4U5GA

Crystal structure of con-ikot-ikot toxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
ADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
molecule tags Toxin
molecule keywords Con-ikot-ikot
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5gA00
4U5GA 4U5CE 4U5DE 4U5BE 4U5HA 4U5EE 4U5FE
chains in the Genus database with same CATH superfamily
3L34A 4LACB 1WGWA 4BJ6A 3UNGC 4CJOA 4D4NA 4I44A 3S84A 1JPNA 3U2MA 4G7ZF 2OCCC 3CZ6A 3T6GB 5L0HA 2J9UA 2YKZA 3L8IA 3JRMO 2A0UA 3SXZA 3C7JA 4CDYA 1XZQA 1D1BA 4U5FE 3W8HA 4MVMA 4Z9IA 1VYIA 3CSKA 3SYNA 5T3TA 4CDVA 2OG2A 1J8MF 3GWLA 3I4UA 3K6BA 4JRZA 5BQIA 1RKEB 5JP7A 2R9RB 3HNJA 1LIHA 3S28A 3NKEA 256BA 3EJNA 5IY5C 5L0JA 5HSWA 1EQ1A 1K05A 1TR2A 3UMIA 2R7QA 4IRUA 4EUKB 4FESA 3M4CA 2UUHA 3WG7C 2Z15A 1LE2A 3JYHA 4CS8A 4PJNA 1L3PA 1XZPA 1LPEA 2J9VA 2J9BA 1AVOB 2KK1A 1EI7A 2ZXRA 3MFNA 4DRJB 5A6BA 1E84A 4E0IA 4BJ5A 1Q0GA 3M1CB 4RBNA 2IBFA 2R7OA 4J30B 2WZLA 3O6XA 4FX5A 4ANJA 1QVXA 3ZWIA 2NSGA 3LESA 1OW6A 1V4AA 1LI7A 3FDQA 2HZ8A 2A68F 2NSFA 3DZAA 3EQLF 5D91A 3DM5A 3Q7GA 5BQGA 3HNIA 4DVYP 1ORYA 2KC3A 2WVOA 1OCOC 2WZGA 4MW3A 1A7DA 5AGFA 5AC4A 4G7OF 4LLEA 1PCXA 2C03A 2H7BA 5KYUA 2KYHA 1GS9A 3B29A 3NKDA 5GPGB 4G7HF 1UG7A 4MQ9F 3N2ZB 3EG9B 2QE9A 4EBBA 2EILC 2NUPA 1RJ9B 4O6YA 3K1IC 3JT1A 3K1IA 4MNDA 1OCRC 1LVKA 3EGDB 1IW7F 3BRJA 4P6IC 1MNEA 3IHUA 3RVZA 1ZZPA 1H9TA 2OOCA 3UGPA 1A7VA 2KW3C 1NBBA 2ASRA 3E70C 2Y3DA 1G8XA 1OKKA 2PNOA 3HNLA 4E7ZA 2B0JA 1LKXA 1NFNA 3B0PA 1CGNA 4IGGA 1ORSC 2JPUA 4BJ6C 1OW7A 3RKOF 2KSFA 2DYSC 2UUIA 5COMA 2XLVA 1ZHTA 2EPLX 3LS0A 3NMIA 1MNDA 3U8PA 4BJ5C 4A4AA 3T6JA 1F1MA 5KYYA 1C02A 3B71A 3ABKC 4EBKA 1HY5A 3FAPB 4I1MA 3ABLC 3PDMP 3O55A 4MTOA 1YARO 1YYXA 3KMIA 5L0FA 2PF4E 1G5ZA 4C3BA 1JRAA 2DI3A 4OD4A 4WGYA 1R4TA 1SMYF 2HV7A 4X0RA 4MTFA 4CS9C 3QMKA 3JSEO 4NTBA 1QSPA 3RIPA 1AUEA 2VCAA 1L7CA 2W9YA 3GEEA 5TJ5E 3SZRA 4A2NB 2VC9A 2QY9A 4N4WA 4U5GA 2Q9AA 1YZAA 1RMVA 1HMOA 4CIHA 1U0BB 3I5PA 2R7WA 5HV9A 1NZEA 4YT2A 3N24A 4ULWA 3ATPA 1TWAA 1K04A 3HLZA 3SP1A 5EK0A 1SZIA 1FFTC 2XL8A 5JLIA 2KQ9A 3RQFA 1M6TA 1T6QA 2W4BA 4DXWA 4I3MA 2VB6A 3C62A 2Y3BA 4P9FA 1JR8A 2B0HA 4BG0A 2PP4A 2YWAA 5KYUB 4LLCA 4E0HA 4OIRF 4JEBA 1E85A 4E17A 3K66A 3IQ5A 2DYRC 3GM1A 2W45A 1FR0A 1ST6A 2J46A 3KYIA 3TJ5A 5L3QA 3SEOA 5T3WA 3S0XA 1VLTA 1D1AA 5L0CA 1TWHA 3FXHA 3HKKA 4FAPB 2D5RB 4ZLDA 1O3UA 2ETSA 2YVKA 3GODA 3ITFA 3NYJA 1VYKA 1NG1A 1NSGB 2PBEA 4JTDB 1A41A 3G4ZA 4JE9A 2ZD9A 3L1MA 1T6UA 5E2QA 4K1OA 4WGZA 1TFOB 2DB4A 4PJMA 1MMAA 1DOVA 3QZCA 1ZU4A 4GYTA 4E7SA 4DBQA 4U9EA 2XM4A 3N0TA 4JTCB 3S29A 4H4KC 4XLPF 3RFYA 3H65A 2CYDA 3ECSA 1V54C 2HFIA 4IAQA 1XWJA 2Q00A 2RD9A 3A11A 1WATA 3LS1A 3VRCA 2QTVA 1VLSA 2A0BA 4MVUA 3U0CA 1QQ3A 1H7IA 3AG3C 1FMWA 3JSZA 3MX3A 3NMKA 4YT8A 2HSQA 4J7YA 1I4YA 1EKYA 1BR2A 4MVSA 1DOWA 1T5OA 2M64A 1OCCC 3EGXA 3SXKA 3X1OA 2CCYA 2I15A 1S05A 3S27A 3AGUA 5L0IA 4JCZA 5T1DB 2OJED 4IB4A 4MTGA 1I4ZA 3LAYA 5JUAA 5DS5A 2IM8A 1OCZC 4YN0B 3AOUA 4D4XA 3M15A 2XLDA 4PFOA 3DI5A 1MMNA 2HKVA 4PJLA 3RQEA 3VM6A 2CNWA 2BL2A 3HTKC 3K33A 4BEJA 4DBRA 1JPJA 4CS7A 2Q3TA 3EPVA 2GDCA 3V5XA 2V3CC 1QPUA 1Y6DA 1NLXA 2YHSA 1Z5ZA 1FNTc 5CIVA 2ICWG 2Q9CA 4XPWA 3JRTA 2LK4A 3JZ0A 5L0GA 2R7XA 5JT4A 3DE8A 2MYSA 4BEMJ 1W2WA 2Q9BA 2R05A 2Y39A 4YL3A 2XXAA 2XRHA 4C7OA 3KYJA 1H6GA 4EIYA 3LNRA 4GQHA 4XTKA 1T9KA 1GQAA 4JKVA 2LFDA 2H7VC 2WB7A 4WABA 4G0HA 4HFKB 1E83A 1MQVA 2EPOA 2XL4A 3QVYA 1H9GA 3U3FA 4H54A 4ZLCA 5JVEA 2Q4FA 3OWTA 2R03A 3RH3A 2YL0A 4K0DA 2GA0A 1NU7D 2LD6A 3DAGA 4EKWA 3DKAA 1WWPA 1TQGA 3EGDA 3IQCA 3TULA 2J7PA 5DQZA 4BJTA 4O6NA 2AWYA 1OXBA 2GFHA 3ZIBA 1GM5A 3GM2A 4AL0A 2W4MA 1PD0A 3CQZA 3FOOA 1N1CA 2OEXA 2P61A 3RF3A 2XM0A 2L6FA 2MHRA 2HJ3A 1R5ID 1YAUO 2NUTA 3LJBA 4DJ9A 5F5HA 2EIJC 3DM9B 1AEPA 1TFKB 4C3EA 2EIMC 3GANA 3EGXB 4JVSA 3AGTA 4N6HA 3MBGA 3U9JA 2AVKA 2HJMA 1KTMA 3FMSA 4YL0A 2E87A 2FGYA 3FHDA 5A6AA 1M2OA 2OEVA 3V5YA 3WHNA 4P9TA 3DE9A 1LE4A 4RD9A 1NU9C 2QUPA 4DVZA 3ASOC 2IXNA 5JSLA 2YEVA 4I1OB 2D4UA 4YL1A 1FTSA 2VCCA 4O6MA 2L81A 3AJMA 4JJFA 1WTYA 1FAPB 5FZTA 4AE4B 1QKRA 2VASA 4CX9A 1VOMA 2HSBA 2J9WA 2YLIA 1ZW3A 3R2PA 4BJ1A 4J7TA 2O9XA 2LQGA 4PACA 5DS6A 4NC3A 1E2XA 1SR2A 3VYWA 5A69A 2OKUA 3C18A 4XEFA 2QNLA 2FFHA 4ONSA 1D0XA 1G4US 3JCUQ 2XSEA 5CI9A 1PD1A 2YL3A 4XWJA 2G3KA 4O7GA 3HJCA 4XQ1A 2R25A 3TD7A 3W2VA 4DRIB 2AWCA 3E9VA 1NFOA 2P7VA 3GEIA 2BC5A 4KNVA 1EA8A 4LDQA 1RCPA 4MVZA 3R7CA 1OR2A 3EZHA 5L0DA 1MMDA 1SYQA 3FVYA 1OKKD 3CEXA 4MS2A 5L3VA 4MW8A 4PFPA 4U5CE 2GAQA 3POVA 2R7RA 5KYXB 3A9CA 3WAQA 4Q4ZF 2Y3GA 4W8PA 4EWCA 1RKEA 2L9JA 4AK9A 4FWVA 1M56C 3MYIA 4CS8C 3NG1A 3NRHA 2H7OA 3EHNA 4YT5A 2J0XA 4DRHB 3DJNB 1YA7O 3G50A 5DS4A 3M79A 3V5ZA 2A1DD 2IXMA 4Z9HA 4JURI 1Z3IX 2EPMX 2YLGA 3LLIA 4MVOA 1CPRA 2PFDA 1LM3B 4LERA 3QW0A 4ULVA 2LSEA 3IEEA 3TQOA 3ABMC 3CAXA 5B1BC 3TK0A 4AL1A 2OU6A 2IXOA 4JIOA 4ER9A 4LDRA 1J8YF 1QZXA 1M2VB 3W4YA 3ZQYA 3LUTB 1VTMP 1PV3A 1YDIA 4OD5A 2ZPAA 4HE8D 3US6A 2J8WA 4CSAC 5F28E 3S90A 3PHF2 2C04A 3SNHA 2OQMA 4OIOF 3QW1A 3C8GB 3FAJA 2G3VA 1C17M 2H8AA 1Z6AA 1BZ4A 4U5EE 1U6HA 2AU5A 3J06A 1JMWA 1ZVZA 3EH2A 5B1AC 1BR4A 1Q0DA 1BDJB 1OR3A 2YRFA 3Q7LA 2X0CA 3AQBA 3VAYA 4XEVA 2XL6A 4CSAA 3I5QA 3TOMA 1M2VA 3SXYA 3EZIA 2EINC 3U9MA 3W8IA 2J45A 4CBEA 3SXMA 1GGQA 4C7OB 3TOLA 2XXAB 3MYFA 1O5HA 1YLMA 1RXQA 3K7DA 3OEOA 4K7BA 4L6RA 3UMHA 2PX3A 3V7OA 1E86A 2F22A 2TMVP 2WVQA 4U5DE 1V74B 3O39A 4M63A 3IPMO 1TWCA 2XLEA 5B3IA 2BE5F 4YJWA 2EIKC 4KBLA 3RQGA 2VCBA 4Q7CA 1B68A 1O87A 1ZW2A 1YJGA 2CNWD 2XLHA 3IQTA 3LNMB 5KYYB 4XEKA 2G62A 3U5SA 4PJJA 1HE9A 1ZHXA 3LEVA 5D92A 5KYNA 1KU2A 3DXJF 2EPNA 1OXKA 1WASA 4JZAA 3T4RA 4J32B 5E3CA 1WOLA 3KKBA 1WN0A 2MWQA 1LI5A 3PMRA 4IJJA 3UR3C 1ZHWA 4QDLA 2NG1A 2ZXPA 2Q7RA 3RW0A 2Y3HA 4NTAA 2DGJA 3ZSUA 5B3SC 1Z63A 4MVQA 4CIPA 2R7UA 2JD3A 1YVIA 4BPMA 3B0VC 4GEHA 3EFOA 2YL7A 2KNHA 3DAFA 1IZMA 1JAFA 2EPKX 3AQCA 3T6BA 5CI8A 3BEHA 3H2VA 4AX2A 4DOZA 5EHHA 3C8GA 4UDVA 2P0NA 4JC7A 2AP3A 1RKCA 3C8ZA 3K1HA 4PK4A 3F47A 3GM3A 5KYXA 2IXPA 3LLKA 2ZXWC 4NCQA 3UMKA 5KYWA 3M4BA 4N06A 4R32A 2HMZA 4YT4A 2CDQA 3AG2C 2YL1A 1ZYRF 4CDAA 2R7VA 3JYYA 1Q0KA 1MMGA 3Q6MA 2OJQA 3U3BA 3LEOA 1ZHZA 1Q0MA 4N6CA 4OIQF 2L6GA 3G4XA 1OW8A 2IOQA 3EHMA 4MVRA 3ZQVA 5AC5A 5E33A 2NUTB 2M4EA 2CW0F 3S9OA 4F4BA 1Q0FA 2CGEA 3DMDA 2P6VA 3ZDLA 1G4WR 2KJGA 4JW1A 4AE4A 5KYWB 1Z23A 4U9DA 2V26A 3L0IA 3ZVRA 2A6EF 3PCVA 4NTFA 1CPQA 4KNWA 3ZC4A 2WL8A 4Z9JA 1VK5A 4O79A 4PR9A 1Z7Qc 3NDBB 3RYLA 2R02A 3VF0A 5JS5A 3F46A 4G78A 2GWWA 1M57C 2J7PD 1K40A 1A7EA 2HMQA 3EFOB 3QTHA 3GORA 3RVYA 1ZU5A 2WZFA 2A69F 3HNKA 3TJ6A 4HFFB 5A6JA 4XPYA 3DD7A 1CGME 1VB5A 2L7AA 4NQFA 2YLDA 1BR1A 4LDKA 4QI0A 5JRAA 4U5BE 1C03A 3C63A 5DQTA 4E18A 3NYLA 4EBJA 2JX0A 2PX0A 3AG4C 3U2LA 4JEAA 3O10A 4KI2A 5BUOA 2I8BA 1I5NA 3JTLO 1ORJA 3B0UX 1JOGA 1BBHA 2FAPB 3GEHA 1T6IA 1KNYA 1FMVA 1APCA 1HMDA 1D0YA 3QVZA 3L8JA 4RDAA 3NMJA 4IARA 3ZTMA 2LCHA 5K0IA 3X2QC 3ZTZA 2A6HF 2ZXOA 4JJGA 4C3DA 5DVWA 2Y69C 1T01A 3UGOA 1CGOA 1U89A 2XLMA 4NY3A 1A0BA 1D0ZA 5DLJA 3Q6NA 1YA9A 5A6KA 4U5HA 2LFFA 2YQYA 2J0WA 2HS5A 3MLGA 3W2WA 2NUPB 2XS1A 4XPXA 5BQHA 4QI2A 2R7TA 1QLEC 1RJ9A 2XLWA 4KC9A 3DWWA 1Y4CA 2LP4A 4OINF 2LIGA 4B6IA 4YWQA 3U8VA 2VH3A 3IQ6A 1D1CA 3ZG1A 2XLOA 2HUJA 4IAOA 4JTAB 2QLAA 2RSEB 2KGOA 3OA1A 1ZHYA 2P1AA 3KH2A 4IWBA 5COFA 1HW1A 1SF8A 3EH1A 2WVNA 3GWNA 3T9OA 3C8GD 3ASNC 4WJ0A 3B9QA 4OIPF 1LS4A 4Q5SF 4JCHA 3NYMA 4EHPA 1UFBA 3FOPA 5A6BD 2NPUA 2R7SA 3H2UA 4CS9A 5FCLA 4W8KA 5F5FA 1VMAA 1FFHA 1HE1A 4XLNF 3WODF 3AG1C 1YZCA 3KPHA 1S7ZA 2L6HA 4YK5A 2XS8A 1HW2A 3DJUB 1TWGA 5EGYA 3EG9A 2HV6A 1TKNA 2X51A 1V55C 2YZSA 4HEAJ 2IYLD 1OQCA 5COGA 4CJGA 3KL4A 1LS1A 1YYJA 5E3AA
chains in the Genus database with same CATH topology
3L34A 4LACB 1WGWA 4BJ6A 3UNGC 4I44A 1JPNA 4G7ZF 2OCCC 3CZ6A 2J9UA 4U5FE 1D1BA 3W8HA 1VYIA 3CSKA 3SYNA 5T3TA 2OG2A 1J8MF 3I4UA 3K6BA 3S28A 5IY5C 3NKEA 5HSWA 3EJNA 1TR2A 3UMIA 2R7QA 4IRUA 4FESA 3WG7C 2Z15A 3JYHA 4CS8A 4PJNA 2J9VA 2ZXRA 4BJ5A 3M1CB 4RBNA 2R7OA 4J30B 2WZLA 3O6XA 4FX5A 4ANJA 3LESA 3FDQA 2A68F 3EQLF 3DZAA 5D91A 3DM5A 3Q7GA 4DVYP 2WVOA 1OCOC 2WZGA 4G7OF 4LLEA 1PCXA 2C03A 2H7BA 5KYUA 4G7HF 3NKDA 4MQ9F 3N2ZB 3EG9B 4EBBA 2EILC 2NUPA 1RJ9B 4O6YA 3K1IC 3JT1A 4MNDA 1OCRC 1LVKA 3EGDB 1IW7F 4P6IC 1MNEA 3UGPA 2KW3C 3E70C 2Y3DA 1G8XA 1OKKA 4E7ZA 2B0JA 1LKXA 3B0PA 4BJ6C 3RKOF 2DYSC 1ZHTA 3LS0A 1MNDA 4BJ5C 3T6JA 5KYYA 3ABKC 4I1MA 3ABLC 3KMIA 2PF4E 4C3BA 4OD4A 1SMYF 2HV7A 4X0RA 4CS9C 3QMKA 3RIPA 2W9YA 4A2NB 3SZRA 2QY9A 4U5GA 2Q9AA 4CIHA 3I5PA 2R7WA 1NZEA 4YT2A 3N24A 4ULWA 1TWAA 3HLZA 3SP1A 1SZIA 1FFTC 2KQ9A 2W4BA 4I3MA 2VB6A 2Y3BA 5KYUB 4BG0A 2PP4A 4LLCA 4OIRF 3K66A 2DYRC 2W45A 1ST6A 2J46A 3SEOA 5T3WA 3S0XA 1D1AA 1TWHA 2D5RB 4ZLDA 3ITFA 3GODA 3NYJA 1VYKA 1NG1A 5E2QA 4PJMA 1MMAA 3QZCA 4GYTA 1ZU4A 4E7SA 4DBQA 3N0TA 3S29A 4H4KC 3RFYA 3H65A 3ECSA 1V54C 3LS1A 2QTVA 3AG3C 1FMWA 3JSZA 3MX3A 4YT8A 1BR2A 1OCCC 3EGXA 3X1OA 3S27A 5T1DB 3LAYA 5DS5A 1OCZC 4YN0B 4PFOA 1MMNA 4PJLA 2CNWA 3K33A 3HTKC 4BEJA 4DBRA 1JPJA 4CS7A 2Q3TA 3EPVA 2V3CC 2YHSA 1Z5ZA 2Q9CA 3JRTA 2R7XA 2MYSA 1W2WA 2Q9BA 2Y39A 2XXAA 2XRHA 4C7OA 3LNRA 4XTKA 2H7VC 2WB7A 4G0HA 4HFKB 2XL4A 4ZLCA 3OWTA 3RH3A 4K0DA 1NU7D 3DAGA 3EGDA 2J7PA 5DQZA 4BJTA 4O6NA 2GFHA 3ZIBA 2W4MA 1PD0A 3CQZA 1N1CA 2NUTA 3LJBA 5F5HA 2EIJC 3DM9B 4C3EA 2EIMC 3GANA 3EGXB 4JVSA 2E87A 2FGYA 3FHDA 1M2OA 4RD9A 1NU9C 4DVZA 3ASOC 2IXNA 2YEVA 4I1OB 1FTSA 4O6MA 2L81A 4JJFA 4AE4B 2VASA 1VOMA 2J9WA 4BJ1A 2O9XA 5DS6A 3VYWA 2FFHA 1D0XA 3JCUQ 2XSEA 5CI9A 1PD1A 3W2VA 4XWJA 2G3KA 4O7GA 3HJCA 3TD7A 3E9VA 2P7VA 4KNVA 3EZHA 1MMDA 3FVYA 1OKKD 5L3VA 3POVA 4PFPA 4U5CE 2R7RA 5KYXB 4Q4ZF 2Y3GA 4EWCA 2L9JA 4AK9A 4FWVA 1M56C 4CS8C 3NG1A 3NRHA 2H7OA 3EHNA 4YT5A 2J0XA 3DJNB 5DS4A 2A1DD 2IXMA 4JURI 1Z3IX 3LLIA 5L3QA 2PFDA 4LERA 2LSEA 3IEEA 3ABMC 5B1BC 2IXOA 1J8YF 1QZXA 1M2VB 4OD5A 2ZPAA 4HE8D 4CSAC 3PHF2 2C04A 3SNHA 4OIOF 3FAJA 2G3VA 1Z6AA 4U5EE 5B1AC 3EH2A 1BR4A 3Q7LA 3VAYA 3AQBA 4CSAA 3I5QA 4CBEA 1M2VA 3EZIA 2EINC 3W8IA 2J45A 4C7OB 2XXAB 1O5HA 3OEOA 3K7DA 4K7BA 3UMHA 3V7OA 2PX3A 2WVQA 4U5DE 3O39A 4M63A 1TWCA 2BE5F 4YJWA 2EIKC 4KBLA 4Q7CA 1O87A 4XLPF 2CNWD 5KYYB 2G62A 4PJJA 3LEVA 1ZHXA 5D92A 5KYNA 1KU2A 3DXJF 4JZAA 3T4RA 4J32B 5E3CA 3KKBA 2MWQA 3PMRA 4IJJA 3UR3C 1ZHWA 4QDLA 2NG1A 2ZXPA 2Y3HA 5B3SC 2DGJA 3ZSUA 1Z63A 2R7UA 2JD3A 3B0VC 4GEHA 3EFOA 2KNHA 3DAFA 1IZMA 3AQCA 3T6BA 5CI8A 4AX2A 4DOZA 5EHHA 3K1HA 4PK4A 3F47A 5KYXA 2IXPA 3LLKA 2ZXWC 3UMKA 5KYWA 4N06A 4YT4A 2CDQA 3AG2C 1ZYRF 2R7VA 1MMGA 3Q6MA 1ZHZA 4OIQF 2IOQA 3EHMA 5E33A 2NUTB 2M4EA 2CW0F 4F4BA 2CGEA 3DMDA 2P6VA 4AE4A 2KJGA 4JW1A 5KYWB 1Z23A 2V26A 3L0IA 3ZVRA 2A6EF 4KNWA 3ZC4A 2WL8A 1VK5A 4O79A 3NDBB 3RYLA 3F46A 1M57C 2J7PD 3EFOB 1ZU5A 2WZFA 2A69F 4HFFB 3DD7A 1BR1A 4QI0A 4U5BE 5DQTA 3NYLA 2PX0A 3AG4C 4KI2A 5BUOA 2I8BA 3B0UX 1FMVA 1D0YA 4RDAA 3X2QC 2A6HF 2ZXOA 4JJGA 4C3DA 5DVWA 2Y69C 3UGOA 4NY3A 1D0ZA 5DLJA 3Q6NA 4U5HA 2J0WA 3MLGA 3W2WA 2NUPB 2R7TA 4QI2A 1QLEC 1RJ9A 4KC9A 4OINF 4YWQA 4B6IA 2VH3A 1D1CA 3ZG1A 4IAOA 3OA1A 2KGOA 4IWBA 1ZHYA 3KH2A 1SF8A 3EH1A 2WVNA 3ASNC 4WJ0A 3B9QA 4OIPF 4Q5SF 4JCHA 3NYMA 2R7SA 4CS9A 5FCLA 5F5FA 4W8KA 1VMAA 1FFHA 3WODF 4XLNF 3AG1C 1S7ZA 3DJUB 1TWGA 5EGYA 3EG9A 2HV6A 1TKNA 2X51A 1V55C 2YZSA 4HEAJ 2IYLD 3KL4A 1LS1A 5E3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5G A;  4U5C E;  4U5D E;  4U5B E;  4U5H A;  4U5E E;  4U5F E; 
#chains in the Genus database with same CATH topology
 3L34 A;  4LAC B;  1WGW A;  4BJ6 A;  3UNG C;  4CJO A;  4D4N A;  4I44 A;  3S84 A;  1JPN A;  3U2M A;  4G7Z F;  2OCC C;  3CZ6 A;  3T6G B;  5L0H A;  2J9U A;  2YKZ A;  3L8I A;  3JRM O;  2A0U A;  3SXZ A;  3C7J A;  4CDY A;  1XZQ A;  1D1B A;  4U5F E;  3W8H A;  4MVM A;  4Z9I A;  1VYI A;  3CSK A;  3SYN A;  5T3T A;  4CDV A;  2OG2 A;  1J8M F;  3GWL A;  3I4U A;  3K6B A;  4JRZ A;  5BQI A;  1RKE B;  5JP7 A;  2R9R B;  3HNJ A;  1LIH A;  3S28 A;  3NKE A;  256B A;  3EJN A;  5IY5 C;  5L0J A;  5HSW A;  1EQ1 A;  1K05 A;  1TR2 A;  3UMI A;  2R7Q A;  4IRU A;  4EUK B;  4FES A;  3M4C A;  2UUH A;  3WG7 C;  2Z15 A;  1LE2 A;  3JYH A;  4CS8 A;  4PJN A;  1L3P A;  1XZP A;  1LPE A;  2J9V A;  2J9B A;  1AVO B;  2KK1 A;  1EI7 A;  2ZXR A;  3MFN A;  4DRJ B;  5A6B A;  1E84 A;  4E0I A;  4BJ5 A;  1Q0G A;  3M1C B;  4RBN A;  2IBF A;  2R7O A;  4J30 B;  2WZL A;  3O6X A;  4FX5 A;  4ANJ A;  1QVX A;  3ZWI A;  2NSG A;  3LES A;  1OW6 A;  1V4A A;  1LI7 A;  3FDQ A;  2HZ8 A;  2A68 F;  2NSF A;  3DZA A;  3EQL F;  5D91 A;  3DM5 A;  3Q7G A;  5BQG A;  3HNI A;  4DVY P;  1ORY A;  2KC3 A;  2WVO A;  1OCO C;  2WZG A;  4MW3 A;  1A7D A;  5AGF A;  5AC4 A;  4G7O F;  4LLE A;  1PCX A;  2C03 A;  2H7B A;  5KYU A;  2KYH A;  1GS9 A;  3B29 A;  3NKD A;  5GPG B;  4G7H F;  1UG7 A;  4MQ9 F;  3N2Z B;  3EG9 B;  2QE9 A;  4EBB A;  2EIL C;  2NUP A;  1RJ9 B;  4O6Y A;  3K1I C;  3JT1 A;  3K1I A;  4MND A;  1OCR C;  1LVK A;  3EGD B;  1IW7 F;  3BRJ A;  4P6I C;  1MNE A;  3IHU A;  3RVZ A;  1ZZP A;  1H9T A;  2OOC A;  3UGP A;  1A7V A;  2KW3 C;  1NBB A;  2ASR A;  3E70 C;  2Y3D A;  1G8X A;  1OKK A;  2PNO A;  3HNL A;  4E7Z A;  2B0J A;  1LKX A;  1NFN A;  3B0P A;  1CGN A;  4IGG A;  1ORS C;  2JPU A;  4BJ6 C;  1OW7 A;  3RKO F;  2KSF A;  2DYS C;  2UUI A;  5COM A;  2XLV A;  1ZHT A;  2EPL X;  3LS0 A;  3NMI A;  1MND A;  3U8P A;  4BJ5 C;  4A4A A;  3T6J A;  1F1M A;  5KYY A;  1C02 A;  3B71 A;  3ABK C;  4EBK A;  1HY5 A;  3FAP B;  4I1M A;  3ABL C;  3PDM P;  3O55 A;  4MTO A;  1YAR O;  1YYX A;  3KMI A;  5L0F A;  2PF4 E;  1G5Z A;  4C3B A;  1JRA A;  2DI3 A;  4OD4 A;  4WGY A;  1R4T A;  1SMY F;  2HV7 A;  4X0R A;  4MTF A;  4CS9 C;  3QMK A;  3JSE O;  4NTB A;  1QSP A;  3RIP A;  1AUE A;  2VCA A;  1L7C A;  2W9Y A;  3GEE A;  5TJ5 E;  3SZR A;  4A2N B;  2VC9 A;  2QY9 A;  4N4W A;  4U5G A;  2Q9A A;  1YZA A;  1RMV A;  1HMO A;  4CIH A;  1U0B B;  3I5P A;  2R7W A;  5HV9 A;  1NZE A;  4YT2 A;  3N24 A;  4ULW A;  3ATP A;  1TWA A;  1K04 A;  3HLZ A;  3SP1 A;  5EK0 A;  1SZI A;  1FFT C;  2XL8 A;  5JLI A;  2KQ9 A;  3RQF A;  1M6T A;  1T6Q A;  2W4B A;  4DXW A;  4I3M A;  2VB6 A;  3C62 A;  2Y3B A;  4P9F A;  1JR8 A;  2B0H A;  4BG0 A;  2PP4 A;  2YWA A;  5KYU B;  4LLC A;  4E0H A;  4OIR F;  4JEB A;  1E85 A;  4E17 A;  3K66 A;  3IQ5 A;  2DYR C;  3GM1 A;  2W45 A;  1FR0 A;  1ST6 A;  2J46 A;  3KYI A;  3TJ5 A;  5L3Q A;  3SEO A;  5T3W A;  3S0X A;  1VLT A;  1D1A A;  5L0C A;  1TWH A;  3FXH A;  3HKK A;  4FAP B;  2D5R B;  4ZLD A;  1O3U A;  2ETS A;  2YVK A;  3GOD A;  3ITF A;  3NYJ A;  1VYK A;  1NG1 A;  1NSG B;  2PBE A;  4JTD B;  1A41 A;  3G4Z A;  4JE9 A;  2ZD9 A;  3L1M A;  1T6U A;  5E2Q A;  4K1O A;  4WGZ A;  1TFO B;  2DB4 A;  4PJM A;  1MMA A;  1DOV A;  3QZC A;  1ZU4 A;  4GYT A;  4E7S A;  4DBQ A;  4U9E A;  2XM4 A;  3N0T A;  4JTC B;  3S29 A;  4H4K C;  4XLP F;  3RFY A;  3H65 A;  2CYD A;  3ECS A;  1V54 C;  2HFI A;  4IAQ A;  1XWJ A;  2Q00 A;  2RD9 A;  3A11 A;  1WAT A;  3LS1 A;  3VRC A;  2QTV A;  1VLS A;  2A0B A;  4MVU A;  3U0C A;  1QQ3 A;  1H7I A;  3AG3 C;  1FMW A;  3JSZ A;  3MX3 A;  3NMK A;  4YT8 A;  2HSQ A;  4J7Y A;  1I4Y A;  1EKY A;  1BR2 A;  4MVS A;  1DOW A;  1T5O A;  2M64 A;  1OCC C;  3EGX A;  3SXK A;  3X1O A;  2CCY A;  2I15 A;  1S05 A;  3S27 A;  3AGU A;  5L0I A;  4JCZ A;  5T1D B;  2OJE D;  4IB4 A;  4MTG A;  1I4Z A;  3LAY A;  5JUA A;  5DS5 A;  2IM8 A;  1OCZ C;  4YN0 B;  3AOU A;  4D4X A;  3M15 A;  2XLD A;  4PFO A;  3DI5 A;  1MMN A;  2HKV A;  4PJL A;  3RQE A;  3VM6 A;  2CNW A;  2BL2 A;  3HTK C;  3K33 A;  4BEJ A;  4DBR A;  1JPJ A;  4CS7 A;  2Q3T A;  3EPV A;  2GDC A;  3V5X A;  2V3C C;  1QPU A;  1Y6D A;  1NLX A;  2YHS A;  1Z5Z A;  1FNT c;  5CIV A;  2ICW G;  2Q9C A;  4XPW A;  3JRT A;  2LK4 A;  3JZ0 A;  5L0G A;  2R7X A;  5JT4 A;  3DE8 A;  2MYS A;  4BEM J;  1W2W A;  2Q9B A;  2R05 A;  2Y39 A;  4YL3 A;  2XXA A;  2XRH A;  4C7O A;  3KYJ A;  1H6G A;  4EIY A;  3LNR A;  4GQH A;  4XTK A;  1T9K A;  1GQA A;  4JKV A;  2LFD A;  2H7V C;  2WB7 A;  4WAB A;  4G0H A;  4HFK B;  1E83 A;  1MQV A;  2EPO A;  2XL4 A;  3QVY A;  1H9G A;  3U3F A;  4H54 A;  4ZLC A;  5JVE A;  2Q4F A;  3OWT A;  2R03 A;  3RH3 A;  2YL0 A;  4K0D A;  2GA0 A;  1NU7 D;  2LD6 A;  3DAG A;  4EKW A;  3DKA A;  1WWP A;  1TQG A;  3EGD A;  3IQC A;  3TUL A;  2J7P A;  5DQZ A;  4BJT A;  4O6N A;  2AWY A;  1OXB A;  2GFH A;  3ZIB A;  1GM5 A;  3GM2 A;  4AL0 A;  2W4M A;  1PD0 A;  3CQZ A;  3FOO A;  1N1C A;  2OEX A;  2P61 A;  3RF3 A;  2XM0 A;  2L6F A;  2MHR A;  2HJ3 A;  1R5I D;  1YAU O;  2NUT A;  3LJB A;  4DJ9 A;  5F5H A;  2EIJ C;  3DM9 B;  1AEP A;  1TFK B;  4C3E A;  2EIM C;  3GAN A;  3EGX B;  4JVS A;  3AGT A;  4N6H A;  3MBG A;  3U9J A;  2AVK A;  2HJM A;  1KTM A;  3FMS A;  4YL0 A;  2E87 A;  2FGY A;  3FHD A;  5A6A A;  1M2O A;  2OEV A;  3V5Y A;  3WHN A;  4P9T A;  3DE9 A;  1LE4 A;  4RD9 A;  1NU9 C;  2QUP A;  4DVZ A;  3ASO C;  2IXN A;  5JSL A;  2YEV A;  4I1O B;  2D4U A;  4YL1 A;  1FTS A;  2VCC A;  4O6M A;  2L81 A;  3AJM A;  4JJF A;  1WTY A;  1FAP B;  5FZT A;  4AE4 B;  1QKR A;  2VAS A;  4CX9 A;  1VOM A;  2HSB A;  2J9W A;  2YLI A;  1ZW3 A;  3R2P A;  4BJ1 A;  4J7T A;  2O9X A;  2LQG A;  4PAC A;  5DS6 A;  4NC3 A;  1E2X A;  1SR2 A;  3VYW A;  5A69 A;  2OKU A;  3C18 A;  4XEF A;  2QNL A;  2FFH A;  4ONS A;  1D0X A;  1G4U S;  3JCU Q;  2XSE A;  5CI9 A;  1PD1 A;  2YL3 A;  4XWJ A;  2G3K A;  4O7G A;  3HJC A;  4XQ1 A;  2R25 A;  3TD7 A;  3W2V A;  4DRI B;  2AWC A;  3E9V A;  1NFO A;  2P7V A;  3GEI A;  2BC5 A;  4KNV A;  1EA8 A;  4LDQ A;  1RCP A;  4MVZ A;  3R7C A;  1OR2 A;  3EZH A;  5L0D A;  1MMD A;  1SYQ A;  3FVY A;  1OKK D;  3CEX A;  4MS2 A;  5L3V A;  4MW8 A;  4PFP A;  4U5C E;  2GAQ A;  3POV A;  2R7R A;  5KYX B;  3A9C A;  3WAQ A;  4Q4Z F;  2Y3G A;  4W8P A;  4EWC A;  1RKE A;  2L9J A;  4AK9 A;  4FWV A;  1M56 C;  3MYI A;  4CS8 C;  3NG1 A;  3NRH A;  2H7O A;  3EHN A;  4YT5 A;  2J0X A;  4DRH B;  3DJN B;  1YA7 O;  3G50 A;  5DS4 A;  3M79 A;  3V5Z A;  2A1D D;  2IXM A;  4Z9H A;  4JUR I;  1Z3I X;  2EPM X;  2YLG A;  3LLI A;  4MVO A;  1CPR A;  2PFD A;  1LM3 B;  4LER A;  3QW0 A;  4ULV A;  2LSE A;  3IEE A;  3TQO A;  3ABM C;  3CAX A;  5B1B C;  3TK0 A;  4AL1 A;  2OU6 A;  2IXO A;  4JIO A;  4ER9 A;  4LDR A;  1J8Y F;  1QZX A;  1M2V B;  3W4Y A;  3ZQY A;  3LUT B;  1VTM P;  1PV3 A;  1YDI A;  4OD5 A;  2ZPA A;  4HE8 D;  3US6 A;  2J8W A;  4CSA C;  5F28 E;  3S90 A;  3PHF 2;  2C04 A;  3SNH A;  2OQM A;  4OIO F;  3QW1 A;  3C8G B;  3FAJ A;  2G3V A;  1C17 M;  2H8A A;  1Z6A A;  1BZ4 A;  4U5E E;  1U6H A;  2AU5 A;  3J06 A;  1JMW A;  1ZVZ A;  3EH2 A;  5B1A C;  1BR4 A;  1Q0D A;  1BDJ B;  1OR3 A;  2YRF A;  3Q7L A;  2X0C A;  3AQB A;  3VAY A;  4XEV A;  2XL6 A;  4CSA A;  3I5Q A;  3TOM A;  1M2V A;  3SXY A;  3EZI A;  2EIN C;  3U9M A;  3W8I A;  2J45 A;  4CBE A;  3SXM A;  1GGQ A;  4C7O B;  3TOL A;  2XXA B;  3MYF A;  1O5H A;  1YLM A;  1RXQ A;  3K7D A;  3OEO A;  4K7B A;  4L6R A;  3UMH A;  2PX3 A;  3V7O A;  1E86 A;  2F22 A;  2TMV P;  2WVQ A;  4U5D E;  1V74 B;  3O39 A;  4M63 A;  3IPM O;  1TWC A;  2XLE A;  5B3I A;  2BE5 F;  4YJW A;  2EIK C;  4KBL A;  3RQG A;  2VCB A;  4Q7C A;  1B68 A;  1O87 A;  1ZW2 A;  1YJG A;  2CNW D;  2XLH A;  3IQT A;  3LNM B;  5KYY B;  4XEK A;  2G62 A;  3U5S A;  4PJJ A;  1HE9 A;  1ZHX A;  3LEV A;  5D92 A;  5KYN A;  1KU2 A;  3DXJ F;  2EPN A;  1OXK A;  1WAS A;  4JZA A;  3T4R A;  4J32 B;  5E3C A;  1WOL A;  3KKB A;  1WN0 A;  2MWQ A;  1LI5 A;  3PMR A;  4IJJ A;  3UR3 C;  1ZHW A;  4QDL A;  2NG1 A;  2ZXP A;  2Q7R A;  3RW0 A;  2Y3H A;  4NTA A;  2DGJ A;  3ZSU A;  5B3S C;  1Z63 A;  4MVQ A;  4CIP A;  2R7U A;  2JD3 A;  1YVI A;  4BPM A;  3B0V C;  4GEH A;  3EFO A;  2YL7 A;  2KNH A;  3DAF A;  1IZM A;  1JAF A;  2EPK X;  3AQC A;  3T6B A;  5CI8 A;  3BEH A;  3H2V A;  4AX2 A;  4DOZ A;  5EHH A;  3C8G A;  4UDV A;  2P0N A;  4JC7 A;  2AP3 A;  1RKC A;  3C8Z A;  3K1H A;  4PK4 A;  3F47 A;  3GM3 A;  5KYX A;  2IXP A;  3LLK A;  2ZXW C;  4NCQ A;  3UMK A;  5KYW A;  3M4B A;  4N06 A;  4R32 A;  2HMZ A;  4YT4 A;  2CDQ A;  3AG2 C;  2YL1 A;  1ZYR F;  4CDA A;  2R7V A;  3JYY A;  1Q0K A;  1MMG A;  3Q6M A;  2OJQ A;  3U3B A;  3LEO A;  1ZHZ A;  1Q0M A;  4N6C A;  4OIQ F;  2L6G A;  3G4X A;  1OW8 A;  2IOQ A;  3EHM A;  4MVR A;  3ZQV A;  5AC5 A;  5E33 A;  2NUT B;  2M4E A;  2CW0 F;  3S9O A;  4F4B A;  1Q0F A;  2CGE A;  3DMD A;  2P6V A;  3ZDL A;  1G4W R;  2KJG A;  4JW1 A;  4AE4 A;  5KYW B;  1Z23 A;  4U9D A;  2V26 A;  3L0I A;  3ZVR A;  2A6E F;  3PCV A;  4NTF A;  1CPQ A;  4KNW A;  3ZC4 A;  2WL8 A;  4Z9J A;  1VK5 A;  4O79 A;  4PR9 A;  1Z7Q c;  3NDB B;  3RYL A;  2R02 A;  3VF0 A;  5JS5 A;  3F46 A;  4G78 A;  2GWW A;  1M57 C;  2J7P D;  1K40 A;  1A7E A;  2HMQ A;  3EFO B;  3QTH A;  3GOR A;  3RVY A;  1ZU5 A;  2WZF A;  2A69 F;  3HNK A;  3TJ6 A;  4HFF B;  5A6J A;  4XPY A;  3DD7 A;  1CGM E;  1VB5 A;  2L7A A;  4NQF A;  2YLD A;  1BR1 A;  4LDK A;  4QI0 A;  5JRA A;  4U5B E;  1C03 A;  3C63 A;  5DQT A;  4E18 A;  3NYL A;  4EBJ A;  2JX0 A;  2PX0 A;  3AG4 C;  3U2L A;  4JEA A;  3O10 A;  4KI2 A;  5BUO A;  2I8B A;  1I5N A;  3JTL O;  1ORJ A;  3B0U X;  1JOG A;  1BBH A;  2FAP B;  3GEH A;  1T6I A;  1KNY A;  1FMV A;  1APC A;  1HMD A;  1D0Y A;  3QVZ A;  3L8J A;  4RDA A;  3NMJ A;  4IAR A;  3ZTM A;  2LCH A;  5K0I A;  3X2Q C;  3ZTZ A;  2A6H F;  2ZXO A;  4JJG A;  4C3D A;  5DVW A;  2Y69 C;  1T01 A;  3UGO A;  1CGO A;  1U89 A;  2XLM A;  4NY3 A;  1A0B A;  1D0Z A;  5DLJ A;  3Q6N A;  1YA9 A;  5A6K A;  4U5H A;  2LFF A;  2YQY A;  2J0W A;  2HS5 A;  3MLG A;  3W2W A;  2NUP B;  2XS1 A;  4XPX A;  5BQH A;  4QI2 A;  2R7T A;  1QLE C;  1RJ9 A;  2XLW A;  4KC9 A;  3DWW A;  1Y4C A;  2LP4 A;  4OIN F;  2LIG A;  4B6I A;  4YWQ A;  3U8V A;  2VH3 A;  3IQ6 A;  1D1C A;  3ZG1 A;  2XLO A;  2HUJ A;  4IAO A;  4JTA B;  2QLA A;  2RSE B;  2KGO A;  3OA1 A;  1ZHY A;  2P1A A;  3KH2 A;  4IWB A;  5COF A;  1HW1 A;  1SF8 A;  3EH1 A;  2WVN A;  3GWN A;  3T9O A;  3C8G D;  3ASN C;  4WJ0 A;  3B9Q A;  4OIP F;  1LS4 A;  4Q5S F;  4JCH A;  3NYM A;  4EHP A;  1UFB A;  3FOP A;  5A6B D;  2NPU A;  2R7S A;  3H2U A;  4CS9 A;  5FCL A;  4W8K A;  5F5F A;  1VMA A;  1FFH A;  1HE1 A;  4XLN F;  3WOD F;  3AG1 C;  1YZC A;  3KPH A;  1S7Z A;  2L6H A;  4YK5 A;  2XS8 A;  1HW2 A;  3DJU B;  1TWG A;  5EGY A;  3EG9 A;  2HV6 A;  1TKN A;  2X51 A;  1V55 C;  2YZS A;  4HEA J;  2IYL D;  1OQC A;  5COG A;  4CJG A;  3KL4 A;  1LS1 A;  1YYJ A;  5E3A A; 
#chains in the Genus database with same CATH homology
 3L34 A;  4LAC B;  1WGW A;  4BJ6 A;  3UNG C;  4I44 A;  1JPN A;  4G7Z F;  2OCC C;  3CZ6 A;  2J9U A;  4U5F E;  1D1B A;  3W8H A;  1VYI A;  3CSK A;  3SYN A;  5T3T A;  2OG2 A;  1J8M F;  3I4U A;  3K6B A;  3S28 A;  5IY5 C;  3NKE A;  5HSW A;  3EJN A;  1TR2 A;  3UMI A;  2R7Q A;  4IRU A;  4FES A;  3WG7 C;  2Z15 A;  3JYH A;  4CS8 A;  4PJN A;  2J9V A;  2ZXR A;  4BJ5 A;  3M1C B;  4RBN A;  2R7O A;  4J30 B;  2WZL A;  3O6X A;  4FX5 A;  4ANJ A;  3LES A;  3FDQ A;  2A68 F;  3EQL F;  3DZA A;  5D91 A;  3DM5 A;  3Q7G A;  4DVY P;  2WVO A;  1OCO C;  2WZG A;  4G7O F;  4LLE A;  1PCX A;  2C03 A;  2H7B A;  5KYU A;  4G7H F;  3NKD A;  4MQ9 F;  3N2Z B;  3EG9 B;  4EBB A;  2EIL C;  2NUP A;  1RJ9 B;  4O6Y A;  3K1I C;  3JT1 A;  4MND A;  1OCR C;  1LVK A;  3EGD B;  1IW7 F;  4P6I C;  1MNE A;  3UGP A;  2KW3 C;  3E70 C;  2Y3D A;  1G8X A;  1OKK A;  4E7Z A;  2B0J A;  1LKX A;  3B0P A;  4BJ6 C;  3RKO F;  2DYS C;  1ZHT A;  3LS0 A;  1MND A;  4BJ5 C;  3T6J A;  5KYY A;  3ABK C;  4I1M A;  3ABL C;  3KMI A;  2PF4 E;  4C3B A;  4OD4 A;  1SMY F;  2HV7 A;  4X0R A;  4CS9 C;  3QMK A;  3RIP A;  2W9Y A;  4A2N B;  3SZR A;  2QY9 A;  4U5G A;  2Q9A A;  4CIH A;  3I5P A;  2R7W A;  1NZE A;  4YT2 A;  3N24 A;  4ULW A;  1TWA A;  3HLZ A;  3SP1 A;  1SZI A;  1FFT C;  2KQ9 A;  2W4B A;  4I3M A;  2VB6 A;  2Y3B A;  5KYU B;  4BG0 A;  2PP4 A;  4LLC A;  4OIR F;  3K66 A;  2DYR C;  2W45 A;  1ST6 A;  2J46 A;  3SEO A;  5T3W A;  3S0X A;  1D1A A;  1TWH A;  2D5R B;  4ZLD A;  3ITF A;  3GOD A;  3NYJ A;  1VYK A;  1NG1 A;  5E2Q A;  4PJM A;  1MMA A;  3QZC A;  4GYT A;  1ZU4 A;  4E7S A;  4DBQ A;  3N0T A;  3S29 A;  4H4K C;  3RFY A;  3H65 A;  3ECS A;  1V54 C;  3LS1 A;  2QTV A;  3AG3 C;  1FMW A;  3JSZ A;  3MX3 A;  4YT8 A;  1BR2 A;  1OCC C;  3EGX A;  3X1O A;  3S27 A;  5T1D B;  3LAY A;  5DS5 A;  1OCZ C;  4YN0 B;  4PFO A;  1MMN A;  4PJL A;  2CNW A;  3K33 A;  3HTK C;  4BEJ A;  4DBR A;  1JPJ A;  4CS7 A;  2Q3T A;  3EPV A;  2V3C C;  2YHS A;  1Z5Z A;  2Q9C A;  3JRT A;  2R7X A;  2MYS A;  1W2W A;  2Q9B A;  2Y39 A;  2XXA A;  2XRH A;  4C7O A;  3LNR A;  4XTK A;  2H7V C;  2WB7 A;  4G0H A;  4HFK B;  2XL4 A;  4ZLC A;  3OWT A;  3RH3 A;  4K0D A;  1NU7 D;  3DAG A;  3EGD A;  2J7P A;  5DQZ A;  4BJT A;  4O6N A;  2GFH A;  3ZIB A;  2W4M A;  1PD0 A;  3CQZ A;  1N1C A;  2NUT A;  3LJB A;  5F5H A;  2EIJ C;  3DM9 B;  4C3E A;  2EIM C;  3GAN A;  3EGX B;  4JVS A;  2E87 A;  2FGY A;  3FHD A;  1M2O A;  4RD9 A;  1NU9 C;  4DVZ A;  3ASO C;  2IXN A;  2YEV A;  4I1O B;  1FTS A;  4O6M A;  2L81 A;  4JJF A;  4AE4 B;  2VAS A;  1VOM A;  2J9W A;  4BJ1 A;  2O9X A;  5DS6 A;  3VYW A;  2FFH A;  1D0X A;  3JCU Q;  2XSE A;  5CI9 A;  1PD1 A;  3W2V A;  4XWJ A;  2G3K A;  4O7G A;  3HJC A;  3TD7 A;  3E9V A;  2P7V A;  4KNV A;  3EZH A;  1MMD A;  3FVY A;  1OKK D;  5L3V A;  3POV A;  4PFP A;  4U5C E;  2R7R A;  5KYX B;  4Q4Z F;  2Y3G A;  4EWC A;  2L9J A;  4AK9 A;  4FWV A;  1M56 C;  4CS8 C;  3NG1 A;  3NRH A;  2H7O A;  3EHN A;  4YT5 A;  2J0X A;  3DJN B;  5DS4 A;  2A1D D;  2IXM A;  4JUR I;  1Z3I X;  3LLI A;  5L3Q A;  2PFD A;  4LER A;  2LSE A;  3IEE A;  3ABM C;  5B1B C;  2IXO A;  1J8Y F;  1QZX A;  1M2V B;  4OD5 A;  2ZPA A;  4HE8 D;  4CSA C;  3PHF 2;  2C04 A;  3SNH A;  4OIO F;  3FAJ A;  2G3V A;  1Z6A A;  4U5E E;  5B1A C;  3EH2 A;  1BR4 A;  3Q7L A;  3VAY A;  3AQB A;  4CSA A;  3I5Q A;  4CBE A;  1M2V A;  3EZI A;  2EIN C;  3W8I A;  2J45 A;  4C7O B;  2XXA B;  1O5H A;  3OEO A;  3K7D A;  4K7B A;  3UMH A;  3V7O A;  2PX3 A;  2WVQ A;  4U5D E;  3O39 A;  4M63 A;  1TWC A;  2BE5 F;  4YJW A;  2EIK C;  4KBL A;  4Q7C A;  1O87 A;  4XLP F;  2CNW D;  5KYY B;  2G62 A;  4PJJ A;  3LEV A;  1ZHX A;  5D92 A;  5KYN A;  1KU2 A;  3DXJ F;  4JZA A;  3T4R A;  4J32 B;  5E3C A;  3KKB A;  2MWQ A;  3PMR A;  4IJJ A;  3UR3 C;  1ZHW A;  4QDL A;  2NG1 A;  2ZXP A;  2Y3H A;  5B3S C;  2DGJ A;  3ZSU A;  1Z63 A;  2R7U A;  2JD3 A;  3B0V C;  4GEH A;  3EFO A;  2KNH A;  3DAF A;  1IZM A;  3AQC A;  3T6B A;  5CI8 A;  4AX2 A;  4DOZ A;  5EHH A;  3K1H A;  4PK4 A;  3F47 A;  5KYX A;  2IXP A;  3LLK A;  2ZXW C;  3UMK A;  5KYW A;  4N06 A;  4YT4 A;  2CDQ A;  3AG2 C;  1ZYR F;  2R7V A;  1MMG A;  3Q6M A;  1ZHZ A;  4OIQ F;  2IOQ A;  3EHM A;  5E33 A;  2NUT B;  2M4E A;  2CW0 F;  4F4B A;  2CGE A;  3DMD A;  2P6V A;  4AE4 A;  2KJG A;  4JW1 A;  5KYW B;  1Z23 A;  2V26 A;  3L0I A;  3ZVR A;  2A6E F;  4KNW A;  3ZC4 A;  2WL8 A;  1VK5 A;  4O79 A;  3NDB B;  3RYL A;  3F46 A;  1M57 C;  2J7P D;  3EFO B;  1ZU5 A;  2WZF A;  2A69 F;  4HFF B;  3DD7 A;  1BR1 A;  4QI0 A;  4U5B E;  5DQT A;  3NYL A;  2PX0 A;  3AG4 C;  4KI2 A;  5BUO A;  2I8B A;  3B0U X;  1FMV A;  1D0Y A;  4RDA A;  3X2Q C;  2A6H F;  2ZXO A;  4JJG A;  4C3D A;  5DVW A;  2Y69 C;  3UGO A;  4NY3 A;  1D0Z A;  5DLJ A;  3Q6N A;  4U5H A;  2J0W A;  3MLG A;  3W2W A;  2NUP B;  2R7T A;  4QI2 A;  1QLE C;  1RJ9 A;  4KC9 A;  4OIN F;  4YWQ A;  4B6I A;  2VH3 A;  1D1C A;  3ZG1 A;  4IAO A;  3OA1 A;  2KGO A;  4IWB A;  1ZHY A;  3KH2 A;  1SF8 A;  3EH1 A;  2WVN A;  3ASN C;  4WJ0 A;  3B9Q A;  4OIP F;  4Q5S F;  4JCH A;  3NYM A;  2R7S A;  4CS9 A;  5FCL A;  5F5F A;  4W8K A;  1VMA A;  1FFH A;  3WOD F;  4XLN F;  3AG1 C;  1S7Z A;  3DJU B;  1TWG A;  5EGY A;  3EG9 A;  2HV6 A;  1TKN A;  2X51 A;  1V55 C;  2YZS A;  4HEA J;  2IYL D;  3KL4 A;  1LS1 A;  5E3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...