3FAPB

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 3fapB00
4DRIB 2RSEB 1FAPB 1NSGB 1AUEA 4DRJB 5GPGB 2GAQA 3FAPB 4DRHB 2FAPB 2NPUA 4FAPB
chains in the Genus database with same CATH superfamily
1PV3A 2EINC 3TK0A 3ZIBA 3UGPA 4LLCA 2GAQA 2XL4A 3FOPA 1VB5A 4Z9IA 4KNWA 1B68A 1HMOA 3Q6MA 2CW0F 5D91A 1PD1A 2KGOA 1J8YF 4EUKB 4YN0B 3SP1A 2XLHA 4MVSA 4PACA 3SXZA 1N1CA 1CGME 3FVYA 2YHSA 2J9BA 3KL4A 2CCYA 1YA9A 1EKYA 1JOGA 4XQ1A 2UUHA 1WOLA 2NUTA 1K04A 3DM5A 3ZQVA 4J30B 3AG3C 3ZTMA 2L7AA 2YLDA 3RQFA 4G7ZF 1Y4CA 2XL8A 2XLEA 2X0CA 5EK0A 5KYWB 5BQHA 1GQAA 3DAFA 4MNDA 1BR2A 1CPRA 1NU7D 4N4WA 2R7WA 1FTSA 3DJNB 2BL2A 1J8MF 3H65A 2J9VA 1ZW2A 5DQTA 4YT8A 5A69A 1VOMA 5D92A 2KNHA 4JC7A 3HNIA 4CIHA 3I4UA 3L8JA 4N06A 4U9EA 4WABA 5F28E 4CSAC 5F5FA 3S9OA 2DYSC 3ZG1A 3WHNA 4Z9HA 3U0CA 3V5XA 1SZIA 1MMAA 4O7GA 2LIGA 2OKUA 2R25A 1SF8A 4MS2A 2P1AA 3RVZA 256BA 5HV9A 5HSWA 5KYUA 3FXHA 2HV6A 4PR9A 1FR0A 4IB4A 1AVOB 1ZU4A 3C8ZA 4PJMA 5KYNA 3T6GB 1YZAA 2M4EA 1JMWA 1MQVA 3EG9B 1D0ZA 3EGDB 1OR3A 3KPHA 3V5ZA 3BRJA 4U5EE 1LPEA 3U9MA 3E9VA 3RVYA 5L3QA 1KU2A 2I8BA 1A7EA 2LFDA 3DM9B 3LS1A 5CI8A 4OIQF 4J7TA 2WZGA 3B9QA 4BPMA 3NDBB 3ZWIA 2L6FA 2G3VA 5DS4A 4RBNA 4EKWA 1W2WA 4ER9A 2YKZA 2R03A 4CDYA 2IXNA 1M6TA 1TFKB 1SMYF 5DLJA 3U2MA 2EIMC 1OKKA 2R02A 1NFOA 1QSPA 2OJQA 2R7QA 3LESA 4I1MA 4Q7CA 3S29A 3FDQA 3EGXA 1UFBA 1RKEB 4LLEA 3LLIA 4NY3A 4F4BA 5AC4A 5A6BA 1XZQA 3W2WA 3U3FA 3DJUB 2L6GA 3DZAA 3EH2A 3VM6A 3ZTZA 5JLIA 5JP7A 3ITFA 4JRZA 4E0HA 4G7HF 2YL7A 2QTVA 1MNEA 4CJGA 2CGEA 2R7XA 3JZ0A 2ICWG 2XS1A 1NSGB 1Q0GA 1Z6AA 2YLGA 4FWVA 2OOCA 4O6MA 4EIYA 3W2VA 3IQTA 4NTBA 2H7OA 1T01A 1OW6A 4XPXA 4U5GA 1VMAA 3AG2C 4O6YA 4MW8A 2J7PD 2AWYA 4PFPA 4PK4A 2Y69C 3GWNA 3V5YA 3O6XA 2LFFA 2DGJA 3ABKC 4CBEA 4W8KA 2HSBA 2EIKC 2Q4FA 1MNDA 2J0WA 3AG1C 3HTKC 2OEVA 3KH2A 5CI9A 2ZXWC 3JSEO 5L0IA 1E85A 2R7RA 2YEVA 3DMDA 3MBGA 4HFKB 4XEVA 4E0IA 3JSZA 3FHDA 1C02A 4Z9JA 3SXYA 4EBJA 2HMZA 2GFHA 3U8VA 3E70C 4M63A 5DQZA 4LERA 2Q7RA 1RCPA 3KYJA 1HE9A 2XM4A 1WGWA 1HMDA 4BEMJ 3LS0A 3Q7LA 1FMWA 3IEEA 2Y3HA 4XWJA 1G4US 2KC3A 1TFOB 3CZ6A 3DWWA 4NCQA 1NFNA 3LEVA 5COMA 2FGYA 3K7DA 5K0IA 4ZLDA 1V4AA 2KJGA 3NMIA 4JEBA 3Q6NA 2IBFA 1TWCA 1XZPA 1EI7A 2HKVA 2MYSA 3CEXA 4J32B 1E84A 3UGOA 1QKRA 2AU5A 4Q5SF 1FMVA 4MTFA 1RXQA 2LSEA 1NG1A 2DYRC 3ASOC 1Z23A 2J9WA 2R7VA 3TOLA 5L0GA 1OKKD 1AEPA 3POVA 2YL1A 4J7YA 3RF3A 3NYMA 2P7VA 3JCUQ 2UUIA 4AL1A 1OCCC 5A6BD 3VYWA 4FX5A 2KYHA 3PMRA 4IWBA 1TWAA 2PFDA 2E87A 3EGXB 5B1BC 2Y39A 3HNKA 1RKEA 4U9DA 1D1BA 4IJJA 1O3UA 2IOQA 1RKCA 2I15A 4G0HA 1TWHA 4MTGA 4MVZA 4IAQA 1M57C 3K1IA 3NYJA 3S27A 1Q0MA 3DE8A 3QVYA 1LS1A 3W4YA 3EQLF 3C18A 1OR2A 3DAGA 1OXKA 3ZC4A 4PFOA 2J9UA 5L0DA 2VCBA 2Y3DA 5TJ5E 5L3VA 3M79A 3M4CA 5JSLA 1VLSA 3RFYA 2KK1A 2PNOA 3ZSUA 4DBRA 4XPYA 2XLWA 3X2QC 2W4MA 3AG4C 2HS5A 2X51A 1D0XA 4AL0A 1LE2A 4GEHA 4U5DE 2Q9BA 2CYDA 3LUTB 3T4RA 4DOZA 3B0VC 3GM2A 2OQMA 3N24A 4JCHA 3VF0A 3OWTA 4D4NA 3GM3A 2IM8A 4X0RA 4XLNF 2ZXOA 4BJ5A 1E83A 1G4WR 2IXOA 3JT1A 2HV7A 4YJWA 4ULVA 1AUEA 1TKNA 3L0IA 3WODF 3UMHA 4A2NB 4EBKA 3BEHA 2DI3A 2L6HA 3EPVA 1BR1A 4UDVA 1WTYA 1L3PA 2B0JA 3G50A 4JKVA 5E2QA 4EBBA 2HMQA 2V3CC 2D5RB 1QZXA 2P6VA 3RH3A 3NRHA 2OJED 1ZHXA 2W45A 4MVMA 4ULWA 1FNTc 4CSAA 2WZLA 4AX2A 3ABMC 3K6BA 3SYNA 4DXWA 2GDCA 4HE8D 2WVOA 2XLVA 5BQGA 3LLKA 1M2OA 3WG7C 2NPUA 3K1HA 1LIHA 4YL3A 2O9XA 1V54C 3UR3C 4OIPF 3LNMB 4XEKA 1ZZPA 3PHF2 2YQYA 4CDVA 4EHPA 3GWLA 4E17A 1EA8A 1HW2A 2WB7A 2J45A 3EHMA 4RDAA 1ST6A 4I3MA 4P6IC 1JAFA 3FOOA 2QNLA 4U5CE 4C3EA 1Q0FA 3QVZA 4C3DA 2W4BA 2ZXPA 3IQ5A 3M1CB 2G3KA 2A6EF 4YL1A 4MW3A 3ASNC 4IAOA 2Q3TA 2A6HF 3EH1A 3ATPA 2ZD9A 3GEHA 4BEJA 2LD6A 2WZFA 3I5PA 3PDMP 3OA1A 2XS8A 1EQ1A 2J46A 2JD3A 1OCZC 1ZYRF 1ZHWA 1L7CA 3NKEA 3OEOA 4GQHA 4MVUA 1I4YA 4D4XA 3GM1A 3TULA 1CGNA 2R7TA 1KTMA 3UMKA 3NMKA 2XL6A 1G5ZA 2CNWA 1CGOA 1BZ4A 3FAJA 3G4ZA 3N2ZB 2KSFA 3MFNA 4MVRA 2BC5A 4PJJA 3C7JA 1FFTC 2R05A 1R4TA 2EIJC 3H2UA 3NKDA 2L81A 4P9FA 1GM5A 2V26A 2PBEA 4HEAJ 3JTLO 2H8AA 3IQCA 5JRAA 1XWJA 3ABLC 1YYXA 5FZTA 3H2VA 4N6HA 2XLDA 1JR8A 3MYIA 2CDQA 2Y3GA 2XM0A 1LI7A 1QLEC 3ZVRA 1LKXA 3HLZA 1NZEA 1D0YA 2L9JA 1HY5A 4YL0A 3U3BA 5L0FA 1RMVA 4H4KC 4LDQA 3JRMO 1VLTA 2EPKX 3RW0A 3RQEA 3SEOA 1Z63A 5A6AA 4XEFA 4BJ6C 4MTOA 2D4UA 4DRHB 4O6NA 3GORA 2FAPB 4CS9A 5DS6A 4A4AA 4RD9A 1QVXA 5B3IA 5KYXB 2XXAB 1QPUA 5GPGB 3UMIA 2QLAA 2ETSA 4DBQA 3DKAA 4E7ZA 2IXPA 2C04A 2NUPA 2LQGA 1H9GA 1LM3B 2B0HA 3JYYA 3RQGA 2PX0A 4IARA 1WN0A 3GANA 1YA7O 1A7VA 3DE9A 3V7OA 1H6GA 3PCVA 2J8WA 2ZXRA 3B71A 3EZHA 5AGFA 4YT2A 1I4ZA 1T6IA 2JX0A 1ZW3A 4OIOF 1JPNA 2VCAA 2TMVP 2MHRA 3DXJF 5E3CA 3U8PA 2MWQA 1UG7A 3L1MA 2XLOA 1IW7F 2PX3A 4NTAA 1QQ3A 5T3TA 3HJCA 1Q0DA 2IYLD 4LDRA 5EHHA 2PF4E 1NLXA 3L8IA 1LE4A 4CS8C 4IGGA 3CAXA 3HNLA 5JS5A 4KI2A 4G7OF 1G8XA 2EPNA 4OIRF 2LCHA 3HNJA 4PJLA 3TD7A 1U0BB 3M15A 4DRIB 2CNWD 3US6A 1D1AA 2NSFA 4I1OB 3KYIA 3W8HA 5DS5A 4ONSA 1FFHA 1Z5ZA 1YZCA 3VAYA 2A1DD 4EWCA 3SXKA 4BJTA 4C3BA 2A68F 2GA0A 5A6JA 3KMIA 5T1DB 4B6IA 1T6QA 1K05A 4HFFB 4JCZA 1ZHYA 2EPLX 1VYIA 3TQOA 2Q00A 5JUAA 3EFOB 4FAPB 1JPJA 2F22A 1PCXA 1K40A 4I44A 4CS7A 2OEXA 3M4BA 5COGA 4C7OB 3QW0A 3C8GB 1T9KA 1MMNA 3MLGA 4O79A 4JE9A 3IPMO 2A69F 2YRFA 4ZLCA 1E2XA 2G62A 3DD7A 3SZRA 2AWCA 1MMDA 4R32A 5JT4A 4QI0A 1WWPA 3S28A 4C7OA 1BDJB 3W8IA 3AQBA 4U5BE 3ECSA 1Z7Qc 4QI2A 3S0XA 3AGTA 1FAPB 2EPMX 1U89A 1TR2A 2QY9A 1SR2A 1D1CA 4PJNA 1R5ID 5AC5A 3AJMA 1H9TA 1SYQA 4WGZA 2Q9CA 1Y6DA 4YWQA 3O10A 2A0UA 2HUJA 1S7ZA 2QE9A 3AOUA 4L6RA 4N6CA 1DOWA 4BJ5C 2WL8A 5KYXA 1YARO 2XXAA 3FMSA 4W8PA 3MYFA 1TQGA 1BR4A 2NUPB 2EPOA 2HJMA 2YZSA 2Z15A 4LACB 4YT4A 4AE4B 1Z3IX 3EZIA 5BUOA 5CIVA 4E18A 3S90A 2A0BA 3T6BA 3J06A 5E3AA 5B3SC 5A6KA 5DVWA 5BQIA 2R7SA 1APCA 2BE5F 2J7PA 5JVEA 1E86A 2C03A 2WVQA 2OG2A 4DVYP 5L0JA 4K7BA 5EGYA 2XLMA 3DI5A 3KKBA 3NG1A 4Q4ZF 1ZU5A 3O39A 3B0UX 4BJ1A 4WJ0A 1GGQA 3LEOA 2NG1A 2Q9AA 2YL3A 1OCRC 1YVIA 1OCOC 2JPUA 3GEEA 3QTHA 1T6UA 3AQCA 1A41A 4OD5A 2IXMA 3R7CA 4E7SA 3U9JA 4DRJB 1YAUO 1C17M 2LP4A 1Q0KA 2HSQA 2R7OA 2AVKA 2HZ8A 4KNVA 4NTFA 1BBHA 4KBLA 4XTKA 2LK4A 2RD9A 4ANJA 4K1OA 1IZMA 5FCLA 2XRHA 1OW8A 1O5HA 2XSEA 3L34A 4MVQA 1VTMP 3IQ6A 4U5HA 1C03A 3A9CA 1HE1A 1RJ9A 2R9RB 4MQ9F 3EFOA 3QZCA 5KYYB 3F47A 1M2VA 3A11A 4CDAA 3GODA 3LJBA 2VH3A 1VYKA 1ORJA 3C8GA 4JURI 1V74B 5COFA 3U2LA 2PP4A 3AGUA 4G78A 4CIPA 1NU9C 3RYLA 3QMKA 2YWAA 3VRCA 1I5NA 2KQ9A 2M64A 1VK5A 2NSGA 2J0XA 3C63A 3R2PA 4JW1A 4LDKA 4JTAB 4JZAA 4OD4A 2VC9A 2R7UA 2Y3BA 2ZPAA 2H7BA 4YT5A 1WASA 1PD0A 5L0CA 3UNGC 3CSKA 3I5QA 4JEAA 2GWWA 3T6JA 2YLIA 4IRUA 5IY5C 3TOMA 4NC3A 2NUTB 1ZVZA 4CJOA 2FFHA 3U5SA 3O55A 1LVKA 3NYLA 4P9TA 5F5HA 3WAQA 3S84A 2HJ3A 2P61A 5KYWA 1LS4A 1U6HA 3GEIA 2OU6A 4AE4A 2DB4A 1GS9A 4WGYA 4CS9C 1A0BA 4BJ6A 1H7IA 3EHNA 4JTDB 1KNYA 3N0TA 2H7VC 4FESA 3F46A 3B29A 4KC9A 2RSEB 1YDIA 3Q7GA 3CQZA 4YK5A 4QDLA 1T5OA 3MX3A 4JJFA 1ORSC 3JRTA 4GYTA 3RKOF 1YYJA 2WVNA 4JIOA 3TJ5A 4XPWA 1JRAA 5T3WA 3SXMA 1V55C 1LI5A 4JVSA 2W9YA 1O87A 3FAPB 5B1AC 2OCCC 2VB6A 3G4XA 3T9OA 3TJ6A 3RIPA 3JYHA 5KYUB 2QUPA 2YVKA 3X1OA 1OW7A 4NQFA 3B0PA 3K33A 1A7DA 1YLMA 2AP3A 2KW3C 1OQCA 5E33A 1WATA 3EJNA 3QW1A 3EG9A 3EGDA 1CPQA 3C62A 1ZHZA 3ZQYA 1M56C 2ASRA 4H54A 4JJGA 4U5FE 4CX9A 2VCCA 4CS8A 4MVOA 4DJ9A 3LAYA 2EILC 2HFIA 4JTCB 1NBBA 1S05A 3NMJA 1RJ9B 2VASA 3C8GD 3ZDLA 1YJGA 4AK9A 4DVZA 4OINF 2P0NA 1MMGA 3IHUA 4XLPF 4K0DA 1M2VB 5KYYA 1OXBA 1DOVA 3K66A 3SNHA 4BG0A 1HW1A 1F1MA 1TWGA 1ZHTA 3K1IC 1ORYA 3LNRA 3HKKA 2YL0A 5L0HA
chains in the Genus database with same CATH topology
4DRIB 2RSEB 1FAPB 1NSGB 1AUEA 4DRJB 5GPGB 2GAQA 3FAPB 4DRHB 2FAPB 2NPUA 4FAPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI B;  2RSE B;  1FAP B;  1NSG B;  1AUE A;  4DRJ B;  5GPG B;  2GAQ A;  3FAP B;  4DRH B;  2FAP B;  2NPU A;  4FAP B; 
#chains in the Genus database with same CATH topology
 1PV3 A;  2EIN C;  3TK0 A;  3ZIB A;  3UGP A;  4LLC A;  2GAQ A;  2XL4 A;  3FOP A;  1VB5 A;  4Z9I A;  4KNW A;  1B68 A;  1HMO A;  3Q6M A;  2CW0 F;  5D91 A;  1PD1 A;  2KGO A;  1J8Y F;  4EUK B;  4YN0 B;  3SP1 A;  2XLH A;  4MVS A;  4PAC A;  3SXZ A;  1N1C A;  1CGM E;  3FVY A;  2YHS A;  2J9B A;  3KL4 A;  2CCY A;  1YA9 A;  1EKY A;  1JOG A;  4XQ1 A;  2UUH A;  1WOL A;  2NUT A;  1K04 A;  3DM5 A;  3ZQV A;  4J30 B;  3AG3 C;  3ZTM A;  2L7A A;  2YLD A;  3RQF A;  4G7Z F;  1Y4C A;  2XL8 A;  2XLE A;  2X0C A;  5EK0 A;  5KYW B;  5BQH A;  1GQA A;  3DAF A;  4MND A;  1BR2 A;  1CPR A;  1NU7 D;  4N4W A;  2R7W A;  1FTS A;  3DJN B;  2BL2 A;  1J8M F;  3H65 A;  2J9V A;  1ZW2 A;  5DQT A;  4YT8 A;  5A69 A;  1VOM A;  5D92 A;  2KNH A;  4JC7 A;  3HNI A;  4CIH A;  3I4U A;  3L8J A;  4N06 A;  4U9E A;  4WAB A;  5F28 E;  4CSA C;  5F5F A;  3S9O A;  2DYS C;  3ZG1 A;  3WHN A;  4Z9H A;  3U0C A;  3V5X A;  1SZI A;  1MMA A;  4O7G A;  2LIG A;  2OKU A;  2R25 A;  1SF8 A;  4MS2 A;  2P1A A;  3RVZ A;  256B A;  5HV9 A;  5HSW A;  5KYU A;  3FXH A;  2HV6 A;  4PR9 A;  1FR0 A;  4IB4 A;  1AVO B;  1ZU4 A;  3C8Z A;  4PJM A;  5KYN A;  3T6G B;  1YZA A;  2M4E A;  1JMW A;  1MQV A;  3EG9 B;  1D0Z A;  3EGD B;  1OR3 A;  3KPH A;  3V5Z A;  3BRJ A;  4U5E E;  1LPE A;  3U9M A;  3E9V A;  3RVY A;  5L3Q A;  1KU2 A;  2I8B A;  1A7E A;  2LFD A;  3DM9 B;  3LS1 A;  5CI8 A;  4OIQ F;  4J7T A;  2WZG A;  3B9Q A;  4BPM A;  3NDB B;  3ZWI A;  2L6F A;  2G3V A;  5DS4 A;  4RBN A;  4EKW A;  1W2W A;  4ER9 A;  2YKZ A;  2R03 A;  4CDY A;  2IXN A;  1M6T A;  1TFK B;  1SMY F;  5DLJ A;  3U2M A;  2EIM C;  1OKK A;  2R02 A;  1NFO A;  1QSP A;  2OJQ A;  2R7Q A;  3LES A;  4I1M A;  4Q7C A;  3S29 A;  3FDQ A;  3EGX A;  1UFB A;  1RKE B;  4LLE A;  3LLI A;  4NY3 A;  4F4B A;  5AC4 A;  5A6B A;  1XZQ A;  3W2W A;  3U3F A;  3DJU B;  2L6G A;  3DZA A;  3EH2 A;  3VM6 A;  3ZTZ A;  5JLI A;  5JP7 A;  3ITF A;  4JRZ A;  4E0H A;  4G7H F;  2YL7 A;  2QTV A;  1MNE A;  4CJG A;  2CGE A;  2R7X A;  3JZ0 A;  2ICW G;  2XS1 A;  1NSG B;  1Q0G A;  1Z6A A;  2YLG A;  4FWV A;  2OOC A;  4O6M A;  4EIY A;  3W2V A;  3IQT A;  4NTB A;  2H7O A;  1T01 A;  1OW6 A;  4XPX A;  4U5G A;  1VMA A;  3AG2 C;  4O6Y A;  4MW8 A;  2J7P D;  2AWY A;  4PFP A;  4PK4 A;  2Y69 C;  3GWN A;  3V5Y A;  3O6X A;  2LFF A;  2DGJ A;  3ABK C;  4CBE A;  4W8K A;  2HSB A;  2EIK C;  2Q4F A;  1MND A;  2J0W A;  3AG1 C;  3HTK C;  2OEV A;  3KH2 A;  5CI9 A;  2ZXW C;  3JSE O;  5L0I A;  1E85 A;  2R7R A;  2YEV A;  3DMD A;  3MBG A;  4HFK B;  4XEV A;  4E0I A;  3JSZ A;  3FHD A;  1C02 A;  4Z9J A;  3SXY A;  4EBJ A;  2HMZ A;  2GFH A;  3U8V A;  3E70 C;  4M63 A;  5DQZ A;  4LER A;  2Q7R A;  1RCP A;  3KYJ A;  1HE9 A;  2XM4 A;  1WGW A;  1HMD A;  4BEM J;  3LS0 A;  3Q7L A;  1FMW A;  3IEE A;  2Y3H A;  4XWJ A;  1G4U S;  2KC3 A;  1TFO B;  3CZ6 A;  3DWW A;  4NCQ A;  1NFN A;  3LEV A;  5COM A;  2FGY A;  3K7D A;  5K0I A;  4ZLD A;  1V4A A;  2KJG A;  3NMI A;  4JEB A;  3Q6N A;  2IBF A;  1TWC A;  1XZP A;  1EI7 A;  2HKV A;  2MYS A;  3CEX A;  4J32 B;  1E84 A;  3UGO A;  1QKR A;  2AU5 A;  4Q5S F;  1FMV A;  4MTF A;  1RXQ A;  2LSE A;  1NG1 A;  2DYR C;  3ASO C;  1Z23 A;  2J9W A;  2R7V A;  3TOL A;  5L0G A;  1OKK D;  1AEP A;  3POV A;  2YL1 A;  4J7Y A;  3RF3 A;  3NYM A;  2P7V A;  3JCU Q;  2UUI A;  4AL1 A;  1OCC C;  5A6B D;  3VYW A;  4FX5 A;  2KYH A;  3PMR A;  4IWB A;  1TWA A;  2PFD A;  2E87 A;  3EGX B;  5B1B C;  2Y39 A;  3HNK A;  1RKE A;  4U9D A;  1D1B A;  4IJJ A;  1O3U A;  2IOQ A;  1RKC A;  2I15 A;  4G0H A;  1TWH A;  4MTG A;  4MVZ A;  4IAQ A;  1M57 C;  3K1I A;  3NYJ A;  3S27 A;  1Q0M A;  3DE8 A;  3QVY A;  1LS1 A;  3W4Y A;  3EQL F;  3C18 A;  1OR2 A;  3DAG A;  1OXK A;  3ZC4 A;  4PFO A;  2J9U A;  5L0D A;  2VCB A;  2Y3D A;  5TJ5 E;  5L3V A;  3M79 A;  3M4C A;  5JSL A;  1VLS A;  3RFY A;  2KK1 A;  2PNO A;  3ZSU A;  4DBR A;  4XPY A;  2XLW A;  3X2Q C;  2W4M A;  3AG4 C;  2HS5 A;  2X51 A;  1D0X A;  4AL0 A;  1LE2 A;  4GEH A;  4U5D E;  2Q9B A;  2CYD A;  3LUT B;  3T4R A;  4DOZ A;  3B0V C;  3GM2 A;  2OQM A;  3N24 A;  4JCH A;  3VF0 A;  3OWT A;  4D4N A;  3GM3 A;  2IM8 A;  4X0R A;  4XLN F;  2ZXO A;  4BJ5 A;  1E83 A;  1G4W R;  2IXO A;  3JT1 A;  2HV7 A;  4YJW A;  4ULV A;  1AUE A;  1TKN A;  3L0I A;  3WOD F;  3UMH A;  4A2N B;  4EBK A;  3BEH A;  2DI3 A;  2L6H A;  3EPV A;  1BR1 A;  4UDV A;  1WTY A;  1L3P A;  2B0J A;  3G50 A;  4JKV A;  5E2Q A;  4EBB A;  2HMQ A;  2V3C C;  2D5R B;  1QZX A;  2P6V A;  3RH3 A;  3NRH A;  2OJE D;  1ZHX A;  2W45 A;  4MVM A;  4ULW A;  1FNT c;  4CSA A;  2WZL A;  4AX2 A;  3ABM C;  3K6B A;  3SYN A;  4DXW A;  2GDC A;  4HE8 D;  2WVO A;  2XLV A;  5BQG A;  3LLK A;  1M2O A;  3WG7 C;  2NPU A;  3K1H A;  1LIH A;  4YL3 A;  2O9X A;  1V54 C;  3UR3 C;  4OIP F;  3LNM B;  4XEK A;  1ZZP A;  3PHF 2;  2YQY A;  4CDV A;  4EHP A;  3GWL A;  4E17 A;  1EA8 A;  1HW2 A;  2WB7 A;  2J45 A;  3EHM A;  4RDA A;  1ST6 A;  4I3M A;  4P6I C;  1JAF A;  3FOO A;  2QNL A;  4U5C E;  4C3E A;  1Q0F A;  3QVZ A;  4C3D A;  2W4B A;  2ZXP A;  3IQ5 A;  3M1C B;  2G3K A;  2A6E F;  4YL1 A;  4MW3 A;  3ASN C;  4IAO A;  2Q3T A;  2A6H F;  3EH1 A;  3ATP A;  2ZD9 A;  3GEH A;  4BEJ A;  2LD6 A;  2WZF A;  3I5P A;  3PDM P;  3OA1 A;  2XS8 A;  1EQ1 A;  2J46 A;  2JD3 A;  1OCZ C;  1ZYR F;  1ZHW A;  1L7C A;  3NKE A;  3OEO A;  4GQH A;  4MVU A;  1I4Y A;  4D4X A;  3GM1 A;  3TUL A;  1CGN A;  2R7T A;  1KTM A;  3UMK A;  3NMK A;  2XL6 A;  1G5Z A;  2CNW A;  1CGO A;  1BZ4 A;  3FAJ A;  3G4Z A;  3N2Z B;  2KSF A;  3MFN A;  4MVR A;  2BC5 A;  4PJJ A;  3C7J A;  1FFT C;  2R05 A;  1R4T A;  2EIJ C;  3H2U A;  3NKD A;  2L81 A;  4P9F A;  1GM5 A;  2V26 A;  2PBE A;  4HEA J;  3JTL O;  2H8A A;  3IQC A;  5JRA A;  1XWJ A;  3ABL C;  1YYX A;  5FZT A;  3H2V A;  4N6H A;  2XLD A;  1JR8 A;  3MYI A;  2CDQ A;  2Y3G A;  2XM0 A;  1LI7 A;  1QLE C;  3ZVR A;  1LKX A;  3HLZ A;  1NZE A;  1D0Y A;  2L9J A;  1HY5 A;  4YL0 A;  3U3B A;  5L0F A;  1RMV A;  4H4K C;  4LDQ A;  3JRM O;  1VLT A;  2EPK X;  3RW0 A;  3RQE A;  3SEO A;  1Z63 A;  5A6A A;  4XEF A;  4BJ6 C;  4MTO A;  2D4U A;  4DRH B;  4O6N A;  3GOR A;  2FAP B;  4CS9 A;  5DS6 A;  4A4A A;  4RD9 A;  1QVX A;  5B3I A;  5KYX B;  2XXA B;  1QPU A;  5GPG B;  3UMI A;  2QLA A;  2ETS A;  4DBQ A;  3DKA A;  4E7Z A;  2IXP A;  2C04 A;  2NUP A;  2LQG A;  1H9G A;  1LM3 B;  2B0H A;  3JYY A;  3RQG A;  2PX0 A;  4IAR A;  1WN0 A;  3GAN A;  1YA7 O;  1A7V A;  3DE9 A;  3V7O A;  1H6G A;  3PCV A;  2J8W A;  2ZXR A;  3B71 A;  3EZH A;  5AGF A;  4YT2 A;  1I4Z A;  1T6I A;  2JX0 A;  1ZW3 A;  4OIO F;  1JPN A;  2VCA A;  2TMV P;  2MHR A;  3DXJ F;  5E3C A;  3U8P A;  2MWQ A;  1UG7 A;  3L1M A;  2XLO A;  1IW7 F;  2PX3 A;  4NTA A;  1QQ3 A;  5T3T A;  3HJC A;  1Q0D A;  2IYL D;  4LDR A;  5EHH A;  2PF4 E;  1NLX A;  3L8I A;  1LE4 A;  4CS8 C;  4IGG A;  3CAX A;  3HNL A;  5JS5 A;  4KI2 A;  4G7O F;  1G8X A;  2EPN A;  4OIR F;  2LCH A;  3HNJ A;  4PJL A;  3TD7 A;  1U0B B;  3M15 A;  4DRI B;  2CNW D;  3US6 A;  1D1A A;  2NSF A;  4I1O B;  3KYI A;  3W8H A;  5DS5 A;  4ONS A;  1FFH A;  1Z5Z A;  1YZC A;  3VAY A;  2A1D D;  4EWC A;  3SXK A;  4BJT A;  4C3B A;  2A68 F;  2GA0 A;  5A6J A;  3KMI A;  5T1D B;  4B6I A;  1T6Q A;  1K05 A;  4HFF B;  4JCZ A;  1ZHY A;  2EPL X;  1VYI A;  3TQO A;  2Q00 A;  5JUA A;  3EFO B;  4FAP B;  1JPJ A;  2F22 A;  1PCX A;  1K40 A;  4I44 A;  4CS7 A;  2OEX A;  3M4B A;  5COG A;  4C7O B;  3QW0 A;  3C8G B;  1T9K A;  1MMN A;  3MLG A;  4O79 A;  4JE9 A;  3IPM O;  2A69 F;  2YRF A;  4ZLC A;  1E2X A;  2G62 A;  3DD7 A;  3SZR A;  2AWC A;  1MMD A;  4R32 A;  5JT4 A;  4QI0 A;  1WWP A;  3S28 A;  4C7O A;  1BDJ B;  3W8I A;  3AQB A;  4U5B E;  3ECS A;  1Z7Q c;  4QI2 A;  3S0X A;  3AGT A;  1FAP B;  2EPM X;  1U89 A;  1TR2 A;  2QY9 A;  1SR2 A;  1D1C A;  4PJN A;  1R5I D;  5AC5 A;  3AJM A;  1H9T A;  1SYQ A;  4WGZ A;  2Q9C A;  1Y6D A;  4YWQ A;  3O10 A;  2A0U A;  2HUJ A;  1S7Z A;  2QE9 A;  3AOU A;  4L6R A;  4N6C A;  1DOW A;  4BJ5 C;  2WL8 A;  5KYX A;  1YAR O;  2XXA A;  3FMS A;  4W8P A;  3MYF A;  1TQG A;  1BR4 A;  2NUP B;  2EPO A;  2HJM A;  2YZS A;  2Z15 A;  4LAC B;  4YT4 A;  4AE4 B;  1Z3I X;  3EZI A;  5BUO A;  5CIV A;  4E18 A;  3S90 A;  2A0B A;  3T6B A;  3J06 A;  5E3A A;  5B3S C;  5A6K A;  5DVW A;  5BQI A;  2R7S A;  1APC A;  2BE5 F;  2J7P A;  5JVE A;  1E86 A;  2C03 A;  2WVQ A;  2OG2 A;  4DVY P;  5L0J A;  4K7B A;  5EGY A;  2XLM A;  3DI5 A;  3KKB A;  3NG1 A;  4Q4Z F;  1ZU5 A;  3O39 A;  3B0U X;  4BJ1 A;  4WJ0 A;  1GGQ A;  3LEO A;  2NG1 A;  2Q9A A;  2YL3 A;  1OCR C;  1YVI A;  1OCO C;  2JPU A;  3GEE A;  3QTH A;  1T6U A;  3AQC A;  1A41 A;  4OD5 A;  2IXM A;  3R7C A;  4E7S A;  3U9J A;  4DRJ B;  1YAU O;  1C17 M;  2LP4 A;  1Q0K A;  2HSQ A;  2R7O A;  2AVK A;  2HZ8 A;  4KNV A;  4NTF A;  1BBH A;  4KBL A;  4XTK A;  2LK4 A;  2RD9 A;  4ANJ A;  4K1O A;  1IZM A;  5FCL A;  2XRH A;  1OW8 A;  1O5H A;  2XSE A;  3L34 A;  4MVQ A;  1VTM P;  3IQ6 A;  4U5H A;  1C03 A;  3A9C A;  1HE1 A;  1RJ9 A;  2R9R B;  4MQ9 F;  3EFO A;  3QZC A;  5KYY B;  3F47 A;  1M2V A;  3A11 A;  4CDA A;  3GOD A;  3LJB A;  2VH3 A;  1VYK A;  1ORJ A;  3C8G A;  4JUR I;  1V74 B;  5COF A;  3U2L A;  2PP4 A;  3AGU A;  4G78 A;  4CIP A;  1NU9 C;  3RYL A;  3QMK A;  2YWA A;  3VRC A;  1I5N A;  2KQ9 A;  2M64 A;  1VK5 A;  2NSG A;  2J0X A;  3C63 A;  3R2P A;  4JW1 A;  4LDK A;  4JTA B;  4JZA A;  4OD4 A;  2VC9 A;  2R7U A;  2Y3B A;  2ZPA A;  2H7B A;  4YT5 A;  1WAS A;  1PD0 A;  5L0C A;  3UNG C;  3CSK A;  3I5Q A;  4JEA A;  2GWW A;  3T6J A;  2YLI A;  4IRU A;  5IY5 C;  3TOM A;  4NC3 A;  2NUT B;  1ZVZ A;  4CJO A;  2FFH A;  3U5S A;  3O55 A;  1LVK A;  3NYL A;  4P9T A;  5F5H A;  3WAQ A;  3S84 A;  2HJ3 A;  2P61 A;  5KYW A;  1LS4 A;  1U6H A;  3GEI A;  2OU6 A;  4AE4 A;  2DB4 A;  1GS9 A;  4WGY A;  4CS9 C;  1A0B A;  4BJ6 A;  1H7I A;  3EHN A;  4JTD B;  1KNY A;  3N0T A;  2H7V C;  4FES A;  3F46 A;  3B29 A;  4KC9 A;  2RSE B;  1YDI A;  3Q7G A;  3CQZ A;  4YK5 A;  4QDL A;  1T5O A;  3MX3 A;  4JJF A;  1ORS C;  3JRT A;  4GYT A;  3RKO F;  1YYJ A;  2WVN A;  4JIO A;  3TJ5 A;  4XPW A;  1JRA A;  5T3W A;  3SXM A;  1V55 C;  1LI5 A;  4JVS A;  2W9Y A;  1O87 A;  3FAP B;  5B1A C;  2OCC C;  2VB6 A;  3G4X A;  3T9O A;  3TJ6 A;  3RIP A;  3JYH A;  5KYU B;  2QUP A;  2YVK A;  3X1O A;  1OW7 A;  4NQF A;  3B0P A;  3K33 A;  1A7D A;  1YLM A;  2AP3 A;  2KW3 C;  1OQC A;  5E33 A;  1WAT A;  3EJN A;  3QW1 A;  3EG9 A;  3EGD A;  1CPQ A;  3C62 A;  1ZHZ A;  3ZQY A;  1M56 C;  2ASR A;  4H54 A;  4JJG A;  4U5F E;  4CX9 A;  2VCC A;  4CS8 A;  4MVO A;  4DJ9 A;  3LAY A;  2EIL C;  2HFI A;  4JTC B;  1NBB A;  1S05 A;  3NMJ A;  1RJ9 B;  2VAS A;  3C8G D;  3ZDL A;  1YJG A;  4AK9 A;  4DVZ A;  4OIN F;  2P0N A;  1MMG A;  3IHU A;  4XLP F;  4K0D A;  1M2V B;  5KYY A;  1OXB A;  1DOV A;  3K66 A;  3SNH A;  4BG0 A;  1HW1 A;  1F1M A;  1TWG A;  1ZHT A;  3K1I C;  1ORY A;  3LNR A;  3HKK A;  2YL0 A;  5L0H A; 
#chains in the Genus database with same CATH homology
 4DRI B;  2RSE B;  1FAP B;  1NSG B;  1AUE A;  4DRJ B;  5GPG B;  2GAQ A;  3FAP B;  4DRH B;  2FAP B;  2NPU A;  4FAP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...