3FAPB

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 3fapB00
1AUEA 1NSGB 4DRJB 1FAPB 4DRIB 4DRHB 4FAPB 2RSEB 2NPUA 2FAPB 2GAQA 3FAPB 5GPGB
chains in the Genus database with same CATH superfamily
2O9XA 5BUOA 3ZDLA 3GANA 1O5HA 2J9BA 5AGFA 1LS4A 3VRCA 3DD7A 2A69F 1D1BA 3FAPB 3MFNA 1ORYA 4KNWA 2BE5F 3DKAA 3U8VA 3SXZA 3EFOB 2HFIA 5A69A 1FFTC 2IBFA 2UUIA 4P9FA 2L6GA 2YL1A 2RD9A 3LLKA 3GM3A 4G0HA 5JS5A 3U0CA 1A41A 5COMA 2PF4E 4Z9IA 1HW1A 3O39A 3UGOA 2LCHA 3X1OA 1RKEA 4J30B 3N0TA 2YL7A 3KH2A 4IB4A 5A6AA 1OW8A 2BC5A 3FVYA 2YQYA 2M64A 3HNKA 3TK0A 1CPQA 1Q0MA 5K0IA 2ZXWC 4XPXA 3AJMA 5HV9A 2UUHA 1Y4CA 4Q7CA 4ULWA 1U6HA 4EUKB 2XLHA 4OIQF 3BEHA 1MMNA 2R7QA 4XLNF 4G78A 1YA7O 4AL0A 1NU7D 4JE9A 4L6RA 1K04A 4Z9HA 1LE4A 2A6EF 1OW6A 2ETSA 3GWLA 2FGYA 3LNMB 4XLPF 1Y6DA 1YLMA 4U9DA 2E87A 2G3VA 1OCOC 4N6CA 2R7TA 2NUPA 2Y3HA 4E0HA 2R7VA 2YLDA 3JCUQ 2W45A 3C63A 1VLSA 2ZD9A 4MNDA 3DE9A 1H9TA 3HNIA 4FWVA 1V74B 4BJ6A 5KYUB 2FFHA 1QKRA 3G4ZA 4CSAC 1Q0DA 2HV7A 3Q7GA 5FZTA 4OINF 4U5DE 4JIOA 3EQLF 1O3UA 2NSGA 4U5FE 3ZVRA 1D0ZA 4XPYA 3WG7C 4PR9A 1NBBA 4BPMA 1V54C 1OR3A 2LFFA 2CNWA 1D1CA 2IXPA 3Q6NA 1XWJA 1U89A 4P6IC 1APCA 1M2VB 4PJJA 3TQOA 4MTGA 4XEKA 2R7RA 4NTAA 5DS6A 1D0YA 2HJMA 2MWQA 2YKZA 2Z15A 3ASNC 2Y3DA 2LD6A 4RD9A 1CGME 3LS1A 5DQTA 2QUPA 1DOWA 4FX5A 3SEOA 1WGWA 5DLJA 2LIGA 4IWBA 1SMYF 2F22A 3NMIA 1RXQA 4BEJA 1ZHWA 4MS2A 4U5GA 3JTLO 4MVMA 2L9JA 4WJ0A 3U3FA 1KTMA 2XL8A 1BBHA 1R4TA 1C02A 3NMJA 4CS8C 3T9OA 4PFPA 1JPNA 3RW0A 4R32A 5L0HA 4IAQA 5JP7A 2PP4A 2IOQA 3BRJA 4DRIB 2VC9A 2Q9CA 4I44A 2NSFA 1VLTA 2KNHA 4CJGA 2EIMC 1HMOA 3H2UA 3ASOC 4ZLDA 3O6XA 2EILC 1NSGB 3TOLA 3ZC4A 3CQZA 4CJOA 1TFOB 2A6HF 3NRHA 4JURI 5CI8A 4EIYA 1RMVA 1Q0KA 2EPKX 2R02A 4GQHA 3R7CA 1UG7A 4EBBA 4CIHA 5IY5C 2I8BA 4MQ9F 1H7IA 2CDQA 4XEVA 2XXAB 4CS8A 3A9CA 4E7SA 4YT5A 2A1DD 3C8GD 2R7OA 4I3MA 2QNLA 3JRTA 3M4CA 1WOLA 2LSEA 5L3QA 4MVZA 1L7CA 1TWHA 2XM4A 4K7BA 3T4RA 3U9JA 3O55A 4ZLCA 1BR1A 1B68A 4EHPA 1I4ZA 1QPUA 2DYRC 3V5ZA 5T3TA 4HE8D 2XSEA 5E3CA 3C8GB 3V5YA 4YL1A 3RQEA 1MMAA 4QDLA 3VYWA 4AK9A 5DS5A 4C7OB 4E17A 2WZLA 2AWYA 3HNJA 3GM2A 3OA1A 2DB4A 3GWNA 5BQGA 2XM0A 2J7PA 3TJ6A 2Q3TA 4JCZA 5COGA 1LPEA 2P7VA 5HSWA 1FMVA 1ZYRF 2XLMA 2HSQA 3Q6MA 3RVZA 1LI7A 2G3KA 2BL2A 2P0NA 3AG1C 4AE4A 5JVEA 1F1MA 2OU6A 5KYXB 3CSKA 3B9QA 3H2VA 2QTVA 5E3AA 3RQGA 5L0GA 2GWWA 3EHMA 3JRMO 4XEFA 2KJGA 3POVA 1ZVZA 2L6HA 3IPMO 4LDQA 3B29A 2XRHA 3KMIA 4XWJA 5EHHA 2LQGA 2YL0A 1MMGA 3K33A 3WAQA 3VF0A 5JRAA 4LDKA 5BQIA 1GM5A 2R7UA 2KW3C 2Q00A 4G7OF 3EG9B 3L0IA 4LLCA 2X0CA 1T9KA 2B0JA 2OJED 1ST6A 2XLVA 2Y3BA 4PK4A 4DJ9A 2OOCA 2HJ3A 3E70C 1OCCC 3EPVA 3M15A 3A11A 2EIKC 2AVKA 2YRFA 1LKXA 3KPHA 1EA8A 2ZPAA 1E84A 2ASRA 1JRAA 3GEEA 3S29A 1CGNA 4N6HA 1A7DA 1MNEA 4OIOF 1TWGA 3ZQYA 1M2OA 2DYSC 2HZ8A 4DBRA 2OJQA 3QVYA 1T01A 1A7EA 5DQZA 4LLEA 3RVYA 3LS0A 1U0BB 2J46A 1Z5ZA 5T3WA 3EGXA 4IRUA 3UNGC 1ZU5A 4N4WA 2P1AA 3L34A 2L6FA 2IM8A 2W4MA 2YVKA 2JPUA 4JTCB 4O6MA 1Z6AA 2WZGA 4YN0B 5KYWA 2R7SA 1YYXA 5JT4A 2EPOA 2GAQA 3UGPA 3T6BA 3C8ZA 1HMDA 2WB7A 4OD5A 3W2VA 2JX0A 2RSEB 2CNWD 2VCAA 3EH1A 2L81A 4IJJA 3QMKA 1TWAA 4U5CE 1SR2A 2GA0A 2PX3A 3ATPA 3WODF 2LK4A 3NMKA 1EKYA 1FR0A 2GDCA 1I5NA 1RJ9B 4PFOA 4E18A 1E86A 2Q9AA 4O6YA 1TQGA 2H7VC 2C04A 4LERA 3EZIA 4KI2A 4OD4A 3NYLA 3EFOA 1ZW2A 3NG1A 5EGYA 3QW1A 1NU9C 3LUTB 1T5OA 3W8IA 1GGQA 1AVOB 3GORA 1WTYA 4PJMA 4CS9C 4PJNA 1H9GA 3U5SA 1K05A 3AG3C 3JYYA 2X51A 4BJ1A 5L0CA 4YL3A 3UMHA 3UMKA 3UR3C 3I4UA 3NYJA 3KKBA 3JSZA 1JAFA 1YJGA 4C3DA 4YWQA 4CIPA 1FTSA 3EGDB 5COFA 5L3VA 4WABA 2OKUA 3W8HA 4DOZA 1ZZPA 3RQFA 4XPWA 2KGOA 4YT8A 1IZMA 1Q0GA 4BJTA 4EKWA 2C03A 4JCHA 4E0IA 4NQFA 4CSAA 3S0XA 1BZ4A 1Z63A 1JOGA 3LESA 3SYNA 2PFDA 2P61A 3AQBA 4JVSA 4XTKA 3T6GB 4ER9A 5E2QA 1NZEA 256BA 2W9YA 3PCVA 4ULVA 3RFYA 3ZWIA 5T1DB 1VMAA 3B71A 2PBEA 1E83A 4CX9A 3TD7A 2H7OA 2A0UA 3S9OA 1UFBA 2NUTB 3S90A 1OXKA 2YHSA 1MQVA 2R03A 4G7HF 1HW2A 5KYUA 5FCLA 3ITFA 3OWTA 3IQ6A 4MTOA 3SXYA 2XL4A 3U2MA 1O87A 1FNTc 2HSBA 3LEOA 1FMWA 1R5ID 3DZAA 1OR2A 4NTBA 3E9VA 1XZPA 2YLGA 3F46A 2J9VA 3AGTA 3K66A 2PX0A 3OEOA 3AGUA 1VTMP 4CBEA 2KC3A 4JEAA 2DGJA 2XLWA 4DVZA 2MHRA 3K1IC 1M2VA 2J7PD 4A4AA 1FAPB 3QTHA 3ZSUA 2J9UA 3CAXA 4U5BE 2NPUA 1M57C 2LP4A 3FOOA 4BEMJ 3K1HA 2J0XA 3K7DA 1YZAA 3LLIA 4JZAA 1J8YF 4JRZA 3DI5A 3U2LA 4U5EE 2KSFA 2R9RB 1WN0A 4HEAJ 4JW1A 1LI5A 4K1OA 3ZIBA 4IGGA 3FXHA 3MYIA 4N06A 5KYYB 1OKKA 4EBJA 3QZCA 1QSPA 3N24A 2XL6A 4BG0A 1LM3B 4HFKB 2WL8A 5A6KA 3M79A 2ICWG 5E33A 1G5ZA 1G8XA 5B1AC 4EBKA 1T6IA 3ABMC 2W4BA 2CCYA 4C3EA 3O10A 1W2WA 1QZXA 3LJBA 3B0VC 1HE1A 1NLXA 4Q4ZF 1G4WR 1RKCA 2EINC 2ZXPA 5DVWA 3NKDA 2M4EA 5JSLA 4CDYA 3Q7LA 1PCXA 5B3IA 2Y3GA 1FFHA 3EHNA 2D5RB 1YA9A 3DM9B 1VYKA 3DMDA 4O79A 3JZ0A 2PNOA 4P9TA 5A6BA 1WWPA 1VOMA 3ABLC 1AUEA 3SP1A 3I5QA 2OG2A 1CGOA 3QW0A 2EIJC 3DAGA 3WHNA 1J8MF 3HNLA 4Q5SF 3ZQVA 3S84A 2DI3A 5B1BC 2QY9A 3V7OA 2AP3A 3IQTA 4JC7A 1JMWA 3C8GA 4JJGA 1CPRA 3DXJF 3EH2A 2D4UA 2QLAA 1YDIA 4C7OA 1S05A 3TOMA 3W4YA 2WVQA 1RKEB 3AG2C 1M56C 4JJFA 4MTFA 5EK0A 1SZIA 1IW7F 1A7VA 2OCCC 1K40A 1VB5A 3FHDA 3KYJA 3VAYA 1ZHXA 2R7WA 3FOPA 4JTDB 4C3BA 3L8JA 1N1CA 1OCZC 4W8KA 1Q0FA 4DBQA 3PDMP 1VYIA 1YARO 3ABKC 2YEVA 1JR8A 4AX2A 2EPMX 5KYXA 2XLOA 1I4YA 3N2ZB 1Z7Qc 2Y39A 3G4XA 3M4BA 1QQ3A 3C7JA 2TMVP 4OIPF 2Q4FA 3SXMA 3T6JA 2FAPB 4O7GA 2XS8A 2VCBA 4YT4A 4NY3A 1YYJA 2NUPB 3NKEA 3MBGA 2B0HA 3TULA 4Z9JA 1DOVA 2P6VA 2OQMA 2JD3A 3EG9A 3AG4C 3C62A 2A0BA 3V5XA 3C18A 4U5HA 2AWCA 3CEXA 2IXNA 4M63A 3AQCA 1WASA 1TR2A 5D92A 4YT2A 1LIHA 3MX3A 2IYLD 4NC3A 5AC5A 1H6GA 1YVIA 2GFHA 4GYTA 2XLDA 1ORJA 5TJ5E 5B3SC 3RYLA 1OXBA 1ZU4A 1T6QA 2HV6A 1OCRC 2YL3A 3DWWA 4ONSA 4BJ6C 3L1MA 2HKVA 4W8PA 3RKOF 3AOUA 3HJCA 3NDBB 2QE9A 4H4KC 3PHF2 1ZW3A 1NFOA 1NG1A 1D0XA 4OIRF 1PD0A 3JT1A 4JKVA 3EJNA 3DM5A 1V55C 3LAYA 4NCQA 2R25A 2VCCA 4WGYA 3B0UX 3IQ5A 4U9EA 3FMSA 2Y69C 4G7ZF 1HE9A 3X2QC 4CDVA 1VK5A 2OEXA 2ZXOA 3GEIA 1QLEC 1EI7A 4D4NA 3US6A 3DAFA 5L0IA 4MVRA 2CW0F 3FAJA 3DE8A 5D91A 4QI0A 1PD1A 3B0PA 5AC4A 1PV3A 1LS1A 1AEPA 3M1CB 4CS9A 4B6IA 2WVNA 1C03A 4O6NA 2KQ9A 2L7AA 3K6BA 3GODA 3SNHA 1RJ9A 4EWCA 5KYNA 4MVSA 3TJ5A 4BJ5C 3FDQA 3HTKC 4JTAB 3J06A 1WATA 3RH3A 4LDRA 4YJWA 2R7XA 1BR4A 4KNVA 2HS5A 3DJNB 1LE2A 1V4AA 4KBLA 4E7ZA 2VASA 4MW8A 2G62A 2LFDA 3IQCA 3LEVA 1OW7A 1OKKD 2ZXRA 2Q7RA 2V3CC 1G4US 1M6TA 1TFKB 1T6UA 4CDAA 4J7YA 4DXWA 1YZCA 2A68F 4CS7A 3EGDA 3GEHA 4X0RA 5A6JA 1SF8A 1JPJA 3IEEA 4BJ5A 3W2WA 1BDJB 3IHUA 3UMIA 4LACB 2IXOA 4FAPB 3ZG1A 3VM6A 4XQ1A 5CI9A 3U8PA 2KK1A 5BQHA 2R05A 5L0DA 4I1OB 4A2NB 1E85A 3R2PA 3QVZA 3G50A 1Z23A 2WZFA 1NFNA 3LNRA 3RIPA 5A6BD 2NG1A 2HMQA 2IXMA 2J45A 3KL4A 2I15A 2NUTA 4AE4B 2OEVA 1YAUO 3K1IA 2VB6A 3F47A 1ZHTA 2WVOA 4PACA 2YWAA 4HFFB 1OQCA 3SZRA 1GS9A 1A0BA 1GQAA 4QI2A 1XZQA 1KU2A 3HKKA 4DVYP 1Z3IX 3SXKA 3H65A 4J32B 2YZSA 4F4BA 2XS1A 3S28A 1BR2A 1LVKA 4UDVA 5CIVA 2KYHA 3MLGA 2EPLX 1E2XA 4J7TA 4ANJA 3RF3A 3ZTZA 2XXAA 3L8IA 1ZHZA 3PMRA 4IAOA 2AU5A 1EQ1A 3S27A 2V26A 3U9MA 2HMZA 5F28E 1C17M 2XLEA 1RCPA 4MW3A 4MVUA 5L0JA 4RBNA 4RDAA 4K0DA 4PJLA 2J0WA 4FESA 3ZTMA 3EZHA 4DRJB 2HUJA 5JLIA 5JUAA 1TWCA 1ORSC 4YL0A 2Q9BA 1S7ZA 4YK5A 5F5HA 2J8WA 5KYYA 3KYIA 4MVQA 1D1AA 1QVXA 4IARA 3EGXB 2H7BA 4H54A 2MYSA 3NYMA 3MYFA 2CGEA 1MMDA 1L3PA 3DJUB 4DRHB 5L0FA 5F5FA 4MVOA 3JYHA 4I1MA 3CZ6A 5KYWB 1KNYA 2CYDA 2EPNA 4NTFA 4WGZA 1ZHYA 2J9WA 3ECSA 3JSEO 4D4XA 2YLIA 1SYQA 2H8AA 2VH3A 3GM1A 3U3BA 4GEHA 1MNDA 1TKNA 3I5PA 4KC9A 3HLZA 1HY5A 4AL1A 4JEBA 5DS4A 5GPGB
chains in the Genus database with same CATH topology
1AUEA 1NSGB 4DRJB 1FAPB 4DRIB 4DRHB 4FAPB 2RSEB 2NPUA 2FAPB 2GAQA 3FAPB 5GPGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AUE A;  1NSG B;  4DRJ B;  1FAP B;  4DRI B;  4DRH B;  4FAP B;  2RSE B;  2NPU A;  2FAP B;  2GAQ A;  3FAP B;  5GPG B; 
#chains in the Genus database with same CATH topology
 2O9X A;  5BUO A;  3ZDL A;  3GAN A;  1O5H A;  2J9B A;  5AGF A;  1LS4 A;  3VRC A;  3DD7 A;  2A69 F;  1D1B A;  3FAP B;  3MFN A;  1ORY A;  4KNW A;  2BE5 F;  3DKA A;  3U8V A;  3SXZ A;  3EFO B;  2HFI A;  5A69 A;  1FFT C;  2IBF A;  2UUI A;  4P9F A;  2L6G A;  2YL1 A;  2RD9 A;  3LLK A;  3GM3 A;  4G0H A;  5JS5 A;  3U0C A;  1A41 A;  5COM A;  2PF4 E;  4Z9I A;  1HW1 A;  3O39 A;  3UGO A;  2LCH A;  3X1O A;  1RKE A;  4J30 B;  3N0T A;  2YL7 A;  3KH2 A;  4IB4 A;  5A6A A;  1OW8 A;  2BC5 A;  3FVY A;  2YQY A;  2M64 A;  3HNK A;  3TK0 A;  1CPQ A;  1Q0M A;  5K0I A;  2ZXW C;  4XPX A;  3AJM A;  5HV9 A;  2UUH A;  1Y4C A;  4Q7C A;  4ULW A;  1U6H A;  4EUK B;  2XLH A;  4OIQ F;  3BEH A;  1MMN A;  2R7Q A;  4XLN F;  4G78 A;  1YA7 O;  4AL0 A;  1NU7 D;  4JE9 A;  4L6R A;  1K04 A;  4Z9H A;  1LE4 A;  2A6E F;  1OW6 A;  2ETS A;  3GWL A;  2FGY A;  3LNM B;  4XLP F;  1Y6D A;  1YLM A;  4U9D A;  2E87 A;  2G3V A;  1OCO C;  4N6C A;  2R7T A;  2NUP A;  2Y3H A;  4E0H A;  2R7V A;  2YLD A;  3JCU Q;  2W45 A;  3C63 A;  1VLS A;  2ZD9 A;  4MND A;  3DE9 A;  1H9T A;  3HNI A;  4FWV A;  1V74 B;  4BJ6 A;  5KYU B;  2FFH A;  1QKR A;  3G4Z A;  4CSA C;  1Q0D A;  2HV7 A;  3Q7G A;  5FZT A;  4OIN F;  4U5D E;  4JIO A;  3EQL F;  1O3U A;  2NSG A;  4U5F E;  3ZVR A;  1D0Z A;  4XPY A;  3WG7 C;  4PR9 A;  1NBB A;  4BPM A;  1V54 C;  1OR3 A;  2LFF A;  2CNW A;  1D1C A;  2IXP A;  3Q6N A;  1XWJ A;  1U89 A;  4P6I C;  1APC A;  1M2V B;  4PJJ A;  3TQO A;  4MTG A;  4XEK A;  2R7R A;  4NTA A;  5DS6 A;  1D0Y A;  2HJM A;  2MWQ A;  2YKZ A;  2Z15 A;  3ASN C;  2Y3D A;  2LD6 A;  4RD9 A;  1CGM E;  3LS1 A;  5DQT A;  2QUP A;  1DOW A;  4FX5 A;  3SEO A;  1WGW A;  5DLJ A;  2LIG A;  4IWB A;  1SMY F;  2F22 A;  3NMI A;  1RXQ A;  4BEJ A;  1ZHW A;  4MS2 A;  4U5G A;  3JTL O;  4MVM A;  2L9J A;  4WJ0 A;  3U3F A;  1KTM A;  2XL8 A;  1BBH A;  1R4T A;  1C02 A;  3NMJ A;  4CS8 C;  3T9O A;  4PFP A;  1JPN A;  3RW0 A;  4R32 A;  5L0H A;  4IAQ A;  5JP7 A;  2PP4 A;  2IOQ A;  3BRJ A;  4DRI B;  2VC9 A;  2Q9C A;  4I44 A;  2NSF A;  1VLT A;  2KNH A;  4CJG A;  2EIM C;  1HMO A;  3H2U A;  3ASO C;  4ZLD A;  3O6X A;  2EIL C;  1NSG B;  3TOL A;  3ZC4 A;  3CQZ A;  4CJO A;  1TFO B;  2A6H F;  3NRH A;  4JUR I;  5CI8 A;  4EIY A;  1RMV A;  1Q0K A;  2EPK X;  2R02 A;  4GQH A;  3R7C A;  1UG7 A;  4EBB A;  4CIH A;  5IY5 C;  2I8B A;  4MQ9 F;  1H7I A;  2CDQ A;  4XEV A;  2XXA B;  4CS8 A;  3A9C A;  4E7S A;  4YT5 A;  2A1D D;  3C8G D;  2R7O A;  4I3M A;  2QNL A;  3JRT A;  3M4C A;  1WOL A;  2LSE A;  5L3Q A;  4MVZ A;  1L7C A;  1TWH A;  2XM4 A;  4K7B A;  3T4R A;  3U9J A;  3O55 A;  4ZLC A;  1BR1 A;  1B68 A;  4EHP A;  1I4Z A;  1QPU A;  2DYR C;  3V5Z A;  5T3T A;  4HE8 D;  2XSE A;  5E3C A;  3C8G B;  3V5Y A;  4YL1 A;  3RQE A;  1MMA A;  4QDL A;  3VYW A;  4AK9 A;  5DS5 A;  4C7O B;  4E17 A;  2WZL A;  2AWY A;  3HNJ A;  3GM2 A;  3OA1 A;  2DB4 A;  3GWN A;  5BQG A;  2XM0 A;  2J7P A;  3TJ6 A;  2Q3T A;  4JCZ A;  5COG A;  1LPE A;  2P7V A;  5HSW A;  1FMV A;  1ZYR F;  2XLM A;  2HSQ A;  3Q6M A;  3RVZ A;  1LI7 A;  2G3K A;  2BL2 A;  2P0N A;  3AG1 C;  4AE4 A;  5JVE A;  1F1M A;  2OU6 A;  5KYX B;  3CSK A;  3B9Q A;  3H2V A;  2QTV A;  5E3A A;  3RQG A;  5L0G A;  2GWW A;  3EHM A;  3JRM O;  4XEF A;  2KJG A;  3POV A;  1ZVZ A;  2L6H A;  3IPM O;  4LDQ A;  3B29 A;  2XRH A;  3KMI A;  4XWJ A;  5EHH A;  2LQG A;  2YL0 A;  1MMG A;  3K33 A;  3WAQ A;  3VF0 A;  5JRA A;  4LDK A;  5BQI A;  1GM5 A;  2R7U A;  2KW3 C;  2Q00 A;  4G7O F;  3EG9 B;  3L0I A;  4LLC A;  2X0C A;  1T9K A;  2B0J A;  2OJE D;  1ST6 A;  2XLV A;  2Y3B A;  4PK4 A;  4DJ9 A;  2OOC A;  2HJ3 A;  3E70 C;  1OCC C;  3EPV A;  3M15 A;  3A11 A;  2EIK C;  2AVK A;  2YRF A;  1LKX A;  3KPH A;  1EA8 A;  2ZPA A;  1E84 A;  2ASR A;  1JRA A;  3GEE A;  3S29 A;  1CGN A;  4N6H A;  1A7D A;  1MNE A;  4OIO F;  1TWG A;  3ZQY A;  1M2O A;  2DYS C;  2HZ8 A;  4DBR A;  2OJQ A;  3QVY A;  1T01 A;  1A7E A;  5DQZ A;  4LLE A;  3RVY A;  3LS0 A;  1U0B B;  2J46 A;  1Z5Z A;  5T3W A;  3EGX A;  4IRU A;  3UNG C;  1ZU5 A;  4N4W A;  2P1A A;  3L34 A;  2L6F A;  2IM8 A;  2W4M A;  2YVK A;  2JPU A;  4JTC B;  4O6M A;  1Z6A A;  2WZG A;  4YN0 B;  5KYW A;  2R7S A;  1YYX A;  5JT4 A;  2EPO A;  2GAQ A;  3UGP A;  3T6B A;  3C8Z A;  1HMD A;  2WB7 A;  4OD5 A;  3W2V A;  2JX0 A;  2RSE B;  2CNW D;  2VCA A;  3EH1 A;  2L81 A;  4IJJ A;  3QMK A;  1TWA A;  4U5C E;  1SR2 A;  2GA0 A;  2PX3 A;  3ATP A;  3WOD F;  2LK4 A;  3NMK A;  1EKY A;  1FR0 A;  2GDC A;  1I5N A;  1RJ9 B;  4PFO A;  4E18 A;  1E86 A;  2Q9A A;  4O6Y A;  1TQG A;  2H7V C;  2C04 A;  4LER A;  3EZI A;  4KI2 A;  4OD4 A;  3NYL A;  3EFO A;  1ZW2 A;  3NG1 A;  5EGY A;  3QW1 A;  1NU9 C;  3LUT B;  1T5O A;  3W8I A;  1GGQ A;  1AVO B;  3GOR A;  1WTY A;  4PJM A;  4CS9 C;  4PJN A;  1H9G A;  3U5S A;  1K05 A;  3AG3 C;  3JYY A;  2X51 A;  4BJ1 A;  5L0C A;  4YL3 A;  3UMH A;  3UMK A;  3UR3 C;  3I4U A;  3NYJ A;  3KKB A;  3JSZ A;  1JAF A;  1YJG A;  4C3D A;  4YWQ A;  4CIP A;  1FTS A;  3EGD B;  5COF A;  5L3V A;  4WAB A;  2OKU A;  3W8H A;  4DOZ A;  1ZZP A;  3RQF A;  4XPW A;  2KGO A;  4YT8 A;  1IZM A;  1Q0G A;  4BJT A;  4EKW A;  2C03 A;  4JCH A;  4E0I A;  4NQF A;  4CSA A;  3S0X A;  1BZ4 A;  1Z63 A;  1JOG A;  3LES A;  3SYN A;  2PFD A;  2P61 A;  3AQB A;  4JVS A;  4XTK A;  3T6G B;  4ER9 A;  5E2Q A;  1NZE A;  256B A;  2W9Y A;  3PCV A;  4ULV A;  3RFY A;  3ZWI A;  5T1D B;  1VMA A;  3B71 A;  2PBE A;  1E83 A;  4CX9 A;  3TD7 A;  2H7O A;  2A0U A;  3S9O A;  1UFB A;  2NUT B;  3S90 A;  1OXK A;  2YHS A;  1MQV A;  2R03 A;  4G7H F;  1HW2 A;  5KYU A;  5FCL A;  3ITF A;  3OWT A;  3IQ6 A;  4MTO A;  3SXY A;  2XL4 A;  3U2M A;  1O87 A;  1FNT c;  2HSB A;  3LEO A;  1FMW A;  1R5I D;  3DZA A;  1OR2 A;  4NTB A;  3E9V A;  1XZP A;  2YLG A;  3F46 A;  2J9V A;  3AGT A;  3K66 A;  2PX0 A;  3OEO A;  3AGU A;  1VTM P;  4CBE A;  2KC3 A;  4JEA A;  2DGJ A;  2XLW A;  4DVZ A;  2MHR A;  3K1I C;  1M2V A;  2J7P D;  4A4A A;  1FAP B;  3QTH A;  3ZSU A;  2J9U A;  3CAX A;  4U5B E;  2NPU A;  1M57 C;  2LP4 A;  3FOO A;  4BEM J;  3K1H A;  2J0X A;  3K7D A;  1YZA A;  3LLI A;  4JZA A;  1J8Y F;  4JRZ A;  3DI5 A;  3U2L A;  4U5E E;  2KSF A;  2R9R B;  1WN0 A;  4HEA J;  4JW1 A;  1LI5 A;  4K1O A;  3ZIB A;  4IGG A;  3FXH A;  3MYI A;  4N06 A;  5KYY B;  1OKK A;  4EBJ A;  3QZC A;  1QSP A;  3N24 A;  2XL6 A;  4BG0 A;  1LM3 B;  4HFK B;  2WL8 A;  5A6K A;  3M79 A;  2ICW G;  5E33 A;  1G5Z A;  1G8X A;  5B1A C;  4EBK A;  1T6I A;  3ABM C;  2W4B A;  2CCY A;  4C3E A;  3O10 A;  1W2W A;  1QZX A;  3LJB A;  3B0V C;  1HE1 A;  1NLX A;  4Q4Z F;  1G4W R;  1RKC A;  2EIN C;  2ZXP A;  5DVW A;  3NKD A;  2M4E A;  5JSL A;  4CDY A;  3Q7L A;  1PCX A;  5B3I A;  2Y3G A;  1FFH A;  3EHN A;  2D5R B;  1YA9 A;  3DM9 B;  1VYK A;  3DMD A;  4O79 A;  3JZ0 A;  2PNO A;  4P9T A;  5A6B A;  1WWP A;  1VOM A;  3ABL C;  1AUE A;  3SP1 A;  3I5Q A;  2OG2 A;  1CGO A;  3QW0 A;  2EIJ C;  3DAG A;  3WHN A;  1J8M F;  3HNL A;  4Q5S F;  3ZQV A;  3S84 A;  2DI3 A;  5B1B C;  2QY9 A;  3V7O A;  2AP3 A;  3IQT A;  4JC7 A;  1JMW A;  3C8G A;  4JJG A;  1CPR A;  3DXJ F;  3EH2 A;  2D4U A;  2QLA A;  1YDI A;  4C7O A;  1S05 A;  3TOM A;  3W4Y A;  2WVQ A;  1RKE B;  3AG2 C;  1M56 C;  4JJF A;  4MTF A;  5EK0 A;  1SZI A;  1IW7 F;  1A7V A;  2OCC C;  1K40 A;  1VB5 A;  3FHD A;  3KYJ A;  3VAY A;  1ZHX A;  2R7W A;  3FOP A;  4JTD B;  4C3B A;  3L8J A;  1N1C A;  1OCZ C;  4W8K A;  1Q0F A;  4DBQ A;  3PDM P;  1VYI A;  1YAR O;  3ABK C;  2YEV A;  1JR8 A;  4AX2 A;  2EPM X;  5KYX A;  2XLO A;  1I4Y A;  3N2Z B;  1Z7Q c;  2Y39 A;  3G4X A;  3M4B A;  1QQ3 A;  3C7J A;  2TMV P;  4OIP F;  2Q4F A;  3SXM A;  3T6J A;  2FAP B;  4O7G A;  2XS8 A;  2VCB A;  4YT4 A;  4NY3 A;  1YYJ A;  2NUP B;  3NKE A;  3MBG A;  2B0H A;  3TUL A;  4Z9J A;  1DOV A;  2P6V A;  2OQM A;  2JD3 A;  3EG9 A;  3AG4 C;  3C62 A;  2A0B A;  3V5X A;  3C18 A;  4U5H A;  2AWC A;  3CEX A;  2IXN A;  4M63 A;  3AQC A;  1WAS A;  1TR2 A;  5D92 A;  4YT2 A;  1LIH A;  3MX3 A;  2IYL D;  4NC3 A;  5AC5 A;  1H6G A;  1YVI A;  2GFH A;  4GYT A;  2XLD A;  1ORJ A;  5TJ5 E;  5B3S C;  3RYL A;  1OXB A;  1ZU4 A;  1T6Q A;  2HV6 A;  1OCR C;  2YL3 A;  3DWW A;  4ONS A;  4BJ6 C;  3L1M A;  2HKV A;  4W8P A;  3RKO F;  3AOU A;  3HJC A;  3NDB B;  2QE9 A;  4H4K C;  3PHF 2;  1ZW3 A;  1NFO A;  1NG1 A;  1D0X A;  4OIR F;  1PD0 A;  3JT1 A;  4JKV A;  3EJN A;  3DM5 A;  1V55 C;  3LAY A;  4NCQ A;  2R25 A;  2VCC A;  4WGY A;  3B0U X;  3IQ5 A;  4U9E A;  3FMS A;  2Y69 C;  4G7Z F;  1HE9 A;  3X2Q C;  4CDV A;  1VK5 A;  2OEX A;  2ZXO A;  3GEI A;  1QLE C;  1EI7 A;  4D4N A;  3US6 A;  3DAF A;  5L0I A;  4MVR A;  2CW0 F;  3FAJ A;  3DE8 A;  5D91 A;  4QI0 A;  1PD1 A;  3B0P A;  5AC4 A;  1PV3 A;  1LS1 A;  1AEP A;  3M1C B;  4CS9 A;  4B6I A;  2WVN A;  1C03 A;  4O6N A;  2KQ9 A;  2L7A A;  3K6B A;  3GOD A;  3SNH A;  1RJ9 A;  4EWC A;  5KYN A;  4MVS A;  3TJ5 A;  4BJ5 C;  3FDQ A;  3HTK C;  4JTA B;  3J06 A;  1WAT A;  3RH3 A;  4LDR A;  4YJW A;  2R7X A;  1BR4 A;  4KNV A;  2HS5 A;  3DJN B;  1LE2 A;  1V4A A;  4KBL A;  4E7Z A;  2VAS A;  4MW8 A;  2G62 A;  2LFD A;  3IQC A;  3LEV A;  1OW7 A;  1OKK D;  2ZXR A;  2Q7R A;  2V3C C;  1G4U S;  1M6T A;  1TFK B;  1T6U A;  4CDA A;  4J7Y A;  4DXW A;  1YZC A;  2A68 F;  4CS7 A;  3EGD A;  3GEH A;  4X0R A;  5A6J A;  1SF8 A;  1JPJ A;  3IEE A;  4BJ5 A;  3W2W A;  1BDJ B;  3IHU A;  3UMI A;  4LAC B;  2IXO A;  4FAP B;  3ZG1 A;  3VM6 A;  4XQ1 A;  5CI9 A;  3U8P A;  2KK1 A;  5BQH A;  2R05 A;  5L0D A;  4I1O B;  4A2N B;  1E85 A;  3R2P A;  3QVZ A;  3G50 A;  1Z23 A;  2WZF A;  1NFN A;  3LNR A;  3RIP A;  5A6B D;  2NG1 A;  2HMQ A;  2IXM A;  2J45 A;  3KL4 A;  2I15 A;  2NUT A;  4AE4 B;  2OEV A;  1YAU O;  3K1I A;  2VB6 A;  3F47 A;  1ZHT A;  2WVO A;  4PAC A;  2YWA A;  4HFF B;  1OQC A;  3SZR A;  1GS9 A;  1A0B A;  1GQA A;  4QI2 A;  1XZQ A;  1KU2 A;  3HKK A;  4DVY P;  1Z3I X;  3SXK A;  3H65 A;  4J32 B;  2YZS A;  4F4B A;  2XS1 A;  3S28 A;  1BR2 A;  1LVK A;  4UDV A;  5CIV A;  2KYH A;  3MLG A;  2EPL X;  1E2X A;  4J7T A;  4ANJ A;  3RF3 A;  3ZTZ A;  2XXA A;  3L8I A;  1ZHZ A;  3PMR A;  4IAO A;  2AU5 A;  1EQ1 A;  3S27 A;  2V26 A;  3U9M A;  2HMZ A;  5F28 E;  1C17 M;  2XLE A;  1RCP A;  4MW3 A;  4MVU A;  5L0J A;  4RBN A;  4RDA A;  4K0D A;  4PJL A;  2J0W A;  4FES A;  3ZTM A;  3EZH A;  4DRJ B;  2HUJ A;  5JLI A;  5JUA A;  1TWC A;  1ORS C;  4YL0 A;  2Q9B A;  1S7Z A;  4YK5 A;  5F5H A;  2J8W A;  5KYY A;  3KYI A;  4MVQ A;  1D1A A;  1QVX A;  4IAR A;  3EGX B;  2H7B A;  4H54 A;  2MYS A;  3NYM A;  3MYF A;  2CGE A;  1MMD A;  1L3P A;  3DJU B;  4DRH B;  5L0F A;  5F5F A;  4MVO A;  3JYH A;  4I1M A;  3CZ6 A;  5KYW B;  1KNY A;  2CYD A;  2EPN A;  4NTF A;  4WGZ A;  1ZHY A;  2J9W A;  3ECS A;  3JSE O;  4D4X A;  2YLI A;  1SYQ A;  2H8A A;  2VH3 A;  3GM1 A;  3U3B A;  4GEH A;  1MND A;  1TKN A;  3I5P A;  4KC9 A;  3HLZ A;  1HY5 A;  4AL1 A;  4JEB A;  5DS4 A;  5GPG B; 
#chains in the Genus database with same CATH homology
 1AUE A;  1NSG B;  4DRJ B;  1FAP B;  4DRI B;  4DRH B;  4FAP B;  2RSE B;  2NPU A;  2FAP B;  2GAQ A;  3FAP B;  5GPG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...