2LQGA

Solution structure of the r4 domain of talin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
138
structure length
138
Chain Sequence
GIDPFTLVQRLEHAAKQAAASATQTIAAAQHAASAPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title RIAM and Vinculin Binding to Talin Are Mutually Exclusive and Regulate Adhesion Assembly and Turnover.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion, structural protein
total genus 47
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 2lqgA00
2X0CA 3H2UA 1U6HA 2B0HA 3ZDLA 5L0JA 5L0DA 1ST6A 5L0CA 3TJ6A 3VF0A 1RKEA 4E17A 2LQGA 1ZW2A 2IBFA 4IGGA 1T01A 5FZTA 2GDCA 3RF3A 1ZW3A 1TR2A 4DJ9A 1DOWA 3TJ5A 1H6GA 5L0FA 1RKCA 1QKRA 1SYQA 2HSQA 4EHPA 3S90A 1L7CA 1U89A 1YDIA 4PR9A 3T6GB 4P9TA 4W8PA 1XWJA 4ONSA 1DOVA 1RKEB 3H2VA 5L0HA 5L0GA 5L0IA 2L7AA 2GWWA 3MYIA 1ZVZA 4K1OA 4E18A
chains in the Genus database with same CATH superfamily
1CGNA 3U3BA 5B3IA 1O5HA 2B0HA 3IEEA 4AL0A 5HSWA 1TFOB 1Z6AA 3UMIA 4FX5A 5FCLA 3M15A 1VMAA 2AVKA 4J32B 3CZ6A 1HY5A 1M2VA 3VAYA 2YL1A 1ZHWA 3M1CB 3PCVA 4C3DA 1A41A 4U5HA 4CBEA 2XL6A 4X0RA 1FMWA 1PD0A 2EPKX 4E0IA 4LLCA 3W2VA 4DVYP 3M79A 1LIHA 2PBEA 2RD9A 1Q0FA 2XLEA 4PR9A 3DKAA 3BRJA 1VTMP 1ZZPA 2FFHA 3GEIA 2R7WA 1RKEB 3DAGA 2FAPB 1T6IA 4G78A 5BQIA 3AQCA 2F22A 3FMSA 5KYWB 3JRTA 1NSGB 3Q6NA 4E7SA 3LEOA 3E9VA 2EPOA 1OXKA 4XPWA 3CAXA 2W45A 4JE9A 3C8ZA 4Q7CA 4QI0A 1AEPA 4CS8A 2EIKC 2W4BA 3SZRA 2XLVA 2LK4A 4EKWA 1WOLA 2YRFA 3C7JA 5HV9A 1RXQA 2HKVA 2M4EA 4YK5A 4HE8D 5A6AA 2P6VA 3RQFA 5L0FA 1QKRA 4H4KC 3H65A 5D92A 2HSQA 2EPNA 3SXMA 2RSEB 1WASA 1R5ID 1HMOA 4YWQA 2IM8A 1GM5A 4I1OB 4I1MA 4I3MA 3ZG1A 4JTCB 4WGZA 2C03A 4O6YA 3ZTZA 4BEJA 2L7AA 4U5BE 3RFYA 2MWQA 3U9JA 2Q4FA 4JKVA 5E3CA 4AL1A 1OCOC 1ZVZA 2JD3A 3K1IA 1ORJA 4P6IC 2WVQA 3GWNA 1VLTA 2XLDA 4MW8A 2YZSA 2G3KA 2QY9A 4DBRA 1NLXA 3AGUA 5JP7A 3GODA 5D91A 2PP4A 2XSEA 2XL4A 4C3EA 4RDAA 2R7UA 4CS8C 1C17M 1SR2A 4A2NB 3NMKA 5T1DB 5DS5A 2BE5F 1QLEC 1ZW3A 1LVKA 4MS2A 3UGOA 3GM2A 1IW7F 1NZEA 1XZQA 1LPEA 2CYDA 4OD4A 1B68A 1G5ZA 3RVZA 1L7CA 1U89A 1LM3B 3HNLA 1MMDA 2YLDA 4JEBA 5DQZA 3B29A 3DZAA 5KYUA 2QUPA 4ONSA 3JTLO 2WVNA 4QI2A 3IQTA 2Y3GA 4C3BA 2DYRC 2GWWA 3R2PA 4MTFA 1FR0A 3EHMA 3K1IC 2VASA 3X1OA 3ZDLA 3ZWIA 2G3VA 1A7DA 3LAYA 4OIQF 1FAPB 3NYJA 3EG9B 4LDRA 4U9DA 4FWVA 2A68F 4NTFA 3JZ0A 2R7QA 4Z9IA 2ETSA 3KMIA 4BJ6A 4DBQA 2V3CC 3WHNA 3POVA 3TOMA 3NMJA 2KQ9A 3EGXB 3PDMP 3EZIA 4G7ZF 3GEEA 3V5YA 4JIOA 2J9BA 2PX3A 1D0ZA 4C7OA 2BC5A 1YDIA 3NKEA 3EFOA 4P9TA 2KSFA 3HKKA 1XWJA 2J0WA 4MVUA 2P1AA 2C04A 4DRHB 2HS5A 1QZXA 3LS1A 3PMRA 2Y3HA 5BUOA 5KYYA 4XEKA 4K1OA 3R7CA 3S0XA 1YA7O 5B3SC 3KH2A 2LP4A 4ULVA 4YL3A 5L0DA 1YVIA 3EJNA 2X51A 3U5SA 1PV3A 2LD6A 3TULA 4PFOA 3QW0A 2CNWD 4EBBA 3ABKC 2AWYA 2LFFA 2IXNA 3BEHA 4BJ6C 4CSAA 3IHUA 4G0HA 3FAJA 3LLIA 4FAPB 4Q4ZF 1KTMA 3QVYA 2ZD9A 1M6TA 4PJMA 5T3WA 5KYXB 3SXYA 2AWCA 2WVOA 3K66A 4MVOA 4MVSA 4U5EE 4CIHA 5A6BD 4U5FE 3F47A 1EI7A 2A6HF 2P7VA 2VB6A 3GM3A 2J45A 1Y6DA 3SP1A 3MBGA 2UUHA 2NUTA 4JW1A 2EPLX 2XXAB 5L3QA 1QPUA 3SYNA 2KYHA 3U8VA 4GEHA 5JVEA 2NUPB 1APCA 3DM9B 2DGJA 2CCYA 5COGA 2B0JA 2IYLD 4YN0B 4CDVA 1QVXA 3FOPA 3B0VC 1Z63A 4IGGA 2L9JA 1G4WR 4AE4B 2NSGA 4LACB 1C03A 1OXBA 2R7TA 3NDBB 4KNWA 3CSKA 1FNTc 1NG1A 1V74B 3HNJA 2Q9CA 4RD9A 4IJJA 2M64A 2PX0A 3S90A 2O9XA 3L34A 2EIJC 2YL0A 3C8GB 1M57C 3I5QA 2PF4E 3TQOA 1HMDA 3DXJF 3H2VA 1ZHTA 3MX3A 4NCQA 4BJ5A 1BDJB 4RBNA 5A6BA 2J0XA 2YL3A 2Y3DA 3N2ZB 3FOOA 5DS4A 4N06A 1U6HA 3NYLA 2ZXPA 1U0BB 1C02A 3KPHA 2TMVP 2G62A 2VH3A 2VCBA 4OIOF 1SF8A 3HNKA 1BR2A 1Q0GA 3FXHA 3L8JA 4JJFA 1VB5A 2IBFA 5F5HA 1H9TA 3UNGC 4F4BA 3OA1A 4DOZA 4YT2A 1HW1A 4HEAJ 1LI7A 1JAFA 1LE4A 3I4UA 1LS4A 4NTBA 1WGWA 3RKOF 4FESA 2IXMA 1SYQA 4XPYA 1VYKA 3AG2C 1NU9C 3HTKC 1OW6A 3RYLA 4BG0A 3N24A 1UG7A 3WODF 5BQHA 2HV6A 3ECSA 4YT5A 1H7IA 3ASOC 1Z7Qc 2XLHA 4BJ5C 4BJTA 4J7YA 5EK0A 1NU7D 3VRCA 1M2VB 5F5FA 2P61A 1S05A 3EPVA 2LFDA 1I5NA 4CDYA 1LS1A 3EH2A 5L0CA 4KI2A 2HFIA 1QQ3A 1RJ9B 1T6QA 2YLGA 3NMIA 4OD5A 3FVYA 1TFKB 4PFPA 3JT1A 5T3TA 3JSZA 2R7OA 3M4CA 4IAQA 4N6HA 3U2MA 2ICWG 1RMVA 2HSBA 4NY3A 2A0BA 3DMDA 1CPRA 2YWAA 3LNMB 2Y69C 3EG9A 1H6GA 4Q5SF 4UDVA 2AP3A 3S28A 2ZPAA 4IRUA 3AGTA 3B0UX 2MHRA 4CDAA 4W8PA 1JRAA 1V55C 3EHNA 2WZFA 3X2QC 2OG2A 1LI5A 5AC5A 1ZU4A 1LKXA 1YA9A 1HE9A 3MYIA 2LSEA 3DE9A 3DWWA 2I8BA 3H2UA 3ABMC 1HE1A 3TOLA 5IY5C 4IARA 2QNLA 5DVWA 5L0JA 3LNRA 4YL0A 3T9OA 1LE2A 3EH1A 3ZC4A 2H7VC 2CGEA 4CS7A 4CS9A 4XEVA 2A6EF 3K33A 2YKZA 1YZAA 2Y39A 3ZIBA 3PHF2 5AGFA 1OW7A 3AG4C 2P0NA 2KNHA 1JMWA 1TR2A 4ANJA 5EGYA 1RKCA 1VOMA 5KYNA 2KK1A 4XLPF 3JYHA 3QVZA 2J46A 2R7VA 2D5RB 4ER9A 4KNVA 2YHSA 2JX0A 3LEVA 4PJLA 4XQ1A 1G4US 2JPUA 1E85A 1G8XA 2J9WA 5L0GA 3GWLA 3HNIA 3LS0A 5A6JA 3QW1A 1YARO 2HJMA 2OJED 4EIYA 3U2LA 3NG1A 3LESA 3US6A 1I4ZA 3ZQYA 1ST6A 2E87A 3O6XA 3RIPA 2J8WA 2Q9AA 3A9CA 3ITFA 3FDQA 3U0CA 4JVSA 1VLSA 1MMNA 4XEFA 4CS9C 1TKNA 1Z3IX 5F28E 5FZTA 4K7BA 3K6BA 5KYUB 2NUPA 4MVZA 5B1AC 4HFFB 4CJOA 4LLEA 4GYTA 1YYXA 3T6JA 3B0PA 1OKKD 3E70C 3KL4A 3UR3C 1JPNA 3U9MA 3RW0A 1L3PA 4O6MA 5BQGA 1H9GA 1SZIA 2XS1A 1D1BA 3DM5A 1YJGA 1K40A 2Y3BA 1HW2A 3KKBA 4KBLA 2HV7A 3U8PA 3RH3A 2WZLA 4JURI 3QTHA 1JR8A 3WG7C 4XPXA 2YVKA 2J9VA 4LDQA 3DAFA 1M56C 1S7ZA 1Z23A 2W9YA 3NRHA 4H54A 2XLMA 2VC9A 3G4XA 4PACA 3MYFA 4LDKA 1CGME 1YAUO 3ABLC 4M63A 4EBJA 1ZHXA 1RKEA 1ORSC 4E17A 4B6IA 4NTAA 1TWGA 1O87A 5KYWA 3OEOA 4AX2A 2W4MA 4NQFA 4C7OB 4BJ1A 3EGDB 2VCAA 3EFOB 3IQ5A 2GDCA 1D1AA 1TWAA 4AK9A 1OR3A 3UGPA 4DJ9A 4JCHA 5JT4A 2L6GA 3N0TA 1Q0KA 2CNWA 2OOCA 4XWJA 4CSAC 1A0BA 2Q00A 3JRMO 3JYYA 3LJBA 5KYYB 1TWHA 1ZHYA 4JJGA 3DJUB 1CGOA 4W8KA 1UFBA 4Z9HA 3G4ZA 4WGYA 5CI9A 1EKYA 1OW8A 2KC3A 3U3FA 4BPMA 1MQVA 1OKKA 2Q9BA 1NBBA 2H7OA 3AQBA 1D1CA 3CEXA 4JTDB 3SXZA 1SMYF 2EIMC 4IAOA 4E18A 2IXPA 2YEVA 3HJCA 2A1DD 3Q6MA 3RQEA 3RQGA 5AC4A 2J9UA 2KJGA 3F46A 3JSEO 3SNHA 2YL7A 2OEVA 2XL8A 1ZW2A 3ZQVA 4U5DE 3O55A 3AJMA 4G7HF 2DYSC 1VK5A 2WB7A 1A7VA 5TJ5E 3RF3A 3EZHA 3GM1A 1YLMA 3KYIA 4ULWA 3VYWA 1RJ9A 3TJ5A 3TK0A 2XLWA 5A69A 1CPQA 2NUTB 1T5OA 2OEXA 3M4BA 3NKDA 4EHPA 4CIPA 4NC3A 4O79A 1E2XA 2R9RB 4L6RA 4IWBA 3T6GB 3W8HA 2NPUA 3W2WA 4PK4A 2R05A 3DI5A 1Z5ZA 4I44A 3CQZA 4JRZA 1WATA 5L0IA 2ZXOA 5EHHA 1T6UA 3L0IA 2V26A 3MLGA 2WZGA 3K7DA 3L1MA 2L81A 1BBHA 1BR1A 1F1MA 4WJ0A 4BEMJ 4D4XA 4N4WA 1YZCA 2XLOA 3OWTA 1KNYA 3TJ6A 1OQCA 3HLZA 1A7EA 1GQAA 3IPMO 2UUIA 1ZHZA 4MW3A 4DXWA 3QZCA 1T01A 2H8AA 2R7XA 2EINC 1D0YA 3VM6A 3C18A 1O3UA 1OCZC 4A4AA 3GORA 3O39A 4JEAA 3JCUQ 4PJJA 5JUAA 2OJQA 5COMA 4YL1A 1PD1A 1MNDA 5K0IA 3QMKA 1D0XA 2HZ8A 4U5GA 2MYSA 1ZU5A 1FFHA 3EGXA 3SEOA 3NYMA 2GAQA 4KC9A 2CDQA 4MVQA 4O6NA 1FFTC 2D4UA 1NFNA 3IQCA 4IB4A 4JC7A 3G50A 3TD7A 3S29A 1IZMA 1JPJA 4CX9A 3DJNB 1MMAA 2HJ3A 1J8MF 1Q0MA 1ORYA 2H7BA 1FTSA 2DB4A 2Z15A 3C63A 4WABA 3VF0A 3Q7LA 1JOGA 2CW0F 2LQGA 4N6CA 1W2WA 2XS8A 3ATPA 3KYJA 4U9EA 4D4NA 1VYIA 3S27A 5COFA 1E86A 2IXOA 2LIGA 2ZXRA 1MNEA 4E7ZA 1V4AA 2R03A 2PNOA 3ASNC 3K1HA 4CJGA 2R02A 1I4YA 3SXKA 5A6KA 3B9QA 3Q7GA 1Q0DA 3FHDA 4DRJB 2XM4A 3V7OA 2KW3C 4ZLDA 4K0DA 1TQGA 4EBKA 2J7PD 2R7RA 4HFKB 4O7GA 3C8GD 4OIRF 5KYXA 1QSPA 1RCPA 1EA8A 2QLAA 3L8IA 1K04A 4U5CE 2VCCA 4MQ9F 3IQ6A 3ZTMA 2OKUA 5B1BC 1AUEA 3LLKA 5E3AA 1FMVA 3WAQA 4J7TA 4EUKB 1XZPA 3S84A 1GS9A 2FGYA 2HUJA 5E2QA 3W4YA 2XXAA 5GPGB 2ASRA 1OR2A 2YQYA 3B71A 1NFOA 3DE8A 5CIVA 1J8YF 1OCRC 4DRIB 1ZYRF 1DOWA 5L3VA 3EQLF 3V5XA 1EQ1A 2DI3A 4R32A 2L6HA 3V5ZA 3ZSUA 2HMQA 5CI8A 1N1CA 2EILC 3EGDA 4PJNA 4Z9JA 3T6BA 4AE4A 2L6FA 4ZLCA 2WL8A 2AU5A 2OQMA 4QDLA 1R4TA 4XLNF 2I15A 4JCZA 2QE9A 2Q7RA 5JRAA 1E84A 4MVMA 1MMGA 3FAPB 3S9OA 3UMHA 5JS5A 3AOUA 4YT4A 3GANA 4LERA 4MTGA 4MVRA 2X0CA 1AVOB 1M2OA 1V54C 2XM0A 2HMZA 3DD7A 3O10A 2J7PA 4J30B 4JZAA 2OU6A 2GA0A 1K05A 3C8GA 4MNDA 4P9FA 4XTKA 5JSLA 5DLJA 2A0UA 2Q3TA 2A69F 2GFHA 1WWPA 4GQHA 3AG1C 2YLIA 1T9KA 4EWCA 1TWCA 3T4RA 3W8IA 4G7OF 1BZ4A 3UMKA 4OINF 1BR4A 3J06A 3LUTB 3ZVRA 4OIPF 2OCCC 1KU2A 2ZXWC 4YT8A 2LCHA 3I5PA 4MTOA 1Y4CA 3A11A 1WN0A 1YYJA 2R25A 1OCCC 3AG3C 3GEHA 4DVZA 2EPMX 2NG1A 2QTVA 3RVYA 4E0HA 2R7SA 5JLIA 1GGQA 4JTAB 5E33A 5DS6A 2PFDA 2NSFA 1PCXA 256BA 3MFNA 1WTYA 1E83A 1DOVA 5L0HA 3C62A 2BL2A 4YJWA 2IOQA 5DQTA 2KGOA 2XRHA
chains in the Genus database with same CATH topology
2X0CA 3H2UA 1U6HA 2B0HA 3ZDLA 5L0JA 5L0DA 1ST6A 5L0CA 3TJ6A 3VF0A 1RKEA 4E17A 2LQGA 1ZW2A 2IBFA 4IGGA 1T01A 5FZTA 2GDCA 3RF3A 1ZW3A 1TR2A 4DJ9A 1DOWA 3TJ5A 1H6GA 5L0FA 1RKCA 1QKRA 1SYQA 2HSQA 4EHPA 3S90A 1L7CA 1U89A 1YDIA 4PR9A 3T6GB 4P9TA 4W8PA 1XWJA 4ONSA 1DOVA 1RKEB 3H2VA 5L0HA 5L0GA 5L0IA 2L7AA 2GWWA 3MYIA 1ZVZA 4K1OA 4E18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X0C A;  3H2U A;  1U6H A;  2B0H A;  3ZDL A;  5L0J A;  5L0D A;  1ST6 A;  5L0C A;  3TJ6 A;  3VF0 A;  1RKE A;  4E17 A;  2LQG A;  1ZW2 A;  2IBF A;  4IGG A;  1T01 A;  5FZT A;  2GDC A;  3RF3 A;  1ZW3 A;  1TR2 A;  4DJ9 A;  1DOW A;  3TJ5 A;  1H6G A;  5L0F A;  1RKC A;  1QKR A;  1SYQ A;  2HSQ A;  4EHP A;  3S90 A;  1L7C A;  1U89 A;  1YDI A;  4PR9 A;  3T6G B;  4P9T A;  4W8P A;  1XWJ A;  4ONS A;  1DOV A;  1RKE B;  3H2V A;  5L0H A;  5L0G A;  5L0I A;  2L7A A;  2GWW A;  3MYI A;  1ZVZ A;  4K1O A;  4E18 A; 
#chains in the Genus database with same CATH topology
 1CGN A;  3U3B A;  5B3I A;  1O5H A;  2B0H A;  3IEE A;  4AL0 A;  5HSW A;  1TFO B;  1Z6A A;  3UMI A;  4FX5 A;  5FCL A;  3M15 A;  1VMA A;  2AVK A;  4J32 B;  3CZ6 A;  1HY5 A;  1M2V A;  3VAY A;  2YL1 A;  1ZHW A;  3M1C B;  3PCV A;  4C3D A;  1A41 A;  4U5H A;  4CBE A;  2XL6 A;  4X0R A;  1FMW A;  1PD0 A;  2EPK X;  4E0I A;  4LLC A;  3W2V A;  4DVY P;  3M79 A;  1LIH A;  2PBE A;  2RD9 A;  1Q0F A;  2XLE A;  4PR9 A;  3DKA A;  3BRJ A;  1VTM P;  1ZZP A;  2FFH A;  3GEI A;  2R7W A;  1RKE B;  3DAG A;  2FAP B;  1T6I A;  4G78 A;  5BQI A;  3AQC A;  2F22 A;  3FMS A;  5KYW B;  3JRT A;  1NSG B;  3Q6N A;  4E7S A;  3LEO A;  3E9V A;  2EPO A;  1OXK A;  4XPW A;  3CAX A;  2W45 A;  4JE9 A;  3C8Z A;  4Q7C A;  4QI0 A;  1AEP A;  4CS8 A;  2EIK C;  2W4B A;  3SZR A;  2XLV A;  2LK4 A;  4EKW A;  1WOL A;  2YRF A;  3C7J A;  5HV9 A;  1RXQ A;  2HKV A;  2M4E A;  4YK5 A;  4HE8 D;  5A6A A;  2P6V A;  3RQF A;  5L0F A;  1QKR A;  4H4K C;  3H65 A;  5D92 A;  2HSQ A;  2EPN A;  3SXM A;  2RSE B;  1WAS A;  1R5I D;  1HMO A;  4YWQ A;  2IM8 A;  1GM5 A;  4I1O B;  4I1M A;  4I3M A;  3ZG1 A;  4JTC B;  4WGZ A;  2C03 A;  4O6Y A;  3ZTZ A;  4BEJ A;  2L7A A;  4U5B E;  3RFY A;  2MWQ A;  3U9J A;  2Q4F A;  4JKV A;  5E3C A;  4AL1 A;  1OCO C;  1ZVZ A;  2JD3 A;  3K1I A;  1ORJ A;  4P6I C;  2WVQ A;  3GWN A;  1VLT A;  2XLD A;  4MW8 A;  2YZS A;  2G3K A;  2QY9 A;  4DBR A;  1NLX A;  3AGU A;  5JP7 A;  3GOD A;  5D91 A;  2PP4 A;  2XSE A;  2XL4 A;  4C3E A;  4RDA A;  2R7U A;  4CS8 C;  1C17 M;  1SR2 A;  4A2N B;  3NMK A;  5T1D B;  5DS5 A;  2BE5 F;  1QLE C;  1ZW3 A;  1LVK A;  4MS2 A;  3UGO A;  3GM2 A;  1IW7 F;  1NZE A;  1XZQ A;  1LPE A;  2CYD A;  4OD4 A;  1B68 A;  1G5Z A;  3RVZ A;  1L7C A;  1U89 A;  1LM3 B;  3HNL A;  1MMD A;  2YLD A;  4JEB A;  5DQZ A;  3B29 A;  3DZA A;  5KYU A;  2QUP A;  4ONS A;  3JTL O;  2WVN A;  4QI2 A;  3IQT A;  2Y3G A;  4C3B A;  2DYR C;  2GWW A;  3R2P A;  4MTF A;  1FR0 A;  3EHM A;  3K1I C;  2VAS A;  3X1O A;  3ZDL A;  3ZWI A;  2G3V A;  1A7D A;  3LAY A;  4OIQ F;  1FAP B;  3NYJ A;  3EG9 B;  4LDR A;  4U9D A;  4FWV A;  2A68 F;  4NTF A;  3JZ0 A;  2R7Q A;  4Z9I A;  2ETS A;  3KMI A;  4BJ6 A;  4DBQ A;  2V3C C;  3WHN A;  3POV A;  3TOM A;  3NMJ A;  2KQ9 A;  3EGX B;  3PDM P;  3EZI A;  4G7Z F;  3GEE A;  3V5Y A;  4JIO A;  2J9B A;  2PX3 A;  1D0Z A;  4C7O A;  2BC5 A;  1YDI A;  3NKE A;  3EFO A;  4P9T A;  2KSF A;  3HKK A;  1XWJ A;  2J0W A;  4MVU A;  2P1A A;  2C04 A;  4DRH B;  2HS5 A;  1QZX A;  3LS1 A;  3PMR A;  2Y3H A;  5BUO A;  5KYY A;  4XEK A;  4K1O A;  3R7C A;  3S0X A;  1YA7 O;  5B3S C;  3KH2 A;  2LP4 A;  4ULV A;  4YL3 A;  5L0D A;  1YVI A;  3EJN A;  2X51 A;  3U5S A;  1PV3 A;  2LD6 A;  3TUL A;  4PFO A;  3QW0 A;  2CNW D;  4EBB A;  3ABK C;  2AWY A;  2LFF A;  2IXN A;  3BEH A;  4BJ6 C;  4CSA A;  3IHU A;  4G0H A;  3FAJ A;  3LLI A;  4FAP B;  4Q4Z F;  1KTM A;  3QVY A;  2ZD9 A;  1M6T A;  4PJM A;  5T3W A;  5KYX B;  3SXY A;  2AWC A;  2WVO A;  3K66 A;  4MVO A;  4MVS A;  4U5E E;  4CIH A;  5A6B D;  4U5F E;  3F47 A;  1EI7 A;  2A6H F;  2P7V A;  2VB6 A;  3GM3 A;  2J45 A;  1Y6D A;  3SP1 A;  3MBG A;  2UUH A;  2NUT A;  4JW1 A;  2EPL X;  2XXA B;  5L3Q A;  1QPU A;  3SYN A;  2KYH A;  3U8V A;  4GEH A;  5JVE A;  2NUP B;  1APC A;  3DM9 B;  2DGJ A;  2CCY A;  5COG A;  2B0J A;  2IYL D;  4YN0 B;  4CDV A;  1QVX A;  3FOP A;  3B0V C;  1Z63 A;  4IGG A;  2L9J A;  1G4W R;  4AE4 B;  2NSG A;  4LAC B;  1C03 A;  1OXB A;  2R7T A;  3NDB B;  4KNW A;  3CSK A;  1FNT c;  1NG1 A;  1V74 B;  3HNJ A;  2Q9C A;  4RD9 A;  4IJJ A;  2M64 A;  2PX0 A;  3S90 A;  2O9X A;  3L34 A;  2EIJ C;  2YL0 A;  3C8G B;  1M57 C;  3I5Q A;  2PF4 E;  3TQO A;  1HMD A;  3DXJ F;  3H2V A;  1ZHT A;  3MX3 A;  4NCQ A;  4BJ5 A;  1BDJ B;  4RBN A;  5A6B A;  2J0X A;  2YL3 A;  2Y3D A;  3N2Z B;  3FOO A;  5DS4 A;  4N06 A;  1U6H A;  3NYL A;  2ZXP A;  1U0B B;  1C02 A;  3KPH A;  2TMV P;  2G62 A;  2VH3 A;  2VCB A;  4OIO F;  1SF8 A;  3HNK A;  1BR2 A;  1Q0G A;  3FXH A;  3L8J A;  4JJF A;  1VB5 A;  2IBF A;  5F5H A;  1H9T A;  3UNG C;  4F4B A;  3OA1 A;  4DOZ A;  4YT2 A;  1HW1 A;  4HEA J;  1LI7 A;  1JAF A;  1LE4 A;  3I4U A;  1LS4 A;  4NTB A;  1WGW A;  3RKO F;  4FES A;  2IXM A;  1SYQ A;  4XPY A;  1VYK A;  3AG2 C;  1NU9 C;  3HTK C;  1OW6 A;  3RYL A;  4BG0 A;  3N24 A;  1UG7 A;  3WOD F;  5BQH A;  2HV6 A;  3ECS A;  4YT5 A;  1H7I A;  3ASO C;  1Z7Q c;  2XLH A;  4BJ5 C;  4BJT A;  4J7Y A;  5EK0 A;  1NU7 D;  3VRC A;  1M2V B;  5F5F A;  2P61 A;  1S05 A;  3EPV A;  2LFD A;  1I5N A;  4CDY A;  1LS1 A;  3EH2 A;  5L0C A;  4KI2 A;  2HFI A;  1QQ3 A;  1RJ9 B;  1T6Q A;  2YLG A;  3NMI A;  4OD5 A;  3FVY A;  1TFK B;  4PFP A;  3JT1 A;  5T3T A;  3JSZ A;  2R7O A;  3M4C A;  4IAQ A;  4N6H A;  3U2M A;  2ICW G;  1RMV A;  2HSB A;  4NY3 A;  2A0B A;  3DMD A;  1CPR A;  2YWA A;  3LNM B;  2Y69 C;  3EG9 A;  1H6G A;  4Q5S F;  4UDV A;  2AP3 A;  3S28 A;  2ZPA A;  4IRU A;  3AGT A;  3B0U X;  2MHR A;  4CDA A;  4W8P A;  1JRA A;  1V55 C;  3EHN A;  2WZF A;  3X2Q C;  2OG2 A;  1LI5 A;  5AC5 A;  1ZU4 A;  1LKX A;  1YA9 A;  1HE9 A;  3MYI A;  2LSE A;  3DE9 A;  3DWW A;  2I8B A;  3H2U A;  3ABM C;  1HE1 A;  3TOL A;  5IY5 C;  4IAR A;  2QNL A;  5DVW A;  5L0J A;  3LNR A;  4YL0 A;  3T9O A;  1LE2 A;  3EH1 A;  3ZC4 A;  2H7V C;  2CGE A;  4CS7 A;  4CS9 A;  4XEV A;  2A6E F;  3K33 A;  2YKZ A;  1YZA A;  2Y39 A;  3ZIB A;  3PHF 2;  5AGF A;  1OW7 A;  3AG4 C;  2P0N A;  2KNH A;  1JMW A;  1TR2 A;  4ANJ A;  5EGY A;  1RKC A;  1VOM A;  5KYN A;  2KK1 A;  4XLP F;  3JYH A;  3QVZ A;  2J46 A;  2R7V A;  2D5R B;  4ER9 A;  4KNV A;  2YHS A;  2JX0 A;  3LEV A;  4PJL A;  4XQ1 A;  1G4U S;  2JPU A;  1E85 A;  1G8X A;  2J9W A;  5L0G A;  3GWL A;  3HNI A;  3LS0 A;  5A6J A;  3QW1 A;  1YAR O;  2HJM A;  2OJE D;  4EIY A;  3U2L A;  3NG1 A;  3LES A;  3US6 A;  1I4Z A;  3ZQY A;  1ST6 A;  2E87 A;  3O6X A;  3RIP A;  2J8W A;  2Q9A A;  3A9C A;  3ITF A;  3FDQ A;  3U0C A;  4JVS A;  1VLS A;  1MMN A;  4XEF A;  4CS9 C;  1TKN A;  1Z3I X;  5F28 E;  5FZT A;  4K7B A;  3K6B A;  5KYU B;  2NUP A;  4MVZ A;  5B1A C;  4HFF B;  4CJO A;  4LLE A;  4GYT A;  1YYX A;  3T6J A;  3B0P A;  1OKK D;  3E70 C;  3KL4 A;  3UR3 C;  1JPN A;  3U9M A;  3RW0 A;  1L3P A;  4O6M A;  5BQG A;  1H9G A;  1SZI A;  2XS1 A;  1D1B A;  3DM5 A;  1YJG A;  1K40 A;  2Y3B A;  1HW2 A;  3KKB A;  4KBL A;  2HV7 A;  3U8P A;  3RH3 A;  2WZL A;  4JUR I;  3QTH A;  1JR8 A;  3WG7 C;  4XPX A;  2YVK A;  2J9V A;  4LDQ A;  3DAF A;  1M56 C;  1S7Z A;  1Z23 A;  2W9Y A;  3NRH A;  4H54 A;  2XLM A;  2VC9 A;  3G4X A;  4PAC A;  3MYF A;  4LDK A;  1CGM E;  1YAU O;  3ABL C;  4M63 A;  4EBJ A;  1ZHX A;  1RKE A;  1ORS C;  4E17 A;  4B6I A;  4NTA A;  1TWG A;  1O87 A;  5KYW A;  3OEO A;  4AX2 A;  2W4M A;  4NQF A;  4C7O B;  4BJ1 A;  3EGD B;  2VCA A;  3EFO B;  3IQ5 A;  2GDC A;  1D1A A;  1TWA A;  4AK9 A;  1OR3 A;  3UGP A;  4DJ9 A;  4JCH A;  5JT4 A;  2L6G A;  3N0T A;  1Q0K A;  2CNW A;  2OOC A;  4XWJ A;  4CSA C;  1A0B A;  2Q00 A;  3JRM O;  3JYY A;  3LJB A;  5KYY B;  1TWH A;  1ZHY A;  4JJG A;  3DJU B;  1CGO A;  4W8K A;  1UFB A;  4Z9H A;  3G4Z A;  4WGY A;  5CI9 A;  1EKY A;  1OW8 A;  2KC3 A;  3U3F A;  4BPM A;  1MQV A;  1OKK A;  2Q9B A;  1NBB A;  2H7O A;  3AQB A;  1D1C A;  3CEX A;  4JTD B;  3SXZ A;  1SMY F;  2EIM C;  4IAO A;  4E18 A;  2IXP A;  2YEV A;  3HJC A;  2A1D D;  3Q6M A;  3RQE A;  3RQG A;  5AC4 A;  2J9U A;  2KJG A;  3F46 A;  3JSE O;  3SNH A;  2YL7 A;  2OEV A;  2XL8 A;  1ZW2 A;  3ZQV A;  4U5D E;  3O55 A;  3AJM A;  4G7H F;  2DYS C;  1VK5 A;  2WB7 A;  1A7V A;  5TJ5 E;  3RF3 A;  3EZH A;  3GM1 A;  1YLM A;  3KYI A;  4ULW A;  3VYW A;  1RJ9 A;  3TJ5 A;  3TK0 A;  2XLW A;  5A69 A;  1CPQ A;  2NUT B;  1T5O A;  2OEX A;  3M4B A;  3NKD A;  4EHP A;  4CIP A;  4NC3 A;  4O79 A;  1E2X A;  2R9R B;  4L6R A;  4IWB A;  3T6G B;  3W8H A;  2NPU A;  3W2W A;  4PK4 A;  2R05 A;  3DI5 A;  1Z5Z A;  4I44 A;  3CQZ A;  4JRZ A;  1WAT A;  5L0I A;  2ZXO A;  5EHH A;  1T6U A;  3L0I A;  2V26 A;  3MLG A;  2WZG A;  3K7D A;  3L1M A;  2L81 A;  1BBH A;  1BR1 A;  1F1M A;  4WJ0 A;  4BEM J;  4D4X A;  4N4W A;  1YZC A;  2XLO A;  3OWT A;  1KNY A;  3TJ6 A;  1OQC A;  3HLZ A;  1A7E A;  1GQA A;  3IPM O;  2UUI A;  1ZHZ A;  4MW3 A;  4DXW A;  3QZC A;  1T01 A;  2H8A A;  2R7X A;  2EIN C;  1D0Y A;  3VM6 A;  3C18 A;  1O3U A;  1OCZ C;  4A4A A;  3GOR A;  3O39 A;  4JEA A;  3JCU Q;  4PJJ A;  5JUA A;  2OJQ A;  5COM A;  4YL1 A;  1PD1 A;  1MND A;  5K0I A;  3QMK A;  1D0X A;  2HZ8 A;  4U5G A;  2MYS A;  1ZU5 A;  1FFH A;  3EGX A;  3SEO A;  3NYM A;  2GAQ A;  4KC9 A;  2CDQ A;  4MVQ A;  4O6N A;  1FFT C;  2D4U A;  1NFN A;  3IQC A;  4IB4 A;  4JC7 A;  3G50 A;  3TD7 A;  3S29 A;  1IZM A;  1JPJ A;  4CX9 A;  3DJN B;  1MMA A;  2HJ3 A;  1J8M F;  1Q0M A;  1ORY A;  2H7B A;  1FTS A;  2DB4 A;  2Z15 A;  3C63 A;  4WAB A;  3VF0 A;  3Q7L A;  1JOG A;  2CW0 F;  2LQG A;  4N6C A;  1W2W A;  2XS8 A;  3ATP A;  3KYJ A;  4U9E A;  4D4N A;  1VYI A;  3S27 A;  5COF A;  1E86 A;  2IXO A;  2LIG A;  2ZXR A;  1MNE A;  4E7Z A;  1V4A A;  2R03 A;  2PNO A;  3ASN C;  3K1H A;  4CJG A;  2R02 A;  1I4Y A;  3SXK A;  5A6K A;  3B9Q A;  3Q7G A;  1Q0D A;  3FHD A;  4DRJ B;  2XM4 A;  3V7O A;  2KW3 C;  4ZLD A;  4K0D A;  1TQG A;  4EBK A;  2J7P D;  2R7R A;  4HFK B;  4O7G A;  3C8G D;  4OIR F;  5KYX A;  1QSP A;  1RCP A;  1EA8 A;  2QLA A;  3L8I A;  1K04 A;  4U5C E;  2VCC A;  4MQ9 F;  3IQ6 A;  3ZTM A;  2OKU A;  5B1B C;  1AUE A;  3LLK A;  5E3A A;  1FMV A;  3WAQ A;  4J7T A;  4EUK B;  1XZP A;  3S84 A;  1GS9 A;  2FGY A;  2HUJ A;  5E2Q A;  3W4Y A;  2XXA A;  5GPG B;  2ASR A;  1OR2 A;  2YQY A;  3B71 A;  1NFO A;  3DE8 A;  5CIV A;  1J8Y F;  1OCR C;  4DRI B;  1ZYR F;  1DOW A;  5L3V A;  3EQL F;  3V5X A;  1EQ1 A;  2DI3 A;  4R32 A;  2L6H A;  3V5Z A;  3ZSU A;  2HMQ A;  5CI8 A;  1N1C A;  2EIL C;  3EGD A;  4PJN A;  4Z9J A;  3T6B A;  4AE4 A;  2L6F A;  4ZLC A;  2WL8 A;  2AU5 A;  2OQM A;  4QDL A;  1R4T A;  4XLN F;  2I15 A;  4JCZ A;  2QE9 A;  2Q7R A;  5JRA A;  1E84 A;  4MVM A;  1MMG A;  3FAP B;  3S9O A;  3UMH A;  5JS5 A;  3AOU A;  4YT4 A;  3GAN A;  4LER A;  4MTG A;  4MVR A;  2X0C A;  1AVO B;  1M2O A;  1V54 C;  2XM0 A;  2HMZ A;  3DD7 A;  3O10 A;  2J7P A;  4J30 B;  4JZA A;  2OU6 A;  2GA0 A;  1K05 A;  3C8G A;  4MND A;  4P9F A;  4XTK A;  5JSL A;  5DLJ A;  2A0U A;  2Q3T A;  2A69 F;  2GFH A;  1WWP A;  4GQH A;  3AG1 C;  2YLI A;  1T9K A;  4EWC A;  1TWC A;  3T4R A;  3W8I A;  4G7O F;  1BZ4 A;  3UMK A;  4OIN F;  1BR4 A;  3J06 A;  3LUT B;  3ZVR A;  4OIP F;  2OCC C;  1KU2 A;  2ZXW C;  4YT8 A;  2LCH A;  3I5P A;  4MTO A;  1Y4C A;  3A11 A;  1WN0 A;  1YYJ A;  2R25 A;  1OCC C;  3AG3 C;  3GEH A;  4DVZ A;  2EPM X;  2NG1 A;  2QTV A;  3RVY A;  4E0H A;  2R7S A;  5JLI A;  1GGQ A;  4JTA B;  5E33 A;  5DS6 A;  2PFD A;  2NSF A;  1PCX A;  256B A;  3MFN A;  1WTY A;  1E83 A;  1DOV A;  5L0H A;  3C62 A;  2BL2 A;  4YJW A;  2IOQ A;  5DQT A;  2KGO A;  2XRH A; 
#chains in the Genus database with same CATH homology
 2X0C A;  3H2U A;  1U6H A;  2B0H A;  3ZDL A;  5L0J A;  5L0D A;  1ST6 A;  5L0C A;  3TJ6 A;  3VF0 A;  1RKE A;  4E17 A;  2LQG A;  1ZW2 A;  2IBF A;  4IGG A;  1T01 A;  5FZT A;  2GDC A;  3RF3 A;  1ZW3 A;  1TR2 A;  4DJ9 A;  1DOW A;  3TJ5 A;  1H6G A;  5L0F A;  1RKC A;  1QKR A;  1SYQ A;  2HSQ A;  4EHP A;  3S90 A;  1L7C A;  1U89 A;  1YDI A;  4PR9 A;  3T6G B;  4P9T A;  4W8P A;  1XWJ A;  4ONS A;  1DOV A;  1RKE B;  3H2V A;  5L0H A;  5L0G A;  5L0I A;  2L7A A;  2GWW A;  3MYI A;  1ZVZ A;  4K1O A;  4E18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...