4NY3A

Human ptpa in complex with peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
299
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis for PTPA interaction with the invariant C-terminal tail of PP2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 116
structure length 299
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ny3A02
2IXMA 2HV6A 4LACB 2IXPA 2G62A 4NY3A 2IXOA 2IXNA 2HV7A
chains in the Genus database with same CATH superfamily
2KGOA 3LS1A 1A7EA 3M4BA 2NSFA 2IXMA 1PD1A 5KYYA 3E70C 3KYIA 3HJCA 1J8MF 1OW6A 2YWAA 3S9OA 1AUEA 2G3VA 2IBFA 3ITFA 3SXKA 4G78A 2FFHA 1I4YA 3PDMP 3ABKC 3G50A 2P7VA 1D0ZA 4XEKA 5A6JA 3M15A 3T4RA 2DI3A 1AEPA 3ZDLA 1Q0DA 2AWCA 4U5BE 5BQHA 3PHF2 2O9XA 3AQCA 2VASA 3ABLC 2YVKA 5JUAA 1V74B 4EWCA 4U9DA 3F47A 3QMKA 3OWTA 4XPXA 3K7DA 3I5PA 3K1IA 3L8IA 3Q7LA 5CI9A 2NUTA 1L3PA 4F4BA 4IB4A 2J45A 1G8XA 3IHUA 3MFNA 4GYTA 3O10A 4LERA 1F1MA 4J7YA 3DAGA 4J7TA 2YZSA 2ICWG 2Q9AA 3FOOA 4NCQA 2P1AA 1OKKA 2Y3GA 2KK1A 3L1MA 4OD4A 4P9TA 5DS5A 3T6JA 4A4AA 2NG1A 4MVRA 4WGZA 4MTGA 3DZAA 4YL3A 3RVYA 4OIQF 1WATA 1A7VA 2C04A 3QTHA 4PR9A 1M56C 3ZSUA 3DE9A 3UMIA 1GQAA 3U9JA 3FXHA 3JYHA 1T5OA 2KQ9A 3EGXB 2YL7A 4FWVA 4I1OB 4Z9IA 2XSEA 3DJNB 2J0XA 4JTAB 2HV6A 3TQOA 1DOWA 3VM6A 4DVYP 3TD7A 2Y3BA 3W8IA 4BPMA 2BE5F 2VCCA 3RQFA 3A11A 3FDQA 2HV7A 2KW3C 3CQZA 4LDRA 5CIVA 2R7UA 1O87A 2KYHA 1I5NA 1J8YF 2CCYA 1N1CA 3S27A 5JS5A 2LFDA 1LS4A 4G7HF 3GEEA 4U5HA 1SZIA 3VYWA 4DBRA 4Q4ZF 3LUTB 1HY5A 1RJ9A 2LD6A 4DJ9A 1VLSA 1Q0KA 2Q00A 2M4EA 3GM3A 3UMHA 1A41A 2V26A 5BQIA 2R9RB 3ZTZA 2YLGA 2OEXA 1A7DA 1Y6DA 4XPYA 1QPUA 1WOLA 2VH3A 3QZCA 3ABMC 4W8PA 1DOVA 2R7SA 1LVKA 4LDKA 1R5ID 2XRHA 3HNKA 3W8HA 2H7VC 3G4XA 2YKZA 4U9EA 4G7OF 4E18A 3K1HA 3ZC4A 1TFOB 4JCZA 4XEFA 3H65A 3MX3A 2IOQA 1E83A 3JSEO 5L3VA 3EFOA 1MNDA 3FAPB 3EHNA 4JIOA 3ASNC 1RCPA 2R25A 3NYJA 3TK0A 3W4YA 1C17M 2H7OA 3R7CA 3RQGA 5JLIA 1OW8A 3LEVA 3SXMA 3IEEA 3DMDA 2CGEA 4YT8A 1NG1A 4GQHA 2MHRA 5L0CA 3I4UA 3T6BA 3US6A 1A0BA 1SYQA 3C7JA 2DYSC 2GDCA 2PNOA 3FHDA 1U0BB 2XLHA 2L7AA 1NZEA 3E9VA 1H9TA 1C02A 3C8GD 1Z7Qc 3G4ZA 1JPJA 4Z9HA 1MQVA 3U2LA 3S90A 2NPUA 2OJQA 2A69F 2YL0A 1QSPA 4CS7A 3JZ0A 5T1DB 1HE9A 4PJJA 2B0HA 4MQ9F 3B29A 2HSQA 4JEAA 5DQTA 2Y3HA 2YQYA 4E7SA 2LP4A 2LFFA 3Q6MA 5CI8A 2BL2A 3O6XA 2J9BA 3C62A 3RKOF 4QDLA 4OINF 1R4TA 1YZAA 4CDAA 2R7TA 4J30B 1YVIA 1OCOC 1LI7A 1Z23A 4OIPF 3DJUB 2KJGA 1M2VB 2M64A 3EGXA 4XTKA 2R7VA 1XWJA 2CNWA 3L0IA 1Z3IX 2UUHA 4E7ZA 1OQCA 1TR2A 1OW7A 3ZQVA 4ZLDA 2L6GA 3TJ5A 4UDVA 1AVOB 1UG7A 3RF3A 3EJNA 5KYWB 4G0HA 3RFYA 1GM5A 2H8AA 4EKWA 5E3CA 4OIRF 3U2MA 1VYKA 1K40A 3IQ6A 4MVOA 2XLDA 2XLEA 3L34A 4ULVA 4U5CE 5T3TA 1K05A 5TJ5E 4FAPB 3K66A 4YWQA 5A6BA 1MMDA 5L0GA 4CS8C 2EPLX 4KBLA 3EGDA 2OEVA 5KYNA 3AGUA 3LEOA 1FR0A 4I1MA 4CJOA 3M79A 2ETSA 3EFOB 3KH2A 1G4WR 2D5RB 1JAFA 2MWQA 1Q0GA 4XQ1A 4E17A 2X0CA 3PMRA 3AG2C 1WGWA 3GM1A 3SYNA 1HW1A 4OD5A 3DWWA 3O55A 2IYLD 5JP7A 3LNMB 1SMYF 3UR3C 1ORYA 1WWPA 1YDIA 2WL8A 2R03A 4ULWA 1O3UA 1OKKD 2IXNA 3C8ZA 3Q6NA 4WJ0A 5COMA 4G7ZF 3VRCA 2A0BA 1ST6A 2R7OA 3AQBA 5DS6A 1ZHWA 2AU5A 3KL4A 4O79A 5COFA 2DYRC 1QVXA 2OQMA 2PF4E 1HMOA 4JC7A 1S05A 3ZTMA 2H7BA 2NSGA 2ZXPA 3VF0A 4N6CA 1OCRC 3CEXA 4E0IA 3CZ6A 3NDBB 2LQGA 3ZIBA 1W2WA 4XEVA 3IQTA 1HW2A 4EUKB 1ZHXA 5BUOA 2EILC 1U6HA 1ZHZA 3LJBA 4CIPA 2R7RA 4W8KA 3FMSA 3U8PA 4IJJA 1CGME 2LK4A 3AG1C 3X2QC 3CAXA 2Q9BA 4CSAC 4YT5A 3TJ6A 1E2XA 2BC5A 4IAQA 4L6RA 1WTYA 3DD7A 3U3BA 4N06A 1TKNA 3JCUQ 3EPVA 3DAFA 4CIHA 4YT4A 3ECSA 1RKEB 3UMKA 3HNJA 4MTFA 4YL1A 2HJ3A 5L0FA 2RD9A 4BJ1A 3RW0A 1T01A 2CDQA 4IGGA 3ATPA 4CS9C 2XLOA 2AP3A 1ORSC 2G62A 1YYJA 3H2VA 4LLEA 1Z6AA 3MYIA 4WGYA 2L6FA 1FMWA 1BDJB 1BR2A 1M2VA 3GEIA 2R7WA 1JOGA 2B0JA 3DM5A 4RDAA 3AJMA 3OEOA 4D4NA 3RVZA 5AC4A 3EGDB 3SEOA 3B0VC 3ZVRA 3M1CB 1ZU4A 5KYWA 3GANA 1VMAA 1UFBA 4P6IC 3HLZA 1KNYA 3K1IC 1VOMA 2UUIA 4YJWA 2JD3A 3ZWIA 2W9YA 4NY3A 4C7OA 4P9FA 2AWYA 4X0RA 2JPUA 3T9OA 2J0WA 1APCA 3LESA 4MW3A 4KNVA 4Z9JA 4XLNF 4CJGA 1QQ3A 4EBKA 4AK9A 3NMKA 3TOLA 2A68F 2JX0A 1Q0MA 2XS8A 1B68A 1RKCA 2ZPAA 2WVNA 4JVSA 1LE4A 2P61A 2G3KA 2CW0F 4NTFA 1FTSA 1YLMA 5B3IA 4O7GA 1OR3A 4I44A 4NTBA 1CPRA 4DRIB 2V3CC 3B9QA 1H9GA 2XLWA 1EI7A 1E84A 5EHHA 2GAQA 3EZIA 2QY9A 1YYXA 1FFTC 3AGTA 4NTAA 256BA 4CDVA 3N2ZB 1C03A 4JEBA 5B1BC 1FFHA 3NKEA 2RSEB 3SXYA 1ZW2A 2HSBA 4D4XA 1NU7D 4JW1A 3O39A 1I4ZA 4JKVA 4PK4A 2YLDA 1EQ1A 2EPNA 5DVWA 5BQGA 4EBBA 4BEMJ 3NYMA 1NFNA 4JE9A 4OIOF 3ASOC 1E86A 3NYLA 5B3SC 2QTVA 1ZU5A 2J7PD 2XL4A 3FVYA 4DOZA 3UNGC 2A0UA 4IAOA 2ZD9A 2FAPB 4MTOA 3ZQYA 2A6HF 3VAYA 1Q0FA 4CS8A 5F5HA 2VC9A 2XM0A 2XS1A 5L0IA 5D92A 2YHSA 4JJGA 5KYXB 1BR1A 2EIMC 1JPNA 2LSEA 1RKEA 1O5HA 2NUPB 3L8JA 3POVA 3QW1A 4GEHA 2TMVP 4BJ6C 1GGQA 2DB4A 4IARA 3TOMA 3HKKA 3FAJA 1BZ4A 2HJMA 4AE4B 4PJNA 1ZHYA 5FCLA 2ASRA 2PX3A 4ZLCA 4HFFB 2DGJA 1BBHA 2C03A 2QLAA 1KTMA 1FAPB 4MNDA 5JSLA 4HE8D 1XZQA 3C8GA 1LI5A 5L0HA 1EKYA 4BJ5C 5A6AA 1CPQA 1YARO 2F22A 3HTKC 3GWLA 3SXZA 3W2VA 3AG3C 3HNIA 1JRAA 5K0IA 2WZLA 2Y69C 2J8WA 2YEVA 3QW0A 2OU6A 4Q7CA 1HMDA 4JTCB 4EHPA 1CGNA 3J06A 1NBBA 5A69A 1TWAA 4XPWA 3U0CA 2WVQA 4NQFA 2WVOA 1RMVA 2PFDA 1OR2A 1D1AA 4EIYA 4U5EE 5L0DA 3WG7C 1TFKB 1YZCA 2OKUA 2WB7A 3X1OA 2A6EF 2GWWA 2X51A 3NRHA 4O6MA 3AG4C 3DM9B 1NLXA 3JT1A 4MVSA 1V55C 1BR4A 3AOUA 4ONSA 3EG9A 4BJTA 4C3DA 5DQZA 1VB5A 2HKVA 2Q4FA 4LLCA 1IW7F 2EPKX 3LS0A 2J46A 1IZMA 1PCXA 1YA9A 1ZYRF 4MVZA 5DS4A 4N6HA 4LDQA 3B0PA 3JRTA 4JTDB 4CS9A 3K6BA 3Q7GA 4RD9A 4U5GA 3HNLA 3QVZA 3S28A 3V5YA 1LPEA 2EIKC 4Q5SF 3EH1A 4O6NA 4U5FE 3JSZA 2J9VA 5JVEA 2KSFA 1NSGB 3GEHA 1VTMP 1V54C 1VYIA 2XXAA 1S7ZA 1HE1A 2YLIA 4MVQA 1WN0A 1Z5ZA 3WHNA 4BG0A 2R7XA 2YL3A 1YJGA 3DKAA 4KNWA 3UGPA 5AC5A 4CX9A 5COGA 4K1OA 4MW8A 4AL0A 4ER9A 3LLKA 5JRAA 1Y4CA 2EPMX 2PX0A 4KI2A 2I8BA 2Q7RA 5L0JA 3FOPA 5F5FA 3S29A 5D91A 2Q3TA 4JJFA 3BRJA 4JZAA 3V7OA 3S84A 5KYXA 2Y39A 4K0DA 4AL1A 3SZRA 3DE8A 5JT4A 3H2UA 2PBEA 1MMNA 4CBEA 1H6GA 1JMWA 2NUPA 1MNEA 3C8GB 1D1BA 3N24A 1QLEC 5HSWA 2WZGA 3TULA 4MS2A 1G5ZA 2MYSA 3A9CA 2ZXOA 3SP1A 2XL8A 3IQCA 3KYJA 4J32B 5E3AA 1TWHA 4HFKB 4AE4A 1JR8A 3T6GB 3U5SA 5KYUA 4AX2A 3WAQA 1D1CA 4XWJA 2ZXRA 2R05A 1YAUO 2IXOA 2J9WA 1FNTc 2A1DD 2HUJA 4PFOA 2XL6A 2HMQA 2VCBA 2KC3A 2KNHA 1ORJA 2XLMA 3JTLO 2P6VA 3LAYA 1D0XA 3QVYA 3GODA 4LACB 4MVMA 3ZG1A 4BEJA 2R02A 1CGOA 5A6KA 2W4BA 2I15A 4NC3A 1XZPA 2QNLA 4PFPA 4C3BA 3S0XA 3KPHA 4JRZA 2FGYA 3EG9B 3NG1A 2HMZA 4H54A 4JURI 1E85A 1QZXA 4DRJB 3EZHA 3V5ZA 2IM8A 3B0UX 4HEAJ 5KYYB 1EA8A 1SF8A 5DLJA 1VLTA 3DXJF 3EH2A 3EHMA 2HS5A 3W2WA 2XM4A 2QE9A 2Y3DA 3I5QA 4DRHB 4XLPF 2ZXWC 4MVUA 2LIGA 1FMVA 3NMIA 5E2QA 2HFIA 4PJMA 4YL0A 1MMAA 3M4CA 3R2PA 5T3WA 3JRMO 1M6TA 1LS1A 1LM3B 2EINC 3MLGA 4BJ6A 1SR2A 2CNWD 2LCHA 3BEHA 4B6IA 4DBQA 1M57C 2L81A 4CDYA 4DVZA 2XXAB 2AVKA 4YN0B 4C7OB 2NUTB 1PD0A 4EBJA 3F46A 3MYFA 2J9UA 1TQGA 2OG2A 2WZFA 5E33A 1G4US 3LLIA 4WABA 4I3MA 5F28E 1RXQA 1PV3A 1ZHTA 4FX5A 2OJED 4RBNA 2GA0A 3U9MA 3U8VA 1OXKA 4BJ5A 5A6BD 3GWNA 4ANJA 2CYDA 5IY5C 3EQLF 2D4UA 2Q9CA 3V5XA 2E87A 1D0YA 1GS9A 2Z15A 4O6YA 3GM2A 4E0HA 2R7QA 1H7IA 1VK5A 3JYYA 1T6UA 4PJLA 2OCCC 3PCVA 4C3EA 1M2OA 3NMJA 1LE2A 5FZTA 2EPOA 1NU9C 1NFOA 1OCCC 3IQ5A 4YK5A 4QI2A 5KYUB 3MBGA 1TWGA 1L7CA 1T9KA 1U89A 4KC9A 3U3FA 1YA7O 3NKDA 5AGFA 3B71A 3RYLA 1K04A 1OXBA 3KMIA 1ZZPA 2HZ8A 4K7BA 3DI5A 3OA1A 5EGYA 5L3QA 1TWCA 1T6IA 1OCZC 4M63A 1LKXA 4H4KC 4IRUA 3WODF 1KU2A 4DXWA 1RJ9B 3KKBA 3LNRA 3RIPA 3N0TA 1LIHA 2IXPA 3GORA 2J7PA 4FESA 2OOCA 3CSKA 3K33A 3SNHA 4YT2A 5HV9A 1Z63A 4QI0A 2YRFA 2XLVA 2L9JA 3RH3A 2QUPA 1ZW3A 1QKRA 4PACA 2EIJC 3IPMO 4IWBA 3C63A 1MMGA 1V4AA 1T6QA 4R32A 1WASA 5B1AC 3RQEA 4A2NB 3UGOA 4CSAA 2VCAA 2YL1A 2P0NA 2W4MA 2VB6A 2L6HA 2PP4A 5EK0A 2W45A 5GPGB 3C18A 2GFHA 4N4WA 4U5DE 1ZVZA 4JCHA
chains in the Genus database with same CATH topology
2KGOA 3LS1A 5KYYA 2IXMA 1PD1A 3E70C 3HJCA 1J8MF 2G3VA 3ITFA 2FFHA 3ABKC 2P7VA 1D0ZA 3T4RA 3PHF2 4U5BE 2O9XA 3AQCA 2VASA 3ABLC 4EWCA 3F47A 3QMKA 3OWTA 3K7DA 3I5PA 3Q7LA 5CI9A 2NUTA 4F4BA 2J45A 1G8XA 4GYTA 4LERA 3DAGA 2YZSA 2Q9AA 4OD4A 1OKKA 2Y3GA 5DS5A 3T6JA 2NG1A 3DZAA 4OIQF 2C04A 3ZSUA 1M56C 3UMIA 3JYHA 2KQ9A 3EGXB 4I1OB 4FWVA 2XSEA 3DJNB 2J0XA 2HV6A 4DVYP 3TD7A 2Y3BA 3W8IA 2BE5F 3FDQA 2HV7A 2KW3C 3CQZA 2R7UA 1O87A 1J8YF 1N1CA 3S27A 4G7HF 3VYWA 4U5HA 1SZIA 4DBRA 4Q4ZF 1RJ9A 3UMHA 2M4EA 2V26A 2VH3A 3QZCA 3ABMC 2R7SA 1LVKA 3W8HA 2XRHA 2H7VC 4G7OF 3K1HA 3ZC4A 3H65A 3MX3A 2IOQA 5L3VA 3EFOA 1MNDA 3EHNA 3ASNC 3NYJA 2H7OA 3LEVA 3IEEA 3DMDA 2CGEA 4YT8A 1NG1A 3I4UA 3T6BA 2DYSC 3FHDA 1NZEA 3E9VA 1JPJA 2A69F 4CS7A 4PJJA 4E7SA 4MQ9F 4KI2A 5DQTA 2Y3HA 3Q6MA 5CI8A 3O6XA 3RKOF 4QDLA 4OINF 2R7TA 4J30B 1OCOC 1Z23A 4OIPF 3DJUB 2KJGA 1M2VB 4XTKA 3EGXA 2R7VA 2CNWA 3L0IA 1Z3IX 4E7ZA 1TR2A 4ZLDA 5KYWB 3EJNA 4G0HA 3RFYA 5E3CA 4OIRF 1VYKA 5T3TA 3S29A 3L34A 4U5CE 4YWQA 3K66A 1MMDA 4CS8C 4KBLA 3EGDA 5KYNA 4I1MA 3EFOB 3KH2A 2D5RB 2MWQA 3PMRA 3AG2C 1WGWA 3SYNA 4OD5A 2IYLD 1SMYF 3UR3C 2WL8A 4ULWA 4WJ0A 1OKKD 4G7ZF 2IXNA 3Q6NA 1ST6A 2R7OA 3AQBA 5DS6A 1ZHWA 3KL4A 4O79A 2DYRC 2PF4E 2H7BA 2ZXPA 1OCRC 3CZ6A 3NDBB 3ZIBA 1W2WA 1ZHXA 5BUOA 2EILC 3LJBA 1ZHZA 2R7RA 4W8KA 4IJJA 3AG1C 3X2QC 2Q9BA 4CSAC 4YT5A 3DD7A 4N06A 1TKNA 3JCUQ 3EPVA 3DAFA 4CIHA 4YT4A 3ECSA 3UMKA 4BJ1A 2CDQA 4CS9C 4LLEA 2G62A 1Z6AA 2R7WA 1M2VA 1FMWA 1BR2A 3DM5A 2B0JA 4RDAA 3OEOA 3EGDB 3SEOA 3B0VC 3ZVRA 3M1CB 1ZU4A 5KYWA 3GANA 1VMAA 4P6IC 3HLZA 3K1IC 1VOMA 4YJWA 2JD3A 2W9YA 4NY3A 4X0RA 2J0WA 3LESA 4XLNF 4KNVA 4AK9A 2A68F 2ZPAA 2WVNA 4JVSA 2G3KA 2CW0F 1FTSA 4O7GA 4I44A 2V3CC 3B9QA 5EHHA 3EZIA 2QY9A 1FFTC 3N2ZB 5B1BC 1FFHA 3NKEA 1NU7D 4JW1A 3O39A 4PK4A 5DVWA 4EBBA 3NYMA 4OIOF 3ASOC 3NYLA 5B3SC 2QTVA 1ZU5A 2J7PD 2XL4A 3FVYA 4DOZA 3UNGC 4IAOA 2A6HF 3VAYA 4CS8A 5F5HA 5D92A 2YHSA 4JJGA 5KYXB 1BR1A 2EIMC 1JPNA 2LSEA 1O5HA 2NUPB 3POVA 4GEHA 4BJ6C 3FAJA 4AE4B 4PJNA 1ZHYA 5FCLA 2PX3A 4ZLCA 4HFFB 2DGJA 2C03A 4MNDA 4HE8D 4BJ5C 3HTKC 3W2VA 3AG3C 2WZLA 2Y69C 2YEVA 4Q7CA 1TWAA 2WVQA 2WVOA 2PFDA 1D1AA 4U5EE 3WG7C 3X1OA 2WB7A 2A6EF 3NRHA 2X51A 4O6MA 3AG4C 3DM9B 3JT1A 1V55C 1BR4A 4C3DA 4BJTA 3EG9A 5DQZA 4LLCA 1IW7F 3LS0A 2J46A 1IZMA 1PCXA 1ZYRF 5DS4A 3B0PA 3JRTA 4CS9A 3K6BA 3Q7GA 4RD9A 4U5GA 3S28A 2EIKC 4Q5SF 3EH1A 4O6NA 4U5FE 3JSZA 2J9VA 1V54C 1VYIA 2XXAA 1S7ZA 4BG0A 1Z5ZA 2R7XA 4KNWA 3UGPA 3LLKA 2PX0A 2I8BA 5F5FA 5D91A 2Q3TA 4JJFA 4JZAA 3V7OA 5KYXA 2Y39A 4K0DA 3SZRA 1MMNA 4CBEA 2NUPA 1MNEA 1D1BA 3N24A 1QLEC 5HSWA 2WZGA 3SP1A 2MYSA 2ZXOA 4J32B 5E3AA 1TWHA 4HFKB 4AE4A 5KYUA 4AX2A 1D1CA 4XWJA 2ZXRA 2IXOA 2J9WA 2A1DD 4PFOA 5T1DB 5T3WA 4C3EA 2KNHA 3LAYA 4C7OB 2P6VA 1D0XA 3GODA 4LACB 3ZG1A 4BEJA 3S0XA 2W4BA 4PFPA 4C3BA 2FGYA 3EG9B 3NG1A 4JURI 1QZXA 3EZHA 3B0UX 4HEAJ 5KYYB 1SF8A 5DLJA 3DXJF 3EH2A 3EHMA 3W2WA 3I5QA 2Y3DA 4XLPF 2ZXWC 1FMVA 5E2QA 4PJMA 1MMAA 1LS1A 2EINC 3MLGA 4BJ6A 2CNWD 4DBQA 4B6IA 1M57C 2L81A 4DVZA 2XXAB 4YN0B 2NUTB 1PD0A 3F46A 2J9UA 2OG2A 2WZFA 5E33A 3LLIA 4I3MA 1ZHTA 4FX5A 4RBNA 4BJ5A 4ANJA 5IY5C 3EQLF 2Q9CA 2E87A 1D0YA 2Z15A 4O6YA 2R7QA 1VK5A 4PJLA 2OCCC 1M2OA 1NU9C 1OCCC 4QI2A 5KYUB 1TWGA 4KC9A 3NKDA 3RYLA 3KMIA 4K7BA 5L3QA 3OA1A 5EGYA 1TWCA 4M63A 1OCZC 3WODF 1LKXA 4H4KC 4IRUA 1KU2A 1RJ9B 3KKBA 3LNRA 3RIPA 3N0TA 2IXPA 2J7PA 4FESA 3CSKA 3K33A 3SNHA 4YT2A 1Z63A 4QI0A 3RH3A 2L9JA 2EIJC 4IWBA 4C7OA 3UGOA 1MMGA 5B1AC 4CSAA 4A2NB 2W4MA 2VB6A 2PP4A 2W45A 4U5DE 2GFHA 4JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXM A;  2HV6 A;  4LAC B;  2IXP A;  2G62 A;  4NY3 A;  2IXO A;  2IXN A;  2HV7 A; 
#chains in the Genus database with same CATH topology
 2KGO A;  3LS1 A;  1A7E A;  3M4B A;  2NSF A;  2IXM A;  1PD1 A;  5KYY A;  3E70 C;  3KYI A;  3HJC A;  1J8M F;  1OW6 A;  2YWA A;  3S9O A;  1AUE A;  2G3V A;  2IBF A;  3ITF A;  3SXK A;  4G78 A;  2FFH A;  1I4Y A;  3PDM P;  3ABK C;  3G50 A;  2P7V A;  1D0Z A;  4XEK A;  5A6J A;  3M15 A;  3T4R A;  2DI3 A;  1AEP A;  3ZDL A;  1Q0D A;  2AWC A;  4U5B E;  5BQH A;  3PHF 2;  2O9X A;  3AQC A;  2VAS A;  3ABL C;  2YVK A;  5JUA A;  1V74 B;  4EWC A;  4U9D A;  3F47 A;  3QMK A;  3OWT A;  4XPX A;  3K7D A;  3I5P A;  3K1I A;  3L8I A;  3Q7L A;  5CI9 A;  2NUT A;  1L3P A;  4F4B A;  4IB4 A;  2J45 A;  1G8X A;  3IHU A;  3MFN A;  4GYT A;  3O10 A;  4LER A;  1F1M A;  4J7Y A;  3DAG A;  4J7T A;  2YZS A;  2ICW G;  2Q9A A;  3FOO A;  4NCQ A;  2P1A A;  1OKK A;  2Y3G A;  2KK1 A;  3L1M A;  4OD4 A;  4P9T A;  5DS5 A;  3T6J A;  4A4A A;  2NG1 A;  4MVR A;  4WGZ A;  4MTG A;  3DZA A;  4YL3 A;  3RVY A;  4OIQ F;  1WAT A;  1A7V A;  2C04 A;  3QTH A;  4PR9 A;  1M56 C;  3ZSU A;  3DE9 A;  3UMI A;  1GQA A;  3U9J A;  3FXH A;  3JYH A;  1T5O A;  2KQ9 A;  3EGX B;  2YL7 A;  4FWV A;  4I1O B;  4Z9I A;  2XSE A;  3DJN B;  2J0X A;  4JTA B;  2HV6 A;  3TQO A;  1DOW A;  3VM6 A;  4DVY P;  3TD7 A;  2Y3B A;  3W8I A;  4BPM A;  2BE5 F;  2VCC A;  3RQF A;  3A11 A;  3FDQ A;  2HV7 A;  2KW3 C;  3CQZ A;  4LDR A;  5CIV A;  2R7U A;  1O87 A;  2KYH A;  1I5N A;  1J8Y F;  2CCY A;  1N1C A;  3S27 A;  5JS5 A;  2LFD A;  1LS4 A;  4G7H F;  3GEE A;  4U5H A;  1SZI A;  3VYW A;  4DBR A;  4Q4Z F;  3LUT B;  1HY5 A;  1RJ9 A;  2LD6 A;  4DJ9 A;  1VLS A;  1Q0K A;  2Q00 A;  2M4E A;  3GM3 A;  3UMH A;  1A41 A;  2V26 A;  5BQI A;  2R9R B;  3ZTZ A;  2YLG A;  2OEX A;  1A7D A;  1Y6D A;  4XPY A;  1QPU A;  1WOL A;  2VH3 A;  3QZC A;  3ABM C;  4W8P A;  1DOV A;  2R7S A;  1LVK A;  4LDK A;  1R5I D;  2XRH A;  3HNK A;  3W8H A;  2H7V C;  3G4X A;  2YKZ A;  4U9E A;  4G7O F;  4E18 A;  3K1H A;  3ZC4 A;  1TFO B;  4JCZ A;  4XEF A;  3H65 A;  3MX3 A;  2IOQ A;  1E83 A;  3JSE O;  5L3V A;  3EFO A;  1MND A;  3FAP B;  3EHN A;  4JIO A;  3ASN C;  1RCP A;  2R25 A;  3NYJ A;  3TK0 A;  3W4Y A;  1C17 M;  2H7O A;  3R7C A;  3RQG A;  5JLI A;  1OW8 A;  3LEV A;  3SXM A;  3IEE A;  3DMD A;  2CGE A;  4YT8 A;  1NG1 A;  4GQH A;  2MHR A;  5L0C A;  3I4U A;  3T6B A;  3US6 A;  1A0B A;  1SYQ A;  3C7J A;  2DYS C;  2GDC A;  2PNO A;  3FHD A;  1U0B B;  2XLH A;  2L7A A;  1NZE A;  3E9V A;  1H9T A;  1C02 A;  3C8G D;  1Z7Q c;  3G4Z A;  1JPJ A;  4Z9H A;  1MQV A;  3U2L A;  3S90 A;  2NPU A;  2OJQ A;  2A69 F;  2YL0 A;  1QSP A;  4CS7 A;  3JZ0 A;  5T1D B;  1HE9 A;  4PJJ A;  2B0H A;  4MQ9 F;  3B29 A;  2HSQ A;  4JEA A;  5DQT A;  2Y3H A;  2YQY A;  4E7S A;  2LP4 A;  2LFF A;  3Q6M A;  5CI8 A;  2BL2 A;  3O6X A;  2J9B A;  3C62 A;  3RKO F;  4QDL A;  4OIN F;  1R4T A;  1YZA A;  4CDA A;  2R7T A;  4J30 B;  1YVI A;  1OCO C;  1LI7 A;  1Z23 A;  4OIP F;  3DJU B;  2KJG A;  1M2V B;  2M64 A;  3EGX A;  4XTK A;  2R7V A;  1XWJ A;  2CNW A;  3L0I A;  1Z3I X;  2UUH A;  4E7Z A;  1OQC A;  1TR2 A;  1OW7 A;  3ZQV A;  4ZLD A;  2L6G A;  3TJ5 A;  4UDV A;  1AVO B;  1UG7 A;  3RF3 A;  3EJN A;  5KYW B;  4G0H A;  3RFY A;  1GM5 A;  2H8A A;  4EKW A;  5E3C A;  4OIR F;  3U2M A;  1VYK A;  1K40 A;  3IQ6 A;  4MVO A;  2XLD A;  2XLE A;  3L34 A;  4ULV A;  4U5C E;  5T3T A;  1K05 A;  5TJ5 E;  4FAP B;  3K66 A;  4YWQ A;  5A6B A;  1MMD A;  5L0G A;  4CS8 C;  2EPL X;  4KBL A;  3EGD A;  2OEV A;  5KYN A;  3AGU A;  3LEO A;  1FR0 A;  4I1M A;  4CJO A;  3M79 A;  2ETS A;  3EFO B;  3KH2 A;  1G4W R;  2D5R B;  1JAF A;  2MWQ A;  1Q0G A;  4XQ1 A;  4E17 A;  2X0C A;  3PMR A;  3AG2 C;  1WGW A;  3GM1 A;  3SYN A;  1HW1 A;  4OD5 A;  3DWW A;  3O55 A;  2IYL D;  5JP7 A;  3LNM B;  1SMY F;  3UR3 C;  1ORY A;  1WWP A;  1YDI A;  2WL8 A;  2R03 A;  4ULW A;  1O3U A;  1OKK D;  2IXN A;  3C8Z A;  3Q6N A;  4WJ0 A;  5COM A;  4G7Z F;  3VRC A;  2A0B A;  1ST6 A;  2R7O A;  3AQB A;  5DS6 A;  1ZHW A;  2AU5 A;  3KL4 A;  4O79 A;  5COF A;  2DYR C;  1QVX A;  2OQM A;  2PF4 E;  1HMO A;  4JC7 A;  1S05 A;  3ZTM A;  2H7B A;  2NSG A;  2ZXP A;  3VF0 A;  4N6C A;  1OCR C;  3CEX A;  4E0I A;  3CZ6 A;  3NDB B;  2LQG A;  3ZIB A;  1W2W A;  4XEV A;  3IQT A;  1HW2 A;  4EUK B;  1ZHX A;  5BUO A;  2EIL C;  1U6H A;  1ZHZ A;  3LJB A;  4CIP A;  2R7R A;  4W8K A;  3FMS A;  3U8P A;  4IJJ A;  1CGM E;  2LK4 A;  3AG1 C;  3X2Q C;  3CAX A;  2Q9B A;  4CSA C;  4YT5 A;  3TJ6 A;  1E2X A;  2BC5 A;  4IAQ A;  4L6R A;  1WTY A;  3DD7 A;  3U3B A;  4N06 A;  1TKN A;  3JCU Q;  3EPV A;  3DAF A;  4CIH A;  4YT4 A;  3ECS A;  1RKE B;  3UMK A;  3HNJ A;  4MTF A;  4YL1 A;  2HJ3 A;  5L0F A;  2RD9 A;  4BJ1 A;  3RW0 A;  1T01 A;  2CDQ A;  4IGG A;  3ATP A;  4CS9 C;  2XLO A;  2AP3 A;  1ORS C;  2G62 A;  1YYJ A;  3H2V A;  4LLE A;  1Z6A A;  3MYI A;  4WGY A;  2L6F A;  1FMW A;  1BDJ B;  1BR2 A;  1M2V A;  3GEI A;  2R7W A;  1JOG A;  2B0J A;  3DM5 A;  4RDA A;  3AJM A;  3OEO A;  4D4N A;  3RVZ A;  5AC4 A;  3EGD B;  3SEO A;  3B0V C;  3ZVR A;  3M1C B;  1ZU4 A;  5KYW A;  3GAN A;  1VMA A;  1UFB A;  4P6I C;  3HLZ A;  1KNY A;  3K1I C;  1VOM A;  2UUI A;  4YJW A;  2JD3 A;  3ZWI A;  2W9Y A;  4NY3 A;  4C7O A;  4P9F A;  2AWY A;  4X0R A;  2JPU A;  3T9O A;  2J0W A;  1APC A;  3LES A;  4MW3 A;  4KNV A;  4Z9J A;  4XLN F;  4CJG A;  1QQ3 A;  4EBK A;  4AK9 A;  3NMK A;  3TOL A;  2A68 F;  2JX0 A;  1Q0M A;  2XS8 A;  1B68 A;  1RKC A;  2ZPA A;  2WVN A;  4JVS A;  1LE4 A;  2P61 A;  2G3K A;  2CW0 F;  4NTF A;  1FTS A;  1YLM A;  5B3I A;  4O7G A;  1OR3 A;  4I44 A;  4NTB A;  1CPR A;  4DRI B;  2V3C C;  3B9Q A;  1H9G A;  2XLW A;  1EI7 A;  1E84 A;  5EHH A;  2GAQ A;  3EZI A;  2QY9 A;  1YYX A;  1FFT C;  3AGT A;  4NTA A;  256B A;  4CDV A;  3N2Z B;  1C03 A;  4JEB A;  5B1B C;  1FFH A;  3NKE A;  2RSE B;  3SXY A;  1ZW2 A;  2HSB A;  4D4X A;  1NU7 D;  4JW1 A;  3O39 A;  1I4Z A;  4JKV A;  4PK4 A;  2YLD A;  1EQ1 A;  2EPN A;  5DVW A;  5BQG A;  4EBB A;  4BEM J;  3NYM A;  1NFN A;  4JE9 A;  4OIO F;  3ASO C;  1E86 A;  3NYL A;  5B3S C;  2QTV A;  1ZU5 A;  2J7P D;  2XL4 A;  3FVY A;  4DOZ A;  3UNG C;  2A0U A;  4IAO A;  2ZD9 A;  2FAP B;  4MTO A;  3ZQY A;  2A6H F;  3VAY A;  1Q0F A;  4CS8 A;  5F5H A;  2VC9 A;  2XM0 A;  2XS1 A;  5L0I A;  5D92 A;  2YHS A;  4JJG A;  5KYX B;  1BR1 A;  2EIM C;  1JPN A;  2LSE A;  1RKE A;  1O5H A;  2NUP B;  3L8J A;  3POV A;  3QW1 A;  4GEH A;  2TMV P;  4BJ6 C;  1GGQ A;  2DB4 A;  4IAR A;  3TOM A;  3HKK A;  3FAJ A;  1BZ4 A;  2HJM A;  4AE4 B;  4PJN A;  1ZHY A;  5FCL A;  2ASR A;  2PX3 A;  4ZLC A;  4HFF B;  2DGJ A;  1BBH A;  2C03 A;  2QLA A;  1KTM A;  1FAP B;  4MND A;  5JSL A;  4HE8 D;  1XZQ A;  3C8G A;  1LI5 A;  5L0H A;  1EKY A;  4BJ5 C;  5A6A A;  1CPQ A;  1YAR O;  2F22 A;  3HTK C;  3GWL A;  3SXZ A;  3W2V A;  3AG3 C;  3HNI A;  1JRA A;  5K0I A;  2WZL A;  2Y69 C;  2J8W A;  2YEV A;  3QW0 A;  2OU6 A;  4Q7C A;  1HMD A;  4JTC B;  4EHP A;  1CGN A;  3J06 A;  1NBB A;  5A69 A;  1TWA A;  4XPW A;  3U0C A;  2WVQ A;  4NQF A;  2WVO A;  1RMV A;  2PFD A;  1OR2 A;  1D1A A;  4EIY A;  4U5E E;  5L0D A;  3WG7 C;  1TFK B;  1YZC A;  2OKU A;  2WB7 A;  3X1O A;  2A6E F;  2GWW A;  2X51 A;  3NRH A;  4O6M A;  3AG4 C;  3DM9 B;  1NLX A;  3JT1 A;  4MVS A;  1V55 C;  1BR4 A;  3AOU A;  4ONS A;  3EG9 A;  4BJT A;  4C3D A;  5DQZ A;  1VB5 A;  2HKV A;  2Q4F A;  4LLC A;  1IW7 F;  2EPK X;  3LS0 A;  2J46 A;  1IZM A;  1PCX A;  1YA9 A;  1ZYR F;  4MVZ A;  5DS4 A;  4N6H A;  4LDQ A;  3B0P A;  3JRT A;  4JTD B;  4CS9 A;  3K6B A;  3Q7G A;  4RD9 A;  4U5G A;  3HNL A;  3QVZ A;  3S28 A;  3V5Y A;  1LPE A;  2EIK C;  4Q5S F;  3EH1 A;  4O6N A;  4U5F E;  3JSZ A;  2J9V A;  5JVE A;  2KSF A;  1NSG B;  3GEH A;  1VTM P;  1V54 C;  1VYI A;  2XXA A;  1S7Z A;  1HE1 A;  2YLI A;  4MVQ A;  1WN0 A;  1Z5Z A;  3WHN A;  4BG0 A;  2R7X A;  2YL3 A;  1YJG A;  3DKA A;  4KNW A;  3UGP A;  5AC5 A;  4CX9 A;  5COG A;  4K1O A;  4MW8 A;  4AL0 A;  4ER9 A;  3LLK A;  5JRA A;  1Y4C A;  2EPM X;  2PX0 A;  4KI2 A;  2I8B A;  2Q7R A;  5L0J A;  3FOP A;  5F5F A;  3S29 A;  5D91 A;  2Q3T A;  4JJF A;  3BRJ A;  4JZA A;  3V7O A;  3S84 A;  5KYX A;  2Y39 A;  4K0D A;  4AL1 A;  3SZR A;  3DE8 A;  5JT4 A;  3H2U A;  2PBE A;  1MMN A;  4CBE A;  1H6G A;  1JMW A;  2NUP A;  1MNE A;  3C8G B;  1D1B A;  3N24 A;  1QLE C;  5HSW A;  2WZG A;  3TUL A;  4MS2 A;  1G5Z A;  2MYS A;  3A9C A;  2ZXO A;  3SP1 A;  2XL8 A;  3IQC A;  3KYJ A;  4J32 B;  5E3A A;  1TWH A;  4HFK B;  4AE4 A;  1JR8 A;  3T6G B;  3U5S A;  5KYU A;  4AX2 A;  3WAQ A;  1D1C A;  4XWJ A;  2ZXR A;  2R05 A;  1YAU O;  2IXO A;  2J9W A;  1FNT c;  2A1D D;  2HUJ A;  4PFO A;  2XL6 A;  2HMQ A;  2VCB A;  2KC3 A;  2KNH A;  1ORJ A;  2XLM A;  3JTL O;  2P6V A;  3LAY A;  1D0X A;  3QVY A;  3GOD A;  4LAC B;  4MVM A;  3ZG1 A;  4BEJ A;  2R02 A;  1CGO A;  5A6K A;  2W4B A;  2I15 A;  4NC3 A;  1XZP A;  2QNL A;  4PFP A;  4C3B A;  3S0X A;  3KPH A;  4JRZ A;  2FGY A;  3EG9 B;  3NG1 A;  2HMZ A;  4H54 A;  4JUR I;  1E85 A;  1QZX A;  4DRJ B;  3EZH A;  3V5Z A;  2IM8 A;  3B0U X;  4HEA J;  5KYY B;  1EA8 A;  1SF8 A;  5DLJ A;  1VLT A;  3DXJ F;  3EH2 A;  3EHM A;  2HS5 A;  3W2W A;  2XM4 A;  2QE9 A;  2Y3D A;  3I5Q A;  4DRH B;  4XLP F;  2ZXW C;  4MVU A;  2LIG A;  1FMV A;  3NMI A;  5E2Q A;  2HFI A;  4PJM A;  4YL0 A;  1MMA A;  3M4C A;  3R2P A;  5T3W A;  3JRM O;  1M6T A;  1LS1 A;  1LM3 B;  2EIN C;  3MLG A;  4BJ6 A;  1SR2 A;  2CNW D;  2LCH A;  3BEH A;  4B6I A;  4DBQ A;  1M57 C;  2L81 A;  4CDY A;  4DVZ A;  2XXA B;  2AVK A;  4YN0 B;  4C7O B;  2NUT B;  1PD0 A;  4EBJ A;  3F46 A;  3MYF A;  2J9U A;  1TQG A;  2OG2 A;  2WZF A;  5E33 A;  1G4U S;  3LLI A;  4WAB A;  4I3M A;  5F28 E;  1RXQ A;  1PV3 A;  1ZHT A;  4FX5 A;  2OJE D;  4RBN A;  2GA0 A;  3U9M A;  3U8V A;  1OXK A;  4BJ5 A;  5A6B D;  3GWN A;  4ANJ A;  2CYD A;  5IY5 C;  3EQL F;  2D4U A;  2Q9C A;  3V5X A;  2E87 A;  1D0Y A;  1GS9 A;  2Z15 A;  4O6Y A;  3GM2 A;  4E0H A;  2R7Q A;  1H7I A;  1VK5 A;  3JYY A;  1T6U A;  4PJL A;  2OCC C;  3PCV A;  4C3E A;  1M2O A;  3NMJ A;  1LE2 A;  5FZT A;  2EPO A;  1NU9 C;  1NFO A;  1OCC C;  3IQ5 A;  4YK5 A;  4QI2 A;  5KYU B;  3MBG A;  1TWG A;  1L7C A;  1T9K A;  1U89 A;  4KC9 A;  3U3F A;  1YA7 O;  3NKD A;  5AGF A;  3B71 A;  3RYL A;  1K04 A;  1OXB A;  3KMI A;  1ZZP A;  2HZ8 A;  4K7B A;  3DI5 A;  3OA1 A;  5EGY A;  5L3Q A;  1TWC A;  1T6I A;  1OCZ C;  4M63 A;  1LKX A;  4H4K C;  4IRU A;  3WOD F;  1KU2 A;  4DXW A;  1RJ9 B;  3KKB A;  3LNR A;  3RIP A;  3N0T A;  1LIH A;  2IXP A;  3GOR A;  2J7P A;  4FES A;  2OOC A;  3CSK A;  3K33 A;  3SNH A;  4YT2 A;  5HV9 A;  1Z63 A;  4QI0 A;  2YRF A;  2XLV A;  2L9J A;  3RH3 A;  2QUP A;  1ZW3 A;  1QKR A;  4PAC A;  2EIJ C;  3IPM O;  4IWB A;  3C63 A;  1MMG A;  1V4A A;  1T6Q A;  4R32 A;  1WAS A;  5B1A C;  3RQE A;  4A2N B;  3UGO A;  4CSA A;  2VCA A;  2YL1 A;  2P0N A;  2W4M A;  2VB6 A;  2L6H A;  2PP4 A;  5EK0 A;  2W45 A;  5GPG B;  3C18 A;  2GFH A;  4N4W A;  4U5D E;  1ZVZ A;  4JCH A; 
#chains in the Genus database with same CATH homology
 2KGO A;  3LS1 A;  5KYY A;  2IXM A;  1PD1 A;  3E70 C;  3HJC A;  1J8M F;  2G3V A;  3ITF A;  2FFH A;  3ABK C;  2P7V A;  1D0Z A;  3T4R A;  3PHF 2;  4U5B E;  2O9X A;  3AQC A;  2VAS A;  3ABL C;  4EWC A;  3F47 A;  3QMK A;  3OWT A;  3K7D A;  3I5P A;  3Q7L A;  5CI9 A;  2NUT A;  4F4B A;  2J45 A;  1G8X A;  4GYT A;  4LER A;  3DAG A;  2YZS A;  2Q9A A;  4OD4 A;  1OKK A;  2Y3G A;  5DS5 A;  3T6J A;  2NG1 A;  3DZA A;  4OIQ F;  2C04 A;  3ZSU A;  1M56 C;  3UMI A;  3JYH A;  2KQ9 A;  3EGX B;  4I1O B;  4FWV A;  2XSE A;  3DJN B;  2J0X A;  2HV6 A;  4DVY P;  3TD7 A;  2Y3B A;  3W8I A;  2BE5 F;  3FDQ A;  2HV7 A;  2KW3 C;  3CQZ A;  2R7U A;  1O87 A;  1J8Y F;  1N1C A;  3S27 A;  4G7H F;  3VYW A;  4U5H A;  1SZI A;  4DBR A;  4Q4Z F;  1RJ9 A;  3UMH A;  2M4E A;  2V26 A;  2VH3 A;  3QZC A;  3ABM C;  2R7S A;  1LVK A;  3W8H A;  2XRH A;  2H7V C;  4G7O F;  3K1H A;  3ZC4 A;  3H65 A;  3MX3 A;  2IOQ A;  5L3V A;  3EFO A;  1MND A;  3EHN A;  3ASN C;  3NYJ A;  2H7O A;  3LEV A;  3IEE A;  3DMD A;  2CGE A;  4YT8 A;  1NG1 A;  3I4U A;  3T6B A;  2DYS C;  3FHD A;  1NZE A;  3E9V A;  1JPJ A;  2A69 F;  4CS7 A;  4PJJ A;  4E7S A;  4MQ9 F;  4KI2 A;  5DQT A;  2Y3H A;  3Q6M A;  5CI8 A;  3O6X A;  3RKO F;  4QDL A;  4OIN F;  2R7T A;  4J30 B;  1OCO C;  1Z23 A;  4OIP F;  3DJU B;  2KJG A;  1M2V B;  4XTK A;  3EGX A;  2R7V A;  2CNW A;  3L0I A;  1Z3I X;  4E7Z A;  1TR2 A;  4ZLD A;  5KYW B;  3EJN A;  4G0H A;  3RFY A;  5E3C A;  4OIR F;  1VYK A;  5T3T A;  3S29 A;  3L34 A;  4U5C E;  4YWQ A;  3K66 A;  1MMD A;  4CS8 C;  4KBL A;  3EGD A;  5KYN A;  4I1M A;  3EFO B;  3KH2 A;  2D5R B;  2MWQ A;  3PMR A;  3AG2 C;  1WGW A;  3SYN A;  4OD5 A;  2IYL D;  1SMY F;  3UR3 C;  2WL8 A;  4ULW A;  4WJ0 A;  1OKK D;  4G7Z F;  2IXN A;  3Q6N A;  1ST6 A;  2R7O A;  3AQB A;  5DS6 A;  1ZHW A;  3KL4 A;  4O79 A;  2DYR C;  2PF4 E;  2H7B A;  2ZXP A;  1OCR C;  3CZ6 A;  3NDB B;  3ZIB A;  1W2W A;  1ZHX A;  5BUO A;  2EIL C;  3LJB A;  1ZHZ A;  2R7R A;  4W8K A;  4IJJ A;  3AG1 C;  3X2Q C;  2Q9B A;  4CSA C;  4YT5 A;  3DD7 A;  4N06 A;  1TKN A;  3JCU Q;  3EPV A;  3DAF A;  4CIH A;  4YT4 A;  3ECS A;  3UMK A;  4BJ1 A;  2CDQ A;  4CS9 C;  4LLE A;  2G62 A;  1Z6A A;  2R7W A;  1M2V A;  1FMW A;  1BR2 A;  3DM5 A;  2B0J A;  4RDA A;  3OEO A;  3EGD B;  3SEO A;  3B0V C;  3ZVR A;  3M1C B;  1ZU4 A;  5KYW A;  3GAN A;  1VMA A;  4P6I C;  3HLZ A;  3K1I C;  1VOM A;  4YJW A;  2JD3 A;  2W9Y A;  4NY3 A;  4X0R A;  2J0W A;  3LES A;  4XLN F;  4KNV A;  4AK9 A;  2A68 F;  2ZPA A;  2WVN A;  4JVS A;  2G3K A;  2CW0 F;  1FTS A;  4O7G A;  4I44 A;  2V3C C;  3B9Q A;  5EHH A;  3EZI A;  2QY9 A;  1FFT C;  3N2Z B;  5B1B C;  1FFH A;  3NKE A;  1NU7 D;  4JW1 A;  3O39 A;  4PK4 A;  5DVW A;  4EBB A;  3NYM A;  4OIO F;  3ASO C;  3NYL A;  5B3S C;  2QTV A;  1ZU5 A;  2J7P D;  2XL4 A;  3FVY A;  4DOZ A;  3UNG C;  4IAO A;  2A6H F;  3VAY A;  4CS8 A;  5F5H A;  5D92 A;  2YHS A;  4JJG A;  5KYX B;  1BR1 A;  2EIM C;  1JPN A;  2LSE A;  1O5H A;  2NUP B;  3POV A;  4GEH A;  4BJ6 C;  3FAJ A;  4AE4 B;  4PJN A;  1ZHY A;  5FCL A;  2PX3 A;  4ZLC A;  4HFF B;  2DGJ A;  2C03 A;  4MND A;  4HE8 D;  4BJ5 C;  3HTK C;  3W2V A;  3AG3 C;  2WZL A;  2Y69 C;  2YEV A;  4Q7C A;  1TWA A;  2WVQ A;  2WVO A;  2PFD A;  1D1A A;  4U5E E;  3WG7 C;  3X1O A;  2WB7 A;  2A6E F;  3NRH A;  2X51 A;  4O6M A;  3AG4 C;  3DM9 B;  3JT1 A;  1V55 C;  1BR4 A;  4C3D A;  4BJT A;  3EG9 A;  5DQZ A;  4LLC A;  1IW7 F;  3LS0 A;  2J46 A;  1IZM A;  1PCX A;  1ZYR F;  5DS4 A;  3B0P A;  3JRT A;  4CS9 A;  3K6B A;  3Q7G A;  4RD9 A;  4U5G A;  3S28 A;  2EIK C;  4Q5S F;  3EH1 A;  4O6N A;  4U5F E;  3JSZ A;  2J9V A;  1V54 C;  1VYI A;  2XXA A;  1S7Z A;  4BG0 A;  1Z5Z A;  2R7X A;  4KNW A;  3UGP A;  3LLK A;  2PX0 A;  2I8B A;  5F5F A;  5D91 A;  2Q3T A;  4JJF A;  4JZA A;  3V7O A;  5KYX A;  2Y39 A;  4K0D A;  3SZR A;  1MMN A;  4CBE A;  2NUP A;  1MNE A;  1D1B A;  3N24 A;  1QLE C;  5HSW A;  2WZG A;  3SP1 A;  2MYS A;  2ZXO A;  4J32 B;  5E3A A;  1TWH A;  4HFK B;  4AE4 A;  5KYU A;  4AX2 A;  1D1C A;  4XWJ A;  2ZXR A;  2IXO A;  2J9W A;  2A1D D;  4PFO A;  5T1D B;  5T3W A;  4C3E A;  2KNH A;  3LAY A;  4C7O B;  2P6V A;  1D0X A;  3GOD A;  4LAC B;  3ZG1 A;  4BEJ A;  3S0X A;  2W4B A;  4PFP A;  4C3B A;  2FGY A;  3EG9 B;  3NG1 A;  4JUR I;  1QZX A;  3EZH A;  3B0U X;  4HEA J;  5KYY B;  1SF8 A;  5DLJ A;  3DXJ F;  3EH2 A;  3EHM A;  3W2W A;  3I5Q A;  2Y3D A;  4XLP F;  2ZXW C;  1FMV A;  5E2Q A;  4PJM A;  1MMA A;  1LS1 A;  2EIN C;  3MLG A;  4BJ6 A;  2CNW D;  4DBQ A;  4B6I A;  1M57 C;  2L81 A;  4DVZ A;  2XXA B;  4YN0 B;  2NUT B;  1PD0 A;  3F46 A;  2J9U A;  2OG2 A;  2WZF A;  5E33 A;  3LLI A;  4I3M A;  1ZHT A;  4FX5 A;  4RBN A;  4BJ5 A;  4ANJ A;  5IY5 C;  3EQL F;  2Q9C A;  2E87 A;  1D0Y A;  2Z15 A;  4O6Y A;  2R7Q A;  1VK5 A;  4PJL A;  2OCC C;  1M2O A;  1NU9 C;  1OCC C;  4QI2 A;  5KYU B;  1TWG A;  4KC9 A;  3NKD A;  3RYL A;  3KMI A;  4K7B A;  5L3Q A;  3OA1 A;  5EGY A;  1TWC A;  4M63 A;  1OCZ C;  3WOD F;  1LKX A;  4H4K C;  4IRU A;  1KU2 A;  1RJ9 B;  3KKB A;  3LNR A;  3RIP A;  3N0T A;  2IXP A;  2J7P A;  4FES A;  3CSK A;  3K33 A;  3SNH A;  4YT2 A;  1Z63 A;  4QI0 A;  3RH3 A;  2L9J A;  2EIJ C;  4IWB A;  4C7O A;  3UGO A;  1MMG A;  5B1A C;  4CSA A;  4A2N B;  2W4M A;  2VB6 A;  2PP4 A;  2W45 A;  4U5D E;  2GFH A;  4JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...