2JD3A

Parr from plasmid pb171
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
KRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STBB PROTEIN
publication title Structural Analysis of the Parr/Parc Plasmid Partition Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 26
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1170 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2jd3A01
2JD3A
chains in the Genus database with same CATH superfamily
3FAJA 1G4US 2L6FA 3LESA 4Q4ZF 4JCZA 1CGNA 3FXHA 1RMVA 1M56C 2XSEA 1GM5A 5T1DB 1GS9A 1Q0MA 5L3QA 1ZHZA 4EKWA 4IAOA 4QI2A 3VAYA 3K1HA 4C3BA 5CI8A 1E85A 3E70C 2A0UA 4PACA 5A6BA 4XPXA 1LS4A 2F22A 2EPNA 2RD9A 1ZW3A 4N6HA 1CGME 2IXPA 4XEVA 3QVZA 1PD0A 4EBJA 3WHNA 3B0VC 4OD4A 4CSAA 3C63A 3TOLA 3U3FA 3MYFA 4OD5A 4IWBA 3Q7GA 1NSGB 4O79A 4BG0A 3DZAA 2R7XA 4Z9HA 2IXNA 2YHSA 3KMIA 4BEJA 3K6BA 2PF4E 1FFTC 1HMOA 2XL6A 5DS4A 5KYXA 1E86A 1XWJA 4H4KC 1LIHA 1T01A 2YEVA 1Q0FA 3JYHA 3US6A 4GEHA 5JSLA 1TWGA 3SXMA 3QMKA 2LFFA 1BR1A 1YYJA 2R05A 3HKKA 4KNVA 3ABLC 2HMQA 5JP7A 5AC5A 3NYMA 1FFHA 2J8WA 2ZXPA 4A2NB 1Q0GA 5F28E 1OR2A 4P9FA 2R7OA 1LM3B 1YVIA 2P6VA 4BJ1A 2BL2A 1T6IA 2L7AA 2Y3HA 1M2OA 1B68A 3JZ0A 2AU5A 2L81A 4U5GA 1UFBA 3T4RA 3G50A 1OW7A 2YVKA 3S29A 3HNKA 1QLEC 2YLDA 4K0DA 2D4UA 4NY3A 3ZWIA 3TJ6A 4G78A 2R7VA 2XM4A 1DOVA 3U8PA 4W8KA 4PR9A 4D4XA 1YJGA 5CI9A 2EPMX 1AEPA 3ASOC 1O5HA 2YL3A 1PD1A 1IZMA 1WGWA 2LIGA 3TQOA 3O10A 3VM6A 3ECSA 3VRCA 2LK4A 3RQGA 4CIHA 3JCUQ 3UMHA 2J7PD 1QZXA 4MTGA 2XXAB 3OA1A 4MQ9F 4MVRA 2KW3C 4J32B 5L0JA 5KYNA 3DXJF 5EGYA 3RIPA 3C18A 2MHRA 2EPOA 2P0NA 4M63A 1JAFA 1G8XA 3L1MA 4PK4A 2VCBA 1WOLA 4P9TA 1IW7F 2CNWA 3ZG1A 1V54C 2A0BA 2KC3A 2WZLA 3BEHA 3GWNA 4YT5A 3DD7A 2AWYA 2X51A 1QPUA 3JRMO 3EFOB 1O3UA 1O87A 1TQGA 2FFHA 2YKZA 4DBQA 2O9XA 1JR8A 3WAQA 2IOQA 1C03A 2RSEB 2IM8A 3NKEA 4Z9JA 5T3TA 1U0BB 1EA8A 3EH2A 5HSWA 2CW0F 2HSQA 3L34A 3LJBA 1TWAA 4H54A 3U9MA 4AE4B 2HV7A 3SXZA 1V55C 2NPUA 3O39A 2GWWA 2DGJA 1D0XA 5AC4A 3EGDB 3IQCA 4GQHA 2A68F 4Z9IA 4EIYA 4KI2A 3EJNA 5COFA 5E3AA 3J06A 2E87A 5A6AA 4C3DA 5EHHA 1K05A 3O55A 4MTOA 5E3CA 2XS8A 3U2LA 5IY5C 1WWPA 3U5SA 3A9CA 2AVKA 4ZLDA 1RKEB 1I5NA 3AG4C 2M64A 4NCQA 1LI5A 2EINC 1SR2A 4AK9A 3MYIA 2BE5F 4BJ5C 2XL4A 3DE9A 3DM9B 2VB6A 3KL4A 1FTSA 3AG3C 3EH1A 1HE9A 3C8ZA 3H65A 1HW2A 3C62A 5KYWA 3B0UX 2HV6A 5JLIA 3DKAA 4LERA 3PDMP 3KH2A 2NUTA 4CS9A 2DI3A 2ZXOA 4CX9A 4PJNA 4JTAB 4O6YA 2J9WA 1RJ9A 3ZVRA 1TFOB 1VYKA 5JUAA 1OCOC 3UMKA 4ER9A 1ZHTA 4LACB 3V7OA 3AQBA 4E7ZA 2R7UA 1R4TA 2XM0A 2JPUA 1E84A 5E33A 1A0BA 2ICWG 4C7OB 4DJ9A 4CS9C 2NG1A 4J7TA 1A7DA 3S28A 5HV9A 1D1AA 1I4YA 4D4NA 4CJGA 2IBFA 3CZ6A 3G4ZA 2W4BA 2YL7A 2VC9A 2HFIA 3F47A 3DJUB 2J9UA 4ONSA 4EWCA 1E2XA 3K66A 1C17M 3RVYA 4FX5A 1YARO 4U5DE 2L9JA 2B0HA 4N06A 1H6GA 2VCCA 2G62A 1FMWA 1G5ZA 1HE1A 2G3KA 2IYLD 1U89A 3EZHA 3H2VA 3QVYA 3QW0A 4MVMA 4N4WA 4YT8A 1FNTc 2NUPB 1DOWA 1D1CA 1RXQA 5TJ5E 1ZW2A 5KYYA 1L7CA 3W8IA 3GODA 4U9DA 5DS6A 3ABMC 3UMIA 4XEFA 3ASNC 2OEVA 2XLWA 3W8HA 1S7ZA 4QI0A 2Q9CA 4E7SA 1M2VB 1OXKA 2EIKC 4OIRF 2WZGA 4CDVA 5KYUB 4IJJA 3L0IA 4PFOA 2LP4A 1Z5ZA 4PFPA 4F4BA 3DI5A 4CJOA 1JMWA 2Q3TA 4U5HA 1NZEA 1WTYA 1NU9C 1LKXA 3B0PA 2JX0A 1BBHA 1SYQA 2PBEA 3GORA 3RW0A 4CS8A 2WVQA 3LS0A 4O6NA 3NMIA 3LS1A 5KYUA 2J46A 3AOUA 2IXOA 4N6CA 4CS7A 4CSAC 4G7OF 5DS5A 4K7BA 4XLPF 1A7EA 1GGQA 1MMGA 1PCXA 2JD3A 1OQCA 2H7BA 1SF8A 3OWTA 2J0XA 1MMNA 3ZDLA 4JURI 1Z63A 5EK0A 1JPNA 1LI7A 5T3WA 2KGOA 3K1IA 4XPWA 5COGA 1MMAA 4MVQA 3X2QC 4NTBA 4LLEA 1U6HA 4MNDA 3FOPA 2V3CC 1XZQA 3G4XA 4PJLA 1MMDA 4GYTA 1Q0DA 2EPLX 3CSKA 3TJ5A 3OEOA 3UGPA 2GDCA 1J8YF 2VH3A 3MFNA 3T6GB 5L0CA 1ZU5A 4IGGA 3AGTA 2GA0A 3QZCA 4XPYA 2KNHA 3ZTMA 3KPHA 1G4WR 2J7PA 2PNOA 5BQIA 3ZSUA 2KQ9A 4MVUA 5GPGB 2QLAA 1C02A 1VTMP 1K40A 1D1BA 1FAPB 3EQLF 3E9VA 5F5FA 3NKDA 3VYWA 1OKKD 2XLVA 5E2QA 4IB4A 2XLOA 256BA 3T9OA 3W2WA 2KJGA 1YLMA 2A6HF 2H7OA 2Y3GA 1LVKA 2P61A 3U9JA 3CAXA 3VF0A 2XXAA 4EBKA 1NBBA 2WB7A 2Y39A 2XLMA 4WGYA 3LNMB 4E18A 3C8GD 3IQ6A 3JRTA 4YL1A 3I5PA 3S84A 4EBBA 1ZHYA 3RF3A 2QE9A 1NU7D 1VLSA 2GAQA 4OIPF 2QNLA 3AJMA 3GM3A 4CIPA 2R03A 4IRUA 3MBGA 4CDAA 2XRHA 3JSZA 3RKOF 5K0IA 1H9GA 1K04A 2WL8A 1T9KA 4XQ1A 3ZTZA 1Z3IX 2W4MA 2DYRC 3DJNB 4MTFA 4RD9A 3EFOA 3U3BA 5FCLA 2XS1A 4ULWA 5B1BC 4I44A 2GFHA 4JKVA 2H8AA 2EILC 4LLCA 4MW8A 2YL1A 2KK1A 2Y3BA 2OJQA 4LDRA 1V74B 2VCAA 3JSEO 4BPMA 3PMRA 3RYLA 4AE4A 1QQ3A 1J8MF 2OQMA 3EGXB 5DQTA 1H9TA 1YA9A 4X0RA 1TWCA 2HSBA 3C7JA 3SEOA 1HY5A 2YRFA 3EGDA 4WABA 4G7HF 2HJ3A 2XLDA 2Q9BA 4YWQA 1VYIA 4BJ6A 3Q7LA 4NTFA 1M6TA 3S0XA 5A69A 2HZ8A 2YL0A 5BUOA 4LDQA 1XZPA 1BDJB 1Q0KA 2NSFA 2R7QA 3SP1A 3GEEA 1RKEA 3H2UA 2C03A 2M4EA 2YQYA 2DB4A 3EGXA 3X1OA 3PHF2 4DOZA 1QSPA 4ZLCA 3K7DA 4YL0A 2NSGA 4JCHA 2Q7RA 2LFDA 1TR2A 4E17A 1T5OA 1FMVA 1OW8A 3ZC4A 2HKVA 4OIOF 4PJJA 3AGUA 5BQHA 4EUKB 1HMDA 2A1DD 4G0HA 3F46A 3NYJA 1A7VA 1F1MA 1KNYA 1TWHA 2PX3A 3HNJA 1Z7Qc 1Y4CA 4Q5SF 3IEEA 2LD6A 2V26A 4DVZA 2Y3DA 1D0YA 1R5ID 1RCPA 2A69F 4JIOA 1OW6A 4XEKA 3M79A 4B6IA 4FAPB 3ZQYA 5B3SC 2LQGA 4A4AA 3B29A 1YYXA 2IXMA 1UG7A 2H7VC 3HLZA 2G3VA 2HJMA 2CCYA 5L0FA 4O7GA 5D91A 2J0WA 4C7OA 3ABKC 4MS2A 2L6HA 4AX2A 3TULA 1V4AA 3WG7C 2YLGA 2R02A 4HFKB 2ZPAA 3B71A 1ZZPA 4DRHB 3IQTA 1TKNA 3WODF 3DM5A 4JEAA 1VOMA 3LEOA 4BJTA 4DRJB 1GQAA 3Q6NA 5A6JA 3NDBB 2J9BA 3CEXA 2P1AA 1ST6A 1CGOA 3K33A 1NFNA 4PJMA 1CPRA 4U5FE 4JTCB 1YDIA 4NQFA 2NUPA 3FVYA 2EPKX 3NG1A 3W4YA 5L0IA 2Z15A 1BZ4A 4CDYA 5JVEA 2Q9AA 2L6GA 4JEBA 3FDQA 2PP4A 3GWLA 4JE9A 3DE8A 4XWJA 4J7YA 3NRHA 1QVXA 4JJGA 4U5BE 5KYXB 1M2VA 2R7SA 2ZXRA 3LLKA 2XL8A 5A6BD 4DVYP 3UGOA 2HS5A 4NC3A 3POVA 1YZCA 3ATPA 5DQZA 4L6RA 3ITFA 3AG1C 4K1OA 1EI7A 2OU6A 3U8VA 2R9RB 3KYIA 4HFFB 1OCCC 4FESA 2ZD9A 1WASA 2ASRA 3GM1A 4NTAA 3SZRA 3GM2A 4YT2A 1YA7O 3N0TA 2UUIA 5BQGA 5F5HA 3AQCA 4DBRA 5DVWA 4P6IC 1SMYF 2PFDA 4JRZA 2WZFA 2KSFA 4CS8C 2C04A 2W9YA 3LUTB 4MVSA 1TFKB 3EHNA 2CGEA 2YWAA 2R25A 4ULVA 1KU2A 2HMZA 1M57C 3DWWA 3GEIA 4I1OB 3SNHA 4MW3A 3EG9B 3T6BA 1QKRA 4AL1A 3O6XA 4FWVA 4RBNA 2PX0A 1NFOA 4XTKA 2OEXA 3UNGC 3K1IC 3S9OA 1OCRC 2CYDA 4KC9A 5AGFA 1MQVA 4YN0B 1EQ1A 2VASA 1WATA 4I1MA 3C8GB 1AVOB 3KKBA 4WGZA 2A6EF 2EIJC 3HNLA 2YZSA 3RQFA 4EHPA 1I4ZA 2P7VA 4KNWA 4JJFA 1OKKA 3EG9A 1JRAA 3IHUA 3TOMA 2YLIA 2AWCA 1BR4A 5B3IA 3Q6MA 4MVOA 2OOCA 4R32A 4G7ZF 3PCVA 4AL0A 3BRJA 1ZYRF 4LDKA 4HE8D 2EIMC 3MX3A 3C8GA 3MLGA 4HEAJ 4U9EA 4RDAA 5D92A 1AUEA 2D5RB 2ZXWC 4OINF 3B9QA 1WN0A 3A11A 3SXKA 3M1CB 4IAQA 4JZAA 3KYJA 4W8PA 3RFYA 1OR3A 1OXBA 4WJ0A 1H7IA 2Q00A 1BR2A 1N1CA 1ZHWA 2FGYA 3DAGA 3FHDA 2HUJA 3LAYA 2DYSC 3GANA 1L3PA 3M4CA 3DMDA 4I3MA 5COMA 2OKUA 2CNWD 1ZVZA 1T6UA 3DAFA 3EZIA 3FAPB 3LLIA 1E83A 1EKYA 3RQEA 3M15A 2W45A 3UR3C 2R7TA 1ORYA 4KBLA 1T6QA 4E0IA 1CPQA 1Z23A 2MYSA 3SYNA 5L3VA 4J30B 4XLNF 3V5XA 2OJED 1VK5A 5JS5A 4MVZA 3S27A 1JOGA 1VLTA 2QY9A 3R7CA 1MNEA 3RVZA 2MWQA 3JYYA 3SXYA 4BEMJ 1D0ZA 3N24A 4DXWA 1Y6DA 2I15A 2R7WA 5L0GA 2X0CA 4U5EE 4BJ5A 4Q7CA 3LNRA 2TMVP 2AP3A 2WVOA 3HNIA 1ZHXA 3N2ZB 4IARA 4JW1A 3U2MA 1W2WA 4YL3A 5DLJA 3U0CA 3LEVA 2R7RA 2QUPA 1SZIA 4OIQF 4CBEA 1LS1A 1YZAA 3QTHA 1APCA 3R2PA 4JVSA 1LE2A 2UUHA 4DRIB 3CQZA 5CIVA 5KYWB 5JT4A 2OG2A 3I5QA 2NUTB 4BJ6C 1S05A 4U5CE 4YJWA 2OCCC 3ZQVA 5A6KA 5L0HA 1HW1A 1PV3A 2WVNA 2Y69C 3V5ZA 3RH3A 5JRAA 3L8JA 4C3EA 2BC5A 2KYHA 1RJ9B 4QDLA 1ZU4A 2B0JA 2J45A 3L8IA 4ANJA 3HTKC 3I4UA 3NMJA 1NG1A 3FMSA 1NLXA 2LSEA 1RKCA 1FR0A 1ORJA 2XLHA 3QW1A 4JC7A 1Z6AA 3FOOA 3HJCA 2CDQA 2I8BA 1VMAA 2J9VA 3S90A 3TD7A 3ZIBA 4YK5A 1LPEA 1ORSC 3M4BA 5FZTA 2QTVA 1A41A 1MNDA 4O6MA 3EHMA 1YAUO 5B1AC 3W2VA 3NMKA 4JTDB 3EPVA 3TK0A 3JTLO 2LCHA 2ETSA 1JPJA 3V5YA 5L0DA 3T6JA 5KYYB 4YT4A 1OCZC 3GEHA 3JT1A 3AG2C 1LE4A 1KTMA 4E0HA 2Q4FA 3IQ5A 4UDVA 3IPMO 2FAPB 2XLEA 3NYLA 1VB5A
chains in the Genus database with same CATH topology
3FAJA 3LESA 1M56C 2XSEA 5T1DB 5L3QA 1ZHZA 4IAOA 4QI2A 3VAYA 3K1HA 4C3BA 5CI8A 3E70C 2IXPA 4CSAA 1PD0A 3B0VC 4OD4A 4OD5A 4IWBA 3Q7GA 4O79A 4BG0A 3DZAA 2R7XA 2IXNA 2YHSA 3KMIA 4BEJA 3K6BA 2PF4E 1FFTC 5KYXA 5DS4A 4Q4ZF 4H4KC 3JYHA 2YEVA 4GEHA 1TWGA 3QMKA 1BR1A 4KNVA 3ABLC 3NYMA 1FFHA 2ZXPA 4A2NB 2R7OA 2P6VA 4BJ1A 2Y3HA 1M2OA 2L81A 4U5GA 3T4RA 3S29A 1QLEC 4K0DA 4NY3A 2R7VA 4W8KA 5CI9A 3ASOC 1O5HA 1PD1A 1IZMA 1WGWA 3ECSA 4CIHA 3JCUQ 3UMHA 2J7PD 1QZXA 2XXAB 3OA1A 4MQ9F 2KW3C 4J32B 5KYNA 3DXJF 3RIPA 4M63A 1G8XA 4PK4A 1IW7F 2CNWA 1V54C 2WZLA 4YT5A 3DD7A 2X51A 3EFOB 1O87A 2FFHA 4DBQA 2O9XA 2IOQA 5T3TA 3NKEA 3EH2A 5HSWA 2CW0F 3LJBA 3L34A 4AE4B 1TWAA 2HV7A 1V55C 3O39A 2DGJA 1D0XA 3EGDB 4KI2A 2A68F 3EJNA 5E3AA 2E87A 5EHHA 4C3DA 5E3CA 5IY5C 4ZLDA 3AG4C 2EINC 4AK9A 2BE5F 4BJ5C 2XL4A 3DM9B 2VB6A 3KL4A 1FTSA 3AG3C 3EH1A 3H65A 5KYWA 3B0UX 2HV6A 4LERA 3KH2A 2NUTA 4CS9A 2ZXOA 4PJNA 4O6YA 2J9WA 1RJ9A 3ZVRA 1VYKA 1OCOC 3UMKA 1ZHTA 4LACB 3V7OA 3AQBA 4E7ZA 2R7UA 5E33A 4C7OB 4CS9C 2NG1A 1D1AA 3S28A 3CZ6A 2W4BA 3F47A 3DJUB 2J9UA 4EWCA 3K66A 4FX5A 4U5DE 2L9JA 4N06A 2G62A 1FMWA 2G3KA 2IYLD 3EZHA 4YT8A 2NUPB 1D1CA 5KYYA 3W8IA 3GODA 5DS6A 3ABMC 3UMIA 3ASNC 3W8HA 1S7ZA 4QI0A 2Q9CA 4E7SA 1M2VB 2EIKC 5KYUB 4OIRF 2WZGA 4IJJA 3L0IA 4PFOA 1Z5ZA 4PFPA 4F4BA 2Q3TA 4U5HA 1NZEA 1NU9C 1LKXA 3B0PA 4CS8A 2WVQA 3LS0A 4O6NA 3LS1A 5KYUA 2J46A 2IXOA 4CS7A 4CSAC 4G7OF 5DS5A 4K7BA 4XLPF 1MMGA 2JD3A 1PCXA 3OWTA 2H7BA 1SF8A 2J0XA 1MMNA 4JURI 1Z63A 1JPNA 5T3WA 2KGOA 1MMAA 3X2QC 4LLEA 4MNDA 2V3CC 4PJLA 1MMDA 4GYTA 3CSKA 3OEOA 3UGPA 1J8YF 2VH3A 1ZU5A 3QZCA 2KNHA 2J7PA 3ZSUA 2KQ9A 1D1BA 3EQLF 3E9VA 5F5FA 3NKDA 3VYWA 1OKKD 5E2QA 3W2WA 2KJGA 2A6HF 2H7OA 2Y3GA 1LVKA 2XXAA 2WB7A 2Y39A 3JRTA 3I5PA 4EBBA 1ZHYA 4OIPF 1NU7D 4IRUA 2XRHA 3JSZA 3RKOF 5EGYA 2WL8A 5FCLA 1Z3IX 2W4MA 2DYRC 3DJNB 4RD9A 3EFOA 4ULWA 5B1BC 4I44A 2GFHA 2EILC 4LLCA 2Y3BA 3PMRA 3RYLA 4AE4A 1J8MF 5DQTA 3EGXB 4X0RA 3SEOA 1TWCA 3EGDA 4G7HF 2Q9BA 4YWQA 1VYIA 4BJ6A 3Q7LA 3S0XA 5BUOA 2R7QA 3SP1A 2C03A 2M4EA 3EGXA 3X1OA 3PHF2 4DOZA 4ZLCA 3K7DA 4JCHA 1TR2A 1FMVA 4OIOF 3ZC4A 4PJJA 2A1DD 4G0HA 3F46A 3NYJA 1TWHA 2PX3A 4Q5SF 3IEEA 4DVZA 2V26A 2Y3DA 1D0YA 2A69F 4B6IA 5B3SC 2IXMA 2H7VC 3HLZA 2G3VA 4O7GA 5D91A 2J0WA 4C7OA 3ABKC 4AX2A 3WG7C 4HFKB 2ZPAA 1TKNA 3WODF 3DM5A 1VOMA 4BJTA 3Q6NA 3NDBB 1ST6A 3K33A 4PJMA 4U5FE 2NUPA 3FVYA 3NG1A 2Z15A 2Q9AA 3FDQA 2PP4A 4XWJA 3NRHA 4JJGA 4U5BE 5KYXB 1M2VA 2R7SA 2ZXRA 3LLKA 3UGOA 4DVYP 3POVA 5DQZA 3ITFA 3AG1C 4HFFB 1OCCC 4FESA 4YT2A 3SZRA 3N0TA 5F5HA 4DBRA 3AQCA 5DVWA 4P6IC 1SMYF 2PFDA 4CS8C 2WZFA 2C04A 2W9YA 3EHNA 2CGEA 1KU2A 1M57C 3SNHA 4I1OB 3EG9B 3T6BA 3O6XA 4FWVA 4RBNA 2PX0A 4XTKA 3UNGC 3K1IC 1OCRC 4KC9A 4YN0B 2VASA 4I1MA 3KKBA 2A6EF 2EIJC 2YZSA 2P7VA 4KNWA 4JJFA 1OKKA 3EG9A 1BR4A 3Q6MA 4G7ZF 1ZYRF 4HE8D 2EIMC 3MX3A 3MLGA 4HEAJ 4RDAA 5D92A 4OINF 2D5RB 2ZXWC 3B9QA 3M1CB 4JZAA 3RFYA 4WJ0A 3LAYA 1BR2A 1N1CA 1ZHWA 2FGYA 3DAGA 3FHDA 3ZG1A 2DYSC 3GANA 3DMDA 4I3MA 2CNWD 3LLIA 3DAFA 3EZIA 2W45A 3UR3C 2R7TA 4KBLA 1Z23A 2MYSA 3SYNA 5L3VA 4J30B 4XLNF 1VK5A 3S27A 2QY9A 1MNEA 2MWQA 1D0ZA 3N24A 2R7WA 4U5EE 4BJ5A 4Q7CA 3LNRA 2WVOA 4JW1A 1ZHXA 3N2ZB 1W2WA 5DLJA 3LEVA 2R7RA 1SZIA 4OIQF 4CBEA 1LS1A 5KYWB 4JVSA 3CQZA 2OG2A 3I5QA 2NUTB 4BJ6C 4YJWA 4U5CE 2OCCC 2WVNA 2Y69C 3RH3A 4C3EA 1RJ9B 4QDLA 1ZU4A 2B0JA 2J45A 4ANJA 3HTKC 3I4UA 1NG1A 2LSEA 1Z6AA 3HJCA 2CDQA 2I8BA 1VMAA 2J9VA 3TD7A 3ZIBA 2QTVA 1MNDA 4O6MA 3EHMA 5B1AC 3W2VA 3EPVA 1JPJA 3T6JA 5KYYB 4YT4A 1OCZC 3JT1A 3AG2C 3NYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD3 A; 
#chains in the Genus database with same CATH topology
 3FAJ A;  1G4U S;  2L6F A;  3LES A;  4Q4Z F;  4JCZ A;  1CGN A;  3FXH A;  1RMV A;  1M56 C;  2XSE A;  1GM5 A;  5T1D B;  1GS9 A;  1Q0M A;  5L3Q A;  1ZHZ A;  4EKW A;  4IAO A;  4QI2 A;  3VAY A;  3K1H A;  4C3B A;  5CI8 A;  1E85 A;  3E70 C;  2A0U A;  4PAC A;  5A6B A;  4XPX A;  1LS4 A;  2F22 A;  2EPN A;  2RD9 A;  1ZW3 A;  4N6H A;  1CGM E;  2IXP A;  4XEV A;  3QVZ A;  1PD0 A;  4EBJ A;  3WHN A;  3B0V C;  4OD4 A;  4CSA A;  3C63 A;  3TOL A;  3U3F A;  3MYF A;  4OD5 A;  4IWB A;  3Q7G A;  1NSG B;  4O79 A;  4BG0 A;  3DZA A;  2R7X A;  4Z9H A;  2IXN A;  2YHS A;  3KMI A;  4BEJ A;  3K6B A;  2PF4 E;  1FFT C;  1HMO A;  2XL6 A;  5DS4 A;  5KYX A;  1E86 A;  1XWJ A;  4H4K C;  1LIH A;  1T01 A;  2YEV A;  1Q0F A;  3JYH A;  3US6 A;  4GEH A;  5JSL A;  1TWG A;  3SXM A;  3QMK A;  2LFF A;  1BR1 A;  1YYJ A;  2R05 A;  3HKK A;  4KNV A;  3ABL C;  2HMQ A;  5JP7 A;  5AC5 A;  3NYM A;  1FFH A;  2J8W A;  2ZXP A;  4A2N B;  1Q0G A;  5F28 E;  1OR2 A;  4P9F A;  2R7O A;  1LM3 B;  1YVI A;  2P6V A;  4BJ1 A;  2BL2 A;  1T6I A;  2L7A A;  2Y3H A;  1M2O A;  1B68 A;  3JZ0 A;  2AU5 A;  2L81 A;  4U5G A;  1UFB A;  3T4R A;  3G50 A;  1OW7 A;  2YVK A;  3S29 A;  3HNK A;  1QLE C;  2YLD A;  4K0D A;  2D4U A;  4NY3 A;  3ZWI A;  3TJ6 A;  4G78 A;  2R7V A;  2XM4 A;  1DOV A;  3U8P A;  4W8K A;  4PR9 A;  4D4X A;  1YJG A;  5CI9 A;  2EPM X;  1AEP A;  3ASO C;  1O5H A;  2YL3 A;  1PD1 A;  1IZM A;  1WGW A;  2LIG A;  3TQO A;  3O10 A;  3VM6 A;  3ECS A;  3VRC A;  2LK4 A;  3RQG A;  4CIH A;  3JCU Q;  3UMH A;  2J7P D;  1QZX A;  4MTG A;  2XXA B;  3OA1 A;  4MQ9 F;  4MVR A;  2KW3 C;  4J32 B;  5L0J A;  5KYN A;  3DXJ F;  5EGY A;  3RIP A;  3C18 A;  2MHR A;  2EPO A;  2P0N A;  4M63 A;  1JAF A;  1G8X A;  3L1M A;  4PK4 A;  2VCB A;  1WOL A;  4P9T A;  1IW7 F;  2CNW A;  3ZG1 A;  1V54 C;  2A0B A;  2KC3 A;  2WZL A;  3BEH A;  3GWN A;  4YT5 A;  3DD7 A;  2AWY A;  2X51 A;  1QPU A;  3JRM O;  3EFO B;  1O3U A;  1O87 A;  1TQG A;  2FFH A;  2YKZ A;  4DBQ A;  2O9X A;  1JR8 A;  3WAQ A;  2IOQ A;  1C03 A;  2RSE B;  2IM8 A;  3NKE A;  4Z9J A;  5T3T A;  1U0B B;  1EA8 A;  3EH2 A;  5HSW A;  2CW0 F;  2HSQ A;  3L34 A;  3LJB A;  1TWA A;  4H54 A;  3U9M A;  4AE4 B;  2HV7 A;  3SXZ A;  1V55 C;  2NPU A;  3O39 A;  2GWW A;  2DGJ A;  1D0X A;  5AC4 A;  3EGD B;  3IQC A;  4GQH A;  2A68 F;  4Z9I A;  4EIY A;  4KI2 A;  3EJN A;  5COF A;  5E3A A;  3J06 A;  2E87 A;  5A6A A;  4C3D A;  5EHH A;  1K05 A;  3O55 A;  4MTO A;  5E3C A;  2XS8 A;  3U2L A;  5IY5 C;  1WWP A;  3U5S A;  3A9C A;  2AVK A;  4ZLD A;  1RKE B;  1I5N A;  3AG4 C;  2M64 A;  4NCQ A;  1LI5 A;  2EIN C;  1SR2 A;  4AK9 A;  3MYI A;  2BE5 F;  4BJ5 C;  2XL4 A;  3DE9 A;  3DM9 B;  2VB6 A;  3KL4 A;  1FTS A;  3AG3 C;  3EH1 A;  1HE9 A;  3C8Z A;  3H65 A;  1HW2 A;  3C62 A;  5KYW A;  3B0U X;  2HV6 A;  5JLI A;  3DKA A;  4LER A;  3PDM P;  3KH2 A;  2NUT A;  4CS9 A;  2DI3 A;  2ZXO A;  4CX9 A;  4PJN A;  4JTA B;  4O6Y A;  2J9W A;  1RJ9 A;  3ZVR A;  1TFO B;  1VYK A;  5JUA A;  1OCO C;  3UMK A;  4ER9 A;  1ZHT A;  4LAC B;  3V7O A;  3AQB A;  4E7Z A;  2R7U A;  1R4T A;  2XM0 A;  2JPU A;  1E84 A;  5E33 A;  1A0B A;  2ICW G;  4C7O B;  4DJ9 A;  4CS9 C;  2NG1 A;  4J7T A;  1A7D A;  3S28 A;  5HV9 A;  1D1A A;  1I4Y A;  4D4N A;  4CJG A;  2IBF A;  3CZ6 A;  3G4Z A;  2W4B A;  2YL7 A;  2VC9 A;  2HFI A;  3F47 A;  3DJU B;  2J9U A;  4ONS A;  4EWC A;  1E2X A;  3K66 A;  1C17 M;  3RVY A;  4FX5 A;  1YAR O;  4U5D E;  2L9J A;  2B0H A;  4N06 A;  1H6G A;  2VCC A;  2G62 A;  1FMW A;  1G5Z A;  1HE1 A;  2G3K A;  2IYL D;  1U89 A;  3EZH A;  3H2V A;  3QVY A;  3QW0 A;  4MVM A;  4N4W A;  4YT8 A;  1FNT c;  2NUP B;  1DOW A;  1D1C A;  1RXQ A;  5TJ5 E;  1ZW2 A;  5KYY A;  1L7C A;  3W8I A;  3GOD A;  4U9D A;  5DS6 A;  3ABM C;  3UMI A;  4XEF A;  3ASN C;  2OEV A;  2XLW A;  3W8H A;  1S7Z A;  4QI0 A;  2Q9C A;  4E7S A;  1M2V B;  1OXK A;  2EIK C;  4OIR F;  2WZG A;  4CDV A;  5KYU B;  4IJJ A;  3L0I A;  4PFO A;  2LP4 A;  1Z5Z A;  4PFP A;  4F4B A;  3DI5 A;  4CJO A;  1JMW A;  2Q3T A;  4U5H A;  1NZE A;  1WTY A;  1NU9 C;  1LKX A;  3B0P A;  2JX0 A;  1BBH A;  1SYQ A;  2PBE A;  3GOR A;  3RW0 A;  4CS8 A;  2WVQ A;  3LS0 A;  4O6N A;  3NMI A;  3LS1 A;  5KYU A;  2J46 A;  3AOU A;  2IXO A;  4N6C A;  4CS7 A;  4CSA C;  4G7O F;  5DS5 A;  4K7B A;  4XLP F;  1A7E A;  1GGQ A;  1MMG A;  1PCX A;  2JD3 A;  1OQC A;  2H7B A;  1SF8 A;  3OWT A;  2J0X A;  1MMN A;  3ZDL A;  4JUR I;  1Z63 A;  5EK0 A;  1JPN A;  1LI7 A;  5T3W A;  2KGO A;  3K1I A;  4XPW A;  5COG A;  1MMA A;  4MVQ A;  3X2Q C;  4NTB A;  4LLE A;  1U6H A;  4MND A;  3FOP A;  2V3C C;  1XZQ A;  3G4X A;  4PJL A;  1MMD A;  4GYT A;  1Q0D A;  2EPL X;  3CSK A;  3TJ5 A;  3OEO A;  3UGP A;  2GDC A;  1J8Y F;  2VH3 A;  3MFN A;  3T6G B;  5L0C A;  1ZU5 A;  4IGG A;  3AGT A;  2GA0 A;  3QZC A;  4XPY A;  2KNH A;  3ZTM A;  3KPH A;  1G4W R;  2J7P A;  2PNO A;  5BQI A;  3ZSU A;  2KQ9 A;  4MVU A;  5GPG B;  2QLA A;  1C02 A;  1VTM P;  1K40 A;  1D1B A;  1FAP B;  3EQL F;  3E9V A;  5F5F A;  3NKD A;  3VYW A;  1OKK D;  2XLV A;  5E2Q A;  4IB4 A;  2XLO A;  256B A;  3T9O A;  3W2W A;  2KJG A;  1YLM A;  2A6H F;  2H7O A;  2Y3G A;  1LVK A;  2P61 A;  3U9J A;  3CAX A;  3VF0 A;  2XXA A;  4EBK A;  1NBB A;  2WB7 A;  2Y39 A;  2XLM A;  4WGY A;  3LNM B;  4E18 A;  3C8G D;  3IQ6 A;  3JRT A;  4YL1 A;  3I5P A;  3S84 A;  4EBB A;  1ZHY A;  3RF3 A;  2QE9 A;  1NU7 D;  1VLS A;  2GAQ A;  4OIP F;  2QNL A;  3AJM A;  3GM3 A;  4CIP A;  2R03 A;  4IRU A;  3MBG A;  4CDA A;  2XRH A;  3JSZ A;  3RKO F;  5K0I A;  1H9G A;  1K04 A;  2WL8 A;  1T9K A;  4XQ1 A;  3ZTZ A;  1Z3I X;  2W4M A;  2DYR C;  3DJN B;  4MTF A;  4RD9 A;  3EFO A;  3U3B A;  5FCL A;  2XS1 A;  4ULW A;  5B1B C;  4I44 A;  2GFH A;  4JKV A;  2H8A A;  2EIL C;  4LLC A;  4MW8 A;  2YL1 A;  2KK1 A;  2Y3B A;  2OJQ A;  4LDR A;  1V74 B;  2VCA A;  3JSE O;  4BPM A;  3PMR A;  3RYL A;  4AE4 A;  1QQ3 A;  1J8M F;  2OQM A;  3EGX B;  5DQT A;  1H9T A;  1YA9 A;  4X0R A;  1TWC A;  2HSB A;  3C7J A;  3SEO A;  1HY5 A;  2YRF A;  3EGD A;  4WAB A;  4G7H F;  2HJ3 A;  2XLD A;  2Q9B A;  4YWQ A;  1VYI A;  4BJ6 A;  3Q7L A;  4NTF A;  1M6T A;  3S0X A;  5A69 A;  2HZ8 A;  2YL0 A;  5BUO A;  4LDQ A;  1XZP A;  1BDJ B;  1Q0K A;  2NSF A;  2R7Q A;  3SP1 A;  3GEE A;  1RKE A;  3H2U A;  2C03 A;  2M4E A;  2YQY A;  2DB4 A;  3EGX A;  3X1O A;  3PHF 2;  4DOZ A;  1QSP A;  4ZLC A;  3K7D A;  4YL0 A;  2NSG A;  4JCH A;  2Q7R A;  2LFD A;  1TR2 A;  4E17 A;  1T5O A;  1FMV A;  1OW8 A;  3ZC4 A;  2HKV A;  4OIO F;  4PJJ A;  3AGU A;  5BQH A;  4EUK B;  1HMD A;  2A1D D;  4G0H A;  3F46 A;  3NYJ A;  1A7V A;  1F1M A;  1KNY A;  1TWH A;  2PX3 A;  3HNJ A;  1Z7Q c;  1Y4C A;  4Q5S F;  3IEE A;  2LD6 A;  2V26 A;  4DVZ A;  2Y3D A;  1D0Y A;  1R5I D;  1RCP A;  2A69 F;  4JIO A;  1OW6 A;  4XEK A;  3M79 A;  4B6I A;  4FAP B;  3ZQY A;  5B3S C;  2LQG A;  4A4A A;  3B29 A;  1YYX A;  2IXM A;  1UG7 A;  2H7V C;  3HLZ A;  2G3V A;  2HJM A;  2CCY A;  5L0F A;  4O7G A;  5D91 A;  2J0W A;  4C7O A;  3ABK C;  4MS2 A;  2L6H A;  4AX2 A;  3TUL A;  1V4A A;  3WG7 C;  2YLG A;  2R02 A;  4HFK B;  2ZPA A;  3B71 A;  1ZZP A;  4DRH B;  3IQT A;  1TKN A;  3WOD F;  3DM5 A;  4JEA A;  1VOM A;  3LEO A;  4BJT A;  4DRJ B;  1GQA A;  3Q6N A;  5A6J A;  3NDB B;  2J9B A;  3CEX A;  2P1A A;  1ST6 A;  1CGO A;  3K33 A;  1NFN A;  4PJM A;  1CPR A;  4U5F E;  4JTC B;  1YDI A;  4NQF A;  2NUP A;  3FVY A;  2EPK X;  3NG1 A;  3W4Y A;  5L0I A;  2Z15 A;  1BZ4 A;  4CDY A;  5JVE A;  2Q9A A;  2L6G A;  4JEB A;  3FDQ A;  2PP4 A;  3GWL A;  4JE9 A;  3DE8 A;  4XWJ A;  4J7Y A;  3NRH A;  1QVX A;  4JJG A;  4U5B E;  5KYX B;  1M2V A;  2R7S A;  2ZXR A;  3LLK A;  2XL8 A;  5A6B D;  4DVY P;  3UGO A;  2HS5 A;  4NC3 A;  3POV A;  1YZC A;  3ATP A;  5DQZ A;  4L6R A;  3ITF A;  3AG1 C;  4K1O A;  1EI7 A;  2OU6 A;  3U8V A;  2R9R B;  3KYI A;  4HFF B;  1OCC C;  4FES A;  2ZD9 A;  1WAS A;  2ASR A;  3GM1 A;  4NTA A;  3SZR A;  3GM2 A;  4YT2 A;  1YA7 O;  3N0T A;  2UUI A;  5BQG A;  5F5H A;  3AQC A;  4DBR A;  5DVW A;  4P6I C;  1SMY F;  2PFD A;  4JRZ A;  2WZF A;  2KSF A;  4CS8 C;  2C04 A;  2W9Y A;  3LUT B;  4MVS A;  1TFK B;  3EHN A;  2CGE A;  2YWA A;  2R25 A;  4ULV A;  1KU2 A;  2HMZ A;  1M57 C;  3DWW A;  3GEI A;  4I1O B;  3SNH A;  4MW3 A;  3EG9 B;  3T6B A;  1QKR A;  4AL1 A;  3O6X A;  4FWV A;  4RBN A;  2PX0 A;  1NFO A;  4XTK A;  2OEX A;  3UNG C;  3K1I C;  3S9O A;  1OCR C;  2CYD A;  4KC9 A;  5AGF A;  1MQV A;  4YN0 B;  1EQ1 A;  2VAS A;  1WAT A;  4I1M A;  3C8G B;  1AVO B;  3KKB A;  4WGZ A;  2A6E F;  2EIJ C;  3HNL A;  2YZS A;  3RQF A;  4EHP A;  1I4Z A;  2P7V A;  4KNW A;  4JJF A;  1OKK A;  3EG9 A;  1JRA A;  3IHU A;  3TOM A;  2YLI A;  2AWC A;  1BR4 A;  5B3I A;  3Q6M A;  4MVO A;  2OOC A;  4R32 A;  4G7Z F;  3PCV A;  4AL0 A;  3BRJ A;  1ZYR F;  4LDK A;  4HE8 D;  2EIM C;  3MX3 A;  3C8G A;  3MLG A;  4HEA J;  4U9E A;  4RDA A;  5D92 A;  1AUE A;  2D5R B;  2ZXW C;  4OIN F;  3B9Q A;  1WN0 A;  3A11 A;  3SXK A;  3M1C B;  4IAQ A;  4JZA A;  3KYJ A;  4W8P A;  3RFY A;  1OR3 A;  1OXB A;  4WJ0 A;  1H7I A;  2Q00 A;  1BR2 A;  1N1C A;  1ZHW A;  2FGY A;  3DAG A;  3FHD A;  2HUJ A;  3LAY A;  2DYS C;  3GAN A;  1L3P A;  3M4C A;  3DMD A;  4I3M A;  5COM A;  2OKU A;  2CNW D;  1ZVZ A;  1T6U A;  3DAF A;  3EZI A;  3FAP B;  3LLI A;  1E83 A;  1EKY A;  3RQE A;  3M15 A;  2W45 A;  3UR3 C;  2R7T A;  1ORY A;  4KBL A;  1T6Q A;  4E0I A;  1CPQ A;  1Z23 A;  2MYS A;  3SYN A;  5L3V A;  4J30 B;  4XLN F;  3V5X A;  2OJE D;  1VK5 A;  5JS5 A;  4MVZ A;  3S27 A;  1JOG A;  1VLT A;  2QY9 A;  3R7C A;  1MNE A;  3RVZ A;  2MWQ A;  3JYY A;  3SXY A;  4BEM J;  1D0Z A;  3N24 A;  4DXW A;  1Y6D A;  2I15 A;  2R7W A;  5L0G A;  2X0C A;  4U5E E;  4BJ5 A;  4Q7C A;  3LNR A;  2TMV P;  2AP3 A;  2WVO A;  3HNI A;  1ZHX A;  3N2Z B;  4IAR A;  4JW1 A;  3U2M A;  1W2W A;  4YL3 A;  5DLJ A;  3U0C A;  3LEV A;  2R7R A;  2QUP A;  1SZI A;  4OIQ F;  4CBE A;  1LS1 A;  1YZA A;  3QTH A;  1APC A;  3R2P A;  4JVS A;  1LE2 A;  2UUH A;  4DRI B;  3CQZ A;  5CIV A;  5KYW B;  5JT4 A;  2OG2 A;  3I5Q A;  2NUT B;  4BJ6 C;  1S05 A;  4U5C E;  4YJW A;  2OCC C;  3ZQV A;  5A6K A;  5L0H A;  1HW1 A;  1PV3 A;  2WVN A;  2Y69 C;  3V5Z A;  3RH3 A;  5JRA A;  3L8J A;  4C3E A;  2BC5 A;  2KYH A;  1RJ9 B;  4QDL A;  1ZU4 A;  2B0J A;  2J45 A;  3L8I A;  4ANJ A;  3HTK C;  3I4U A;  3NMJ A;  1NG1 A;  3FMS A;  1NLX A;  2LSE A;  1RKC A;  1FR0 A;  1ORJ A;  2XLH A;  3QW1 A;  4JC7 A;  1Z6A A;  3FOO A;  3HJC A;  2CDQ A;  2I8B A;  1VMA A;  2J9V A;  3S90 A;  3TD7 A;  3ZIB A;  4YK5 A;  1LPE A;  1ORS C;  3M4B A;  5FZT A;  2QTV A;  1A41 A;  1MND A;  4O6M A;  3EHM A;  1YAU O;  5B1A C;  3W2V A;  3NMK A;  4JTD B;  3EPV A;  3TK0 A;  3JTL O;  2LCH A;  2ETS A;  1JPJ A;  3V5Y A;  5L0D A;  3T6J A;  5KYY B;  4YT4 A;  1OCZ C;  3GEH A;  3JT1 A;  3AG2 C;  1LE4 A;  1KTM A;  4E0H A;  2Q4F A;  3IQ5 A;  4UDV A;  3IPM O;  2FAP B;  2XLE A;  3NYL A;  1VB5 A; 
#chains in the Genus database with same CATH homology
 3FAJ A;  3LES A;  1M56 C;  2XSE A;  5T1D B;  5L3Q A;  1ZHZ A;  4IAO A;  4QI2 A;  3VAY A;  3K1H A;  4C3B A;  5CI8 A;  3E70 C;  2IXP A;  4CSA A;  1PD0 A;  3B0V C;  4OD4 A;  4OD5 A;  4IWB A;  3Q7G A;  4O79 A;  4BG0 A;  3DZA A;  2R7X A;  2IXN A;  2YHS A;  3KMI A;  4BEJ A;  3K6B A;  2PF4 E;  1FFT C;  5KYX A;  5DS4 A;  4Q4Z F;  4H4K C;  3JYH A;  2YEV A;  4GEH A;  1TWG A;  3QMK A;  1BR1 A;  4KNV A;  3ABL C;  3NYM A;  1FFH A;  2ZXP A;  4A2N B;  2R7O A;  2P6V A;  4BJ1 A;  2Y3H A;  1M2O A;  2L81 A;  4U5G A;  3T4R A;  3S29 A;  1QLE C;  4K0D A;  4NY3 A;  2R7V A;  4W8K A;  5CI9 A;  3ASO C;  1O5H A;  1PD1 A;  1IZM A;  1WGW A;  3ECS A;  4CIH A;  3JCU Q;  3UMH A;  2J7P D;  1QZX A;  2XXA B;  3OA1 A;  4MQ9 F;  2KW3 C;  4J32 B;  5KYN A;  3DXJ F;  3RIP A;  4M63 A;  1G8X A;  4PK4 A;  1IW7 F;  2CNW A;  1V54 C;  2WZL A;  4YT5 A;  3DD7 A;  2X51 A;  3EFO B;  1O87 A;  2FFH A;  4DBQ A;  2O9X A;  2IOQ A;  5T3T A;  3NKE A;  3EH2 A;  5HSW A;  2CW0 F;  3LJB A;  3L34 A;  4AE4 B;  1TWA A;  2HV7 A;  1V55 C;  3O39 A;  2DGJ A;  1D0X A;  3EGD B;  4KI2 A;  2A68 F;  3EJN A;  5E3A A;  2E87 A;  5EHH A;  4C3D A;  5E3C A;  5IY5 C;  4ZLD A;  3AG4 C;  2EIN C;  4AK9 A;  2BE5 F;  4BJ5 C;  2XL4 A;  3DM9 B;  2VB6 A;  3KL4 A;  1FTS A;  3AG3 C;  3EH1 A;  3H65 A;  5KYW A;  3B0U X;  2HV6 A;  4LER A;  3KH2 A;  2NUT A;  4CS9 A;  2ZXO A;  4PJN A;  4O6Y A;  2J9W A;  1RJ9 A;  3ZVR A;  1VYK A;  1OCO C;  3UMK A;  1ZHT A;  4LAC B;  3V7O A;  3AQB A;  4E7Z A;  2R7U A;  5E33 A;  4C7O B;  4CS9 C;  2NG1 A;  1D1A A;  3S28 A;  3CZ6 A;  2W4B A;  3F47 A;  3DJU B;  2J9U A;  4EWC A;  3K66 A;  4FX5 A;  4U5D E;  2L9J A;  4N06 A;  2G62 A;  1FMW A;  2G3K A;  2IYL D;  3EZH A;  4YT8 A;  2NUP B;  1D1C A;  5KYY A;  3W8I A;  3GOD A;  5DS6 A;  3ABM C;  3UMI A;  3ASN C;  3W8H A;  1S7Z A;  4QI0 A;  2Q9C A;  4E7S A;  1M2V B;  2EIK C;  5KYU B;  4OIR F;  2WZG A;  4IJJ A;  3L0I A;  4PFO A;  1Z5Z A;  4PFP A;  4F4B A;  2Q3T A;  4U5H A;  1NZE A;  1NU9 C;  1LKX A;  3B0P A;  4CS8 A;  2WVQ A;  3LS0 A;  4O6N A;  3LS1 A;  5KYU A;  2J46 A;  2IXO A;  4CS7 A;  4CSA C;  4G7O F;  5DS5 A;  4K7B A;  4XLP F;  1MMG A;  2JD3 A;  1PCX A;  3OWT A;  2H7B A;  1SF8 A;  2J0X A;  1MMN A;  4JUR I;  1Z63 A;  1JPN A;  5T3W A;  2KGO A;  1MMA A;  3X2Q C;  4LLE A;  4MND A;  2V3C C;  4PJL A;  1MMD A;  4GYT A;  3CSK A;  3OEO A;  3UGP A;  1J8Y F;  2VH3 A;  1ZU5 A;  3QZC A;  2KNH A;  2J7P A;  3ZSU A;  2KQ9 A;  1D1B A;  3EQL F;  3E9V A;  5F5F A;  3NKD A;  3VYW A;  1OKK D;  5E2Q A;  3W2W A;  2KJG A;  2A6H F;  2H7O A;  2Y3G A;  1LVK A;  2XXA A;  2WB7 A;  2Y39 A;  3JRT A;  3I5P A;  4EBB A;  1ZHY A;  4OIP F;  1NU7 D;  4IRU A;  2XRH A;  3JSZ A;  3RKO F;  5EGY A;  2WL8 A;  5FCL A;  1Z3I X;  2W4M A;  2DYR C;  3DJN B;  4RD9 A;  3EFO A;  4ULW A;  5B1B C;  4I44 A;  2GFH A;  2EIL C;  4LLC A;  2Y3B A;  3PMR A;  3RYL A;  4AE4 A;  1J8M F;  5DQT A;  3EGX B;  4X0R A;  3SEO A;  1TWC A;  3EGD A;  4G7H F;  2Q9B A;  4YWQ A;  1VYI A;  4BJ6 A;  3Q7L A;  3S0X A;  5BUO A;  2R7Q A;  3SP1 A;  2C03 A;  2M4E A;  3EGX A;  3X1O A;  3PHF 2;  4DOZ A;  4ZLC A;  3K7D A;  4JCH A;  1TR2 A;  1FMV A;  4OIO F;  3ZC4 A;  4PJJ A;  2A1D D;  4G0H A;  3F46 A;  3NYJ A;  1TWH A;  2PX3 A;  4Q5S F;  3IEE A;  4DVZ A;  2V26 A;  2Y3D A;  1D0Y A;  2A69 F;  4B6I A;  5B3S C;  2IXM A;  2H7V C;  3HLZ A;  2G3V A;  4O7G A;  5D91 A;  2J0W A;  4C7O A;  3ABK C;  4AX2 A;  3WG7 C;  4HFK B;  2ZPA A;  1TKN A;  3WOD F;  3DM5 A;  1VOM A;  4BJT A;  3Q6N A;  3NDB B;  1ST6 A;  3K33 A;  4PJM A;  4U5F E;  2NUP A;  3FVY A;  3NG1 A;  2Z15 A;  2Q9A A;  3FDQ A;  2PP4 A;  4XWJ A;  3NRH A;  4JJG A;  4U5B E;  5KYX B;  1M2V A;  2R7S A;  2ZXR A;  3LLK A;  3UGO A;  4DVY P;  3POV A;  5DQZ A;  3ITF A;  3AG1 C;  4HFF B;  1OCC C;  4FES A;  4YT2 A;  3SZR A;  3N0T A;  5F5H A;  4DBR A;  3AQC A;  5DVW A;  4P6I C;  1SMY F;  2PFD A;  4CS8 C;  2WZF A;  2C04 A;  2W9Y A;  3EHN A;  2CGE A;  1KU2 A;  1M57 C;  3SNH A;  4I1O B;  3EG9 B;  3T6B A;  3O6X A;  4FWV A;  4RBN A;  2PX0 A;  4XTK A;  3UNG C;  3K1I C;  1OCR C;  4KC9 A;  4YN0 B;  2VAS A;  4I1M A;  3KKB A;  2A6E F;  2EIJ C;  2YZS A;  2P7V A;  4KNW A;  4JJF A;  1OKK A;  3EG9 A;  1BR4 A;  3Q6M A;  4G7Z F;  1ZYR F;  4HE8 D;  2EIM C;  3MX3 A;  3MLG A;  4HEA J;  4RDA A;  5D92 A;  4OIN F;  2D5R B;  2ZXW C;  3B9Q A;  3M1C B;  4JZA A;  3RFY A;  4WJ0 A;  3LAY A;  1BR2 A;  1N1C A;  1ZHW A;  2FGY A;  3DAG A;  3FHD A;  3ZG1 A;  2DYS C;  3GAN A;  3DMD A;  4I3M A;  2CNW D;  3LLI A;  3DAF A;  3EZI A;  2W45 A;  3UR3 C;  2R7T A;  4KBL A;  1Z23 A;  2MYS A;  3SYN A;  5L3V A;  4J30 B;  4XLN F;  1VK5 A;  3S27 A;  2QY9 A;  1MNE A;  2MWQ A;  1D0Z A;  3N24 A;  2R7W A;  4U5E E;  4BJ5 A;  4Q7C A;  3LNR A;  2WVO A;  4JW1 A;  1ZHX A;  3N2Z B;  1W2W A;  5DLJ A;  3LEV A;  2R7R A;  1SZI A;  4OIQ F;  4CBE A;  1LS1 A;  5KYW B;  4JVS A;  3CQZ A;  2OG2 A;  3I5Q A;  2NUT B;  4BJ6 C;  4YJW A;  4U5C E;  2OCC C;  2WVN A;  2Y69 C;  3RH3 A;  4C3E A;  1RJ9 B;  4QDL A;  1ZU4 A;  2B0J A;  2J45 A;  4ANJ A;  3HTK C;  3I4U A;  1NG1 A;  2LSE A;  1Z6A A;  3HJC A;  2CDQ A;  2I8B A;  1VMA A;  2J9V A;  3TD7 A;  3ZIB A;  2QTV A;  1MND A;  4O6M A;  3EHM A;  5B1A C;  3W2V A;  3EPV A;  1JPJ A;  3T6J A;  5KYY B;  4YT4 A;  1OCZ C;  3JT1 A;  3AG2 C;  3NYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...