2JD3A

Parr from plasmid pb171
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
b'KRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STBB PROTEIN
publication title Structural Analysis of the Parr/Parc Plasmid Partition Complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 26
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1170 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2jd3A01
2JD3A
chains in the Genus database with same CATH superfamily
2HUJA 5T3WA 4EBKA 5KYXA 2Q9AA 3DM5A 1QLEC 1CGME 3IQ6A 4ZLCA 1Q0GA 5JP7A 1KNYA 4E18A 4W8KA 2KYHA 3HTKC 2P7VA 2A0UA 3VRCA 3IPMO 3EGXB 2AP3A 1EQ1A 2PFDA 2RSEB 5L0IA 2WB7A 3KKBA 3US6A 2KGOA 1YA9A 4WGZA 2J7PA 3SP1A 3E70C 3L0IA 1JPJA 4ER9A 3EG9B 1SR2A 4LDQA 4J30B 4RDAA 3ZIBA 4CSAC 2HS5A 3GM3A 4MTOA 5F5FA 2I15A 2J9WA 3SXZA 1ZW3A 5EHHA 1JRAA 256BA 2FFHA 4LLCA 4MVQA 1YZAA 3K6BA 2QE9A 4ULVA 5JS5A 3PHF2 4DOZA 2CYDA 4P9FA 4IARA 3M79A 5BUOA 3MBGA 4NQFA 2YLGA 5L0JA 4IRUA 1VMAA 1NLXA 3MYFA 3A11A 3EGDA 4CIHA 2ZXPA 2OJQA 1VOMA 3WAQA 2R05A 4FWVA 1YLMA 2XLOA 2WVNA 4XEVA 4Z9JA 3U2MA 3VF0A 3W8HA 2CDQA 1V74B 3TJ5A 4G7HF 3EJNA 4LACB 1RMVA 1LKXA 2KK1A 1HE1A 1GS9A 2XLMA 3E9VA 2EIMC 2LSEA 5KYNA 2J45A 4JTCB 2R25A 4LLEA 2B0JA 3EGXA 3EPVA 4B6IA 4O79A 5DQTA 3BEHA 1LVKA 1M6TA 3WODF 1OKKD 4O6YA 4E7ZA 2QUPA 1M56C 1ZVZA 3EG9A 3LUTB 5E2QA 3RQEA 4D4XA 1YYXA 3AG2C 1ZHWA 2CW0F 1Z63A 3O55A 4CDVA 1ZU5A 4DVYP 2YWAA 3GEEA 3MFNA 3NYMA 1E2XA 1PD1A 2B0HA 2J9BA 4JRZA 3V7OA 1FAPB 3W8IA 4JW1A 1VYKA 1WWPA 1JR8A 1Z3IX 2Q9CA 3G4XA 3NMJA 4PJLA 1OKKA 3ABMC 3JSEO 4CS9A 2XS1A 2YEVA 3JCUQ 4QDLA 1ZYRF 1ZU4A 3HLZA 4KNWA 4ULWA 4PJNA 4BJTA 4FX5A 4G78A 1E86A 5CI9A 3ZVRA 3VAYA 5CI8A 1GGQA 2ETSA 3ZG1A 4U9DA 3EH1A 4U5DE 4MTFA 5FZTA 4OINF 2OEVA 3LJBA 4CBEA 2YRFA 4DBRA 3S84A 3ZTMA 1YZCA 2DB4A 3PDMP 3HNKA 5D92A 2YL0A 3H2VA 1LI7A 4KBLA 2XRHA 4H4KC 3S28A 4G7ZF 4BEMJ 4MTGA 5CIVA 1TQGA 2LFDA 3T9OA 1KU2A 4K0DA 2PX0A 3FHDA 3UGPA 4CS8A 2RD9A 3VYWA 5AC5A 3O39A 3JTLO 1OW7A 2QY9A 2X51A 3C62A 2IOQA 3B0PA 3A9CA 3R2PA 4BJ6A 3DAFA 4P9TA 3NG1A 3H65A 2YQYA 1CPRA 1NFNA 2YZSA 3AQBA 3GANA 4AL0A 3MYIA 2OQMA 1QSPA 1LM3B 3T6BA 2LCHA 5L3VA 3TOLA 1S05A 1TFKB 3OEOA 3Q6MA 2W9YA 4LERA 4BJ1A 3K1IC 4GYTA 2CNWD 3B9QA 3DI5A 4IWBA 5TJ5E 3UMHA 4WABA 2L6FA 1YAUO 1FMVA 1AVOB 1FFTC 5JSLA 4ZLDA 4E7SA 1F1MA 3KYIA 1YYJA 4N4WA 1T6IA 2NSFA 4U5HA 3L1MA 1YVIA 1MMNA 1WASA 1T01A 2A1DD 2HJ3A 1WGWA 3QVZA 4H54A 4E0HA 4YT2A 2CNWA 2WL8A 1L3PA 1M2OA 1MMDA 1UG7A 2IXPA 2VCCA 3U8PA 3W2VA 5L0FA 3JYYA 3QZCA 2XS8A 4LDRA 3M4CA 4HFFB 2HMZA 2L9JA 2ASRA 3SYNA 1QQ3A 3JZ0A 2YL3A 4HEAJ 2AWYA 3FVYA 3V5ZA 1C17M 3U3FA 2HZ8A 3NYJA 2JD3A 2R7QA 3C8GB 4NCQA 2GA0A 3O6XA 3WG7C 4JZAA 4CDAA 5FCLA 3TULA 4JTDB 3O10A 2H7BA 5JVEA 3IQ5A 2OJED 1QZXA 1RKCA 2JX0A 3JRTA 4WJ0A 3HJCA 5D91A 2KSFA 3IHUA 3W4YA 4RD9A 4N06A 2H8AA 3GM1A 2GWWA 3UR3C 4O6NA 3FDQA 2OKUA 1T6QA 2VASA 3T4RA 1L7CA 1LE2A 2XLVA 2BL2A 1YJGA 1TWAA 2CCYA 1BR4A 2PNOA 1D1BA 3DE9A 2XLEA 3V5XA 4C3BA 1HW2A 4OIOF 3U2LA 1U0BB 1WATA 2A6HF 3DM9B 3VM6A 5DVWA 3U3BA 2W4BA 2HKVA 2HFIA 4HE8D 3M4BA 1M2VB 3EHMA 3ZC4A 1G4US 3I5PA 3IQCA 1TWHA 3UGOA 3RFYA 3K7DA 4PACA 4IB4A 3IQTA 3RKOF 1FFHA 2GDCA 2LQGA 3ZQVA 4BJ5C 2L7AA 2EPKX 2LP4A 3C8GA 5EGYA 4UDVA 1Q0DA 3QW0A 4R32A 3RF3A 3U5SA 4U9EA 2WVOA 3CZ6A 3N0TA 2A69F 2G3VA 4JTAB 3DJNB 5AGFA 5B1AC 2MWQA 4C7OB 1D0XA 1E84A 2EINC 4DJ9A 4YL1A 1OR3A 3AG3C 4G0HA 2MHRA 2R02A 4XTKA 1GQAA 4IAQA 1JOGA 2DYSC 2OEXA 3EZIA 4NTFA 4U5CE 4J7YA 4EHPA 3C63A 1O87A 3TJ6A 2R7OA 4AK9A 3J06A 1CPQA 3C8ZA 3LS1A 3ZSUA 4CJOA 2LIGA 3HNIA 4F4BA 2R7SA 4ONSA 3DAGA 2OG2A 4A2NB 1ZW2A 2DI3A 4EKWA 2IBFA 4I1MA 2UUIA 1V54C 2XLDA 3KMIA 2Y3GA 2R7VA 2W45A 3M1CB 1M2VA 1IZMA 2IM8A 1D0YA 3QVYA 2CGEA 4PFOA 1E85A 2R7UA 3NYLA 3UMKA 1RJ9B 3GM2A 2F22A 3ATPA 4QI2A 2M4EA 1BR1A 2A68F 4Q5SF 5F28E 5L0HA 3MX3A 1Q0FA 3G50A 4BJ6C 1A41A 1QKRA 3GWLA 3QW1A 4NTAA 3ZTZA 3S0XA 2HJMA 4C7OA 5KYYB 4MVSA 1S7ZA 4MVUA 1TWGA 5KYWB 4XLNF 2P61A 5K0IA 2Y3DA 2XSEA 2KNHA 3DXJF 3SEOA 2R7TA 4CS9C 1MQVA 3GEHA 2XXAB 2Q00A 3KYJA 3EZHA 1J8MF 2HMQA 4JE9A 1I5NA 1HE9A 1W2WA 2WVQA 4K7BA 1LIHA 2IXNA 3LLKA 2KW3C 1I4ZA 2EILC 5COGA 1N1CA 1FNTc 2JPUA 2Y39A 2R7WA 4KI2A 3ZQYA 4I1OB 3SNHA 3T6JA 5BQGA 1OCOC 1PD0A 1UFBA 3M15A 3MLGA 4MW8A 2VB6A 4NTBA 5E3AA 2Q9BA 1D1AA 2VH3A 3ZDLA 1BZ4A 5KYUB 2ICWG 3NDBB 4PK4A 2OOCA 1G4WR 1A7VA 1RJ9A 1XZQA 2R9RB 3Q7GA 1ZHTA 4ANJA 1V55C 2ZXRA 1BDJB 2PF4E 2EPLX 1ZHXA 3AGUA 4CIPA 3NMIA 1Z5ZA 2HSQA 1XWJA 4OIRF 1WOLA 2G62A 2I8BA 2P1AA 3JT1A 4XEFA 4D4NA 1Z7Qc 3LAYA 5KYYA 3F46A 1VB5A 4OD4A 5T1DB 4IAOA 3CAXA 5COFA 3PMRA 4CS8C 4MVOA 1AUEA 4G7OF 3LNMB 5KYWA 1YDIA 2VCAA 5L0DA 4BPMA 3UNGC 3WHNA 2L6GA 2LD6A 4YT4A 1JAFA 1HMOA 3L34A 1ORYA 4W8PA 4YT5A 1J8YF 2R03A 1ST6A 3KH2A 3SZRA 1OCZC 2J46A 3AG4C 1YA7O 5L0GA 1EKYA 1LE4A 5B3SC 4NC3A 3GWNA 4IGGA 1VLTA 1NZEA 3AG1C 3EHNA 3LS0A 2XL6A 2ZPAA 2UUHA 4PR9A 3TD7A 1OW8A 2D4UA 4GEHA 3S9OA 2P0NA 5F5HA 2XLWA 5KYUA 4EUKB 2BE5F 1AEPA 1LS1A 1FTSA 3POVA 5A6AA 1BBHA 4XWJA 4N6HA 1RKEB 3FAPB 3LEOA 5AC4A 4KC9A 2J8WA 2LK4A 4KNVA 3U0CA 2PP4A 1OCCC 2QLAA 1GM5A 1NU9C 2NPUA 5A6JA 1DOVA 1NSGB 4BG0A 1VTMP 2L6HA 2XL4A 2HV7A 3HKKA 5BQIA 5DQZA 2XM4A 1E83A 4I3MA 5B1BC 3DWWA 1VYIA 1FMWA 3ABKC 3JRMO 4MVZA 1ZZPA 4YWQA 4I44A 3S29A 2W4MA 2A6EF 1ZHZA 3AJMA 4RBNA 5L0CA 1VK5A 1U89A 4OIPF 3DE8A 2AVKA 3T6GB 2Y3HA 4L6RA 4XEKA 2A0BA 4DRIB 1G8XA 4DRJB 5T3TA 1K04A 3RVZA 1D1CA 1LI5A 3N24A 3Q6NA 4DXWA 3CEXA 3HNJA 4U5EE 1VLSA 3RQGA 3C8GD 5A6BD 1M57C 3X2QC 4CSAA 2J9VA 4Z9HA 3FOOA 4JEBA 4JJGA 2IXMA 1Q0KA 1TR2A 5DS4A 4DRHB 4JJFA 1TKNA 3ASOC 1A0BA 4E0IA 4PJMA 2EIKC 1MNDA 3ITFA 1RKEA 2Q3TA 3AOUA 4Q7CA 5A6BA 5E33A 4XPWA 2AWCA 3FMSA 1OW6A 3B71A 2J9UA 3FOPA 1OQCA 2J0WA 3PCVA 3DD7A 4MQ9F 5E3CA 4AL1A 4BJ5A 2XXAA 4FESA 1NU7D 3EFOB 3QTHA 1EA8A 4YL3A 4EBJA 1SZIA 2ZXOA 4JCZA 4MS2A 3U9MA 4C3EA 5COMA 5A69A 4QI0A 3U9JA 1KTMA 2EIJC 4YK5A 1H7IA 2NUPB 1HY5A 4HFKB 3RVYA 4K1OA 4AE4B 3G4ZA 4MNDA 2TMVP 4JEAA 4EBBA 4XQ1A 3JSZA 1D0ZA 3FXHA 4YT8A 2GAQA 4M63A 1PCXA 3OA1A 3DMDA 2NG1A 4XPYA 1K05A 3TQOA 1TFOB 2M64A 1FR0A 4O6MA 1LPEA 3DJUB 1A7DA 3IEEA 3Q7LA 1QPUA 3LESA 2XL8A 1NFOA 1ORSC 1MMGA 3SXMA 1MMAA 4YN0B 3I4UA 4O7GA 2EPMX 2YVKA 2J0XA 3L8JA 2C03A 1U6HA 2Y69C 3EH2A 3BRJA 3C7JA 3SXKA 3DZAA 4CJGA 3JYHA 2KC3A 3EFOA 2P6VA 2D5RB 3QMKA 1SYQA 3AGTA 2NUTB 1PV3A 4LDKA 1Z23A 3AQCA 3TK0A 1IW7F 2OU6A 1ORJA 3CSKA 2E87A 3K33A 3L8IA 4EWCA 1G5ZA 3HNLA 4JCHA 2NUPA 4IJJA 1R4TA 3ECSA 3KL4A 3ZWIA 4AE4A 3RQFA 2V3CC 2HV6A 2PX3A 2YLDA 3I5QA 3RYLA 2QNLA 3C18A 1HW1A 4DBQA 3W2WA 4CX9A 1Y6DA 1ZHYA 4CDYA 5B3IA 4OD5A 4Q4ZF 2G3KA 1I4YA 1OR2A 2NSGA 2WZGA 3S90A 1OCRC 2OCCC 1HMDA 1Q0MA 1RXQA 3GORA 1WTYA 4MVRA 2EPNA 2V26A 2XLHA 3ASNC 5GPGB 4X0RA 4N6CA 2X0CA 4YL0A 5DS6A 3B0VC 2Z15A 3GEIA 2O9XA 4MVMA 2VC9A 2PBEA 3FAJA 4PFPA 3NMKA 2MYSA 1NG1A 3OWTA 3U8VA 2XM0A 3LEVA 1C02A 1NBBA 1RCPA 2Q7RA 3NKEA 2Y3BA 5DLJA 2QTVA 3X1OA 3NRHA 4A4AA 1TWCA 2NUTA 1MNEA 2HSBA 1H6GA 2ZD9A 1YARO 2WZLA 3K1HA 5A6KA 5HV9A 4JURI 1A7EA 4CS7A 4OIQF 3K1IA 3RW0A 2R7XA 2YLIA 5L3QA 1CGNA 4PJJA 1LS4A 2H7VC 2L81A 2IXOA 3TOMA 4BEJA 3DKAA 2YL7A 2KQ9A 3ABLC 4JC7A 5JLIA 5HSWA 1BR2A 1SMYF 1QVXA 4AX2A 2KJGA 3CQZA 4JKVA 4J32B 2AU5A 1CGOA 1V4AA 2LFFA 2WZFA 1H9TA 5KYXB 4GQHA 1C03A 1K40A 2H7OA 3B29A 4JIOA 3KPHA 3N2ZB 3V5YA 3SXYA 5JT4A 2GFHA 4EIYA 4JVSA 5IY5C 4DVZA 2IYLD 5EK0A 2FGYA 3LLIA 2C04A 2R7RA 1R5ID 1O5HA 2YKZA 1SF8A 5JUAA 1T9KA 2DGJA 1Y4CA 1Z6AA 1APCA 3K66A 4U5FE 1DOWA 4FAPB 1OXKA 4Z9IA 1O3UA 4P6IC 1JMWA 3RIPA 2YL1A 2FAPB 3NKDA 2EPOA 4XPXA 3S27A 3UMIA 4WGYA 1JPNA 5DS5A 3F47A 1WN0A 3LNRA 2YHSA 4E17A 1H9GA 1OXBA 2DYRC 1EI7A 3GODA 1T5OA 4U5BE 4J7TA 4U5GA 1B68A 1XZPA 4NY3A 2VCBA 3RH3A 5BQHA 3B0UX 2BC5A 3EGDB 4MW3A 5JRAA 2ZXWC 4C3DA 1T6UA 2J7PD 2Q4FA 4XLPF 3R7CA 4YJWA 3EQLF 3H2UA
chains in the Genus database with same CATH topology
5T3WA 5KYXA 2Q9AA 3DM5A 1QLEC 4ZLCA 4W8KA 3HTKC 2P7VA 3EGXB 2PFDA 2WB7A 3KKBA 2KGOA 2J7PA 3SP1A 3E70C 3L0IA 1JPJA 3EG9B 4J30B 4RDAA 3ZIBA 4CSAC 5F5FA 2J9WA 5EHHA 4LLCA 2FFHA 3K6BA 3PHF2 4DOZA 4IRUA 1VMAA 3EGDA 4CIHA 2ZXPA 1VOMA 4FWVA 2WVNA 3W8HA 2CDQA 4G7HF 3EJNA 4LACB 1LKXA 3E9VA 2EIMC 2LSEA 5KYNA 2J45A 4LLEA 2B0JA 3EGXA 3EPVA 4B6IA 4O79A 5DQTA 1LVKA 3WODF 1OKKD 4O6YA 4E7ZA 1M56C 3EG9A 5E2QA 3AG2C 1ZHWA 2CW0F 1Z63A 1ZU5A 4DVYP 3NYMA 1PD1A 3V7OA 3W8IA 4JW1A 1VYKA 1Z3IX 2Q9CA 4PJLA 1OKKA 3ABMC 4CS9A 2YEVA 3JCUQ 4QDLA 1ZYRF 1ZU4A 3HLZA 4KNWA 4ULWA 4PJNA 4BJTA 4FX5A 5CI9A 3ZVRA 3VAYA 5CI8A 3ZG1A 3EH1A 4U5DE 4CBEA 4OINF 3LJBA 4DBRA 5D92A 4KBLA 2XRHA 4H4KC 3S28A 4G7ZF 1KU2A 4K0DA 2PX0A 3FHDA 3UGPA 4CS8A 3VYWA 3O39A 2QY9A 2X51A 2IOQA 3B0PA 4BJ6A 3DAFA 3NG1A 3H65A 2YZSA 3AQBA 3GANA 3T6BA 5L3VA 3Q6MA 3OEOA 4LERA 2W9YA 4BJ1A 3K1IC 4GYTA 2CNWD 3B9QA 4IWBA 3UMHA 1FMVA 1FFTC 4ZLDA 4E7SA 4U5HA 4OIPF 1MMNA 2A1DD 1WGWA 4YT2A 2CNWA 2WL8A 2IXPA 1M2OA 1MMDA 3W2VA 3QZCA 4HFFB 2L9JA 3SYNA 4HEAJ 3FVYA 3NYJA 2JD3A 2R7QA 3O6XA 3WG7C 4JZAA 5FCLA 2H7BA 1QZXA 4WJ0A 3JRTA 3HJCA 5D91A 4RD9A 4N06A 3UR3C 4O6NA 3FDQA 2VASA 3T4RA 1TWAA 1BR4A 1D1BA 4C3BA 4OIOF 2A6HF 3DM9B 5DVWA 2W4BA 4HE8D 1M2VB 3EHMA 3ZC4A 3I5PA 1TWHA 3UGOA 3RFYA 3K7DA 3RKOF 1FFHA 4BJ5C 5EGYA 2WVOA 3N0TA 3CZ6A 2A69F 2G3VA 4C7OB 3DJNB 5B1AC 2MWQA 1D0XA 2EINC 3AG3C 4G0HA 4XTKA 3EZIA 2DYSC 4U5CE 1O87A 2R7OA 4AK9A 3LS1A 3ZSUA 4F4BA 2R7SA 3DAGA 2OG2A 4A2NB 4I1MA 1V54C 3KMIA 2Y3GA 2R7VA 2W45A 3M1CB 1M2VA 1IZMA 1D0YA 2CGEA 4PFOA 2R7UA 3NYLA 3UMKA 1RJ9B 4QI2A 2M4EA 1BR1A 2A68F 4Q5SF 3MX3A 3S0XA 4C7OA 5KYYB 1S7ZA 1TWGA 5KYWB 4XLNF 2Y3DA 2XSEA 2KNHA 3DXJF 3SEOA 2R7TA 4CS9C 2XXAB 3EZHA 1J8MF 1W2WA 2WVQA 4K7BA 2IXNA 3LLKA 2KW3C 2EILC 1N1CA 2R7WA 2Y39A 4KI2A 4I1OB 3SNHA 3T6JA 1OCOC 1PD0A 3MLGA 5E3AA 2VB6A 5KYUB 3NDBB 2Q9BA 1D1AA 2VH3A 4PK4A 1RJ9A 3Q7GA 1ZHTA 4ANJA 1V55C 2ZXRA 2PF4E 1ZHXA 1Z5ZA 4OIRF 2G62A 3JT1A 2I8BA 3LAYA 5KYYA 3F46A 4OD4A 5T1DB 4IAOA 3PMRA 4CS8C 4G7OF 5KYWA 3UNGC 4YT4A 2XXAA 4BJ6C 3SZRA 3L34A 4YT5A 1J8YF 1ST6A 3KH2A 1OCZC 2J46A 3AG4C 5B3SC 1NZEA 3AG1C 3EHNA 3LS0A 2ZPAA 3TD7A 4GEHA 5F5HA 5KYUA 2BE5F 1LS1A 1FTSA 3POVA 4XWJA 4KC9A 4KNVA 2PP4A 1OCCC 1NU9C 4BG0A 2XL4A 2HV7A 5DQZA 4I3MA 5B1BC 1VYIA 1FMWA 3ABKC 4YWQA 4I44A 3S29A 2W4MA 2A6EF 1ZHZA 4RBNA 1VK5A 2Y3HA 1G8XA 5T3TA 1D1CA 3N24A 3Q6NA 4U5EE 4CSAA 1M57C 3X2QC 2J9VA 5DS4A 4JJGA 2IXMA 1TR2A 4JJFA 1TKNA 3ASOC 4PJMA 1MNDA 2EIKC 3ITFA 2Q3TA 4Q7CA 5E33A 2J9UA 2J0WA 3DD7A 4MQ9F 5E3CA 4BJ5A 4FESA 1NU7D 3EFOB 1SZIA 4C3EA 4QI0A 2EIJC 2NUPB 4HFKB 4AE4B 4MNDA 4EBBA 3JSZA 1D0ZA 4YT8A 4M63A 1PCXA 3OA1A 3DMDA 2NG1A 4O6MA 3DJUB 3IEEA 3Q7LA 3LESA 1MMGA 1MMAA 4YN0B 3I4UA 4O7GA 2J0XA 2C03A 2Y69C 3EH2A 3DZAA 3JYHA 3EFOA 2P6VA 2D5RB 3QMKA 2NUTB 1Z23A 3AQCA 1IW7F 3CSKA 2E87A 3K33A 4EWCA 4JCHA 2NUPA 4IJJA 3ECSA 3KL4A 2V3CC 4AE4A 2HV6A 2PX3A 3I5QA 3RYLA 4DBQA 3W2WA 1ZHYA 4OD5A 4Q4ZF 2G3KA 2WZGA 1OCRC 2OCCC 5BUOA 2V26A 3ASNC 3B0VC 4X0RA 5DS6A 2Z15A 2O9XA 4PFPA 3FAJA 2MYSA 1NG1A 3OWTA 3LEVA 3NKEA 2Y3BA 5DLJA 2QTVA 3X1OA 3NRHA 1TWCA 2NUTA 1MNEA 3K1HA 2WZLA 4JURI 4CS7A 4OIQF 2R7XA 5L3QA 4PJJA 2L81A 2H7VC 2IXOA 4BEJA 2KQ9A 3ABLC 5HSWA 1BR2A 1SMYF 4AX2A 2KJGA 3CQZA 4J32B 2WZFA 5KYXB 2H7OA 3N2ZB 2GFHA 4JVSA 5IY5C 4DVZA 2IYLD 2FGYA 3LLIA 2C04A 2R7RA 1O5HA 1SF8A 2DGJA 1Z6AA 3K66A 4U5FE 4P6IC 3RIPA 3NKDA 3S27A 3UMIA 1JPNA 5DS5A 3F47A 3LNRA 2YHSA 2DYRC 3GODA 4U5BE 4U5GA 4NY3A 3RH3A 3B0UX 3EGDB 2ZXWC 4C3DA 2J7PD 2ZXOA 4XLPF 4YJWA 3EQLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD3 A; 
#chains in the Genus database with same CATH topology
 2HUJ A;  5T3W A;  4EBK A;  5KYX A;  2Q9A A;  3DM5 A;  1QLE C;  1CGM E;  3IQ6 A;  4ZLC A;  1Q0G A;  5JP7 A;  1KNY A;  4E18 A;  4W8K A;  2KYH A;  3HTK C;  2P7V A;  2A0U A;  3VRC A;  3IPM O;  3EGX B;  2AP3 A;  1EQ1 A;  2PFD A;  2RSE B;  5L0I A;  2WB7 A;  3KKB A;  3US6 A;  2KGO A;  1YA9 A;  4WGZ A;  2J7P A;  3SP1 A;  3E70 C;  3L0I A;  1JPJ A;  4ER9 A;  3EG9 B;  1SR2 A;  4LDQ A;  4J30 B;  4RDA A;  3ZIB A;  4CSA C;  2HS5 A;  3GM3 A;  4MTO A;  5F5F A;  2I15 A;  2J9W A;  3SXZ A;  1ZW3 A;  5EHH A;  1JRA A;  256B A;  2FFH A;  4LLC A;  4MVQ A;  1YZA A;  3K6B A;  2QE9 A;  4ULV A;  5JS5 A;  3PHF 2;  4DOZ A;  2CYD A;  4P9F A;  4IAR A;  3M79 A;  5BUO A;  3MBG A;  4NQF A;  2YLG A;  5L0J A;  4IRU A;  1VMA A;  1NLX A;  3MYF A;  3A11 A;  3EGD A;  4CIH A;  2ZXP A;  2OJQ A;  1VOM A;  3WAQ A;  2R05 A;  4FWV A;  1YLM A;  2XLO A;  2WVN A;  4XEV A;  4Z9J A;  3U2M A;  3VF0 A;  3W8H A;  2CDQ A;  1V74 B;  3TJ5 A;  4G7H F;  3EJN A;  4LAC B;  1RMV A;  1LKX A;  2KK1 A;  1HE1 A;  1GS9 A;  2XLM A;  3E9V A;  2EIM C;  2LSE A;  5KYN A;  2J45 A;  4JTC B;  2R25 A;  4LLE A;  2B0J A;  3EGX A;  3EPV A;  4B6I A;  4O79 A;  5DQT A;  3BEH A;  1LVK A;  1M6T A;  3WOD F;  1OKK D;  4O6Y A;  4E7Z A;  2QUP A;  1M56 C;  1ZVZ A;  3EG9 A;  3LUT B;  5E2Q A;  3RQE A;  4D4X A;  1YYX A;  3AG2 C;  1ZHW A;  2CW0 F;  1Z63 A;  3O55 A;  4CDV A;  1ZU5 A;  4DVY P;  2YWA A;  3GEE A;  3MFN A;  3NYM A;  1E2X A;  1PD1 A;  2B0H A;  2J9B A;  4JRZ A;  3V7O A;  1FAP B;  3W8I A;  4JW1 A;  1VYK A;  1WWP A;  1JR8 A;  1Z3I X;  2Q9C A;  3G4X A;  3NMJ A;  4PJL A;  1OKK A;  3ABM C;  3JSE O;  4CS9 A;  2XS1 A;  2YEV A;  3JCU Q;  4QDL A;  1ZYR F;  1ZU4 A;  3HLZ A;  4KNW A;  4ULW A;  4PJN A;  4BJT A;  4FX5 A;  4G78 A;  1E86 A;  5CI9 A;  3ZVR A;  3VAY A;  5CI8 A;  1GGQ A;  2ETS A;  3ZG1 A;  4U9D A;  3EH1 A;  4U5D E;  4MTF A;  5FZT A;  4OIN F;  2OEV A;  3LJB A;  4CBE A;  2YRF A;  4DBR A;  3S84 A;  3ZTM A;  1YZC A;  2DB4 A;  3PDM P;  3HNK A;  5D92 A;  2YL0 A;  3H2V A;  1LI7 A;  4KBL A;  2XRH A;  4H4K C;  3S28 A;  4G7Z F;  4BEM J;  4MTG A;  5CIV A;  1TQG A;  2LFD A;  3T9O A;  1KU2 A;  4K0D A;  2PX0 A;  3FHD A;  3UGP A;  4CS8 A;  2RD9 A;  3VYW A;  5AC5 A;  3O39 A;  3JTL O;  1OW7 A;  2QY9 A;  2X51 A;  3C62 A;  2IOQ A;  3B0P A;  3A9C A;  3R2P A;  4BJ6 A;  3DAF A;  4P9T A;  3NG1 A;  3H65 A;  2YQY A;  1CPR A;  1NFN A;  2YZS A;  3AQB A;  3GAN A;  4AL0 A;  3MYI A;  2OQM A;  1QSP A;  1LM3 B;  3T6B A;  2LCH A;  5L3V A;  3TOL A;  1S05 A;  1TFK B;  3OEO A;  3Q6M A;  2W9Y A;  4LER A;  4BJ1 A;  3K1I C;  4GYT A;  2CNW D;  3B9Q A;  3DI5 A;  4IWB A;  5TJ5 E;  3UMH A;  4WAB A;  2L6F A;  1YAU O;  1FMV A;  1AVO B;  1FFT C;  5JSL A;  4ZLD A;  4E7S A;  1F1M A;  3KYI A;  1YYJ A;  4N4W A;  1T6I A;  2NSF A;  4U5H A;  3L1M A;  1YVI A;  1MMN A;  1WAS A;  1T01 A;  2A1D D;  2HJ3 A;  1WGW A;  3QVZ A;  4H54 A;  4E0H A;  4YT2 A;  2CNW A;  2WL8 A;  1L3P A;  1M2O A;  1MMD A;  1UG7 A;  2IXP A;  2VCC A;  3U8P A;  3W2V A;  5L0F A;  3JYY A;  3QZC A;  2XS8 A;  4LDR A;  3M4C A;  4HFF B;  2HMZ A;  2L9J A;  2ASR A;  3SYN A;  1QQ3 A;  3JZ0 A;  2YL3 A;  4HEA J;  2AWY A;  3FVY A;  3V5Z A;  1C17 M;  3U3F A;  2HZ8 A;  3NYJ A;  2JD3 A;  2R7Q A;  3C8G B;  4NCQ A;  2GA0 A;  3O6X A;  3WG7 C;  4JZA A;  4CDA A;  5FCL A;  3TUL A;  4JTD B;  3O10 A;  2H7B A;  5JVE A;  3IQ5 A;  2OJE D;  1QZX A;  1RKC A;  2JX0 A;  3JRT A;  4WJ0 A;  3HJC A;  5D91 A;  2KSF A;  3IHU A;  3W4Y A;  4RD9 A;  4N06 A;  2H8A A;  3GM1 A;  2GWW A;  3UR3 C;  4O6N A;  3FDQ A;  2OKU A;  1T6Q A;  2VAS A;  3T4R A;  1L7C A;  1LE2 A;  2XLV A;  2BL2 A;  1YJG A;  1TWA A;  2CCY A;  1BR4 A;  2PNO A;  1D1B A;  3DE9 A;  2XLE A;  3V5X A;  4C3B A;  1HW2 A;  4OIO F;  3U2L A;  1U0B B;  1WAT A;  2A6H F;  3DM9 B;  3VM6 A;  5DVW A;  3U3B A;  2W4B A;  2HKV A;  2HFI A;  4HE8 D;  3M4B A;  1M2V B;  3EHM A;  3ZC4 A;  1G4U S;  3I5P A;  3IQC A;  1TWH A;  3UGO A;  3RFY A;  3K7D A;  4PAC A;  4IB4 A;  3IQT A;  3RKO F;  1FFH A;  2GDC A;  2LQG A;  3ZQV A;  4BJ5 C;  2L7A A;  2EPK X;  2LP4 A;  3C8G A;  5EGY A;  4UDV A;  1Q0D A;  3QW0 A;  4R32 A;  3RF3 A;  3U5S A;  4U9E A;  2WVO A;  3CZ6 A;  3N0T A;  2A69 F;  2G3V A;  4JTA B;  3DJN B;  5AGF A;  5B1A C;  2MWQ A;  4C7O B;  1D0X A;  1E84 A;  2EIN C;  4DJ9 A;  4YL1 A;  1OR3 A;  3AG3 C;  4G0H A;  2MHR A;  2R02 A;  4XTK A;  1GQA A;  4IAQ A;  1JOG A;  2DYS C;  2OEX A;  3EZI A;  4NTF A;  4U5C E;  4J7Y A;  4EHP A;  3C63 A;  1O87 A;  3TJ6 A;  2R7O A;  4AK9 A;  3J06 A;  1CPQ A;  3C8Z A;  3LS1 A;  3ZSU A;  4CJO A;  2LIG A;  3HNI A;  4F4B A;  2R7S A;  4ONS A;  3DAG A;  2OG2 A;  4A2N B;  1ZW2 A;  2DI3 A;  4EKW A;  2IBF A;  4I1M A;  2UUI A;  1V54 C;  2XLD A;  3KMI A;  2Y3G A;  2R7V A;  2W45 A;  3M1C B;  1M2V A;  1IZM A;  2IM8 A;  1D0Y A;  3QVY A;  2CGE A;  4PFO A;  1E85 A;  2R7U A;  3NYL A;  3UMK A;  1RJ9 B;  3GM2 A;  2F22 A;  3ATP A;  4QI2 A;  2M4E A;  1BR1 A;  2A68 F;  4Q5S F;  5F28 E;  5L0H A;  3MX3 A;  1Q0F A;  3G50 A;  4BJ6 C;  1A41 A;  1QKR A;  3GWL A;  3QW1 A;  4NTA A;  3ZTZ A;  3S0X A;  2HJM A;  4C7O A;  5KYY B;  4MVS A;  1S7Z A;  4MVU A;  1TWG A;  5KYW B;  4XLN F;  2P61 A;  5K0I A;  2Y3D A;  2XSE A;  2KNH A;  3DXJ F;  3SEO A;  2R7T A;  4CS9 C;  1MQV A;  3GEH A;  2XXA B;  2Q00 A;  3KYJ A;  3EZH A;  1J8M F;  2HMQ A;  4JE9 A;  1I5N A;  1HE9 A;  1W2W A;  2WVQ A;  4K7B A;  1LIH A;  2IXN A;  3LLK A;  2KW3 C;  1I4Z A;  2EIL C;  5COG A;  1N1C A;  1FNT c;  2JPU A;  2Y39 A;  2R7W A;  4KI2 A;  3ZQY A;  4I1O B;  3SNH A;  3T6J A;  5BQG A;  1OCO C;  1PD0 A;  1UFB A;  3M15 A;  3MLG A;  4MW8 A;  2VB6 A;  4NTB A;  5E3A A;  2Q9B A;  1D1A A;  2VH3 A;  3ZDL A;  1BZ4 A;  5KYU B;  2ICW G;  3NDB B;  4PK4 A;  2OOC A;  1G4W R;  1A7V A;  1RJ9 A;  1XZQ A;  2R9R B;  3Q7G A;  1ZHT A;  4ANJ A;  1V55 C;  2ZXR A;  1BDJ B;  2PF4 E;  2EPL X;  1ZHX A;  3AGU A;  4CIP A;  3NMI A;  1Z5Z A;  2HSQ A;  1XWJ A;  4OIR F;  1WOL A;  2G62 A;  2I8B A;  2P1A A;  3JT1 A;  4XEF A;  4D4N A;  1Z7Q c;  3LAY A;  5KYY A;  3F46 A;  1VB5 A;  4OD4 A;  5T1D B;  4IAO A;  3CAX A;  5COF A;  3PMR A;  4CS8 C;  4MVO A;  1AUE A;  4G7O F;  3LNM B;  5KYW A;  1YDI A;  2VCA A;  5L0D A;  4BPM A;  3UNG C;  3WHN A;  2L6G A;  2LD6 A;  4YT4 A;  1JAF A;  1HMO A;  3L34 A;  1ORY A;  4W8P A;  4YT5 A;  1J8Y F;  2R03 A;  1ST6 A;  3KH2 A;  3SZR A;  1OCZ C;  2J46 A;  3AG4 C;  1YA7 O;  5L0G A;  1EKY A;  1LE4 A;  5B3S C;  4NC3 A;  3GWN A;  4IGG A;  1VLT A;  1NZE A;  3AG1 C;  3EHN A;  3LS0 A;  2XL6 A;  2ZPA A;  2UUH A;  4PR9 A;  3TD7 A;  1OW8 A;  2D4U A;  4GEH A;  3S9O A;  2P0N A;  5F5H A;  2XLW A;  5KYU A;  4EUK B;  2BE5 F;  1AEP A;  1LS1 A;  1FTS A;  3POV A;  5A6A A;  1BBH A;  4XWJ A;  4N6H A;  1RKE B;  3FAP B;  3LEO A;  5AC4 A;  4KC9 A;  2J8W A;  2LK4 A;  4KNV A;  3U0C A;  2PP4 A;  1OCC C;  2QLA A;  1GM5 A;  1NU9 C;  2NPU A;  5A6J A;  1DOV A;  1NSG B;  4BG0 A;  1VTM P;  2L6H A;  2XL4 A;  2HV7 A;  3HKK A;  5BQI A;  5DQZ A;  2XM4 A;  1E83 A;  4I3M A;  5B1B C;  3DWW A;  1VYI A;  1FMW A;  3ABK C;  3JRM O;  4MVZ A;  1ZZP A;  4YWQ A;  4I44 A;  3S29 A;  2W4M A;  2A6E F;  1ZHZ A;  3AJM A;  4RBN A;  5L0C A;  1VK5 A;  1U89 A;  4OIP F;  3DE8 A;  2AVK A;  3T6G B;  2Y3H A;  4L6R A;  4XEK A;  2A0B A;  4DRI B;  1G8X A;  4DRJ B;  5T3T A;  1K04 A;  3RVZ A;  1D1C A;  1LI5 A;  3N24 A;  3Q6N A;  4DXW A;  3CEX A;  3HNJ A;  4U5E E;  1VLS A;  3RQG A;  3C8G D;  5A6B D;  1M57 C;  3X2Q C;  4CSA A;  2J9V A;  4Z9H A;  3FOO A;  4JEB A;  4JJG A;  2IXM A;  1Q0K A;  1TR2 A;  5DS4 A;  4DRH B;  4JJF A;  1TKN A;  3ASO C;  1A0B A;  4E0I A;  4PJM A;  2EIK C;  1MND A;  3ITF A;  1RKE A;  2Q3T A;  3AOU A;  4Q7C A;  5A6B A;  5E33 A;  4XPW A;  2AWC A;  3FMS A;  1OW6 A;  3B71 A;  2J9U A;  3FOP A;  1OQC A;  2J0W A;  3PCV A;  3DD7 A;  4MQ9 F;  5E3C A;  4AL1 A;  4BJ5 A;  2XXA A;  4FES A;  1NU7 D;  3EFO B;  3QTH A;  1EA8 A;  4YL3 A;  4EBJ A;  1SZI A;  2ZXO A;  4JCZ A;  4MS2 A;  3U9M A;  4C3E A;  5COM A;  5A69 A;  4QI0 A;  3U9J A;  1KTM A;  2EIJ C;  4YK5 A;  1H7I A;  2NUP B;  1HY5 A;  4HFK B;  3RVY A;  4K1O A;  4AE4 B;  3G4Z A;  4MND A;  2TMV P;  4JEA A;  4EBB A;  4XQ1 A;  3JSZ A;  1D0Z A;  3FXH A;  4YT8 A;  2GAQ A;  4M63 A;  1PCX A;  3OA1 A;  3DMD A;  2NG1 A;  4XPY A;  1K05 A;  3TQO A;  1TFO B;  2M64 A;  1FR0 A;  4O6M A;  1LPE A;  3DJU B;  1A7D A;  3IEE A;  3Q7L A;  1QPU A;  3LES A;  2XL8 A;  1NFO A;  1ORS C;  1MMG A;  3SXM A;  1MMA A;  4YN0 B;  3I4U A;  4O7G A;  2EPM X;  2YVK A;  2J0X A;  3L8J A;  2C03 A;  1U6H A;  2Y69 C;  3EH2 A;  3BRJ A;  3C7J A;  3SXK A;  3DZA A;  4CJG A;  3JYH A;  2KC3 A;  3EFO A;  2P6V A;  2D5R B;  3QMK A;  1SYQ A;  3AGT A;  2NUT B;  1PV3 A;  4LDK A;  1Z23 A;  3AQC A;  3TK0 A;  1IW7 F;  2OU6 A;  1ORJ A;  3CSK A;  2E87 A;  3K33 A;  3L8I A;  4EWC A;  1G5Z A;  3HNL A;  4JCH A;  2NUP A;  4IJJ A;  1R4T A;  3ECS A;  3KL4 A;  3ZWI A;  4AE4 A;  3RQF A;  2V3C C;  2HV6 A;  2PX3 A;  2YLD A;  3I5Q A;  3RYL A;  2QNL A;  3C18 A;  1HW1 A;  4DBQ A;  3W2W A;  4CX9 A;  1Y6D A;  1ZHY A;  4CDY A;  5B3I A;  4OD5 A;  4Q4Z F;  2G3K A;  1I4Y A;  1OR2 A;  2NSG A;  2WZG A;  3S90 A;  1OCR C;  2OCC C;  1HMD A;  1Q0M A;  1RXQ A;  3GOR A;  1WTY A;  4MVR A;  2EPN A;  2V26 A;  2XLH A;  3ASN C;  5GPG B;  4X0R A;  4N6C A;  2X0C A;  4YL0 A;  5DS6 A;  3B0V C;  2Z15 A;  3GEI A;  2O9X A;  4MVM A;  2VC9 A;  2PBE A;  3FAJ A;  4PFP A;  3NMK A;  2MYS A;  1NG1 A;  3OWT A;  3U8V A;  2XM0 A;  3LEV A;  1C02 A;  1NBB A;  1RCP A;  2Q7R A;  3NKE A;  2Y3B A;  5DLJ A;  2QTV A;  3X1O A;  3NRH A;  4A4A A;  1TWC A;  2NUT A;  1MNE A;  2HSB A;  1H6G A;  2ZD9 A;  1YAR O;  2WZL A;  3K1H A;  5A6K A;  5HV9 A;  4JUR I;  1A7E A;  4CS7 A;  4OIQ F;  3K1I A;  3RW0 A;  2R7X A;  2YLI A;  5L3Q A;  1CGN A;  4PJJ A;  1LS4 A;  2H7V C;  2L81 A;  2IXO A;  3TOM A;  4BEJ A;  3DKA A;  2YL7 A;  2KQ9 A;  3ABL C;  4JC7 A;  5JLI A;  5HSW A;  1BR2 A;  1SMY F;  1QVX A;  4AX2 A;  2KJG A;  3CQZ A;  4JKV A;  4J32 B;  2AU5 A;  1CGO A;  1V4A A;  2LFF A;  2WZF A;  1H9T A;  5KYX B;  4GQH A;  1C03 A;  1K40 A;  2H7O A;  3B29 A;  4JIO A;  3KPH A;  3N2Z B;  3V5Y A;  3SXY A;  5JT4 A;  2GFH A;  4EIY A;  4JVS A;  5IY5 C;  4DVZ A;  2IYL D;  5EK0 A;  2FGY A;  3LLI A;  2C04 A;  2R7R A;  1R5I D;  1O5H A;  2YKZ A;  1SF8 A;  5JUA A;  1T9K A;  2DGJ A;  1Y4C A;  1Z6A A;  1APC A;  3K66 A;  4U5F E;  1DOW A;  4FAP B;  1OXK A;  4Z9I A;  1O3U A;  4P6I C;  1JMW A;  3RIP A;  2YL1 A;  2FAP B;  3NKD A;  2EPO A;  4XPX A;  3S27 A;  3UMI A;  4WGY A;  1JPN A;  5DS5 A;  3F47 A;  1WN0 A;  3LNR A;  2YHS A;  4E17 A;  1H9G A;  1OXB A;  2DYR C;  1EI7 A;  3GOD A;  1T5O A;  4U5B E;  4J7T A;  4U5G A;  1B68 A;  1XZP A;  4NY3 A;  2VCB A;  3RH3 A;  5BQH A;  3B0U X;  2BC5 A;  3EGD B;  4MW3 A;  5JRA A;  2ZXW C;  4C3D A;  1T6U A;  2J7P D;  2Q4F A;  4XLP F;  3R7C A;  4YJW A;  3EQL F;  3H2U A; 
#chains in the Genus database with same CATH homology
 5T3W A;  5KYX A;  2Q9A A;  3DM5 A;  1QLE C;  4ZLC A;  4W8K A;  3HTK C;  2P7V A;  3EGX B;  2PFD A;  2WB7 A;  3KKB A;  2KGO A;  2J7P A;  3SP1 A;  3E70 C;  3L0I A;  1JPJ A;  3EG9 B;  4J30 B;  4RDA A;  3ZIB A;  4CSA C;  5F5F A;  2J9W A;  5EHH A;  4LLC A;  2FFH A;  3K6B A;  3PHF 2;  4DOZ A;  4IRU A;  1VMA A;  3EGD A;  4CIH A;  2ZXP A;  1VOM A;  4FWV A;  2WVN A;  3W8H A;  2CDQ A;  4G7H F;  3EJN A;  4LAC B;  1LKX A;  3E9V A;  2EIM C;  2LSE A;  5KYN A;  2J45 A;  4LLE A;  2B0J A;  3EGX A;  3EPV A;  4B6I A;  4O79 A;  5DQT A;  1LVK A;  3WOD F;  1OKK D;  4O6Y A;  4E7Z A;  1M56 C;  3EG9 A;  5E2Q A;  3AG2 C;  1ZHW A;  2CW0 F;  1Z63 A;  1ZU5 A;  4DVY P;  3NYM A;  1PD1 A;  3V7O A;  3W8I A;  4JW1 A;  1VYK A;  1Z3I X;  2Q9C A;  4PJL A;  1OKK A;  3ABM C;  4CS9 A;  2YEV A;  3JCU Q;  4QDL A;  1ZYR F;  1ZU4 A;  3HLZ A;  4KNW A;  4ULW A;  4PJN A;  4BJT A;  4FX5 A;  5CI9 A;  3ZVR A;  3VAY A;  5CI8 A;  3ZG1 A;  3EH1 A;  4U5D E;  4CBE A;  4OIN F;  3LJB A;  4DBR A;  5D92 A;  4KBL A;  2XRH A;  4H4K C;  3S28 A;  4G7Z F;  1KU2 A;  4K0D A;  2PX0 A;  3FHD A;  3UGP A;  4CS8 A;  3VYW A;  3O39 A;  2QY9 A;  2X51 A;  2IOQ A;  3B0P A;  4BJ6 A;  3DAF A;  3NG1 A;  3H65 A;  2YZS A;  3AQB A;  3GAN A;  3T6B A;  5L3V A;  3Q6M A;  3OEO A;  4LER A;  2W9Y A;  4BJ1 A;  3K1I C;  4GYT A;  2CNW D;  3B9Q A;  4IWB A;  3UMH A;  1FMV A;  1FFT C;  4ZLD A;  4E7S A;  4U5H A;  4OIP F;  1MMN A;  2A1D D;  1WGW A;  4YT2 A;  2CNW A;  2WL8 A;  2IXP A;  1M2O A;  1MMD A;  3W2V A;  3QZC A;  4HFF B;  2L9J A;  3SYN A;  4HEA J;  3FVY A;  3NYJ A;  2JD3 A;  2R7Q A;  3O6X A;  3WG7 C;  4JZA A;  5FCL A;  2H7B A;  1QZX A;  4WJ0 A;  3JRT A;  3HJC A;  5D91 A;  4RD9 A;  4N06 A;  3UR3 C;  4O6N A;  3FDQ A;  2VAS A;  3T4R A;  1TWA A;  1BR4 A;  1D1B A;  4C3B A;  4OIO F;  2A6H F;  3DM9 B;  5DVW A;  2W4B A;  4HE8 D;  1M2V B;  3EHM A;  3ZC4 A;  3I5P A;  1TWH A;  3UGO A;  3RFY A;  3K7D A;  3RKO F;  1FFH A;  4BJ5 C;  5EGY A;  2WVO A;  3N0T A;  3CZ6 A;  2A69 F;  2G3V A;  4C7O B;  3DJN B;  5B1A C;  2MWQ A;  1D0X A;  2EIN C;  3AG3 C;  4G0H A;  4XTK A;  3EZI A;  2DYS C;  4U5C E;  1O87 A;  2R7O A;  4AK9 A;  3LS1 A;  3ZSU A;  4F4B A;  2R7S A;  3DAG A;  2OG2 A;  4A2N B;  4I1M A;  1V54 C;  3KMI A;  2Y3G A;  2R7V A;  2W45 A;  3M1C B;  1M2V A;  1IZM A;  1D0Y A;  2CGE A;  4PFO A;  2R7U A;  3NYL A;  3UMK A;  1RJ9 B;  4QI2 A;  2M4E A;  1BR1 A;  2A68 F;  4Q5S F;  3MX3 A;  3S0X A;  4C7O A;  5KYY B;  1S7Z A;  1TWG A;  5KYW B;  4XLN F;  2Y3D A;  2XSE A;  2KNH A;  3DXJ F;  3SEO A;  2R7T A;  4CS9 C;  2XXA B;  3EZH A;  1J8M F;  1W2W A;  2WVQ A;  4K7B A;  2IXN A;  3LLK A;  2KW3 C;  2EIL C;  1N1C A;  2R7W A;  2Y39 A;  4KI2 A;  4I1O B;  3SNH A;  3T6J A;  1OCO C;  1PD0 A;  3MLG A;  5E3A A;  2VB6 A;  5KYU B;  3NDB B;  2Q9B A;  1D1A A;  2VH3 A;  4PK4 A;  1RJ9 A;  3Q7G A;  1ZHT A;  4ANJ A;  1V55 C;  2ZXR A;  2PF4 E;  1ZHX A;  1Z5Z A;  4OIR F;  2G62 A;  3JT1 A;  2I8B A;  3LAY A;  5KYY A;  3F46 A;  4OD4 A;  5T1D B;  4IAO A;  3PMR A;  4CS8 C;  4G7O F;  5KYW A;  3UNG C;  4YT4 A;  2XXA A;  4BJ6 C;  3SZR A;  3L34 A;  4YT5 A;  1J8Y F;  1ST6 A;  3KH2 A;  1OCZ C;  2J46 A;  3AG4 C;  5B3S C;  1NZE A;  3AG1 C;  3EHN A;  3LS0 A;  2ZPA A;  3TD7 A;  4GEH A;  5F5H A;  5KYU A;  2BE5 F;  1LS1 A;  1FTS A;  3POV A;  4XWJ A;  4KC9 A;  4KNV A;  2PP4 A;  1OCC C;  1NU9 C;  4BG0 A;  2XL4 A;  2HV7 A;  5DQZ A;  4I3M A;  5B1B C;  1VYI A;  1FMW A;  3ABK C;  4YWQ A;  4I44 A;  3S29 A;  2W4M A;  2A6E F;  1ZHZ A;  4RBN A;  1VK5 A;  2Y3H A;  1G8X A;  5T3T A;  1D1C A;  3N24 A;  3Q6N A;  4U5E E;  4CSA A;  1M57 C;  3X2Q C;  2J9V A;  5DS4 A;  4JJG A;  2IXM A;  1TR2 A;  4JJF A;  1TKN A;  3ASO C;  4PJM A;  1MND A;  2EIK C;  3ITF A;  2Q3T A;  4Q7C A;  5E33 A;  2J9U A;  2J0W A;  3DD7 A;  4MQ9 F;  5E3C A;  4BJ5 A;  4FES A;  1NU7 D;  3EFO B;  1SZI A;  4C3E A;  4QI0 A;  2EIJ C;  2NUP B;  4HFK B;  4AE4 B;  4MND A;  4EBB A;  3JSZ A;  1D0Z A;  4YT8 A;  4M63 A;  1PCX A;  3OA1 A;  3DMD A;  2NG1 A;  4O6M A;  3DJU B;  3IEE A;  3Q7L A;  3LES A;  1MMG A;  1MMA A;  4YN0 B;  3I4U A;  4O7G A;  2J0X A;  2C03 A;  2Y69 C;  3EH2 A;  3DZA A;  3JYH A;  3EFO A;  2P6V A;  2D5R B;  3QMK A;  2NUT B;  1Z23 A;  3AQC A;  1IW7 F;  3CSK A;  2E87 A;  3K33 A;  4EWC A;  4JCH A;  2NUP A;  4IJJ A;  3ECS A;  3KL4 A;  2V3C C;  4AE4 A;  2HV6 A;  2PX3 A;  3I5Q A;  3RYL A;  4DBQ A;  3W2W A;  1ZHY A;  4OD5 A;  4Q4Z F;  2G3K A;  2WZG A;  1OCR C;  2OCC C;  5BUO A;  2V26 A;  3ASN C;  3B0V C;  4X0R A;  5DS6 A;  2Z15 A;  2O9X A;  4PFP A;  3FAJ A;  2MYS A;  1NG1 A;  3OWT A;  3LEV A;  3NKE A;  2Y3B A;  5DLJ A;  2QTV A;  3X1O A;  3NRH A;  1TWC A;  2NUT A;  1MNE A;  3K1H A;  2WZL A;  4JUR I;  4CS7 A;  4OIQ F;  2R7X A;  5L3Q A;  4PJJ A;  2L81 A;  2H7V C;  2IXO A;  4BEJ A;  2KQ9 A;  3ABL C;  5HSW A;  1BR2 A;  1SMY F;  4AX2 A;  2KJG A;  3CQZ A;  4J32 B;  2WZF A;  5KYX B;  2H7O A;  3N2Z B;  2GFH A;  4JVS A;  5IY5 C;  4DVZ A;  2IYL D;  2FGY A;  3LLI A;  2C04 A;  2R7R A;  1O5H A;  1SF8 A;  2DGJ A;  1Z6A A;  3K66 A;  4U5F E;  4P6I C;  3RIP A;  3NKD A;  3S27 A;  3UMI A;  1JPN A;  5DS5 A;  3F47 A;  3LNR A;  2YHS A;  2DYR C;  3GOD A;  4U5B E;  4U5G A;  4NY3 A;  3RH3 A;  3B0U X;  3EGD B;  2ZXW C;  4C3D A;  2J7P D;  2ZXO A;  4XLP F;  4YJW A;  3EQL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...