4U5GA

Crystal structure of con-ikot-ikot toxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
ADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Con-ikot-ikot
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5gA00
4U5DE 4U5FE 4U5EE 4U5GA 4U5CE 4U5BE 4U5HA
chains in the Genus database with same CATH superfamily
2L6GA 3G4ZA 4CDAA 3FMSA 3RVZA 1RXQA 5KYXB 1TFKB 3FOPA 3EFOA 4IWBA 4DRJB 2R25A 3PCVA 4EHPA 3S90A 2TMVP 4BJ6A 3IQ5A 3ZSUA 2P0NA 2Q4FA 2WL8A 4YL1A 4JKVA 4BJTA 4ONSA 1M2VA 2XLVA 1Z23A 3EH2A 1GM5A 4PK4A 1YYJA 5T3WA 5A6JA 3W2WA 5GPGB 5JS5A 3GORA 2BE5F 4ER9A 2Y3HA 4K7BA 3QVYA 4EBKA 4I1OB 3TOMA 3A9CA 2LP4A 1QPUA 4CS9C 3T9OA 3EPVA 2XL4A 4C3DA 4CIPA 2R7VA 4MVOA 1D0XA 1VLTA 3AQCA 3FHDA 3T6JA 4P6IC 3ZIBA 3SP1A 1V4AA 2D5RB 1CGOA 1I4YA 1VYIA 2OKUA 4GEHA 3AG2C 2YL3A 2CYDA 2IBFA 2NUPA 3NYLA 2D4UA 2PF4E 3ECSA 1RKEB 3HJCA 2Y3BA 4BJ5C 5DQZA 4C7OB 2H7BA 2J46A 1TWCA 1QZXA 3DM9B 2H7VC 3UMHA 4U9EA 2ZXWC 4NTAA 2R03A 3VF0A 3EFOB 5L0FA 1ORSC 3POVA 2VASA 4RDAA 4A2NB 1FFTC 1D1CA 3AOUA 2LK4A 1AUEA 2XLHA 3K66A 4E0IA 2MWQA 1E84A 1VK5A 3TJ6A 2OJED 1VYKA 4C7OA 2ASRA 2IXPA 3X1OA 1MMDA 3CSKA 2A1DD 1BR1A 1G8XA 2AWCA 3K1HA 3IQCA 1TWGA 1QSPA 2JD3A 2QY9A 1WOLA 2HSQA 3HNJA 4I1MA 1NSGB 4NTBA 1OQCA 1SMYF 3JCUQ 2G62A 2Q7RA 4BJ5A 3FAJA 2L6FA 1O5HA 3LLKA 3HKKA 1MQVA 5JRAA 4DJ9A 5L0JA 2L7AA 4JCHA 1APCA 2V3CC 4CJOA 2Q9AA 2BL2A 1GGQA 5F5FA 4ANJA 2VB6A 2OG2A 3DI5A 3EG9A 4OD5A 4U5DE 4XPYA 5E33A 1Z3IX 2XLOA 2R7WA 1CGME 2H8AA 4Z9JA 3AG4C 2QUPA 2Q3TA 4JEBA 4U9DA 2A68F 3RF3A 5BQHA 4RD9A 2A0BA 2XM0A 5E2QA 3IQ6A 3WG7C 3U0CA 3QW0A 4U5CE 1MNDA 1M57C 2GAQA 1YYXA 1F1MA 2DB4A 2OU6A 2HV7A 1ZU4A 1HMOA 2X0CA 4C3BA 3TK0A 2LFDA 4CDVA 2YWAA 1EQ1A 2VCBA 1OKKA 2VC9A 2IYLD 2A69F 1D0ZA 2PBEA 3B0PA 3I5QA 4HEAJ 4KC9A 3N2ZB 1JRAA 5K0IA 2KNHA 2J8WA 2OEXA 3TOLA 4E18A 2PNOA 4O7GA 4N6CA 4MTOA 3DE9A 2HKVA 1T9KA 4N06A 1QQ3A 4IB4A 3T6BA 3EH1A 3ATPA 1ZHXA 5T3TA 3U2LA 1S7ZA 4G7HF 2YRFA 4HE8D 1AVOB 1TWHA 2LQGA 5COMA 1TR2A 5B1AC 1Z7Qc 1HY5A 4P9FA 5AGFA 4G7ZF 1EI7A 2QE9A 5DS5A 5JT4A 3DJNB 4MW8A 5L3QA 3QTHA 1ZHWA 4MTGA 3FXHA 2YL1A 1VTMP 2ZXRA 4MVZA 2DI3A 2XSEA 5COFA 1XZPA 5B3SC 4FAPB 1HMDA 1M6TA 5CI9A 5E3CA 1OKKD 3EG9B 4CDYA 5IY5C 4DOZA 4XPXA 1R4TA 4L6RA 5D92A 3KYJA 4EKWA 2YHSA 4G78A 5F28E 2WB7A 1J8MF 3AGTA 2R7QA 3C62A 3OWTA 2J9WA 4PJJA 2UUHA 5A6BA 2XXAA 1TFOB 2Q9CA 3AG1C 3X2QC 5A6KA 4G0HA 4AL0A 1MMNA 1WASA 2DGJA 3U2MA 4CX9A 2X51A 3EGDA 2EPLX 5E3AA 2XLDA 3VRCA 1YZCA 2XS8A 1ZHTA 3Q6NA 3GWNA 4BJ6C 3ZC4A 1OCZC 3JSEO 3CAXA 4JEAA 2ZPAA 2HS5A 3ZQYA 1OCCC 3ASOC 2Z15A 3VM6A 4CS8A 4Z9HA 2C03A 3SXKA 4EBBA 3JRMO 1Z6AA 2HMQA 2YKZA 4HFKB 2ZXOA 3I5PA 3LAYA 3M15A 2J7PD 3R2PA 5A6BD 3U9JA 2HZ8A 5DQTA 1MMAA 3U5SA 3C7JA 1E2XA 5KYYA 1PD0A 3O39A 2W4MA 2YVKA 2XM4A 3NG1A 4YN0B 1U0BB 1SYQA 3FAPB 1RKCA 1LVKA 2P1AA 4YT8A 1LKXA 3L8JA 3N24A 5JLIA 1M2OA 3W8IA 1O3UA 3LS1A 1NFOA 1BZ4A 4XQ1A 3WAQA 1A0BA 4W8PA 3SYNA 2Q9BA 1GS9A 2KYHA 2C04A 1HW1A 2QLAA 4OINF 1S05A 3LLIA 1U6HA 1ZU5A 3IQTA 3ZTZA 2XLMA 3K1IA 1YLMA 4LDQA 3AG3C 4IAOA 1LS1A 1G4US 1RCPA 2DYSC 3VAYA 4O79A 2L9JA 3ZWIA 2YZSA 3GWLA 5EK0A 4QI0A 4LDRA 3DM5A 5KYNA 1BR2A 3F46A 3PHF2 2J0WA 3GEIA 5A6AA 4CSAA 3KL4A 3U3BA 2EIJC 2HFIA 3GM1A 4MVRA 2QTVA 1XWJA 2FAPB 2LD6A 2P6VA 3FOOA 2NSFA 3FVYA 4CBEA 1PV3A 1L7CA 1NLXA 4FESA 3JYYA 2UUIA 5BUOA 3CEXA 3S27A 2B0HA 1E85A 4JJGA 2AP3A 2EILC 2P7VA 2Y39A 1YA9A 3QMKA 4I44A 4YK5A 4DBRA 3NMIA 2EIMC 3M4BA 2ICWG 5KYYB 3CQZA 3MBGA 4YT4A 1OR3A 3K6BA 4JIOA 2EIKC 5JP7A 4A4AA 3IHUA 2R05A 4KI2A 2CNWA 2JPUA 1OW6A 3V7OA 1WGWA 3LEOA 1M2VB 4E0HA 5CIVA 2KQ9A 3PMRA 2RSEB 4FX5A 3RYLA 1ST6A 3M4CA 4K1OA 4Z9IA 4OIRF 3W8HA 4E17A 1PD1A 1H7IA 4RBNA 3KYIA 2OJQA 5HV9A 4DBQA 1G4WR 1BR4A 2WVOA 4MVMA 4UDVA 4YL0A 4MS2A 1IZMA 1C02A 4XWJA 1IW7F 1CGNA 1K05A 3TD7A 3HTKC 1YARO 2YEVA 3C8ZA 1I5NA 2XLEA 2KC3A 2CNWD 3TULA 2CDQA 2R7TA 3ABKC 3ABLC 2V26A 4U5FE 4LERA 1HW2A 3TQOA 4ULWA 2NUPB 1CPRA 2AWYA 2G3VA 2EPMX 3NYJA 3RQEA 2KW3C 4IJJA 3EZHA 3HLZA 3E9VA 2R9RB 1JR8A 2GFHA 4ZLCA 1ZHZA 3EQLF 2H7OA 5AC4A 5L0HA 2IXNA 4QI2A 1PCXA 2B0JA 3LESA 4GYTA 2A6EF 5JUAA 3G50A 1RMVA 1T6UA 3S84A 2O9XA 1TQGA 2R7OA 3T4RA 2L81A 4JCZA 1FMWA 4JTDB 1OXKA 1OR2A 4PFOA 2LFFA 3UGPA 3BEHA 1VOMA 2EPNA 1LM3B 4U5EE 4DXWA 1O87A 3LNRA 2WZGA 2R7RA 3MFNA 4CJGA 2YLIA 3H65A 2KK1A 2OCCC 4U5HA 2WZFA 3J06A 3L8IA 1I4ZA 4MNDA 4J7TA 5F5HA 4OIOF 1KTMA 4FWVA 3UNGC 1BDJB 2W45A 1UG7A 4I3MA 4O6YA 4BEJA 2OOCA 1H9TA 4CS8C 2Y69C 3CZ6A 4AL1A 3M1CB 1VLSA 4PJNA 2IXMA 1L3PA 4E7SA 3ZQVA 1Q0MA 5HSWA 2PP4A 2L6HA 3RVYA 4DRIB 5B1BC 3JRTA 4YT2A 3N0TA 2PFDA 5KYXA 4HFFB 4MTFA 2AVKA 3LEVA 3V5ZA 3GEHA 3H2UA 2XL6A 2QNLA 4NC3A 4U5BE 3S0XA 4IARA 1U89A 1ZZPA 2ETSA 2R02A 2XRHA 1ZVZA 1T01A 4LDKA 1Z63A 1ZW3A 3B29A 4JJFA 4AX2A 4B6IA 3ASNC 4Q4ZF 3ABMC 1ORYA 1JAFA 2I8BA 2YLGA 1FAPB 3MX3A 1A41A 3UMKA 2J9BA 1K04A 3LS0A 4R32A 1D0YA 2XL8A 2PX3A 1DOVA 2R7UA 1A7DA 1ZW2A 1Q0DA 1C17M 1LI5A 2FFHA 2HJ3A 2P61A 2I15A 3HNKA 3OEOA 3QVZA 2YL7A 3K1IC 4NQFA 2J45A 4PFPA 2AU5A 1B68A 4BJ1A 2LIGA 3OA1A 3EJNA 4O6MA 3S9OA 4IRUA 4YWQA 3GM3A 3UGOA 1H6GA 4O6NA 1FR0A 2Y3GA 3ITFA 2WVNA 1E83A 1LI7A 4PJLA 4CSAC 4IGGA 2CGEA 1E86A 2GDCA 1LIHA 3C18A 1N1CA 1OCRC 1D1AA 2KSFA 2Q00A 4N4WA 1BBHA 1ZYRF 2A6HF 4NCQA 2W9YA 2XXAB 4LACB 3F47A 3IEEA 4U5GA 3B0UX 3IPMO 1V74B 1J8YF 3V5XA 4MQ9F 3EGDB 2ZD9A 2R7XA 4PR9A 1H9GA 4OIQF 4W8KA 1NFNA 3ZVRA 4D4NA 4E7ZA 1YJGA 5A69A 4EBJA 5B3IA 4C3EA 1HE1A 3E70C 5L0IA 3R7CA 3DKAA 3JZ0A 4XEKA 2NG1A 1KU2A 2XS1A 4WABA 4XEFA 1M56C 4AK9A 1HE9A 3TJ5A 2MYSA 1ZHYA 1A7EA 3B9QA 2GA0A 2KGOA 3EGXA 2J0XA 1NU7D 1TKNA 3SEOA 1NU9C 2BC5A 3DWWA 3RQFA 3LUTB 1C03A 1V55C 2GWWA 2LCHA 5AC5A 1T6IA 3EHNA 4JZAA 3M79A 2NSGA 4XLPF 2E87A 3NRHA 4ZLDA 3JYHA 4H4KC 3EZIA 5FZTA 1XZQA 3MLGA 4H54A 5BQGA 2J9VA 2FGYA 1GQAA 3KPHA 2WZLA 1Y4CA 3AGUA 2DYRC 4GQHA 4J7YA 3EHMA 3SNHA 3JTLO 1VB5A 1ORJA 3I4UA 3HNIA 1YZAA 4XLNF 4LLCA 1WTYA 2IM8A 3W2VA 3HNLA 4WGZA 4MVQA 2HJMA 5DS4A 5KYUA 3K33A 2HUJA 3KKBA 5BQIA 4CS9A 1SZIA 4M63A 4IAQA 2WVQA 2XLWA 4KNVA 5T1DB 1QKRA 4N6HA 4Q5SF 3B0VC 3SXYA 1QVXA 1KNYA 4JE9A 5DLJA 1G5ZA 1RJ9A 1OW8A 1JPNA 2MHRA 1FMVA 1LE4A 1YVIA 3GEEA 2YQYA 3AJMA 3SXMA 3NMKA 1YA7O 2M4EA 2J9UA 1NZEA 2W4BA 2OQMA 2VCCA 1W2WA 3DAGA 3L34A 5JSLA 1LS4A 3WHNA 3EGXB 2PX0A 4YL3A 4J30B 3SXZA 3ZG1A 2NUTA 2RD9A 2IOQA 2EPOA 4MVSA 3KH2A 3JT1A 4XTKA 5L3VA 4NY3A 1R5ID 1VMAA 3LNMB 4BG0A 3BRJA 5EHHA 5L0GA 3FDQA 1FNTc 3U8PA 2A0UA 4J32B 3QW1A 3SZRA 2EPKX 2IXOA 4AE4A 1V54C 1T5OA 3K7DA 3MYIA 3O10A 4JTAB 3RKOF 1EKYA 3V5YA 4CIHA 4JW1A 1OXBA 1A7VA 1QLEC 4ULVA 3B71A 2R7SA 4MVUA 3T6GB 2CCYA 5KYUB 2Y3DA 3AQBA 2EINC 1NBBA 1T6QA 3NKEA 5D91A 2VCAA 4EWCA 3DD7A 4PJMA 1Q0GA 1FFHA 2CW0F 3DAFA 3NMJA 5CI8A 3DJUB 4YJWA 3NYMA 5TJ5E 4D4XA 4DVYP 2HMZA 4EIYA 5JVEA 3U8VA 1LE2A 3O6XA 1RJ9B 2YLDA 4KBLA 4XEVA 3C8GA 3L1MA 3RQGA 5EGYA 5KYWA 3ZTMA 1WN0A 1D1BA 3RW0A 2JX0A 2G3KA 2YL0A 3RFYA 4K0DA 4CS7A 5DS6A 1SR2A 1JPJA 2F22A 4JRZA 1Q0KA 3DZAA 4YT5A 3NKDA 3VYWA 2NUTB 3MYFA 3Q7LA 4KNWA 3DXJF 4EUKB 3U3FA 256BA 2KJGA 4NTFA 4BPMA 3W4YA 1Q0FA 3GM2A 4F4BA 2M64A 4WGYA 3UR3C 2HV6A 3KMIA 1OW7A 1SF8A 3GANA 1WWPA 1FTSA 1TWAA 4BEMJ 4DVZA 1MMGA 5DVWA 1YAUO 4QDLA 3O55A 1NG1A 5L0CA 5COGA 2J7PA 4AE4B 1JMWA 3C8GD 1DOWA 4MW3A 4XPWA 4G7OF 3QZCA 4JTCB 4P9TA 3DE8A 2HSBA 1EA8A 3JSZA 1UFBA 2LSEA 2OEVA 3US6A 4OIPF 1Z5ZA 3L0IA 4LLEA 4OD4A 3UMIA 4DRHB 5L0DA 4Q7CA 3NDBB 1JOGA 2VH3A 2ZXPA 3Q6MA 3RH3A 1CPQA 3RIPA 3WODF 1LPEA 4X0RA 3Q7GA 3H2VA 1AEPA 3S29A 4JC7A 2NPUA 1YDIA 3A11A 1MNEA 3LJBA 1WATA 4WJ0A 3G4XA 3C8GB 4JVSA 3S28A 1K40A 3U9MA 3GODA 4JURI 3ZDLA 1Y6DA 5FCLA 1RKEA 4PACA 5KYWB 3PDMP 3DMDA 3C63A 1OCOC
chains in the Genus database with same CATH topology
5KYXB 3EFOA 4IWBA 4BJ6A 3ZSUA 2WL8A 4BJTA 1M2VA 3EH2A 1Z23A 4PK4A 5T3WA 3W2WA 2BE5F 2Y3HA 4K7BA 4I1OB 4CS9C 3EPVA 2XL4A 4C3DA 2R7VA 1D0XA 3AQCA 3FHDA 3T6JA 4P6IC 3ZIBA 3SP1A 2D5RB 1VYIA 4GEHA 3AG2C 2NUPA 3NYLA 2PF4E 3ECSA 3HJCA 2Y3BA 4BJ5C 5DQZA 4C7OB 2H7BA 2J46A 1TWCA 1QZXA 3DM9B 2H7VC 3UMHA 2ZXWC 3POVA 3EFOB 2VASA 4RDAA 4A2NB 1FFTC 1D1CA 3K66A 2MWQA 1VK5A 1VYKA 4C7OA 2IXPA 3X1OA 1MMDA 3CSKA 2A1DD 1BR1A 1G8XA 3K1HA 1TWGA 2JD3A 2QY9A 4I1MA 1SMYF 3JCUQ 2G62A 4BJ5A 3FAJA 3LLKA 1O5HA 2V3CC 4JCHA 2Q9AA 5F5FA 4ANJA 2VB6A 2OG2A 3EG9A 4OD5A 4U5DE 5E33A 2R7WA 1Z3IX 3AG4C 2Q3TA 2A68F 4RD9A 5E2QA 3WG7C 4U5CE 1MNDA 1M57C 2HV7A 1ZU4A 4C3BA 1OKKA 3B0PA 2IYLD 2A69F 1D0ZA 3I5QA 4HEAJ 4KC9A 3N2ZB 2KNHA 4O7GA 4N06A 3T6BA 3EH1A 5T3TA 1ZHXA 4G7HF 1S7ZA 4HE8D 1TWHA 1TR2A 5B1AC 5DS5A 5L3QA 3DJNB 1ZHWA 2ZXRA 2XSEA 5B3SC 5CI9A 5E3CA 1OKKD 3EG9B 5IY5C 4DOZA 5D92A 2YHSA 2WB7A 1J8MF 2R7QA 3OWTA 2J9WA 4PJJA 2XXAA 2Q9CA 3AG1C 3X2QC 4G0HA 1MMNA 2DGJA 2X51A 3EGDA 5E3AA 1ZHTA 3Q6NA 4BJ6C 3ZC4A 1OCZC 2ZPAA 4CS8A 1OCCC 3ASOC 2Z15A 2C03A 4EBBA 1Z6AA 4HFKB 2ZXOA 3I5PA 3LAYA 2J7PD 5DQTA 1MMAA 5KYYA 1PD0A 3O39A 2W4MA 3NG1A 4YN0B 1LVKA 4YT8A 1LKXA 3N24A 1M2OA 3W8IA 3LS1A 3SYNA 2Q9BA 2C04A 4OINF 3LLIA 1ZU5A 3AG3C 4IAOA 1LS1A 2DYSC 3VAYA 4O79A 2L9JA 2YZSA 4QI0A 3DM5A 5KYNA 1BR2A 3F46A 3PHF2 2J0WA 4CSAA 3KL4A 2EIJC 2QTVA 2P6VA 3FVYA 4CBEA 4FESA 5BUOA 3S27A 4JJGA 2EILC 2P7VA 2Y39A 3QMKA 4I44A 4DBRA 2EIMC 5KYYB 3CQZA 4YT4A 3K6BA 2EIKC 4KI2A 2CNWA 3V7OA 1WGWA 1M2VB 2KQ9A 3PMRA 4FX5A 3RYLA 1ST6A 4OIRF 3W8HA 1PD1A 4RBNA 4DBQA 1BR4A 2WVOA 1IZMA 4XWJA 1IW7F 3TD7A 3HTKC 2YEVA 2R7TA 2CNWD 2CDQA 3ABKC 3ABLC 2V26A 4U5FE 4LERA 4ULWA 2NUPB 3NYJA 2G3VA 2KW3C 4IJJA 3EZHA 3HLZA 3E9VA 2GFHA 4ZLCA 1ZHZA 3EQLF 2H7OA 4QI2A 2IXNA 1PCXA 2B0JA 3LESA 4GYTA 2A6EF 2O9XA 2R7OA 3T4RA 2L81A 1FMWA 4PFOA 3UGPA 1VOMA 4U5EE 1O87A 3LNRA 2WZGA 2R7RA 3H65A 2OCCC 4U5HA 2WZFA 4MNDA 5F5HA 4OIOF 4FWVA 3UNGC 2W45A 4I3MA 4O6YA 4BEJA 4CS8C 2Y69C 3CZ6A 3M1CB 4PJNA 2IXMA 4E7SA 5HSWA 2PP4A 5B1BC 3JRTA 4YT2A 3N0TA 2PFDA 5KYXA 4HFFB 3LEVA 3S0XA 4U5BE 2XRHA 1Z63A 4JJFA 4AX2A 4B6IA 4Q4ZF 3ASNC 3ABMC 2I8BA 3UMKA 3MX3A 3LS0A 1D0YA 2PX3A 2R7UA 2FFHA 3OEOA 3K1IC 2J45A 4PFPA 4BJ1A 3OA1A 3EJNA 4O6MA 4IRUA 4YWQA 3UGOA 4O6NA 2Y3GA 3ITFA 2WVNA 4PJLA 4CSAC 2CGEA 1N1CA 1OCRC 1D1AA 1ZYRF 2A6HF 2W9YA 2XXAB 4LACB 3F47A 3IEEA 4U5GA 3B0UX 1J8YF 4MQ9F 3EGDB 2R7XA 4OIQF 4W8KA 3ZVRA 4E7ZA 4C3EA 3E70C 2NG1A 1KU2A 1M56C 4AK9A 2MYSA 1ZHYA 3B9QA 3EGXA 2KGOA 2J0XA 1NU7D 1TKNA 3SEOA 1NU9C 1V55C 3EHNA 4JZAA 4XLPF 3NRHA 2E87A 4ZLDA 3JYHA 4H4KC 3EZIA 3MLGA 2J9VA 2FGYA 2WZLA 2DYRC 3EHMA 3SNHA 3I4UA 4XLNF 4LLCA 3W2VA 5DS4A 5KYUA 3K33A 3KKBA 4CS9A 1SZIA 4M63A 2WVQA 4KNVA 5T1DB 3B0VC 5DLJA 1RJ9A 1JPNA 1FMVA 2M4EA 4Q5SF 2J9UA 1NZEA 2W4BA 3L34A 3DAGA 1W2WA 3EGXB 2PX0A 4J30B 3ZG1A 2NUTA 2IOQA 3KH2A 3JT1A 4XTKA 5L3VA 4NY3A 1VMAA 5EHHA 4BG0A 3FDQA 4J32B 3SZRA 2IXOA 4AE4A 1V54C 3K7DA 3RKOF 4CIHA 4JW1A 1QLEC 2R7SA 5KYUB 2Y3DA 3AQBA 2EINC 5D91A 3NKEA 4EWCA 3DD7A 4PJMA 2CW0F 1FFHA 5CI8A 3DAFA 4YJWA 4DVYP 3DJUB 3NYMA 3O6XA 1RJ9B 4KBLA 5EGYA 5KYWA 1D1BA 2G3KA 3RFYA 4K0DA 4CS7A 5DS6A 1JPJA 4YT5A 3DZAA 4G7ZF 3VYWA 3NKDA 2NUTB 3Q7LA 4KNWA 3DXJF 2KJGA 4F4BA 3UR3C 2HV6A 3KMIA 1SF8A 3GANA 1TWAA 1FTSA 4DVZA 1MMGA 5DVWA 4QDLA 1NG1A 2J7PA 4AE4B 4G7OF 3QZCA 3JSZA 2LSEA 4OIPF 1Z5ZA 3L0IA 4LLEA 4OD4A 3UMIA 4Q7CA 3NDBB 2VH3A 3Q6MA 2ZXPA 3RH3A 3RIPA 3WODF 4X0RA 3Q7GA 3S29A 1MNEA 3LJBA 4WJ0A 4JVSA 3S28A 5KYWB 3GODA 4JURI 5FCLA 3DMDA 1OCOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5D E;  4U5F E;  4U5E E;  4U5G A;  4U5C E;  4U5B E;  4U5H A; 
#chains in the Genus database with same CATH topology
 2L6G A;  3G4Z A;  4CDA A;  3FMS A;  3RVZ A;  1RXQ A;  5KYX B;  1TFK B;  3FOP A;  3EFO A;  4IWB A;  4DRJ B;  2R25 A;  3PCV A;  4EHP A;  3S90 A;  2TMV P;  4BJ6 A;  3IQ5 A;  3ZSU A;  2P0N A;  2Q4F A;  2WL8 A;  4YL1 A;  4JKV A;  4BJT A;  4ONS A;  1M2V A;  2XLV A;  1Z23 A;  3EH2 A;  1GM5 A;  4PK4 A;  1YYJ A;  5T3W A;  5A6J A;  3W2W A;  5GPG B;  5JS5 A;  3GOR A;  2BE5 F;  4ER9 A;  2Y3H A;  4K7B A;  3QVY A;  4EBK A;  4I1O B;  3TOM A;  3A9C A;  2LP4 A;  1QPU A;  4CS9 C;  3T9O A;  3EPV A;  2XL4 A;  4C3D A;  4CIP A;  2R7V A;  4MVO A;  1D0X A;  1VLT A;  3AQC A;  3FHD A;  3T6J A;  4P6I C;  3ZIB A;  3SP1 A;  1V4A A;  2D5R B;  1CGO A;  1I4Y A;  1VYI A;  2OKU A;  4GEH A;  3AG2 C;  2YL3 A;  2CYD A;  2IBF A;  2NUP A;  3NYL A;  2D4U A;  2PF4 E;  3ECS A;  1RKE B;  3HJC A;  2Y3B A;  4BJ5 C;  5DQZ A;  4C7O B;  2H7B A;  2J46 A;  1TWC A;  1QZX A;  3DM9 B;  2H7V C;  3UMH A;  4U9E A;  2ZXW C;  4NTA A;  2R03 A;  3VF0 A;  3EFO B;  5L0F A;  1ORS C;  3POV A;  2VAS A;  4RDA A;  4A2N B;  1FFT C;  1D1C A;  3AOU A;  2LK4 A;  1AUE A;  2XLH A;  3K66 A;  4E0I A;  2MWQ A;  1E84 A;  1VK5 A;  3TJ6 A;  2OJE D;  1VYK A;  4C7O A;  2ASR A;  2IXP A;  3X1O A;  1MMD A;  3CSK A;  2A1D D;  1BR1 A;  1G8X A;  2AWC A;  3K1H A;  3IQC A;  1TWG A;  1QSP A;  2JD3 A;  2QY9 A;  1WOL A;  2HSQ A;  3HNJ A;  4I1M A;  1NSG B;  4NTB A;  1OQC A;  1SMY F;  3JCU Q;  2G62 A;  2Q7R A;  4BJ5 A;  3FAJ A;  2L6F A;  1O5H A;  3LLK A;  3HKK A;  1MQV A;  5JRA A;  4DJ9 A;  5L0J A;  2L7A A;  4JCH A;  1APC A;  2V3C C;  4CJO A;  2Q9A A;  2BL2 A;  1GGQ A;  5F5F A;  4ANJ A;  2VB6 A;  2OG2 A;  3DI5 A;  3EG9 A;  4OD5 A;  4U5D E;  4XPY A;  5E33 A;  1Z3I X;  2XLO A;  2R7W A;  1CGM E;  2H8A A;  4Z9J A;  3AG4 C;  2QUP A;  2Q3T A;  4JEB A;  4U9D A;  2A68 F;  3RF3 A;  5BQH A;  4RD9 A;  2A0B A;  2XM0 A;  5E2Q A;  3IQ6 A;  3WG7 C;  3U0C A;  3QW0 A;  4U5C E;  1MND A;  1M57 C;  2GAQ A;  1YYX A;  1F1M A;  2DB4 A;  2OU6 A;  2HV7 A;  1ZU4 A;  1HMO A;  2X0C A;  4C3B A;  3TK0 A;  2LFD A;  4CDV A;  2YWA A;  1EQ1 A;  2VCB A;  1OKK A;  2VC9 A;  2IYL D;  2A69 F;  1D0Z A;  2PBE A;  3B0P A;  3I5Q A;  4HEA J;  4KC9 A;  3N2Z B;  1JRA A;  5K0I A;  2KNH A;  2J8W A;  2OEX A;  3TOL A;  4E18 A;  2PNO A;  4O7G A;  4N6C A;  4MTO A;  3DE9 A;  2HKV A;  1T9K A;  4N06 A;  1QQ3 A;  4IB4 A;  3T6B A;  3EH1 A;  3ATP A;  1ZHX A;  5T3T A;  3U2L A;  1S7Z A;  4G7H F;  2YRF A;  4HE8 D;  1AVO B;  1TWH A;  2LQG A;  5COM A;  1TR2 A;  5B1A C;  1Z7Q c;  1HY5 A;  4P9F A;  5AGF A;  4G7Z F;  1EI7 A;  2QE9 A;  5DS5 A;  5JT4 A;  3DJN B;  4MW8 A;  5L3Q A;  3QTH A;  1ZHW A;  4MTG A;  3FXH A;  2YL1 A;  1VTM P;  2ZXR A;  4MVZ A;  2DI3 A;  2XSE A;  5COF A;  1XZP A;  5B3S C;  4FAP B;  1HMD A;  1M6T A;  5CI9 A;  5E3C A;  1OKK D;  3EG9 B;  4CDY A;  5IY5 C;  4DOZ A;  4XPX A;  1R4T A;  4L6R A;  5D92 A;  3KYJ A;  4EKW A;  2YHS A;  4G78 A;  5F28 E;  2WB7 A;  1J8M F;  3AGT A;  2R7Q A;  3C62 A;  3OWT A;  2J9W A;  4PJJ A;  2UUH A;  5A6B A;  2XXA A;  1TFO B;  2Q9C A;  3AG1 C;  3X2Q C;  5A6K A;  4G0H A;  4AL0 A;  1MMN A;  1WAS A;  2DGJ A;  3U2M A;  4CX9 A;  2X51 A;  3EGD A;  2EPL X;  5E3A A;  2XLD A;  3VRC A;  1YZC A;  2XS8 A;  1ZHT A;  3Q6N A;  3GWN A;  4BJ6 C;  3ZC4 A;  1OCZ C;  3JSE O;  3CAX A;  4JEA A;  2ZPA A;  2HS5 A;  3ZQY A;  1OCC C;  3ASO C;  2Z15 A;  3VM6 A;  4CS8 A;  4Z9H A;  2C03 A;  3SXK A;  4EBB A;  3JRM O;  1Z6A A;  2HMQ A;  2YKZ A;  4HFK B;  2ZXO A;  3I5P A;  3LAY A;  3M15 A;  2J7P D;  3R2P A;  5A6B D;  3U9J A;  2HZ8 A;  5DQT A;  1MMA A;  3U5S A;  3C7J A;  1E2X A;  5KYY A;  1PD0 A;  3O39 A;  2W4M A;  2YVK A;  2XM4 A;  3NG1 A;  4YN0 B;  1U0B B;  1SYQ A;  3FAP B;  1RKC A;  1LVK A;  2P1A A;  4YT8 A;  1LKX A;  3L8J A;  3N24 A;  5JLI A;  1M2O A;  3W8I A;  1O3U A;  3LS1 A;  1NFO A;  1BZ4 A;  4XQ1 A;  3WAQ A;  1A0B A;  4W8P A;  3SYN A;  2Q9B A;  1GS9 A;  2KYH A;  2C04 A;  1HW1 A;  2QLA A;  4OIN F;  1S05 A;  3LLI A;  1U6H A;  1ZU5 A;  3IQT A;  3ZTZ A;  2XLM A;  3K1I A;  1YLM A;  4LDQ A;  3AG3 C;  4IAO A;  1LS1 A;  1G4U S;  1RCP A;  2DYS C;  3VAY A;  4O79 A;  2L9J A;  3ZWI A;  2YZS A;  3GWL A;  5EK0 A;  4QI0 A;  4LDR A;  3DM5 A;  5KYN A;  1BR2 A;  3F46 A;  3PHF 2;  2J0W A;  3GEI A;  5A6A A;  4CSA A;  3KL4 A;  3U3B A;  2EIJ C;  2HFI A;  3GM1 A;  4MVR A;  2QTV A;  1XWJ A;  2FAP B;  2LD6 A;  2P6V A;  3FOO A;  2NSF A;  3FVY A;  4CBE A;  1PV3 A;  1L7C A;  1NLX A;  4FES A;  3JYY A;  2UUI A;  5BUO A;  3CEX A;  3S27 A;  2B0H A;  1E85 A;  4JJG A;  2AP3 A;  2EIL C;  2P7V A;  2Y39 A;  1YA9 A;  3QMK A;  4I44 A;  4YK5 A;  4DBR A;  3NMI A;  2EIM C;  3M4B A;  2ICW G;  5KYY B;  3CQZ A;  3MBG A;  4YT4 A;  1OR3 A;  3K6B A;  4JIO A;  2EIK C;  5JP7 A;  4A4A A;  3IHU A;  2R05 A;  4KI2 A;  2CNW A;  2JPU A;  1OW6 A;  3V7O A;  1WGW A;  3LEO A;  1M2V B;  4E0H A;  5CIV A;  2KQ9 A;  3PMR A;  2RSE B;  4FX5 A;  3RYL A;  1ST6 A;  3M4C A;  4K1O A;  4Z9I A;  4OIR F;  3W8H A;  4E17 A;  1PD1 A;  1H7I A;  4RBN A;  3KYI A;  2OJQ A;  5HV9 A;  4DBQ A;  1G4W R;  1BR4 A;  2WVO A;  4MVM A;  4UDV A;  4YL0 A;  4MS2 A;  1IZM A;  1C02 A;  4XWJ A;  1IW7 F;  1CGN A;  1K05 A;  3TD7 A;  3HTK C;  1YAR O;  2YEV A;  3C8Z A;  1I5N A;  2XLE A;  2KC3 A;  2CNW D;  3TUL A;  2CDQ A;  2R7T A;  3ABK C;  3ABL C;  2V26 A;  4U5F E;  4LER A;  1HW2 A;  3TQO A;  4ULW A;  2NUP B;  1CPR A;  2AWY A;  2G3V A;  2EPM X;  3NYJ A;  3RQE A;  2KW3 C;  4IJJ A;  3EZH A;  3HLZ A;  3E9V A;  2R9R B;  1JR8 A;  2GFH A;  4ZLC A;  1ZHZ A;  3EQL F;  2H7O A;  5AC4 A;  5L0H A;  2IXN A;  4QI2 A;  1PCX A;  2B0J A;  3LES A;  4GYT A;  2A6E F;  5JUA A;  3G50 A;  1RMV A;  1T6U A;  3S84 A;  2O9X A;  1TQG A;  2R7O A;  3T4R A;  2L81 A;  4JCZ A;  1FMW A;  4JTD B;  1OXK A;  1OR2 A;  4PFO A;  2LFF A;  3UGP A;  3BEH A;  1VOM A;  2EPN A;  1LM3 B;  4U5E E;  4DXW A;  1O87 A;  3LNR A;  2WZG A;  2R7R A;  3MFN A;  4CJG A;  2YLI A;  3H65 A;  2KK1 A;  2OCC C;  4U5H A;  2WZF A;  3J06 A;  3L8I A;  1I4Z A;  4MND A;  4J7T A;  5F5H A;  4OIO F;  1KTM A;  4FWV A;  3UNG C;  1BDJ B;  2W45 A;  1UG7 A;  4I3M A;  4O6Y A;  4BEJ A;  2OOC A;  1H9T A;  4CS8 C;  2Y69 C;  3CZ6 A;  4AL1 A;  3M1C B;  1VLS A;  4PJN A;  2IXM A;  1L3P A;  4E7S A;  3ZQV A;  1Q0M A;  5HSW A;  2PP4 A;  2L6H A;  3RVY A;  4DRI B;  5B1B C;  3JRT A;  4YT2 A;  3N0T A;  2PFD A;  5KYX A;  4HFF B;  4MTF A;  2AVK A;  3LEV A;  3V5Z A;  3GEH A;  3H2U A;  2XL6 A;  2QNL A;  4NC3 A;  4U5B E;  3S0X A;  4IAR A;  1U89 A;  1ZZP A;  2ETS A;  2R02 A;  2XRH A;  1ZVZ A;  1T01 A;  4LDK A;  1Z63 A;  1ZW3 A;  3B29 A;  4JJF A;  4AX2 A;  4B6I A;  3ASN C;  4Q4Z F;  3ABM C;  1ORY A;  1JAF A;  2I8B A;  2YLG A;  1FAP B;  3MX3 A;  1A41 A;  3UMK A;  2J9B A;  1K04 A;  3LS0 A;  4R32 A;  1D0Y A;  2XL8 A;  2PX3 A;  1DOV A;  2R7U A;  1A7D A;  1ZW2 A;  1Q0D A;  1C17 M;  1LI5 A;  2FFH A;  2HJ3 A;  2P61 A;  2I15 A;  3HNK A;  3OEO A;  3QVZ A;  2YL7 A;  3K1I C;  4NQF A;  2J45 A;  4PFP A;  2AU5 A;  1B68 A;  4BJ1 A;  2LIG A;  3OA1 A;  3EJN A;  4O6M A;  3S9O A;  4IRU A;  4YWQ A;  3GM3 A;  3UGO A;  1H6G A;  4O6N A;  1FR0 A;  2Y3G A;  3ITF A;  2WVN A;  1E83 A;  1LI7 A;  4PJL A;  4CSA C;  4IGG A;  2CGE A;  1E86 A;  2GDC A;  1LIH A;  3C18 A;  1N1C A;  1OCR C;  1D1A A;  2KSF A;  2Q00 A;  4N4W A;  1BBH A;  1ZYR F;  2A6H F;  4NCQ A;  2W9Y A;  2XXA B;  4LAC B;  3F47 A;  3IEE A;  4U5G A;  3B0U X;  3IPM O;  1V74 B;  1J8Y F;  3V5X A;  4MQ9 F;  3EGD B;  2ZD9 A;  2R7X A;  4PR9 A;  1H9G A;  4OIQ F;  4W8K A;  1NFN A;  3ZVR A;  4D4N A;  4E7Z A;  1YJG A;  5A69 A;  4EBJ A;  5B3I A;  4C3E A;  1HE1 A;  3E70 C;  5L0I A;  3R7C A;  3DKA A;  3JZ0 A;  4XEK A;  2NG1 A;  1KU2 A;  2XS1 A;  4WAB A;  4XEF A;  1M56 C;  4AK9 A;  1HE9 A;  3TJ5 A;  2MYS A;  1ZHY A;  1A7E A;  3B9Q A;  2GA0 A;  2KGO A;  3EGX A;  2J0X A;  1NU7 D;  1TKN A;  3SEO A;  1NU9 C;  2BC5 A;  3DWW A;  3RQF A;  3LUT B;  1C03 A;  1V55 C;  2GWW A;  2LCH A;  5AC5 A;  1T6I A;  3EHN A;  4JZA A;  3M79 A;  2NSG A;  4XLP F;  2E87 A;  3NRH A;  4ZLD A;  3JYH A;  4H4K C;  3EZI A;  5FZT A;  1XZQ A;  3MLG A;  4H54 A;  5BQG A;  2J9V A;  2FGY A;  1GQA A;  3KPH A;  2WZL A;  1Y4C A;  3AGU A;  2DYR C;  4GQH A;  4J7Y A;  3EHM A;  3SNH A;  3JTL O;  1VB5 A;  1ORJ A;  3I4U A;  3HNI A;  1YZA A;  4XLN F;  4LLC A;  1WTY A;  2IM8 A;  3W2V A;  3HNL A;  4WGZ A;  4MVQ A;  2HJM A;  5DS4 A;  5KYU A;  3K33 A;  2HUJ A;  3KKB A;  5BQI A;  4CS9 A;  1SZI A;  4M63 A;  4IAQ A;  2WVQ A;  2XLW A;  4KNV A;  5T1D B;  1QKR A;  4N6H A;  4Q5S F;  3B0V C;  3SXY A;  1QVX A;  1KNY A;  4JE9 A;  5DLJ A;  1G5Z A;  1RJ9 A;  1OW8 A;  1JPN A;  2MHR A;  1FMV A;  1LE4 A;  1YVI A;  3GEE A;  2YQY A;  3AJM A;  3SXM A;  3NMK A;  1YA7 O;  2M4E A;  2J9U A;  1NZE A;  2W4B A;  2OQM A;  2VCC A;  1W2W A;  3DAG A;  3L34 A;  5JSL A;  1LS4 A;  3WHN A;  3EGX B;  2PX0 A;  4YL3 A;  4J30 B;  3SXZ A;  3ZG1 A;  2NUT A;  2RD9 A;  2IOQ A;  2EPO A;  4MVS A;  3KH2 A;  3JT1 A;  4XTK A;  5L3V A;  4NY3 A;  1R5I D;  1VMA A;  3LNM B;  4BG0 A;  3BRJ A;  5EHH A;  5L0G A;  3FDQ A;  1FNT c;  3U8P A;  2A0U A;  4J32 B;  3QW1 A;  3SZR A;  2EPK X;  2IXO A;  4AE4 A;  1V54 C;  1T5O A;  3K7D A;  3MYI A;  3O10 A;  4JTA B;  3RKO F;  1EKY A;  3V5Y A;  4CIH A;  4JW1 A;  1OXB A;  1A7V A;  1QLE C;  4ULV A;  3B71 A;  2R7S A;  4MVU A;  3T6G B;  2CCY A;  5KYU B;  2Y3D A;  3AQB A;  2EIN C;  1NBB A;  1T6Q A;  3NKE A;  5D91 A;  2VCA A;  4EWC A;  3DD7 A;  4PJM A;  1Q0G A;  1FFH A;  2CW0 F;  3DAF A;  3NMJ A;  5CI8 A;  3DJU B;  4YJW A;  3NYM A;  5TJ5 E;  4D4X A;  4DVY P;  2HMZ A;  4EIY A;  5JVE A;  3U8V A;  1LE2 A;  3O6X A;  1RJ9 B;  2YLD A;  4KBL A;  4XEV A;  3C8G A;  3L1M A;  3RQG A;  5EGY A;  5KYW A;  3ZTM A;  1WN0 A;  1D1B A;  3RW0 A;  2JX0 A;  2G3K A;  2YL0 A;  3RFY A;  4K0D A;  4CS7 A;  5DS6 A;  1SR2 A;  1JPJ A;  2F22 A;  4JRZ A;  1Q0K A;  3DZA A;  4YT5 A;  3NKD A;  3VYW A;  2NUT B;  3MYF A;  3Q7L A;  4KNW A;  3DXJ F;  4EUK B;  3U3F A;  256B A;  2KJG A;  4NTF A;  4BPM A;  3W4Y A;  1Q0F A;  3GM2 A;  4F4B A;  2M64 A;  4WGY A;  3UR3 C;  2HV6 A;  3KMI A;  1OW7 A;  1SF8 A;  3GAN A;  1WWP A;  1FTS A;  1TWA A;  4BEM J;  4DVZ A;  1MMG A;  5DVW A;  1YAU O;  4QDL A;  3O55 A;  1NG1 A;  5L0C A;  5COG A;  2J7P A;  4AE4 B;  1JMW A;  3C8G D;  1DOW A;  4MW3 A;  4XPW A;  4G7O F;  3QZC A;  4JTC B;  4P9T A;  3DE8 A;  2HSB A;  1EA8 A;  3JSZ A;  1UFB A;  2LSE A;  2OEV A;  3US6 A;  4OIP F;  1Z5Z A;  3L0I A;  4LLE A;  4OD4 A;  3UMI A;  4DRH B;  5L0D A;  4Q7C A;  3NDB B;  1JOG A;  2VH3 A;  2ZXP A;  3Q6M A;  3RH3 A;  1CPQ A;  3RIP A;  3WOD F;  1LPE A;  4X0R A;  3Q7G A;  3H2V A;  1AEP A;  3S29 A;  4JC7 A;  2NPU A;  1YDI A;  3A11 A;  1MNE A;  3LJB A;  1WAT A;  4WJ0 A;  3G4X A;  3C8G B;  4JVS A;  3S28 A;  1K40 A;  3U9M A;  3GOD A;  4JUR I;  3ZDL A;  1Y6D A;  5FCL A;  1RKE A;  4PAC A;  5KYW B;  3PDM P;  3DMD A;  3C63 A;  1OCO C; 
#chains in the Genus database with same CATH homology
 5KYX B;  3EFO A;  4IWB A;  4BJ6 A;  3ZSU A;  2WL8 A;  4BJT A;  1M2V A;  3EH2 A;  1Z23 A;  4PK4 A;  5T3W A;  3W2W A;  2BE5 F;  2Y3H A;  4K7B A;  4I1O B;  4CS9 C;  3EPV A;  2XL4 A;  4C3D A;  2R7V A;  1D0X A;  3AQC A;  3FHD A;  3T6J A;  4P6I C;  3ZIB A;  3SP1 A;  2D5R B;  1VYI A;  4GEH A;  3AG2 C;  2NUP A;  3NYL A;  2PF4 E;  3ECS A;  3HJC A;  2Y3B A;  4BJ5 C;  5DQZ A;  4C7O B;  2H7B A;  2J46 A;  1TWC A;  1QZX A;  3DM9 B;  2H7V C;  3UMH A;  2ZXW C;  3POV A;  3EFO B;  2VAS A;  4RDA A;  4A2N B;  1FFT C;  1D1C A;  3K66 A;  2MWQ A;  1VK5 A;  1VYK A;  4C7O A;  2IXP A;  3X1O A;  1MMD A;  3CSK A;  2A1D D;  1BR1 A;  1G8X A;  3K1H A;  1TWG A;  2JD3 A;  2QY9 A;  4I1M A;  1SMY F;  3JCU Q;  2G62 A;  4BJ5 A;  3FAJ A;  3LLK A;  1O5H A;  2V3C C;  4JCH A;  2Q9A A;  5F5F A;  4ANJ A;  2VB6 A;  2OG2 A;  3EG9 A;  4OD5 A;  4U5D E;  5E33 A;  2R7W A;  1Z3I X;  3AG4 C;  2Q3T A;  2A68 F;  4RD9 A;  5E2Q A;  3WG7 C;  4U5C E;  1MND A;  1M57 C;  2HV7 A;  1ZU4 A;  4C3B A;  1OKK A;  3B0P A;  2IYL D;  2A69 F;  1D0Z A;  3I5Q A;  4HEA J;  4KC9 A;  3N2Z B;  2KNH A;  4O7G A;  4N06 A;  3T6B A;  3EH1 A;  5T3T A;  1ZHX A;  4G7H F;  1S7Z A;  4HE8 D;  1TWH A;  1TR2 A;  5B1A C;  5DS5 A;  5L3Q A;  3DJN B;  1ZHW A;  2ZXR A;  2XSE A;  5B3S C;  5CI9 A;  5E3C A;  1OKK D;  3EG9 B;  5IY5 C;  4DOZ A;  5D92 A;  2YHS A;  2WB7 A;  1J8M F;  2R7Q A;  3OWT A;  2J9W A;  4PJJ A;  2XXA A;  2Q9C A;  3AG1 C;  3X2Q C;  4G0H A;  1MMN A;  2DGJ A;  2X51 A;  3EGD A;  5E3A A;  1ZHT A;  3Q6N A;  4BJ6 C;  3ZC4 A;  1OCZ C;  2ZPA A;  4CS8 A;  1OCC C;  3ASO C;  2Z15 A;  2C03 A;  4EBB A;  1Z6A A;  4HFK B;  2ZXO A;  3I5P A;  3LAY A;  2J7P D;  5DQT A;  1MMA A;  5KYY A;  1PD0 A;  3O39 A;  2W4M A;  3NG1 A;  4YN0 B;  1LVK A;  4YT8 A;  1LKX A;  3N24 A;  1M2O A;  3W8I A;  3LS1 A;  3SYN A;  2Q9B A;  2C04 A;  4OIN F;  3LLI A;  1ZU5 A;  3AG3 C;  4IAO A;  1LS1 A;  2DYS C;  3VAY A;  4O79 A;  2L9J A;  2YZS A;  4QI0 A;  3DM5 A;  5KYN A;  1BR2 A;  3F46 A;  3PHF 2;  2J0W A;  4CSA A;  3KL4 A;  2EIJ C;  2QTV A;  2P6V A;  3FVY A;  4CBE A;  4FES A;  5BUO A;  3S27 A;  4JJG A;  2EIL C;  2P7V A;  2Y39 A;  3QMK A;  4I44 A;  4DBR A;  2EIM C;  5KYY B;  3CQZ A;  4YT4 A;  3K6B A;  2EIK C;  4KI2 A;  2CNW A;  3V7O A;  1WGW A;  1M2V B;  2KQ9 A;  3PMR A;  4FX5 A;  3RYL A;  1ST6 A;  4OIR F;  3W8H A;  1PD1 A;  4RBN A;  4DBQ A;  1BR4 A;  2WVO A;  1IZM A;  4XWJ A;  1IW7 F;  3TD7 A;  3HTK C;  2YEV A;  2R7T A;  2CNW D;  2CDQ A;  3ABK C;  3ABL C;  2V26 A;  4U5F E;  4LER A;  4ULW A;  2NUP B;  3NYJ A;  2G3V A;  2KW3 C;  4IJJ A;  3EZH A;  3HLZ A;  3E9V A;  2GFH A;  4ZLC A;  1ZHZ A;  3EQL F;  2H7O A;  4QI2 A;  2IXN A;  1PCX A;  2B0J A;  3LES A;  4GYT A;  2A6E F;  2O9X A;  2R7O A;  3T4R A;  2L81 A;  1FMW A;  4PFO A;  3UGP A;  1VOM A;  4U5E E;  1O87 A;  3LNR A;  2WZG A;  2R7R A;  3H65 A;  2OCC C;  4U5H A;  2WZF A;  4MND A;  5F5H A;  4OIO F;  4FWV A;  3UNG C;  2W45 A;  4I3M A;  4O6Y A;  4BEJ A;  4CS8 C;  2Y69 C;  3CZ6 A;  3M1C B;  4PJN A;  2IXM A;  4E7S A;  5HSW A;  2PP4 A;  5B1B C;  3JRT A;  4YT2 A;  3N0T A;  2PFD A;  5KYX A;  4HFF B;  3LEV A;  3S0X A;  4U5B E;  2XRH A;  1Z63 A;  4JJF A;  4AX2 A;  4B6I A;  4Q4Z F;  3ASN C;  3ABM C;  2I8B A;  3UMK A;  3MX3 A;  3LS0 A;  1D0Y A;  2PX3 A;  2R7U A;  2FFH A;  3OEO A;  3K1I C;  2J45 A;  4PFP A;  4BJ1 A;  3OA1 A;  3EJN A;  4O6M A;  4IRU A;  4YWQ A;  3UGO A;  4O6N A;  2Y3G A;  3ITF A;  2WVN A;  4PJL A;  4CSA C;  2CGE A;  1N1C A;  1OCR C;  1D1A A;  1ZYR F;  2A6H F;  2W9Y A;  2XXA B;  4LAC B;  3F47 A;  3IEE A;  4U5G A;  3B0U X;  1J8Y F;  4MQ9 F;  3EGD B;  2R7X A;  4OIQ F;  4W8K A;  3ZVR A;  4E7Z A;  4C3E A;  3E70 C;  2NG1 A;  1KU2 A;  1M56 C;  4AK9 A;  2MYS A;  1ZHY A;  3B9Q A;  3EGX A;  2KGO A;  2J0X A;  1NU7 D;  1TKN A;  3SEO A;  1NU9 C;  1V55 C;  3EHN A;  4JZA A;  4XLP F;  3NRH A;  2E87 A;  4ZLD A;  3JYH A;  4H4K C;  3EZI A;  3MLG A;  2J9V A;  2FGY A;  2WZL A;  2DYR C;  3EHM A;  3SNH A;  3I4U A;  4XLN F;  4LLC A;  3W2V A;  5DS4 A;  5KYU A;  3K33 A;  3KKB A;  4CS9 A;  1SZI A;  4M63 A;  2WVQ A;  4KNV A;  5T1D B;  3B0V C;  5DLJ A;  1RJ9 A;  1JPN A;  1FMV A;  2M4E A;  4Q5S F;  2J9U A;  1NZE A;  2W4B A;  3L34 A;  3DAG A;  1W2W A;  3EGX B;  2PX0 A;  4J30 B;  3ZG1 A;  2NUT A;  2IOQ A;  3KH2 A;  3JT1 A;  4XTK A;  5L3V A;  4NY3 A;  1VMA A;  5EHH A;  4BG0 A;  3FDQ A;  4J32 B;  3SZR A;  2IXO A;  4AE4 A;  1V54 C;  3K7D A;  3RKO F;  4CIH A;  4JW1 A;  1QLE C;  2R7S A;  5KYU B;  2Y3D A;  3AQB A;  2EIN C;  5D91 A;  3NKE A;  4EWC A;  3DD7 A;  4PJM A;  2CW0 F;  1FFH A;  5CI8 A;  3DAF A;  4YJW A;  4DVY P;  3DJU B;  3NYM A;  3O6X A;  1RJ9 B;  4KBL A;  5EGY A;  5KYW A;  1D1B A;  2G3K A;  3RFY A;  4K0D A;  4CS7 A;  5DS6 A;  1JPJ A;  4YT5 A;  3DZA A;  4G7Z F;  3VYW A;  3NKD A;  2NUT B;  3Q7L A;  4KNW A;  3DXJ F;  2KJG A;  4F4B A;  3UR3 C;  2HV6 A;  3KMI A;  1SF8 A;  3GAN A;  1TWA A;  1FTS A;  4DVZ A;  1MMG A;  5DVW A;  4QDL A;  1NG1 A;  2J7P A;  4AE4 B;  4G7O F;  3QZC A;  3JSZ A;  2LSE A;  4OIP F;  1Z5Z A;  3L0I A;  4LLE A;  4OD4 A;  3UMI A;  4Q7C A;  3NDB B;  2VH3 A;  3Q6M A;  2ZXP A;  3RH3 A;  3RIP A;  3WOD F;  4X0R A;  3Q7G A;  3S29 A;  1MNE A;  3LJB A;  4WJ0 A;  4JVS A;  3S28 A;  5KYW B;  3GOD A;  4JUR I;  5FCL A;  3DMD A;  1OCO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...