2JD3A

Parr from plasmid pb171
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
KRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STBB PROTEIN
publication title Structural Analysis of the Parr/Parc Plasmid Partition Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 26
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1170 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2jd3A01
2JD3A
chains in the Genus database with same CATH superfamily
1L7CA 4MVSA 4IJJA 1SZIA 2EPNA 2VCAA 3RVYA 3UMHA 2ZXOA 1MNDA 3UGPA 1Y6DA 2YLDA 1TWGA 2DB4A 3SNHA 2KQ9A 2OJQA 5AC4A 1JAFA 2A69F 1LPEA 2YEVA 1TFKB 1JRAA 2IYLD 2G62A 5L0JA 1YDIA 3QTHA 3FXHA 1T6QA 4XLPF 4MVZA 3MYFA 3K66A 4AE4B 5KYYB 3EHNA 4PJLA 2PX3A 4DBQA 3DAGA 2J45A 3NYMA 1YJGA 2LIGA 3S9OA 3DE9A 4CJOA 3AOUA 4XWJA 3ZG1A 4YT2A 1GM5A 2KW3C 1ZZPA 4NC3A 4PJMA 5A6AA 3UMIA 4D4NA 2ZPAA 2Q9CA 1W2WA 4MW8A 3U8VA 5AGFA 3U5SA 1GS9A 2Y3DA 3AG2C 3B9QA 3L8IA 5E3AA 2IBFA 2M64A 5CI8A 4P9TA 4JTDB 3U9JA 2KJGA 5JLIA 1LIHA 3AJMA 3I4UA 4IARA 4EBJA 5KYUB 5KYWB 2XS1A 4BJ5C 4ANJA 4U5DE 1HY5A 1NLXA 1FTSA 3K33A 2XLEA 1WTYA 3C8GB 3DD7A 3NYJA 3NMJA 4MNDA 2O9XA 2QTVA 3ASOC 1QVXA 3ATPA 1PCXA 1ST6A 1H7IA 3S28A 1SYQA 3QW0A 4ZLDA 3IQCA 1YA9A 4MW3A 5FCLA 4YL1A 3RIPA 1D1BA 3GODA 3Q6MA 4H54A 3SZRA 1V4AA 3ZTMA 2F22A 1XZPA 2J0XA 4J30B 1YYXA 3DMDA 2P61A 4WGZA 4NY3A 2A0BA 2ZD9A 4DXWA 2BL2A 3LEOA 2W9YA 3OA1A 2HUJA 2VH3A 1Z7Qc 2QUPA 4IRUA 2LFDA 3RH3A 1JPNA 4XEKA 4FWVA 3K7DA 4KC9A 2R02A 1BR4A 5K0IA 1RKCA 1SF8A 1OXBA 2GA0A 4U9EA 3KKBA 1OCOC 3QVZA 3RVZA 3RQEA 2YHSA 3O39A 1ORSC 1AVOB 4K7BA 4Z9JA 3ZQVA 1PD0A 4YK5A 1TR2A 3Q6NA 2BE5F 4FAPB 2IXMA 5B1AC 3RQGA 3POVA 2IXNA 3K1IA 3FAPB 1CGME 2WVNA 1BR1A 3NKEA 1OR2A 3L1MA 5BUOA 2L81A 3IPMO 3M79A 3U0CA 3RQFA 1Q0MA 3EGXB 1LE4A 2H8AA 2L6FA 4MVOA 3S27A 4HFFB 4CIPA 1M56C 4EUKB 2Y39A 3Q7LA 2J8WA 3GWLA 3N2ZB 3V5XA 1B68A 3ITFA 1Z6AA 5KYUA 1C17M 4EHPA 4WABA 1FFHA 2LQGA 4R32A 1CGNA 2A6HF 1ZHWA 3GEIA 4G7ZF 1E2XA 2PBEA 3C8GA 4JVSA 3IQTA 4JRZA 2D5RB 2AP3A 4JC7A 3ZVRA 1MQVA 4D4XA 1D0XA 2WZFA 2Q3TA 3AQCA 1Z3IX 3V5YA 4KNWA 4JJFA 5TJ5E 3TD7A 1C03A 2XL8A 5T1DB 3DZAA 5L3VA 5A6BD 1WWPA 1U6HA 1E86A 3VM6A 4M63A 3ABLC 2M4EA 3B0UX 3JTLO 3J06A 4O79A 2A68F 2XLMA 4EBBA 1V54C 1T9KA 2L6GA 4BPMA 4CS9A 1VK5A 3VAYA 2HMQA 3FVYA 4OINF 4FX5A 4G0HA 3ABMC 4O6MA 4E7SA 2P1AA 4NTAA 3T6JA 5KYXB 2OQMA 5CI9A 4AX2A 2NSFA 1A7DA 1J8MF 1Q0GA 1RJ9A 1LS4A 2EPOA 3PDMP 4OIQF 4OIRF 1T5OA 3JZ0A 2HV6A 3GM3A 3W4YA 3PMRA 4IWBA 3TK0A 1E84A 2LD6A 4C7OB 3ECSA 3C8GD 4XEVA 3EH2A 3PHF2 3H2VA 2YRFA 2B0JA 4CS8A 1QQ3A 1FMWA 1KNYA 2HKVA 2Y3BA 5KYNA 3AG3C 1G4WR 5COGA 3CAXA 3EQLF 2J9VA 2VASA 3QW1A 4LDKA 4B6IA 5JRAA 2XLDA 3S90A 3VRCA 3AGUA 4N06A 4JW1A 3CQZA 3ZIBA 4GYTA 3ABKC 2Z15A 3UMKA 1VYKA 1YYJA 3TQOA 5L0CA 2DGJA 1YLMA 1IW7F 1O5HA 3EZHA 1FAPB 2Y3GA 1MMGA 1OW7A 5JSLA 2L7AA 3LLKA 4QDLA 2YWAA 1FNTc 1NG1A 2IOQA 3S0XA 1HE1A 4IGGA 5A6JA 3N24A 4IB4A 2L9JA 2H7BA 2Q7RA 2Q9AA 3TOMA 2EPKX 1RXQA 2LP4A 3SP1A 3JRMO 4DRHB 2J46A 4L6RA 1YA7O 4Q5SF 1OQCA 4U5CE 1KU2A 3U8PA 4ULVA 1OCCC 1IZMA 2PNOA 2YQYA 1N1CA 3M15A 3RW0A 4U5GA 5L0GA 1PV3A 2IXPA 5GPGB 1VYIA 5A6KA 4CIHA 1D0ZA 1ZHTA 3FMSA 4IAQA 5EHHA 2AU5A 3N0TA 2V26A 4BG0A 4DRIB 5BQIA 2R7VA 2WVOA 1VTMP 1T6UA 3M4BA 4JKVA 4MTOA 3U2LA 3JSZA 2MYSA 4OD4A 4XLNF 3T4RA 2OJED 4BJ6A 4CSAA 2XL4A 4JJGA 2R7UA 5DLJA 2BC5A 4PK4A 2A1DD 5L0FA 5BQHA 5JS5A 1WGWA 2OEXA 1NU9C 2R05A 1MNEA 2I15A 1MMDA 3L0IA 4UDVA 2VC9A 4C7OA 2HZ8A 1WASA 4WJ0A 4PJJA 2EIJC 4K0DA 4Z9HA 4AL0A 1UG7A 4DRJB 5A6BA 2Q9BA 2D4UA 4WGYA 3FOOA 2Q4FA 4XEFA 3SXKA 3EFOB 3TOLA 2L6HA 1Y4CA 5AC5A 3W2VA 2NUPA 4DJ9A 4YN0B 3H65A 1LI5A 1RKEA 2EINC 1YARO 1PD1A 3BEHA 3HNLA 3SYNA 2NUTB 4U5HA 1OR3A 3U2MA 4Z9IA 5F5FA 3LUTB 4W8KA 1F1MA 3ZWIA 4BEMJ 2G3VA 2X0CA 2EILC 3SXMA 3B0PA 1AEPA 2YZSA 2JPUA 1ZYRF 2FFHA 2RD9A 5JP7A 4CX9A 1XZQA 4JEBA 2GDCA 5F28E 1TWHA 1M57C 5IY5C 3AGTA 1RCPA 3HTKC 3KH2A 3WODF 1NSGB 1RMVA 1LM3B 3TJ5A 3MX3A 4E7ZA 1E85A 3I5QA 4CDVA 4HFKB 2XXAB 3R7CA 4N4WA 2TMVP 3F47A 4A4AA 3C8ZA 2HSQA 1A41A 1O87A 3HJCA 3CSKA 3MLGA 3O6XA 1O3UA 2YKZA 3GM2A 4YJWA 2YL7A 5B1BC 4AE4A 4CBEA 1H9TA 3TULA 1CGOA 2J7PA 2EIKC 2GWWA 4U5FE 1D1AA 1BBHA 1H9GA 4MVQA 4JEAA 3EGDB 4YT4A 4CDYA 2EIMC 1V74B 4CS7A 1ZHXA 1A7VA 1EI7A 3JYYA 4BJ5A 5L0HA 1KTMA 1K40A 2I8BA 1YZCA 5KYWA 2ZXRA 3RKOF 1EKYA 4N6CA 1OKKA 1SR2A 2CNWA 4NQFA 4E0HA 3FDQA 1D0YA 2OU6A 1K04A 3M1CB 4PFPA 3EG9B 2QE9A 2XLVA 1G4US 1FMVA 1TWAA 2VB6A 1JOGA 2IXOA 3JCUQ 4W8PA 3LNMB 4DBRA 4MVRA 4QI0A 2XLWA 4YL0A 5KYYA 2J9BA 1I5NA 1TFOB 1VMAA 2DYRC 2G3KA 1Z63A 1ZW3A 1NBBA 2LK4A 3G4XA 4G7HF 1DOWA 3TJ6A 4QI2A 3AG4C 2CW0F 1G8XA 4KBLA 2J7PD 3ZQYA 1QZXA 3LAYA 3PCVA 3LJBA 3L8JA 4E0IA 1HW2A 5D92A 4RDAA 3GORA 1EQ1A 1LE2A 1DOVA 2CYDA 4NCQA 2H7VC 4O6YA 4PJNA 4FESA 3SEOA 3T9OA 256BA 1R5ID 3S84A 2XLOA 3C62A 1OKKD 1YAUO 1Q0DA 4KI2A 2CNWD 3U3FA 1ZHZA 3JRTA 3ZSUA 4PFOA 3ZC4A 2B0HA 2X51A 5DS6A 4BJ1A 1OW8A 3R2PA 2WB7A 4BJTA 2GFHA 3OEOA 5JVEA 2WL8A 2AWYA 3ZTZA 4GEHA 3RFYA 4H4KC 5B3SC 5CIVA 3O10A 2R7OA 4XPWA 4G78A 2KNHA 3EGXA 3ASNC 5FZTA 4X0RA 2NG1A 3ZDLA 2KSFA 1YZAA 3EGDA 3HNIA 3KL4A 4LDRA 5JUAA 2OCCC 3EH1A 2R9RB 5JT4A 1MMNA 2PX0A 3IQ6A 3WHNA 4ZLCA 1VLSA 4I1MA 2Y3HA 1ORYA 4A2NB 4Q4ZF 4I3MA 2ASRA 2HJMA 3NRHA 1VLTA 5COMA 3M4CA 3QVYA 4JCHA 1LI7A 1VB5A 5EK0A 2P0NA 4XPXA 3IEEA 5A69A 2NPUA 4HE8D 2P7VA 4J7YA 1R4TA 2OG2A 1HMOA 4I44A 1ORJA 5L3QA 2P6VA 2Y69C 3W8HA 5E33A 1CPRA 2GAQA 1HE9A 4RBNA 2FGYA 5HV9A 2NSGA 1FFTC 3W8IA 4EKWA 1U0BB 1EA8A 1OCRC 3EPVA 4XPYA 3RYLA 3HLZA 4JTAB 4JCZA 5KYXA 3NMIA 1ZHYA 3U9MA 3X2QC 2W45A 1K05A 2XSEA 4C3EA 1WATA 2C03A 4JIOA 4MVMA 3F46A 3JT1A 4LLEA 3KYIA 4F4BA 4PACA 1OW6A 3LNRA 4I1OB 2QLAA 2H7OA 2XM4A 1LKXA 1S05A 4JZAA 3K1IC 1U89A 2LFFA 1Z5ZA 2HMZA 1S7ZA 4EIYA 3DAFA 4MS2A 4U5BE 1J8YF 3B71A 4JURI 2OOCA 1OCZC 2YVKA 4LACB 4LDQA 3T6GB 5HSWA 3UGOA 1L3PA 3KMIA 5E3CA 4CJGA 1NU7D 3RF3A 4C3BA 1CPQA 1NFOA 4OIPF 3K6BA 1H6GA 2KYHA 1TQGA 4E18A 1LS1A 3K1HA 3WAQA 1SMYF 4BEJA 4OIOF 3S29A 3V5ZA 2XLHA 4ONSA 4XTKA 4ULWA 3VYWA 2YLIA 1TKNA 2ICWG 3OWTA 1LVKA 1WN0A 1ZVZA 2DI3A 2W4MA 4NTFA 5D91A 4CDAA 3VF0A 4EBKA 1ZU5A 1NFNA 1G5ZA 1ZW2A 4IAOA 5DS5A 1BZ4A 4JTCB 1D1CA 3GEEA 1FR0A 2XL6A 3EJNA 3HNKA 4PR9A 1QLEC 3HNJA 4MVUA 2WVQA 3DE8A 3IQ5A 3UR3C 4C3DA 2AWCA 2W4BA 1T6IA 3LS0A 2J9UA 4DVYP 3C18A 3SXZA 3L34A 2V3CC 4CS9C 4LERA 3E9VA 1YVIA 3IHUA 2E87A 3U3BA 3DM9B 5B3IA 4U5EE 1RJ9B 2KC3A 2XRHA 1M2VB 3GWNA 3QZCA 2R7RA 2WZLA 5COFA 3EZIA 2XS8A 3LESA 4RD9A 1WOLA 3SXYA 3CZ6A 1XWJA 4JE9A 3WG7C 5DS4A 4G7OF 3X1OA 3GM1A 3KPHA 1JPJA 3NG1A 5BQGA 4ER9A 2QNLA 1I4ZA 2QY9A 2LSEA 1VOMA 2YLGA 4K1OA 5DVWA 4YWQA 4AL1A 4GQHA 4CS8C 2XM0A 5DQZA 1GGQA 3H2UA 5T3TA 3E70C 3B29A 2R25A 3DI5A 1HMDA 3W2WA 3LEVA 2HV7A 2R7TA 3MYIA 4MQ9F 1M2OA 3EFOA 2J0WA 1OXKA 3C7JA 2JD3A 4E17A 5T3WA 1QKRA 2ZXPA 2YL3A 1JMWA 3US6A 1UFBA 4P6IC 2YL0A 1QSPA 2MHRA 2R03A 1MMAA 3KYJA 3NDBB 4HEAJ 2NUTA 2R7SA 2HFIA 1M6TA 1BR2A 3DXJF 4YT8A 3MFNA 2R7XA 2HS5A 4NTBA 3AQBA 2KK1A 2LCHA 3HKKA 5E2QA 3A9CA 2VCCA 4OD5A 2EPMX 3QMKA 4U9DA 3NYLA 3AG1C 2OEVA 3DWWA 2RSEB 3I5PA 1T01A 1A0BA 4O7GA 1A7EA 1APCA 1GQAA 1TWCA 1ZU4A 2FAPB 3MBGA 2MWQA 3LLIA 4P9FA 4YL3A 4AK9A 2XXAA 3G4ZA 3DJNB 3NKDA 3FOPA 2AVKA 3O55A 1JR8A 2OKUA 4J32B 2CCYA 2UUIA 2KGOA 4DVZA 3Q7GA 4KNVA 2C04A 5F5HA 3BRJA 2EPLX 2ETSA 2CGEA 1V55C 3C63A 4CSAC 5DQTA 4BJ6C 1E83A 2IM8A 1M2VA 2JX0A 1BDJB 3CEXA 3GANA 3JSEO 4XQ1A 5L0DA 3T6BA 1I4YA 2Q00A 3A11A 1AUEA 3UNGC 2HSBA 4MTFA 3DKAA 4Q7CA 4J7TA 2A6EF 2PFDA 2CDQA 3DJUB 2HJ3A 3DM5A 3EG9A 3V7OA 2PP4A 4YT5A 1Q0FA 3NMKA 1QPUA 2R7QA 3FAJA 4MTGA 2YL1A 1Q0KA 4O6NA 1HW1A 2WZGA 2NUPB 1RKEB 1C02A 2PF4E 2J9WA 5L0IA 3GEHA 3B0VC 4N6HA 3EHMA 2ZXWC 4DOZA 4EWCA 5EGYA 3JYHA 3G50A 3LS1A 2UUHA 1Z23A 2R7WA 1NZEA 4LLCA 3FHDA 2A0UA 2DYSC 2VCBA
chains in the Genus database with same CATH topology
4IJJA 1SZIA 3UMHA 2ZXOA 1MNDA 3UGPA 1TWGA 3SNHA 2KQ9A 2A69F 2YEVA 2IYLD 2G62A 4XLPF 3K66A 4AE4B 5KYYB 3EHNA 4PJLA 2PX3A 4DBQA 3DAGA 2J45A 3NYMA 4XWJA 3ZG1A 4YT2A 2KW3C 4PJMA 3UMIA 2ZPAA 2Q9CA 1W2WA 2Y3DA 3AG2C 3B9QA 5E3AA 4CBEA 5CI8A 2KJGA 3I4UA 5KYUB 5KYWB 4BJ5C 4ANJA 4U5DE 1FTSA 3K33A 3NYJA 3DD7A 4MNDA 2O9XA 2QTVA 3ASOC 1PCXA 1ST6A 3S28A 4ZLDA 5FCLA 3RIPA 1D1BA 3GODA 3Q6MA 3SZRA 4J30B 2J0XA 3DMDA 4NY3A 2W9YA 3OA1A 2VH3A 4IRUA 3RH3A 1JPNA 4FWVA 3K7DA 4KC9A 1BR4A 1SF8A 3KKBA 1OCOC 2YHSA 3O39A 4K7BA 1PD0A 1TR2A 3Q6NA 2BE5F 2IXMA 5B1AC 3POVA 2IXNA 2WVNA 1BR1A 3NKEA 5BUOA 2L81A 3EGXB 3S27A 4HFFB 1M56C 2Y39A 3Q7LA 3N2ZB 3ITFA 1Z6AA 5KYUA 1FFHA 2A6HF 1ZHWA 4G7ZF 4JVSA 2D5RB 3ZVRA 1D0XA 2WZFA 2Q3TA 3AQCA 1Z3IX 4KNWA 4JJFA 3TD7A 5T1DB 3DZAA 5L3VA 4M63A 3ABLC 2M4EA 3B0UX 4O79A 2A68F 4EBBA 1V54C 4CS9A 1VK5A 3VAYA 3FVYA 4OINF 4FX5A 4G0HA 3ABMC 4O6MA 4E7SA 5KYXB 3T6JA 5CI9A 4AX2A 4OIQF 1J8MF 1RJ9A 4OIRF 2HV6A 3PMRA 4IWBA 4C7OB 3ECSA 3EH2A 3PHF2 4CS8A 2B0JA 5KYNA 1FMWA 2Y3BA 3AG3C 3EQLF 2J9VA 2VASA 4B6IA 4N06A 4JW1A 3CQZA 3ZIBA 4GYTA 3ABKC 2Z15A 3UMKA 1VYKA 2DGJA 1IW7F 1O5HA 3EZHA 2Y3GA 1MMGA 3LLKA 4QDLA 1NG1A 2IOQA 3S0XA 3N24A 2L9JA 2H7BA 2Q9AA 3SP1A 2J46A 4Q5SF 4U5CE 1KU2A 1OCCC 1IZMA 1N1CA 4U5GA 2IXPA 1VYIA 4CIHA 1D0ZA 1ZHTA 5EHHA 3N0TA 2V26A 4BG0A 2R7VA 2WVOA 3JSZA 2MYSA 4OD4A 4XLNF 3T4RA 4CSAA 4BJ6A 2R7UA 2XL4A 4JJGA 5DLJA 4PK4A 2A1DD 1WGWA 1NU9C 1MNEA 1MMDA 3L0IA 4C7OA 4WJ0A 4PJJA 2EIJC 4K0DA 2Q9BA 3EFOB 3W2VA 2NUPA 4YN0B 3H65A 2EINC 1PD1A 3SYNA 2NUTB 4U5HA 5F5FA 4W8KA 2G3VA 2EILC 3B0PA 2YZSA 1ZYRF 2FFHA 1TWHA 1M57C 5IY5C 3HTKC 3KH2A 3WODF 4E7ZA 3MX3A 3I5QA 4HFKB 2XXAB 3F47A 3O6XA 1O87A 3HJCA 3CSKA 3MLGA 4YJWA 4AE4A 4BJ1A 5B1BC 5KYYA 2J7PA 2EIKC 4U5FE 1D1AA 3EGDB 4YT4A 2EIMC 4CS7A 1ZHXA 4BJ5A 2I8BA 5KYWA 2ZXRA 3RKOF 1OKKA 2CNWA 3FDQA 1D0YA 3M1CB 4PFPA 3EG9B 1FMVA 1TWAA 2VB6A 2IXOA 3JCUQ 4DBRA 4QI0A 1VMAA 2DYRC 2G3KA 1Z63A 4G7HF 4QI2A 3AG4C 2CW0F 1G8XA 4KBLA 2J7PD 1QZXA 3LAYA 3LJBA 5D92A 4RDAA 4O6YA 2H7VC 4PJNA 3SEOA 4FESA 1OKKD 4KI2A 2CNWD 1ZHZA 3JRTA 3ZSUA 4PFOA 3ZC4A 2X51A 5DS6A 2WB7A 4BJTA 2GFHA 3OEOA 2WL8A 4GEHA 3RFYA 4H4KC 5B3SC 2R7OA 2KNHA 3EGXA 3ASNC 4X0RA 2NG1A 3EGDA 3KL4A 2OCCC 3EH1A 1MMNA 2PX0A 4ZLCA 4I1MA 2Y3HA 4A2NB 4Q4ZF 4I3MA 3NRHA 4JCHA 3IEEA 4HE8D 2P7VA 2OG2A 4I44A 5L3QA 2P6VA 2Y69C 3W8HA 5E33A 4RBNA 2FGYA 1FFTC 3W8IA 1OCRC 3EPVA 3RYLA 3HLZA 5KYXA 1ZHYA 3X2QC 2W45A 2XSEA 4C3EA 2C03A 3F46A 3JT1A 4LLEA 4F4BA 3LNRA 4I1OB 2H7OA 1LKXA 4JZAA 3K1IC 1Z5ZA 1S7ZA 3DAFA 4U5BE 1J8YF 4JURI 1OCZC 4LACB 3UGOA 5HSWA 3KMIA 5E3CA 1NU7D 4C3BA 4OIPF 3K6BA 1LS1A 3K1HA 4OIOF 1SMYF 4BEJA 3S29A 4XTKA 4ULWA 3VYWA 1TKNA 3OWTA 1LVKA 2W4MA 5D91A 1ZU5A 4IAOA 5DS5A 1D1CA 3EJNA 1QLEC 2WVQA 3UR3C 4C3DA 2W4BA 3LS0A 2J9UA 4DVYP 3L34A 2V3CC 4CS9C 4LERA 3E9VA 2E87A 3DM9B 4U5EE 1RJ9B 2R7RA 2XRHA 1M2VB 3QZCA 2WZLA 3EZIA 3LESA 4RD9A 3WG7C 5DS4A 3CZ6A 4G7OF 3X1OA 3NG1A 1JPJA 2QY9A 2LSEA 1VOMA 5DVWA 4YWQA 4CS8C 5T3TA 3E70C 3W2WA 2R7TA 3LEVA 2HV7A 4MQ9F 1M2OA 3EFOA 2J0WA 2JD3A 5T3WA 2ZXPA 4P6IC 2R7SA 1MMAA 3NDBB 4HEAJ 2NUTA 1BR2A 3DXJF 4YT8A 2R7XA 3AQBA 5E2QA 4OD5A 3QMKA 3NYLA 3AG1C 3I5PA 4O7GA 1ZU4A 5DQZA 1TWCA 4AK9A 2XXAA 2MWQA 3LLIA 4J32B 3DJNB 3NKDA 2KGOA 4DVZA 3Q7GA 4KNVA 2C04A 5F5HA 2CGEA 1V55C 4CSAC 5DQTA 4BJ6C 1M2VA 3GANA 3T6BA 3UNGC 4Q7CA 2A6EF 2PFDA 2CDQA 3DJUB 3DM5A 3EG9A 3V7OA 2PP4A 4YT5A 2R7QA 3FAJA 4O6NA 2WZGA 2NUPB 2PF4E 2J9WA 3B0VC 3EHMA 2ZXWC 4DOZA 4EWCA 5EGYA 3JYHA 2R7WA 3LS1A 1Z23A 1NZEA 4LLCA 3FHDA 2DYSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD3 A; 
#chains in the Genus database with same CATH topology
 1L7C A;  4MVS A;  4IJJ A;  1SZI A;  2EPN A;  2VCA A;  3RVY A;  3UMH A;  2ZXO A;  1MND A;  3UGP A;  1Y6D A;  2YLD A;  1TWG A;  2DB4 A;  3SNH A;  2KQ9 A;  2OJQ A;  5AC4 A;  1JAF A;  2A69 F;  1LPE A;  2YEV A;  1TFK B;  1JRA A;  2IYL D;  2G62 A;  5L0J A;  1YDI A;  3QTH A;  3FXH A;  1T6Q A;  4XLP F;  4MVZ A;  3MYF A;  3K66 A;  4AE4 B;  5KYY B;  3EHN A;  4PJL A;  2PX3 A;  4DBQ A;  3DAG A;  2J45 A;  3NYM A;  1YJG A;  2LIG A;  3S9O A;  3DE9 A;  4CJO A;  3AOU A;  4XWJ A;  3ZG1 A;  4YT2 A;  1GM5 A;  2KW3 C;  1ZZP A;  4NC3 A;  4PJM A;  5A6A A;  3UMI A;  4D4N A;  2ZPA A;  2Q9C A;  1W2W A;  4MW8 A;  3U8V A;  5AGF A;  3U5S A;  1GS9 A;  2Y3D A;  3AG2 C;  3B9Q A;  3L8I A;  5E3A A;  2IBF A;  2M64 A;  5CI8 A;  4P9T A;  4JTD B;  3U9J A;  2KJG A;  5JLI A;  1LIH A;  3AJM A;  3I4U A;  4IAR A;  4EBJ A;  5KYU B;  5KYW B;  2XS1 A;  4BJ5 C;  4ANJ A;  4U5D E;  1HY5 A;  1NLX A;  1FTS A;  3K33 A;  2XLE A;  1WTY A;  3C8G B;  3DD7 A;  3NYJ A;  3NMJ A;  4MND A;  2O9X A;  2QTV A;  3ASO C;  1QVX A;  3ATP A;  1PCX A;  1ST6 A;  1H7I A;  3S28 A;  1SYQ A;  3QW0 A;  4ZLD A;  3IQC A;  1YA9 A;  4MW3 A;  5FCL A;  4YL1 A;  3RIP A;  1D1B A;  3GOD A;  3Q6M A;  4H54 A;  3SZR A;  1V4A A;  3ZTM A;  2F22 A;  1XZP A;  2J0X A;  4J30 B;  1YYX A;  3DMD A;  2P61 A;  4WGZ A;  4NY3 A;  2A0B A;  2ZD9 A;  4DXW A;  2BL2 A;  3LEO A;  2W9Y A;  3OA1 A;  2HUJ A;  2VH3 A;  1Z7Q c;  2QUP A;  4IRU A;  2LFD A;  3RH3 A;  1JPN A;  4XEK A;  4FWV A;  3K7D A;  4KC9 A;  2R02 A;  1BR4 A;  5K0I A;  1RKC A;  1SF8 A;  1OXB A;  2GA0 A;  4U9E A;  3KKB A;  1OCO C;  3QVZ A;  3RVZ A;  3RQE A;  2YHS A;  3O39 A;  1ORS C;  1AVO B;  4K7B A;  4Z9J A;  3ZQV A;  1PD0 A;  4YK5 A;  1TR2 A;  3Q6N A;  2BE5 F;  4FAP B;  2IXM A;  5B1A C;  3RQG A;  3POV A;  2IXN A;  3K1I A;  3FAP B;  1CGM E;  2WVN A;  1BR1 A;  3NKE A;  1OR2 A;  3L1M A;  5BUO A;  2L81 A;  3IPM O;  3M79 A;  3U0C A;  3RQF A;  1Q0M A;  3EGX B;  1LE4 A;  2H8A A;  2L6F A;  4MVO A;  3S27 A;  4HFF B;  4CIP A;  1M56 C;  4EUK B;  2Y39 A;  3Q7L A;  2J8W A;  3GWL A;  3N2Z B;  3V5X A;  1B68 A;  3ITF A;  1Z6A A;  5KYU A;  1C17 M;  4EHP A;  4WAB A;  1FFH A;  2LQG A;  4R32 A;  1CGN A;  2A6H F;  1ZHW A;  3GEI A;  4G7Z F;  1E2X A;  2PBE A;  3C8G A;  4JVS A;  3IQT A;  4JRZ A;  2D5R B;  2AP3 A;  4JC7 A;  3ZVR A;  1MQV A;  4D4X A;  1D0X A;  2WZF A;  2Q3T A;  3AQC A;  1Z3I X;  3V5Y A;  4KNW A;  4JJF A;  5TJ5 E;  3TD7 A;  1C03 A;  2XL8 A;  5T1D B;  3DZA A;  5L3V A;  5A6B D;  1WWP A;  1U6H A;  1E86 A;  3VM6 A;  4M63 A;  3ABL C;  2M4E A;  3B0U X;  3JTL O;  3J06 A;  4O79 A;  2A68 F;  2XLM A;  4EBB A;  1V54 C;  1T9K A;  2L6G A;  4BPM A;  4CS9 A;  1VK5 A;  3VAY A;  2HMQ A;  3FVY A;  4OIN F;  4FX5 A;  4G0H A;  3ABM C;  4O6M A;  4E7S A;  2P1A A;  4NTA A;  3T6J A;  5KYX B;  2OQM A;  5CI9 A;  4AX2 A;  2NSF A;  1A7D A;  1J8M F;  1Q0G A;  1RJ9 A;  1LS4 A;  2EPO A;  3PDM P;  4OIQ F;  4OIR F;  1T5O A;  3JZ0 A;  2HV6 A;  3GM3 A;  3W4Y A;  3PMR A;  4IWB A;  3TK0 A;  1E84 A;  2LD6 A;  4C7O B;  3ECS A;  3C8G D;  4XEV A;  3EH2 A;  3PHF 2;  3H2V A;  2YRF A;  2B0J A;  4CS8 A;  1QQ3 A;  1FMW A;  1KNY A;  2HKV A;  2Y3B A;  5KYN A;  3AG3 C;  1G4W R;  5COG A;  3CAX A;  3EQL F;  2J9V A;  2VAS A;  3QW1 A;  4LDK A;  4B6I A;  5JRA A;  2XLD A;  3S90 A;  3VRC A;  3AGU A;  4N06 A;  4JW1 A;  3CQZ A;  3ZIB A;  4GYT A;  3ABK C;  2Z15 A;  3UMK A;  1VYK A;  1YYJ A;  3TQO A;  5L0C A;  2DGJ A;  1YLM A;  1IW7 F;  1O5H A;  3EZH A;  1FAP B;  2Y3G A;  1MMG A;  1OW7 A;  5JSL A;  2L7A A;  3LLK A;  4QDL A;  2YWA A;  1FNT c;  1NG1 A;  2IOQ A;  3S0X A;  1HE1 A;  4IGG A;  5A6J A;  3N24 A;  4IB4 A;  2L9J A;  2H7B A;  2Q7R A;  2Q9A A;  3TOM A;  2EPK X;  1RXQ A;  2LP4 A;  3SP1 A;  3JRM O;  4DRH B;  2J46 A;  4L6R A;  1YA7 O;  4Q5S F;  1OQC A;  4U5C E;  1KU2 A;  3U8P A;  4ULV A;  1OCC C;  1IZM A;  2PNO A;  2YQY A;  1N1C A;  3M15 A;  3RW0 A;  4U5G A;  5L0G A;  1PV3 A;  2IXP A;  5GPG B;  1VYI A;  5A6K A;  4CIH A;  1D0Z A;  1ZHT A;  3FMS A;  4IAQ A;  5EHH A;  2AU5 A;  3N0T A;  2V26 A;  4BG0 A;  4DRI B;  5BQI A;  2R7V A;  2WVO A;  1VTM P;  1T6U A;  3M4B A;  4JKV A;  4MTO A;  3U2L A;  3JSZ A;  2MYS A;  4OD4 A;  4XLN F;  3T4R A;  2OJE D;  4BJ6 A;  4CSA A;  2XL4 A;  4JJG A;  2R7U A;  5DLJ A;  2BC5 A;  4PK4 A;  2A1D D;  5L0F A;  5BQH A;  5JS5 A;  1WGW A;  2OEX A;  1NU9 C;  2R05 A;  1MNE A;  2I15 A;  1MMD A;  3L0I A;  4UDV A;  2VC9 A;  4C7O A;  2HZ8 A;  1WAS A;  4WJ0 A;  4PJJ A;  2EIJ C;  4K0D A;  4Z9H A;  4AL0 A;  1UG7 A;  4DRJ B;  5A6B A;  2Q9B A;  2D4U A;  4WGY A;  3FOO A;  2Q4F A;  4XEF A;  3SXK A;  3EFO B;  3TOL A;  2L6H A;  1Y4C A;  5AC5 A;  3W2V A;  2NUP A;  4DJ9 A;  4YN0 B;  3H65 A;  1LI5 A;  1RKE A;  2EIN C;  1YAR O;  1PD1 A;  3BEH A;  3HNL A;  3SYN A;  2NUT B;  4U5H A;  1OR3 A;  3U2M A;  4Z9I A;  5F5F A;  3LUT B;  4W8K A;  1F1M A;  3ZWI A;  4BEM J;  2G3V A;  2X0C A;  2EIL C;  3SXM A;  3B0P A;  1AEP A;  2YZS A;  2JPU A;  1ZYR F;  2FFH A;  2RD9 A;  5JP7 A;  4CX9 A;  1XZQ A;  4JEB A;  2GDC A;  5F28 E;  1TWH A;  1M57 C;  5IY5 C;  3AGT A;  1RCP A;  3HTK C;  3KH2 A;  3WOD F;  1NSG B;  1RMV A;  1LM3 B;  3TJ5 A;  3MX3 A;  4E7Z A;  1E85 A;  3I5Q A;  4CDV A;  4HFK B;  2XXA B;  3R7C A;  4N4W A;  2TMV P;  3F47 A;  4A4A A;  3C8Z A;  2HSQ A;  1A41 A;  1O87 A;  3HJC A;  3CSK A;  3MLG A;  3O6X A;  1O3U A;  2YKZ A;  3GM2 A;  4YJW A;  2YL7 A;  5B1B C;  4AE4 A;  4CBE A;  1H9T A;  3TUL A;  1CGO A;  2J7P A;  2EIK C;  2GWW A;  4U5F E;  1D1A A;  1BBH A;  1H9G A;  4MVQ A;  4JEA A;  3EGD B;  4YT4 A;  4CDY A;  2EIM C;  1V74 B;  4CS7 A;  1ZHX A;  1A7V A;  1EI7 A;  3JYY A;  4BJ5 A;  5L0H A;  1KTM A;  1K40 A;  2I8B A;  1YZC A;  5KYW A;  2ZXR A;  3RKO F;  1EKY A;  4N6C A;  1OKK A;  1SR2 A;  2CNW A;  4NQF A;  4E0H A;  3FDQ A;  1D0Y A;  2OU6 A;  1K04 A;  3M1C B;  4PFP A;  3EG9 B;  2QE9 A;  2XLV A;  1G4U S;  1FMV A;  1TWA A;  2VB6 A;  1JOG A;  2IXO A;  3JCU Q;  4W8P A;  3LNM B;  4DBR A;  4MVR A;  4QI0 A;  2XLW A;  4YL0 A;  5KYY A;  2J9B A;  1I5N A;  1TFO B;  1VMA A;  2DYR C;  2G3K A;  1Z63 A;  1ZW3 A;  1NBB A;  2LK4 A;  3G4X A;  4G7H F;  1DOW A;  3TJ6 A;  4QI2 A;  3AG4 C;  2CW0 F;  1G8X A;  4KBL A;  2J7P D;  3ZQY A;  1QZX A;  3LAY A;  3PCV A;  3LJB A;  3L8J A;  4E0I A;  1HW2 A;  5D92 A;  4RDA A;  3GOR A;  1EQ1 A;  1LE2 A;  1DOV A;  2CYD A;  4NCQ A;  2H7V C;  4O6Y A;  4PJN A;  4FES A;  3SEO A;  3T9O A;  256B A;  1R5I D;  3S84 A;  2XLO A;  3C62 A;  1OKK D;  1YAU O;  1Q0D A;  4KI2 A;  2CNW D;  3U3F A;  1ZHZ A;  3JRT A;  3ZSU A;  4PFO A;  3ZC4 A;  2B0H A;  2X51 A;  5DS6 A;  4BJ1 A;  1OW8 A;  3R2P A;  2WB7 A;  4BJT A;  2GFH A;  3OEO A;  5JVE A;  2WL8 A;  2AWY A;  3ZTZ A;  4GEH A;  3RFY A;  4H4K C;  5B3S C;  5CIV A;  3O10 A;  2R7O A;  4XPW A;  4G78 A;  2KNH A;  3EGX A;  3ASN C;  5FZT A;  4X0R A;  2NG1 A;  3ZDL A;  2KSF A;  1YZA A;  3EGD A;  3HNI A;  3KL4 A;  4LDR A;  5JUA A;  2OCC C;  3EH1 A;  2R9R B;  5JT4 A;  1MMN A;  2PX0 A;  3IQ6 A;  3WHN A;  4ZLC A;  1VLS A;  4I1M A;  2Y3H A;  1ORY A;  4A2N B;  4Q4Z F;  4I3M A;  2ASR A;  2HJM A;  3NRH A;  1VLT A;  5COM A;  3M4C A;  3QVY A;  4JCH A;  1LI7 A;  1VB5 A;  5EK0 A;  2P0N A;  4XPX A;  3IEE A;  5A69 A;  2NPU A;  4HE8 D;  2P7V A;  4J7Y A;  1R4T A;  2OG2 A;  1HMO A;  4I44 A;  1ORJ A;  5L3Q A;  2P6V A;  2Y69 C;  3W8H A;  5E33 A;  1CPR A;  2GAQ A;  1HE9 A;  4RBN A;  2FGY A;  5HV9 A;  2NSG A;  1FFT C;  3W8I A;  4EKW A;  1U0B B;  1EA8 A;  1OCR C;  3EPV A;  4XPY A;  3RYL A;  3HLZ A;  4JTA B;  4JCZ A;  5KYX A;  3NMI A;  1ZHY A;  3U9M A;  3X2Q C;  2W45 A;  1K05 A;  2XSE A;  4C3E A;  1WAT A;  2C03 A;  4JIO A;  4MVM A;  3F46 A;  3JT1 A;  4LLE A;  3KYI A;  4F4B A;  4PAC A;  1OW6 A;  3LNR A;  4I1O B;  2QLA A;  2H7O A;  2XM4 A;  1LKX A;  1S05 A;  4JZA A;  3K1I C;  1U89 A;  2LFF A;  1Z5Z A;  2HMZ A;  1S7Z A;  4EIY A;  3DAF A;  4MS2 A;  4U5B E;  1J8Y F;  3B71 A;  4JUR I;  2OOC A;  1OCZ C;  2YVK A;  4LAC B;  4LDQ A;  3T6G B;  5HSW A;  3UGO A;  1L3P A;  3KMI A;  5E3C A;  4CJG A;  1NU7 D;  3RF3 A;  4C3B A;  1CPQ A;  1NFO A;  4OIP F;  3K6B A;  1H6G A;  2KYH A;  1TQG A;  4E18 A;  1LS1 A;  3K1H A;  3WAQ A;  1SMY F;  4BEJ A;  4OIO F;  3S29 A;  3V5Z A;  2XLH A;  4ONS A;  4XTK A;  4ULW A;  3VYW A;  2YLI A;  1TKN A;  2ICW G;  3OWT A;  1LVK A;  1WN0 A;  1ZVZ A;  2DI3 A;  2W4M A;  4NTF A;  5D91 A;  4CDA A;  3VF0 A;  4EBK A;  1ZU5 A;  1NFN A;  1G5Z A;  1ZW2 A;  4IAO A;  5DS5 A;  1BZ4 A;  4JTC B;  1D1C A;  3GEE A;  1FR0 A;  2XL6 A;  3EJN A;  3HNK A;  4PR9 A;  1QLE C;  3HNJ A;  4MVU A;  2WVQ A;  3DE8 A;  3IQ5 A;  3UR3 C;  4C3D A;  2AWC A;  2W4B A;  1T6I A;  3LS0 A;  2J9U A;  4DVY P;  3C18 A;  3SXZ A;  3L34 A;  2V3C C;  4CS9 C;  4LER A;  3E9V A;  1YVI A;  3IHU A;  2E87 A;  3U3B A;  3DM9 B;  5B3I A;  4U5E E;  1RJ9 B;  2KC3 A;  2XRH A;  1M2V B;  3GWN A;  3QZC A;  2R7R A;  2WZL A;  5COF A;  3EZI A;  2XS8 A;  3LES A;  4RD9 A;  1WOL A;  3SXY A;  3CZ6 A;  1XWJ A;  4JE9 A;  3WG7 C;  5DS4 A;  4G7O F;  3X1O A;  3GM1 A;  3KPH A;  1JPJ A;  3NG1 A;  5BQG A;  4ER9 A;  2QNL A;  1I4Z A;  2QY9 A;  2LSE A;  1VOM A;  2YLG A;  4K1O A;  5DVW A;  4YWQ A;  4AL1 A;  4GQH A;  4CS8 C;  2XM0 A;  5DQZ A;  1GGQ A;  3H2U A;  5T3T A;  3E70 C;  3B29 A;  2R25 A;  3DI5 A;  1HMD A;  3W2W A;  3LEV A;  2HV7 A;  2R7T A;  3MYI A;  4MQ9 F;  1M2O A;  3EFO A;  2J0W A;  1OXK A;  3C7J A;  2JD3 A;  4E17 A;  5T3W A;  1QKR A;  2ZXP A;  2YL3 A;  1JMW A;  3US6 A;  1UFB A;  4P6I C;  2YL0 A;  1QSP A;  2MHR A;  2R03 A;  1MMA A;  3KYJ A;  3NDB B;  4HEA J;  2NUT A;  2R7S A;  2HFI A;  1M6T A;  1BR2 A;  3DXJ F;  4YT8 A;  3MFN A;  2R7X A;  2HS5 A;  4NTB A;  3AQB A;  2KK1 A;  2LCH A;  3HKK A;  5E2Q A;  3A9C A;  2VCC A;  4OD5 A;  2EPM X;  3QMK A;  4U9D A;  3NYL A;  3AG1 C;  2OEV A;  3DWW A;  2RSE B;  3I5P A;  1T01 A;  1A0B A;  4O7G A;  1A7E A;  1APC A;  1GQA A;  1TWC A;  1ZU4 A;  2FAP B;  3MBG A;  2MWQ A;  3LLI A;  4P9F A;  4YL3 A;  4AK9 A;  2XXA A;  3G4Z A;  3DJN B;  3NKD A;  3FOP A;  2AVK A;  3O55 A;  1JR8 A;  2OKU A;  4J32 B;  2CCY A;  2UUI A;  2KGO A;  4DVZ A;  3Q7G A;  4KNV A;  2C04 A;  5F5H A;  3BRJ A;  2EPL X;  2ETS A;  2CGE A;  1V55 C;  3C63 A;  4CSA C;  5DQT A;  4BJ6 C;  1E83 A;  2IM8 A;  1M2V A;  2JX0 A;  1BDJ B;  3CEX A;  3GAN A;  3JSE O;  4XQ1 A;  5L0D A;  3T6B A;  1I4Y A;  2Q00 A;  3A11 A;  1AUE A;  3UNG C;  2HSB A;  4MTF A;  3DKA A;  4Q7C A;  4J7T A;  2A6E F;  2PFD A;  2CDQ A;  3DJU B;  2HJ3 A;  3DM5 A;  3EG9 A;  3V7O A;  2PP4 A;  4YT5 A;  1Q0F A;  3NMK A;  1QPU A;  2R7Q A;  3FAJ A;  4MTG A;  2YL1 A;  1Q0K A;  4O6N A;  1HW1 A;  2WZG A;  2NUP B;  1RKE B;  1C02 A;  2PF4 E;  2J9W A;  5L0I A;  3GEH A;  3B0V C;  4N6H A;  3EHM A;  2ZXW C;  4DOZ A;  4EWC A;  5EGY A;  3JYH A;  3G50 A;  3LS1 A;  2UUH A;  1Z23 A;  2R7W A;  1NZE A;  4LLC A;  3FHD A;  2A0U A;  2DYS C;  2VCB A; 
#chains in the Genus database with same CATH homology
 4IJJ A;  1SZI A;  3UMH A;  2ZXO A;  1MND A;  3UGP A;  1TWG A;  3SNH A;  2KQ9 A;  2A69 F;  2YEV A;  2IYL D;  2G62 A;  4XLP F;  3K66 A;  4AE4 B;  5KYY B;  3EHN A;  4PJL A;  2PX3 A;  4DBQ A;  3DAG A;  2J45 A;  3NYM A;  4XWJ A;  3ZG1 A;  4YT2 A;  2KW3 C;  4PJM A;  3UMI A;  2ZPA A;  2Q9C A;  1W2W A;  2Y3D A;  3AG2 C;  3B9Q A;  5E3A A;  4CBE A;  5CI8 A;  2KJG A;  3I4U A;  5KYU B;  5KYW B;  4BJ5 C;  4ANJ A;  4U5D E;  1FTS A;  3K33 A;  3NYJ A;  3DD7 A;  4MND A;  2O9X A;  2QTV A;  3ASO C;  1PCX A;  1ST6 A;  3S28 A;  4ZLD A;  5FCL A;  3RIP A;  1D1B A;  3GOD A;  3Q6M A;  3SZR A;  4J30 B;  2J0X A;  3DMD A;  4NY3 A;  2W9Y A;  3OA1 A;  2VH3 A;  4IRU A;  3RH3 A;  1JPN A;  4FWV A;  3K7D A;  4KC9 A;  1BR4 A;  1SF8 A;  3KKB A;  1OCO C;  2YHS A;  3O39 A;  4K7B A;  1PD0 A;  1TR2 A;  3Q6N A;  2BE5 F;  2IXM A;  5B1A C;  3POV A;  2IXN A;  2WVN A;  1BR1 A;  3NKE A;  5BUO A;  2L81 A;  3EGX B;  3S27 A;  4HFF B;  1M56 C;  2Y39 A;  3Q7L A;  3N2Z B;  3ITF A;  1Z6A A;  5KYU A;  1FFH A;  2A6H F;  1ZHW A;  4G7Z F;  4JVS A;  2D5R B;  3ZVR A;  1D0X A;  2WZF A;  2Q3T A;  3AQC A;  1Z3I X;  4KNW A;  4JJF A;  3TD7 A;  5T1D B;  3DZA A;  5L3V A;  4M63 A;  3ABL C;  2M4E A;  3B0U X;  4O79 A;  2A68 F;  4EBB A;  1V54 C;  4CS9 A;  1VK5 A;  3VAY A;  3FVY A;  4OIN F;  4FX5 A;  4G0H A;  3ABM C;  4O6M A;  4E7S A;  5KYX B;  3T6J A;  5CI9 A;  4AX2 A;  4OIQ F;  1J8M F;  1RJ9 A;  4OIR F;  2HV6 A;  3PMR A;  4IWB A;  4C7O B;  3ECS A;  3EH2 A;  3PHF 2;  4CS8 A;  2B0J A;  5KYN A;  1FMW A;  2Y3B A;  3AG3 C;  3EQL F;  2J9V A;  2VAS A;  4B6I A;  4N06 A;  4JW1 A;  3CQZ A;  3ZIB A;  4GYT A;  3ABK C;  2Z15 A;  3UMK A;  1VYK A;  2DGJ A;  1IW7 F;  1O5H A;  3EZH A;  2Y3G A;  1MMG A;  3LLK A;  4QDL A;  1NG1 A;  2IOQ A;  3S0X A;  3N24 A;  2L9J A;  2H7B A;  2Q9A A;  3SP1 A;  2J46 A;  4Q5S F;  4U5C E;  1KU2 A;  1OCC C;  1IZM A;  1N1C A;  4U5G A;  2IXP A;  1VYI A;  4CIH A;  1D0Z A;  1ZHT A;  5EHH A;  3N0T A;  2V26 A;  4BG0 A;  2R7V A;  2WVO A;  3JSZ A;  2MYS A;  4OD4 A;  4XLN F;  3T4R A;  4CSA A;  4BJ6 A;  2R7U A;  2XL4 A;  4JJG A;  5DLJ A;  4PK4 A;  2A1D D;  1WGW A;  1NU9 C;  1MNE A;  1MMD A;  3L0I A;  4C7O A;  4WJ0 A;  4PJJ A;  2EIJ C;  4K0D A;  2Q9B A;  3EFO B;  3W2V A;  2NUP A;  4YN0 B;  3H65 A;  2EIN C;  1PD1 A;  3SYN A;  2NUT B;  4U5H A;  5F5F A;  4W8K A;  2G3V A;  2EIL C;  3B0P A;  2YZS A;  1ZYR F;  2FFH A;  1TWH A;  1M57 C;  5IY5 C;  3HTK C;  3KH2 A;  3WOD F;  4E7Z A;  3MX3 A;  3I5Q A;  4HFK B;  2XXA B;  3F47 A;  3O6X A;  1O87 A;  3HJC A;  3CSK A;  3MLG A;  4YJW A;  4AE4 A;  4BJ1 A;  5B1B C;  5KYY A;  2J7P A;  2EIK C;  4U5F E;  1D1A A;  3EGD B;  4YT4 A;  2EIM C;  4CS7 A;  1ZHX A;  4BJ5 A;  2I8B A;  5KYW A;  2ZXR A;  3RKO F;  1OKK A;  2CNW A;  3FDQ A;  1D0Y A;  3M1C B;  4PFP A;  3EG9 B;  1FMV A;  1TWA A;  2VB6 A;  2IXO A;  3JCU Q;  4DBR A;  4QI0 A;  1VMA A;  2DYR C;  2G3K A;  1Z63 A;  4G7H F;  4QI2 A;  3AG4 C;  2CW0 F;  1G8X A;  4KBL A;  2J7P D;  1QZX A;  3LAY A;  3LJB A;  5D92 A;  4RDA A;  4O6Y A;  2H7V C;  4PJN A;  3SEO A;  4FES A;  1OKK D;  4KI2 A;  2CNW D;  1ZHZ A;  3JRT A;  3ZSU A;  4PFO A;  3ZC4 A;  2X51 A;  5DS6 A;  2WB7 A;  4BJT A;  2GFH A;  3OEO A;  2WL8 A;  4GEH A;  3RFY A;  4H4K C;  5B3S C;  2R7O A;  2KNH A;  3EGX A;  3ASN C;  4X0R A;  2NG1 A;  3EGD A;  3KL4 A;  2OCC C;  3EH1 A;  1MMN A;  2PX0 A;  4ZLC A;  4I1M A;  2Y3H A;  4A2N B;  4Q4Z F;  4I3M A;  3NRH A;  4JCH A;  3IEE A;  4HE8 D;  2P7V A;  2OG2 A;  4I44 A;  5L3Q A;  2P6V A;  2Y69 C;  3W8H A;  5E33 A;  4RBN A;  2FGY A;  1FFT C;  3W8I A;  1OCR C;  3EPV A;  3RYL A;  3HLZ A;  5KYX A;  1ZHY A;  3X2Q C;  2W45 A;  2XSE A;  4C3E A;  2C03 A;  3F46 A;  3JT1 A;  4LLE A;  4F4B A;  3LNR A;  4I1O B;  2H7O A;  1LKX A;  4JZA A;  3K1I C;  1Z5Z A;  1S7Z A;  3DAF A;  4U5B E;  1J8Y F;  4JUR I;  1OCZ C;  4LAC B;  3UGO A;  5HSW A;  3KMI A;  5E3C A;  1NU7 D;  4C3B A;  4OIP F;  3K6B A;  1LS1 A;  3K1H A;  4OIO F;  1SMY F;  4BEJ A;  3S29 A;  4XTK A;  4ULW A;  3VYW A;  1TKN A;  3OWT A;  1LVK A;  2W4M A;  5D91 A;  1ZU5 A;  4IAO A;  5DS5 A;  1D1C A;  3EJN A;  1QLE C;  2WVQ A;  3UR3 C;  4C3D A;  2W4B A;  3LS0 A;  2J9U A;  4DVY P;  3L34 A;  2V3C C;  4CS9 C;  4LER A;  3E9V A;  2E87 A;  3DM9 B;  4U5E E;  1RJ9 B;  2R7R A;  2XRH A;  1M2V B;  3QZC A;  2WZL A;  3EZI A;  3LES A;  4RD9 A;  3WG7 C;  5DS4 A;  3CZ6 A;  4G7O F;  3X1O A;  3NG1 A;  1JPJ A;  2QY9 A;  2LSE A;  1VOM A;  5DVW A;  4YWQ A;  4CS8 C;  5T3T A;  3E70 C;  3W2W A;  2R7T A;  3LEV A;  2HV7 A;  4MQ9 F;  1M2O A;  3EFO A;  2J0W A;  2JD3 A;  5T3W A;  2ZXP A;  4P6I C;  2R7S A;  1MMA A;  3NDB B;  4HEA J;  2NUT A;  1BR2 A;  3DXJ F;  4YT8 A;  2R7X A;  3AQB A;  5E2Q A;  4OD5 A;  3QMK A;  3NYL A;  3AG1 C;  3I5P A;  4O7G A;  1ZU4 A;  5DQZ A;  1TWC A;  4AK9 A;  2XXA A;  2MWQ A;  3LLI A;  4J32 B;  3DJN B;  3NKD A;  2KGO A;  4DVZ A;  3Q7G A;  4KNV A;  2C04 A;  5F5H A;  2CGE A;  1V55 C;  4CSA C;  5DQT A;  4BJ6 C;  1M2V A;  3GAN A;  3T6B A;  3UNG C;  4Q7C A;  2A6E F;  2PFD A;  2CDQ A;  3DJU B;  3DM5 A;  3EG9 A;  3V7O A;  2PP4 A;  4YT5 A;  2R7Q A;  3FAJ A;  4O6N A;  2WZG A;  2NUP B;  2PF4 E;  2J9W A;  3B0V C;  3EHM A;  2ZXW C;  4DOZ A;  4EWC A;  5EGY A;  3JYH A;  2R7W A;  3LS1 A;  1Z23 A;  1NZE A;  4LLC A;  3FHD A;  2DYS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...