 3NMJA 4CDYA 3ZQVA 1CGNA 3M4BA 3QVYA 2YKZA 4JKVA 1BBHA 4CX9A 3M79A 4CIPA 1EKYA 1JAFA 2J9BA 3M4CA 1NBBA 2YLIA 2YL3A 4CDAA 4JEAA 4WGZA 2BC5A 3C62A 5JLIA 3HNLA 4EIYA 4ULVA 4IARA 4U9EA 3FOPA 5JT4A 4JEBA 2CCYA 3DE9A 2J8WA 2XLOA 4U9DA 4N6HA 1RCPA 2XL6A 3ZWIA 3VRCA 2XLHA 5JS5A 1YYXA 2YLDA 1E85A 3NMIA 2XM4A 2YL7A 1GQAA 1CGOA 1MQVA 4NC3A 1S05A 3L1MA 4IAQA 5JSLA 1YYJA 3NMKA 3QVZA 2XLWA 4CJOA 3HNJA 3HNIA 4JE9A 4D4XA 1YZCA 3U8PA 1E86A 2XL8A 3IQ6A 3ZTZA 3TOMA 2XLMA 4N4WA 3ZTMA 1E83A 256BA 3FOOA 5AGFA 3DE8A 3TOLA 5JVEA 2YLGA 4ER9A 3M15A 4CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL0 A;  3QW0 A;  1CPQ A;  1LM3 B;  1QQ3 A;  3HNK A;  5JRA A;  1QPU A;  3C63 A;  3ZQY A;  1APC A;  2XLV A;  1CPR A;  2XLE A;  2YL1 A;  3IQ5 A;  2XM0 A;  4D4N A;  3QW1 A;  4CJG A;  1M6T A;  2XLD A;  1YZA A;  4L6R A;  5JUA A;  2QLA A;  1A7V A;  5B3I A;  1E84 A;  5JP7 A;  4IB4 A;  4WGY A;  3NMJ A;  4CDY A;  3ZQV A;  1CGN A;  3M4B A;  3QVY A;  2YKZ A;  4JKV A;  1BBH A;  4CX9 A;  3M79 A;  4CIP A;  1EKY A;  1JAF A;  2J9B A;  3M4C A;  1NBB A;  2YLI A;  2YL3 A;  4CDA A;  4JEA A;  4WGZ A;  2BC5 A;  3C62 A;  5JLI A;  3HNL A;  4EIY A;  4ULV A;  4IAR A;  4U9E A;  3FOP A;  5JT4 A;  4JEB A;  2CCY A;  3DE9 A;  2J8W A;  2XLO A;  4U9D A;  4N6H A;  1RCP A;  2XL6 A;  3ZWI A;  3VRC A;  2XLH A;  5JS5 A;  1YYX A;  2YLD A;  1E85 A;  3NMI A;  2XM4 A;  2YL7 A;  1GQA A;  1CGO A;  1MQV A;  4NC3 A;  1S05 A;  3L1M A;  4IAQ A;  5JSL A;  1YYJ A;  3NMK A;  3QVZ A;  2XLW A;  4CJO A;  3HNJ A;  3HNI A;  4JE9 A;  4D4X A;  1YZC A;  3U8P A;  1E86 A;  2XL8 A;  3IQ6 A;  3ZTZ A;  3TOM A;  2XLM A;  4N4W A;  3ZTM A;  1E83 A;  256B A;  3FOO A;  5AGF A;  3DE8 A;  3TOL A;  5JVE A;  2YLG A;  4ER9 A;  3M15 A;  4CDV A; 
#chains in the Genus database with same CATH topology
 2G3K A;  2KSF A;  2YRF A;  3H2V A;  3B29 A;  1G4W R;  3TJ6 A;  1LM3 B;  3HNK A;  3B0P A;  1QSP A;  3NKD A;  3FVY A;  5F5F A;  2AP3 A;  1A0B A;  3K7D A;  1TFO B;  1TWG A;  2HS5 A;  2I15 A;  3PCV A;  2HMZ A;  3OWT A;  4XEK A;  2W4M A;  2DYR C;  2NSG A;  5KYU B;  1AVO B;  1N1C A;  1CPR A;  4MVO A;  4NTA A;  4LDQ A;  1SMY F;  3T6G B;  2YL1 A;  4JTA B;  5KYW A;  4KI2 A;  3RYL A;  4OD5 A;  1QLE C;  1Z23 A;  1LPE A;  1TWA A;  1YVI A;  3DKA A;  2OOC A;  3GWL A;  3H2U A;  1T6I A;  1SYQ A;  1TQG A;  2L81 A;  3C8G D;  2R05 A;  2YZS A;  3U8V A;  1T9K A;  2XLD A;  5JUA A;  2EIM C;  1O5H A;  1L3P A;  1M2V A;  3V5Y A;  4E17 A;  5DS5 A;  1FNT c;  3ZC4 A;  4X0R A;  1Q0D A;  2Q4F A;  2Y39 A;  3ZQV A;  1CGN A;  4EBB A;  3V7O A;  3QVY A;  2DGJ A;  5DS4 A;  3EH1 A;  3SP1 A;  1VB5 A;  2YKZ A;  4XEF A;  2YQY A;  3KYJ A;  1V55 C;  1M57 C;  2JX0 A;  4JTD B;  4LDR A;  2R7W A;  1YA7 O;  3KMI A;  4AE4 A;  3PDM P;  4LLE A;  1EKY A;  3LNR A;  1JAF A;  1ORJ A;  4HEA J;  3G50 A;  4O6Y A;  5F28 E;  5L0G A;  2CW0 F;  3UMH A;  4YWQ A;  2YLI A;  2R7Q A;  5D91 A;  4DRI B;  1MMG A;  3NYL A;  4XWJ A;  3ZDL A;  3G4X A;  3S84 A;  3JT1 A;  3RKO F;  3U2M A;  1HE1 A;  2OG2 A;  1VYK A;  2BC5 A;  4DRH B;  1OR2 A;  2WL8 A;  5JLI A;  4CBE A;  3HNL A;  4LLC A;  4RD9 A;  3RFY A;  4UDV A;  2H7O A;  4CS8 A;  3W2W A;  4JCZ A;  2GFH A;  4EBJ A;  2G62 A;  3O55 A;  2PF4 E;  1BR1 A;  2AWY A;  2A6H F;  3MX3 A;  4FX5 A;  4B6I A;  3FOP A;  3AG4 C;  3C8G B;  4BEJ A;  2IXO A;  3KH2 A;  4FES A;  3JYY A;  3WAQ A;  2Y69 C;  4U5G A;  3LEV A;  2XLO A;  1JMW A;  4HFK B;  4MW3 A;  4K1O A;  1K40 A;  1I4Z A;  3SEO A;  3EPV A;  4GYT A;  2J7P D;  2XLH A;  3GOR A;  5JS5 A;  2NUP B;  1CGM E;  3N2Z B;  4G7O F;  1OXB A;  4DRJ B;  3B71 A;  3NMI A;  1LI5 A;  3Q6M A;  2HFI A;  1GQA A;  2ZXR A;  1CGO A;  3KYI A;  1L7C A;  2FGY A;  3L1M A;  5JSL A;  3HKK A;  4E0H A;  1YYJ A;  2VCC A;  1SF8 A;  1VOM A;  5L0J A;  1XZQ A;  2A68 F;  4CJO A;  3VF0 A;  3HNJ A;  3EG9 B;  1BR4 A;  1MND A;  4MQ9 F;  4NCQ A;  2J0X A;  4IGG A;  1YLM A;  1YZC A;  5L0F A;  3U8P A;  5EGY A;  3ABM C;  3ZTZ A;  3RQG A;  3S9O A;  3ASO C;  4MVS A;  3AJM A;  2MHR A;  1ZHW A;  2B0J A;  3ZTM A;  5L0C A;  4FWV A;  3L8J A;  1OXK A;  3AOU A;  3TJ5 A;  5KYU A;  2IOQ A;  1KU2 A;  5AGF A;  2M64 A;  3DE8 A;  3TOL A;  3DXJ F;  1BDJ B;  4BJT A;  2XL4 A;  4BEM J;  2Z15 A;  4C3B A;  4I3M A;  3DAF A;  4EWC A;  3Q7G A;  4JJF A;  4U5B E;  3SNH A;  4PAC A;  3VAY A;  4CDV A;  4I44 A;  3U9J A;  2HZ8 A;  4RBN A;  4ANJ A;  4YJW A;  1LS4 A;  1FFH A;  2QTV A;  2Y3D A;  1M2O A;  2AU5 A;  3EJN A;  4PK4 A;  1MNE A;  5COM A;  2WZL A;  4GEH A;  2HUJ A;  2L6F A;  1QPU A;  3C63 A;  3F47 A;  3A9C A;  2Q00 A;  2J46 A;  5BQH A;  5HSW A;  2ZXP A;  4C3D A;  2FFH A;  2XLE A;  3T4R A;  3U2L A;  3MBG A;  5T1D B;  2QE9 A;  2QY9 A;  3C8Z A;  3L34 A;  1MMA A;  4PJN A;  3ZVR A;  4M63 A;  2OCC C;  2OEX A;  3AG2 C;  3SXZ A;  4YT4 A;  2G3V A;  2PX3 A;  4L6R A;  2R7T A;  2LSE A;  2EPO A;  3O6X A;  3Q7L A;  3UMK A;  1SZI A;  2OKU A;  4BJ5 C;  1LIH A;  5COF A;  4C3E A;  4IB4 A;  4IWB A;  1E84 A;  3DM9 B;  4WGY A;  4EHP A;  4PR9 A;  2LFF A;  2J9U A;  3C7J A;  2EIL C;  5DQT A;  4ZLC A;  1WWP A;  4AL0 A;  4DBR A;  3IPM O;  2ICW G;  4EKW A;  1Q0F A;  2JD3 A;  2P1A A;  2Q9B A;  3AG1 C;  3AQB A;  2KGO A;  2L6H A;  3TK0 A;  3ZIB A;  1BBH A;  4MND A;  4Q5S F;  3KKB A;  4P9F A;  3EQL F;  1F1M A;  3DJU B;  3JTL O;  3ZSU A;  4CX9 A;  2I8B A;  2D4U A;  5TJ5 E;  1VTM P;  3EH2 A;  2EIJ C;  2J9B A;  1JR8 A;  4E18 A;  4QI2 A;  3X2Q C;  1OW6 A;  4CDA A;  3RH3 A;  2ASR A;  2Y3H A;  4JIO A;  1V74 B;  4JEA A;  2OU6 A;  3GWN A;  5DLJ A;  2QUP A;  2A0U A;  5GPG B;  1RKE B;  4CS7 A;  2PP4 A;  3AGT A;  3C8G A;  1TKN A;  4JW1 A;  4KNW A;  3ECS A;  2H7V C;  1YDI A;  3X1O A;  4O6N A;  1IW7 F;  3KPH A;  4WGZ A;  3UGP A;  3JRM O;  4JUR I;  4BG0 A;  1VK5 A;  3H65 A;  3K33 A;  4ULW A;  2R7V A;  1T01 A;  1O87 A;  2XS8 A;  5HV9 A;  2BL2 A;  3F46 A;  1KTM A;  2WZF A;  4EIY A;  3U0C A;  1YA9 A;  5AC4 A;  1VYI A;  1H9T A;  1S7Z A;  4Z9I A;  3GEI A;  1ZW2 A;  2NUP A;  3ASN C;  4IRU A;  1Z6A A;  1ZHY A;  3DAG A;  2J9V A;  2NSF A;  3EHM A;  3FMS A;  4JEB A;  5D92 A;  4AX2 A;  1HW2 A;  2HJ3 A;  3DE9 A;  1T6Q A;  2QNL A;  3G4Z A;  1EA8 A;  3SXK A;  1Y6D A;  2IYL D;  3I5Q A;  4IAO A;  3SXY A;  2EPM X;  2CYD A;  4U9D A;  1YAR O;  1ORS C;  4N6H A;  3EGD B;  3B0V C;  3EZH A;  3LES A;  2LD6 A;  3DZA A;  4PFO A;  5K0I A;  4R32 A;  4I1O B;  1JRA A;  3EG9 A;  3FAJ A;  4HE8 D;  4H4K C;  2GWW A;  3HLZ A;  3VRC A;  4XTK A;  1V54 C;  2NPU A;  4G78 A;  2YLD A;  1TFK B;  1OCZ C;  2RD9 A;  4XLN F;  3ABK C;  1T6U A;  3PHF 2;  1PCX A;  2LQG A;  3W4Y A;  2IXM A;  3LLI A;  1MQV A;  4G7Z F;  1HMD A;  1YAU O;  4NTB A;  2RSE B;  4QI0 A;  2PBE A;  4NC3 A;  5L0I A;  5B3S C;  4BJ6 A;  5E3A A;  2W9Y A;  2J0W A;  2R7R A;  4U5D E;  3QVZ A;  2XLW A;  2V26 A;  5T3W A;  1C02 A;  1Q0G A;  2WVO A;  1K05 A;  3EFO B;  3LNM B;  2A0B A;  1H9G A;  2EPK X;  4W8K A;  3W2V A;  1ZZP A;  1FMW A;  4JC7 A;  1NU7 D;  2EIK C;  3OEO A;  4U5C E;  2VCA A;  3K66 A;  3IQC A;  1R4T A;  3JRT A;  1D0Z A;  1FAP B;  3IQ6 A;  3L0I A;  3NDB B;  2OJE D;  4JCH A;  5KYY B;  1TR2 A;  5KYX B;  2Q9C A;  2P0N A;  3E9V A;  4DVY P;  1D1A A;  3MLG A;  5CIV A;  3JYH A;  2VC9 A;  1IZM A;  3FOO A;  1WAT A;  1OQC A;  2J7P A;  1PV3 A;  1G8X A;  2ETS A;  3J06 A;  2YLG A;  5T3T A;  3KL4 A;  1D0Y A;  4DOZ A;  4O7G A;  5AC5 A;  3K1I C;  5BUO A;  4JZA A;  2ZXW C;  4O79 A;  1OKK D;  2YL0 A;  3QW0 A;  1CPQ A;  4H54 A;  4YK5 A;  3BEH A;  4OIN F;  3U9M A;  1OKK A;  5E3C A;  3CSK A;  1ZHX A;  3W8H A;  5JRA A;  4A4A A;  1WAS A;  4NTF A;  1ZU5 A;  1O3U A;  2CDQ A;  4DXW A;  4XQ1 A;  1HE9 A;  2XLV A;  5CI8 A;  4BPM A;  1EI7 A;  1J8Y F;  1G4U S;  2DI3 A;  3NYJ A;  3JSE O;  3IQ5 A;  4YT8 A;  2L7A A;  1RXQ A;  5L0D A;  2EPL X;  2OJQ A;  4YL0 A;  4D4N A;  3LAY A;  1XZP A;  1OCR C;  1K04 A;  3E70 C;  4RDA A;  1YZA A;  2PNO A;  2QLA A;  5E2Q A;  3RVZ A;  1A7V A;  1D0X A;  3RF3 A;  1ZHZ A;  1Q0K A;  1OCO C;  4KBL A;  4MVZ A;  3VYW A;  1I5N A;  4JVS A;  4CDY A;  4A2N B;  2A69 F;  2CNW D;  3MYI A;  3M4B A;  4LDK A;  4ZLD A;  3T6J A;  2YEV A;  4JTC B;  5EHH A;  1ZYR F;  3AG3 C;  4ONS A;  3LEO A;  1RKE A;  3OA1 A;  4Z9J A;  1BZ4 A;  3US6 A;  4K0D A;  2Q9A A;  1LE4 A;  2P6V A;  3CQZ A;  3M79 A;  4JJG A;  3QZC A;  3HJC A;  4U5E E;  3R7C A;  4KC9 A;  1NBB A;  3LS1 A;  2FAP B;  4CSA C;  3FHD A;  2KC3 A;  3O10 A;  1UFB A;  5B1A C;  4EBK A;  1JPN A;  3EZI A;  3GAN A;  4YL3 A;  1T5O A;  2W45 A;  2EIN C;  3C62 A;  2Y3G A;  3FDQ A;  2C04 A;  5COG A;  3JCU Q;  2DYS C;  4XLP F;  3WHN A;  1R5I D;  3EGD A;  5DS6 A;  5IY5 C;  4G7H F;  4C7O B;  2R7X A;  4IAR A;  3MFN A;  3CEX A;  3K1I A;  4QDL A;  1E2X A;  3TUL A;  3BRJ A;  2Y3B A;  5E33 A;  3U3F A;  1DOW A;  4MVQ A;  1ZHT A;  2CCY A;  3DJN B;  4MVM A;  5F5H A;  3VM6 A;  2PFD A;  2NG1 A;  2VCB A;  3CAX A;  1WTY A;  4G0H A;  4IJJ A;  2LP4 A;  2J8W A;  4U5F E;  4E0I A;  3I4U A;  1G5Z A;  1FFT C;  1VLS A;  4EUK B;  1ZVZ A;  1A7D A;  1RJ9 B;  3U3B A;  1WOL A;  1ZU4 A;  3ZWI A;  4MVU A;  1TWC A;  2X51 A;  3EFO A;  2WVN A;  4CS8 C;  3LLK A;  3QTH A;  1OW7 A;  5A6B D;  2C03 A;  1Q0M A;  2KYH A;  4NQF A;  4WAB A;  3L8I A;  1QKR A;  4K7B A;  4E7S A;  1SR2 A;  4PJL A;  5KYY A;  2YVK A;  3FXH A;  4KNV A;  1HW1 A;  5KYX A;  5B3I A;  1V4A A;  1EQ1 A;  2KQ9 A;  1NLX A;  4PFP A;  1I4Y A;  5DQZ A;  4Q7C A;  3DM5 A;  4J30 B;  2VH3 A;  2J45 A;  4FAP B;  2IXP A;  2MYS A;  3HNI A;  4JE9 A;  4LAC B;  3V5Z A;  3SYN A;  3ZG1 A;  5A6K A;  1BR2 A;  3UGO A;  4Q4Z F;  4LER A;  2XS1 A;  2XL8 A;  2HMQ A;  5DVW A;  4DJ9 A;  1FTS A;  1RKC A;  1VLT A;  3EGX B;  2KJG A;  2KNH A;  5BQG A;  2ZD9 A;  3S28 A;  3U5S A;  3MYF A;  1Z63 A;  4OIP F;  1NSG B;  2XXA B;  4OIQ F;  2HV6 A;  3LS0 A;  2BE5 F;  4CSA A;  4XPX A;  1NZE A;  3FAP B;  4CS9 C;  4J32 B;  1C17 M;  2LCH A;  2R9R B;  1C03 A;  1DOV A;  2JPU A;  3DWW A;  4MS2 A;  1LKX A;  2J9W A;  3M15 A;  3WG7 C;  1D1C A;  1NFN A;  1NU9 C;  4BJ5 A;  2HKV A;  3TD7 A;  3IHU A;  2R25 A;  1QQ3 A;  2GA0 A;  4E7Z A;  1AUE A;  2DB4 A;  2WZG A;  3A11 A;  2YWA A;  3AQC A;  4O6M A;  3GM2 A;  4OD4 A;  4F4B A;  2VAS A;  1AEP A;  1XWJ A;  3GEE A;  2P7V A;  2ZPA A;  4HFF B;  3GM3 A;  2NUT B;  2UUH A;  1APC A;  4JRZ A;  3V5X A;  1MMD A;  2H8A A;  3ZQY A;  3S90 A;  2LK4 A;  3ABL C;  3EHN A;  2IM8 A;  4YT5 A;  4AL1 A;  4YT2 A;  4CIH A;  4OIR F;  1Z5Z A;  2XM0 A;  1H6G A;  3R2P A;  1B68 A;  2OQM A;  2R7O A;  3NYM A;  5A6J A;  2XSE A;  4WJ0 A;  5FCL A;  1M56 C;  2MWQ A;  3QW1 A;  1M6T A;  4XPY A;  4PJJ A;  1LVK A;  2XRH A;  3W8I A;  2Q7R A;  4CJG A;  4Z9H A;  2LFD A;  3DI5 A;  2IXN A;  5JP7 A;  1HY5 A;  2GDC A;  3ATP A;  5L0H A;  2V3C C;  1JPJ A;  1ORY A;  3NMJ A;  4I1M A;  1J8M F;  4MW8 A;  2X0C A;  1A41 A;  1NG1 A;  1OR3 A;  5A6B A;  5KYW B;  2D5R B;  2F22 A;  3I5P A;  4N06 A;  1U0B B;  3Q6N A;  4JKV A;  4DBQ A;  2UUI A;  3LJB A;  3RQF A;  1M2V B;  5FZT A;  1GGQ A;  4CIP A;  4BJ1 A;  2W4B A;  3TQO A;  1GM5 A;  3DMD A;  2M4E A;  2HV7 A;  4C7O A;  3M4C A;  4J7T A;  1A7E A;  3C18 A;  3NRH A;  2YL3 A;  4U5H A;  4J7Y A;  4YN0 B;  4XPW A;  3K1H A;  4XEV A;  5A69 A;  1VMA A;  2YHS A;  3AGU A;  5KYN A;  4AE4 B;  1OCC C;  5CI9 A;  2P61 A;  1D1B A;  3B9Q A;  5BQI A;  1LI7 A;  2AWC A;  1U89 A;  4CS9 A;  5A6A A;  3UR3 C;  2ZXO A;  3QMK A;  4ULV A;  3ITF A;  1RJ9 A;  1TWH A;  3HTK C;  1QZX A;  3IEE A;  5L3Q A;  3N24 A;  2CNW A;  4PJM A;  3POV A;  4U9E A;  1FMV A;  3S0X A;  4MTG A;  5JT4 A;  2OEV A;  1OW8 A;  2HJM A;  1Y4C A;  3T9O A;  3IQT A;  4P9T A;  1HMO A;  4AK9 A;  3CZ6 A;  5L3V A;  2R7U A;  2R02 A;  1Z3I X;  3RW0 A;  3T6B A;  1U6H A;  1UG7 A;  2B0H A;  1RCP A;  2XL6 A;  1WGW A;  2GAQ A;  2TMV P;  3O39 A;  2R7S A;  4NY3 A;  3NKE A;  3SZR A;  2R03 A;  3RIP A;  1WN0 A;  2LIG A;  2KW3 C;  2WB7 A;  3GM1 A;  3JSZ A;  1Z7Q c;  1QVX A;  1W2W A;  1YYX A;  2WVQ A;  3S29 A;  2A1D D;  1E85 A;  1JOG A;  1ZW3 A;  3UMI A;  3GOD A;  1FR0 A;  4W8P A;  2XM4 A;  2YL7 A;  3UNG C;  1YJG A;  3JZ0 A;  3GEH A;  3NG1 A;  2E87 A;  3PMR A;  3EGX A;  1S05 A;  4IAQ A;  2VB6 A;  2CGE A;  1RMV A;  3NMK A;  2L9J A;  1MMN A;  1GS9 A;  1KNY A;  1LE2 A;  1LS1 A;  1PD0 A;  2KK1 A;  2XXA A;  1H7I A;  1ST6 A;  3K6B A;  2L6G A;  4D4X A;  4MVR A;  1PD1 A;  2HSB A;  2A6E F;  4DVZ A;  2HSQ A;  4MTO A;  1E86 A;  2PX0 A;  3N0T A;  3WOD F;  3TOM A;  2XLM A;  3RQE A;  2AVK A;  4N4W A;  3S27 A;  5EK0 A;  3RVY A;  1E83 A;  2EPN A;  2H7B A;  5B1B C;  4YL1 A;  2O9X A;  1NFO A;  4GQH A;  256B A;  2IBF A;  2NUT A;  4MTF A;  4P6I C;  4N6C A;  4OIO F;  3B0U X;  4BJ6 C;  3LUT B;  5JVE A;  3M1C B;  3DD7 A;  4ER9 A;  2Q3T A;  3SXM A; 
#chains in the Genus database with same CATH homology
 2YL0 A;  3QW0 A;  1CPQ A;  1LM3 B;  1QQ3 A;  3HNK A;  5JRA A;  1QPU A;  3C63 A;  3ZQY A;  1APC A;  2XLV A;  1CPR A;  2XLE A;  2YL1 A;  3IQ5 A;  2XM0 A;  4D4N A;  3QW1 A;  4CJG A;  1M6T A;  2XLD A;  1YZA A;  4L6R A;  5JUA A;  2QLA A;  1A7V A;  5B3I A;  1E84 A;  5JP7 A;  4IB4 A;  4WGY A;  3NMJ A;  4CDY A;  3ZQV A;  1CGN A;  3M4B A;  3QVY A;  2YKZ A;  4JKV A;  1BBH A;  4CX9 A;  3M79 A;  4CIP A;  1EKY A;  1JAF A;  2J9B A;  3M4C A;  1NBB A;  2YLI A;  2YL3 A;  4CDA A;  4JEA A;  4WGZ A;  2BC5 A;  3C62 A;  5JLI A;  3HNL A;  4EIY A;  4ULV A;  4IAR A;  4U9E A;  3FOP A;  5JT4 A;  4JEB A;  2CCY A;  3DE9 A;  2J8W A;  2XLO A;  4U9D A;  4N6H A;  1RCP A;  2XL6 A;  3ZWI A;  3VRC A;  2XLH A;  5JS5 A;  1YYX A;  2YLD A;  1E85 A;  3NMI A;  2XM4 A;  2YL7 A;  1GQA A;  1CGO A;  1MQV A;  4NC3 A;  1S05 A;  3L1M A;  4IAQ A;  5JSL A;  1YYJ A;  3NMK A;  3QVZ A;  2XLW A;  4CJO A;  3HNJ A;  3HNI A;  4JE9 A;  4D4X A;  1YZC A;  3U8P A;  1E86 A;  2XL8 A;  3IQ6 A;  3ZTZ A;  3TOM A;  2XLM A;  4N4W A;  3ZTM A;  1E83 A;  256B A;  3FOO A;  5AGF A;  3DE8 A;  3TOL A;  5JVE A;  2YLG A;  4ER9 A;  3M15 A;  4CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...