3FAPB

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords FK506-BINDING PROTEIN
total genus 38
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 3fapB00
4DRIB 1AUEA 4DRHB 1NSGB 2RSEB 1FAPB 2NPUA 4FAPB 3FAPB 2GAQA 2FAPB 4DRJB 5GPGB
chains in the Genus database with same CATH superfamily
4MTGA 2ZXPA 3RH3A 3B0UX 2ZD9A 2P0NA 3C7JA 3IPMO 4U5CE 2HJ3A 4MVRA 2Q7RA 3O10A 4WGYA 1J8YF 3ZDLA 3U2MA 1T6IA 2YZSA 3KYJA 1V54C 4CS8C 4JE9A 5L0CA 4D4NA 4OIOF 2HV6A 1XZQA 3CSKA 2YHSA 4MVQA 4YT2A 2XXAA 4U5GA 1SZIA 3FAJA 4QDLA 2HUJA 5E3AA 3UR3C 4PJMA 4I1MA 4K1OA 4ULVA 2BC5A 1B68A 3AG3C 3HNLA 1BR2A 2R7QA 4CDVA 4K0DA 3EGXA 3TULA 3NRHA 3TQOA 1MQVA 4GYTA 1CGOA 1LM3B 4PFOA 5EK0A 5KYXA 2VCCA 1OR3A 2YLDA 1T6UA 3N2ZB 4Z9IA 4JTAB 5L0DA 2EIKC 4NTBA 2L6GA 3W8IA 2PNOA 1E85A 1M2OA 1JAFA 3TJ6A 3C8GB 4U9EA 1Q0MA 1H6GA 2I8BA 1SR2A 1BR4A 3M4BA 3Q6MA 4AX2A 4C7OB 2IXPA 3AGTA 5L0JA 1SF8A 2BL2A 2YRFA 3DMDA 4YT8A 4WJ0A 5AC4A 3UGPA 5A6BA 3T9OA 4EKWA 1ZU4A 2XLDA 1M56C 1DOWA 1KTMA 3G4ZA 3E9VA 1ZYRF 4OD4A 3SEOA 1A7DA 1H7IA 3CZ6A 3QW1A 1LS4A 2YL7A 1BDJB 2Q9BA 3RW0A 4CIPA 3RFYA 5CI9A 2RD9A 3U8VA 4G7HF 3H65A 3ZG1A 2QE9A 4YK5A 2Z15A 2WZFA 3DZAA 4XEKA 4OIPF 3RVYA 2GWWA 3DJUB 3FHDA 2A6HF 2XLVA 3O6XA 4P6IC 5DQTA 2G3VA 3UMHA 3C63A 4BJ5C 2R03A 1WN0A 2OOCA 3ZIBA 3HLZA 4Q7CA 2DYSC 1YVIA 5KYWA 3ZC4A 2VASA 3VF0A 2VCAA 4IGGA 3FOPA 2NUPA 3AGUA 1RMVA 4PK4A 4ANJA 1EI7A 3U3BA 2PP4A 3FVYA 1TWHA 2CNWA 4J7YA 3T6BA 1QKRA 3K66A 3WG7C 2AVKA 1K40A 1MMGA 5KYYA 3S90A 2KC3A 2LK4A 1EQ1A 3N24A 2B0JA 4PR9A 3GM2A 5L0FA 1YLMA 3T4RA 1TWGA 4XTKA 2KNHA 1YARO 4N06A 3S29A 4CJOA 4HFKB 3KYIA 5D91A 3POVA 2QY9A 3RQFA 4CX9A 3WAQA 2J8WA 1FMVA 1O87A 3NMJA 1FTSA 1CGME 1QPUA 2KW3C 4J7TA 1ZHTA 3UMIA 2AU5A 3QVZA 2W4BA 4NC3A 1A7EA 4JJGA 1OCCC 4U5EE 4MQ9F 1YA7O 1O3UA 3H2UA 4JRZA 3RKOF 4YT4A 2EPLX 3SZRA 3PHF2 2LFDA 3FDQA 2W9YA 1QVXA 2HSQA 3AG2C 1WASA 4MVZA 4OD5A 2IYLD 2XLEA 3CQZA 1RKEB 2KSFA 4BPMA 5IY5C 3LJBA 1ORJA 2OJQA 4AE4B 2PX3A 5AGFA 5JT4A 2OG2A 1Y4CA 3NYLA 2XRHA 2OEXA 3U8PA 5A6KA 2KK1A 3E70C 3PDMP 1NU7D 2IXMA 5JP7A 3W2VA 3MYIA 4C3DA 4NTFA 3AJMA 4EIYA 4EUKB 1ZHXA 3RYLA 2J45A 1CPRA 1RKCA 2E87A 2NUTB 3QTHA 4FWVA 3AOUA 3TOMA 1W2WA 2EPOA 3VM6A 4LERA 2LFFA 3Q7LA 4DJ9A 2QTVA 2J9BA 3GM1A 4MTOA 3S27A 3BEHA 4MW8A 4JW1A 2YQYA 4DRHB 2EILC 3EPVA 3UNGC 4CS8A 2Q3TA 2XLOA 3FAPB 2GAQA 3X1OA 3W8HA 2ASRA 1VLSA 4JTDB 2R7XA 5E33A 1Z3IX 2CDQA 3MX3A 5JSLA 1NFNA 4BEJA 5F5HA 3SXYA 4Q4ZF 2J46A 5DLJA 4CDAA 2LD6A 1G8XA 1RJ9A 4LLCA 1CGNA 4E0HA 5L0HA 3TJ5A 3DD7A 3JRTA 1D1BA 3W4YA 2A69F 3JTLO 1OKKD 1YZCA 4ULWA 3QMKA 3R7CA 3LEOA 1JRAA 1T6QA 2A68F 1FFHA 1TKNA 4W8PA 3HJCA 2XS1A 3EFOB 2QLAA 1WWPA 2HV7A 4IARA 3M79A 4HFFB 5E3CA 3SYNA 1WGWA 2XLMA 4MVUA 3W2WA 2DI3A 1ZVZA 1NBBA 4NTAA 4RD9A 3V5ZA 3V5XA 1Z23A 2HSBA 4U5HA 4BJ1A 2EPKX 2L7AA 4P9FA 2CW0F 4PJLA 3GWNA 1H9TA 2YLGA 4I3MA 4IAQA 3Q7GA 1S05A 4EWCA 3GEEA 4XEVA 3J06A 3EGDA 3ECSA 2L81A 1AVOB 1I4YA 2OU6A 4KC9A 4MNDA 5B1AC 3S0XA 2Q9CA 3DM5A 1LPEA 2LP4A 3GWLA 4N4WA 2F22A 4C3BA 4MS2A 5L0GA 4IJJA 3O55A 1LVKA 2X0CA 2W45A 3KMIA 4CSAA 3JSZA 1SMYF 1VTMP 4UDVA 1ZHWA 1HMOA 2A0BA 4MVSA 5BQHA 1OQCA 4BEMJ 4OINF 3C8GA 3G50A 1VLTA 2GFHA 1JPJA 2JPUA 3R2PA 4U5DE 3ASNC 5L3VA 5AC5A 4JTCB 1UG7A 2Y3GA 3LNRA 1C17M 1OW7A 2HMZA 2PF4E 1SYQA 4DBRA 2H8AA 4WABA 4FAPB 5JUAA 1HE1A 1YYXA 3JYHA 3B0VC 4KI2A 1LE2A 2G62A 3B9QA 3HNKA 3A9CA 2H7BA 4CS9C 2J7PA 4HEAJ 4YL0A 2IXOA 4B6IA 1MMDA 2JD3A 3RQEA 5BQGA 4CIHA 3DI5A 4U9DA 3IQCA 3NDBB 4ZLDA 1NFOA 3DAGA 4D4XA 2UUIA 3MBGA 3ZWIA 3MYFA 1PD1A 2J0WA 2FAPB 4DBQA 1CPQA 1ZHZA 2VCBA 1T01A 3LS1A 5EHHA 3L1MA 2WVOA 1UFBA 4CBEA 2OEVA 4G7ZF 1MNDA 3EJNA 2R7UA 3NYMA 5TJ5E 3M4CA 4O6NA 2MWQA 2NUPB 1WTYA 1M2VB 4PJNA 1G4US 4ER9A 1U89A 2HZ8A 1ZZPA 4Z9HA 1G5ZA 1QLEC 3EH1A 3EQLF 3UGOA 3EHMA 2HKVA 3S9OA 1ORYA 5KYYB 4E18A 5D92A 5A6AA 3RQGA 2C03A 1OCZC 1HW1A 1OR2A 3AG1C 2GDCA 3JZ0A 1Z63A 1JR8A 5DS6A 3EH2A 3K6BA 5DS5A 2FFHA 2ICWG 2CGEA 1HE9A 4YL3A 4JEAA 2WVQA 2AWYA 1QSPA 3LEVA 1A7VA 3IQTA 1M6TA 3L34A 4WGZA 1GGQA 1ZU5A 3GM3A 3G4XA 2A1DD 5DVWA 4BJTA 4EBBA 4ZLCA 5EGYA 1ZW3A 2ZXWC 2NSGA 1APCA 3ABMC 3SNHA 2R7RA 3DE8A 1VYKA 3DKAA 3ZSUA 5HSWA 4BJ6A 1ORSC 2H7VC 1T5OA 3B29A 1RKEA 3ZTMA 2MHRA 1QQ3A 2P7VA 1D0ZA 1S7ZA 2LSEA 4IRUA 2O9XA 1DOVA 4IWBA 2DYRC 3RIPA 4AE4A 5HV9A 2FGYA 3GANA 5JLIA 1Q0GA 5T3TA 3ZVRA 5B3SC 2Y3BA 2D5RB 4ONSA 3KL4A 3JRMO 4JZAA 5A6BD 2EIMC 1E2XA 3C18A 1FMWA 4AL1A 4PJJA 1BBHA 1OW6A 2KQ9A 3K7DA 4XQ1A 4AL0A 3IQ6A 2J0XA 5B1BC 1C02A 2XL4A 4MVMA 2HMQA 2KYHA 4G0HA 2HJMA 2YKZA 4FESA 4DRIB 3JCUQ 2OQMA 2M64A 1IZMA 2AP3A 2P6VA 1TQGA 4EBJA 4KBLA 5JRAA 2J9WA 3NMIA 2HFIA 4XLNF 2L9JA 3GEIA 4LDRA 1YJGA 2HS5A 3IEEA 3EZIA 3EG9A 3V7OA 1K04A 4BG0A 2LQGA 3AQBA 3PMRA 1A0BA 5COGA 2YWAA 3N0TA 3U0CA 1RJ9B 1R5ID 4IB4A 4PACA 5GPGB 3LUTB 3DAFA 2EPNA 3U9MA 2EIJC 5KYUB 3ABLC 3HNIA 4U5BE 2B0HA 4YN0B 3NKEA 4O79A 4E7ZA 1Q0KA 3EFOA 4YJWA 3U3FA 3MLGA 3OWTA 3JT1A 4LDQA 3GORA 1NZEA 3L8JA 4G7OF 1WOLA 3C62A 3K1IA 2XL8A 1NLXA 4IAOA 1BZ4A 3F47A 1TWAA 2Y3HA 2YL0A 3QW0A 4I1OB 3PCVA 1C03A 1MMNA 1Y6DA 3U5SA 4JVSA 3T6GB 5K0IA 3EGDB 3SP1A 2IXNA 2OKUA 4EHPA 4A4AA 5FZTA 3SXKA 2XM4A 1OXKA 2X51A 4O6MA 4OIRF 3WHNA 4F4BA 1NG1A 3BRJA 3S28A 1PV3A 3CEXA 2YVKA 1LI5A 1MNEA 2C04A 1KNYA 1YZAA 2D4UA 1YYJA 4JURI 1V4AA 1TR2A 4DXWA 5BQIA 5KYNA 3UMKA 5BUOA 1XZPA 1H9GA 1HMDA 256BA 1TWCA 3DE9A 4U5FE 4BJ6C 2CYDA 1D0YA 2YLIA 4A2NB 4KNWA 1VYIA 2PX0A 1GS9A 3LLKA 5FCLA 4E0IA 3RF3A 5L0IA 3F46A 4MW3A 3K1IC 1D1CA 1L3PA 1ZHYA 4JC7A 1Q0FA 4JEBA 3B71A 5E2QA 2M4EA 2XSEA 3DJNB 4P9TA 3GEHA 3K33A 2XXAB 2H7OA 3JYYA 4NQFA 5A6JA 2WVNA 1U6HA 2R9RB 2RSEB 4X0RA 2ZPAA 4DRJB 3HNJA 2BE5F 3CAXA 1OCRC 1R4TA 1LI7A 3U2LA 2R7SA 1EA8A 3EGXB 4M63A 1YAUO 4LDKA 3ZQVA 5KYXB 3A11A 1HW2A 4GEHA 2AWCA 1L7CA 4G78A 1XWJA 2YL1A 3O39A 5F28E 1E86A 2NG1A 4J32B 4QI2A 4YWQA 4XLPF 3C8GD 4JCZA 2WZLA 3QVYA 3I5PA 4C7OA 1IW7F 3LNMB 3V5YA 2WZGA 4LACB 2Y3DA 1M2VA 3AG4C 1AEPA 3B0PA 3KPHA 1D0XA 1V55C 1FAPB 4W8KA 4Z9JA 5CIVA 5DQZA 4E17A 2LCHA 3L8IA 1J8MF 2J9VA 2R7OA 2A0UA 5JVEA 2CNWD 3OA1A 1ZW2A 2DB4A 4I44A 2OCCC 3M1CB 1VK5A 3VRCA 1F1MA 3VYWA 1JPNA 3ITFA 2R7VA 2A6EF 5F5FA 1VOMA 1PD0A 2V26A 1EKYA 1FNTc 3EZHA 1M57C 2ZXRA 2XL6A 5B3IA 3FOOA 2V3CC 4NY3A 4NCQA 4OIQF 5CI8A 2IOQA 4DOZA 1D1AA 2R25A 4EBKA 4HE8D 2XS8A 4RBNA 5KYWB 1RXQA 1Z7Qc 4JJFA 3OEOA 3QZCA 2EPMX 3SXZA 2UUHA 3NKDA 4L6RA 1I4ZA 3L0IA 3DWWA 2GA0A 2VH3A 2XM0A 2Y39A 2JX0A 3H2VA 1HY5A 3JSEO 4GQHA 4JCHA 1OCOC 2DGJA 1LS1A 1MMAA 1OKKA 2WB7A 1NSGB 4BJ5A 1JOGA 2WL8A 2P1AA 3KH2A 3DXJF 4R32A 4YT5A 3EHNA 3HKKA 5L3QA 1LIHA 4K7BA 2QUPA 4XPYA 3NG1A 2KGOA 2OJED 2IM8A 1E84A 4KNVA 4CJGA 2P61A 5T1DB 4CS7A 4J30B 3K1HA 3KKBA 3C8ZA 4DVZA 2R7WA 3Q6NA 2QNLA 3RVZA 3WODF 1Q0DA 1GQAA 3LLIA 5DS4A 4RDAA 3AQCA 4CS9A 4N6HA 1JMWA 2XLHA 4CSAC 1V74B 4N6CA 4XPXA 1RCPA 5COFA 3X2QC 4MVOA 4H54A 3U9JA 4Q5SF 1NU9C 1OW8A 1PCXA 4JKVA 4YL1A 3I5QA 2CCYA 4FX5A 2VB6A 5JS5A 1A41A 3EG9B 3LS0A 3VAYA 2L6HA 3ZQYA 1VMAA 2Q4FA 3FXHA 3MFNA 3NMKA 4AK9A 1E83A 1K05A 2W4MA 1Z5ZA 1TFOB 1YDIA 2I15A 5COMA 1OXBA 2YEVA 4PFPA 1YA9A 2PBEA 3TD7A 2TMVP 2L6FA 4CDYA 5KYUA 2J7PD 2VC9A 4H4KC 3M15A 4O7GA 1BR1A 2PFDA 3I4UA 1AUEA 2XLWA 4QI0A 4XWJA 2NUTA 4C3EA 1LE4A 3NYJA 4DVYP 1KU2A 2R02A 2MYSA 1T9KA 3IHUA 3LAYA 3ASOC 1LKXA 4XPWA 1GM5A 1I5NA 3ATPA 4E7SA 5A69A 2ZXOA 3HTKC 2NSFA 3T6JA 1FR0A 2G3KA 1ST6A 2Y69C 1O5HA 1QZXA 1VB5A 2NPUA 4JIOA 5T3WA 2R05A 2KJGA 2J9UA 2IBFA 4LLEA 3ABKC 2EINC 1Z6AA 2YL3A 1U0BB 2Q9AA 4O6YA 2R7TA 2Q00A 1WATA 4MTFA 2ETSA 3LESA 3TK0A 3GODA 3S84A 1TFKB 3SXMA 3TOLA 3ZTZA 3DM9B 1FFTC 4XEFA 3US6A 3IQ5A 3FMSA 1N1CA 1G4WR 2LIGA
chains in the Genus database with same CATH topology
4DRIB 1AUEA 4DRHB 1NSGB 2RSEB 1FAPB 2NPUA 4FAPB 3FAPB 2GAQA 2FAPB 4DRJB 5GPGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRI B;  1AUE A;  4DRH B;  1NSG B;  2RSE B;  1FAP B;  2NPU A;  4FAP B;  3FAP B;  2GAQ A;  2FAP B;  4DRJ B;  5GPG B; 
#chains in the Genus database with same CATH topology
 4MTG A;  2ZXP A;  3RH3 A;  3B0U X;  2ZD9 A;  2P0N A;  3C7J A;  3IPM O;  4U5C E;  2HJ3 A;  4MVR A;  2Q7R A;  3O10 A;  4WGY A;  1J8Y F;  3ZDL A;  3U2M A;  1T6I A;  2YZS A;  3KYJ A;  1V54 C;  4CS8 C;  4JE9 A;  5L0C A;  4D4N A;  4OIO F;  2HV6 A;  1XZQ A;  3CSK A;  2YHS A;  4MVQ A;  4YT2 A;  2XXA A;  4U5G A;  1SZI A;  3FAJ A;  4QDL A;  2HUJ A;  5E3A A;  3UR3 C;  4PJM A;  4I1M A;  4K1O A;  4ULV A;  2BC5 A;  1B68 A;  3AG3 C;  3HNL A;  1BR2 A;  2R7Q A;  4CDV A;  4K0D A;  3EGX A;  3TUL A;  3NRH A;  3TQO A;  1MQV A;  4GYT A;  1CGO A;  1LM3 B;  4PFO A;  5EK0 A;  5KYX A;  2VCC A;  1OR3 A;  2YLD A;  1T6U A;  3N2Z B;  4Z9I A;  4JTA B;  5L0D A;  2EIK C;  4NTB A;  2L6G A;  3W8I A;  2PNO A;  1E85 A;  1M2O A;  1JAF A;  3TJ6 A;  3C8G B;  4U9E A;  1Q0M A;  1H6G A;  2I8B A;  1SR2 A;  1BR4 A;  3M4B A;  3Q6M A;  4AX2 A;  4C7O B;  2IXP A;  3AGT A;  5L0J A;  1SF8 A;  2BL2 A;  2YRF A;  3DMD A;  4YT8 A;  4WJ0 A;  5AC4 A;  3UGP A;  5A6B A;  3T9O A;  4EKW A;  1ZU4 A;  2XLD A;  1M56 C;  1DOW A;  1KTM A;  3G4Z A;  3E9V A;  1ZYR F;  4OD4 A;  3SEO A;  1A7D A;  1H7I A;  3CZ6 A;  3QW1 A;  1LS4 A;  2YL7 A;  1BDJ B;  2Q9B A;  3RW0 A;  4CIP A;  3RFY A;  5CI9 A;  2RD9 A;  3U8V A;  4G7H F;  3H65 A;  3ZG1 A;  2QE9 A;  4YK5 A;  2Z15 A;  2WZF A;  3DZA A;  4XEK A;  4OIP F;  3RVY A;  2GWW A;  3DJU B;  3FHD A;  2A6H F;  2XLV A;  3O6X A;  4P6I C;  5DQT A;  2G3V A;  3UMH A;  3C63 A;  4BJ5 C;  2R03 A;  1WN0 A;  2OOC A;  3ZIB A;  3HLZ A;  4Q7C A;  2DYS C;  1YVI A;  5KYW A;  3ZC4 A;  2VAS A;  3VF0 A;  2VCA A;  4IGG A;  3FOP A;  2NUP A;  3AGU A;  1RMV A;  4PK4 A;  4ANJ A;  1EI7 A;  3U3B A;  2PP4 A;  3FVY A;  1TWH A;  2CNW A;  4J7Y A;  3T6B A;  1QKR A;  3K66 A;  3WG7 C;  2AVK A;  1K40 A;  1MMG A;  5KYY A;  3S90 A;  2KC3 A;  2LK4 A;  1EQ1 A;  3N24 A;  2B0J A;  4PR9 A;  3GM2 A;  5L0F A;  1YLM A;  3T4R A;  1TWG A;  4XTK A;  2KNH A;  1YAR O;  4N06 A;  3S29 A;  4CJO A;  4HFK B;  3KYI A;  5D91 A;  3POV A;  2QY9 A;  3RQF A;  4CX9 A;  3WAQ A;  2J8W A;  1FMV A;  1O87 A;  3NMJ A;  1FTS A;  1CGM E;  1QPU A;  2KW3 C;  4J7T A;  1ZHT A;  3UMI A;  2AU5 A;  3QVZ A;  2W4B A;  4NC3 A;  1A7E A;  4JJG A;  1OCC C;  4U5E E;  4MQ9 F;  1YA7 O;  1O3U A;  3H2U A;  4JRZ A;  3RKO F;  4YT4 A;  2EPL X;  3SZR A;  3PHF 2;  2LFD A;  3FDQ A;  2W9Y A;  1QVX A;  2HSQ A;  3AG2 C;  1WAS A;  4MVZ A;  4OD5 A;  2IYL D;  2XLE A;  3CQZ A;  1RKE B;  2KSF A;  4BPM A;  5IY5 C;  3LJB A;  1ORJ A;  2OJQ A;  4AE4 B;  2PX3 A;  5AGF A;  5JT4 A;  2OG2 A;  1Y4C A;  3NYL A;  2XRH A;  2OEX A;  3U8P A;  5A6K A;  2KK1 A;  3E70 C;  3PDM P;  1NU7 D;  2IXM A;  5JP7 A;  3W2V A;  3MYI A;  4C3D A;  4NTF A;  3AJM A;  4EIY A;  4EUK B;  1ZHX A;  3RYL A;  2J45 A;  1CPR A;  1RKC A;  2E87 A;  2NUT B;  3QTH A;  4FWV A;  3AOU A;  3TOM A;  1W2W A;  2EPO A;  3VM6 A;  4LER A;  2LFF A;  3Q7L A;  4DJ9 A;  2QTV A;  2J9B A;  3GM1 A;  4MTO A;  3S27 A;  3BEH A;  4MW8 A;  4JW1 A;  2YQY A;  4DRH B;  2EIL C;  3EPV A;  3UNG C;  4CS8 A;  2Q3T A;  2XLO A;  3FAP B;  2GAQ A;  3X1O A;  3W8H A;  2ASR A;  1VLS A;  4JTD B;  2R7X A;  5E33 A;  1Z3I X;  2CDQ A;  3MX3 A;  5JSL A;  1NFN A;  4BEJ A;  5F5H A;  3SXY A;  4Q4Z F;  2J46 A;  5DLJ A;  4CDA A;  2LD6 A;  1G8X A;  1RJ9 A;  4LLC A;  1CGN A;  4E0H A;  5L0H A;  3TJ5 A;  3DD7 A;  3JRT A;  1D1B A;  3W4Y A;  2A69 F;  3JTL O;  1OKK D;  1YZC A;  4ULW A;  3QMK A;  3R7C A;  3LEO A;  1JRA A;  1T6Q A;  2A68 F;  1FFH A;  1TKN A;  4W8P A;  3HJC A;  2XS1 A;  3EFO B;  2QLA A;  1WWP A;  2HV7 A;  4IAR A;  3M79 A;  4HFF B;  5E3C A;  3SYN A;  1WGW A;  2XLM A;  4MVU A;  3W2W A;  2DI3 A;  1ZVZ A;  1NBB A;  4NTA A;  4RD9 A;  3V5Z A;  3V5X A;  1Z23 A;  2HSB A;  4U5H A;  4BJ1 A;  2EPK X;  2L7A A;  4P9F A;  2CW0 F;  4PJL A;  3GWN A;  1H9T A;  2YLG A;  4I3M A;  4IAQ A;  3Q7G A;  1S05 A;  4EWC A;  3GEE A;  4XEV A;  3J06 A;  3EGD A;  3ECS A;  2L81 A;  1AVO B;  1I4Y A;  2OU6 A;  4KC9 A;  4MND A;  5B1A C;  3S0X A;  2Q9C A;  3DM5 A;  1LPE A;  2LP4 A;  3GWL A;  4N4W A;  2F22 A;  4C3B A;  4MS2 A;  5L0G A;  4IJJ A;  3O55 A;  1LVK A;  2X0C A;  2W45 A;  3KMI A;  4CSA A;  3JSZ A;  1SMY F;  1VTM P;  4UDV A;  1ZHW A;  1HMO A;  2A0B A;  4MVS A;  5BQH A;  1OQC A;  4BEM J;  4OIN F;  3C8G A;  3G50 A;  1VLT A;  2GFH A;  1JPJ A;  2JPU A;  3R2P A;  4U5D E;  3ASN C;  5L3V A;  5AC5 A;  4JTC B;  1UG7 A;  2Y3G A;  3LNR A;  1C17 M;  1OW7 A;  2HMZ A;  2PF4 E;  1SYQ A;  4DBR A;  2H8A A;  4WAB A;  4FAP B;  5JUA A;  1HE1 A;  1YYX A;  3JYH A;  3B0V C;  4KI2 A;  1LE2 A;  2G62 A;  3B9Q A;  3HNK A;  3A9C A;  2H7B A;  4CS9 C;  2J7P A;  4HEA J;  4YL0 A;  2IXO A;  4B6I A;  1MMD A;  2JD3 A;  3RQE A;  5BQG A;  4CIH A;  3DI5 A;  4U9D A;  3IQC A;  3NDB B;  4ZLD A;  1NFO A;  3DAG A;  4D4X A;  2UUI A;  3MBG A;  3ZWI A;  3MYF A;  1PD1 A;  2J0W A;  2FAP B;  4DBQ A;  1CPQ A;  1ZHZ A;  2VCB A;  1T01 A;  3LS1 A;  5EHH A;  3L1M A;  2WVO A;  1UFB A;  4CBE A;  2OEV A;  4G7Z F;  1MND A;  3EJN A;  2R7U A;  3NYM A;  5TJ5 E;  3M4C A;  4O6N A;  2MWQ A;  2NUP B;  1WTY A;  1M2V B;  4PJN A;  1G4U S;  4ER9 A;  1U89 A;  2HZ8 A;  1ZZP A;  4Z9H A;  1G5Z A;  1QLE C;  3EH1 A;  3EQL F;  3UGO A;  3EHM A;  2HKV A;  3S9O A;  1ORY A;  5KYY B;  4E18 A;  5D92 A;  5A6A A;  3RQG A;  2C03 A;  1OCZ C;  1HW1 A;  1OR2 A;  3AG1 C;  2GDC A;  3JZ0 A;  1Z63 A;  1JR8 A;  5DS6 A;  3EH2 A;  3K6B A;  5DS5 A;  2FFH A;  2ICW G;  2CGE A;  1HE9 A;  4YL3 A;  4JEA A;  2WVQ A;  2AWY A;  1QSP A;  3LEV A;  1A7V A;  3IQT A;  1M6T A;  3L34 A;  4WGZ A;  1GGQ A;  1ZU5 A;  3GM3 A;  3G4X A;  2A1D D;  5DVW A;  4BJT A;  4EBB A;  4ZLC A;  5EGY A;  1ZW3 A;  2ZXW C;  2NSG A;  1APC A;  3ABM C;  3SNH A;  2R7R A;  3DE8 A;  1VYK A;  3DKA A;  3ZSU A;  5HSW A;  4BJ6 A;  1ORS C;  2H7V C;  1T5O A;  3B29 A;  1RKE A;  3ZTM A;  2MHR A;  1QQ3 A;  2P7V A;  1D0Z A;  1S7Z A;  2LSE A;  4IRU A;  2O9X A;  1DOV A;  4IWB A;  2DYR C;  3RIP A;  4AE4 A;  5HV9 A;  2FGY A;  3GAN A;  5JLI A;  1Q0G A;  5T3T A;  3ZVR A;  5B3S C;  2Y3B A;  2D5R B;  4ONS A;  3KL4 A;  3JRM O;  4JZA A;  5A6B D;  2EIM C;  1E2X A;  3C18 A;  1FMW A;  4AL1 A;  4PJJ A;  1BBH A;  1OW6 A;  2KQ9 A;  3K7D A;  4XQ1 A;  4AL0 A;  3IQ6 A;  2J0X A;  5B1B C;  1C02 A;  2XL4 A;  4MVM A;  2HMQ A;  2KYH A;  4G0H A;  2HJM A;  2YKZ A;  4FES A;  4DRI B;  3JCU Q;  2OQM A;  2M64 A;  1IZM A;  2AP3 A;  2P6V A;  1TQG A;  4EBJ A;  4KBL A;  5JRA A;  2J9W A;  3NMI A;  2HFI A;  4XLN F;  2L9J A;  3GEI A;  4LDR A;  1YJG A;  2HS5 A;  3IEE A;  3EZI A;  3EG9 A;  3V7O A;  1K04 A;  4BG0 A;  2LQG A;  3AQB A;  3PMR A;  1A0B A;  5COG A;  2YWA A;  3N0T A;  3U0C A;  1RJ9 B;  1R5I D;  4IB4 A;  4PAC A;  5GPG B;  3LUT B;  3DAF A;  2EPN A;  3U9M A;  2EIJ C;  5KYU B;  3ABL C;  3HNI A;  4U5B E;  2B0H A;  4YN0 B;  3NKE A;  4O79 A;  4E7Z A;  1Q0K A;  3EFO A;  4YJW A;  3U3F A;  3MLG A;  3OWT A;  3JT1 A;  4LDQ A;  3GOR A;  1NZE A;  3L8J A;  4G7O F;  1WOL A;  3C62 A;  3K1I A;  2XL8 A;  1NLX A;  4IAO A;  1BZ4 A;  3F47 A;  1TWA A;  2Y3H A;  2YL0 A;  3QW0 A;  4I1O B;  3PCV A;  1C03 A;  1MMN A;  1Y6D A;  3U5S A;  4JVS A;  3T6G B;  5K0I A;  3EGD B;  3SP1 A;  2IXN A;  2OKU A;  4EHP A;  4A4A A;  5FZT A;  3SXK A;  2XM4 A;  1OXK A;  2X51 A;  4O6M A;  4OIR F;  3WHN A;  4F4B A;  1NG1 A;  3BRJ A;  3S28 A;  1PV3 A;  3CEX A;  2YVK A;  1LI5 A;  1MNE A;  2C04 A;  1KNY A;  1YZA A;  2D4U A;  1YYJ A;  4JUR I;  1V4A A;  1TR2 A;  4DXW A;  5BQI A;  5KYN A;  3UMK A;  5BUO A;  1XZP A;  1H9G A;  1HMD A;  256B A;  1TWC A;  3DE9 A;  4U5F E;  4BJ6 C;  2CYD A;  1D0Y A;  2YLI A;  4A2N B;  4KNW A;  1VYI A;  2PX0 A;  1GS9 A;  3LLK A;  5FCL A;  4E0I A;  3RF3 A;  5L0I A;  3F46 A;  4MW3 A;  3K1I C;  1D1C A;  1L3P A;  1ZHY A;  4JC7 A;  1Q0F A;  4JEB A;  3B71 A;  5E2Q A;  2M4E A;  2XSE A;  3DJN B;  4P9T A;  3GEH A;  3K33 A;  2XXA B;  2H7O A;  3JYY A;  4NQF A;  5A6J A;  2WVN A;  1U6H A;  2R9R B;  2RSE B;  4X0R A;  2ZPA A;  4DRJ B;  3HNJ A;  2BE5 F;  3CAX A;  1OCR C;  1R4T A;  1LI7 A;  3U2L A;  2R7S A;  1EA8 A;  3EGX B;  4M63 A;  1YAU O;  4LDK A;  3ZQV A;  5KYX B;  3A11 A;  1HW2 A;  4GEH A;  2AWC A;  1L7C A;  4G78 A;  1XWJ A;  2YL1 A;  3O39 A;  5F28 E;  1E86 A;  2NG1 A;  4J32 B;  4QI2 A;  4YWQ A;  4XLP F;  3C8G D;  4JCZ A;  2WZL A;  3QVY A;  3I5P A;  4C7O A;  1IW7 F;  3LNM B;  3V5Y A;  2WZG A;  4LAC B;  2Y3D A;  1M2V A;  3AG4 C;  1AEP A;  3B0P A;  3KPH A;  1D0X A;  1V55 C;  1FAP B;  4W8K A;  4Z9J A;  5CIV A;  5DQZ A;  4E17 A;  2LCH A;  3L8I A;  1J8M F;  2J9V A;  2R7O A;  2A0U A;  5JVE A;  2CNW D;  3OA1 A;  1ZW2 A;  2DB4 A;  4I44 A;  2OCC C;  3M1C B;  1VK5 A;  3VRC A;  1F1M A;  3VYW A;  1JPN A;  3ITF A;  2R7V A;  2A6E F;  5F5F A;  1VOM A;  1PD0 A;  2V26 A;  1EKY A;  1FNT c;  3EZH A;  1M57 C;  2ZXR A;  2XL6 A;  5B3I A;  3FOO A;  2V3C C;  4NY3 A;  4NCQ A;  4OIQ F;  5CI8 A;  2IOQ A;  4DOZ A;  1D1A A;  2R25 A;  4EBK A;  4HE8 D;  2XS8 A;  4RBN A;  5KYW B;  1RXQ A;  1Z7Q c;  4JJF A;  3OEO A;  3QZC A;  2EPM X;  3SXZ A;  2UUH A;  3NKD A;  4L6R A;  1I4Z A;  3L0I A;  3DWW A;  2GA0 A;  2VH3 A;  2XM0 A;  2Y39 A;  2JX0 A;  3H2V A;  1HY5 A;  3JSE O;  4GQH A;  4JCH A;  1OCO C;  2DGJ A;  1LS1 A;  1MMA A;  1OKK A;  2WB7 A;  1NSG B;  4BJ5 A;  1JOG A;  2WL8 A;  2P1A A;  3KH2 A;  3DXJ F;  4R32 A;  4YT5 A;  3EHN A;  3HKK A;  5L3Q A;  1LIH A;  4K7B A;  2QUP A;  4XPY A;  3NG1 A;  2KGO A;  2OJE D;  2IM8 A;  1E84 A;  4KNV A;  4CJG A;  2P61 A;  5T1D B;  4CS7 A;  4J30 B;  3K1H A;  3KKB A;  3C8Z A;  4DVZ A;  2R7W A;  3Q6N A;  2QNL A;  3RVZ A;  3WOD F;  1Q0D A;  1GQA A;  3LLI A;  5DS4 A;  4RDA A;  3AQC A;  4CS9 A;  4N6H A;  1JMW A;  2XLH A;  4CSA C;  1V74 B;  4N6C A;  4XPX A;  1RCP A;  5COF A;  3X2Q C;  4MVO A;  4H54 A;  3U9J A;  4Q5S F;  1NU9 C;  1OW8 A;  1PCX A;  4JKV A;  4YL1 A;  3I5Q A;  2CCY A;  4FX5 A;  2VB6 A;  5JS5 A;  1A41 A;  3EG9 B;  3LS0 A;  3VAY A;  2L6H A;  3ZQY A;  1VMA A;  2Q4F A;  3FXH A;  3MFN A;  3NMK A;  4AK9 A;  1E83 A;  1K05 A;  2W4M A;  1Z5Z A;  1TFO B;  1YDI A;  2I15 A;  5COM A;  1OXB A;  2YEV A;  4PFP A;  1YA9 A;  2PBE A;  3TD7 A;  2TMV P;  2L6F A;  4CDY A;  5KYU A;  2J7P D;  2VC9 A;  4H4K C;  3M15 A;  4O7G A;  1BR1 A;  2PFD A;  3I4U A;  1AUE A;  2XLW A;  4QI0 A;  4XWJ A;  2NUT A;  4C3E A;  1LE4 A;  3NYJ A;  4DVY P;  1KU2 A;  2R02 A;  2MYS A;  1T9K A;  3IHU A;  3LAY A;  3ASO C;  1LKX A;  4XPW A;  1GM5 A;  1I5N A;  3ATP A;  4E7S A;  5A69 A;  2ZXO A;  3HTK C;  2NSF A;  3T6J A;  1FR0 A;  2G3K A;  1ST6 A;  2Y69 C;  1O5H A;  1QZX A;  1VB5 A;  2NPU A;  4JIO A;  5T3W A;  2R05 A;  2KJG A;  2J9U A;  2IBF A;  4LLE A;  3ABK C;  2EIN C;  1Z6A A;  2YL3 A;  1U0B B;  2Q9A A;  4O6Y A;  2R7T A;  2Q00 A;  1WAT A;  4MTF A;  2ETS A;  3LES A;  3TK0 A;  3GOD A;  3S84 A;  1TFK B;  3SXM A;  3TOL A;  3ZTZ A;  3DM9 B;  1FFT C;  4XEF A;  3US6 A;  3IQ5 A;  3FMS A;  1N1C A;  1G4W R;  2LIG A; 
#chains in the Genus database with same CATH homology
 4DRI B;  1AUE A;  4DRH B;  1NSG B;  2RSE B;  1FAP B;  2NPU A;  4FAP B;  3FAP B;  2GAQ A;  2FAP B;  4DRJ B;  5GPG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...