4NY3A

Human ptpa in complex with peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
299
Chain Sequence
b'NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis for PTPA interaction with the invariant C-terminal tail of PP2A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 116
structure length 299
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ny3A02
2HV7A 2IXNA 2G62A 2IXMA 4NY3A 2IXOA 2IXPA 2HV6A 4LACB
chains in the Genus database with same CATH superfamily
3VAYA 5E3CA 1T6UA 3HNJA 1Y4CA 4XEKA 5L0CA 4XLPF 4IRUA 4GEHA 1MMAA 4CDVA 3I5QA 1VLSA 1OW6A 1O3UA 2EIJC 1VK5A 2P1AA 1HY5A 1FAPB 2VC9A 4MVMA 3O10A 3UMHA 5A6AA 1K40A 3B0UX 3PMRA 4BEMJ 1ZHYA 5KYUA 3AQBA 3SEOA 1H9TA 4BJ1A 3JYHA 4MTFA 3U0CA 2EIMC 1LS4A 2G3VA 4L6RA 1D1BA 1CGNA 2YVKA 4MW3A 4Z9HA 4Z9IA 2C04A 1OKKA 1Q0FA 1JPJA 3HLZA 1A7DA 2D4UA 3NG1A 2GDCA 3AG1C 2MWQA 3EGDA 4DBRA 1XZPA 3C63A 3IQ6A 4JC7A 1T01A 3ASNC 4JW1A 4NC3A 4ANJA 1CGOA 4HFFB 1QQ3A 2XM0A 1T9KA 4NQFA 5JT4A 1U6HA 3N0TA 1ZVZA 3DAFA 3CSKA 2XXAB 3JSZA 2IOQA 3HNLA 3TOMA 1H6GA 1E84A 3EJNA 2LIGA 3LLKA 2J9BA 3OEOA 1T5OA 3NMKA 2J0XA 4E7SA 2J45A 4RBNA 2PP4A 4XEFA 4MVUA 4KNVA 3FAPB 1HE1A 2CCYA 2YLDA 2Q4FA 3KL4A 1ZW3A 3RH3A 4YT8A 1E85A 1MMDA 2NUPA 4JCZA 1YYXA 4KNWA 3V5YA 4U5FE 4O7GA 2VCCA 3QZCA 4K1OA 3MX3A 4XEVA 3RQGA 4JEBA 3PDMP 2R7UA 2DYRC 3GODA 3LS1A 3R2PA 4PR9A 4ZLCA 1YZCA 2EPNA 1LM3B 2OOCA 2Q9AA 3SP1A 1JAFA 2M64A 3RYLA 1D0XA 5A69A 4P9TA 1Q0DA 4J30B 3WAQA 1YA7O 2KQ9A 1MNEA 2PX0A 1TWGA 5B1AC 1A7VA 3Q7GA 3ECSA 4LLEA 3ZTZA 3ASOC 1YARO 2GFHA 2YQYA 3AQCA 4N6HA 1T6QA 3LNRA 3ZWIA 2V3CC 2XLMA 4XPWA 2W4MA 4LERA 4WGZA 2G62A 5EHHA 1AVOB 2EILC 2P7VA 4BJTA 2GA0A 3ZC4A 4A2NB 4NY3A 3JZ0A 1ST6A 4IARA 4KI2A 3C8GD 1ZHXA 4M63A 3FHDA 2AWCA 4D4NA 1OQCA 4EHPA 4O79A 2BL2A 3G4ZA 5BUOA 2H8AA 4OIPF 4IJJA 2HZ8A 4E7ZA 2I8BA 1IW7F 2Y3GA 4FESA 4JJGA 3C62A 1M2OA 3L8JA 4J32B 5JVEA 2W4BA 4BJ5A 1RMVA 2NSFA 2ZXPA 5L0IA 1NG1A 4ULVA 2HV6A 3QVZA 2YL7A 3CEXA 4IB4A 4LLCA 3WODF 4JTAB 1Q0KA 2IXMA 3DXJF 1EQ1A 3LEVA 1FMVA 2XLOA 1L7CA 2HMQA 2LK4A 4MQ9F 4P6IC 3PCVA 4WGYA 1SF8A 2NPUA 2YL0A 4KC9A 4QI2A 1LE2A 2HMZA 1W2WA 2IM8A 2XLWA 4E0HA 5JUAA 3TULA 2A0BA 4C7OB 1ORYA 3KYIA 1WTYA 3O39A 5B3IA 1TWCA 3B29A 3LJBA 1CPQA 2HV7A 3W8IA 3U3BA 2L81A 3LEOA 3TD7A 2A6HF 4BJ6C 4EBJA 2OQMA 3US6A 2D5RB 1TFKB 2EPMX 2R25A 4MTOA 4MVSA 2EPLX 2ICWG 3EGXB 5EGYA 2R7WA 1R4TA 4JIOA 1PV3A 2XRHA 3NKDA 1ZU5A 1G5ZA 3MYFA 3VYWA 4F4BA 2QLAA 5DQZA 1TQGA 2XL4A 2R7OA 3AOUA 2OG2A 2R7XA 1FMWA 3DD7A 2CNWA 2FGYA 2GWWA 3HKKA 3WHNA 5AGFA 1VLTA 4GQHA 3T6GB 2J9VA 3NDBB 1OCRC 3C18A 2KC3A 2XS8A 4E0IA 1BR1A 5HSWA 1HW2A 4C7OA 4AE4B 1K05A 2CW0F 2AU5A 2AP3A 3E9VA 3J06A 3NMJA 4YWQA 2YZSA 3ITFA 2QE9A 2IYLD 2R7VA 5L3VA 1Z63A 2KJGA 2EPKX 5E33A 1YZAA 1S05A 3GEIA 3GEHA 2YL3A 3L34A 5KYNA 2KSFA 2L7AA 3AG3C 2PBEA 3MFNA 4U5DE 3MYIA 1A41A 3EGXA 3V5XA 3W2WA 2Y3BA 2CDQA 4CS7A 2BE5F 3UNGC 1GGQA 2P61A 4EUKB 2E87A 1I5NA 4X0RA 4BG0A 4QI0A 3U2MA 3HTKC 3HJCA 3TOLA 4YT2A 3S90A 2WVNA 3NMIA 2J0WA 3RIPA 2ZXWC 3NYLA 4NTBA 4YL1A 4EWCA 1NLXA 2CYDA 2LQGA 1TWAA 2FAPB 4IWBA 1QLEC 1VYIA 2YKZA 2WB7A 3ZIBA 1S7ZA 3EHMA 2QNLA 1RJ9B 2NUPB 3AJMA 4AE4A 3VF0A 3G50A 2WZLA 3FOOA 3GWLA 1ZHWA 2ETSA 2QY9A 1SZIA 2I15A 5COMA 3S27A 1Z6AA 3MLGA 1RKEA 2Q3TA 3RKOF 2X51A 1FTSA 2PF4E 3LAYA 3OA1A 2LD6A 2HKVA 1LI7A 2X0CA 3G4XA 3I4UA 3RVZA 3UR3C 4FAPB 2L6HA 4EIYA 2MYSA 3JYYA 4W8KA 5JP7A 3U3FA 1EKYA 3B0PA 3RW0A 1Z23A 4PFPA 4N4WA 2Z15A 2L6FA 2XLDA 3TJ6A 5IY5C 2R7RA 4MTGA 3V5ZA 4FX5A 4OD5A 1RJ9A 4GYTA 3EHNA 4LACB 1PD1A 1E2XA 4DVYP 5CI9A 4JURI 3QMKA 1U0BB 1ZYRF 3HNKA 4ULWA 3LESA 2Y39A 2AVKA 4XQ1A 5L0GA 3ZDLA 4OIOF 1QPUA 2NUTA 2HSBA 3ABMC 4I44A 1D1CA 1WWPA 3B71A 4YT5A 5T3WA 3SXKA 5DS6A 4PFOA 5KYXA 4R32A 3HNIA 2RSEB 3C7JA 3U9MA 2JD3A 3KKBA 3V7OA 1MMGA 1GQAA 1ZU4A 2A1DD 3TQOA 3NYMA 5DVWA 4XTKA 3T6JA 2R7TA 1JOGA 1NFOA 1QZXA 3ABLC 4DRJB 3AG2C 5L0FA 3JCUQ 1HMDA 3CZ6A 2XS1A 4WABA 1WASA 5L0DA 5KYWB 4JRZA 4JVSA 3F47A 1MQVA 2NSGA 3IQTA 5A6BA 2L9JA 3U8PA 4JEAA 2J9UA 3SNHA 2MHRA 3UMIA 1OW7A 2PFDA 3FAJA 5DQTA 5KYYA 1Q0GA 3RQFA 4U9EA 3AG4C 3DAGA 3U5SA 2DGJA 2Q9BA 3QW1A 1MNDA 1G4US 3EFOB 2HJMA 1ORSC 4MVQA 3K1IA 4U5BE 4DOZA 4IAOA 2OJED 1WN0A 3NRHA 4W8PA 3TK0A 4CSAA 1LE4A 4CJGA 5FCLA 1D1AA 2IXOA 2P6VA 3IQ5A 1I4YA 3M1CB 3DMDA 4H54A 4U5EE 1V74B 5T1DB 1WGWA 3RQEA 3C8GB 2B0HA 4CX9A 4MVZA 1EI7A 1R5ID 4CS8A 4AX2A 4NTFA 1M56C 1D0YA 1KU2A 1LKXA 2IBFA 2YEVA 1HE9A 3S28A 4DRIB 2LSEA 5A6KA 5KYWA 1QSPA 5L3QA 4CS9A 3ZQVA 2HSQA 2R9RB 4Q7CA 4CS9C 2DYSC 1ZW2A 3LNMB 256BA 4J7YA 5L0JA 2DI3A 3M15A 4FWVA 2F22A 2IXNA 2KGOA 1Y6DA 1TWHA 2CNWD 5B1BC 4LDRA 4MS2A 1NU9C 2R05A 3KMIA 3ZSUA 2R7SA 2J7PD 1M57C 3EFOA 3EH2A 4MVRA 2J8WA 1HMOA 4O6NA 2OU6A 3JTLO 3SXZA 2XSEA 3ZTMA 5GPGB 2R7QA 3BRJA 4AL0A 4IGGA 5CI8A 1J8MF 1A7EA 5D92A 3O6XA 3FVYA 4E18A 4KBLA 3C8GA 1XWJA 1YAUO 4CDYA 4XPXA 4AL1A 1SR2A 4PJJA 3F46A 3KPHA 4E17A 1WATA 3M4BA 1V55C 3DJUB 1CGME 1H9GA 4JE9A 2A6EF 1UG7A 1ORJA 2NG1A 3IHUA 4G7ZF 4JZAA 1A0BA 1FNTc 4LDKA 4YL0A 1SMYF 3W8HA 3EPVA 2IXPA 1RKEB 2P0NA 3EG9B 4G7HF 1AUEA 1OKKD 2OEVA 1FR0A 2R02A 1QKRA 3LS0A 2R03A 3DKAA 3NKEA 3QTHA 4PACA 4U5CE 4O6MA 2L6GA 3EQLF 1Z5ZA 4K0DA 2G3KA 3DI5A 2YRFA 1TFOB 1JRAA 1M2VB 3JT1A 4BJ5C 1TKNA 3LUTB 1RCPA 4HEAJ 5AC4A 5JLIA 1LI5A 5E3AA 4PK4A 3SXMA 1DOVA 1VYKA 3U9JA 2UUIA 1C03A 1E86A 3U8VA 1C02A 1O5HA 2PX3A 2Q9CA 5CIVA 1PD0A 4EBBA 1OXKA 1NU7D 3Q6MA 2FFHA 3E70C 2XLVA 4DRHB 1APCA 2RD9A 1XZQA 4U9DA 2EPOA 3UGOA 4I1MA 2NUTB 4U5HA 2DB4A 5TJ5E 3EG9A 1QVXA 1MMNA 2B0JA 2OEXA 5KYXB 1G8XA 3RF3A 1GS9A 3T6BA 4BPMA 1YJGA 3N2ZB 2J46A 3EH1A 5K0IA 1O87A 3H2VA 4CBEA 2V26A 4MNDA 2Q7RA 5L0HA 3UGPA 2YLIA 1M2VA 3FXHA 2VASA 2YWAA 4JCHA 4ZLDA 3S84A 2XLEA 4JTDB 5DLJA 1JMWA 1Z3IX 1OW8A 3ABKC 4Z9JA 2HFIA 3A11A 3CAXA 1GM5A 3WG7C 5COGA 3RFYA 3AGUA 3DE8A 2TMVP 4OIQF 2WZGA 1B68A 3I5PA 4C3DA 2ZXOA 3M79A 4CJOA 4N06A 4BEJA 4J7TA 4RDAA 3Q6NA 2YHSA 1SYQA 1YYJA 1ZZPA 1FFHA 3JSEO 3AGTA 4H4KC 2WVQA 4ONSA 4C3EA 5A6BD 3KYJA 2JX0A 3L1MA 1M6TA 1Z7Qc 1V4AA 3DWWA 1G4WR 3DZAA 3Q7LA 5D91A 3QVYA 5F28E 3ATPA 4IAQA 1H7IA 2XL8A 2Q00A 4U5GA 3OWTA 3S0XA 1OR3A 4YT4A 4K7BA 1TR2A 1BDJB 4BJ6A 4EKWA 2AWYA 4QDLA 4PJMA 5B3SC 1RXQA 4DVZA 1LIHA 4LDQA 2LFFA 3JRMO 2YL1A 2LP4A 3R7CA 3PHF2 3POVA 5BQGA 3DM5A 5EK0A 3M4CA 5F5HA 4WJ0A 4D4XA 4XPYA 1I4ZA 2WZFA 3SXYA 1N1CA 5AC5A 4EBKA 1VB5A 3FMSA 3U2LA 3EZHA 5F5FA 3S9OA 2C03A 4UDVA 1LPEA 1HW1A 2XXAA 4OINF 3EZIA 1FFTC 3DM9B 2O9XA 2VB6A 4JKVA 3L8IA 3ZG1A 5HV9A 2OKUA 3IQCA 4YN0B 2ZD9A 2CGEA 2KK1A 4YL3A 1Q0MA 3H65A 3KH2A 2BC5A 1CPRA 1UFBA 1OR2A 1JR8A 1YDIA 3GEEA 3T9OA 1E83A 2Y69C 3GWNA 1VTMP 2W45A 5E2QA 3ZVRA 1ZHTA 1NFNA 2VCBA 2A0UA 3A9CA 4C3BA 2UUHA 2Y3HA 1NSGB 2ASRA 4JJFA 3SYNA 4N6CA 2QUPA 3K6BA 2XL6A 1F1MA 3X2QC 2LCHA 3JRTA 3N24A 5BQIA 4G78A 4XWJA 4RD9A 2EIKC 3W4YA 3S29A 2H7VC 2XLHA 5BQHA 3GANA 4CIHA 3BEHA 4YK5A 3MBGA 2KYHA 4CIPA 1BZ4A 2M4EA 2WL8A 2ZPAA 3L0IA 3B0VC 4I1OB 1AEPA 1T6IA 2GAQA 4NCQA 5FZTA 3SZRA 2Y3DA 3W2VA 4Q4ZF 1BR2A 4CDAA 4Q5SF 2EINC 3FOPA 3IEEA 4O6YA 1C17M 4G7OF 4I3MA 1V54C 1OCZC 4MVOA 4DJ9A 5DS5A 1JPNA 1OXBA 3K33A 4G0HA 3GM1A 1U89A 3K7DA 2LFDA 5T3TA 4MW8A 5JRAA 2XM4A 3C8ZA 3CQZA 3FDQA 4HE8D 5DS4A 1OCOC 1K04A 3GORA 2HJ3A 1LVKA 4PJNA 5KYYB 1BBHA 4OD4A 1YA9A 3X1OA 3UMKA 1PCXA 3TJ5A 3T4RA 2A69F 2KW3C 4ER9A 3IPMO 2WVOA 3B9QA 3O55A 4PJLA 2ZXRA 4AK9A 2KNHA 3DJNB 3ZQYA 1D0ZA 3K66A 4YJWA 3K1IC 4XLNF 1VOMA 4DXWA 4NTAA 5A6JA 4OIRF 3VRCA 1KTMA 2HS5A 3GM3A 3VM6A 2A68F 5JS5A 2QTVA 4B6IA 5KYUB 4CSAC 2HUJA 3GM2A 1YLMA 2J7PA 1IZMA 1L3PA 1VMAA 1NBBA 2W9YA 1YVIA 1OCCC 3DE9A 1LS1A 2JPUA 4CS8C 1NZEA 1KNYA 4JTCB 4DBQA 1EA8A 2YLGA 2VH3A 2PNOA 1ZHZA 1BR4A 4P9FA 3EGDB 2H7OA 1DOWA 2OCCC 3K1HA 1RKCA 1WOLA 2OJQA 3H2UA 3NYJA 2H7BA 3QW0A 4HFKB 3RVYA 5COFA 4A4AA 1J8YF 3LLIA 5JSLA 2J9WA 2VCAA
chains in the Genus database with same CATH topology
3VAYA 5E3CA 4XLPF 4IRUA 4GEHA 1MMAA 3I5QA 2EIJC 1VK5A 3UMHA 3B0UX 3PMRA 1ZHYA 5KYUA 3AQBA 3SEOA 4BJ1A 3JYHA 2EIMC 2G3VA 1D1BA 2C04A 1OKKA 3HLZA 1JPJA 3NG1A 3AG1C 2MWQA 3EGDA 4DBRA 3ASNC 4JW1A 4ANJA 4HFFB 3N0TA 3DAFA 3CSKA 2XXAB 3JSZA 2IOQA 3EJNA 3LLKA 3OEOA 2J0XA 4E7SA 2J45A 4RBNA 2PP4A 4KNVA 3KL4A 3RH3A 4YT8A 1MMDA 2NUPA 4KNWA 4U5FE 4O7GA 3QZCA 3MX3A 2R7UA 2DYRC 3GODA 3LS1A 4ZLCA 2Q9AA 3SP1A 3RYLA 1D0XA 4J30B 2KQ9A 1MNEA 2PX0A 1TWGA 5B1AC 3Q7GA 3ECSA 4LLEA 3ASOC 2GFHA 3AQCA 3LNRA 2V3CC 2W4MA 4LERA 2G62A 5EHHA 2EILC 2P7VA 4BJTA 3ZC4A 4A2NB 4NY3A 1ST6A 4KI2A 1ZHXA 4M63A 3FHDA 4O79A 5BUOA 4OIPF 4E7ZA 2I8BA 1IW7F 2Y3GA 4FESA 4JJGA 1M2OA 4J32B 2W4BA 4BJ5A 2ZXPA 1NG1A 2HV6A 3WODF 4LLCA 2IXMA 3DXJF 3LEVA 1FMVA 4P6IC 4MQ9F 1SF8A 4KC9A 4QI2A 1W2WA 4C7OB 3O39A 3LJBA 1TWCA 4BJ6C 2HV7A 3W8IA 2L81A 3TD7A 2A6HF 2D5RB 3EGXB 5EGYA 2R7WA 2XRHA 3NKDA 1ZU5A 3VYWA 4F4BA 5DQZA 2XL4A 2R7OA 2OG2A 2R7XA 1FMWA 3DD7A 2CNWA 2FGYA 2J9VA 3NDBB 1OCRC 5HSWA 1BR1A 4C7OA 4AE4B 2CW0F 3E9VA 4YWQA 2YZSA 3ITFA 2IYLD 2R7VA 5L3VA 1Z63A 2KJGA 5E33A 5KYNA 3L34A 3AG3C 4U5DE 3EGXA 4CS7A 3W2WA 2Y3BA 2CDQA 2BE5F 3UNGC 2E87A 4X0RA 4BG0A 4QI0A 3HTKC 3HJCA 4YT2A 2WVNA 2J0WA 3RIPA 2ZXWC 3NYLA 4EWCA 1TWAA 4IWBA 1QLEC 1VYIA 2WB7A 3ZIBA 1S7ZA 3EHMA 1RJ9B 2NUPB 4AE4A 2WZLA 1ZHWA 2QY9A 1SZIA 3S27A 1Z6AA 3MLGA 2Q3TA 3RKOF 2X51A 1FTSA 2PF4E 3LAYA 3OA1A 3UR3C 3I4UA 2MYSA 4W8KA 3B0PA 1Z23A 4PFPA 2Z15A 5IY5C 2R7RA 4FX5A 4OD5A 1RJ9A 4GYTA 3EHNA 4LACB 1PD1A 4DVYP 5CI9A 4JURI 3QMKA 1ZYRF 4ULWA 3LESA 2Y39A 4OIOF 2NUTA 3ABMC 4I44A 1D1CA 4YT5A 5T3WA 5DS6A 5KYXA 4PFOA 2JD3A 3KKBA 3V7OA 1MMGA 1ZU4A 2A1DD 3NYMA 5DVWA 4XTKA 3T6JA 2R7TA 1QZXA 3ABLC 3AG2C 3JCUQ 3CZ6A 5KYWB 4JVSA 3F47A 2L9JA 2J9UA 3SNHA 3UMIA 2PFDA 3FAJA 5DQTA 3AG4C 3DAGA 2DGJA 2Q9BA 1MNDA 3EFOB 4DOZA 4U5BE 4IAOA 3NRHA 4CSAA 5FCLA 1D1AA 2IXOA 2P6VA 4U5EE 3M1CB 3DMDA 5T1DB 1WGWA 4CS8A 4AX2A 1M56C 1D0YA 1KU2A 1LKXA 2YEVA 3S28A 5KYWA 2LSEA 5L3QA 4CS9A 4Q7CA 2DYSC 4FWVA 2IXNA 2KGOA 2CNWD 1TWHA 5B1BC 1NU9C 3KMIA 3ZSUA 2R7SA 2J7PD 1M57C 3EFOA 3EH2A 4O6NA 2XSEA 2R7QA 5CI8A 1J8MF 5D92A 3O6XA 3FVYA 4KBLA 4PJJA 3F46A 1V55C 3DJUB 2A6EF 4G7ZF 2NG1A 4JZAA 3W8HA 1SMYF 3EPVA 2IXPA 3EG9B 4G7HF 1OKKD 3LS0A 3NKEA 4U5CE 4O6MA 3EQLF 1Z5ZA 4K0DA 2G3KA 1M2VB 3JT1A 4BJ5C 1TKNA 4HEAJ 5E3AA 4PK4A 1VYKA 1O5HA 2PX3A 2Q9CA 1PD0A 4EBBA 1NU7D 3Q6MA 2FFHA 3E70C 3UGOA 4I1MA 2NUTB 4U5HA 3EG9A 1MMNA 2B0JA 5KYXB 1G8XA 3T6BA 3N2ZB 2J46A 3EH1A 1O87A 4CBEA 2V26A 4MNDA 3UGPA 1M2VA 2VASA 4JCHA 4ZLDA 5DLJA 1Z3IX 3ABKC 3WG7C 3RFYA 4OIQF 2WZGA 3I5PA 4C3DA 2ZXOA 4N06A 4BEJA 3Q6NA 2YHSA 4C3EA 1FFHA 4H4KC 2WVQA 3DZAA 3Q7LA 5D91A 4U5GA 3OWTA 3S0XA 4YT4A 4K7BA 1TR2A 4BJ6A 4QDLA 4PJMA 5B3SC 3PHF2 3POVA 5F5HA 3DM5A 4WJ0A 2WZFA 1N1CA 3EZHA 5F5FA 2C03A 2XXAA 4OINF 3EZIA 1FFTC 3DM9B 2O9XA 2VB6A 3ZG1A 4YN0B 2CGEA 3H65A 3KH2A 2Y69C 2W45A 5E2QA 3ZVRA 1ZHTA 4C3BA 2Y3HA 3SYNA 4JJFA 3K6BA 3X2QC 3N24A 3JRTA 4XWJA 4RD9A 2EIKC 3S29A 2H7VC 4CIHA 3GANA 2M4EA 2WL8A 2ZPAA 3L0IA 3B0VC 4I1OB 3SZRA 4Q4ZF 3W2VA 2Y3DA 1BR2A 4Q5SF 2EINC 3IEEA 4O6YA 4G7OF 4I3MA 1V54C 1OCZC 5DS5A 1JPNA 3K33A 4G0HA 3K7DA 5T3TA 3FDQA 3CQZA 4HE8D 5DS4A 1OCOC 1LVKA 4PJNA 5KYYB 4OD4A 3X1OA 3UMKA 1PCXA 3T4RA 2A69F 2KW3C 2WVOA 3B9QA 4PJLA 2ZXRA 4AK9A 2KNHA 3DJNB 1D0ZA 3K66A 4YJWA 3K1IC 4XLNF 1VOMA 4OIRF 4CSAC 2A68F 5KYUB 2QTVA 4B6IA 2J7PA 1IZMA 1VMAA 2W9YA 1OCCC 1LS1A 4DBQA 4CS8C 1NZEA 2VH3A 1ZHZA 1BR4A 4RDAA 3EGDB 2H7OA 3NYJA 2OCCC 3K1HA 4CS9C 4DVZA 5KYYA 2H7BA 4HFKB 1J8YF 3LLIA 2J9WA 4IJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV7 A;  2IXN A;  2G62 A;  2IXM A;  4NY3 A;  2IXO A;  2IXP A;  2HV6 A;  4LAC B; 
#chains in the Genus database with same CATH topology
 3VAY A;  5E3C A;  1T6U A;  3HNJ A;  1Y4C A;  4XEK A;  5L0C A;  4XLP F;  4IRU A;  4GEH A;  1MMA A;  4CDV A;  3I5Q A;  1VLS A;  1OW6 A;  1O3U A;  2EIJ C;  1VK5 A;  2P1A A;  1HY5 A;  1FAP B;  2VC9 A;  4MVM A;  3O10 A;  3UMH A;  5A6A A;  1K40 A;  3B0U X;  3PMR A;  4BEM J;  1ZHY A;  5KYU A;  3AQB A;  3SEO A;  1H9T A;  4BJ1 A;  3JYH A;  4MTF A;  3U0C A;  2EIM C;  1LS4 A;  2G3V A;  4L6R A;  1D1B A;  1CGN A;  2YVK A;  4MW3 A;  4Z9H A;  4Z9I A;  2C04 A;  1OKK A;  1Q0F A;  1JPJ A;  3HLZ A;  1A7D A;  2D4U A;  3NG1 A;  2GDC A;  3AG1 C;  2MWQ A;  3EGD A;  4DBR A;  1XZP A;  3C63 A;  3IQ6 A;  4JC7 A;  1T01 A;  3ASN C;  4JW1 A;  4NC3 A;  4ANJ A;  1CGO A;  4HFF B;  1QQ3 A;  2XM0 A;  1T9K A;  4NQF A;  5JT4 A;  1U6H A;  3N0T A;  1ZVZ A;  3DAF A;  3CSK A;  2XXA B;  3JSZ A;  2IOQ A;  3HNL A;  3TOM A;  1H6G A;  1E84 A;  3EJN A;  2LIG A;  3LLK A;  2J9B A;  3OEO A;  1T5O A;  3NMK A;  2J0X A;  4E7S A;  2J45 A;  4RBN A;  2PP4 A;  4XEF A;  4MVU A;  4KNV A;  3FAP B;  1HE1 A;  2CCY A;  2YLD A;  2Q4F A;  3KL4 A;  1ZW3 A;  3RH3 A;  4YT8 A;  1E85 A;  1MMD A;  2NUP A;  4JCZ A;  1YYX A;  4KNW A;  3V5Y A;  4U5F E;  4O7G A;  2VCC A;  3QZC A;  4K1O A;  3MX3 A;  4XEV A;  3RQG A;  4JEB A;  3PDM P;  2R7U A;  2DYR C;  3GOD A;  3LS1 A;  3R2P A;  4PR9 A;  4ZLC A;  1YZC A;  2EPN A;  1LM3 B;  2OOC A;  2Q9A A;  3SP1 A;  1JAF A;  2M64 A;  3RYL A;  1D0X A;  5A69 A;  4P9T A;  1Q0D A;  4J30 B;  3WAQ A;  1YA7 O;  2KQ9 A;  1MNE A;  2PX0 A;  1TWG A;  5B1A C;  1A7V A;  3Q7G A;  3ECS A;  4LLE A;  3ZTZ A;  3ASO C;  1YAR O;  2GFH A;  2YQY A;  3AQC A;  4N6H A;  1T6Q A;  3LNR A;  3ZWI A;  2V3C C;  2XLM A;  4XPW A;  2W4M A;  4LER A;  4WGZ A;  2G62 A;  5EHH A;  1AVO B;  2EIL C;  2P7V A;  4BJT A;  2GA0 A;  3ZC4 A;  4A2N B;  4NY3 A;  3JZ0 A;  1ST6 A;  4IAR A;  4KI2 A;  3C8G D;  1ZHX A;  4M63 A;  3FHD A;  2AWC A;  4D4N A;  1OQC A;  4EHP A;  4O79 A;  2BL2 A;  3G4Z A;  5BUO A;  2H8A A;  4OIP F;  4IJJ A;  2HZ8 A;  4E7Z A;  2I8B A;  1IW7 F;  2Y3G A;  4FES A;  4JJG A;  3C62 A;  1M2O A;  3L8J A;  4J32 B;  5JVE A;  2W4B A;  4BJ5 A;  1RMV A;  2NSF A;  2ZXP A;  5L0I A;  1NG1 A;  4ULV A;  2HV6 A;  3QVZ A;  2YL7 A;  3CEX A;  4IB4 A;  4LLC A;  3WOD F;  4JTA B;  1Q0K A;  2IXM A;  3DXJ F;  1EQ1 A;  3LEV A;  1FMV A;  2XLO A;  1L7C A;  2HMQ A;  2LK4 A;  4MQ9 F;  4P6I C;  3PCV A;  4WGY A;  1SF8 A;  2NPU A;  2YL0 A;  4KC9 A;  4QI2 A;  1LE2 A;  2HMZ A;  1W2W A;  2IM8 A;  2XLW A;  4E0H A;  5JUA A;  3TUL A;  2A0B A;  4C7O B;  1ORY A;  3KYI A;  1WTY A;  3O39 A;  5B3I A;  1TWC A;  3B29 A;  3LJB A;  1CPQ A;  2HV7 A;  3W8I A;  3U3B A;  2L81 A;  3LEO A;  3TD7 A;  2A6H F;  4BJ6 C;  4EBJ A;  2OQM A;  3US6 A;  2D5R B;  1TFK B;  2EPM X;  2R25 A;  4MTO A;  4MVS A;  2EPL X;  2ICW G;  3EGX B;  5EGY A;  2R7W A;  1R4T A;  4JIO A;  1PV3 A;  2XRH A;  3NKD A;  1ZU5 A;  1G5Z A;  3MYF A;  3VYW A;  4F4B A;  2QLA A;  5DQZ A;  1TQG A;  2XL4 A;  2R7O A;  3AOU A;  2OG2 A;  2R7X A;  1FMW A;  3DD7 A;  2CNW A;  2FGY A;  2GWW A;  3HKK A;  3WHN A;  5AGF A;  1VLT A;  4GQH A;  3T6G B;  2J9V A;  3NDB B;  1OCR C;  3C18 A;  2KC3 A;  2XS8 A;  4E0I A;  1BR1 A;  5HSW A;  1HW2 A;  4C7O A;  4AE4 B;  1K05 A;  2CW0 F;  2AU5 A;  2AP3 A;  3E9V A;  3J06 A;  3NMJ A;  4YWQ A;  2YZS A;  3ITF A;  2QE9 A;  2IYL D;  2R7V A;  5L3V A;  1Z63 A;  2KJG A;  2EPK X;  5E33 A;  1YZA A;  1S05 A;  3GEI A;  3GEH A;  2YL3 A;  3L34 A;  5KYN A;  2KSF A;  2L7A A;  3AG3 C;  2PBE A;  3MFN A;  4U5D E;  3MYI A;  1A41 A;  3EGX A;  3V5X A;  3W2W A;  2Y3B A;  2CDQ A;  4CS7 A;  2BE5 F;  3UNG C;  1GGQ A;  2P61 A;  4EUK B;  2E87 A;  1I5N A;  4X0R A;  4BG0 A;  4QI0 A;  3U2M A;  3HTK C;  3HJC A;  3TOL A;  4YT2 A;  3S90 A;  2WVN A;  3NMI A;  2J0W A;  3RIP A;  2ZXW C;  3NYL A;  4NTB A;  4YL1 A;  4EWC A;  1NLX A;  2CYD A;  2LQG A;  1TWA A;  2FAP B;  4IWB A;  1QLE C;  1VYI A;  2YKZ A;  2WB7 A;  3ZIB A;  1S7Z A;  3EHM A;  2QNL A;  1RJ9 B;  2NUP B;  3AJM A;  4AE4 A;  3VF0 A;  3G50 A;  2WZL A;  3FOO A;  3GWL A;  1ZHW A;  2ETS A;  2QY9 A;  1SZI A;  2I15 A;  5COM A;  3S27 A;  1Z6A A;  3MLG A;  1RKE A;  2Q3T A;  3RKO F;  2X51 A;  1FTS A;  2PF4 E;  3LAY A;  3OA1 A;  2LD6 A;  2HKV A;  1LI7 A;  2X0C A;  3G4X A;  3I4U A;  3RVZ A;  3UR3 C;  4FAP B;  2L6H A;  4EIY A;  2MYS A;  3JYY A;  4W8K A;  5JP7 A;  3U3F A;  1EKY A;  3B0P A;  3RW0 A;  1Z23 A;  4PFP A;  4N4W A;  2Z15 A;  2L6F A;  2XLD A;  3TJ6 A;  5IY5 C;  2R7R A;  4MTG A;  3V5Z A;  4FX5 A;  4OD5 A;  1RJ9 A;  4GYT A;  3EHN A;  4LAC B;  1PD1 A;  1E2X A;  4DVY P;  5CI9 A;  4JUR I;  3QMK A;  1U0B B;  1ZYR F;  3HNK A;  4ULW A;  3LES A;  2Y39 A;  2AVK A;  4XQ1 A;  5L0G A;  3ZDL A;  4OIO F;  1QPU A;  2NUT A;  2HSB A;  3ABM C;  4I44 A;  1D1C A;  1WWP A;  3B71 A;  4YT5 A;  5T3W A;  3SXK A;  5DS6 A;  4PFO A;  5KYX A;  4R32 A;  3HNI A;  2RSE B;  3C7J A;  3U9M A;  2JD3 A;  3KKB A;  3V7O A;  1MMG A;  1GQA A;  1ZU4 A;  2A1D D;  3TQO A;  3NYM A;  5DVW A;  4XTK A;  3T6J A;  2R7T A;  1JOG A;  1NFO A;  1QZX A;  3ABL C;  4DRJ B;  3AG2 C;  5L0F A;  3JCU Q;  1HMD A;  3CZ6 A;  2XS1 A;  4WAB A;  1WAS A;  5L0D A;  5KYW B;  4JRZ A;  4JVS A;  3F47 A;  1MQV A;  2NSG A;  3IQT A;  5A6B A;  2L9J A;  3U8P A;  4JEA A;  2J9U A;  3SNH A;  2MHR A;  3UMI A;  1OW7 A;  2PFD A;  3FAJ A;  5DQT A;  5KYY A;  1Q0G A;  3RQF A;  4U9E A;  3AG4 C;  3DAG A;  3U5S A;  2DGJ A;  2Q9B A;  3QW1 A;  1MND A;  1G4U S;  3EFO B;  2HJM A;  1ORS C;  4MVQ A;  3K1I A;  4U5B E;  4DOZ A;  4IAO A;  2OJE D;  1WN0 A;  3NRH A;  4W8P A;  3TK0 A;  4CSA A;  1LE4 A;  4CJG A;  5FCL A;  1D1A A;  2IXO A;  2P6V A;  3IQ5 A;  1I4Y A;  3M1C B;  3DMD A;  4H54 A;  4U5E E;  1V74 B;  5T1D B;  1WGW A;  3RQE A;  3C8G B;  2B0H A;  4CX9 A;  4MVZ A;  1EI7 A;  1R5I D;  4CS8 A;  4AX2 A;  4NTF A;  1M56 C;  1D0Y A;  1KU2 A;  1LKX A;  2IBF A;  2YEV A;  1HE9 A;  3S28 A;  4DRI B;  2LSE A;  5A6K A;  5KYW A;  1QSP A;  5L3Q A;  4CS9 A;  3ZQV A;  2HSQ A;  2R9R B;  4Q7C A;  4CS9 C;  2DYS C;  1ZW2 A;  3LNM B;  256B A;  4J7Y A;  5L0J A;  2DI3 A;  3M15 A;  4FWV A;  2F22 A;  2IXN A;  2KGO A;  1Y6D A;  1TWH A;  2CNW D;  5B1B C;  4LDR A;  4MS2 A;  1NU9 C;  2R05 A;  3KMI A;  3ZSU A;  2R7S A;  2J7P D;  1M57 C;  3EFO A;  3EH2 A;  4MVR A;  2J8W A;  1HMO A;  4O6N A;  2OU6 A;  3JTL O;  3SXZ A;  2XSE A;  3ZTM A;  5GPG B;  2R7Q A;  3BRJ A;  4AL0 A;  4IGG A;  5CI8 A;  1J8M F;  1A7E A;  5D92 A;  3O6X A;  3FVY A;  4E18 A;  4KBL A;  3C8G A;  1XWJ A;  1YAU O;  4CDY A;  4XPX A;  4AL1 A;  1SR2 A;  4PJJ A;  3F46 A;  3KPH A;  4E17 A;  1WAT A;  3M4B A;  1V55 C;  3DJU B;  1CGM E;  1H9G A;  4JE9 A;  2A6E F;  1UG7 A;  1ORJ A;  2NG1 A;  3IHU A;  4G7Z F;  4JZA A;  1A0B A;  1FNT c;  4LDK A;  4YL0 A;  1SMY F;  3W8H A;  3EPV A;  2IXP A;  1RKE B;  2P0N A;  3EG9 B;  4G7H F;  1AUE A;  1OKK D;  2OEV A;  1FR0 A;  2R02 A;  1QKR A;  3LS0 A;  2R03 A;  3DKA A;  3NKE A;  3QTH A;  4PAC A;  4U5C E;  4O6M A;  2L6G A;  3EQL F;  1Z5Z A;  4K0D A;  2G3K A;  3DI5 A;  2YRF A;  1TFO B;  1JRA A;  1M2V B;  3JT1 A;  4BJ5 C;  1TKN A;  3LUT B;  1RCP A;  4HEA J;  5AC4 A;  5JLI A;  1LI5 A;  5E3A A;  4PK4 A;  3SXM A;  1DOV A;  1VYK A;  3U9J A;  2UUI A;  1C03 A;  1E86 A;  3U8V A;  1C02 A;  1O5H A;  2PX3 A;  2Q9C A;  5CIV A;  1PD0 A;  4EBB A;  1OXK A;  1NU7 D;  3Q6M A;  2FFH A;  3E70 C;  2XLV A;  4DRH B;  1APC A;  2RD9 A;  1XZQ A;  4U9D A;  2EPO A;  3UGO A;  4I1M A;  2NUT B;  4U5H A;  2DB4 A;  5TJ5 E;  3EG9 A;  1QVX A;  1MMN A;  2B0J A;  2OEX A;  5KYX B;  1G8X A;  3RF3 A;  1GS9 A;  3T6B A;  4BPM A;  1YJG A;  3N2Z B;  2J46 A;  3EH1 A;  5K0I A;  1O87 A;  3H2V A;  4CBE A;  2V26 A;  4MND A;  2Q7R A;  5L0H A;  3UGP A;  2YLI A;  1M2V A;  3FXH A;  2VAS A;  2YWA A;  4JCH A;  4ZLD A;  3S84 A;  2XLE A;  4JTD B;  5DLJ A;  1JMW A;  1Z3I X;  1OW8 A;  3ABK C;  4Z9J A;  2HFI A;  3A11 A;  3CAX A;  1GM5 A;  3WG7 C;  5COG A;  3RFY A;  3AGU A;  3DE8 A;  2TMV P;  4OIQ F;  2WZG A;  1B68 A;  3I5P A;  4C3D A;  2ZXO A;  3M79 A;  4CJO A;  4N06 A;  4BEJ A;  4J7T A;  4RDA A;  3Q6N A;  2YHS A;  1SYQ A;  1YYJ A;  1ZZP A;  1FFH A;  3JSE O;  3AGT A;  4H4K C;  2WVQ A;  4ONS A;  4C3E A;  5A6B D;  3KYJ A;  2JX0 A;  3L1M A;  1M6T A;  1Z7Q c;  1V4A A;  3DWW A;  1G4W R;  3DZA A;  3Q7L A;  5D91 A;  3QVY A;  5F28 E;  3ATP A;  4IAQ A;  1H7I A;  2XL8 A;  2Q00 A;  4U5G A;  3OWT A;  3S0X A;  1OR3 A;  4YT4 A;  4K7B A;  1TR2 A;  1BDJ B;  4BJ6 A;  4EKW A;  2AWY A;  4QDL A;  4PJM A;  5B3S C;  1RXQ A;  4DVZ A;  1LIH A;  4LDQ A;  2LFF A;  3JRM O;  2YL1 A;  2LP4 A;  3R7C A;  3PHF 2;  3POV A;  5BQG A;  3DM5 A;  5EK0 A;  3M4C A;  5F5H A;  4WJ0 A;  4D4X A;  4XPY A;  1I4Z A;  2WZF A;  3SXY A;  1N1C A;  5AC5 A;  4EBK A;  1VB5 A;  3FMS A;  3U2L A;  3EZH A;  5F5F A;  3S9O A;  2C03 A;  4UDV A;  1LPE A;  1HW1 A;  2XXA A;  4OIN F;  3EZI A;  1FFT C;  3DM9 B;  2O9X A;  2VB6 A;  4JKV A;  3L8I A;  3ZG1 A;  5HV9 A;  2OKU A;  3IQC A;  4YN0 B;  2ZD9 A;  2CGE A;  2KK1 A;  4YL3 A;  1Q0M A;  3H65 A;  3KH2 A;  2BC5 A;  1CPR A;  1UFB A;  1OR2 A;  1JR8 A;  1YDI A;  3GEE A;  3T9O A;  1E83 A;  2Y69 C;  3GWN A;  1VTM P;  2W45 A;  5E2Q A;  3ZVR A;  1ZHT A;  1NFN A;  2VCB A;  2A0U A;  3A9C A;  4C3B A;  2UUH A;  2Y3H A;  1NSG B;  2ASR A;  4JJF A;  3SYN A;  4N6C A;  2QUP A;  3K6B A;  2XL6 A;  1F1M A;  3X2Q C;  2LCH A;  3JRT A;  3N24 A;  5BQI A;  4G78 A;  4XWJ A;  4RD9 A;  2EIK C;  3W4Y A;  3S29 A;  2H7V C;  2XLH A;  5BQH A;  3GAN A;  4CIH A;  3BEH A;  4YK5 A;  3MBG A;  2KYH A;  4CIP A;  1BZ4 A;  2M4E A;  2WL8 A;  2ZPA A;  3L0I A;  3B0V C;  4I1O B;  1AEP A;  1T6I A;  2GAQ A;  4NCQ A;  5FZT A;  3SZR A;  2Y3D A;  3W2V A;  4Q4Z F;  1BR2 A;  4CDA A;  4Q5S F;  2EIN C;  3FOP A;  3IEE A;  4O6Y A;  1C17 M;  4G7O F;  4I3M A;  1V54 C;  1OCZ C;  4MVO A;  4DJ9 A;  5DS5 A;  1JPN A;  1OXB A;  3K33 A;  4G0H A;  3GM1 A;  1U89 A;  3K7D A;  2LFD A;  5T3T A;  4MW8 A;  5JRA A;  2XM4 A;  3C8Z A;  3CQZ A;  3FDQ A;  4HE8 D;  5DS4 A;  1OCO C;  1K04 A;  3GOR A;  2HJ3 A;  1LVK A;  4PJN A;  5KYY B;  1BBH A;  4OD4 A;  1YA9 A;  3X1O A;  3UMK A;  1PCX A;  3TJ5 A;  3T4R A;  2A69 F;  2KW3 C;  4ER9 A;  3IPM O;  2WVO A;  3B9Q A;  3O55 A;  4PJL A;  2ZXR A;  4AK9 A;  2KNH A;  3DJN B;  3ZQY A;  1D0Z A;  3K66 A;  4YJW A;  3K1I C;  4XLN F;  1VOM A;  4DXW A;  4NTA A;  5A6J A;  4OIR F;  3VRC A;  1KTM A;  2HS5 A;  3GM3 A;  3VM6 A;  2A68 F;  5JS5 A;  2QTV A;  4B6I A;  5KYU B;  4CSA C;  2HUJ A;  3GM2 A;  1YLM A;  2J7P A;  1IZM A;  1L3P A;  1VMA A;  1NBB A;  2W9Y A;  1YVI A;  1OCC C;  3DE9 A;  1LS1 A;  2JPU A;  4CS8 C;  1NZE A;  1KNY A;  4JTC B;  4DBQ A;  1EA8 A;  2YLG A;  2VH3 A;  2PNO A;  1ZHZ A;  1BR4 A;  4P9F A;  3EGD B;  2H7O A;  1DOW A;  2OCC C;  3K1H A;  1RKC A;  1WOL A;  2OJQ A;  3H2U A;  3NYJ A;  2H7B A;  3QW0 A;  4HFK B;  3RVY A;  5COF A;  4A4A A;  1J8Y F;  3LLI A;  5JSL A;  2J9W A;  2VCA A; 
#chains in the Genus database with same CATH homology
 3VAY A;  5E3C A;  4XLP F;  4IRU A;  4GEH A;  1MMA A;  3I5Q A;  2EIJ C;  1VK5 A;  3UMH A;  3B0U X;  3PMR A;  1ZHY A;  5KYU A;  3AQB A;  3SEO A;  4BJ1 A;  3JYH A;  2EIM C;  2G3V A;  1D1B A;  2C04 A;  1OKK A;  3HLZ A;  1JPJ A;  3NG1 A;  3AG1 C;  2MWQ A;  3EGD A;  4DBR A;  3ASN C;  4JW1 A;  4ANJ A;  4HFF B;  3N0T A;  3DAF A;  3CSK A;  2XXA B;  3JSZ A;  2IOQ A;  3EJN A;  3LLK A;  3OEO A;  2J0X A;  4E7S A;  2J45 A;  4RBN A;  2PP4 A;  4KNV A;  3KL4 A;  3RH3 A;  4YT8 A;  1MMD A;  2NUP A;  4KNW A;  4U5F E;  4O7G A;  3QZC A;  3MX3 A;  2R7U A;  2DYR C;  3GOD A;  3LS1 A;  4ZLC A;  2Q9A A;  3SP1 A;  3RYL A;  1D0X A;  4J30 B;  2KQ9 A;  1MNE A;  2PX0 A;  1TWG A;  5B1A C;  3Q7G A;  3ECS A;  4LLE A;  3ASO C;  2GFH A;  3AQC A;  3LNR A;  2V3C C;  2W4M A;  4LER A;  2G62 A;  5EHH A;  2EIL C;  2P7V A;  4BJT A;  3ZC4 A;  4A2N B;  4NY3 A;  1ST6 A;  4KI2 A;  1ZHX A;  4M63 A;  3FHD A;  4O79 A;  5BUO A;  4OIP F;  4E7Z A;  2I8B A;  1IW7 F;  2Y3G A;  4FES A;  4JJG A;  1M2O A;  4J32 B;  2W4B A;  4BJ5 A;  2ZXP A;  1NG1 A;  2HV6 A;  3WOD F;  4LLC A;  2IXM A;  3DXJ F;  3LEV A;  1FMV A;  4P6I C;  4MQ9 F;  1SF8 A;  4KC9 A;  4QI2 A;  1W2W A;  4C7O B;  3O39 A;  3LJB A;  1TWC A;  4BJ6 C;  2HV7 A;  3W8I A;  2L81 A;  3TD7 A;  2A6H F;  2D5R B;  3EGX B;  5EGY A;  2R7W A;  2XRH A;  3NKD A;  1ZU5 A;  3VYW A;  4F4B A;  5DQZ A;  2XL4 A;  2R7O A;  2OG2 A;  2R7X A;  1FMW A;  3DD7 A;  2CNW A;  2FGY A;  2J9V A;  3NDB B;  1OCR C;  5HSW A;  1BR1 A;  4C7O A;  4AE4 B;  2CW0 F;  3E9V A;  4YWQ A;  2YZS A;  3ITF A;  2IYL D;  2R7V A;  5L3V A;  1Z63 A;  2KJG A;  5E33 A;  5KYN A;  3L34 A;  3AG3 C;  4U5D E;  3EGX A;  4CS7 A;  3W2W A;  2Y3B A;  2CDQ A;  2BE5 F;  3UNG C;  2E87 A;  4X0R A;  4BG0 A;  4QI0 A;  3HTK C;  3HJC A;  4YT2 A;  2WVN A;  2J0W A;  3RIP A;  2ZXW C;  3NYL A;  4EWC A;  1TWA A;  4IWB A;  1QLE C;  1VYI A;  2WB7 A;  3ZIB A;  1S7Z A;  3EHM A;  1RJ9 B;  2NUP B;  4AE4 A;  2WZL A;  1ZHW A;  2QY9 A;  1SZI A;  3S27 A;  1Z6A A;  3MLG A;  2Q3T A;  3RKO F;  2X51 A;  1FTS A;  2PF4 E;  3LAY A;  3OA1 A;  3UR3 C;  3I4U A;  2MYS A;  4W8K A;  3B0P A;  1Z23 A;  4PFP A;  2Z15 A;  5IY5 C;  2R7R A;  4FX5 A;  4OD5 A;  1RJ9 A;  4GYT A;  3EHN A;  4LAC B;  1PD1 A;  4DVY P;  5CI9 A;  4JUR I;  3QMK A;  1ZYR F;  4ULW A;  3LES A;  2Y39 A;  4OIO F;  2NUT A;  3ABM C;  4I44 A;  1D1C A;  4YT5 A;  5T3W A;  5DS6 A;  5KYX A;  4PFO A;  2JD3 A;  3KKB A;  3V7O A;  1MMG A;  1ZU4 A;  2A1D D;  3NYM A;  5DVW A;  4XTK A;  3T6J A;  2R7T A;  1QZX A;  3ABL C;  3AG2 C;  3JCU Q;  3CZ6 A;  5KYW B;  4JVS A;  3F47 A;  2L9J A;  2J9U A;  3SNH A;  3UMI A;  2PFD A;  3FAJ A;  5DQT A;  3AG4 C;  3DAG A;  2DGJ A;  2Q9B A;  1MND A;  3EFO B;  4DOZ A;  4U5B E;  4IAO A;  3NRH A;  4CSA A;  5FCL A;  1D1A A;  2IXO A;  2P6V A;  4U5E E;  3M1C B;  3DMD A;  5T1D B;  1WGW A;  4CS8 A;  4AX2 A;  1M56 C;  1D0Y A;  1KU2 A;  1LKX A;  2YEV A;  3S28 A;  5KYW A;  2LSE A;  5L3Q A;  4CS9 A;  4Q7C A;  2DYS C;  4FWV A;  2IXN A;  2KGO A;  2CNW D;  1TWH A;  5B1B C;  1NU9 C;  3KMI A;  3ZSU A;  2R7S A;  2J7P D;  1M57 C;  3EFO A;  3EH2 A;  4O6N A;  2XSE A;  2R7Q A;  5CI8 A;  1J8M F;  5D92 A;  3O6X A;  3FVY A;  4KBL A;  4PJJ A;  3F46 A;  1V55 C;  3DJU B;  2A6E F;  4G7Z F;  2NG1 A;  4JZA A;  3W8H A;  1SMY F;  3EPV A;  2IXP A;  3EG9 B;  4G7H F;  1OKK D;  3LS0 A;  3NKE A;  4U5C E;  4O6M A;  3EQL F;  1Z5Z A;  4K0D A;  2G3K A;  1M2V B;  3JT1 A;  4BJ5 C;  1TKN A;  4HEA J;  5E3A A;  4PK4 A;  1VYK A;  1O5H A;  2PX3 A;  2Q9C A;  1PD0 A;  4EBB A;  1NU7 D;  3Q6M A;  2FFH A;  3E70 C;  3UGO A;  4I1M A;  2NUT B;  4U5H A;  3EG9 A;  1MMN A;  2B0J A;  5KYX B;  1G8X A;  3T6B A;  3N2Z B;  2J46 A;  3EH1 A;  1O87 A;  4CBE A;  2V26 A;  4MND A;  3UGP A;  1M2V A;  2VAS A;  4JCH A;  4ZLD A;  5DLJ A;  1Z3I X;  3ABK C;  3WG7 C;  3RFY A;  4OIQ F;  2WZG A;  3I5P A;  4C3D A;  2ZXO A;  4N06 A;  4BEJ A;  3Q6N A;  2YHS A;  4C3E A;  1FFH A;  4H4K C;  2WVQ A;  3DZA A;  3Q7L A;  5D91 A;  4U5G A;  3OWT A;  3S0X A;  4YT4 A;  4K7B A;  1TR2 A;  4BJ6 A;  4QDL A;  4PJM A;  5B3S C;  3PHF 2;  3POV A;  5F5H A;  3DM5 A;  4WJ0 A;  2WZF A;  1N1C A;  3EZH A;  5F5F A;  2C03 A;  2XXA A;  4OIN F;  3EZI A;  1FFT C;  3DM9 B;  2O9X A;  2VB6 A;  3ZG1 A;  4YN0 B;  2CGE A;  3H65 A;  3KH2 A;  2Y69 C;  2W45 A;  5E2Q A;  3ZVR A;  1ZHT A;  4C3B A;  2Y3H A;  3SYN A;  4JJF A;  3K6B A;  3X2Q C;  3N24 A;  3JRT A;  4XWJ A;  4RD9 A;  2EIK C;  3S29 A;  2H7V C;  4CIH A;  3GAN A;  2M4E A;  2WL8 A;  2ZPA A;  3L0I A;  3B0V C;  4I1O B;  3SZR A;  4Q4Z F;  3W2V A;  2Y3D A;  1BR2 A;  4Q5S F;  2EIN C;  3IEE A;  4O6Y A;  4G7O F;  4I3M A;  1V54 C;  1OCZ C;  5DS5 A;  1JPN A;  3K33 A;  4G0H A;  3K7D A;  5T3T A;  3FDQ A;  3CQZ A;  4HE8 D;  5DS4 A;  1OCO C;  1LVK A;  4PJN A;  5KYY B;  4OD4 A;  3X1O A;  3UMK A;  1PCX A;  3T4R A;  2A69 F;  2KW3 C;  2WVO A;  3B9Q A;  4PJL A;  2ZXR A;  4AK9 A;  2KNH A;  3DJN B;  1D0Z A;  3K66 A;  4YJW A;  3K1I C;  4XLN F;  1VOM A;  4OIR F;  4CSA C;  2A68 F;  5KYU B;  2QTV A;  4B6I A;  2J7P A;  1IZM A;  1VMA A;  2W9Y A;  1OCC C;  1LS1 A;  4DBQ A;  4CS8 C;  1NZE A;  2VH3 A;  1ZHZ A;  1BR4 A;  4RDA A;  3EGD B;  2H7O A;  3NYJ A;  2OCC C;  3K1H A;  4CS9 C;  4DVZ A;  5KYY A;  2H7B A;  4HFK B;  1J8Y F;  3LLI A;  2J9W A;  4IJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...