4NY3A

Human ptpa in complex with peptide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
301
structure length
299
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis for PTPA interaction with the invariant C-terminal tail of PP2A.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 299
sequence length 301
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4ny3A02
2HV7A 2IXNA 4LACB 4NY3A 2IXOA 2IXPA 2HV6A 2G62A 2IXMA
chains in the Genus database with same CATH superfamily
2L81A 4U5GA 3UGOA 4YN0B 2EPMX 1OKKD 1FAPB 5B1BC 1ZHWA 4FWVA 5L0JA 4JE9A 1TR2A 5FZTA 3GM1A 1RXQA 3W8HA 1R4TA 3KPHA 2V26A 3L8JA 2B0HA 3IPMO 4NC3A 2XM4A 4MQ9F 4PJNA 3AG3C 3LEVA 2YWAA 1JMWA 2PP4A 1VMAA 1HY5A 2XL4A 3SXZA 4JIOA 3M4CA 3I5PA 2A0BA 3U8PA 3RQGA 3M1CB 1ST6A 2EIJC 2H7BA 2LD6A 3QMKA 4EBJA 2UUIA 1NSGB 1BBHA 4JRZA 4P9FA 2AWCA 1VYIA 4O6MA 3BEHA 2AP3A 4ULWA 4XLNF 4A4AA 1SF8A 1GQAA 1OXBA 2EIKC 3G4XA 3LS0A 1H9GA 4NCQA 4CX9A 4DBRA 1TWHA 3T4RA 3UMKA 1BR1A 4GEHA 2OJQA 2W9YA 5AGFA 5KYUB 1YAUO 2R7VA 1A7DA 1S7ZA 4QI0A 2W4MA 3SYNA 5JUAA 4OD5A 2ZXRA 3CSKA 4BEJA 2P0NA 3K33A 4JEAA 1OXKA 2HSQA 4CS9A 4UDVA 3NG1A 2LFDA 3O6XA 4MS2A 2D4UA 4XEKA 4C3DA 4G7HF 5F5HA 3S29A 4D4XA 3EZIA 3VM6A 2H8AA 3AG4C 1Y4CA 5KYXB 1VYKA 4ULVA 4DRJB 4DVZA 1ZU4A 3ATPA 2J0WA 3FOPA 2XS1A 1K04A 2L6GA 2XLVA 2IOQA 5KYXA 4U5FE 3X1OA 2YRFA 2WZFA 3K6BA 2I8BA 4Z9IA 4A2NB 4OIOF 3SXMA 1C17M 1UFBA 5B3SC 4GQHA 2PX3A 4HFFB 1WGWA 2G62A 2C03A 2EPKX 3NMIA 4BG0A 1HW2A 4U9DA 2YKZA 1D0ZA 3T6JA 2IM8A 1E86A 4CS8A 3MBGA 5KYWB 1ZVZA 1TQGA 5F28E 1OW7A 1YZCA 3WAQA 4J7TA 4EHPA 3W4YA 5KYWA 1A0BA 3S84A 2X51A 4FAPB 1OQCA 1BZ4A 2EPNA 2HUJA 4JW1A 3V5ZA 2OEVA 2FGYA 1JPNA 1QZXA 3DE8A 1U0BB 3L8IA 4PK4A 5T1DB 3TULA 4P6IC 2D5RB 1CGOA 4YT5A 1MQVA 4EUKB 1LI7A 1LKXA 1LE2A 1BR4A 3LNRA 1T5OA 4AL0A 3ZVRA 1O3UA 2HSBA 5D92A 1O87A 2HJ3A 1AVOB 3S27A 1DOVA 4K1OA 3H2VA 3EJNA 5L0IA 2BL2A 1YYJA 3DM9B 3VRCA 1CGNA 3HKKA 4Q5SF 4FESA 1RJ9A 1Z63A 4CSAA 3LNMB 1APCA 1LM3B 1VLTA 1NU7D 4PJJA 4Z9HA 3ZDLA 4U5CE 1PD1A 3NMKA 1J8YF 2OOCA 2YQYA 4EBBA 2KC3A 5CIVA 2BC5A 1WTYA 1HMOA 1NG1A 2KQ9A 3FHDA 1G5ZA 3DJNB 3VF0A 2LK4A 1SYQA 3HNLA 2E87A 2QNLA 4CS9C 3T9OA 3GORA 4IGGA 4ZLDA 2P61A 4RBNA 4WGYA 5CI9A 1WATA 3ZQYA 5FCLA 1Q0FA 2JPUA 3N24A 3AG2C 4KC9A 5DS4A 2Q7RA 3CZ6A 3DAFA 3GWLA 3ZIBA 1FNTc 1VK5A 3PHF2 4JCHA 4L6RA 3WG7C 1Q0MA 5A6AA 1ZZPA 4AK9A 3AQCA 3M4BA 3DMDA 5L0DA 2YEVA 3UNGC 4CDVA 4BJ6A 3S90A 2A1DD 5BUOA 3TD7A 2OEXA 3OWTA 3UMHA 2YL3A 4U9EA 2ASRA 2QY9A 4JURI 3KKBA 3L1MA 2QTVA 2Y3DA 4NTBA 3B0UX 2V3CC 1NFOA 1ZHZA 2HV6A 2OQMA 2EILC 3GODA 4JJGA 4MVUA 2A6HF 1LE4A 3LS1A 2YLIA 4PJMA 1YA9A 4X0RA 2LQGA 4LDRA 4I3MA 4LLCA 3L0IA 4P9TA 3H65A 2L9JA 2XLHA 3AOUA 3DI5A 3K1HA 3Q6NA 3GEIA 2Q9CA 4CS8C 1H6GA 2YL0A 2NUPB 1TFOB 1SR2A 1UG7A 2R02A 1ORYA 1PV3A 2NUPA 2HFIA 3NRHA 3GM3A 1ZYRF 3IQTA 4WJ0A 3ITFA 3RKOF 4BJTA 2EPOA 3AJMA 3DWWA 2R05A 2I15A 4CS7A 1MNEA 2IXNA 3DM5A 4WGZA 4BJ5A 1KU2A 2AVKA 3Q7LA 2JD3A 3JYHA 3RFYA 3TOMA 5IY5C 5F5FA 1Q0DA 2YZSA 4DRIB 4EKWA 1I4ZA 1RCPA 1RKEB 3RIPA 2VB6A 3EFOB 4N6CA 3GEEA 1H7IA 3F47A 3ZWIA 4LDKA 1RKEA 3EHMA 4B6IA 3O55A 3EFOA 2OJED 3KYJA 2EIMC 1FMWA 4PFPA 5KYUA 3DAGA 2XLEA 1M2OA 4KNWA 2MWQA 2TMVP 1QKRA 3RVZA 4YT2A 4H4KC 4XEVA 1Z5ZA 1E84A 3TJ6A 5K0IA 1JAFA 2CYDA 3TK0A 4O7GA 4XEFA 5DS5A 5DQZA 3S0XA 3BRJA 4IJJA 5B1AC 1Z23A 3EH2A 1G8XA 1H9TA 2IBFA 2P6VA 3IQCA 3U9MA 1D1CA 1FTSA 2J46A 2P1AA 1M56C 1V54C 4AX2A 4E17A 5EK0A 4CJOA 2YHSA 1TWAA 2DYSC 4JTDB 5BQGA 4U5BE 1L3PA 1R5ID 3DJUB 4BJ6C 5JT4A 1MMGA 2G3KA 3LESA 5E3CA 1S05A 2CNWA 4E0HA 4ER9A 3VYWA 3RF3A 1AEPA 2DB4A 1HE9A 4JC7A 4IRUA 4CDYA 5EGYA 2KSFA 2PBEA 1FMVA 2IYLD 1VOMA 2Q9AA 2R7OA 3O39A 4IWBA 4JJFA 2KGOA 4KBLA 4MW3A 3UMIA 1D0XA 1E85A 3U2MA 2OG2A 3PDMP 2KW3C 1G4WR 2Q9BA 1VTMP 1HE1A 4J7YA 1WWPA 2GWWA 2YLDA 5L3QA 1YJGA 5HV9A 256BA 3DE9A 3DZAA 1A7EA 3FXHA 4NQFA 3U2LA 2IXMA 4IB4A 1C03A 5JP7A 1TWCA 1ZU5A 3IEEA 4PR9A 5KYNA 5AC5A 3NDBB 2LSEA 2DI3A 2LP4A 1OR3A 2J7PA 3ASNC 3X2QC 4H54A 3FAJA 2XLDA 1I5NA 1EQ1A 3E9VA 2DGJA 3FMSA 5T3WA 3NYJA 1C02A 2EINC 3T6GB 2HKVA 5JSLA 4BJ5C 2R9RB 1QQ3A 1D0YA 3NKEA 1J8MF 1VB5A 3DD7A 4AL1A 2VH3A 1JR8A 5BQHA 3C63A 2L6HA 1W2WA 2VCBA 2ZXWC 5COGA 1FFHA 1HW1A 1PCXA 5EHHA 3ZTMA 3LLKA 2KYHA 3QVZA 4HFKB 4WABA 1MMNA 4C7OB 3RVYA 3NYMA 4G7OF 2IXPA 2R25A 2XRHA 2PNOA 1Y6DA 1XZQA 3SEOA 4C7OA 4MTFA 2R7UA 4XLPF 2YVKA 5TJ5E 4MVRA 1LVKA 3RW0A 1OW8A 3C8GB 3SXKA 3U0CA 1MMAA 3Q6MA 4DRHB 4HE8D 1Z6AA 5L0CA 4W8KA 3US6A 3C8GA 3LJBA 1LI5A 3EGXB 2Q00A 2ZXPA 4AE4B 4G7ZF 2PFDA 3LEOA 4MNDA 5E3AA 1XWJA 2NSGA 5JRAA 1JOGA 4YK5A 3MYFA 3EGXA 3FOOA 4DOZA 4AE4A 3TJ5A 1TFKB 4I44A 3A9CA 4XPYA 5JLIA 3B0VC 3FDQA 2O9XA 3U3BA 4CJGA 1CPRA 1ZHTA 5A6KA 1K40A 2OCCC 1G4US 1GGQA 2JX0A 2NG1A 1YZAA 2XM0A 3EG9B 3RH3A 4DVYP 3VAYA 5KYYB 4ZLCA 1YYXA 1WOLA 2HV7A 4YJWA 4CSAC 4JCZA 5KYYA 2M4EA 2ETSA 3EG9A 3IHUA 3EGDB 1YDIA 3PCVA 5CI8A 1LPEA 2CNWD 4YWQA 3JRTA 2J9BA 4PJLA 2R7QA 5DVWA 1KTMA 3M15A 2Z15A 1D1BA 3EGDA 4MVZA 4XPXA 4CIPA 1KNYA 2G3VA 2Y39A 3AGUA 5T3TA 1Z7Qc 3C18A 5A6BA 1XZPA 1WN0A 2KJGA 4IAOA 5A6JA 1JRAA 1SMYF 3I4UA 3RYLA 1Q0GA 2J9UA 3LUTB 4MVOA 4R32A 3V5XA 4E7ZA 4MVMA 1FFTC 3ABKC 1B68A 1IW7F 2XLOA 3QTHA 3S28A 4QDLA 4NTAA 1ZHXA 3ASOC 1OCRC 3R2PA 3POVA 5COFA 3V5YA 2Q3TA 1A7VA 2CCYA 4J30B 2M64A 1YVIA 2DYRC 2J7PD 3WODF 3C7JA 3GANA 3ABLC 3ABMC 1M6TA 2VC9A 2NPUA 2ZXOA 4N4WA 4G78A 3UR3C 3N0TA 1QPUA 1LS1A 2HS5A 2J8WA 1NBBA 4DXWA 2LCHA 1HMDA 3EPVA 4IAQA 3HJCA 4EIYA 3EZHA 4YL3A 2UUHA 3MYIA 3U9JA 4MW8A 3JTLO 2ICWG 3B71A 3K1IC 2XXAB 2W4BA 1A41A 1OCZC 3KH2A 4JKVA 4XTKA 1D1AA 3T6BA 3W8IA 1SZIA 4M63A 3NKDA 1JPJA 2XXAA 3E70C 3SNHA 1TWGA 2VASA 3JCUQ 3HNJA 1U6HA 4MTGA 1QSPA 1EKYA 1Z3IX 4J32B 1VLSA 3GEHA 3AG1C 3IQ5A 2VCCA 4OIRF 2C04A 3W2WA 1NFNA 4CBEA 5L3VA 1OW6A 2PX0A 2QUPA 4OD4A 3ZQVA 1FR0A 2OU6A 3C8GD 3U5SA 1T01A 3M79A 1TKNA 4ONSA 2J9VA 5JS5A 3B9QA 5HSWA 2J9WA 2MHRA 1V4AA 3ECSA 3HTKC 4OINF 3AQBA 3C62A 2CW0F 3HLZA 3GM2A 3JSZA 3L34A 1YLMA 4GYTA 4MVSA 4F4BA 1EI7A 1Q0KA 3RQEA 2A0UA 1NZEA 2HMZA 1IZMA 4YL1A 2HZ8A 2YLGA 4CIHA 1CPQA 5L0FA 2OKUA 4E0IA 4MVQA 4QI2A 1V55C 4C3BA 3JRMO 3FVYA 2QE9A 4U5EE 4CDAA 2QLAA 2A68F 4HEAJ 3KMIA 2J0XA 4JEBA 1PD0A 4O6YA 5JVEA 3DKAA 2B0JA 2CGEA 5L0GA 4LACB 4LDQA 3SP1A 5COMA 4E7SA 1OCCC 3K66A 4XWJA 3SXYA 2A69F 4D4NA 1T9KA 3FAPB 4PFOA 3W2VA 4DJ9A 2WVQA 3K7DA 3EH1A 1L7CA 1QLEC 2KNHA 2XL8A 3F46A 1YARO 4K7BA 4PACA 4EBKA 2XS8A 1V74B 5A6BD 1ZW3A 2GFHA 1M57C 4O79A 4IARA 2J45A 1ORJA 1M2VB 3OA1A 1OKKA 2Y69C 2YL1A 3CEXA 4Q7CA 2WVOA 2XSEA 4BJ1A 4ANJA 2R7TA 5E33A 1GS9A 3NMJA 4OIPF 4LLEA 1M2VA 3HNIA 3NYLA 2F22A 3CQZA 3R7CA 1E83A 3IQ6A 2AWYA 2GDCA 2AU5A 3TOLA 4N06A 3O10A 2WVNA 4C3EA 2R7RA 1ZW2A 3K1IA 1T6UA 2YL7A 3KYIA 3JT1A 3JZ0A 2WZGA 2RD9A 3QW1A 1N1CA 3MFNA 4E18A 3J06A 2XLWA 3QW0A 3V7OA 2FAPB 4KNVA 2R7WA 4O6NA 1RMVA 4XPWA 2VCAA 3QVYA 1O5HA 5L0HA 3LLIA 2BE5F 1RJ9B 5GPGB 4YT8A 1WASA 3KL4A 2WZLA 3Q7GA 1LS4A 2L7AA 3JSEO 1DOWA 4YT4A 3UGPA 2W45A 3ZTZA 2L6FA 4LERA 5AC4A 1AUEA 2H7OA 4U5HA 1QVXA 3ZC4A 2PF4E 4BPMA 4RDAA 4NTFA 1ORSC 1ZHYA 3U8VA 2FFHA 2A6EF 2XLMA 1LIHA 2GA0A 1T6QA 1YA7O 1K05A 2X0CA 1U89A 5D91A 4BEMJ 3MLGA 2R03A 5DS6A 3SZRA 4JTCB 4XQ1A 5A69A 2CDQA 4RD9A 4I1MA 3TQOA 1MMDA 5DLJA 4DBQA 3C8ZA 2IXOA 3WHNA 1F1MA 3ZG1A 3AGTA 4EWCA 4N6HA 1I4YA 5B3IA 3B0PA 2Y3HA 1NU9C 3A11A 4JVSA 5E2QA 3EHNA 3OEOA 3ZSUA 1GM5A 1BDJB 4I1OB 5BQIA 2R7SA 2NSFA 1OR2A 2LIGA 3DXJF 3CAXA 2R7XA 2H7VC 2RSEB 2WB7A 4JTAB 3B29A 3RQFA 5DQTA 3EQLF 4Q4ZF 4MTOA 2LFFA 2EPLX 1BR2A 2XL6A 4YL0A 2ZD9A 4JZAA 4U5DE 2NUTB 3PMRA 3H2UA 3QZCA 3HNKA 4OIQF 3JYYA 2HJMA 3U3FA 2WL8A 2HMQA 2MYSA 3I5QA 4K0DA 1T6IA 1NLXA 3G4ZA 3GWNA 2NUTA 2Y3GA 3LAYA 2GAQA 4G0HA 1E2XA 2P7VA 4FX5A 3S9OA 1CGME 1RKCA 4NY3A 3N2ZB 2Y3BA 4W8PA 4KI2A 2KK1A 1EA8A 2ZPAA 3G50A 4Z9JA 2Q4FA 1MNDA 3MX3A 1OCOC
chains in the Genus database with same CATH topology
2L81A 4U5GA 3UGOA 4YN0B 1OKKD 5B1BC 1ZHWA 4FWVA 1TR2A 3W8HA 2V26A 4MQ9F 4PJNA 3AG3C 3LEVA 2PP4A 1VMAA 2XL4A 3I5PA 3M1CB 1ST6A 2EIJC 2H7BA 3QMKA 4XLNF 4O6MA 1VYIA 4ULWA 4YT8A 1SF8A 3LS0A 2EIKC 4CSAC 4DBRA 1TWHA 3T4RA 3UMKA 1BR1A 4GEHA 2W9YA 5KYUB 2R7VA 1S7ZA 4QI0A 2W4MA 3SYNA 4OD5A 2ZXRA 3CSKA 4BEJA 3K33A 4CS9A 3NG1A 3O6XA 4C3DA 4G7HF 5F5HA 3S29A 3EZIA 3AG4C 5KYXB 1VYKA 4DVZA 1ZU4A 2J0WA 2IOQA 5KYXA 4U5FE 3X1OA 2WZFA 3K6BA 2I8BA 4A2NB 4OIOF 5B3SC 2PX3A 4HFFB 1WGWA 2G62A 2C03A 4BG0A 3T6JA 1D0ZA 4CS8A 5KYWB 5KYWA 2X51A 4JW1A 2FGYA 1JPNA 1QZXA 4PK4A 5T1DB 4P6IC 2D5RB 4YT5A 1LKXA 1BR4A 3LNRA 3ZVRA 5D92A 3S27A 1O87A 3EJNA 3DM9B 4Q5SF 4FESA 1RJ9A 1Z63A 4CSAA 1NU7D 4PJJA 4U5CE 1PD1A 1J8YF 4EBBA 2KQ9A 1NG1A 3FHDA 3DJNB 2E87A 4CS9C 4ZLDA 4RBNA 5CI9A 5FCLA 3N24A 3AG2C 4KC9A 5DS4A 3CZ6A 3DAFA 3ZIBA 3PHF2 1VK5A 4JCHA 3WG7C 4AK9A 3AQCA 3DMDA 2YEVA 3UNGC 4BJ6A 2A1DD 5BUOA 3TD7A 3OWTA 3UMHA 4JURI 2QY9A 3B0UX 3KKBA 2QTVA 2Y3DA 2V3CC 1ZHZA 2HV6A 2EILC 3GODA 4JJGA 2A6HF 3LS1A 4PJMA 4X0RA 4I3MA 4LLCA 3L0IA 3H65A 2L9JA 3K1HA 3Q6NA 4CS8C 2Q9CA 2NUPB 2NUPA 3NRHA 1ZYRF 4WJ0A 3ITFA 3RKOF 4BJTA 4CS7A 1MNEA 2IXNA 3DM5A 4BJ5A 1KU2A 3Q7LA 3RFYA 2JD3A 3JYHA 5IY5C 5F5FA 2YZSA 3RIPA 2VB6A 3EFOB 3F47A 3EHMA 4B6IA 3EFOA 2EIMC 1FMWA 4PFPA 5KYUA 3DAGA 1M2OA 4KNWA 2MWQA 4YT2A 4H4KC 1Z5ZA 4O7GA 5DS5A 5DQZA 3S0XA 5B1AC 4IJJA 1Z23A 3EH2A 1G8XA 2P6VA 1D1CA 1FTSA 2J46A 1M56C 1V54C 4AX2A 2YHSA 1TWAA 2DYSC 4U5BE 3DJUB 4BJ6C 1MMGA 2G3KA 3LESA 5E3CA 2CNWA 3VYWA 4IRUA 5EGYA 4JJFA 3O39A 1FMVA 2IYLD 1VOMA 2Q9AA 2R7OA 4IWBA 3UMIA 2KGOA 4KBLA 1D0XA 2OG2A 2KW3C 2Q9BA 5L3QA 3DZAA 2IXMA 1TWCA 1ZU5A 3IEEA 5KYNA 3NDBB 2LSEA 3ASNC 2J7PA 3X2QC 3FAJA 3E9VA 2DGJA 5T3WA 3NYJA 2EINC 4BJ5C 1D0YA 3NKEA 1J8MF 3DD7A 2VH3A 1W2WA 2ZXWC 5EHHA 1FFHA 1PCXA 3LLKA 4HFKB 1MMNA 4C7OB 3NYMA 4G7OF 2IXPA 2XRHA 3SEOA 4C7OA 2R7UA 1LVKA 1MMAA 3Q6MA 4HE8D 1Z6AA 4W8KA 3LJBA 3EGXB 2ZXPA 4AE4B 4G7ZF 2PFDA 4MNDA 5E3AA 3EGXA 4DOZA 4AE4A 4I44A 3B0VC 3FDQA 2O9XA 1ZHTA 2OCCC 2NG1A 5KYYB 3EG9B 3RH3A 4DVYP 3VAYA 4ZLCA 2HV7A 4YJWA 5KYYA 2M4EA 3EG9A 3EGDB 5CI8A 4YWQA 2CNWD 3JRTA 4PJLA 2R7QA 5DVWA 2Z15A 1D1BA 3EGDA 2G3VA 2Y39A 5T3TA 2KJGA 4IAOA 1SMYF 3I4UA 3RYLA 2J9UA 4E7ZA 1FFTC 3ABKC 1IW7F 3S28A 4QDLA 1ZHXA 3ASOC 1OCRC 3POVA 2Q3TA 4J30B 2DYRC 2J7PD 3WODF 3GANA 3ABLC 3ABMC 2ZXOA 3N0TA 1LS1A 3EPVA 3HJCA 3EZHA 3K1IC 2XXAB 2W4BA 1OCZC 3KH2A 3T6BA 4XTKA 3W8IA 1D1AA 1SZIA 4M63A 3NKDA 1JPJA 2XXAA 3E70C 3SNHA 1TWGA 2VASA 3JCUQ 1Z3IX 4J32B 3AG1C 4OIRF 2C04A 3W2WA 4CBEA 5L3VA 2PX0A 4OD4A 1TKNA 2J9VA 3B9QA 5HSWA 2J9WA 3ECSA 3HTKC 4OINF 3AQBA 2CW0F 3HLZA 3JSZA 4GYTA 3L34A 4F4BA 1NZEA 1IZMA 4CIHA 4QI2A 1V55C 4C3BA 3FVYA 4U5EE 2A68F 4HEAJ 3KMIA 2J0XA 1PD0A 4O6YA 2B0JA 2CGEA 4LACB 3SP1A 4E7SA 1OCCC 3K66A 4XWJA 2A69F 4PFOA 3W2VA 2WVQA 3K7DA 3EH1A 1QLEC 3F46A 2KNHA 4K7BA 2GFHA 1M57C 4O79A 2J45A 3OA1A 1M2VB 4Q7CA 1OKKA 2Y69C 2R7TA 2WVOA 2XSEA 4BJ1A 4ANJA 5E33A 4OIPF 4LLEA 1M2VA 3NYLA 3CQZA 4N06A 2WVNA 4C3EA 2R7RA 3JT1A 2WZGA 1N1CA 3V7OA 4KNVA 2R7WA 4O6NA 1O5HA 3LLIA 2BE5F 1RJ9B 3KL4A 2WZLA 3Q7GA 4YT4A 3UGPA 2W45A 4LERA 2H7OA 4U5HA 3ZC4A 2PF4E 4RDAA 1ZHYA 2FFHA 2A6EF 5D91A 3MLGA 5DS6A 3SZRA 2CDQA 4RD9A 4I1MA 1MMDA 5DLJA 4DBQA 2IXOA 3ZG1A 4EWCA 3B0PA 2Y3HA 1NU9C 4JVSA 5E2QA 3EHNA 3OEOA 3ZSUA 2R7SA 4I1OB 3DXJF 2R7XA 2H7VC 2WB7A 5DQTA 3EQLF 4Q4ZF 1BR2A 3UR3C 4XLPF 4U5DE 4JZAA 4OIQF 2NUTB 3PMRA 3QZCA 2WL8A 2MYSA 4K0DA 3I5QA 2NUTA 2Y3GA 3LAYA 4G0HA 2P7VA 4FX5A 4NY3A 3N2ZB 2Y3BA 4KI2A 2ZPAA 1MNDA 3MX3A 1OCOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV7 A;  2IXN A;  4LAC B;  4NY3 A;  2IXO A;  2IXP A;  2HV6 A;  2G62 A;  2IXM A; 
#chains in the Genus database with same CATH topology
 2L81 A;  4U5G A;  3UGO A;  4YN0 B;  2EPM X;  1OKK D;  1FAP B;  5B1B C;  1ZHW A;  4FWV A;  5L0J A;  4JE9 A;  1TR2 A;  5FZT A;  3GM1 A;  1RXQ A;  3W8H A;  1R4T A;  3KPH A;  2V26 A;  3L8J A;  2B0H A;  3IPM O;  4NC3 A;  2XM4 A;  4MQ9 F;  4PJN A;  3AG3 C;  3LEV A;  2YWA A;  1JMW A;  2PP4 A;  1VMA A;  1HY5 A;  2XL4 A;  3SXZ A;  4JIO A;  3M4C A;  3I5P A;  2A0B A;  3U8P A;  3RQG A;  3M1C B;  1ST6 A;  2EIJ C;  2H7B A;  2LD6 A;  3QMK A;  4EBJ A;  2UUI A;  1NSG B;  1BBH A;  4JRZ A;  4P9F A;  2AWC A;  1VYI A;  4O6M A;  3BEH A;  2AP3 A;  4ULW A;  4XLN F;  4A4A A;  1SF8 A;  1GQA A;  1OXB A;  2EIK C;  3G4X A;  3LS0 A;  1H9G A;  4NCQ A;  4CX9 A;  4DBR A;  1TWH A;  3T4R A;  3UMK A;  1BR1 A;  4GEH A;  2OJQ A;  2W9Y A;  5AGF A;  5KYU B;  1YAU O;  2R7V A;  1A7D A;  1S7Z A;  4QI0 A;  2W4M A;  3SYN A;  5JUA A;  4OD5 A;  2ZXR A;  3CSK A;  4BEJ A;  2P0N A;  3K33 A;  4JEA A;  1OXK A;  2HSQ A;  4CS9 A;  4UDV A;  3NG1 A;  2LFD A;  3O6X A;  4MS2 A;  2D4U A;  4XEK A;  4C3D A;  4G7H F;  5F5H A;  3S29 A;  4D4X A;  3EZI A;  3VM6 A;  2H8A A;  3AG4 C;  1Y4C A;  5KYX B;  1VYK A;  4ULV A;  4DRJ B;  4DVZ A;  1ZU4 A;  3ATP A;  2J0W A;  3FOP A;  2XS1 A;  1K04 A;  2L6G A;  2XLV A;  2IOQ A;  5KYX A;  4U5F E;  3X1O A;  2YRF A;  2WZF A;  3K6B A;  2I8B A;  4Z9I A;  4A2N B;  4OIO F;  3SXM A;  1C17 M;  1UFB A;  5B3S C;  4GQH A;  2PX3 A;  4HFF B;  1WGW A;  2G62 A;  2C03 A;  2EPK X;  3NMI A;  4BG0 A;  1HW2 A;  4U9D A;  2YKZ A;  1D0Z A;  3T6J A;  2IM8 A;  1E86 A;  4CS8 A;  3MBG A;  5KYW B;  1ZVZ A;  1TQG A;  5F28 E;  1OW7 A;  1YZC A;  3WAQ A;  4J7T A;  4EHP A;  3W4Y A;  5KYW A;  1A0B A;  3S84 A;  2X51 A;  4FAP B;  1OQC A;  1BZ4 A;  2EPN A;  2HUJ A;  4JW1 A;  3V5Z A;  2OEV A;  2FGY A;  1JPN A;  1QZX A;  3DE8 A;  1U0B B;  3L8I A;  4PK4 A;  5T1D B;  3TUL A;  4P6I C;  2D5R B;  1CGO A;  4YT5 A;  1MQV A;  4EUK B;  1LI7 A;  1LKX A;  1LE2 A;  1BR4 A;  3LNR A;  1T5O A;  4AL0 A;  3ZVR A;  1O3U A;  2HSB A;  5D92 A;  1O87 A;  2HJ3 A;  1AVO B;  3S27 A;  1DOV A;  4K1O A;  3H2V A;  3EJN A;  5L0I A;  2BL2 A;  1YYJ A;  3DM9 B;  3VRC A;  1CGN A;  3HKK A;  4Q5S F;  4FES A;  1RJ9 A;  1Z63 A;  4CSA A;  3LNM B;  1APC A;  1LM3 B;  1VLT A;  1NU7 D;  4PJJ A;  4Z9H A;  3ZDL A;  4U5C E;  1PD1 A;  3NMK A;  1J8Y F;  2OOC A;  2YQY A;  4EBB A;  2KC3 A;  5CIV A;  2BC5 A;  1WTY A;  1HMO A;  1NG1 A;  2KQ9 A;  3FHD A;  1G5Z A;  3DJN B;  3VF0 A;  2LK4 A;  1SYQ A;  3HNL A;  2E87 A;  2QNL A;  4CS9 C;  3T9O A;  3GOR A;  4IGG A;  4ZLD A;  2P61 A;  4RBN A;  4WGY A;  5CI9 A;  1WAT A;  3ZQY A;  5FCL A;  1Q0F A;  2JPU A;  3N24 A;  3AG2 C;  4KC9 A;  5DS4 A;  2Q7R A;  3CZ6 A;  3DAF A;  3GWL A;  3ZIB A;  1FNT c;  1VK5 A;  3PHF 2;  4JCH A;  4L6R A;  3WG7 C;  1Q0M A;  5A6A A;  1ZZP A;  4AK9 A;  3AQC A;  3M4B A;  3DMD A;  5L0D A;  2YEV A;  3UNG C;  4CDV A;  4BJ6 A;  3S90 A;  2A1D D;  5BUO A;  3TD7 A;  2OEX A;  3OWT A;  3UMH A;  2YL3 A;  4U9E A;  2ASR A;  2QY9 A;  4JUR I;  3KKB A;  3L1M A;  2QTV A;  2Y3D A;  4NTB A;  3B0U X;  2V3C C;  1NFO A;  1ZHZ A;  2HV6 A;  2OQM A;  2EIL C;  3GOD A;  4JJG A;  4MVU A;  2A6H F;  1LE4 A;  3LS1 A;  2YLI A;  4PJM A;  1YA9 A;  4X0R A;  2LQG A;  4LDR A;  4I3M A;  4LLC A;  3L0I A;  4P9T A;  3H65 A;  2L9J A;  2XLH A;  3AOU A;  3DI5 A;  3K1H A;  3Q6N A;  3GEI A;  2Q9C A;  4CS8 C;  1H6G A;  2YL0 A;  2NUP B;  1TFO B;  1SR2 A;  1UG7 A;  2R02 A;  1ORY A;  1PV3 A;  2NUP A;  2HFI A;  3NRH A;  3GM3 A;  1ZYR F;  3IQT A;  4WJ0 A;  3ITF A;  3RKO F;  4BJT A;  2EPO A;  3AJM A;  3DWW A;  2R05 A;  2I15 A;  4CS7 A;  1MNE A;  2IXN A;  3DM5 A;  4WGZ A;  4BJ5 A;  1KU2 A;  2AVK A;  3Q7L A;  2JD3 A;  3JYH A;  3RFY A;  3TOM A;  5IY5 C;  5F5F A;  1Q0D A;  2YZS A;  4DRI B;  4EKW A;  1I4Z A;  1RCP A;  1RKE B;  3RIP A;  2VB6 A;  3EFO B;  4N6C A;  3GEE A;  1H7I A;  3F47 A;  3ZWI A;  4LDK A;  1RKE A;  3EHM A;  4B6I A;  3O55 A;  3EFO A;  2OJE D;  3KYJ A;  2EIM C;  1FMW A;  4PFP A;  5KYU A;  3DAG A;  2XLE A;  1M2O A;  4KNW A;  2MWQ A;  2TMV P;  1QKR A;  3RVZ A;  4YT2 A;  4H4K C;  4XEV A;  1Z5Z A;  1E84 A;  3TJ6 A;  5K0I A;  1JAF A;  2CYD A;  3TK0 A;  4O7G A;  4XEF A;  5DS5 A;  5DQZ A;  3S0X A;  3BRJ A;  4IJJ A;  5B1A C;  1Z23 A;  3EH2 A;  1G8X A;  1H9T A;  2IBF A;  2P6V A;  3IQC A;  3U9M A;  1D1C A;  1FTS A;  2J46 A;  2P1A A;  1M56 C;  1V54 C;  4AX2 A;  4E17 A;  5EK0 A;  4CJO A;  2YHS A;  1TWA A;  2DYS C;  4JTD B;  5BQG A;  4U5B E;  1L3P A;  1R5I D;  3DJU B;  4BJ6 C;  5JT4 A;  1MMG A;  2G3K A;  3LES A;  5E3C A;  1S05 A;  2CNW A;  4E0H A;  4ER9 A;  3VYW A;  3RF3 A;  1AEP A;  2DB4 A;  1HE9 A;  4JC7 A;  4IRU A;  4CDY A;  5EGY A;  2KSF A;  2PBE A;  1FMV A;  2IYL D;  1VOM A;  2Q9A A;  2R7O A;  3O39 A;  4IWB A;  4JJF A;  2KGO A;  4KBL A;  4MW3 A;  3UMI A;  1D0X A;  1E85 A;  3U2M A;  2OG2 A;  3PDM P;  2KW3 C;  1G4W R;  2Q9B A;  1VTM P;  1HE1 A;  4J7Y A;  1WWP A;  2GWW A;  2YLD A;  5L3Q A;  1YJG A;  5HV9 A;  256B A;  3DE9 A;  3DZA A;  1A7E A;  3FXH A;  4NQF A;  3U2L A;  2IXM A;  4IB4 A;  1C03 A;  5JP7 A;  1TWC A;  1ZU5 A;  3IEE A;  4PR9 A;  5KYN A;  5AC5 A;  3NDB B;  2LSE A;  2DI3 A;  2LP4 A;  1OR3 A;  2J7P A;  3ASN C;  3X2Q C;  4H54 A;  3FAJ A;  2XLD A;  1I5N A;  1EQ1 A;  3E9V A;  2DGJ A;  3FMS A;  5T3W A;  3NYJ A;  1C02 A;  2EIN C;  3T6G B;  2HKV A;  5JSL A;  4BJ5 C;  2R9R B;  1QQ3 A;  1D0Y A;  3NKE A;  1J8M F;  1VB5 A;  3DD7 A;  4AL1 A;  2VH3 A;  1JR8 A;  5BQH A;  3C63 A;  2L6H A;  1W2W A;  2VCB A;  2ZXW C;  5COG A;  1FFH A;  1HW1 A;  1PCX A;  5EHH A;  3ZTM A;  3LLK A;  2KYH A;  3QVZ A;  4HFK B;  4WAB A;  1MMN A;  4C7O B;  3RVY A;  3NYM A;  4G7O F;  2IXP A;  2R25 A;  2XRH A;  2PNO A;  1Y6D A;  1XZQ A;  3SEO A;  4C7O A;  4MTF A;  2R7U A;  4XLP F;  2YVK A;  5TJ5 E;  4MVR A;  1LVK A;  3RW0 A;  1OW8 A;  3C8G B;  3SXK A;  3U0C A;  1MMA A;  3Q6M A;  4DRH B;  4HE8 D;  1Z6A A;  5L0C A;  4W8K A;  3US6 A;  3C8G A;  3LJB A;  1LI5 A;  3EGX B;  2Q00 A;  2ZXP A;  4AE4 B;  4G7Z F;  2PFD A;  3LEO A;  4MND A;  5E3A A;  1XWJ A;  2NSG A;  5JRA A;  1JOG A;  4YK5 A;  3MYF A;  3EGX A;  3FOO A;  4DOZ A;  4AE4 A;  3TJ5 A;  1TFK B;  4I44 A;  3A9C A;  4XPY A;  5JLI A;  3B0V C;  3FDQ A;  2O9X A;  3U3B A;  4CJG A;  1CPR A;  1ZHT A;  5A6K A;  1K40 A;  2OCC C;  1G4U S;  1GGQ A;  2JX0 A;  2NG1 A;  1YZA A;  2XM0 A;  3EG9 B;  3RH3 A;  4DVY P;  3VAY A;  5KYY B;  4ZLC A;  1YYX A;  1WOL A;  2HV7 A;  4YJW A;  4CSA C;  4JCZ A;  5KYY A;  2M4E A;  2ETS A;  3EG9 A;  3IHU A;  3EGD B;  1YDI A;  3PCV A;  5CI8 A;  1LPE A;  2CNW D;  4YWQ A;  3JRT A;  2J9B A;  4PJL A;  2R7Q A;  5DVW A;  1KTM A;  3M15 A;  2Z15 A;  1D1B A;  3EGD A;  4MVZ A;  4XPX A;  4CIP A;  1KNY A;  2G3V A;  2Y39 A;  3AGU A;  5T3T A;  1Z7Q c;  3C18 A;  5A6B A;  1XZP A;  1WN0 A;  2KJG A;  4IAO A;  5A6J A;  1JRA A;  1SMY F;  3I4U A;  3RYL A;  1Q0G A;  2J9U A;  3LUT B;  4MVO A;  4R32 A;  3V5X A;  4E7Z A;  4MVM A;  1FFT C;  3ABK C;  1B68 A;  1IW7 F;  2XLO A;  3QTH A;  3S28 A;  4QDL A;  4NTA A;  1ZHX A;  3ASO C;  1OCR C;  3R2P A;  3POV A;  5COF A;  3V5Y A;  2Q3T A;  1A7V A;  2CCY A;  4J30 B;  2M64 A;  1YVI A;  2DYR C;  2J7P D;  3WOD F;  3C7J A;  3GAN A;  3ABL C;  3ABM C;  1M6T A;  2VC9 A;  2NPU A;  2ZXO A;  4N4W A;  4G78 A;  3UR3 C;  3N0T A;  1QPU A;  1LS1 A;  2HS5 A;  2J8W A;  1NBB A;  4DXW A;  2LCH A;  1HMD A;  3EPV A;  4IAQ A;  3HJC A;  4EIY A;  3EZH A;  4YL3 A;  2UUH A;  3MYI A;  3U9J A;  4MW8 A;  3JTL O;  2ICW G;  3B71 A;  3K1I C;  2XXA B;  2W4B A;  1A41 A;  1OCZ C;  3KH2 A;  4JKV A;  4XTK A;  1D1A A;  3T6B A;  3W8I A;  1SZI A;  4M63 A;  3NKD A;  1JPJ A;  2XXA A;  3E70 C;  3SNH A;  1TWG A;  2VAS A;  3JCU Q;  3HNJ A;  1U6H A;  4MTG A;  1QSP A;  1EKY A;  1Z3I X;  4J32 B;  1VLS A;  3GEH A;  3AG1 C;  3IQ5 A;  2VCC A;  4OIR F;  2C04 A;  3W2W A;  1NFN A;  4CBE A;  5L3V A;  1OW6 A;  2PX0 A;  2QUP A;  4OD4 A;  3ZQV A;  1FR0 A;  2OU6 A;  3C8G D;  3U5S A;  1T01 A;  3M79 A;  1TKN A;  4ONS A;  2J9V A;  5JS5 A;  3B9Q A;  5HSW A;  2J9W A;  2MHR A;  1V4A A;  3ECS A;  3HTK C;  4OIN F;  3AQB A;  3C62 A;  2CW0 F;  3HLZ A;  3GM2 A;  3JSZ A;  3L34 A;  1YLM A;  4GYT A;  4MVS A;  4F4B A;  1EI7 A;  1Q0K A;  3RQE A;  2A0U A;  1NZE A;  2HMZ A;  1IZM A;  4YL1 A;  2HZ8 A;  2YLG A;  4CIH A;  1CPQ A;  5L0F A;  2OKU A;  4E0I A;  4MVQ A;  4QI2 A;  1V55 C;  4C3B A;  3JRM O;  3FVY A;  2QE9 A;  4U5E E;  4CDA A;  2QLA A;  2A68 F;  4HEA J;  3KMI A;  2J0X A;  4JEB A;  1PD0 A;  4O6Y A;  5JVE A;  3DKA A;  2B0J A;  2CGE A;  5L0G A;  4LAC B;  4LDQ A;  3SP1 A;  5COM A;  4E7S A;  1OCC C;  3K66 A;  4XWJ A;  3SXY A;  2A69 F;  4D4N A;  1T9K A;  3FAP B;  4PFO A;  3W2V A;  4DJ9 A;  2WVQ A;  3K7D A;  3EH1 A;  1L7C A;  1QLE C;  2KNH A;  2XL8 A;  3F46 A;  1YAR O;  4K7B A;  4PAC A;  4EBK A;  2XS8 A;  1V74 B;  5A6B D;  1ZW3 A;  2GFH A;  1M57 C;  4O79 A;  4IAR A;  2J45 A;  1ORJ A;  1M2V B;  3OA1 A;  1OKK A;  2Y69 C;  2YL1 A;  3CEX A;  4Q7C A;  2WVO A;  2XSE A;  4BJ1 A;  4ANJ A;  2R7T A;  5E33 A;  1GS9 A;  3NMJ A;  4OIP F;  4LLE A;  1M2V A;  3HNI A;  3NYL A;  2F22 A;  3CQZ A;  3R7C A;  1E83 A;  3IQ6 A;  2AWY A;  2GDC A;  2AU5 A;  3TOL A;  4N06 A;  3O10 A;  2WVN A;  4C3E A;  2R7R A;  1ZW2 A;  3K1I A;  1T6U A;  2YL7 A;  3KYI A;  3JT1 A;  3JZ0 A;  2WZG A;  2RD9 A;  3QW1 A;  1N1C A;  3MFN A;  4E18 A;  3J06 A;  2XLW A;  3QW0 A;  3V7O A;  2FAP B;  4KNV A;  2R7W A;  4O6N A;  1RMV A;  4XPW A;  2VCA A;  3QVY A;  1O5H A;  5L0H A;  3LLI A;  2BE5 F;  1RJ9 B;  5GPG B;  4YT8 A;  1WAS A;  3KL4 A;  2WZL A;  3Q7G A;  1LS4 A;  2L7A A;  3JSE O;  1DOW A;  4YT4 A;  3UGP A;  2W45 A;  3ZTZ A;  2L6F A;  4LER A;  5AC4 A;  1AUE A;  2H7O A;  4U5H A;  1QVX A;  3ZC4 A;  2PF4 E;  4BPM A;  4RDA A;  4NTF A;  1ORS C;  1ZHY A;  3U8V A;  2FFH A;  2A6E F;  2XLM A;  1LIH A;  2GA0 A;  1T6Q A;  1YA7 O;  1K05 A;  2X0C A;  1U89 A;  5D91 A;  4BEM J;  3MLG A;  2R03 A;  5DS6 A;  3SZR A;  4JTC B;  4XQ1 A;  5A69 A;  2CDQ A;  4RD9 A;  4I1M A;  3TQO A;  1MMD A;  5DLJ A;  4DBQ A;  3C8Z A;  2IXO A;  3WHN A;  1F1M A;  3ZG1 A;  3AGT A;  4EWC A;  4N6H A;  1I4Y A;  5B3I A;  3B0P A;  2Y3H A;  1NU9 C;  3A11 A;  4JVS A;  5E2Q A;  3EHN A;  3OEO A;  3ZSU A;  1GM5 A;  1BDJ B;  4I1O B;  5BQI A;  2R7S A;  2NSF A;  1OR2 A;  2LIG A;  3DXJ F;  3CAX A;  2R7X A;  2H7V C;  2RSE B;  2WB7 A;  4JTA B;  3B29 A;  3RQF A;  5DQT A;  3EQL F;  4Q4Z F;  4MTO A;  2LFF A;  2EPL X;  1BR2 A;  2XL6 A;  4YL0 A;  2ZD9 A;  4JZA A;  4U5D E;  2NUT B;  3PMR A;  3H2U A;  3QZC A;  3HNK A;  4OIQ F;  3JYY A;  2HJM A;  3U3F A;  2WL8 A;  2HMQ A;  2MYS A;  3I5Q A;  4K0D A;  1T6I A;  1NLX A;  3G4Z A;  3GWN A;  2NUT A;  2Y3G A;  3LAY A;  2GAQ A;  4G0H A;  1E2X A;  2P7V A;  4FX5 A;  3S9O A;  1CGM E;  1RKC A;  4NY3 A;  3N2Z B;  2Y3B A;  4W8P A;  4KI2 A;  2KK1 A;  1EA8 A;  2ZPA A;  3G50 A;  4Z9J A;  2Q4F A;  1MND A;  3MX3 A;  1OCO C; 
#chains in the Genus database with same CATH homology
 2L81 A;  4U5G A;  3UGO A;  4YN0 B;  1OKK D;  5B1B C;  1ZHW A;  4FWV A;  1TR2 A;  3W8H A;  2V26 A;  4MQ9 F;  4PJN A;  3AG3 C;  3LEV A;  2PP4 A;  1VMA A;  2XL4 A;  3I5P A;  3M1C B;  1ST6 A;  2EIJ C;  2H7B A;  3QMK A;  4XLN F;  4O6M A;  1VYI A;  4ULW A;  4YT8 A;  1SF8 A;  3LS0 A;  2EIK C;  4CSA C;  4DBR A;  1TWH A;  3T4R A;  3UMK A;  1BR1 A;  4GEH A;  2W9Y A;  5KYU B;  2R7V A;  1S7Z A;  4QI0 A;  2W4M A;  3SYN A;  4OD5 A;  2ZXR A;  3CSK A;  4BEJ A;  3K33 A;  4CS9 A;  3NG1 A;  3O6X A;  4C3D A;  4G7H F;  5F5H A;  3S29 A;  3EZI A;  3AG4 C;  5KYX B;  1VYK A;  4DVZ A;  1ZU4 A;  2J0W A;  2IOQ A;  5KYX A;  4U5F E;  3X1O A;  2WZF A;  3K6B A;  2I8B A;  4A2N B;  4OIO F;  5B3S C;  2PX3 A;  4HFF B;  1WGW A;  2G62 A;  2C03 A;  4BG0 A;  3T6J A;  1D0Z A;  4CS8 A;  5KYW B;  5KYW A;  2X51 A;  4JW1 A;  2FGY A;  1JPN A;  1QZX A;  4PK4 A;  5T1D B;  4P6I C;  2D5R B;  4YT5 A;  1LKX A;  1BR4 A;  3LNR A;  3ZVR A;  5D92 A;  3S27 A;  1O87 A;  3EJN A;  3DM9 B;  4Q5S F;  4FES A;  1RJ9 A;  1Z63 A;  4CSA A;  1NU7 D;  4PJJ A;  4U5C E;  1PD1 A;  1J8Y F;  4EBB A;  2KQ9 A;  1NG1 A;  3FHD A;  3DJN B;  2E87 A;  4CS9 C;  4ZLD A;  4RBN A;  5CI9 A;  5FCL A;  3N24 A;  3AG2 C;  4KC9 A;  5DS4 A;  3CZ6 A;  3DAF A;  3ZIB A;  3PHF 2;  1VK5 A;  4JCH A;  3WG7 C;  4AK9 A;  3AQC A;  3DMD A;  2YEV A;  3UNG C;  4BJ6 A;  2A1D D;  5BUO A;  3TD7 A;  3OWT A;  3UMH A;  4JUR I;  2QY9 A;  3B0U X;  3KKB A;  2QTV A;  2Y3D A;  2V3C C;  1ZHZ A;  2HV6 A;  2EIL C;  3GOD A;  4JJG A;  2A6H F;  3LS1 A;  4PJM A;  4X0R A;  4I3M A;  4LLC A;  3L0I A;  3H65 A;  2L9J A;  3K1H A;  3Q6N A;  4CS8 C;  2Q9C A;  2NUP B;  2NUP A;  3NRH A;  1ZYR F;  4WJ0 A;  3ITF A;  3RKO F;  4BJT A;  4CS7 A;  1MNE A;  2IXN A;  3DM5 A;  4BJ5 A;  1KU2 A;  3Q7L A;  3RFY A;  2JD3 A;  3JYH A;  5IY5 C;  5F5F A;  2YZS A;  3RIP A;  2VB6 A;  3EFO B;  3F47 A;  3EHM A;  4B6I A;  3EFO A;  2EIM C;  1FMW A;  4PFP A;  5KYU A;  3DAG A;  1M2O A;  4KNW A;  2MWQ A;  4YT2 A;  4H4K C;  1Z5Z A;  4O7G A;  5DS5 A;  5DQZ A;  3S0X A;  5B1A C;  4IJJ A;  1Z23 A;  3EH2 A;  1G8X A;  2P6V A;  1D1C A;  1FTS A;  2J46 A;  1M56 C;  1V54 C;  4AX2 A;  2YHS A;  1TWA A;  2DYS C;  4U5B E;  3DJU B;  4BJ6 C;  1MMG A;  2G3K A;  3LES A;  5E3C A;  2CNW A;  3VYW A;  4IRU A;  5EGY A;  4JJF A;  3O39 A;  1FMV A;  2IYL D;  1VOM A;  2Q9A A;  2R7O A;  4IWB A;  3UMI A;  2KGO A;  4KBL A;  1D0X A;  2OG2 A;  2KW3 C;  2Q9B A;  5L3Q A;  3DZA A;  2IXM A;  1TWC A;  1ZU5 A;  3IEE A;  5KYN A;  3NDB B;  2LSE A;  3ASN C;  2J7P A;  3X2Q C;  3FAJ A;  3E9V A;  2DGJ A;  5T3W A;  3NYJ A;  2EIN C;  4BJ5 C;  1D0Y A;  3NKE A;  1J8M F;  3DD7 A;  2VH3 A;  1W2W A;  2ZXW C;  5EHH A;  1FFH A;  1PCX A;  3LLK A;  4HFK B;  1MMN A;  4C7O B;  3NYM A;  4G7O F;  2IXP A;  2XRH A;  3SEO A;  4C7O A;  2R7U A;  1LVK A;  1MMA A;  3Q6M A;  4HE8 D;  1Z6A A;  4W8K A;  3LJB A;  3EGX B;  2ZXP A;  4AE4 B;  4G7Z F;  2PFD A;  4MND A;  5E3A A;  3EGX A;  4DOZ A;  4AE4 A;  4I44 A;  3B0V C;  3FDQ A;  2O9X A;  1ZHT A;  2OCC C;  2NG1 A;  5KYY B;  3EG9 B;  3RH3 A;  4DVY P;  3VAY A;  4ZLC A;  2HV7 A;  4YJW A;  5KYY A;  2M4E A;  3EG9 A;  3EGD B;  5CI8 A;  4YWQ A;  2CNW D;  3JRT A;  4PJL A;  2R7Q A;  5DVW A;  2Z15 A;  1D1B A;  3EGD A;  2G3V A;  2Y39 A;  5T3T A;  2KJG A;  4IAO A;  1SMY F;  3I4U A;  3RYL A;  2J9U A;  4E7Z A;  1FFT C;  3ABK C;  1IW7 F;  3S28 A;  4QDL A;  1ZHX A;  3ASO C;  1OCR C;  3POV A;  2Q3T A;  4J30 B;  2DYR C;  2J7P D;  3WOD F;  3GAN A;  3ABL C;  3ABM C;  2ZXO A;  3N0T A;  1LS1 A;  3EPV A;  3HJC A;  3EZH A;  3K1I C;  2XXA B;  2W4B A;  1OCZ C;  3KH2 A;  3T6B A;  4XTK A;  3W8I A;  1D1A A;  1SZI A;  4M63 A;  3NKD A;  1JPJ A;  2XXA A;  3E70 C;  3SNH A;  1TWG A;  2VAS A;  3JCU Q;  1Z3I X;  4J32 B;  3AG1 C;  4OIR F;  2C04 A;  3W2W A;  4CBE A;  5L3V A;  2PX0 A;  4OD4 A;  1TKN A;  2J9V A;  3B9Q A;  5HSW A;  2J9W A;  3ECS A;  3HTK C;  4OIN F;  3AQB A;  2CW0 F;  3HLZ A;  3JSZ A;  4GYT A;  3L34 A;  4F4B A;  1NZE A;  1IZM A;  4CIH A;  4QI2 A;  1V55 C;  4C3B A;  3FVY A;  4U5E E;  2A68 F;  4HEA J;  3KMI A;  2J0X A;  1PD0 A;  4O6Y A;  2B0J A;  2CGE A;  4LAC B;  3SP1 A;  4E7S A;  1OCC C;  3K66 A;  4XWJ A;  2A69 F;  4PFO A;  3W2V A;  2WVQ A;  3K7D A;  3EH1 A;  1QLE C;  3F46 A;  2KNH A;  4K7B A;  2GFH A;  1M57 C;  4O79 A;  2J45 A;  3OA1 A;  1M2V B;  4Q7C A;  1OKK A;  2Y69 C;  2R7T A;  2WVO A;  2XSE A;  4BJ1 A;  4ANJ A;  5E33 A;  4OIP F;  4LLE A;  1M2V A;  3NYL A;  3CQZ A;  4N06 A;  2WVN A;  4C3E A;  2R7R A;  3JT1 A;  2WZG A;  1N1C A;  3V7O A;  4KNV A;  2R7W A;  4O6N A;  1O5H A;  3LLI A;  2BE5 F;  1RJ9 B;  3KL4 A;  2WZL A;  3Q7G A;  4YT4 A;  3UGP A;  2W45 A;  4LER A;  2H7O A;  4U5H A;  3ZC4 A;  2PF4 E;  4RDA A;  1ZHY A;  2FFH A;  2A6E F;  5D91 A;  3MLG A;  5DS6 A;  3SZR A;  2CDQ A;  4RD9 A;  4I1M A;  1MMD A;  5DLJ A;  4DBQ A;  2IXO A;  3ZG1 A;  4EWC A;  3B0P A;  2Y3H A;  1NU9 C;  4JVS A;  5E2Q A;  3EHN A;  3OEO A;  3ZSU A;  2R7S A;  4I1O B;  3DXJ F;  2R7X A;  2H7V C;  2WB7 A;  5DQT A;  3EQL F;  4Q4Z F;  1BR2 A;  3UR3 C;  4XLP F;  4U5D E;  4JZA A;  4OIQ F;  2NUT B;  3PMR A;  3QZC A;  2WL8 A;  2MYS A;  4K0D A;  3I5Q A;  2NUT A;  2Y3G A;  3LAY A;  4G0H A;  2P7V A;  4FX5 A;  4NY3 A;  3N2Z B;  2Y3B A;  4KI2 A;  2ZPA A;  1MND A;  3MX3 A;  1OCO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...