2LQGA

Solution structure of the r4 domain of talin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
GIDPFTLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion, structural protein
molecule keywords Talin-1
publication title RIAM and Vinculin Binding to Talin Are Mutually Exclusive and Regulate Adhesion Assembly and Turnover.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2lqgA00
1XWJA 1ZVZA 1T01A 1DOWA 4P9TA 4E17A 5L0JA 3TJ6A 2HSQA 5L0IA 1H6GA 4DJ9A 1ZW2A 4E18A 1QKRA 3VF0A 4K1OA 1RKEA 3MYIA 3H2UA 1RKEB 2L7AA 5L0GA 1U6HA 5L0FA 1U89A 2GDCA 1TR2A 4ONSA 4W8PA 1L7CA 1ZW3A 3S90A 1ST6A 2GWWA 5L0DA 1SYQA 4EHPA 1RKCA 4IGGA 3TJ5A 2IBFA 2B0HA 3ZDLA 4PR9A 1YDIA 3H2VA 2LQGA 2X0CA 3RF3A 5L0CA 5FZTA 3T6GB 5L0HA 1DOVA
chains in the Genus database with same CATH superfamily
4N06A 5AGFA 3B29A 4YT5A 2OU6A 3B9QA 4K0DA 1KU2A 2LP4A 4CDAA 4AL1A 2I15A 1OCCC 2BC5A 2E87A 4O6YA 1CGOA 1O3UA 2OG2A 3LAYA 1GS9A 4QI2A 4G7OF 1LPEA 2ASRA 3QTHA 2FFHA 5KYUA 4D4XA 1NU9C 3GM1A 3ZWIA 4O79A 2P0NA 3V5YA 2LFDA 1U6HA 1AEPA 2GAQA 4YWQA 2A69F 2R03A 3GEEA 1GM5A 1Z5ZA 2W9YA 1NG1A 2YHSA 3AGUA 1NFNA 5DQZA 1QLEC 4CBEA 4R32A 2NG1A 5F5HA 3L8JA 3FVYA 4WJ0A 4IGGA 4KC9A 3ZC4A 4LLEA 1ZU4A 4XEVA 4BJ5A 2HFIA 1CPQA 3U9MA 2KW3C 4MTGA 4XQ1A 4BJ6C 4M63A 2VCCA 5T1DB 5A69A 2XXAB 3I4UA 4ZLDA 3K1IA 4JW1A 3X1OA 4XTKA 4W8KA 5JT4A 3J06A 2CCYA 2Y39A 2OJQA 2R7WA 2O9XA 1ORYA 2H7BA 4ONSA 3ABLC 3RW0A 2MYSA 5IY5C 1OR2A 2ZPAA 1ST6A 3MYFA 4AX2A 3ECSA 1HMDA 3B0UX 2NUTB 3U8VA 4LDRA 2WZLA 4MVSA 2R25A 3SXKA 2HMZA 5AC5A 3GANA 3EGXA 2X0CA 3LLKA 1D1AA 3AGTA 3SEOA 1YA7O 5L3VA 3S29A 4CDYA 2EPLX 1SR2A 4MW8A 4IWBA 4P9TA 4RDAA 4DRIB 1T6IA 1H6GA 1HY5A 1JPJA 3LS1A 5B3SC 2P1AA 4MVZA 4XPWA 1G5ZA 3NKDA 3UNGC 3U3FA 2Q9AA 5COMA 3K7DA 1Z23A 4ULWA 4U5DE 2EPNA 3B0VC 2ZXOA 3ABKC 4MVRA 1W2WA 3ZVRA 3ATPA 5L0GA 3AG3C 2GA0A 3W8IA 2KC3A 2EIJC 1D1BA 3U3BA 2ZXRA 3KMIA 1L7CA 3HTKC 4PFPA 3AG1C 3ZTMA 1RKCA 3ASOC 3ITFA 5GPGB 5DS4A 1BR1A 1MMDA 3EGDA 3NKEA 1EA8A 3QW0A 1IW7F 2YL0A 2R7VA 5KYYB 4MW3A 1I5NA 2DYSC 1M2OA 5EK0A 2VB6A 4WGZA 1WATA 1DOVA 4BG0A 4EWCA 1HW2A 1NBBA 4IAQA 1YZAA 1T9KA 3GM2A 2GFHA 2QY9A 4PJJA 4C7OA 1D0ZA 3JSZA 1XZPA 3O55A 3DI5A 2HS5A 3C8GB 3ZSUA 4CS8A 4E18A 2G3VA 1S05A 2KNHA 2A0UA 2AWYA 2JPUA 4U5HA 3SYNA 2WZGA 4FX5A 3U2MA 1M56C 1NSGB 5D92A 2Q00A 3M4BA 4CSAC 4GEHA 2VC9A 3LJBA 1I4YA 1PCXA 1YLMA 3JRMO 4A4AA 1D0XA 4DVZA 1QQ3A 5EGYA 4HFKB 2KYHA 4PK4A 2R7QA 4JCHA 1ZHZA 1FMWA 2AWCA 3DAFA 3SXMA 4NQFA 1V55C 3ZDLA 2QLAA 3LLIA 1C03A 1AUEA 2IOQA 3U2LA 2WB7A 3EHNA 4FAPB 4JE9A 3ASNC 2IM8A 5KYNA 1XWJA 3B0PA 1O5HA 2XS8A 1NZEA 3KL4A 1EKYA 3O6XA 4C3DA 2HSQA 2Y3GA 2YL1A 1E84A 2OKUA 3NMKA 2BL2A 2WZFA 4JCZA 3RQGA 3C18A 3RQFA 3VF0A 4E0HA 3GEHA 4HE8D 5DVWA 4U5BE 2H8AA 4B6IA 1ZU5A 1LVKA 1RJ9A 5E33A 1Q0DA 3F46A 5JP7A 3OA1A 2PBEA 3K6BA 1LS1A 2OQMA 3AQCA 4H4KC 3T6JA 3WAQA 2Q7RA 1V4AA 2IXNA 1ZYRF 2B0JA 1VLSA 5KYXB 2HSBA 4O6MA 2HZ8A 4YL1A 2YEVA 3W8HA 4PJMA 3SXZA 1O87A 2W45A 1MMAA 4U5CE 2M4EA 2DYRC 2LIGA 4BEJA 5L0HA 1T01A 2DB4A 5JS5A 3NRHA 2A0BA 5JSLA 2A1DD 3UMKA 2EIMC 1MQVA 4YN0B 3M4CA 5COGA 3C63A 2Q3TA 1A7VA 1YARO 2EIKC 1VYIA 2J9UA 1RXQA 3E9VA 2HV7A 3M79A 3Q6MA 2IYLD 4U5GA 4AE4B 4WGYA 5BQGA 1S7ZA 1H9TA 1G8XA 3JZ0A 1WASA 3EQLF 1FMVA 4OIOF 5KYWB 2C03A 2IXMA 3KKBA 4J30B 3FAJA 2NUPA 1U89A 1MNEA 3TOLA 1PD1A 2QUPA 2R05A 2XLDA 3FOOA 4K7BA 2J45A 4XLPF 1Q0FA 3W4YA 2WVQA 3F47A 2J9BA 1MNDA 3DMDA 4CX9A 4WABA 1OW7A 4XWJA 4DRHB 3DXJF 3C8ZA 2IXOA 4KNWA 3S9OA 3WODF 2OOCA 1APCA 3NMJA 2VH3A 2EPMX 2MHRA 1A41A 1YZCA 3EZHA 4NY3A 2KGOA 4BJTA 1VLTA 1TQGA 1VB5A 1NU7D 2ZXWC 2XLOA 1HE9A 3US6A 3DKAA 2R7XA 4PFOA 1VOMA 1Z63A 2R7RA 1HE1A 4U5EE 3VAYA 5DLJA 1YYXA 2A6EF 4BJ5C 3FAPB 4CJOA 4AK9A 2YL3A 3SXYA 2KQ9A 2EPOA 3T9OA 4OINF 4A2NB 3TOMA 3TK0A 1E86A 4LDKA 1B68A 1TR2A 1TWAA 4RD9A 2XM0A 3EZIA 5F28E 2J9WA 2A6HF 3HNLA 3K1IC 4I1OB 2VCAA 2XLWA 4EHPA 4OIRF 4L6RA 2WVNA 1IZMA 2RD9A 3H65A 5A6BA 5CIVA 5L0CA 1TWGA 3KPHA 3UMIA 1M2VB 3EHMA 3PMRA 5DQTA 1OCZC 4XPXA 3SP1A 4EIYA 5B3IA 5JLIA 3MLGA 2XXAA 2Q9CA 4EBKA 5L0IA 3KH2A 1Z3IX 2D4UA 3EFOB 1ZW2A 3IQ6A 2R7SA 4G7HF 3ZIBA 1VTMP 3DJUB 1UFBA 2J0WA 4DVYP 3LS0A 2Y3DA 3AG4C 3NMIA 1FTSA 1JRAA 2A68F 3EG9B 1T5OA 3TQOA 2M64A 3CSKA 1YVIA 1TFKB 2P6VA 2RSEB 4EBBA 4LACB 3FHDA 2AVKA 2NUTA 4E7ZA 2CNWD 2KSFA 2H7VC 3TULA 2YLIA 4EKWA 1ORSC 2FGYA 3DM9B 5DS6A 2CNWA 1OKKA 4FESA 4NTAA 1C02A 3MBGA 4CS9A 1FR0A 4YT4A 1KNYA 1YDIA 1MMGA 2UUHA 5T3WA 3RF3A 4AL0A 2XM4A 5CI9A 4CJGA 1JAFA 1ZHWA 5FCLA 2LK4A 3S27A 2R7UA 2LSEA 2YQYA 4XLNF 3L0IA 1LKXA 1WN0A 3A9CA 4YJWA 1T6QA 5AC4A 2AP3A 3BRJA 3LNMB 1WWPA 2KK1A 4I3MA 2XLHA 4N6CA 1RKEB 2YLDA 3LNRA 2JX0A 3QVZA 2WL8A 1ORJA 2R9RB 4JURI 4MS2A 3UR3C 1YJGA 4C3EA 5L0FA 2V3CC 1OCRC 2PP4A 5T3TA 4CS8C 4G7ZF 4GQHA 1ZW3A 4JJGA 5E3AA 2L9JA 4YT8A 3AOUA 4PJNA 3EJNA 1YAUO 1K04A 3DM5A 4J32B 2MWQA 5TJ5E 3RYLA 3TJ5A 1NLXA 1VMAA 1V74B 2PX3A 3AJMA 5KYYA 3I5QA 1JOGA 1WOLA 1AVOB 3DE9A 1Z6AA 2ETSA 3WHNA 3S84A 1Q0MA 3C8GA 4U9EA 3Q7GA 1CGME 4MVUA 4E0IA 1TKNA 1RCPA 4FWVA 3AQBA 4IJJA 1K05A 4P9FA 4MVQA 5A6AA 1N1CA 1JPNA 4CDVA 2DI3A 3KYJA 1UG7A 4DBQA 3RKOF 1ZHXA 1OW8A 1SMYF 2LCHA 2OJED 2L6FA 2FAPB 2NPUA 3K66A 1NFOA 4U5FE 1E85A 3U8PA 1LE2A 4JIOA 2J7PD 3M1CB 3TD7A 3L1MA 3L34A 4O6NA 3OWTA 1PV3A 2J7PA 3CZ6A 4PR9A 2D5RB 4E17A 5K0IA 3CAXA 4QDLA 4PACA 4MVMA 5FZTA 1ZHTA 3JT1A 3ABMC 5E2QA 1RMVA 1BDJB 1R5ID 1OXBA 3RVZA 3N2ZB 3O39A 1L3PA 2YRFA 4KNVA 1YA9A 3QZCA 4I44A 1M6TA 4Q4ZF 1GGQA 2J0XA 1QZXA 1LI5A 2DGJA 4MQ9F 4BJ1A 4E7SA 1BR4A 1M57C 2OEXA 5KYUB 4UDVA 1MMNA 1V54C 2HUJA 2QNLA 3EPVA 3IQ5A 3SZRA 4ZLCA 4CIPA 2XSEA 5KYXA 4C3BA 2CYDA 1KTMA 4MVOA 1TWCA 2H7OA 2XL6A 3T6BA 1GQAA 3NG1A 4P6IC 5D91A 5JRAA 4F4BA 2JD3A 3IPMO 3JYYA 1R4TA 1OR3A 4MTOA 4MNDA 4OD4A 1DOWA 4H54A 5L0JA 3JTLO 3KYIA 3NYLA 5A6KA 4N6HA 2YZSA 5JUAA 1LI7A 4AE4A 2Y3HA 3V7OA 3IHUA 3IEEA 1T6UA 3RIPA 3CEXA 2Y69C 2ZXPA 4JTAB 4QI0A 3H2UA 1WGWA 4MTFA 5KYWA 3S0XA 2AU5A 1HW1A 2L81A 3HNJA 3MFNA 1A7DA 2YL7A 2ZD9A 1Z7Qc 1E83A 4BJ6A 5COFA 2PFDA 1FNTc 3V5ZA 1H9GA 3S90A 2LD6A 4JZAA 4IARA 4ER9A 5L0DA 2XLMA 1WTYA 1CPRA 2W4MA 3RFYA 2L6GA 4J7TA 3W2WA 3NYJA 2L6HA 5JVEA 5A6BD 3QMKA 2QTVA 3H2VA 3IQTA 4LLCA 1JR8A 3LESA 4RBNA 3EGXB 3PCVA 2XLEA 3Q6NA 2P7VA 5HSWA 2CW0F 4O7GA 3TJ6A 2V26A 2XRHA 1K40A 1TWHA 2J8WA 2PF4E 3R7CA 4OIQF 4CIHA 1F1MA 3U9JA 4JVSA 3ZG1A 4OIPF 2Q4FA 3JSEO 1A0BA 3EH1A 1LIHA 4LDQA 2G3KA 2Z15A 2L7AA 3HNKA 3POVA 1ZHYA 1SF8A 4BEMJ 3DD7A 3G50A 2XS1A 2CDQA 3IQCA 4XPYA 4YK5A 3LUTB 4YL3A 2EINC 3T4RA 3HKKA 4W8PA 3ZTZA 2VCBA 4DRJB 3UGPA 2PX0A 5B1BC 1J8MF 4DBRA 1OKKD 4NTFA 4IB4A 1BBHA 2IBFA 1H7IA 4Q5SF 3BEHA 3FOPA 5BUOA 3L8IA 4IAOA 1BR2A 1LE4A 1FFTC 1M2VA 1QPUA 2LFFA 2LQGA 2R7OA 3EGDB 3I5PA 3QVYA 4G78A 3T6GB 4N4WA 3VRCA 2TMVP 3EFOA 3K33A 2OCCC 1E2XA 2R02A 3C7JA 3PHF2 2HJ3A 4OD5A 2BE5F 4G0HA 1G4US 4C7OB 4JEAA 1Y4CA 4CS9C 1FFHA 3EG9A 4X0RA 1JMWA 4K1OA 3WG7C 3N24A 4BPMA 2ICWG 3DE8A 4JEBA 2WVOA 3JYHA 4Z9HA 3B71A 2GDCA 1CGNA 4ULVA 2YVKA 3GM3A 5DS5A 2GWWA 3LEVA 4DXWA 2QE9A 1EI7A 3HLZA 1OQCA 3JCUQ 4I1MA 1HMOA 1VK5A 1LM3B 2HKVA 1QSPA 5BQIA 2F22A 2HV6A 3GODA 1Q0GA 4GYTA 4JRZA 2XL4A 5BQHA 1A7EA 3R2PA 1ZVZA 3LEOA 3V5XA 2NSGA 4IRUA 1BZ4A 3C8GD 3RH3A 5L3QA 4CSAA 3K1HA 1QVXA 1XZQA 3JRTA 1LS4A 3DZAA 4Q7CA 1QKRA 2YLGA 1Q0KA 3FXHA 4NC3A 4XEKA 5B1AC 1EQ1A 4XEFA 1RKEA 3N0TA 2HJMA 1SZIA 2YWAA 5HV9A 1C17M 3HJCA 4KI2A 3M15A 2Q9BA 3FMSA 4PJLA 2J46A 1G4WR 1YYJA 1RJ9B 1VYKA 2HMQA 4JJFA 5E3CA 3ZQVA 1ZZPA 5CI8A 4CS7A 3RQEA 2P61A 1OXKA 2YKZA 2KJGA 1PD0A 3C62A 256BA 1SYQA 3GWNA 1Y6DA 4JC7A 4EUKB 2B0HA 3UGOA 1D1CA 1FAPB 3HNIA 3SNHA 3S28A 2XL8A 1OW6A 3O10A 3DJNB 2EILC 4JTCB 3VYWA 2UUIA 3ZQYA 3VM6A 3MX3A 4DJ9A 3OEOA 3X2QC 3GWLA 4JKVA 5F5FA 2VASA 2C04A 3GORA 1U0BB 3W2VA 3NYMA 4YT2A 2XLVA 3QW1A 4Z9IA 2R7TA 4J7YA 2IXPA 2W4BA 2X51A 1OCOC 3MYIA 3AG2C 4NTBA 4D4NA 3PDMP 2I8BA 3E70C 3FDQA 3G4ZA 3A11A 1J8YF 3Q7LA 4HEAJ 4ANJA 1D0YA 4U9DA 3U0CA 2NUPB 4YL0A 3U5SA 2Y3BA 5EHHA 4KBLA 3RVYA 3DWWA 3GEIA 3CQZA 2CGEA 2EPKX 2G62A 3G4XA 3NDBB 4DOZA 2OEVA 2J9VA 3EH2A 4JTDB 1TFOB 4Z9JA 5A6JA 4HFFB 3UMHA 4NCQA 4EBJA 1I4ZA 3DAGA 2PNOA 2NSFA 4LERA
chains in the Genus database with same CATH topology
1XWJA 1ZVZA 1T01A 1DOWA 4P9TA 4E17A 5L0JA 3TJ6A 2HSQA 5L0IA 1H6GA 4DJ9A 1ZW2A 4E18A 1QKRA 3VF0A 4K1OA 1RKEA 3MYIA 3H2UA 1RKEB 2L7AA 5L0GA 1U6HA 5L0FA 1U89A 2GDCA 1TR2A 4ONSA 4W8PA 1L7CA 1ZW3A 3S90A 1ST6A 2GWWA 5L0DA 1SYQA 4EHPA 1RKCA 4IGGA 3TJ5A 2IBFA 2B0HA 3ZDLA 4PR9A 1YDIA 3H2VA 2LQGA 2X0CA 3RF3A 5L0CA 5FZTA 3T6GB 5L0HA 1DOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWJ A;  1ZVZ A;  1T01 A;  1DOW A;  4P9T A;  4E17 A;  5L0J A;  3TJ6 A;  2HSQ A;  5L0I A;  1H6G A;  4DJ9 A;  1ZW2 A;  4E18 A;  1QKR A;  3VF0 A;  4K1O A;  1RKE A;  3MYI A;  3H2U A;  1RKE B;  2L7A A;  5L0G A;  1U6H A;  5L0F A;  1U89 A;  2GDC A;  1TR2 A;  4ONS A;  4W8P A;  1L7C A;  1ZW3 A;  3S90 A;  1ST6 A;  2GWW A;  5L0D A;  1SYQ A;  4EHP A;  1RKC A;  4IGG A;  3TJ5 A;  2IBF A;  2B0H A;  3ZDL A;  4PR9 A;  1YDI A;  3H2V A;  2LQG A;  2X0C A;  3RF3 A;  5L0C A;  5FZT A;  3T6G B;  5L0H A;  1DOV A; 
#chains in the Genus database with same CATH topology
 4N06 A;  5AGF A;  3B29 A;  4YT5 A;  2OU6 A;  3B9Q A;  4K0D A;  1KU2 A;  2LP4 A;  4CDA A;  4AL1 A;  2I15 A;  1OCC C;  2BC5 A;  2E87 A;  4O6Y A;  1CGO A;  1O3U A;  2OG2 A;  3LAY A;  1GS9 A;  4QI2 A;  4G7O F;  1LPE A;  2ASR A;  3QTH A;  2FFH A;  5KYU A;  4D4X A;  1NU9 C;  3GM1 A;  3ZWI A;  4O79 A;  2P0N A;  3V5Y A;  2LFD A;  1U6H A;  1AEP A;  2GAQ A;  4YWQ A;  2A69 F;  2R03 A;  3GEE A;  1GM5 A;  1Z5Z A;  2W9Y A;  1NG1 A;  2YHS A;  3AGU A;  1NFN A;  5DQZ A;  1QLE C;  4CBE A;  4R32 A;  2NG1 A;  5F5H A;  3L8J A;  3FVY A;  4WJ0 A;  4IGG A;  4KC9 A;  3ZC4 A;  4LLE A;  1ZU4 A;  4XEV A;  4BJ5 A;  2HFI A;  1CPQ A;  3U9M A;  2KW3 C;  4MTG A;  4XQ1 A;  4BJ6 C;  4M63 A;  2VCC A;  5T1D B;  5A69 A;  2XXA B;  3I4U A;  4ZLD A;  3K1I A;  4JW1 A;  3X1O A;  4XTK A;  4W8K A;  5JT4 A;  3J06 A;  2CCY A;  2Y39 A;  2OJQ A;  2R7W A;  2O9X A;  1ORY A;  2H7B A;  4ONS A;  3ABL C;  3RW0 A;  2MYS A;  5IY5 C;  1OR2 A;  2ZPA A;  1ST6 A;  3MYF A;  4AX2 A;  3ECS A;  1HMD A;  3B0U X;  2NUT B;  3U8V A;  4LDR A;  2WZL A;  4MVS A;  2R25 A;  3SXK A;  2HMZ A;  5AC5 A;  3GAN A;  3EGX A;  2X0C A;  3LLK A;  1D1A A;  3AGT A;  3SEO A;  1YA7 O;  5L3V A;  3S29 A;  4CDY A;  2EPL X;  1SR2 A;  4MW8 A;  4IWB A;  4P9T A;  4RDA A;  4DRI B;  1T6I A;  1H6G A;  1HY5 A;  1JPJ A;  3LS1 A;  5B3S C;  2P1A A;  4MVZ A;  4XPW A;  1G5Z A;  3NKD A;  3UNG C;  3U3F A;  2Q9A A;  5COM A;  3K7D A;  1Z23 A;  4ULW A;  4U5D E;  2EPN A;  3B0V C;  2ZXO A;  3ABK C;  4MVR A;  1W2W A;  3ZVR A;  3ATP A;  5L0G A;  3AG3 C;  2GA0 A;  3W8I A;  2KC3 A;  2EIJ C;  1D1B A;  3U3B A;  2ZXR A;  3KMI A;  1L7C A;  3HTK C;  4PFP A;  3AG1 C;  3ZTM A;  1RKC A;  3ASO C;  3ITF A;  5GPG B;  5DS4 A;  1BR1 A;  1MMD A;  3EGD A;  3NKE A;  1EA8 A;  3QW0 A;  1IW7 F;  2YL0 A;  2R7V A;  5KYY B;  4MW3 A;  1I5N A;  2DYS C;  1M2O A;  5EK0 A;  2VB6 A;  4WGZ A;  1WAT A;  1DOV A;  4BG0 A;  4EWC A;  1HW2 A;  1NBB A;  4IAQ A;  1YZA A;  1T9K A;  3GM2 A;  2GFH A;  2QY9 A;  4PJJ A;  4C7O A;  1D0Z A;  3JSZ A;  1XZP A;  3O55 A;  3DI5 A;  2HS5 A;  3C8G B;  3ZSU A;  4CS8 A;  4E18 A;  2G3V A;  1S05 A;  2KNH A;  2A0U A;  2AWY A;  2JPU A;  4U5H A;  3SYN A;  2WZG A;  4FX5 A;  3U2M A;  1M56 C;  1NSG B;  5D92 A;  2Q00 A;  3M4B A;  4CSA C;  4GEH A;  2VC9 A;  3LJB A;  1I4Y A;  1PCX A;  1YLM A;  3JRM O;  4A4A A;  1D0X A;  4DVZ A;  1QQ3 A;  5EGY A;  4HFK B;  2KYH A;  4PK4 A;  2R7Q A;  4JCH A;  1ZHZ A;  1FMW A;  2AWC A;  3DAF A;  3SXM A;  4NQF A;  1V55 C;  3ZDL A;  2QLA A;  3LLI A;  1C03 A;  1AUE A;  2IOQ A;  3U2L A;  2WB7 A;  3EHN A;  4FAP B;  4JE9 A;  3ASN C;  2IM8 A;  5KYN A;  1XWJ A;  3B0P A;  1O5H A;  2XS8 A;  1NZE A;  3KL4 A;  1EKY A;  3O6X A;  4C3D A;  2HSQ A;  2Y3G A;  2YL1 A;  1E84 A;  2OKU A;  3NMK A;  2BL2 A;  2WZF A;  4JCZ A;  3RQG A;  3C18 A;  3RQF A;  3VF0 A;  4E0H A;  3GEH A;  4HE8 D;  5DVW A;  4U5B E;  2H8A A;  4B6I A;  1ZU5 A;  1LVK A;  1RJ9 A;  5E33 A;  1Q0D A;  3F46 A;  5JP7 A;  3OA1 A;  2PBE A;  3K6B A;  1LS1 A;  2OQM A;  3AQC A;  4H4K C;  3T6J A;  3WAQ A;  2Q7R A;  1V4A A;  2IXN A;  1ZYR F;  2B0J A;  1VLS A;  5KYX B;  2HSB A;  4O6M A;  2HZ8 A;  4YL1 A;  2YEV A;  3W8H A;  4PJM A;  3SXZ A;  1O87 A;  2W45 A;  1MMA A;  4U5C E;  2M4E A;  2DYR C;  2LIG A;  4BEJ A;  5L0H A;  1T01 A;  2DB4 A;  5JS5 A;  3NRH A;  2A0B A;  5JSL A;  2A1D D;  3UMK A;  2EIM C;  1MQV A;  4YN0 B;  3M4C A;  5COG A;  3C63 A;  2Q3T A;  1A7V A;  1YAR O;  2EIK C;  1VYI A;  2J9U A;  1RXQ A;  3E9V A;  2HV7 A;  3M79 A;  3Q6M A;  2IYL D;  4U5G A;  4AE4 B;  4WGY A;  5BQG A;  1S7Z A;  1H9T A;  1G8X A;  3JZ0 A;  1WAS A;  3EQL F;  1FMV A;  4OIO F;  5KYW B;  2C03 A;  2IXM A;  3KKB A;  4J30 B;  3FAJ A;  2NUP A;  1U89 A;  1MNE A;  3TOL A;  1PD1 A;  2QUP A;  2R05 A;  2XLD A;  3FOO A;  4K7B A;  2J45 A;  4XLP F;  1Q0F A;  3W4Y A;  2WVQ A;  3F47 A;  2J9B A;  1MND A;  3DMD A;  4CX9 A;  4WAB A;  1OW7 A;  4XWJ A;  4DRH B;  3DXJ F;  3C8Z A;  2IXO A;  4KNW A;  3S9O A;  3WOD F;  2OOC A;  1APC A;  3NMJ A;  2VH3 A;  2EPM X;  2MHR A;  1A41 A;  1YZC A;  3EZH A;  4NY3 A;  2KGO A;  4BJT A;  1VLT A;  1TQG A;  1VB5 A;  1NU7 D;  2ZXW C;  2XLO A;  1HE9 A;  3US6 A;  3DKA A;  2R7X A;  4PFO A;  1VOM A;  1Z63 A;  2R7R A;  1HE1 A;  4U5E E;  3VAY A;  5DLJ A;  1YYX A;  2A6E F;  4BJ5 C;  3FAP B;  4CJO A;  4AK9 A;  2YL3 A;  3SXY A;  2KQ9 A;  2EPO A;  3T9O A;  4OIN F;  4A2N B;  3TOM A;  3TK0 A;  1E86 A;  4LDK A;  1B68 A;  1TR2 A;  1TWA A;  4RD9 A;  2XM0 A;  3EZI A;  5F28 E;  2J9W A;  2A6H F;  3HNL A;  3K1I C;  4I1O B;  2VCA A;  2XLW A;  4EHP A;  4OIR F;  4L6R A;  2WVN A;  1IZM A;  2RD9 A;  3H65 A;  5A6B A;  5CIV A;  5L0C A;  1TWG A;  3KPH A;  3UMI A;  1M2V B;  3EHM A;  3PMR A;  5DQT A;  1OCZ C;  4XPX A;  3SP1 A;  4EIY A;  5B3I A;  5JLI A;  3MLG A;  2XXA A;  2Q9C A;  4EBK A;  5L0I A;  3KH2 A;  1Z3I X;  2D4U A;  3EFO B;  1ZW2 A;  3IQ6 A;  2R7S A;  4G7H F;  3ZIB A;  1VTM P;  3DJU B;  1UFB A;  2J0W A;  4DVY P;  3LS0 A;  2Y3D A;  3AG4 C;  3NMI A;  1FTS A;  1JRA A;  2A68 F;  3EG9 B;  1T5O A;  3TQO A;  2M64 A;  3CSK A;  1YVI A;  1TFK B;  2P6V A;  2RSE B;  4EBB A;  4LAC B;  3FHD A;  2AVK A;  2NUT A;  4E7Z A;  2CNW D;  2KSF A;  2H7V C;  3TUL A;  2YLI A;  4EKW A;  1ORS C;  2FGY A;  3DM9 B;  5DS6 A;  2CNW A;  1OKK A;  4FES A;  4NTA A;  1C02 A;  3MBG A;  4CS9 A;  1FR0 A;  4YT4 A;  1KNY A;  1YDI A;  1MMG A;  2UUH A;  5T3W A;  3RF3 A;  4AL0 A;  2XM4 A;  5CI9 A;  4CJG A;  1JAF A;  1ZHW A;  5FCL A;  2LK4 A;  3S27 A;  2R7U A;  2LSE A;  2YQY A;  4XLN F;  3L0I A;  1LKX A;  1WN0 A;  3A9C A;  4YJW A;  1T6Q A;  5AC4 A;  2AP3 A;  3BRJ A;  3LNM B;  1WWP A;  2KK1 A;  4I3M A;  2XLH A;  4N6C A;  1RKE B;  2YLD A;  3LNR A;  2JX0 A;  3QVZ A;  2WL8 A;  1ORJ A;  2R9R B;  4JUR I;  4MS2 A;  3UR3 C;  1YJG A;  4C3E A;  5L0F A;  2V3C C;  1OCR C;  2PP4 A;  5T3T A;  4CS8 C;  4G7Z F;  4GQH A;  1ZW3 A;  4JJG A;  5E3A A;  2L9J A;  4YT8 A;  3AOU A;  4PJN A;  3EJN A;  1YAU O;  1K04 A;  3DM5 A;  4J32 B;  2MWQ A;  5TJ5 E;  3RYL A;  3TJ5 A;  1NLX A;  1VMA A;  1V74 B;  2PX3 A;  3AJM A;  5KYY A;  3I5Q A;  1JOG A;  1WOL A;  1AVO B;  3DE9 A;  1Z6A A;  2ETS A;  3WHN A;  3S84 A;  1Q0M A;  3C8G A;  4U9E A;  3Q7G A;  1CGM E;  4MVU A;  4E0I A;  1TKN A;  1RCP A;  4FWV A;  3AQB A;  4IJJ A;  1K05 A;  4P9F A;  4MVQ A;  5A6A A;  1N1C A;  1JPN A;  4CDV A;  2DI3 A;  3KYJ A;  1UG7 A;  4DBQ A;  3RKO F;  1ZHX A;  1OW8 A;  1SMY F;  2LCH A;  2OJE D;  2L6F A;  2FAP B;  2NPU A;  3K66 A;  1NFO A;  4U5F E;  1E85 A;  3U8P A;  1LE2 A;  4JIO A;  2J7P D;  3M1C B;  3TD7 A;  3L1M A;  3L34 A;  4O6N A;  3OWT A;  1PV3 A;  2J7P A;  3CZ6 A;  4PR9 A;  2D5R B;  4E17 A;  5K0I A;  3CAX A;  4QDL A;  4PAC A;  4MVM A;  5FZT A;  1ZHT A;  3JT1 A;  3ABM C;  5E2Q A;  1RMV A;  1BDJ B;  1R5I D;  1OXB A;  3RVZ A;  3N2Z B;  3O39 A;  1L3P A;  2YRF A;  4KNV A;  1YA9 A;  3QZC A;  4I44 A;  1M6T A;  4Q4Z F;  1GGQ A;  2J0X A;  1QZX A;  1LI5 A;  2DGJ A;  4MQ9 F;  4BJ1 A;  4E7S A;  1BR4 A;  1M57 C;  2OEX A;  5KYU B;  4UDV A;  1MMN A;  1V54 C;  2HUJ A;  2QNL A;  3EPV A;  3IQ5 A;  3SZR A;  4ZLC A;  4CIP A;  2XSE A;  5KYX A;  4C3B A;  2CYD A;  1KTM A;  4MVO A;  1TWC A;  2H7O A;  2XL6 A;  3T6B A;  1GQA A;  3NG1 A;  4P6I C;  5D91 A;  5JRA A;  4F4B A;  2JD3 A;  3IPM O;  3JYY A;  1R4T A;  1OR3 A;  4MTO A;  4MND A;  4OD4 A;  1DOW A;  4H54 A;  5L0J A;  3JTL O;  3KYI A;  3NYL A;  5A6K A;  4N6H A;  2YZS A;  5JUA A;  1LI7 A;  4AE4 A;  2Y3H A;  3V7O A;  3IHU A;  3IEE A;  1T6U A;  3RIP A;  3CEX A;  2Y69 C;  2ZXP A;  4JTA B;  4QI0 A;  3H2U A;  1WGW A;  4MTF A;  5KYW A;  3S0X A;  2AU5 A;  1HW1 A;  2L81 A;  3HNJ A;  3MFN A;  1A7D A;  2YL7 A;  2ZD9 A;  1Z7Q c;  1E83 A;  4BJ6 A;  5COF A;  2PFD A;  1FNT c;  3V5Z A;  1H9G A;  3S90 A;  2LD6 A;  4JZA A;  4IAR A;  4ER9 A;  5L0D A;  2XLM A;  1WTY A;  1CPR A;  2W4M A;  3RFY A;  2L6G A;  4J7T A;  3W2W A;  3NYJ A;  2L6H A;  5JVE A;  5A6B D;  3QMK A;  2QTV A;  3H2V A;  3IQT A;  4LLC A;  1JR8 A;  3LES A;  4RBN A;  3EGX B;  3PCV A;  2XLE A;  3Q6N A;  2P7V A;  5HSW A;  2CW0 F;  4O7G A;  3TJ6 A;  2V26 A;  2XRH A;  1K40 A;  1TWH A;  2J8W A;  2PF4 E;  3R7C A;  4OIQ F;  4CIH A;  1F1M A;  3U9J A;  4JVS A;  3ZG1 A;  4OIP F;  2Q4F A;  3JSE O;  1A0B A;  3EH1 A;  1LIH A;  4LDQ A;  2G3K A;  2Z15 A;  2L7A A;  3HNK A;  3POV A;  1ZHY A;  1SF8 A;  4BEM J;  3DD7 A;  3G50 A;  2XS1 A;  2CDQ A;  3IQC A;  4XPY A;  4YK5 A;  3LUT B;  4YL3 A;  2EIN C;  3T4R A;  3HKK A;  4W8P A;  3ZTZ A;  2VCB A;  4DRJ B;  3UGP A;  2PX0 A;  5B1B C;  1J8M F;  4DBR A;  1OKK D;  4NTF A;  4IB4 A;  1BBH A;  2IBF A;  1H7I A;  4Q5S F;  3BEH A;  3FOP A;  5BUO A;  3L8I A;  4IAO A;  1BR2 A;  1LE4 A;  1FFT C;  1M2V A;  1QPU A;  2LFF A;  2LQG A;  2R7O A;  3EGD B;  3I5P A;  3QVY A;  4G78 A;  3T6G B;  4N4W A;  3VRC A;  2TMV P;  3EFO A;  3K33 A;  2OCC C;  1E2X A;  2R02 A;  3C7J A;  3PHF 2;  2HJ3 A;  4OD5 A;  2BE5 F;  4G0H A;  1G4U S;  4C7O B;  4JEA A;  1Y4C A;  4CS9 C;  1FFH A;  3EG9 A;  4X0R A;  1JMW A;  4K1O A;  3WG7 C;  3N24 A;  4BPM A;  2ICW G;  3DE8 A;  4JEB A;  2WVO A;  3JYH A;  4Z9H A;  3B71 A;  2GDC A;  1CGN A;  4ULV A;  2YVK A;  3GM3 A;  5DS5 A;  2GWW A;  3LEV A;  4DXW A;  2QE9 A;  1EI7 A;  3HLZ A;  1OQC A;  3JCU Q;  4I1M A;  1HMO A;  1VK5 A;  1LM3 B;  2HKV A;  1QSP A;  5BQI A;  2F22 A;  2HV6 A;  3GOD A;  1Q0G A;  4GYT A;  4JRZ A;  2XL4 A;  5BQH A;  1A7E A;  3R2P A;  1ZVZ A;  3LEO A;  3V5X A;  2NSG A;  4IRU A;  1BZ4 A;  3C8G D;  3RH3 A;  5L3Q A;  4CSA A;  3K1H A;  1QVX A;  1XZQ A;  3JRT A;  1LS4 A;  3DZA A;  4Q7C A;  1QKR A;  2YLG A;  1Q0K A;  3FXH A;  4NC3 A;  4XEK A;  5B1A C;  1EQ1 A;  4XEF A;  1RKE A;  3N0T A;  2HJM A;  1SZI A;  2YWA A;  5HV9 A;  1C17 M;  3HJC A;  4KI2 A;  3M15 A;  2Q9B A;  3FMS A;  4PJL A;  2J46 A;  1G4W R;  1YYJ A;  1RJ9 B;  1VYK A;  2HMQ A;  4JJF A;  5E3C A;  3ZQV A;  1ZZP A;  5CI8 A;  4CS7 A;  3RQE A;  2P61 A;  1OXK A;  2YKZ A;  2KJG A;  1PD0 A;  3C62 A;  256B A;  1SYQ A;  3GWN A;  1Y6D A;  4JC7 A;  4EUK B;  2B0H A;  3UGO A;  1D1C A;  1FAP B;  3HNI A;  3SNH A;  3S28 A;  2XL8 A;  1OW6 A;  3O10 A;  3DJN B;  2EIL C;  4JTC B;  3VYW A;  2UUI A;  3ZQY A;  3VM6 A;  3MX3 A;  4DJ9 A;  3OEO A;  3X2Q C;  3GWL A;  4JKV A;  5F5F A;  2VAS A;  2C04 A;  3GOR A;  1U0B B;  3W2V A;  3NYM A;  4YT2 A;  2XLV A;  3QW1 A;  4Z9I A;  2R7T A;  4J7Y A;  2IXP A;  2W4B A;  2X51 A;  1OCO C;  3MYI A;  3AG2 C;  4NTB A;  4D4N A;  3PDM P;  2I8B A;  3E70 C;  3FDQ A;  3G4Z A;  3A11 A;  1J8Y F;  3Q7L A;  4HEA J;  4ANJ A;  1D0Y A;  4U9D A;  3U0C A;  2NUP B;  4YL0 A;  3U5S A;  2Y3B A;  5EHH A;  4KBL A;  3RVY A;  3DWW A;  3GEI A;  3CQZ A;  2CGE A;  2EPK X;  2G62 A;  3G4X A;  3NDB B;  4DOZ A;  2OEV A;  2J9V A;  3EH2 A;  4JTD B;  1TFO B;  4Z9J A;  5A6J A;  4HFF B;  3UMH A;  4NCQ A;  4EBJ A;  1I4Z A;  3DAG A;  2PNO A;  2NSF A;  4LER A; 
#chains in the Genus database with same CATH homology
 1XWJ A;  1ZVZ A;  1T01 A;  1DOW A;  4P9T A;  4E17 A;  5L0J A;  3TJ6 A;  2HSQ A;  5L0I A;  1H6G A;  4DJ9 A;  1ZW2 A;  4E18 A;  1QKR A;  3VF0 A;  4K1O A;  1RKE A;  3MYI A;  3H2U A;  1RKE B;  2L7A A;  5L0G A;  1U6H A;  5L0F A;  1U89 A;  2GDC A;  1TR2 A;  4ONS A;  4W8P A;  1L7C A;  1ZW3 A;  3S90 A;  1ST6 A;  2GWW A;  5L0D A;  1SYQ A;  4EHP A;  1RKC A;  4IGG A;  3TJ5 A;  2IBF A;  2B0H A;  3ZDL A;  4PR9 A;  1YDI A;  3H2V A;  2LQG A;  2X0C A;  3RF3 A;  5L0C A;  5FZT A;  3T6G B;  5L0H A;  1DOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...