4NY3A

Human ptpa in complex with peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
299
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for PTPA interaction with the invariant C-terminal tail of PP2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords Serine/threonine-protein phosphatase 2A activator
total genus 116
structure length 299
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ny3A02
2HV6A 4LACB 2IXOA 2IXNA 4NY3A 2IXPA 2G62A 2IXMA 2HV7A
chains in the Genus database with same CATH superfamily
1WASA 2JPUA 2AWYA 1YLMA 4I1OB 1XWJA 2EPLX 1TR2A 5F28E 4EWCA 4G78A 3U8VA 4MW8A 2NUTA 5A6BA 4PJNA 3UMIA 2LFFA 1GM5A 2WVOA 2YQYA 5EHHA 1OR3A 3HNIA 5A6KA 1VLTA 2YWAA 4JTCB 1H6GA 1TFKB 2HJ3A 2IXMA 2J9WA 3MLGA 4EHPA 3S84A 4O7GA 2YKZA 2OOCA 4RDAA 4JZAA 3RQGA 3SYNA 4E0IA 3H2VA 1PV3A 1HE1A 3GANA 5CI8A 2QLAA 5L0CA 2QNLA 2KW3C 4BJ5C 2CCYA 1PD0A 1RMVA 4C3BA 4DVYP 3EHMA 4C3DA 2IXOA 4AE4A 1VK5A 4OIOF 3JZ0A 2J0XA 2CNWA 4J32B 2X0CA 1CPQA 2KSFA 3KMIA 3RYLA 2ZD9A 3T6GB 4DOZA 2M64A 2P1AA 2YL1A 3O55A 1D0ZA 4LLEA 4YK5A 2TMVP 1Z23A 1TWAA 1L3PA 1BZ4A 3CQZA 2JD3A 1HMDA 1LPEA 2A0BA 3JTLO 2HFIA 2BL2A 5BUOA 3W4YA 4CS9A 2NUPB 1O87A 4YT4A 1YVIA 4Z9IA 3C62A 2GA0A 2EPOA 2QUPA 1BR2A 1JMWA 4ULWA 2A0UA 2XLWA 3J06A 3W2VA 1RKEA 3T6JA 4AE4B 3DJUB 4JEBA 3LEVA 3PMRA 3S90A 5T3TA 5L3VA 4KBLA 2NG1A 2Q9CA 2W9YA 2ASRA 1ZHXA 1MQVA 2PF4E 1SR2A 4OD4A 3FAJA 2R25A 1EI7A 2R9RB 5KYWB 2BE5F 1WWPA 1Y4CA 4XEFA 2P61A 1A0BA 2KNHA 1T6IA 4OIPF 3C7JA 3UR3C 4YT2A 2P0NA 1S7ZA 4JC7A 1H9GA 2R7OA 4PACA 2J45A 2GDCA 5JVEA 5JT4A 1FMVA 3FVYA 2H7OA 3LAYA 3MBGA 4IGGA 1NBBA 3EJNA 3DI5A 4W8KA 2OQMA 5DS4A 3AQBA 3C8GB 3B71A 1TWCA 1UFBA 4HE8D 2ICWG 3HJCA 2M4EA 3E70C 4ULVA 1A7VA 4X0RA 3QW1A 4HEAJ 4MVQA 5DQZA 4E17A 5KYUB 1SZIA 2KGOA 3CEXA 1C03A 2H7BA 3E9VA 1MNEA 3GEEA 3N2ZB 4MTOA 4XWJA 5L3QA 2Y3HA 3EFOA 3GM2A 2G62A 1MMAA 2OCCC 2XLDA 3MYIA 4K1OA 1DOVA 3SP1A 1M56C 3TK0A 4LLCA 4OIQF 4NC3A 1M6TA 4JIOA 3SXKA 4PJLA 1Z6AA 1AUEA 3O39A 4GQHA 2MWQA 3UNGC 3W8IA 2R7UA 2OEVA 5HSWA 1D1AA 2L7AA 3N24A 1YZCA 2XL4A 3FXHA 3DE8A 2L9JA 3RVYA 2Q7RA 3M4CA 1RKCA 5E2QA 3OEOA 1VYKA 4BEJA 4PJJA 1Q0DA 1OR2A 1EQ1A 5E3CA 2R7QA 3WG7C 1U6HA 2J0WA 4ER9A 3PDMP 1ZHZA 3LJBA 4LDKA 3POVA 3DMDA 4CJGA 1U0BB 2A1DD 2CW0F 3G50A 4CJOA 2CGEA 3GODA 3CAXA 3U2MA 3V7OA 2D4UA 3A9CA 4G0HA 1ORSC 3RKOF 4NTBA 2XS8A 2R7VA 2KYHA 4GYTA 2IXNA 1YA9A 2V26A 5JS5A 2X51A 2XS1A 3MYFA 2HS5A 2P6VA 2VCCA 1MMGA 4OD5A 4K0DA 4YWQA 4CSAC 2OU6A 1LM3B 3HNJA 4BJ5A 1FTSA 3B0UX 2XLVA 3T6BA 1ST6A 3ZTZA 2L6FA 3U5SA 1LIHA 1GGQA 1OCCC 3HNKA 1EKYA 1I5NA 2AU5A 5EK0A 1LI7A 4C3EA 2YRFA 1PCXA 3ATPA 3GM1A 2HMQA 2HJMA 3JYHA 4OIRF 4MVZA 1CGNA 1TWGA 3RQEA 3UMKA 2VH3A 2IM8A 2YL3A 3GWNA 4LERA 1RCPA 1BR4A 4NQFA 5E33A 2XM4A 1K04A 1OXKA 2LFDA 2Y3GA 2PP4A 1D1BA 2Q3TA 1G4WR 1HY5A 1LS1A 1GS9A 2G3VA 2ZXWC 4LACB 3AGTA 3RW0A 1Z63A 1ZW3A 3JCUQ 4NY3A 1M2OA 3B9QA 2J7PD 1Z5ZA 1LKXA 1N1CA 1R5ID 3K66A 2NUTB 1ZHTA 2LQGA 4Z9HA 3AJMA 1JR8A 3KL4A 3ASNC 3B0VC 4QI2A 5F5FA 2R03A 3ZSUA 4FWVA 3DD7A 4P9TA 4KNWA 4WJ0A 4DBRA 2GWWA 3FHDA 3L8JA 4XLNF 3NDBB 4YT5A 1OQCA 3F46A 1JOGA 1BDJB 3ITFA 3U2LA 1OXBA 1NZEA 5A6BD 3VAYA 1K05A 3TJ6A 4BPMA 3NMJA 3VRCA 4FAPB 3TOLA 3U8PA 1VLSA 3M4BA 4CBEA 2NPUA 3JSZA 4W8PA 2XLEA 4AL0A 4E0HA 3IQ6A 3CSKA 3EGDB 3K7DA 1K40A 2NSGA 3Q7GA 4MVOA 2OJQA 1VB5A 2Q9BA 3BRJA 4CX9A 1MMDA 1NU7D 5AC5A 4Z9JA 3Q6NA 4L6RA 2DYRC 2AVKA 4U5HA 2G3KA 256BA 2A6HF 1L7CA 1S05A 5DVWA 2YHSA 1A7DA 4O6NA 4MTFA 4JURI 3AGUA 2A69F 3NRHA 5JP7A 1V55C 5JUAA 1J8YF 2QY9A 3NKEA 3U9JA 3RQFA 1MMNA 1YDIA 4XPYA 1YYJA 5L0FA 4U9EA 1DOWA 1M2VB 4N4WA 4RD9A 3AOUA 2H8AA 4C7OA 3EGDA 3HLZA 1Q0MA 5KYNA 1WN0A 3QVZA 2FAPB 4GEHA 2LCHA 3K6BA 4I3MA 5T3WA 2ZXRA 4D4XA 4I1MA 4CIHA 3PCVA 4JKVA 4LDRA 4PFPA 2R7WA 3NYMA 3NMKA 4CDAA 2L81A 3LS1A 1CPRA 1LE4A 1TWHA 3S27A 3UGOA 3NKDA 5BQHA 1NG1A 2OG2A 5DLJA 2NSFA 3N0TA 4O79A 1J8MF 1Q0FA 1YJGA 5DS5A 3O6XA 2HSQA 2DI3A 4JEAA 4U5FE 1V74B 4E18A 4CS8C 3G4XA 4LDQA 5KYXA 4H54A 2VC9A 3C8ZA 3MX3A 1JRAA 3FAPB 1OW6A 5COFA 5JLIA 2XXAA 4IAQA 3C8GA 3TJ5A 2YL0A 1JAFA 4BJ6C 1YZAA 4IWBA 2DYSC 3U3BA 5FZTA 3HTKC 2OEXA 3KH2A 3Q6MA 3AG4C 2B0JA 1ZW2A 3R7CA 4PK4A 3IPMO 3R2PA 2XM0A 2CDQA 3AQCA 1Z7Qc 3K1IC 4AL1A 3S0XA 4YN0B 1QLEC 4P6IC 3PHF2 5BQIA 2H7VC 3RH3A 4IJJA 5L0IA 2L6HA 3LEOA 4U5CE 5AGFA 5TJ5E 4D4NA 2UUIA 1ZZPA 2YLIA 2J9BA 5B1BC 3AG3C 1O5HA 2Q4FA 4JVSA 1TQGA 2OKUA 2ZXPA 2XLHA 2MHRA 2LIGA 4K7BA 4XTKA 1Q0KA 3WAQA 4H4KC 3VYWA 3ZIBA 3B29A 2QTVA 2HKVA 3X1OA 3I4UA 2Y3BA 2J9UA 2AWCA 3GEHA 1IZMA 5COGA 3JSEO 1YA7O 4UDVA 1KTMA 1OW7A 4IB4A 1T5OA 2EIMC 2KJGA 3QVYA 3C8GD 2R05A 3TD7A 3IQCA 3RF3A 1WOLA 4U5DE 4MVSA 4NTFA 4O6YA 1C17M 2WVQA 2B0HA 4CIPA 4PJMA 5D92A 2R7RA 1HE9A 4U5EE 4EBKA 1G5ZA 2J7PA 3M15A 3EPVA 5GPGB 1U89A 2Z15A 4B6IA 5B3SC 2J9VA 1QQ3A 1NU9C 1SF8A 3FOPA 1AVOB 2LP4A 3U3FA 3UGPA 5L0HA 4N06A 4E7SA 1G8XA 3LUTB 3OWTA 4QI0A 5B3IA 1PD1A 4JTAB 2XRHA 5F5HA 3MFNA 4PR9A 3LESA 1NFOA 2DB4A 3ABKC 2VCBA 1OKKA 2YLGA 2VASA 1M57C 5A6JA 2YVKA 5JRAA 1CGME 3DM9B 3RVZA 4U5BE 3QZCA 3T4RA 3CZ6A 4E7ZA 4BJ6A 3S28A 4IRUA 1ZYRF 4MS2A 2YEVA 3AG1C 1IW7F 2E87A 5E3AA 4YJWA 1ORYA 3L34A 3KYIA 2QE9A 1EA8A 2KK1A 1QPUA 4Q4ZF 1OCZC 2XL8A 4CDYA 3FOOA 5KYXB 2PNOA 5K0IA 3EGXB 2Y39A 4BJTA 1ZU4A 1RKEB 2LK4A 3SXMA 3LNMB 1FNTc 3BEHA 3SNHA 3DXJF 3LLIA 5L0DA 3EH2A 2AP3A 2KC3A 1MNDA 3H65A 2A6EF 1E86A 3W8HA 1QSPA 5CI9A 1ZHYA 4ZLDA 3DKAA 3S29A 4Q5SF 4MVRA 1XZQA 1KNYA 1B68A 2XL6A 3HNLA 4M63A 2W4MA 3AG2C 1LS4A 3DJNB 1R4TA 5L0JA 4YL1A 2P7VA 3QTHA 4XPWA 3SXZA 3U9MA 3FDQA 2Y3DA 4ONSA 3JRTA 1T9KA 1E84A 3SXYA 1V54C 3F47A 3ABLC 3FMSA 2YLDA 4ANJA 2JX0A 4EBBA 5KYYB 2CNWD 3GORA 3K33A 1NLXA 4HFKB 3ZC4A 4ZLCA 3IQ5A 2L6GA 5A69A 5D91A 1D1CA 4OINF 3Q7LA 2EIJC 3DAGA 4DJ9A 1SYQA 1FFHA 2LSEA 4EBJA 5CIVA 2MYSA 4N6CA 3WHNA 2Q9AA 3C18A 3OA1A 2WZGA 3NMIA 1FR0A 4BJ1A 1H9TA 1ZU5A 2LD6A 4J7TA 2EILC 1T6QA 2GFHA 3DE9A 3EH1A 3WODF 2HSBA 4JJGA 4FX5A 4MTGA 1Y6DA 4IAOA 1APCA 1HW2A 3S9OA 1M2VA 2Q00A 3KPHA 3T9OA 3V5ZA 4CS7A 5KYYA 1HW1A 2F22A 3EZIA 3US6A 5A6AA 1YAUO 1BBHA 3O10A 1VTMP 1G4US 1Q0GA 4F4BA 4MVUA 2V3CC 3DM5A 3LLKA 5IY5C 5EGYA 4MNDA 2NUPA 2HZ8A 2FGYA 4G7HF 1XZPA 3ZVRA 1D0XA 4G7ZF 4DXWA 3RFYA 2DGJA 2KQ9A 2VCAA 3ABMC 3JYYA 3L1MA 4MW3A 4WGYA 5BQGA 3ZG1A 3ZQYA 2YZSA 4YT8A 3IQTA 1FAPB 2OJED 1BR1A 4WGZA 1NSGB 1I4YA 1I4ZA 1ORJA 1WATA 1WGWA 2HUJA 2FFHA 3K1IA 1YYXA 3ECSA 3KKBA 4RBNA 4QDLA 1E2XA 2XLOA 3GEIA 3UMHA 4U9DA 1T01A 3EG9B 1NFNA 1F1MA 3K1HA 5KYWA 4DRHB 1KU2A 4YL3A 4DBQA 2IXPA 1TKNA 2IYLD 4NTAA 1JPJA 1RXQA 1TFOB 4KI2A 5T1DB 4XEKA 4J30B 4IARA 4YL0A 2XSEA 3V5XA 4CDVA 1D0YA 3NYJA 2VB6A 4JW1A 4BEMJ 4AK9A 4MVMA 2PX0A 2ETSA 2IOQA 3ZQVA 1RJ9A 2I15A 1E85A 1ZHWA 3DAFA 3JT1A 3QMKA 2J8WA 2UUHA 2W45A 3EHNA 1JPNA 1LE2A 4XPXA 4CS8A 2ZXOA 1QKRA 4EKWA 3U0CA 4G7OF 3H2UA 2GAQA 2EINC 4Q7CA 1OKKD 2WVNA 3NYLA 5KYUA 3RIPA 3L0IA 3QW0A 3W2WA 2A68F 1OCOC 2PBEA 3EG9A 2R7SA 4CSAA 3DWWA 3EFOB 2PX3A 1WTYA 2RSEB 1AEPA 3ZTMA 2ZPAA 1CGOA 1QZXA 5B1AC 4MQ9F 2Y69C 4R32A 2D5RB 5DS6A 3LNRA 4U5GA 3I5QA 3V5YA 1RJ9B 4CS9C 1H7IA 2WL8A 4XEVA 2XLMA 2C03A 5HV9A 1QVXA 1OCRC 2R7TA 1GQAA 3EQLF 3TQOA 3ZDLA 3ZWIA 3L8IA 4DRJB 2WB7A 5L0GA 3TULA 4JCHA 4JJFA 3SEOA 3B0PA 2C04A 3I5PA 3M1CB 4KNVA 3X2QC 4EUKB 2J46A 2WZLA 3A11A 3KYJA 3LS0A 1FMWA 4JTDB 1SMYF 4O6MA 2EPNA 4WABA 4BG0A 1LI5A 2WZFA 4XQ1A 1W2WA 4HFFB 1T6UA 1YARO 5JSLA 1LVKA 3GM3A 2HV7A 4A2NB 1VMAA 4JRZA 2PFDA 1VOMA 3GWLA 4I44A 1A7EA 4JCZA 3VM6A 3DZAA 1C02A 2XXAB 4EIYA 3IEEA 5AC4A 2RD9A 2R7XA 2HV6A 3ASOC 2O9XA 5COMA 1ZVZA 3M79A 3TOMA 4P9FA 4KC9A 4J7YA 1VYIA 2YL7A 1FFTC 2BC5A 4JE9A 1HMOA 2CYDA 3C63A 3NG1A 1A41A 1O3UA 1E83A 4DRIB 1Z3IX 4FESA 3SZRA 1V4AA 5DQTA 3IHUA 1UG7A 4DVZA 2IBFA 4PFOA 2EPKX 2W4BA 4XLPF 2R02A 4AX2A 4NCQA 3HKKA 2HMZA 3EGXA 4A4AA 2I8BA 2EPMX 3JRMO 4C7OB 3G4ZA 4N6HA 3EZHA 3VF0A 1OW8A 2EIKC 5FCLA
chains in the Genus database with same CATH topology
4I1OB 1TR2A 4EWCA 2NUTA 4PJNA 3UMIA 2WVOA 5EHHA 2IXMA 2J9WA 3MLGA 4O7GA 4RDAA 4JZAA 3SYNA 3GANA 5CI8A 2KW3C 4BJ5C 1PD0A 4C3BA 4DVYP 3EHMA 4C3DA 2IXOA 4AE4A 1VK5A 4OIOF 2J0XA 2CNWA 4J32B 3KMIA 3RYLA 4DOZA 4LLEA 1D0ZA 1Z23A 1TWAA 3CQZA 2JD3A 5BUOA 4CS9A 2NUPB 1O87A 4YT4A 4ULWA 1BR2A 3W2VA 3T6JA 4AE4B 3DJUB 3LEVA 3PMRA 5T3TA 5L3VA 4KBLA 2NG1A 2Q9CA 2W9YA 1ZHXA 2PF4E 4OD4A 3FAJA 5KYWB 2BE5F 4OIPF 2KNHA 3UR3C 4YT2A 1S7ZA 2R7OA 2J45A 1FMVA 3FVYA 2H7OA 3LAYA 3EJNA 4W8KA 5DS4A 3AQBA 1TWCA 4HE8D 4CIHA 3HJCA 2M4EA 3E70C 4X0RA 5DQZA 5KYUB 4HEAJ 1SZIA 2KGOA 4YWQA 3E9VA 2H7BA 3N2ZB 1MNEA 4XWJA 5L3QA 2Y3HA 3EFOA 2G62A 1MMAA 2OCCC 4G7OF 3SP1A 1M56C 4LLCA 4OIQF 4PJLA 1Z6AA 3O39A 3UNGC 2MWQA 3W8IA 2R7UA 5HSWA 1D1AA 3N24A 2XL4A 2L9JA 5E2QA 3OEOA 1VYKA 4BEJA 4PJJA 5E3CA 2R7QA 3WG7C 2J0WA 1ZHZA 3LJBA 3POVA 3DMDA 2A1DD 2CW0F 2CGEA 3GODA 3V7OA 4G0HA 3RKOF 2R7VA 4GYTA 2IXNA 2V26A 2X51A 2P6VA 1MMGA 4OD5A 4K0DA 4CSAC 4BJ5A 3B0UX 1FTSA 3T6BA 1ST6A 1OCCC 4C3EA 1PCXA 3JYHA 4OIRF 1TWGA 3UMKA 2VH3A 4LERA 1BR4A 5E33A 2Y3GA 2PP4A 1D1BA 2Q3TA 1LS1A 2ZXWC 2G3VA 4LACB 1Z63A 3JCUQ 4NY3A 1M2OA 3B9QA 2J7PD 1Z5ZA 1LKXA 1N1CA 3K66A 2NUTB 1ZHTA 3KL4A 3ASNC 3B0VC 4QI2A 5F5FA 3ZSUA 4FWVA 3DD7A 4WJ0A 4KNWA 4DBRA 3FHDA 4XLNF 3NDBB 4YT5A 3F46A 3ITFA 1NZEA 3VAYA 4CBEA 3JSZA 3CSKA 3EGDB 3K7DA 3Q7GA 2Q9BA 1MMDA 1NU7D 3Q6NA 2DYRC 4U5HA 2G3KA 2A6HF 5DVWA 2YHSA 4O6NA 4JURI 2A69F 3NRHA 1V55C 1J8YF 2QY9A 3NKEA 1MMNA 1M2VB 4RD9A 4C7OA 3EGDA 3HLZA 5KYNA 4GEHA 3K6BA 4I3MA 5T3WA 2ZXRA 4I1MA 2R7WA 4PFPA 3NYMA 2L81A 3LS1A 1TWHA 3S27A 3UGOA 3NKDA 1NG1A 2OG2A 5DLJA 3N0TA 4O79A 1J8MF 5DS5A 3O6XA 4U5FE 4CS8C 5KYXA 3MX3A 2XXAA 4BJ6C 4IWBA 2DYSC 3HTKC 3KH2A 3Q6MA 3AG4C 2B0JA 4PK4A 2CDQA 3AQCA 3K1IC 3S0XA 4YN0B 1QLEC 4P6IC 3PHF2 2H7VC 3RH3A 4IJJA 2EIKC 4U5CE 5B1BC 3AG3C 1O5HA 4JVSA 2ZXPA 4K7BA 4XTKA 4H4KC 3VYWA 3ZIBA 2QTVA 3X1OA 3I4UA 2Y3BA 2J9UA 1IZMA 2EIMC 2KJGA 3TD7A 4U5DE 4O6YA 2R7RA 2WVQA 4PJMA 5D92A 4U5EE 5B3SC 2J7PA 3EPVA 4B6IA 2Z15A 2J9VA 1NU9C 1SF8A 4N06A 4E7SA 1G8XA 3OWTA 4QI0A 1PD1A 2XRHA 5F5HA 3LESA 3ABKC 1OKKA 2VASA 1M57C 3DM9B 4U5BE 3QZCA 3T4RA 3CZ6A 4E7ZA 4BJ6A 3S28A 4IRUA 1ZYRF 2YEVA 3AG1C 1IW7F 2E87A 5E3AA 4YJWA 3L34A 4Q4ZF 1OCZC 5KYXB 3EGXB 2Y39A 4BJTA 1ZU4A 3SNHA 3DXJF 3LLIA 3EH2A 1MNDA 3H65A 2A6EF 3W8HA 5CI9A 1ZHYA 4ZLDA 3S29A 4Q5SF 4M63A 2W4MA 3AG2C 3DJNB 2P7VA 3FDQA 2Y3DA 3JRTA 1V54C 3F47A 3ABLC 4ANJA 4EBBA 5KYYB 2CNWD 3K33A 4HFKB 3ZC4A 4ZLCA 5D91A 1D1CA 4OINF 3Q7LA 2EIJC 3DAGA 1FFHA 2LSEA 2MYSA 2Q9AA 3OA1A 2WZGA 4BJ1A 1ZU5A 2EILC 2GFHA 3EH1A 3WODF 4JJGA 4FX5A 4IAOA 1M2VA 4CS7A 5KYYA 3EZIA 4F4BA 2V3CC 3DM5A 3LLKA 5IY5C 5EGYA 4MNDA 2NUPA 2FGYA 4G7HF 3ZVRA 1D0XA 4G7ZF 3RFYA 2DGJA 2KQ9A 3ABMC 3ZG1A 2YZSA 4YT8A 1BR1A 2FFHA 3UGPA 1WGWA 3KKBA 3ECSA 4RBNA 4QDLA 3UMHA 3EG9B 3K1HA 5KYWA 1KU2A 4DBQA 2IXPA 1TKNA 2IYLD 1JPJA 4KI2A 5T1DB 4J30B 2XSEA 3NYJA 1D0YA 2VB6A 4JW1A 4AK9A 2PX0A 2IOQA 1RJ9A 1ZHWA 3DAFA 3JT1A 3QMKA 2W45A 3EHNA 1JPNA 4CS8A 2ZXOA 2EINC 4Q7CA 1OKKD 2WVNA 3NYLA 5KYUA 3RIPA 3L0IA 3W2WA 2A68F 1OCOC 3EG9A 2R7SA 4CSAA 3EFOB 2PX3A 2ZPAA 5B1AC 1QZXA 4MQ9F 2Y69C 2D5RB 5DS6A 3LNRA 4U5GA 3I5QA 1RJ9B 4CS9C 2WL8A 2C03A 2R7TA 1OCRC 3EQLF 2WB7A 4JCHA 4JJFA 3SEOA 3B0PA 3M1CB 2C04A 3I5PA 4KNVA 3X2QC 2J46A 2WZLA 3LS0A 1FMWA 1SMYF 4O6MA 4BG0A 2WZFA 1W2WA 4HFFB 1LVKA 2HV7A 4A2NB 1VMAA 2PFDA 1VOMA 4I44A 3DZAA 2XXAB 3IEEA 2R7XA 2HV6A 3ASOC 4KC9A 1VYIA 1FFTC 3NG1A 1Z3IX 4FESA 3SZRA 5DQTA 4DVZA 4PFOA 2W4BA 4XLPF 4AX2A 3EGXA 2I8BA 4C7OB 3EZHA 2O9XA 5FCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV6 A;  4LAC B;  2IXO A;  2IXN A;  4NY3 A;  2IXP A;  2G62 A;  2IXM A;  2HV7 A; 
#chains in the Genus database with same CATH topology
 1WAS A;  2JPU A;  2AWY A;  1YLM A;  4I1O B;  1XWJ A;  2EPL X;  1TR2 A;  5F28 E;  4EWC A;  4G78 A;  3U8V A;  4MW8 A;  2NUT A;  5A6B A;  4PJN A;  3UMI A;  2LFF A;  1GM5 A;  2WVO A;  2YQY A;  5EHH A;  1OR3 A;  3HNI A;  5A6K A;  1VLT A;  2YWA A;  4JTC B;  1H6G A;  1TFK B;  2HJ3 A;  2IXM A;  2J9W A;  3MLG A;  4EHP A;  3S84 A;  4O7G A;  2YKZ A;  2OOC A;  4RDA A;  4JZA A;  3RQG A;  3SYN A;  4E0I A;  3H2V A;  1PV3 A;  1HE1 A;  3GAN A;  5CI8 A;  2QLA A;  5L0C A;  2QNL A;  2KW3 C;  4BJ5 C;  2CCY A;  1PD0 A;  1RMV A;  4C3B A;  4DVY P;  3EHM A;  4C3D A;  2IXO A;  4AE4 A;  1VK5 A;  4OIO F;  3JZ0 A;  2J0X A;  2CNW A;  4J32 B;  2X0C A;  1CPQ A;  2KSF A;  3KMI A;  3RYL A;  2ZD9 A;  3T6G B;  4DOZ A;  2M64 A;  2P1A A;  2YL1 A;  3O55 A;  1D0Z A;  4LLE A;  4YK5 A;  2TMV P;  1Z23 A;  1TWA A;  1L3P A;  1BZ4 A;  3CQZ A;  2JD3 A;  1HMD A;  1LPE A;  2A0B A;  3JTL O;  2HFI A;  2BL2 A;  5BUO A;  3W4Y A;  4CS9 A;  2NUP B;  1O87 A;  4YT4 A;  1YVI A;  4Z9I A;  3C62 A;  2GA0 A;  2EPO A;  2QUP A;  1BR2 A;  1JMW A;  4ULW A;  2A0U A;  2XLW A;  3J06 A;  3W2V A;  1RKE A;  3T6J A;  4AE4 B;  3DJU B;  4JEB A;  3LEV A;  3PMR A;  3S90 A;  5T3T A;  5L3V A;  4KBL A;  2NG1 A;  2Q9C A;  2W9Y A;  2ASR A;  1ZHX A;  1MQV A;  2PF4 E;  1SR2 A;  4OD4 A;  3FAJ A;  2R25 A;  1EI7 A;  2R9R B;  5KYW B;  2BE5 F;  1WWP A;  1Y4C A;  4XEF A;  2P61 A;  1A0B A;  2KNH A;  1T6I A;  4OIP F;  3C7J A;  3UR3 C;  4YT2 A;  2P0N A;  1S7Z A;  4JC7 A;  1H9G A;  2R7O A;  4PAC A;  2J45 A;  2GDC A;  5JVE A;  5JT4 A;  1FMV A;  3FVY A;  2H7O A;  3LAY A;  3MBG A;  4IGG A;  1NBB A;  3EJN A;  3DI5 A;  4W8K A;  2OQM A;  5DS4 A;  3AQB A;  3C8G B;  3B71 A;  1TWC A;  1UFB A;  4HE8 D;  2ICW G;  3HJC A;  2M4E A;  3E70 C;  4ULV A;  1A7V A;  4X0R A;  3QW1 A;  4HEA J;  4MVQ A;  5DQZ A;  4E17 A;  5KYU B;  1SZI A;  2KGO A;  3CEX A;  1C03 A;  2H7B A;  3E9V A;  1MNE A;  3GEE A;  3N2Z B;  4MTO A;  4XWJ A;  5L3Q A;  2Y3H A;  3EFO A;  3GM2 A;  2G62 A;  1MMA A;  2OCC C;  2XLD A;  3MYI A;  4K1O A;  1DOV A;  3SP1 A;  1M56 C;  3TK0 A;  4LLC A;  4OIQ F;  4NC3 A;  1M6T A;  4JIO A;  3SXK A;  4PJL A;  1Z6A A;  1AUE A;  3O39 A;  4GQH A;  2MWQ A;  3UNG C;  3W8I A;  2R7U A;  2OEV A;  5HSW A;  1D1A A;  2L7A A;  3N24 A;  1YZC A;  2XL4 A;  3FXH A;  3DE8 A;  2L9J A;  3RVY A;  2Q7R A;  3M4C A;  1RKC A;  5E2Q A;  3OEO A;  1VYK A;  4BEJ A;  4PJJ A;  1Q0D A;  1OR2 A;  1EQ1 A;  5E3C A;  2R7Q A;  3WG7 C;  1U6H A;  2J0W A;  4ER9 A;  3PDM P;  1ZHZ A;  3LJB A;  4LDK A;  3POV A;  3DMD A;  4CJG A;  1U0B B;  2A1D D;  2CW0 F;  3G50 A;  4CJO A;  2CGE A;  3GOD A;  3CAX A;  3U2M A;  3V7O A;  2D4U A;  3A9C A;  4G0H A;  1ORS C;  3RKO F;  4NTB A;  2XS8 A;  2R7V A;  2KYH A;  4GYT A;  2IXN A;  1YA9 A;  2V26 A;  5JS5 A;  2X51 A;  2XS1 A;  3MYF A;  2HS5 A;  2P6V A;  2VCC A;  1MMG A;  4OD5 A;  4K0D A;  4YWQ A;  4CSA C;  2OU6 A;  1LM3 B;  3HNJ A;  4BJ5 A;  1FTS A;  3B0U X;  2XLV A;  3T6B A;  1ST6 A;  3ZTZ A;  2L6F A;  3U5S A;  1LIH A;  1GGQ A;  1OCC C;  3HNK A;  1EKY A;  1I5N A;  2AU5 A;  5EK0 A;  1LI7 A;  4C3E A;  2YRF A;  1PCX A;  3ATP A;  3GM1 A;  2HMQ A;  2HJM A;  3JYH A;  4OIR F;  4MVZ A;  1CGN A;  1TWG A;  3RQE A;  3UMK A;  2VH3 A;  2IM8 A;  2YL3 A;  3GWN A;  4LER A;  1RCP A;  1BR4 A;  4NQF A;  5E33 A;  2XM4 A;  1K04 A;  1OXK A;  2LFD A;  2Y3G A;  2PP4 A;  1D1B A;  2Q3T A;  1G4W R;  1HY5 A;  1LS1 A;  1GS9 A;  2G3V A;  2ZXW C;  4LAC B;  3AGT A;  3RW0 A;  1Z63 A;  1ZW3 A;  3JCU Q;  4NY3 A;  1M2O A;  3B9Q A;  2J7P D;  1Z5Z A;  1LKX A;  1N1C A;  1R5I D;  3K66 A;  2NUT B;  1ZHT A;  2LQG A;  4Z9H A;  3AJM A;  1JR8 A;  3KL4 A;  3ASN C;  3B0V C;  4QI2 A;  5F5F A;  2R03 A;  3ZSU A;  4FWV A;  3DD7 A;  4P9T A;  4KNW A;  4WJ0 A;  4DBR A;  2GWW A;  3FHD A;  3L8J A;  4XLN F;  3NDB B;  4YT5 A;  1OQC A;  3F46 A;  1JOG A;  1BDJ B;  3ITF A;  3U2L A;  1OXB A;  1NZE A;  5A6B D;  3VAY A;  1K05 A;  3TJ6 A;  4BPM A;  3NMJ A;  3VRC A;  4FAP B;  3TOL A;  3U8P A;  1VLS A;  3M4B A;  4CBE A;  2NPU A;  3JSZ A;  4W8P A;  2XLE A;  4AL0 A;  4E0H A;  3IQ6 A;  3CSK A;  3EGD B;  3K7D A;  1K40 A;  2NSG A;  3Q7G A;  4MVO A;  2OJQ A;  1VB5 A;  2Q9B A;  3BRJ A;  4CX9 A;  1MMD A;  1NU7 D;  5AC5 A;  4Z9J A;  3Q6N A;  4L6R A;  2DYR C;  2AVK A;  4U5H A;  2G3K A;  256B A;  2A6H F;  1L7C A;  1S05 A;  5DVW A;  2YHS A;  1A7D A;  4O6N A;  4MTF A;  4JUR I;  3AGU A;  2A69 F;  3NRH A;  5JP7 A;  1V55 C;  5JUA A;  1J8Y F;  2QY9 A;  3NKE A;  3U9J A;  3RQF A;  1MMN A;  1YDI A;  4XPY A;  1YYJ A;  5L0F A;  4U9E A;  1DOW A;  1M2V B;  4N4W A;  4RD9 A;  3AOU A;  2H8A A;  4C7O A;  3EGD A;  3HLZ A;  1Q0M A;  5KYN A;  1WN0 A;  3QVZ A;  2FAP B;  4GEH A;  2LCH A;  3K6B A;  4I3M A;  5T3W A;  2ZXR A;  4D4X A;  4I1M A;  4CIH A;  3PCV A;  4JKV A;  4LDR A;  4PFP A;  2R7W A;  3NYM A;  3NMK A;  4CDA A;  2L81 A;  3LS1 A;  1CPR A;  1LE4 A;  1TWH A;  3S27 A;  3UGO A;  3NKD A;  5BQH A;  1NG1 A;  2OG2 A;  5DLJ A;  2NSF A;  3N0T A;  4O79 A;  1J8M F;  1Q0F A;  1YJG A;  5DS5 A;  3O6X A;  2HSQ A;  2DI3 A;  4JEA A;  4U5F E;  1V74 B;  4E18 A;  4CS8 C;  3G4X A;  4LDQ A;  5KYX A;  4H54 A;  2VC9 A;  3C8Z A;  3MX3 A;  1JRA A;  3FAP B;  1OW6 A;  5COF A;  5JLI A;  2XXA A;  4IAQ A;  3C8G A;  3TJ5 A;  2YL0 A;  1JAF A;  4BJ6 C;  1YZA A;  4IWB A;  2DYS C;  3U3B A;  5FZT A;  3HTK C;  2OEX A;  3KH2 A;  3Q6M A;  3AG4 C;  2B0J A;  1ZW2 A;  3R7C A;  4PK4 A;  3IPM O;  3R2P A;  2XM0 A;  2CDQ A;  3AQC A;  1Z7Q c;  3K1I C;  4AL1 A;  3S0X A;  4YN0 B;  1QLE C;  4P6I C;  3PHF 2;  5BQI A;  2H7V C;  3RH3 A;  4IJJ A;  5L0I A;  2L6H A;  3LEO A;  4U5C E;  5AGF A;  5TJ5 E;  4D4N A;  2UUI A;  1ZZP A;  2YLI A;  2J9B A;  5B1B C;  3AG3 C;  1O5H A;  2Q4F A;  4JVS A;  1TQG A;  2OKU A;  2ZXP A;  2XLH A;  2MHR A;  2LIG A;  4K7B A;  4XTK A;  1Q0K A;  3WAQ A;  4H4K C;  3VYW A;  3ZIB A;  3B29 A;  2QTV A;  2HKV A;  3X1O A;  3I4U A;  2Y3B A;  2J9U A;  2AWC A;  3GEH A;  1IZM A;  5COG A;  3JSE O;  1YA7 O;  4UDV A;  1KTM A;  1OW7 A;  4IB4 A;  1T5O A;  2EIM C;  2KJG A;  3QVY A;  3C8G D;  2R05 A;  3TD7 A;  3IQC A;  3RF3 A;  1WOL A;  4U5D E;  4MVS A;  4NTF A;  4O6Y A;  1C17 M;  2WVQ A;  2B0H A;  4CIP A;  4PJM A;  5D92 A;  2R7R A;  1HE9 A;  4U5E E;  4EBK A;  1G5Z A;  2J7P A;  3M15 A;  3EPV A;  5GPG B;  1U89 A;  2Z15 A;  4B6I A;  5B3S C;  2J9V A;  1QQ3 A;  1NU9 C;  1SF8 A;  3FOP A;  1AVO B;  2LP4 A;  3U3F A;  3UGP A;  5L0H A;  4N06 A;  4E7S A;  1G8X A;  3LUT B;  3OWT A;  4QI0 A;  5B3I A;  1PD1 A;  4JTA B;  2XRH A;  5F5H A;  3MFN A;  4PR9 A;  3LES A;  1NFO A;  2DB4 A;  3ABK C;  2VCB A;  1OKK A;  2YLG A;  2VAS A;  1M57 C;  5A6J A;  2YVK A;  5JRA A;  1CGM E;  3DM9 B;  3RVZ A;  4U5B E;  3QZC A;  3T4R A;  3CZ6 A;  4E7Z A;  4BJ6 A;  3S28 A;  4IRU A;  1ZYR F;  4MS2 A;  2YEV A;  3AG1 C;  1IW7 F;  2E87 A;  5E3A A;  4YJW A;  1ORY A;  3L34 A;  3KYI A;  2QE9 A;  1EA8 A;  2KK1 A;  1QPU A;  4Q4Z F;  1OCZ C;  2XL8 A;  4CDY A;  3FOO A;  5KYX B;  2PNO A;  5K0I A;  3EGX B;  2Y39 A;  4BJT A;  1ZU4 A;  1RKE B;  2LK4 A;  3SXM A;  3LNM B;  1FNT c;  3BEH A;  3SNH A;  3DXJ F;  3LLI A;  5L0D A;  3EH2 A;  2AP3 A;  2KC3 A;  1MND A;  3H65 A;  2A6E F;  1E86 A;  3W8H A;  1QSP A;  5CI9 A;  1ZHY A;  4ZLD A;  3DKA A;  3S29 A;  4Q5S F;  4MVR A;  1XZQ A;  1KNY A;  1B68 A;  2XL6 A;  3HNL A;  4M63 A;  2W4M A;  3AG2 C;  1LS4 A;  3DJN B;  1R4T A;  5L0J A;  4YL1 A;  2P7V A;  3QTH A;  4XPW A;  3SXZ A;  3U9M A;  3FDQ A;  2Y3D A;  4ONS A;  3JRT A;  1T9K A;  1E84 A;  3SXY A;  1V54 C;  3F47 A;  3ABL C;  3FMS A;  2YLD A;  4ANJ A;  2JX0 A;  4EBB A;  5KYY B;  2CNW D;  3GOR A;  3K33 A;  1NLX A;  4HFK B;  3ZC4 A;  4ZLC A;  3IQ5 A;  2L6G A;  5A69 A;  5D91 A;  1D1C A;  4OIN F;  3Q7L A;  2EIJ C;  3DAG A;  4DJ9 A;  1SYQ A;  1FFH A;  2LSE A;  4EBJ A;  5CIV A;  2MYS A;  4N6C A;  3WHN A;  2Q9A A;  3C18 A;  3OA1 A;  2WZG A;  3NMI A;  1FR0 A;  4BJ1 A;  1H9T A;  1ZU5 A;  2LD6 A;  4J7T A;  2EIL C;  1T6Q A;  2GFH A;  3DE9 A;  3EH1 A;  3WOD F;  2HSB A;  4JJG A;  4FX5 A;  4MTG A;  1Y6D A;  4IAO A;  1APC A;  1HW2 A;  3S9O A;  1M2V A;  2Q00 A;  3KPH A;  3T9O A;  3V5Z A;  4CS7 A;  5KYY A;  1HW1 A;  2F22 A;  3EZI A;  3US6 A;  5A6A A;  1YAU O;  1BBH A;  3O10 A;  1VTM P;  1G4U S;  1Q0G A;  4F4B A;  4MVU A;  2V3C C;  3DM5 A;  3LLK A;  5IY5 C;  5EGY A;  4MND A;  2NUP A;  2HZ8 A;  2FGY A;  4G7H F;  1XZP A;  3ZVR A;  1D0X A;  4G7Z F;  4DXW A;  3RFY A;  2DGJ A;  2KQ9 A;  2VCA A;  3ABM C;  3JYY A;  3L1M A;  4MW3 A;  4WGY A;  5BQG A;  3ZG1 A;  3ZQY A;  2YZS A;  4YT8 A;  3IQT A;  1FAP B;  2OJE D;  1BR1 A;  4WGZ A;  1NSG B;  1I4Y A;  1I4Z A;  1ORJ A;  1WAT A;  1WGW A;  2HUJ A;  2FFH A;  3K1I A;  1YYX A;  3ECS A;  3KKB A;  4RBN A;  4QDL A;  1E2X A;  2XLO A;  3GEI A;  3UMH A;  4U9D A;  1T01 A;  3EG9 B;  1NFN A;  1F1M A;  3K1H A;  5KYW A;  4DRH B;  1KU2 A;  4YL3 A;  4DBQ A;  2IXP A;  1TKN A;  2IYL D;  4NTA A;  1JPJ A;  1RXQ A;  1TFO B;  4KI2 A;  5T1D B;  4XEK A;  4J30 B;  4IAR A;  4YL0 A;  2XSE A;  3V5X A;  4CDV A;  1D0Y A;  3NYJ A;  2VB6 A;  4JW1 A;  4BEM J;  4AK9 A;  4MVM A;  2PX0 A;  2ETS A;  2IOQ A;  3ZQV A;  1RJ9 A;  2I15 A;  1E85 A;  1ZHW A;  3DAF A;  3JT1 A;  3QMK A;  2J8W A;  2UUH A;  2W45 A;  3EHN A;  1JPN A;  1LE2 A;  4XPX A;  4CS8 A;  2ZXO A;  1QKR A;  4EKW A;  3U0C A;  4G7O F;  3H2U A;  2GAQ A;  2EIN C;  4Q7C A;  1OKK D;  2WVN A;  3NYL A;  5KYU A;  3RIP A;  3L0I A;  3QW0 A;  3W2W A;  2A68 F;  1OCO C;  2PBE A;  3EG9 A;  2R7S A;  4CSA A;  3DWW A;  3EFO B;  2PX3 A;  1WTY A;  2RSE B;  1AEP A;  3ZTM A;  2ZPA A;  1CGO A;  1QZX A;  5B1A C;  4MQ9 F;  2Y69 C;  4R32 A;  2D5R B;  5DS6 A;  3LNR A;  4U5G A;  3I5Q A;  3V5Y A;  1RJ9 B;  4CS9 C;  1H7I A;  2WL8 A;  4XEV A;  2XLM A;  2C03 A;  5HV9 A;  1QVX A;  1OCR C;  2R7T A;  1GQA A;  3EQL F;  3TQO A;  3ZDL A;  3ZWI A;  3L8I A;  4DRJ B;  2WB7 A;  5L0G A;  3TUL A;  4JCH A;  4JJF A;  3SEO A;  3B0P A;  2C04 A;  3I5P A;  3M1C B;  4KNV A;  3X2Q C;  4EUK B;  2J46 A;  2WZL A;  3A11 A;  3KYJ A;  3LS0 A;  1FMW A;  4JTD B;  1SMY F;  4O6M A;  2EPN A;  4WAB A;  4BG0 A;  1LI5 A;  2WZF A;  4XQ1 A;  1W2W A;  4HFF B;  1T6U A;  1YAR O;  5JSL A;  1LVK A;  3GM3 A;  2HV7 A;  4A2N B;  1VMA A;  4JRZ A;  2PFD A;  1VOM A;  3GWL A;  4I44 A;  1A7E A;  4JCZ A;  3VM6 A;  3DZA A;  1C02 A;  2XXA B;  4EIY A;  3IEE A;  5AC4 A;  2RD9 A;  2R7X A;  2HV6 A;  3ASO C;  2O9X A;  5COM A;  1ZVZ A;  3M79 A;  3TOM A;  4P9F A;  4KC9 A;  4J7Y A;  1VYI A;  2YL7 A;  1FFT C;  2BC5 A;  4JE9 A;  1HMO A;  2CYD A;  3C63 A;  3NG1 A;  1A41 A;  1O3U A;  1E83 A;  4DRI B;  1Z3I X;  4FES A;  3SZR A;  1V4A A;  5DQT A;  3IHU A;  1UG7 A;  4DVZ A;  2IBF A;  4PFO A;  2EPK X;  2W4B A;  4XLP F;  2R02 A;  4AX2 A;  4NCQ A;  3HKK A;  2HMZ A;  3EGX A;  4A4A A;  2I8B A;  2EPM X;  3JRM O;  4C7O B;  3G4Z A;  4N6H A;  3EZH A;  3VF0 A;  1OW8 A;  2EIK C;  5FCL A; 
#chains in the Genus database with same CATH homology
 4I1O B;  1TR2 A;  4EWC A;  2NUT A;  4PJN A;  3UMI A;  2WVO A;  5EHH A;  2IXM A;  2J9W A;  3MLG A;  4O7G A;  4RDA A;  4JZA A;  3SYN A;  3GAN A;  5CI8 A;  2KW3 C;  4BJ5 C;  1PD0 A;  4C3B A;  4DVY P;  3EHM A;  4C3D A;  2IXO A;  4AE4 A;  1VK5 A;  4OIO F;  2J0X A;  2CNW A;  4J32 B;  3KMI A;  3RYL A;  4DOZ A;  4LLE A;  1D0Z A;  1Z23 A;  1TWA A;  3CQZ A;  2JD3 A;  5BUO A;  4CS9 A;  2NUP B;  1O87 A;  4YT4 A;  4ULW A;  1BR2 A;  3W2V A;  3T6J A;  4AE4 B;  3DJU B;  3LEV A;  3PMR A;  5T3T A;  5L3V A;  4KBL A;  2NG1 A;  2Q9C A;  2W9Y A;  1ZHX A;  2PF4 E;  4OD4 A;  3FAJ A;  5KYW B;  2BE5 F;  4OIP F;  2KNH A;  3UR3 C;  4YT2 A;  1S7Z A;  2R7O A;  2J45 A;  1FMV A;  3FVY A;  2H7O A;  3LAY A;  3EJN A;  4W8K A;  5DS4 A;  3AQB A;  1TWC A;  4HE8 D;  4CIH A;  3HJC A;  2M4E A;  3E70 C;  4X0R A;  5DQZ A;  5KYU B;  4HEA J;  1SZI A;  2KGO A;  4YWQ A;  3E9V A;  2H7B A;  3N2Z B;  1MNE A;  4XWJ A;  5L3Q A;  2Y3H A;  3EFO A;  2G62 A;  1MMA A;  2OCC C;  4G7O F;  3SP1 A;  1M56 C;  4LLC A;  4OIQ F;  4PJL A;  1Z6A A;  3O39 A;  3UNG C;  2MWQ A;  3W8I A;  2R7U A;  5HSW A;  1D1A A;  3N24 A;  2XL4 A;  2L9J A;  5E2Q A;  3OEO A;  1VYK A;  4BEJ A;  4PJJ A;  5E3C A;  2R7Q A;  3WG7 C;  2J0W A;  1ZHZ A;  3LJB A;  3POV A;  3DMD A;  2A1D D;  2CW0 F;  2CGE A;  3GOD A;  3V7O A;  4G0H A;  3RKO F;  2R7V A;  4GYT A;  2IXN A;  2V26 A;  2X51 A;  2P6V A;  1MMG A;  4OD5 A;  4K0D A;  4CSA C;  4BJ5 A;  3B0U X;  1FTS A;  3T6B A;  1ST6 A;  1OCC C;  4C3E A;  1PCX A;  3JYH A;  4OIR F;  1TWG A;  3UMK A;  2VH3 A;  4LER A;  1BR4 A;  5E33 A;  2Y3G A;  2PP4 A;  1D1B A;  2Q3T A;  1LS1 A;  2ZXW C;  2G3V A;  4LAC B;  1Z63 A;  3JCU Q;  4NY3 A;  1M2O A;  3B9Q A;  2J7P D;  1Z5Z A;  1LKX A;  1N1C A;  3K66 A;  2NUT B;  1ZHT A;  3KL4 A;  3ASN C;  3B0V C;  4QI2 A;  5F5F A;  3ZSU A;  4FWV A;  3DD7 A;  4WJ0 A;  4KNW A;  4DBR A;  3FHD A;  4XLN F;  3NDB B;  4YT5 A;  3F46 A;  3ITF A;  1NZE A;  3VAY A;  4CBE A;  3JSZ A;  3CSK A;  3EGD B;  3K7D A;  3Q7G A;  2Q9B A;  1MMD A;  1NU7 D;  3Q6N A;  2DYR C;  4U5H A;  2G3K A;  2A6H F;  5DVW A;  2YHS A;  4O6N A;  4JUR I;  2A69 F;  3NRH A;  1V55 C;  1J8Y F;  2QY9 A;  3NKE A;  1MMN A;  1M2V B;  4RD9 A;  4C7O A;  3EGD A;  3HLZ A;  5KYN A;  4GEH A;  3K6B A;  4I3M A;  5T3W A;  2ZXR A;  4I1M A;  2R7W A;  4PFP A;  3NYM A;  2L81 A;  3LS1 A;  1TWH A;  3S27 A;  3UGO A;  3NKD A;  1NG1 A;  2OG2 A;  5DLJ A;  3N0T A;  4O79 A;  1J8M F;  5DS5 A;  3O6X A;  4U5F E;  4CS8 C;  5KYX A;  3MX3 A;  2XXA A;  4BJ6 C;  4IWB A;  2DYS C;  3HTK C;  3KH2 A;  3Q6M A;  3AG4 C;  2B0J A;  4PK4 A;  2CDQ A;  3AQC A;  3K1I C;  3S0X A;  4YN0 B;  1QLE C;  4P6I C;  3PHF 2;  2H7V C;  3RH3 A;  4IJJ A;  2EIK C;  4U5C E;  5B1B C;  3AG3 C;  1O5H A;  4JVS A;  2ZXP A;  4K7B A;  4XTK A;  4H4K C;  3VYW A;  3ZIB A;  2QTV A;  3X1O A;  3I4U A;  2Y3B A;  2J9U A;  1IZM A;  2EIM C;  2KJG A;  3TD7 A;  4U5D E;  4O6Y A;  2R7R A;  2WVQ A;  4PJM A;  5D92 A;  4U5E E;  5B3S C;  2J7P A;  3EPV A;  4B6I A;  2Z15 A;  2J9V A;  1NU9 C;  1SF8 A;  4N06 A;  4E7S A;  1G8X A;  3OWT A;  4QI0 A;  1PD1 A;  2XRH A;  5F5H A;  3LES A;  3ABK C;  1OKK A;  2VAS A;  1M57 C;  3DM9 B;  4U5B E;  3QZC A;  3T4R A;  3CZ6 A;  4E7Z A;  4BJ6 A;  3S28 A;  4IRU A;  1ZYR F;  2YEV A;  3AG1 C;  1IW7 F;  2E87 A;  5E3A A;  4YJW A;  3L34 A;  4Q4Z F;  1OCZ C;  5KYX B;  3EGX B;  2Y39 A;  4BJT A;  1ZU4 A;  3SNH A;  3DXJ F;  3LLI A;  3EH2 A;  1MND A;  3H65 A;  2A6E F;  3W8H A;  5CI9 A;  1ZHY A;  4ZLD A;  3S29 A;  4Q5S F;  4M63 A;  2W4M A;  3AG2 C;  3DJN B;  2P7V A;  3FDQ A;  2Y3D A;  3JRT A;  1V54 C;  3F47 A;  3ABL C;  4ANJ A;  4EBB A;  5KYY B;  2CNW D;  3K33 A;  4HFK B;  3ZC4 A;  4ZLC A;  5D91 A;  1D1C A;  4OIN F;  3Q7L A;  2EIJ C;  3DAG A;  1FFH A;  2LSE A;  2MYS A;  2Q9A A;  3OA1 A;  2WZG A;  4BJ1 A;  1ZU5 A;  2EIL C;  2GFH A;  3EH1 A;  3WOD F;  4JJG A;  4FX5 A;  4IAO A;  1M2V A;  4CS7 A;  5KYY A;  3EZI A;  4F4B A;  2V3C C;  3DM5 A;  3LLK A;  5IY5 C;  5EGY A;  4MND A;  2NUP A;  2FGY A;  4G7H F;  3ZVR A;  1D0X A;  4G7Z F;  3RFY A;  2DGJ A;  2KQ9 A;  3ABM C;  3ZG1 A;  2YZS A;  4YT8 A;  1BR1 A;  2FFH A;  3UGP A;  1WGW A;  3KKB A;  3ECS A;  4RBN A;  4QDL A;  3UMH A;  3EG9 B;  3K1H A;  5KYW A;  1KU2 A;  4DBQ A;  2IXP A;  1TKN A;  2IYL D;  1JPJ A;  4KI2 A;  5T1D B;  4J30 B;  2XSE A;  3NYJ A;  1D0Y A;  2VB6 A;  4JW1 A;  4AK9 A;  2PX0 A;  2IOQ A;  1RJ9 A;  1ZHW A;  3DAF A;  3JT1 A;  3QMK A;  2W45 A;  3EHN A;  1JPN A;  4CS8 A;  2ZXO A;  2EIN C;  4Q7C A;  1OKK D;  2WVN A;  3NYL A;  5KYU A;  3RIP A;  3L0I A;  3W2W A;  2A68 F;  1OCO C;  3EG9 A;  2R7S A;  4CSA A;  3EFO B;  2PX3 A;  2ZPA A;  5B1A C;  1QZX A;  4MQ9 F;  2Y69 C;  2D5R B;  5DS6 A;  3LNR A;  4U5G A;  3I5Q A;  1RJ9 B;  4CS9 C;  2WL8 A;  2C03 A;  2R7T A;  1OCR C;  3EQL F;  2WB7 A;  4JCH A;  4JJF A;  3SEO A;  3B0P A;  3M1C B;  2C04 A;  3I5P A;  4KNV A;  3X2Q C;  2J46 A;  2WZL A;  3LS0 A;  1FMW A;  1SMY F;  4O6M A;  4BG0 A;  2WZF A;  1W2W A;  4HFF B;  1LVK A;  2HV7 A;  4A2N B;  1VMA A;  2PFD A;  1VOM A;  4I44 A;  3DZA A;  2XXA B;  3IEE A;  2R7X A;  2HV6 A;  3ASO C;  4KC9 A;  1VYI A;  1FFT C;  3NG1 A;  1Z3I X;  4FES A;  3SZR A;  5DQT A;  4DVZ A;  4PFO A;  2W4B A;  4XLP F;  4AX2 A;  3EGX A;  2I8B A;  4C7O B;  3EZH A;  2O9X A;  5FCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...