2JD3A

Parr from plasmid pb171
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
KRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords STBB PROTEIN
publication title Structural Analysis of the Parr/Parc Plasmid Partition Complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1170 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2jd3A01
2JD3A
chains in the Genus database with same CATH superfamily
3R7CA 2XLDA 2JD3A 3K6BA 4A2NB 5COFA 5BQHA 4NTAA 4CBEA 3VAYA 4PJMA 1YDIA 1XZPA 3MLGA 2R05A 2MWQA 2A68F 2NUPA 4Z9HA 5BQGA 3K1IC 4LERA 3ZC4A 4EBKA 2BE5F 2IYLD 1V55C 2R03A 2XLMA 3PDMP 4YN0B 4OIOF 1N1CA 3ZQYA 3VRCA 1OKKD 2Y3BA 1HW1A 3QZCA 4JVSA 4O6YA 3C8GB 4O79A 4BJ6C 4EIYA 4XEVA 4AE4B 4JURI 4OIPF 2AP3A 3UMHA 1ST6A 2EIJC 1HE1A 1OR3A 4YL1A 4O7GA 5TJ5E 1BR2A 1FAPB 1OW6A 3QVYA 2EPOA 2IXNA 5JUAA 3G4XA 5COMA 4N6HA 3MFNA 3JSZA 5BQIA 1NU9C 3CZ6A 4DOZA 5E2QA 3FAPB 1YAUO 1QZXA 2VCBA 3LLKA 1GQAA 3I4UA 3Q7LA 3RVZA 1Z6AA 4DBQA 3C63A 4O6NA 3RQEA 2MHRA 2J9BA 2VCCA 2R02A 3CQZA 4KNVA 1M2VB 5CI8A 1SMYF 3NMJA 4IRUA 2PX3A 4X0RA 4XEFA 4MTFA 1RMVA 5L0FA 4RDAA 1EA8A 1OCRC 1DOVA 3EHNA 3U5SA 5DS6A 5CIVA 1BBHA 2XLOA 3C8GD 3HNLA 4K1OA 1LS1A 1Y4CA 1BR4A 1MMNA 1T6IA 1TWAA 3GEEA 5D91A 2YL7A 2UUIA 1VLSA 1TWHA 3JZ0A 3ZG1A 4Q4ZF 2A0UA 1GGQA 2G3KA 2LFDA 2YLIA 2WB7A 1Y6DA 3C8GA 3IQ5A 3PHF2 1S7ZA 3NDBB 3GANA 3FMSA 2HS5A 2QTVA 2YHSA 3AG1C 3IQCA 4AE4A 3S0XA 4CDAA 4OD5A 4P6IC 3QW0A 4CSAA 1E2XA 1KU2A 2HSQA 2OEVA 4LLCA 4XTKA 3DAGA 1WWPA 3AGTA 3NMIA 4JCHA 2A6HF 3O10A 4G7HF 4KI2A 1ORYA 2DGJA 3EH1A 4XEKA 2YL0A 3GWNA 4ULWA 3NKEA 3CAXA 2D4UA 3DJUB 4HE8D 2B0HA 3VF0A 1VOMA 2PFDA 5E3AA 5L0DA 2J9VA 3ZTZA 4L6RA 3EQLF 2A1DD 1M2VA 2MYSA 2CGEA 3F46A 2W9YA 3QMKA 4RD9A 5T3WA 2V3CC 2Q9CA 2CW0F 1LS4A 3KKBA 2HFIA 4AX2A 4E7SA 3WG7C 2PF4E 1JPJA 2XLWA 3PMRA 1G4US 4GQHA 2CNWD 4W8PA 3W2VA 3QVZA 3DJNB 2OG2A 1A41A 1LPEA 1HMDA 5T1DB 3KYIA 4EUKB 2EPNA 3T9OA 5KYNA 1M6TA 4DRIB 3EZIA 1E86A 2EIKC 1GS9A 5F28E 2CCYA 3SXKA 5D92A 1Q0FA 2XLVA 1G4WR 3K66A 4ZLDA 2LIGA 4WGYA 1M57C 2KW3C 2L6GA 2KNHA 3RQGA 1SF8A 2R7SA 1YJGA 3TD7A 3NMKA 2PBEA 3NYMA 4YL3A 1W2WA 4IJJA 3ZWIA 4QI2A 3UGPA 1Z23A 5HV9A 3L0IA 2HJ3A 4QI0A 4XWJA 1UFBA 2Q9AA 5L0GA 2FAPB 1Z7Qc 1PV3A 3DE8A 3I5QA 5FZTA 2R7QA 1E84A 4XPWA 3SXZA 1MMGA 3W8IA 1OCOC 3C7JA 4G7OF 3Q7GA 1D0XA 1VYKA 2I15A 4FESA 4CS7A 5JVEA 3BRJA 5KYWB 3LEVA 4BPMA 1Z5ZA 1ZU4A 1VK5A 2R7OA 4DRHB 2A0BA 3SP1A 3DE9A 1LKXA 2KJGA 3EJNA 3TQOA 4NTBA 5DQZA 4JC7A 1Q0DA 1VLTA 2O9XA 2CDQA 4NC3A 4PJJA 2D5RB 2LFFA 3FXHA 5CI9A 5B1BC 1YARO 4N06A 3RYLA 2Y69C 2GWWA 2DYSC 4MNDA 3M79A 2GA0A 1TKNA 1SR2A 1FFHA 1T5OA 2KSFA 3L34A 2YWAA 4MVSA 4AL0A 4CJGA 3AG4C 5A6KA 2DYRC 1JAFA 4DVZA 4GEHA 4PJLA 1OR2A 2H7VC 2LQGA 1ORSC 3EFOB 4FX5A 4I1OB 4J7TA 2ZPAA 2CYDA 3C18A 3EZHA 3O55A 4DJ9A 3EGDA 5A6BA 1QLEC 2G3VA 2BL2A 2XL8A 4PJNA 2KQ9A 5EHHA 5KYUB 1ZU5A 1RJ9B 1TQGA 2DB4A 1NBBA 1NG1A 3EG9A 2Z15A 3A9CA 1JR8A 3K1HA 4JKVA 4U5CE 3S28A 4YL0A 5K0IA 4IB4A 2IXMA 3IQTA 3VM6A 3V5XA 3X1OA 4RBNA 4EWCA 2AWYA 1MMDA 3W2WA 5KYWA 3TJ5A 1QSPA 1D0ZA 3ZVRA 1CPRA 2YL3A 3LUTB 4JRZA 3KPHA 1A7EA 2FFHA 3I5PA 3U8PA 2ETSA 4K7BA 4C3BA 3ZIBA 2E87A 1NFOA 1OKKA 1YZAA 1J8MF 1QPUA 2M64A 5FCLA 1BZ4A 2KK1A 2P7VA 3ATPA 3KMIA 1LE4A 4LLEA 1LE2A 4KBLA 2EPKX 1F1MA 3M1CB 4CS9A 3DM9B 3EPVA 1R5ID 3DZAA 1JMWA 3U0CA 1ZHTA 4I1MA 4U9EA 4HEAJ 3NKDA 4QDLA 1ZHYA 4FWVA 2XRHA 3LESA 4K0DA 4XLPF 2XXAB 2A6EF 2RSEB 2ICWG 3SXYA 2BC5A 5AGFA 4YT2A 4Q7CA 2R7TA 3QW1A 1LI5A 5KYUA 1NLXA 4G78A 1RJ9A 4YT5A 2IOQA 1CGME 3JYHA 1WASA 1ZW3A 1J8YF 3Q6NA 4AL1A 3AQBA 4A4AA 1MNEA 4PFOA 1LIHA 3L8JA 1C02A 3ZDLA 5AC5A 4CS8A 5F5FA 4E17A 4DVYP 3B9QA 1YZCA 3IHUA 4LDQA 2AWCA 2PP4A 4MVQA 1I5NA 2JX0A 4PFPA 2YL1A 3H2UA 4JE9A 4R32A 1G8XA 3M15A 4FAPB 3S84A 5E33A 2W4BA 3N0TA 3AJMA 4BJ1A 4ZLCA 4OIQF 4HFFB 4JTDB 3UGOA 2KYHA 1TFKB 4DXWA 5COGA 2EILC 3ASOC 2C04A 1FMVA 4JTAB 1OXBA 4CDYA 1G5ZA 5IY5C 3ABKC 2HMZA 3X2QC 2YZSA 4YWQA 3L8IA 2OJED 3U9MA 2OKUA 4EBJA 2XXAA 2HUJA 2XM0A 2VH3A 2ZXOA 1MQVA 5L3QA 1SYQA 1CPQA 1OQCA 4PACA 3C62A 3GM2A 1E85A 2KGOA 1OCZC 3PCVA 4N6CA 5GPGB 1QVXA 2L6HA 1BR1A 1MNDA 3GEHA 4NTFA 3VYWA 4CDVA 4J30B 3JTLO 3UR3C 1LM3B 2VC9A 1XWJA 5A6AA 4U5HA 1M56C 5L0JA 1VYIA 3LNMB 2P1AA 3AG2C 2YLDA 1H7IA 3BEHA 1VB5A 1S05A 2B0JA 3V5YA 4XQ1A 4CJOA 1HW2A 4LACB 4G7ZF 2TMVP 4CSAC 1FR0A 3LNRA 2C03A 1T9KA 2NUTA 3MBGA 1RCPA 2CNWA 4J32B 3B0VC 2EINC 2Y39A 4ULVA 2LD6A 2HV7A 3RFYA 3E9VA 3EGXB 1LVKA 1QKRA 2OEXA 1EKYA 4JZAA 4MVZA 2L7AA 3E70C 3LEOA 3S9OA 3AG3C 1T6UA 3LAYA 3SXMA 2YRFA 4Q5SF 2DI3A 5B3SC 3T6GB 2QE9A 2ZXRA 4JJGA 2J46A 1MMAA 1U6HA 2Q3TA 3J06A 4CIHA 1Q0KA 2W45A 4LDRA 2HMQA 1OW8A 1WN0A 2WZFA 4ONSA 5EGYA 5KYYB 2PNOA 2QLAA 2KC3A 3CSKA 3MX3A 2I8BA 3US6A 3B29A 1NU7D 3EH2A 1Z3IX 3A11A 4P9TA 2NSFA 4YT4A 5DS5A 3L1MA 4JTCB 1C17M 2GDCA 2M4EA 2IM8A 4EBBA 3W8HA 5DLJA 3GEIA 1A7VA 1HY5A 1EQ1A 1TFOB 2J7PD 2L6FA 3ITFA 2J8WA 1ZHZA 3TK0A 4BG0A 2NUTB 3C8ZA 1PD1A 2XLHA 2ZXPA 1WGWA 3ECSA 3DAFA 3R2PA 2OU6A 3JT1A 4IGGA 4O6MA 1YLMA 4BJ5A 1R4TA 2J7PA 1NFNA 2NUPB 3DD7A 4MVUA 5JP7A 4BJTA 2WVNA 4U9DA 2XS8A 3UMKA 4MW3A 1DOWA 1ZYRF 1V54C 3JSEO 1FFTC 3EGXA 2Q4FA 4CX9A 3SNHA 5HSWA 4WJ0A 4BEJA 3OA1A 4MW8A 3DWWA 3V5ZA 2QUPA 2R7WA 4E7ZA 4PR9A 3B0PA 4MVRA 5DQTA 3IPMO 3HJCA 2WVQA 3FVYA 2L9JA 3LS0A 1NSGB 3HLZA 4JEAA 1ZHXA 4ANJA 1QQ3A 4YJWA 5JSLA 3RH3A 4YT8A 1U0BB 3U2MA 4BJ6A 2G62A 1TWCA 4GYTA 4IAQA 4C7OB 2EPMX 3HTKC 2QNLA 1YYJA 2Y3DA 2YLGA 2J0WA 4IARA 4ER9A 2IBFA 1PCXA 3ABLC 2V26A 1BDJB 1KTMA 4U5BE 2HJMA 2H8AA 2Q9BA 4AK9A 2FGYA 3NRHA 4EHPA 3ZSUA 1H9TA 5L3VA 4N4WA 4HFKB 1PD0A 2L81A 1UG7A 2EIMC 4EKWA 3EFOA 2IXPA 4DBRA 3GM3A 2W4MA 5KYXB 2R7UA 2GFHA 1L7CA 2PX0A 5AC4A 1K40A 2ZXWC 1L3PA 1ZW2A 1HMOA 256BA 4I3MA 3RF3A 1U89A 1WTYA 3F47A 1GM5A 1ZHWA 1B68A 4WGZA 5EK0A 3LS1A 3RQFA 2YVKA 1VMAA 1WOLA 2OCCC 1YA9A 3FHDA 4E18A 1RKEB 2H7OA 3T6BA 2XS1A 3U8VA 2IXOA 4CIPA 2HKVA 1C03A 2NSGA 1JOGA 3UMIA 5JS5A 2YKZA 3HNJA 1APCA 1OXKA 4MVMA 3N2ZB 1WATA 1JPNA 2R9RB 1Q0MA 2YEVA 4KNWA 4C7OA 3TOLA 3FDQA 3ZQVA 4CS9C 5B3IA 3ASNC 3S27A 2R7RA 1CGOA 1TWGA 3NG1A 3DKAA 3U3FA 1E83A 2R7VA 2OJQA 2X51A 1SZIA 3JYYA 3TJ6A 3LJBA 3GM1A 1V74B 1TR2A 3K33A 3AOUA 3AQCA 5BUOA 4XPYA 1KNYA 3B0UX 1NZEA 2NPUA 1O5HA 4F4BA 2R7XA 3M4CA 3JCUQ 2H7BA 2XM4A 4BEMJ 4E0IA 5KYXA 2AVKA 3SZRA 3FOOA 1XZQA 2Y3HA 4CS8C 1H6GA 2ASRA 1JRAA 4KC9A 2J0XA 1H9GA 3S29A 4OIRF 2ZD9A 3NYJA 3NYLA 3TOMA 5JLIA 1OW7A 1K05A 1RKEA 1AVOB 2VASA 3DM5A 5T3TA 4NQFA 3RKOF 3KYJA 3AGUA 3GODA 3O6XA 3OWTA 4U5DE 3UNGC 4G0HA 1AEPA 2J9WA 1O3UA 4H4KC 1ZVZA 2JPUA 4M63A 5L0HA 1D1AA 2GAQA 2J45A 2Y3GA 4JW1A 2UUHA 5A69A 1Z63A 3RW0A 1D1CA 1RKCA 3K7DA 4LDKA 2LSEA 4YK5A 4Z9IA 2EPLX 4UDVA 3KL4A 1OCCC 4XLNF 4U5GA 1D0YA 2HV6A 2WL8A 3LLIA 2QY9A 1A0BA 2J9UA 1FTSA 2WZGA 4IAOA 5F5HA 2WVOA 1EI7A 2Q7RA 3SEOA 2P6VA 3WAQA 4JCZA 1IZMA 5JRAA 3FAJA 4WABA 3EHMA 4MTOA 1I4YA 2OOCA 2VB6A 4P9FA 3KH2A 3ZTMA 3U2LA 4MQ9F 3GWLA 3SYNA 3MYFA 1K04A 2P61A 3V7OA 3ABMC 1AUEA 2VCAA 3U3BA 4JEBA 3GORA 3O39A 4C3DA 2YQYA 3N24A 4J7YA 5E3CA 4NY3A 3WODF 3MYIA 2HZ8A 2XL6A 3CEXA 3EGDB 4OD4A 3T6JA 3HNIA 2P0NA 3W4YA 2LK4A 3T4RA 3EG9B 2F22A 1A7DA 1ORJA 1I4ZA 2XLEA 3DI5A 2WZLA 3QTHA 1RXQA 1T6QA 5L0IA 4H54A 4D4NA 3TULA 4NCQA 3JRTA 4MS2A 1YA7O 4PK4A 4OINF 2X0CA 5B1AC 2NG1A 1CGNA 3FOPA 1LI7A 2LCHA 3H65A 3HKKA 4MTGA 2LP4A 4JJFA 5A6JA 1FNTc 4IWBA 2XL4A 3K1IA 1D1BA 4MVOA 1T01A 1FMWA 3B71A 1IW7F 1ZZPA 3DXJF 3JRMO 1V4AA 4XPXA 3S90A 3M4BA 2Q00A 3G50A 3U9JA 3IQ6A 1O87A 3RIPA 4C3EA 3RVYA 5KYYA 3DMDA 3IEEA 3HNKA 3OEOA 4U5FE 2HSBA 4I44A 5A6BD 4U5EE 2XSEA 2A69F 4D4XA 3H2VA 1VTMP 4Z9JA 4W8KA 2RD9A 1HE9A 2AU5A 3WHNA 4E0HA 1M2OA 1YYXA 4BJ5C 4JIOA 4DRJB 5L0CA 4B6IA 5DS4A 1Q0GA 5JT4A 3Q6MA 5DVWA 3POVA 2OQMA 1YVIA 2R25A 3G4ZA
chains in the Genus database with same CATH topology
2JD3A 3K6BA 4A2NB 4CBEA 3VAYA 4PJMA 3MLGA 2MWQA 2A68F 2NUPA 3K1IC 4LERA 3ZC4A 2BE5F 2IYLD 1V55C 4YN0B 4OIOF 1N1CA 1OKKD 2Y3BA 3QZCA 4JVSA 4O6YA 4BJ6C 4O79A 4AE4B 4JURI 4OIPF 3UMHA 1ST6A 2EIJC 4O7GA 1BR2A 2IXNA 3JSZA 1NU9C 3CZ6A 4DOZA 5E2QA 1QZXA 3Q7LA 3LLKA 3I4UA 4DBQA 1Z6AA 4O6NA 3CQZA 4KNVA 1M2VB 5CI8A 1SMYF 4IRUA 2PX3A 4X0RA 4RDAA 1OCRC 3EHNA 5DS6A 1LS1A 1BR4A 1MMNA 1TWAA 5D91A 1TWHA 3ZG1A 4Q4ZF 2G3KA 2WB7A 3PHF2 1S7ZA 3NDBB 3GANA 2YHSA 2QTVA 3AG1C 4AE4A 3S0XA 4OD5A 4P6IC 4CSAA 1KU2A 4LLCA 4XTKA 3DAGA 4JCHA 2A6HF 4G7HF 4KI2A 2DGJA 3EH1A 4ULWA 3NKEA 3DJUB 4HE8D 1VOMA 2PFDA 5E3AA 2J9VA 3EQLF 2A1DD 1M2VA 2MYSA 2CGEA 3F46A 2W9YA 3QMKA 4RD9A 5T3WA 2V3CC 2Q9CA 2CW0F 3KKBA 4AX2A 3WG7C 2PF4E 1JPJA 3PMRA 2CNWD 3W2VA 3DJNB 2OG2A 5T1DB 5KYNA 3EZIA 2EIKC 5D92A 3K66A 4ZLDA 1M57C 2KW3C 2R7SA 2KNHA 1SF8A 3TD7A 3NYMA 1W2WA 4IJJA 4QI2A 3UGPA 1Z23A 3L0IA 4QI0A 4XWJA 2Q9AA 3I5QA 2R7QA 1MMGA 3W8IA 1OCOC 4G7OF 3Q7GA 1D0XA 1VYKA 4FESA 4CS7A 5KYWB 3LEVA 1Z5ZA 1ZU4A 1VK5A 2R7OA 3SP1A 1LKXA 2KJGA 3EJNA 5DQZA 4PJJA 3X2QC 2O9XA 2CDQA 5B1BC 2D5RB 5CI9A 3RYLA 4N06A 2Y69C 4MNDA 2DYSC 1TKNA 1FFHA 3L34A 3AG4C 2DYRC 4DVZA 4GEHA 4PJLA 2H7VC 4FX5A 3EFOB 4I1OB 2ZPAA 3EZHA 3EGDA 1QLEC 2G3VA 4PJNA 5EHHA 5KYUB 2KQ9A 1ZU5A 1RJ9B 1NG1A 3EG9A 2Z15A 3K1HA 4U5CE 3S28A 2IXMA 3X1OA 4RBNA 4EWCA 3W2WA 1MMDA 5KYWA 3ZVRA 1D0ZA 2FFHA 3I5PA 4K7BA 4C3BA 3ZIBA 2E87A 1OKKA 5FCLA 1J8MF 2P7VA 3KMIA 4LLEA 4KBLA 3M1CB 4CS9A 3DM9B 3EPVA 3DZAA 1ZHTA 4I1MA 4HEAJ 3NKDA 4QDLA 1ZHYA 4FWVA 2XRHA 3LESA 4K0DA 4XLPF 2XXAB 2A6EF 4Q5SF 4YT2A 4Q7CA 2R7TA 5KYUA 1RJ9A 4YT5A 2IOQA 3JYHA 3Q6NA 1J8YF 3AQBA 1MNEA 4PFOA 5F5FA 4CS8A 4DVYP 3B9QA 2PP4A 4PFPA 1G8XA 5E33A 2W4BA 3N0TA 4BJ1A 4ZLCA 4OIQF 4HFFB 3UGOA 2EILC 3ASOC 2C04A 1FMVA 5IY5C 3ABKC 2YZSA 4YWQA 2XXAA 2VH3A 2ZXOA 5L3QA 2KGOA 1OCZC 3VYWA 1BR1A 1MNDA 4J30B 3UR3C 4U5HA 1M56C 1VYIA 3AG2C 2B0JA 4CSAC 4LACB 4G7ZF 3LNRA 2C03A 2CNWA 4J32B 3B0VC 2EINC 2Y39A 3RFYA 2HV7A 3E9VA 3EGXB 1LVKA 4JZAA 3E70C 3AG3C 3LAYA 5B3SC 2ZXRA 4JJGA 2J46A 1MMAA 2Q3TA 4CIHA 2W45A 2WZFA 5KYYB 5EGYA 3MX3A 3CSKA 2I8BA 1NU7D 3EH2A 1Z3IX 4YT4A 5DS5A 2M4EA 4EBBA 3W8HA 5DLJA 3ITFA 2J7PD 1ZHZA 4BG0A 2NUTB 1PD1A 2ZXPA 1WGWA 3ECSA 3DAFA 3JT1A 4O6MA 4BJ5A 2J7PA 2NUPB 3DD7A 4BJTA 2WVNA 3UMKA 1ZYRF 1V54C 1FFTC 3EGXA 3SNHA 5HSWA 4WJ0A 4BEJA 3OA1A 2R7WA 4E7ZA 3B0PA 5DQTA 3HJCA 2WVQA 3FVYA 2L9JA 3LS0A 3HLZA 1ZHXA 4ANJA 4YJWA 3RH3A 4YT8A 4BJ6A 2G62A 1TWCA 4GYTA 4C7OB 3HTKC 2Y3DA 2J0WA 1PCXA 3ABLC 2V26A 4U5BE 2Q9BA 4AK9A 2FGYA 3NRHA 3ZSUA 5L3VA 4HFKB 1PD0A 2L81A 2EIMC 3EFOA 2IXPA 4DBRA 5KYXB 2W4MA 2R7UA 2GFHA 2PX0A 2ZXWC 4I3MA 3F47A 1ZHWA 3LS1A 1VMAA 2OCCC 3FHDA 3T6BA 2H7OA 2IXOA 3UMIA 3N2ZB 1JPNA 2YEVA 4KNWA 4C7OA 3FDQA 4CS9C 3ASNC 3S27A 2R7RA 1TWGA 3NG1A 2R7VA 2X51A 1SZIA 3LJBA 1TR2A 3K33A 3AQCA 5BUOA 3B0UX 1NZEA 4F4BA 1O5HA 2R7XA 3JCUQ 2H7BA 5KYXA 3SZRA 2Y3HA 4CS8C 4KC9A 2J0XA 3S29A 3NYLA 3NYJA 2VASA 5T3TA 3DM5A 3RKOF 3GODA 3O6XA 3OWTA 4U5DE 3UNGC 4G0HA 2J9WA 4H4KC 4M63A 1D1AA 2J45A 2Y3GA 4JW1A 1Z63A 1D1CA 3K7DA 2LSEA 3KL4A 1OCCC 4XLNF 4U5GA 1D0YA 2HV6A 2WL8A 3LLIA 2QY9A 2J9UA 2WZGA 1FTSA 4IAOA 5F5HA 4E7SA 2WVOA 3SEOA 2P6VA 1IZMA 3FAJA 3EHMA 2VB6A 3KH2A 4MQ9F 3SYNA 3V7OA 3ABMC 3O39A 4C3DA 3N24A 5E3CA 4NY3A 3WODF 4OD4A 3EGDB 3T6JA 3T4RA 3EG9B 2WZLA 3JRTA 4PK4A 4OINF 5B1AC 2NG1A 3H65A 4JJFA 4IWBA 2XL4A 4OIRF 1D1BA 3DXJF 1FMWA 1IW7F 4C3EA 1O87A 5KYYA 3DMDA 3IEEA 3OEOA 4U5FE 4I44A 4U5EE 2XSEA 2A69F 4W8KA 1M2OA 4BJ5C 4B6IA 5DS4A 3POVA 3Q6MA 5DVWA 2NUTA 3RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JD3 A; 
#chains in the Genus database with same CATH topology
 3R7C A;  2XLD A;  2JD3 A;  3K6B A;  4A2N B;  5COF A;  5BQH A;  4NTA A;  4CBE A;  3VAY A;  4PJM A;  1YDI A;  1XZP A;  3MLG A;  2R05 A;  2MWQ A;  2A68 F;  2NUP A;  4Z9H A;  5BQG A;  3K1I C;  4LER A;  3ZC4 A;  4EBK A;  2BE5 F;  2IYL D;  1V55 C;  2R03 A;  2XLM A;  3PDM P;  4YN0 B;  4OIO F;  1N1C A;  3ZQY A;  3VRC A;  1OKK D;  2Y3B A;  1HW1 A;  3QZC A;  4JVS A;  4O6Y A;  3C8G B;  4O79 A;  4BJ6 C;  4EIY A;  4XEV A;  4AE4 B;  4JUR I;  4OIP F;  2AP3 A;  3UMH A;  1ST6 A;  2EIJ C;  1HE1 A;  1OR3 A;  4YL1 A;  4O7G A;  5TJ5 E;  1BR2 A;  1FAP B;  1OW6 A;  3QVY A;  2EPO A;  2IXN A;  5JUA A;  3G4X A;  5COM A;  4N6H A;  3MFN A;  3JSZ A;  5BQI A;  1NU9 C;  3CZ6 A;  4DOZ A;  5E2Q A;  3FAP B;  1YAU O;  1QZX A;  2VCB A;  3LLK A;  1GQA A;  3I4U A;  3Q7L A;  3RVZ A;  1Z6A A;  4DBQ A;  3C63 A;  4O6N A;  3RQE A;  2MHR A;  2J9B A;  2VCC A;  2R02 A;  3CQZ A;  4KNV A;  1M2V B;  5CI8 A;  1SMY F;  3NMJ A;  4IRU A;  2PX3 A;  4X0R A;  4XEF A;  4MTF A;  1RMV A;  5L0F A;  4RDA A;  1EA8 A;  1OCR C;  1DOV A;  3EHN A;  3U5S A;  5DS6 A;  5CIV A;  1BBH A;  2XLO A;  3C8G D;  3HNL A;  4K1O A;  1LS1 A;  1Y4C A;  1BR4 A;  1MMN A;  1T6I A;  1TWA A;  3GEE A;  5D91 A;  2YL7 A;  2UUI A;  1VLS A;  1TWH A;  3JZ0 A;  3ZG1 A;  4Q4Z F;  2A0U A;  1GGQ A;  2G3K A;  2LFD A;  2YLI A;  2WB7 A;  1Y6D A;  3C8G A;  3IQ5 A;  3PHF 2;  1S7Z A;  3NDB B;  3GAN A;  3FMS A;  2HS5 A;  2QTV A;  2YHS A;  3AG1 C;  3IQC A;  4AE4 A;  3S0X A;  4CDA A;  4OD5 A;  4P6I C;  3QW0 A;  4CSA A;  1E2X A;  1KU2 A;  2HSQ A;  2OEV A;  4LLC A;  4XTK A;  3DAG A;  1WWP A;  3AGT A;  3NMI A;  4JCH A;  2A6H F;  3O10 A;  4G7H F;  4KI2 A;  1ORY A;  2DGJ A;  3EH1 A;  4XEK A;  2YL0 A;  3GWN A;  4ULW A;  3NKE A;  3CAX A;  2D4U A;  3DJU B;  4HE8 D;  2B0H A;  3VF0 A;  1VOM A;  2PFD A;  5E3A A;  5L0D A;  2J9V A;  3ZTZ A;  4L6R A;  3EQL F;  2A1D D;  1M2V A;  2MYS A;  2CGE A;  3F46 A;  2W9Y A;  3QMK A;  4RD9 A;  5T3W A;  2V3C C;  2Q9C A;  2CW0 F;  1LS4 A;  3KKB A;  2HFI A;  4AX2 A;  4E7S A;  3WG7 C;  2PF4 E;  1JPJ A;  2XLW A;  3PMR A;  1G4U S;  4GQH A;  2CNW D;  4W8P A;  3W2V A;  3QVZ A;  3DJN B;  2OG2 A;  1A41 A;  1LPE A;  1HMD A;  5T1D B;  3KYI A;  4EUK B;  2EPN A;  3T9O A;  5KYN A;  1M6T A;  4DRI B;  3EZI A;  1E86 A;  2EIK C;  1GS9 A;  5F28 E;  2CCY A;  3SXK A;  5D92 A;  1Q0F A;  2XLV A;  1G4W R;  3K66 A;  4ZLD A;  2LIG A;  4WGY A;  1M57 C;  2KW3 C;  2L6G A;  2KNH A;  3RQG A;  1SF8 A;  2R7S A;  1YJG A;  3TD7 A;  3NMK A;  2PBE A;  3NYM A;  4YL3 A;  1W2W A;  4IJJ A;  3ZWI A;  4QI2 A;  3UGP A;  1Z23 A;  5HV9 A;  3L0I A;  2HJ3 A;  4QI0 A;  4XWJ A;  1UFB A;  2Q9A A;  5L0G A;  2FAP B;  1Z7Q c;  1PV3 A;  3DE8 A;  3I5Q A;  5FZT A;  2R7Q A;  1E84 A;  4XPW A;  3SXZ A;  1MMG A;  3W8I A;  1OCO C;  3C7J A;  4G7O F;  3Q7G A;  1D0X A;  1VYK A;  2I15 A;  4FES A;  4CS7 A;  5JVE A;  3BRJ A;  5KYW B;  3LEV A;  4BPM A;  1Z5Z A;  1ZU4 A;  1VK5 A;  2R7O A;  4DRH B;  2A0B A;  3SP1 A;  3DE9 A;  1LKX A;  2KJG A;  3EJN A;  3TQO A;  4NTB A;  5DQZ A;  4JC7 A;  1Q0D A;  1VLT A;  2O9X A;  2CDQ A;  4NC3 A;  4PJJ A;  2D5R B;  2LFF A;  3FXH A;  5CI9 A;  5B1B C;  1YAR O;  4N06 A;  3RYL A;  2Y69 C;  2GWW A;  2DYS C;  4MND A;  3M79 A;  2GA0 A;  1TKN A;  1SR2 A;  1FFH A;  1T5O A;  2KSF A;  3L34 A;  2YWA A;  4MVS A;  4AL0 A;  4CJG A;  3AG4 C;  5A6K A;  2DYR C;  1JAF A;  4DVZ A;  4GEH A;  4PJL A;  1OR2 A;  2H7V C;  2LQG A;  1ORS C;  3EFO B;  4FX5 A;  4I1O B;  4J7T A;  2ZPA A;  2CYD A;  3C18 A;  3EZH A;  3O55 A;  4DJ9 A;  3EGD A;  5A6B A;  1QLE C;  2G3V A;  2BL2 A;  2XL8 A;  4PJN A;  2KQ9 A;  5EHH A;  5KYU B;  1ZU5 A;  1RJ9 B;  1TQG A;  2DB4 A;  1NBB A;  1NG1 A;  3EG9 A;  2Z15 A;  3A9C A;  1JR8 A;  3K1H A;  4JKV A;  4U5C E;  3S28 A;  4YL0 A;  5K0I A;  4IB4 A;  2IXM A;  3IQT A;  3VM6 A;  3V5X A;  3X1O A;  4RBN A;  4EWC A;  2AWY A;  1MMD A;  3W2W A;  5KYW A;  3TJ5 A;  1QSP A;  1D0Z A;  3ZVR A;  1CPR A;  2YL3 A;  3LUT B;  4JRZ A;  3KPH A;  1A7E A;  2FFH A;  3I5P A;  3U8P A;  2ETS A;  4K7B A;  4C3B A;  3ZIB A;  2E87 A;  1NFO A;  1OKK A;  1YZA A;  1J8M F;  1QPU A;  2M64 A;  5FCL A;  1BZ4 A;  2KK1 A;  2P7V A;  3ATP A;  3KMI A;  1LE4 A;  4LLE A;  1LE2 A;  4KBL A;  2EPK X;  1F1M A;  3M1C B;  4CS9 A;  3DM9 B;  3EPV A;  1R5I D;  3DZA A;  1JMW A;  3U0C A;  1ZHT A;  4I1M A;  4U9E A;  4HEA J;  3NKD A;  4QDL A;  1ZHY A;  4FWV A;  2XRH A;  3LES A;  4K0D A;  4XLP F;  2XXA B;  2A6E F;  2RSE B;  2ICW G;  3SXY A;  2BC5 A;  5AGF A;  4YT2 A;  4Q7C A;  2R7T A;  3QW1 A;  1LI5 A;  5KYU A;  1NLX A;  4G78 A;  1RJ9 A;  4YT5 A;  2IOQ A;  1CGM E;  3JYH A;  1WAS A;  1ZW3 A;  1J8Y F;  3Q6N A;  4AL1 A;  3AQB A;  4A4A A;  1MNE A;  4PFO A;  1LIH A;  3L8J A;  1C02 A;  3ZDL A;  5AC5 A;  4CS8 A;  5F5F A;  4E17 A;  4DVY P;  3B9Q A;  1YZC A;  3IHU A;  4LDQ A;  2AWC A;  2PP4 A;  4MVQ A;  1I5N A;  2JX0 A;  4PFP A;  2YL1 A;  3H2U A;  4JE9 A;  4R32 A;  1G8X A;  3M15 A;  4FAP B;  3S84 A;  5E33 A;  2W4B A;  3N0T A;  3AJM A;  4BJ1 A;  4ZLC A;  4OIQ F;  4HFF B;  4JTD B;  3UGO A;  2KYH A;  1TFK B;  4DXW A;  5COG A;  2EIL C;  3ASO C;  2C04 A;  1FMV A;  4JTA B;  1OXB A;  4CDY A;  1G5Z A;  5IY5 C;  3ABK C;  2HMZ A;  3X2Q C;  2YZS A;  4YWQ A;  3L8I A;  2OJE D;  3U9M A;  2OKU A;  4EBJ A;  2XXA A;  2HUJ A;  2XM0 A;  2VH3 A;  2ZXO A;  1MQV A;  5L3Q A;  1SYQ A;  1CPQ A;  1OQC A;  4PAC A;  3C62 A;  3GM2 A;  1E85 A;  2KGO A;  1OCZ C;  3PCV A;  4N6C A;  5GPG B;  1QVX A;  2L6H A;  1BR1 A;  1MND A;  3GEH A;  4NTF A;  3VYW A;  4CDV A;  4J30 B;  3JTL O;  3UR3 C;  1LM3 B;  2VC9 A;  1XWJ A;  5A6A A;  4U5H A;  1M56 C;  5L0J A;  1VYI A;  3LNM B;  2P1A A;  3AG2 C;  2YLD A;  1H7I A;  3BEH A;  1VB5 A;  1S05 A;  2B0J A;  3V5Y A;  4XQ1 A;  4CJO A;  1HW2 A;  4LAC B;  4G7Z F;  2TMV P;  4CSA C;  1FR0 A;  3LNR A;  2C03 A;  1T9K A;  2NUT A;  3MBG A;  1RCP A;  2CNW A;  4J32 B;  3B0V C;  2EIN C;  2Y39 A;  4ULV A;  2LD6 A;  2HV7 A;  3RFY A;  3E9V A;  3EGX B;  1LVK A;  1QKR A;  2OEX A;  1EKY A;  4JZA A;  4MVZ A;  2L7A A;  3E70 C;  3LEO A;  3S9O A;  3AG3 C;  1T6U A;  3LAY A;  3SXM A;  2YRF A;  4Q5S F;  2DI3 A;  5B3S C;  3T6G B;  2QE9 A;  2ZXR A;  4JJG A;  2J46 A;  1MMA A;  1U6H A;  2Q3T A;  3J06 A;  4CIH A;  1Q0K A;  2W45 A;  4LDR A;  2HMQ A;  1OW8 A;  1WN0 A;  2WZF A;  4ONS A;  5EGY A;  5KYY B;  2PNO A;  2QLA A;  2KC3 A;  3CSK A;  3MX3 A;  2I8B A;  3US6 A;  3B29 A;  1NU7 D;  3EH2 A;  1Z3I X;  3A11 A;  4P9T A;  2NSF A;  4YT4 A;  5DS5 A;  3L1M A;  4JTC B;  1C17 M;  2GDC A;  2M4E A;  2IM8 A;  4EBB A;  3W8H A;  5DLJ A;  3GEI A;  1A7V A;  1HY5 A;  1EQ1 A;  1TFO B;  2J7P D;  2L6F A;  3ITF A;  2J8W A;  1ZHZ A;  3TK0 A;  4BG0 A;  2NUT B;  3C8Z A;  1PD1 A;  2XLH A;  2ZXP A;  1WGW A;  3ECS A;  3DAF A;  3R2P A;  2OU6 A;  3JT1 A;  4IGG A;  4O6M A;  1YLM A;  4BJ5 A;  1R4T A;  2J7P A;  1NFN A;  2NUP B;  3DD7 A;  4MVU A;  5JP7 A;  4BJT A;  2WVN A;  4U9D A;  2XS8 A;  3UMK A;  4MW3 A;  1DOW A;  1ZYR F;  1V54 C;  3JSE O;  1FFT C;  3EGX A;  2Q4F A;  4CX9 A;  3SNH A;  5HSW A;  4WJ0 A;  4BEJ A;  3OA1 A;  4MW8 A;  3DWW A;  3V5Z A;  2QUP A;  2R7W A;  4E7Z A;  4PR9 A;  3B0P A;  4MVR A;  5DQT A;  3IPM O;  3HJC A;  2WVQ A;  3FVY A;  2L9J A;  3LS0 A;  1NSG B;  3HLZ A;  4JEA A;  1ZHX A;  4ANJ A;  1QQ3 A;  4YJW A;  5JSL A;  3RH3 A;  4YT8 A;  1U0B B;  3U2M A;  4BJ6 A;  2G62 A;  1TWC A;  4GYT A;  4IAQ A;  4C7O B;  2EPM X;  3HTK C;  2QNL A;  1YYJ A;  2Y3D A;  2YLG A;  2J0W A;  4IAR A;  4ER9 A;  2IBF A;  1PCX A;  3ABL C;  2V26 A;  1BDJ B;  1KTM A;  4U5B E;  2HJM A;  2H8A A;  2Q9B A;  4AK9 A;  2FGY A;  3NRH A;  4EHP A;  3ZSU A;  1H9T A;  5L3V A;  4N4W A;  4HFK B;  1PD0 A;  2L81 A;  1UG7 A;  2EIM C;  4EKW A;  3EFO A;  2IXP A;  4DBR A;  3GM3 A;  2W4M A;  5KYX B;  2R7U A;  2GFH A;  1L7C A;  2PX0 A;  5AC4 A;  1K40 A;  2ZXW C;  1L3P A;  1ZW2 A;  1HMO A;  256B A;  4I3M A;  3RF3 A;  1U89 A;  1WTY A;  3F47 A;  1GM5 A;  1ZHW A;  1B68 A;  4WGZ A;  5EK0 A;  3LS1 A;  3RQF A;  2YVK A;  1VMA A;  1WOL A;  2OCC C;  1YA9 A;  3FHD A;  4E18 A;  1RKE B;  2H7O A;  3T6B A;  2XS1 A;  3U8V A;  2IXO A;  4CIP A;  2HKV A;  1C03 A;  2NSG A;  1JOG A;  3UMI A;  5JS5 A;  2YKZ A;  3HNJ A;  1APC A;  1OXK A;  4MVM A;  3N2Z B;  1WAT A;  1JPN A;  2R9R B;  1Q0M A;  2YEV A;  4KNW A;  4C7O A;  3TOL A;  3FDQ A;  3ZQV A;  4CS9 C;  5B3I A;  3ASN C;  3S27 A;  2R7R A;  1CGO A;  1TWG A;  3NG1 A;  3DKA A;  3U3F A;  1E83 A;  2R7V A;  2OJQ A;  2X51 A;  1SZI A;  3JYY A;  3TJ6 A;  3LJB A;  3GM1 A;  1V74 B;  1TR2 A;  3K33 A;  3AOU A;  3AQC A;  5BUO A;  4XPY A;  1KNY A;  3B0U X;  1NZE A;  2NPU A;  1O5H A;  4F4B A;  2R7X A;  3M4C A;  3JCU Q;  2H7B A;  2XM4 A;  4BEM J;  4E0I A;  5KYX A;  2AVK A;  3SZR A;  3FOO A;  1XZQ A;  2Y3H A;  4CS8 C;  1H6G A;  2ASR A;  1JRA A;  4KC9 A;  2J0X A;  1H9G A;  3S29 A;  4OIR F;  2ZD9 A;  3NYJ A;  3NYL A;  3TOM A;  5JLI A;  1OW7 A;  1K05 A;  1RKE A;  1AVO B;  2VAS A;  3DM5 A;  5T3T A;  4NQF A;  3RKO F;  3KYJ A;  3AGU A;  3GOD A;  3O6X A;  3OWT A;  4U5D E;  3UNG C;  4G0H A;  1AEP A;  2J9W A;  1O3U A;  4H4K C;  1ZVZ A;  2JPU A;  4M63 A;  5L0H A;  1D1A A;  2GAQ A;  2J45 A;  2Y3G A;  4JW1 A;  2UUH A;  5A69 A;  1Z63 A;  3RW0 A;  1D1C A;  1RKC A;  3K7D A;  4LDK A;  2LSE A;  4YK5 A;  4Z9I A;  2EPL X;  4UDV A;  3KL4 A;  1OCC C;  4XLN F;  4U5G A;  1D0Y A;  2HV6 A;  2WL8 A;  3LLI A;  2QY9 A;  1A0B A;  2J9U A;  1FTS A;  2WZG A;  4IAO A;  5F5H A;  2WVO A;  1EI7 A;  2Q7R A;  3SEO A;  2P6V A;  3WAQ A;  4JCZ A;  1IZM A;  5JRA A;  3FAJ A;  4WAB A;  3EHM A;  4MTO A;  1I4Y A;  2OOC A;  2VB6 A;  4P9F A;  3KH2 A;  3ZTM A;  3U2L A;  4MQ9 F;  3GWL A;  3SYN A;  3MYF A;  1K04 A;  2P61 A;  3V7O A;  3ABM C;  1AUE A;  2VCA A;  3U3B A;  4JEB A;  3GOR A;  3O39 A;  4C3D A;  2YQY A;  3N24 A;  4J7Y A;  5E3C A;  4NY3 A;  3WOD F;  3MYI A;  2HZ8 A;  2XL6 A;  3CEX A;  3EGD B;  4OD4 A;  3T6J A;  3HNI A;  2P0N A;  3W4Y A;  2LK4 A;  3T4R A;  3EG9 B;  2F22 A;  1A7D A;  1ORJ A;  1I4Z A;  2XLE A;  3DI5 A;  2WZL A;  3QTH A;  1RXQ A;  1T6Q A;  5L0I A;  4H54 A;  4D4N A;  3TUL A;  4NCQ A;  3JRT A;  4MS2 A;  1YA7 O;  4PK4 A;  4OIN F;  2X0C A;  5B1A C;  2NG1 A;  1CGN A;  3FOP A;  1LI7 A;  2LCH A;  3H65 A;  3HKK A;  4MTG A;  2LP4 A;  4JJF A;  5A6J A;  1FNT c;  4IWB A;  2XL4 A;  3K1I A;  1D1B A;  4MVO A;  1T01 A;  1FMW A;  3B71 A;  1IW7 F;  1ZZP A;  3DXJ F;  3JRM O;  1V4A A;  4XPX A;  3S90 A;  3M4B A;  2Q00 A;  3G50 A;  3U9J A;  3IQ6 A;  1O87 A;  3RIP A;  4C3E A;  3RVY A;  5KYY A;  3DMD A;  3IEE A;  3HNK A;  3OEO A;  4U5F E;  2HSB A;  4I44 A;  5A6B D;  4U5E E;  2XSE A;  2A69 F;  4D4X A;  3H2V A;  1VTM P;  4Z9J A;  4W8K A;  2RD9 A;  1HE9 A;  2AU5 A;  3WHN A;  4E0H A;  1M2O A;  1YYX A;  4BJ5 C;  4JIO A;  4DRJ B;  5L0C A;  4B6I A;  5DS4 A;  1Q0G A;  5JT4 A;  3Q6M A;  5DVW A;  3POV A;  2OQM A;  1YVI A;  2R25 A;  3G4Z A; 
#chains in the Genus database with same CATH homology
 2JD3 A;  3K6B A;  4A2N B;  4CBE A;  3VAY A;  4PJM A;  3MLG A;  2MWQ A;  2A68 F;  2NUP A;  3K1I C;  4LER A;  3ZC4 A;  2BE5 F;  2IYL D;  1V55 C;  4YN0 B;  4OIO F;  1N1C A;  1OKK D;  2Y3B A;  3QZC A;  4JVS A;  4O6Y A;  4BJ6 C;  4O79 A;  4AE4 B;  4JUR I;  4OIP F;  3UMH A;  1ST6 A;  2EIJ C;  4O7G A;  1BR2 A;  2IXN A;  3JSZ A;  1NU9 C;  3CZ6 A;  4DOZ A;  5E2Q A;  1QZX A;  3Q7L A;  3LLK A;  3I4U A;  4DBQ A;  1Z6A A;  4O6N A;  3CQZ A;  4KNV A;  1M2V B;  5CI8 A;  1SMY F;  4IRU A;  2PX3 A;  4X0R A;  4RDA A;  1OCR C;  3EHN A;  5DS6 A;  1LS1 A;  1BR4 A;  1MMN A;  1TWA A;  5D91 A;  1TWH A;  3ZG1 A;  4Q4Z F;  2G3K A;  2WB7 A;  3PHF 2;  1S7Z A;  3NDB B;  3GAN A;  2YHS A;  2QTV A;  3AG1 C;  4AE4 A;  3S0X A;  4OD5 A;  4P6I C;  4CSA A;  1KU2 A;  4LLC A;  4XTK A;  3DAG A;  4JCH A;  2A6H F;  4G7H F;  4KI2 A;  2DGJ A;  3EH1 A;  4ULW A;  3NKE A;  3DJU B;  4HE8 D;  1VOM A;  2PFD A;  5E3A A;  2J9V A;  3EQL F;  2A1D D;  1M2V A;  2MYS A;  2CGE A;  3F46 A;  2W9Y A;  3QMK A;  4RD9 A;  5T3W A;  2V3C C;  2Q9C A;  2CW0 F;  3KKB A;  4AX2 A;  3WG7 C;  2PF4 E;  1JPJ A;  3PMR A;  2CNW D;  3W2V A;  3DJN B;  2OG2 A;  5T1D B;  5KYN A;  3EZI A;  2EIK C;  5D92 A;  3K66 A;  4ZLD A;  1M57 C;  2KW3 C;  2R7S A;  2KNH A;  1SF8 A;  3TD7 A;  3NYM A;  1W2W A;  4IJJ A;  4QI2 A;  3UGP A;  1Z23 A;  3L0I A;  4QI0 A;  4XWJ A;  2Q9A A;  3I5Q A;  2R7Q A;  1MMG A;  3W8I A;  1OCO C;  4G7O F;  3Q7G A;  1D0X A;  1VYK A;  4FES A;  4CS7 A;  5KYW B;  3LEV A;  1Z5Z A;  1ZU4 A;  1VK5 A;  2R7O A;  3SP1 A;  1LKX A;  2KJG A;  3EJN A;  5DQZ A;  4PJJ A;  3X2Q C;  2O9X A;  2CDQ A;  5B1B C;  2D5R B;  5CI9 A;  3RYL A;  4N06 A;  2Y69 C;  4MND A;  2DYS C;  1TKN A;  1FFH A;  3L34 A;  3AG4 C;  2DYR C;  4DVZ A;  4GEH A;  4PJL A;  2H7V C;  4FX5 A;  3EFO B;  4I1O B;  2ZPA A;  3EZH A;  3EGD A;  1QLE C;  2G3V A;  4PJN A;  5EHH A;  5KYU B;  2KQ9 A;  1ZU5 A;  1RJ9 B;  1NG1 A;  3EG9 A;  2Z15 A;  3K1H A;  4U5C E;  3S28 A;  2IXM A;  3X1O A;  4RBN A;  4EWC A;  3W2W A;  1MMD A;  5KYW A;  3ZVR A;  1D0Z A;  2FFH A;  3I5P A;  4K7B A;  4C3B A;  3ZIB A;  2E87 A;  1OKK A;  5FCL A;  1J8M F;  2P7V A;  3KMI A;  4LLE A;  4KBL A;  3M1C B;  4CS9 A;  3DM9 B;  3EPV A;  3DZA A;  1ZHT A;  4I1M A;  4HEA J;  3NKD A;  4QDL A;  1ZHY A;  4FWV A;  2XRH A;  3LES A;  4K0D A;  4XLP F;  2XXA B;  2A6E F;  4Q5S F;  4YT2 A;  4Q7C A;  2R7T A;  5KYU A;  1RJ9 A;  4YT5 A;  2IOQ A;  3JYH A;  3Q6N A;  1J8Y F;  3AQB A;  1MNE A;  4PFO A;  5F5F A;  4CS8 A;  4DVY P;  3B9Q A;  2PP4 A;  4PFP A;  1G8X A;  5E33 A;  2W4B A;  3N0T A;  4BJ1 A;  4ZLC A;  4OIQ F;  4HFF B;  3UGO A;  2EIL C;  3ASO C;  2C04 A;  1FMV A;  5IY5 C;  3ABK C;  2YZS A;  4YWQ A;  2XXA A;  2VH3 A;  2ZXO A;  5L3Q A;  2KGO A;  1OCZ C;  3VYW A;  1BR1 A;  1MND A;  4J30 B;  3UR3 C;  4U5H A;  1M56 C;  1VYI A;  3AG2 C;  2B0J A;  4CSA C;  4LAC B;  4G7Z F;  3LNR A;  2C03 A;  2CNW A;  4J32 B;  3B0V C;  2EIN C;  2Y39 A;  3RFY A;  2HV7 A;  3E9V A;  3EGX B;  1LVK A;  4JZA A;  3E70 C;  3AG3 C;  3LAY A;  5B3S C;  2ZXR A;  4JJG A;  2J46 A;  1MMA A;  2Q3T A;  4CIH A;  2W45 A;  2WZF A;  5KYY B;  5EGY A;  3MX3 A;  3CSK A;  2I8B A;  1NU7 D;  3EH2 A;  1Z3I X;  4YT4 A;  5DS5 A;  2M4E A;  4EBB A;  3W8H A;  5DLJ A;  3ITF A;  2J7P D;  1ZHZ A;  4BG0 A;  2NUT B;  1PD1 A;  2ZXP A;  1WGW A;  3ECS A;  3DAF A;  3JT1 A;  4O6M A;  4BJ5 A;  2J7P A;  2NUP B;  3DD7 A;  4BJT A;  2WVN A;  3UMK A;  1ZYR F;  1V54 C;  1FFT C;  3EGX A;  3SNH A;  5HSW A;  4WJ0 A;  4BEJ A;  3OA1 A;  2R7W A;  4E7Z A;  3B0P A;  5DQT A;  3HJC A;  2WVQ A;  3FVY A;  2L9J A;  3LS0 A;  3HLZ A;  1ZHX A;  4ANJ A;  4YJW A;  3RH3 A;  4YT8 A;  4BJ6 A;  2G62 A;  1TWC A;  4GYT A;  4C7O B;  3HTK C;  2Y3D A;  2J0W A;  1PCX A;  3ABL C;  2V26 A;  4U5B E;  2Q9B A;  4AK9 A;  2FGY A;  3NRH A;  3ZSU A;  5L3V A;  4HFK B;  1PD0 A;  2L81 A;  2EIM C;  3EFO A;  2IXP A;  4DBR A;  5KYX B;  2W4M A;  2R7U A;  2GFH A;  2PX0 A;  2ZXW C;  4I3M A;  3F47 A;  1ZHW A;  3LS1 A;  1VMA A;  2OCC C;  3FHD A;  3T6B A;  2H7O A;  2IXO A;  3UMI A;  3N2Z B;  1JPN A;  2YEV A;  4KNW A;  4C7O A;  3FDQ A;  4CS9 C;  3ASN C;  3S27 A;  2R7R A;  1TWG A;  3NG1 A;  2R7V A;  2X51 A;  1SZI A;  3LJB A;  1TR2 A;  3K33 A;  3AQC A;  5BUO A;  3B0U X;  1NZE A;  4F4B A;  1O5H A;  2R7X A;  3JCU Q;  2H7B A;  5KYX A;  3SZR A;  2Y3H A;  4CS8 C;  4KC9 A;  2J0X A;  3S29 A;  3NYL A;  3NYJ A;  2VAS A;  5T3T A;  3DM5 A;  3RKO F;  3GOD A;  3O6X A;  3OWT A;  4U5D E;  3UNG C;  4G0H A;  2J9W A;  4H4K C;  4M63 A;  1D1A A;  2J45 A;  2Y3G A;  4JW1 A;  1Z63 A;  1D1C A;  3K7D A;  2LSE A;  3KL4 A;  1OCC C;  4XLN F;  4U5G A;  1D0Y A;  2HV6 A;  2WL8 A;  3LLI A;  2QY9 A;  2J9U A;  2WZG A;  1FTS A;  4IAO A;  5F5H A;  4E7S A;  2WVO A;  3SEO A;  2P6V A;  1IZM A;  3FAJ A;  3EHM A;  2VB6 A;  3KH2 A;  4MQ9 F;  3SYN A;  3V7O A;  3ABM C;  3O39 A;  4C3D A;  3N24 A;  5E3C A;  4NY3 A;  3WOD F;  4OD4 A;  3EGD B;  3T6J A;  3T4R A;  3EG9 B;  2WZL A;  3JRT A;  4PK4 A;  4OIN F;  5B1A C;  2NG1 A;  3H65 A;  4JJF A;  4IWB A;  2XL4 A;  4OIR F;  1D1B A;  3DXJ F;  1FMW A;  1IW7 F;  4C3E A;  1O87 A;  5KYY A;  3DMD A;  3IEE A;  3OEO A;  4U5F E;  4I44 A;  4U5E E;  2XSE A;  2A69 F;  4W8K A;  1M2O A;  4BJ5 C;  4B6I A;  5DS4 A;  3POV A;  3Q6M A;  5DVW A;  2NUT A;  3RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...