3FAPB

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
b'VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 3fapB00
4DRHB 1FAPB 2RSEB 2NPUA 5GPGB 1NSGB 4FAPB 2FAPB 4DRJB 4DRIB 3FAPB 1AUEA 2GAQA
chains in the Genus database with same CATH superfamily
1SZIA 5CI9A 1SF8A 2YLDA 1RJ9A 1TWCA 4E17A 5KYUB 5DVWA 1LI5A 4MTOA 2AVKA 3DZAA 3Q6MA 2Q7RA 4A2NB 4L6RA 1A7VA 1YAUO 1JPJA 2DYRC 1CPQA 3LS1A 1LS1A 3IQ5A 3S27A 5AGFA 3N0TA 4XTKA 3QZCA 3ABKC 2WZLA 2GA0A 2FGYA 4MTGA 1ZW2A 2EILC 1QZXA 4DJ9A 4G7OF 2J9WA 1BZ4A 3HLZA 1R4TA 1YLMA 3C8GD 4ANJA 2R7UA 1QSPA 2KGOA 2B0HA 3IEEA 3JYHA 4Z9JA 2X0CA 3SXYA 3JRMO 3GODA 1QVXA 1G5ZA 3B9QA 4IARA 1MQVA 3AQBA 3MFNA 4XPXA 1TFOB 1VB5A 4W8KA 2R7QA 3DJUB 1Z5ZA 1R5ID 1CPRA 1TWAA 3W8IA 4Z9IA 3RQFA 1OQCA 3JCUQ 3NMJA 4K0DA 4BJ6C 3Q6NA 1VOMA 3JT1A 5B1AC 3DXJF 1Y4CA 3SXKA 4DBRA 1Z23A 4MQ9F 5JP7A 2A69F 2Y69C 3C18A 4CIHA 1N1CA 3Q7LA 4JCHA 4NTFA 3SZRA 3KYJA 5COGA 4O6NA 2CDQA 4E0HA 3W2VA 3F47A 3LLIA 3ZSUA 4JTCB 2XLVA 3ZG1A 5L3VA 4O7GA 4EHPA 2R02A 5F5FA 3O55A 1MNDA 3DMDA 3ZDLA 1FMVA 2PF4E 2EINC 4CDAA 1M2VA 2IM8A 3CQZA 2KYHA 2XXAB 2H8AA 2A0UA 1KTMA 2GFHA 5T3TA 4P9FA 5T1DB 1K04A 3AG4C 3RKOF 1LE2A 1YDIA 1GS9A 2WZFA 1EI7A 3O10A 3U8PA 2ZD9A 5F5HA 4AK9A 5D92A 2CCYA 2DGJA 1HE1A 3K33A 3EFOB 2LQGA 3EJNA 2Y39A 5KYXB 3UGPA 3QW0A 1E2XA 1UFBA 2A0BA 3K1IC 2H7VC 4D4NA 3UMKA 3NDBB 5DS5A 2BC5A 3B71A 3JSZA 1ZYRF 3SYNA 4QI2A 1NU7D 3RQEA 4CS8C 5KYWB 3RQGA 3SNHA 4E0IA 4NY3A 3H2VA 2V26A 1BBHA 1C17M 1LIHA 2L6FA 5A6BD 2E87A 2H7BA 2LSEA 3ASNC 1VTMP 1V55C 1ORYA 2JPUA 3W8HA 3ZQYA 3L8IA 2XL6A 2XL8A 4FESA 3HNJA 1RKEA 3NYMA 3GANA 2VASA 4PFOA 4BJ6A 4G7ZF 4CBEA 5A69A 2Z15A 2Y3HA 3NMIA 1KNYA 1C02A 2XL4A 2L81A 3NMKA 3K6BA 1BR4A 4Z9HA 3MX3A 2UUHA 5KYUA 4D4XA 1ST6A 1YZAA 2CNWA 3JZ0A 1OXBA 2IXMA 2J45A 1MNEA 1ORJA 2WVOA 4AL1A 1U6HA 4DRIB 5BQHA 2BE5F 1QKRA 2LD6A 5B3SC 2R7OA 3T6JA 4CDYA 3GM2A 2NSGA 4HFFB 4O6MA 4K1OA 3V5YA 3TK0A 4GEHA 1XZQA 3S9OA 2HS5A 2Q00A 3CZ6A 3N24A 4GYTA 1GM5A 1U0BB 1NFOA 4Q4ZF 3POVA 4J7YA 1LE4A 1WATA 4JC7A 3VM6A 4N4WA 4HE8D 4XLNF 3MYFA 1FR0A 5L0GA 1DOVA 3V7OA 4KNVA 2YZSA 4P9TA 2OCCC 2GWWA 1MMGA 2MHRA 3PHF2 1RKCA 2NUPA 1HE9A 2PBEA 3HNIA 4I1OB 4I1MA 4IWBA 2QY9A 3K1IA 5E33A 1L3PA 4JEBA 3AGTA 3UGOA 5E3CA 3C8GA 1F1MA 2QNLA 1WWPA 5TJ5E 2Q3TA 2EPNA 1E86A 1O3UA 2PX0A 4BPMA 4M63A 3NYLA 4KNWA 1E85A 4YT5A 3T4RA 3U3BA 2L6HA 2OG2A 4CS8A 4CS9C 4J32B 2ZPAA 3LAYA 4YL3A 3C8ZA 3RH3A 3S28A 2W45A 1BR1A 1I5NA 3LNRA 1HMDA 2X51A 4ER9A 4U5HA 5JRAA 2JX0A 3G4XA 4JJGA 2EPKX 4FWVA 4CJGA 4ULVA 4IAOA 1T6IA 3GM1A 2VC9A 4IAQA 1GQAA 2J0WA 1HMOA 3FAPB 4JURI 2YKZA 3S29A 1OCZC 1VK5A 1TKNA 3QVZA 1NLXA 4CSAC 2Y3GA 1S7ZA 3ITFA 4FAPB 1L7CA 3TQOA 256BA 4DOZA 2XM0A 4N6HA 1ZHZA 5KYYB 3U0CA 1EQ1A 3RF3A 2R7WA 4PACA 4OIPF 4AX2A 3C63A 3U5SA 2XXAA 4RDAA 1W2WA 2G3KA 5EGYA 1AVOB 2QUPA 3EG9A 2HJMA 1FAPB 1ZHXA 3EGXB 1FFTC 1H9TA 2EPMX 3SXZA 2B0JA 3O6XA 2EIMC 4JEAA 3I5PA 4LLCA 3ASOC 2R9RB 2NPUA 3CEXA 1CGOA 3H65A 4EKWA 2NUTB 3GEIA 3KMIA 3DAGA 4NTAA 1ZVZA 4JTAB 1HY5A 2LK4A 3EQLF 4ZLCA 4J30B 4QDLA 2R7SA 3V5XA 4JIOA 4MVQA 2PNOA 1YA7O 4OD4A 1JMWA 2XLEA 3FVYA 2KC3A 4U9EA 3VRCA 2GAQA 3FAJA 4KBLA 1RJ9B 2NSFA 2QE9A 4MW3A 3X1OA 3QW1A 4YJWA 3ZWIA 3RVZA 1UG7A 3KKBA 2L6GA 5L0HA 2FAPB 2ICWG 5B3IA 5FCLA 1QLEC 2KSFA 4U5CE 5A6BA 3V5ZA 2FFHA 4MVOA 4CS9A 2G62A 4C7OA 3AOUA 3KPHA 2Q9CA 1HW1A 2HV6A 2H7OA 1O87A 1O5HA 2J9UA 2XLOA 3AQCA 3F46A 3LJBA 3K66A 3SXMA 2BL2A 4NQFA 2MYSA 3R2PA 2EIJC 3PDMP 4OIQF 3VF0A 3NKEA 4XEVA 4BJ1A 3JSEO 3DKAA 1AUEA 3IQCA 4I44A 1LKXA 4IRUA 3JRTA 4ULWA 3U2MA 5L0CA 2Y3BA 3JYYA 1H7IA 4C3EA 2QTVA 2YL3A 2HSQA 3FOPA 4MTFA 2OKUA 3L34A 3L8JA 1Z3IX 2TMVP 1ORSC 4CSAA 4U5GA 2A1DD 5IY5C 4PJJA 4IGGA 3U3FA 1WTYA 3S0XA 1V4AA 4MS2A 3A9CA 1YZCA 4YT4A 3N2ZB 4C3BA 1ZHWA 2VB6A 2YRFA 3WAQA 1K40A 4JCZA 4DXWA 4EWCA 5JT4A 5L0FA 3EGDA 3RYLA 2J7PA 5KYNA 2YQYA 3O39A 1CGNA 4J7TA 3BRJA 3I4UA 4XWJA 3UR3C 2HJ3A 3H2UA 3L1MA 4I3MA 4OINF 1VLSA 2HZ8A 1NFNA 3B0UX 1D1BA 2IOQA 4ZLDA 2ZXPA 1AEPA 2IXPA 3GWLA 4QI0A 3T9OA 4WGZA 3DJNB 2NG1A 3FOOA 2O9XA 4KC9A 1GGQA 3RFYA 3EZIA 5GPGB 4U5BE 1EA8A 4W8PA 5DQTA 3DD7A 2HMQA 3M15A 1M2VB 2Y3DA 3WHNA 1D1CA 1TQGA 4DBQA 1PCXA 4HEAJ 1MMNA 1OCCC 1ZZPA 2M4EA 2RSEB 3M79A 4OD5A 2J9BA 1D1AA 4O79A 3W4YA 4MNDA 1YVIA 2R25A 1MMDA 1LPEA 2A68F 5JS5A 3C7JA 5FZTA 2YHSA 3AG2C 4UDVA 1MMAA 2R7VA 1M56C 1M6TA 1OKKA 1Z6AA 2J7PD 5AC4A 5BQIA 1OR2A 2EIKC 2ZXOA 1ZW3A 1C03A 2YL0A 2AP3A 3LEVA 2KW3C 4JKVA 4H4KC 5JVEA 3KYIA 3R7CA 5DS4A 4AE4B 2P7VA 3HNLA 4K7BA 1SYQA 1T6UA 2I8BA 2YWAA 3B0PA 2IXNA 1TFKB 3HJCA 4O6YA 1OCRC 4Q5SF 3OEOA 1OW7A 5EHHA 3ZQVA 1NG1A 1A7EA 2ZXRA 2LFDA 2LIGA 4XEKA 4BG0A 2WL8A 1K05A 1OR3A 4JE9A 1TWHA 3DAFA 1ZHYA 4B6IA 1E83A 1M57C 3AG3C 3ABMC 3EZHA 3M1CB 1FMWA 4G78A 5E2QA 4MVSA 3OA1A 4EBJA 4G7HF 4MVZA 2IXOA 4E7ZA 1PD0A 1SMYF 1XWJA 3FXHA 2VCBA 1H9GA 1OKKD 3EH2A 1FFHA 4XEFA 4EUKB 1RKEB 4YWQA 3GEEA 2R7TA 2OJED 3AGUA 4XLPF 5A6JA 3SP1A 2XLHA 4LACB 3LUTB 4NC3A 4XPYA 3US6A 3ZC4A 2ETSA 1T6QA 2WB7A 4MW8A 4EBBA 2VCAA 3MLGA 3S90A 1RCPA 2YL7A 3PMRA 3MYIA 4MVRA 4IJJA 1D0YA 1KU2A 1JAFA 2WZGA 2P0NA 4YL0A 2D5RB 4EIYA 1IW7F 2XSEA 3UMHA 3ZTZA 5B1BC 1J8YF 1Q0MA 5HSWA 2I15A 3HKKA 1Z7Qc 1SR2A 4MVUA 1J8MF 2L7AA 4WJ0A 2RD9A 4CIPA 2XRHA 2A6EF 4YN0B 2YLIA 2L9JA 4MVMA 4N06A 3T6BA 1RMVA 1Q0GA 5L0DA 2V3CC 2HFIA 1VYIA 2DI3A 2LFFA 4DRHB 4CX9A 5E3AA 2KK1A 1WGWA 3GM3A 4DRJB 3IPMO 1G4WR 4NTBA 3TJ6A 1D0ZA 3TD7A 3L0IA 1B68A 2ZXWC 4ONSA 1BDJB 2R03A 2NUPB 2P1AA 4PJNA 4OIRF 3SEOA 2MWQA 5KYXA 1ZU4A 3EFOA 2R7XA 3C8GB 1OCOC 1Q0DA 2OU6A 2YLGA 4R32A 1Q0KA 4DVZA 3U2LA 2CGEA 3VAYA 2WVNA 3KL4A 3T6GB 2ASRA 3NG1A 4JJFA 2CYDA 5T3WA 3IQ6A 3BEHA 1T5OA 5BQGA 2W9YA 3AG1C 1E84A 5D91A 2KNHA 5JLIA 2W4MA 4EBKA 1ZHTA 3DM9B 1YA9A 2OJQA 5KYWA 3TJ5A 2HKVA 4X0RA 5COFA 3ECSA 5L0IA 3GORA 1H6GA 1APCA 2W4BA 3U9MA 3ZVRA 2DYSC 4HFKB 4LDQA 4CDVA 3C62A 2R05A 4F4BA 4LLEA 1VYKA 2D4UA 1NBBA 1BR2A 4P6IC 4G0HA 1VMAA 3DE9A 4YT8A 4E7SA 4LDRA 4OIOF 5CI8A 1NZEA 3NYJA 1G4US 3U9JA 3QTHA 1EKYA 2YVKA 4PJLA 3EHMA 1LVKA 5L3QA 1LM3B 3M4CA 1IZMA 2R7RA 3KH2A 5CIVA 3ATPA 2YEVA 3AJMA 4XPWA 1NU9C 5DLJA 3J06A 2XS1A 1OXKA 1YYXA 3EG9B 4KI2A 2EPLX 5F28E 4BJ5C 4E18A 3K1HA 5JSLA 5DS6A 2OEVA 3DI5A 3LESA 3TOMA 2XS8A 3DE8A 5A6KA 5DQZA 1G8XA 3IQTA 4U5EE 2J9VA 1JPNA 3G4ZA 1M2OA 2C04A 3CSKA 3IHUA 3Q7GA 3RIPA 4A4AA 1VLTA 4LDKA 3X2QC 4AL0A 4AE4A 2IYLD 1HW2A 3A11A 1WOLA 2HUJA 4NCQA 2Q4FA 2VCCA 2KJGA 2P61A 2HV7A 2PP4A 3K7DA 4JVSA 5L0JA 4IB4A 4JTDB 3HTKC 3EPVA 1FTSA 4JRZA 3NKDA 3MBGA 1PV3A 2CW0F 3UNGC 3WODF 1A7DA 1FNTc 3G50A 5A6AA 3OWTA 3GWNA 2XLWA 3E9VA 3ZTMA 2P6VA 3B29A 3M4BA 1TR2A 1Q0FA 2M64A 3TOLA 4C7OB 1OW8A 1V54C 4YK5A 2LP4A 2DB4A 3RW0A 2Q9AA 1V74B 2YL1A 2XM4A 1WN0A 5HV9A 3TULA 1JR8A 1ZU5A 2A6HF 3ABLC 4LERA 4PJMA 1A0BA 3LS0A 3NRHA 3B0VC 2OEXA 5AC5A 4JW1A 4U9DA 2VH3A 3LEOA 4PK4A 3FDQA 2OOCA 2OQMA 3QMKA 4H54A 1PD1A 3FMSA 4YT2A 4XQ1A 2HMZA 2XLMA 1QQ3A 3WG7C 1I4YA 4Q7CA 4WGYA 3RVYA 2IBFA 3U8VA 3EH1A 1YYJA 4C3DA 2UUIA 1WASA 4PFPA 5JUAA 4PR9A 1Z63A 1NSGB 1U89A 2PX3A 3LNMB 2QLAA 4YL1A 4RD9A 3DWWA 4BJTA 4BEJA 5BUOA 2G3VA 1JOGA 3E70C 3EHNA 4BEMJ 1OW6A 1T9KA 1Y6DA 2XLDA 2KQ9A 1XZPA 2PFDA 4U5DE 3PCVA 1YARO 4U5FE 2GDCA 1D0XA 3EGDB 4GQHA 5KYYA 3S84A 2LCHA 2J0XA 2JD3A 3HNKA 4RBNA 4BJ5A 2F22A 2J8WA 3JTLO 3QVYA 3EGXA 2J46A 4N6CA 3UMIA 3CAXA 2AU5A 5COMA 5EK0A 1DOWA 2HSBA 4JZAA 4WABA 2WVQA 4CJOA 4DVYP 3VYWA 1I4ZA 1S05A 1CGME 3DM5A 1RXQA 1QPUA 2C03A 1TWGA 3FHDA 3I5QA 3W2WA 1JRAA 1A41A 2Q9BA 2NUTA 3ZIBA 4FX5A 3GEHA 2CNWD 5K0IA 1LI7A 1T01A 2AWCA 3LLKA 1LS4A 2EPOA 1YJGA 4CS7A 2AWYA
chains in the Genus database with same CATH topology
4DRHB 1FAPB 2RSEB 2NPUA 5GPGB 1NSGB 4FAPB 2FAPB 4DRJB 4DRIB 3FAPB 1AUEA 2GAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRH B;  1FAP B;  2RSE B;  2NPU A;  5GPG B;  1NSG B;  4FAP B;  2FAP B;  4DRJ B;  4DRI B;  3FAP B;  1AUE A;  2GAQ A; 
#chains in the Genus database with same CATH topology
 1SZI A;  5CI9 A;  1SF8 A;  2YLD A;  1RJ9 A;  1TWC A;  4E17 A;  5KYU B;  5DVW A;  1LI5 A;  4MTO A;  2AVK A;  3DZA A;  3Q6M A;  2Q7R A;  4A2N B;  4L6R A;  1A7V A;  1YAU O;  1JPJ A;  2DYR C;  1CPQ A;  3LS1 A;  1LS1 A;  3IQ5 A;  3S27 A;  5AGF A;  3N0T A;  4XTK A;  3QZC A;  3ABK C;  2WZL A;  2GA0 A;  2FGY A;  4MTG A;  1ZW2 A;  2EIL C;  1QZX A;  4DJ9 A;  4G7O F;  2J9W A;  1BZ4 A;  3HLZ A;  1R4T A;  1YLM A;  3C8G D;  4ANJ A;  2R7U A;  1QSP A;  2KGO A;  2B0H A;  3IEE A;  3JYH A;  4Z9J A;  2X0C A;  3SXY A;  3JRM O;  3GOD A;  1QVX A;  1G5Z A;  3B9Q A;  4IAR A;  1MQV A;  3AQB A;  3MFN A;  4XPX A;  1TFO B;  1VB5 A;  4W8K A;  2R7Q A;  3DJU B;  1Z5Z A;  1R5I D;  1CPR A;  1TWA A;  3W8I A;  4Z9I A;  3RQF A;  1OQC A;  3JCU Q;  3NMJ A;  4K0D A;  4BJ6 C;  3Q6N A;  1VOM A;  3JT1 A;  5B1A C;  3DXJ F;  1Y4C A;  3SXK A;  4DBR A;  1Z23 A;  4MQ9 F;  5JP7 A;  2A69 F;  2Y69 C;  3C18 A;  4CIH A;  1N1C A;  3Q7L A;  4JCH A;  4NTF A;  3SZR A;  3KYJ A;  5COG A;  4O6N A;  2CDQ A;  4E0H A;  3W2V A;  3F47 A;  3LLI A;  3ZSU A;  4JTC B;  2XLV A;  3ZG1 A;  5L3V A;  4O7G A;  4EHP A;  2R02 A;  5F5F A;  3O55 A;  1MND A;  3DMD A;  3ZDL A;  1FMV A;  2PF4 E;  2EIN C;  4CDA A;  1M2V A;  2IM8 A;  3CQZ A;  2KYH A;  2XXA B;  2H8A A;  2A0U A;  1KTM A;  2GFH A;  5T3T A;  4P9F A;  5T1D B;  1K04 A;  3AG4 C;  3RKO F;  1LE2 A;  1YDI A;  1GS9 A;  2WZF A;  1EI7 A;  3O10 A;  3U8P A;  2ZD9 A;  5F5H A;  4AK9 A;  5D92 A;  2CCY A;  2DGJ A;  1HE1 A;  3K33 A;  3EFO B;  2LQG A;  3EJN A;  2Y39 A;  5KYX B;  3UGP A;  3QW0 A;  1E2X A;  1UFB A;  2A0B A;  3K1I C;  2H7V C;  4D4N A;  3UMK A;  3NDB B;  5DS5 A;  2BC5 A;  3B71 A;  3JSZ A;  1ZYR F;  3SYN A;  4QI2 A;  1NU7 D;  3RQE A;  4CS8 C;  5KYW B;  3RQG A;  3SNH A;  4E0I A;  4NY3 A;  3H2V A;  2V26 A;  1BBH A;  1C17 M;  1LIH A;  2L6F A;  5A6B D;  2E87 A;  2H7B A;  2LSE A;  3ASN C;  1VTM P;  1V55 C;  1ORY A;  2JPU A;  3W8H A;  3ZQY A;  3L8I A;  2XL6 A;  2XL8 A;  4FES A;  3HNJ A;  1RKE A;  3NYM A;  3GAN A;  2VAS A;  4PFO A;  4BJ6 A;  4G7Z F;  4CBE A;  5A69 A;  2Z15 A;  2Y3H A;  3NMI A;  1KNY A;  1C02 A;  2XL4 A;  2L81 A;  3NMK A;  3K6B A;  1BR4 A;  4Z9H A;  3MX3 A;  2UUH A;  5KYU A;  4D4X A;  1ST6 A;  1YZA A;  2CNW A;  3JZ0 A;  1OXB A;  2IXM A;  2J45 A;  1MNE A;  1ORJ A;  2WVO A;  4AL1 A;  1U6H A;  4DRI B;  5BQH A;  2BE5 F;  1QKR A;  2LD6 A;  5B3S C;  2R7O A;  3T6J A;  4CDY A;  3GM2 A;  2NSG A;  4HFF B;  4O6M A;  4K1O A;  3V5Y A;  3TK0 A;  4GEH A;  1XZQ A;  3S9O A;  2HS5 A;  2Q00 A;  3CZ6 A;  3N24 A;  4GYT A;  1GM5 A;  1U0B B;  1NFO A;  4Q4Z F;  3POV A;  4J7Y A;  1LE4 A;  1WAT A;  4JC7 A;  3VM6 A;  4N4W A;  4HE8 D;  4XLN F;  3MYF A;  1FR0 A;  5L0G A;  1DOV A;  3V7O A;  4KNV A;  2YZS A;  4P9T A;  2OCC C;  2GWW A;  1MMG A;  2MHR A;  3PHF 2;  1RKC A;  2NUP A;  1HE9 A;  2PBE A;  3HNI A;  4I1O B;  4I1M A;  4IWB A;  2QY9 A;  3K1I A;  5E33 A;  1L3P A;  4JEB A;  3AGT A;  3UGO A;  5E3C A;  3C8G A;  1F1M A;  2QNL A;  1WWP A;  5TJ5 E;  2Q3T A;  2EPN A;  1E86 A;  1O3U A;  2PX0 A;  4BPM A;  4M63 A;  3NYL A;  4KNW A;  1E85 A;  4YT5 A;  3T4R A;  3U3B A;  2L6H A;  2OG2 A;  4CS8 A;  4CS9 C;  4J32 B;  2ZPA A;  3LAY A;  4YL3 A;  3C8Z A;  3RH3 A;  3S28 A;  2W45 A;  1BR1 A;  1I5N A;  3LNR A;  1HMD A;  2X51 A;  4ER9 A;  4U5H A;  5JRA A;  2JX0 A;  3G4X A;  4JJG A;  2EPK X;  4FWV A;  4CJG A;  4ULV A;  4IAO A;  1T6I A;  3GM1 A;  2VC9 A;  4IAQ A;  1GQA A;  2J0W A;  1HMO A;  3FAP B;  4JUR I;  2YKZ A;  3S29 A;  1OCZ C;  1VK5 A;  1TKN A;  3QVZ A;  1NLX A;  4CSA C;  2Y3G A;  1S7Z A;  3ITF A;  4FAP B;  1L7C A;  3TQO A;  256B A;  4DOZ A;  2XM0 A;  4N6H A;  1ZHZ A;  5KYY B;  3U0C A;  1EQ1 A;  3RF3 A;  2R7W A;  4PAC A;  4OIP F;  4AX2 A;  3C63 A;  3U5S A;  2XXA A;  4RDA A;  1W2W A;  2G3K A;  5EGY A;  1AVO B;  2QUP A;  3EG9 A;  2HJM A;  1FAP B;  1ZHX A;  3EGX B;  1FFT C;  1H9T A;  2EPM X;  3SXZ A;  2B0J A;  3O6X A;  2EIM C;  4JEA A;  3I5P A;  4LLC A;  3ASO C;  2R9R B;  2NPU A;  3CEX A;  1CGO A;  3H65 A;  4EKW A;  2NUT B;  3GEI A;  3KMI A;  3DAG A;  4NTA A;  1ZVZ A;  4JTA B;  1HY5 A;  2LK4 A;  3EQL F;  4ZLC A;  4J30 B;  4QDL A;  2R7S A;  3V5X A;  4JIO A;  4MVQ A;  2PNO A;  1YA7 O;  4OD4 A;  1JMW A;  2XLE A;  3FVY A;  2KC3 A;  4U9E A;  3VRC A;  2GAQ A;  3FAJ A;  4KBL A;  1RJ9 B;  2NSF A;  2QE9 A;  4MW3 A;  3X1O A;  3QW1 A;  4YJW A;  3ZWI A;  3RVZ A;  1UG7 A;  3KKB A;  2L6G A;  5L0H A;  2FAP B;  2ICW G;  5B3I A;  5FCL A;  1QLE C;  2KSF A;  4U5C E;  5A6B A;  3V5Z A;  2FFH A;  4MVO A;  4CS9 A;  2G62 A;  4C7O A;  3AOU A;  3KPH A;  2Q9C A;  1HW1 A;  2HV6 A;  2H7O A;  1O87 A;  1O5H A;  2J9U A;  2XLO A;  3AQC A;  3F46 A;  3LJB A;  3K66 A;  3SXM A;  2BL2 A;  4NQF A;  2MYS A;  3R2P A;  2EIJ C;  3PDM P;  4OIQ F;  3VF0 A;  3NKE A;  4XEV A;  4BJ1 A;  3JSE O;  3DKA A;  1AUE A;  3IQC A;  4I44 A;  1LKX A;  4IRU A;  3JRT A;  4ULW A;  3U2M A;  5L0C A;  2Y3B A;  3JYY A;  1H7I A;  4C3E A;  2QTV A;  2YL3 A;  2HSQ A;  3FOP A;  4MTF A;  2OKU A;  3L34 A;  3L8J A;  1Z3I X;  2TMV P;  1ORS C;  4CSA A;  4U5G A;  2A1D D;  5IY5 C;  4PJJ A;  4IGG A;  3U3F A;  1WTY A;  3S0X A;  1V4A A;  4MS2 A;  3A9C A;  1YZC A;  4YT4 A;  3N2Z B;  4C3B A;  1ZHW A;  2VB6 A;  2YRF A;  3WAQ A;  1K40 A;  4JCZ A;  4DXW A;  4EWC A;  5JT4 A;  5L0F A;  3EGD A;  3RYL A;  2J7P A;  5KYN A;  2YQY A;  3O39 A;  1CGN A;  4J7T A;  3BRJ A;  3I4U A;  4XWJ A;  3UR3 C;  2HJ3 A;  3H2U A;  3L1M A;  4I3M A;  4OIN F;  1VLS A;  2HZ8 A;  1NFN A;  3B0U X;  1D1B A;  2IOQ A;  4ZLD A;  2ZXP A;  1AEP A;  2IXP A;  3GWL A;  4QI0 A;  3T9O A;  4WGZ A;  3DJN B;  2NG1 A;  3FOO A;  2O9X A;  4KC9 A;  1GGQ A;  3RFY A;  3EZI A;  5GPG B;  4U5B E;  1EA8 A;  4W8P A;  5DQT A;  3DD7 A;  2HMQ A;  3M15 A;  1M2V B;  2Y3D A;  3WHN A;  1D1C A;  1TQG A;  4DBQ A;  1PCX A;  4HEA J;  1MMN A;  1OCC C;  1ZZP A;  2M4E A;  2RSE B;  3M79 A;  4OD5 A;  2J9B A;  1D1A A;  4O79 A;  3W4Y A;  4MND A;  1YVI A;  2R25 A;  1MMD A;  1LPE A;  2A68 F;  5JS5 A;  3C7J A;  5FZT A;  2YHS A;  3AG2 C;  4UDV A;  1MMA A;  2R7V A;  1M56 C;  1M6T A;  1OKK A;  1Z6A A;  2J7P D;  5AC4 A;  5BQI A;  1OR2 A;  2EIK C;  2ZXO A;  1ZW3 A;  1C03 A;  2YL0 A;  2AP3 A;  3LEV A;  2KW3 C;  4JKV A;  4H4K C;  5JVE A;  3KYI A;  3R7C A;  5DS4 A;  4AE4 B;  2P7V A;  3HNL A;  4K7B A;  1SYQ A;  1T6U A;  2I8B A;  2YWA A;  3B0P A;  2IXN A;  1TFK B;  3HJC A;  4O6Y A;  1OCR C;  4Q5S F;  3OEO A;  1OW7 A;  5EHH A;  3ZQV A;  1NG1 A;  1A7E A;  2ZXR A;  2LFD A;  2LIG A;  4XEK A;  4BG0 A;  2WL8 A;  1K05 A;  1OR3 A;  4JE9 A;  1TWH A;  3DAF A;  1ZHY A;  4B6I A;  1E83 A;  1M57 C;  3AG3 C;  3ABM C;  3EZH A;  3M1C B;  1FMW A;  4G78 A;  5E2Q A;  4MVS A;  3OA1 A;  4EBJ A;  4G7H F;  4MVZ A;  2IXO A;  4E7Z A;  1PD0 A;  1SMY F;  1XWJ A;  3FXH A;  2VCB A;  1H9G A;  1OKK D;  3EH2 A;  1FFH A;  4XEF A;  4EUK B;  1RKE B;  4YWQ A;  3GEE A;  2R7T A;  2OJE D;  3AGU A;  4XLP F;  5A6J A;  3SP1 A;  2XLH A;  4LAC B;  3LUT B;  4NC3 A;  4XPY A;  3US6 A;  3ZC4 A;  2ETS A;  1T6Q A;  2WB7 A;  4MW8 A;  4EBB A;  2VCA A;  3MLG A;  3S90 A;  1RCP A;  2YL7 A;  3PMR A;  3MYI A;  4MVR A;  4IJJ A;  1D0Y A;  1KU2 A;  1JAF A;  2WZG A;  2P0N A;  4YL0 A;  2D5R B;  4EIY A;  1IW7 F;  2XSE A;  3UMH A;  3ZTZ A;  5B1B C;  1J8Y F;  1Q0M A;  5HSW A;  2I15 A;  3HKK A;  1Z7Q c;  1SR2 A;  4MVU A;  1J8M F;  2L7A A;  4WJ0 A;  2RD9 A;  4CIP A;  2XRH A;  2A6E F;  4YN0 B;  2YLI A;  2L9J A;  4MVM A;  4N06 A;  3T6B A;  1RMV A;  1Q0G A;  5L0D A;  2V3C C;  2HFI A;  1VYI A;  2DI3 A;  2LFF A;  4DRH B;  4CX9 A;  5E3A A;  2KK1 A;  1WGW A;  3GM3 A;  4DRJ B;  3IPM O;  1G4W R;  4NTB A;  3TJ6 A;  1D0Z A;  3TD7 A;  3L0I A;  1B68 A;  2ZXW C;  4ONS A;  1BDJ B;  2R03 A;  2NUP B;  2P1A A;  4PJN A;  4OIR F;  3SEO A;  2MWQ A;  5KYX A;  1ZU4 A;  3EFO A;  2R7X A;  3C8G B;  1OCO C;  1Q0D A;  2OU6 A;  2YLG A;  4R32 A;  1Q0K A;  4DVZ A;  3U2L A;  2CGE A;  3VAY A;  2WVN A;  3KL4 A;  3T6G B;  2ASR A;  3NG1 A;  4JJF A;  2CYD A;  5T3W A;  3IQ6 A;  3BEH A;  1T5O A;  5BQG A;  2W9Y A;  3AG1 C;  1E84 A;  5D91 A;  2KNH A;  5JLI A;  2W4M A;  4EBK A;  1ZHT A;  3DM9 B;  1YA9 A;  2OJQ A;  5KYW A;  3TJ5 A;  2HKV A;  4X0R A;  5COF A;  3ECS A;  5L0I A;  3GOR A;  1H6G A;  1APC A;  2W4B A;  3U9M A;  3ZVR A;  2DYS C;  4HFK B;  4LDQ A;  4CDV A;  3C62 A;  2R05 A;  4F4B A;  4LLE A;  1VYK A;  2D4U A;  1NBB A;  1BR2 A;  4P6I C;  4G0H A;  1VMA A;  3DE9 A;  4YT8 A;  4E7S A;  4LDR A;  4OIO F;  5CI8 A;  1NZE A;  3NYJ A;  1G4U S;  3U9J A;  3QTH A;  1EKY A;  2YVK A;  4PJL A;  3EHM A;  1LVK A;  5L3Q A;  1LM3 B;  3M4C A;  1IZM A;  2R7R A;  3KH2 A;  5CIV A;  3ATP A;  2YEV A;  3AJM A;  4XPW A;  1NU9 C;  5DLJ A;  3J06 A;  2XS1 A;  1OXK A;  1YYX A;  3EG9 B;  4KI2 A;  2EPL X;  5F28 E;  4BJ5 C;  4E18 A;  3K1H A;  5JSL A;  5DS6 A;  2OEV A;  3DI5 A;  3LES A;  3TOM A;  2XS8 A;  3DE8 A;  5A6K A;  5DQZ A;  1G8X A;  3IQT A;  4U5E E;  2J9V A;  1JPN A;  3G4Z A;  1M2O A;  2C04 A;  3CSK A;  3IHU A;  3Q7G A;  3RIP A;  4A4A A;  1VLT A;  4LDK A;  3X2Q C;  4AL0 A;  4AE4 A;  2IYL D;  1HW2 A;  3A11 A;  1WOL A;  2HUJ A;  4NCQ A;  2Q4F A;  2VCC A;  2KJG A;  2P61 A;  2HV7 A;  2PP4 A;  3K7D A;  4JVS A;  5L0J A;  4IB4 A;  4JTD B;  3HTK C;  3EPV A;  1FTS A;  4JRZ A;  3NKD A;  3MBG A;  1PV3 A;  2CW0 F;  3UNG C;  3WOD F;  1A7D A;  1FNT c;  3G50 A;  5A6A A;  3OWT A;  3GWN A;  2XLW A;  3E9V A;  3ZTM A;  2P6V A;  3B29 A;  3M4B A;  1TR2 A;  1Q0F A;  2M64 A;  3TOL A;  4C7O B;  1OW8 A;  1V54 C;  4YK5 A;  2LP4 A;  2DB4 A;  3RW0 A;  2Q9A A;  1V74 B;  2YL1 A;  2XM4 A;  1WN0 A;  5HV9 A;  3TUL A;  1JR8 A;  1ZU5 A;  2A6H F;  3ABL C;  4LER A;  4PJM A;  1A0B A;  3LS0 A;  3NRH A;  3B0V C;  2OEX A;  5AC5 A;  4JW1 A;  4U9D A;  2VH3 A;  3LEO A;  4PK4 A;  3FDQ A;  2OOC A;  2OQM A;  3QMK A;  4H54 A;  1PD1 A;  3FMS A;  4YT2 A;  4XQ1 A;  2HMZ A;  2XLM A;  1QQ3 A;  3WG7 C;  1I4Y A;  4Q7C A;  4WGY A;  3RVY A;  2IBF A;  3U8V A;  3EH1 A;  1YYJ A;  4C3D A;  2UUI A;  1WAS A;  4PFP A;  5JUA A;  4PR9 A;  1Z63 A;  1NSG B;  1U89 A;  2PX3 A;  3LNM B;  2QLA A;  4YL1 A;  4RD9 A;  3DWW A;  4BJT A;  4BEJ A;  5BUO A;  2G3V A;  1JOG A;  3E70 C;  3EHN A;  4BEM J;  1OW6 A;  1T9K A;  1Y6D A;  2XLD A;  2KQ9 A;  1XZP A;  2PFD A;  4U5D E;  3PCV A;  1YAR O;  4U5F E;  2GDC A;  1D0X A;  3EGD B;  4GQH A;  5KYY A;  3S84 A;  2LCH A;  2J0X A;  2JD3 A;  3HNK A;  4RBN A;  4BJ5 A;  2F22 A;  2J8W A;  3JTL O;  3QVY A;  3EGX A;  2J46 A;  4N6C A;  3UMI A;  3CAX A;  2AU5 A;  5COM A;  5EK0 A;  1DOW A;  2HSB A;  4JZA A;  4WAB A;  2WVQ A;  4CJO A;  4DVY P;  3VYW A;  1I4Z A;  1S05 A;  1CGM E;  3DM5 A;  1RXQ A;  1QPU A;  2C03 A;  1TWG A;  3FHD A;  3I5Q A;  3W2W A;  1JRA A;  1A41 A;  2Q9B A;  2NUT A;  3ZIB A;  4FX5 A;  3GEH A;  2CNW D;  5K0I A;  1LI7 A;  1T01 A;  2AWC A;  3LLK A;  1LS4 A;  2EPO A;  1YJG A;  4CS7 A;  2AWY A; 
#chains in the Genus database with same CATH homology
 4DRH B;  1FAP B;  2RSE B;  2NPU A;  5GPG B;  1NSG B;  4FAP B;  2FAP B;  4DRJ B;  4DRI B;  3FAP B;  1AUE A;  2GAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...