4U5GA

Crystal structure of con-ikot-ikot toxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
83
structure length
83
Chain Sequence
ADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Con-ikot-ikot
publication title X-ray structures of AMPA receptor-cone snail toxin complexes illuminate activation mechanism.
pubmed doi rcsb
source organism Conus striatus
molecule tags Toxin
total genus 27
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1800 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4u5gA00
4U5CE 4U5FE 4U5DE 4U5EE 4U5GA 4U5HA 4U5BE
chains in the Genus database with same CATH superfamily
2C03A 2EILC 3KMIA 2XRHA 4MTFA 3S27A 3QVZA 2CYDA 2QUPA 1A7DA 3FAJA 3JRMO 4J32B 4BJ6A 5EHHA 2XLDA 3FVYA 2YLIA 4EUKB 4Z9HA 4CX9A 4KBLA 4BJTA 4C3DA 3NRHA 4F4BA 1JRAA 2OEVA 4N6CA 3LS1A 2R9RB 2BE5F 2D5RB 3DE8A 3DKAA 3MFNA 4P9FA 1LI5A 5E3CA 1TR2A 2EPKX 4CJGA 1SYQA 3JZ0A 1WTYA 3ZIBA 2H7BA 2XL8A 1GM5A 4D4NA 1LE4A 5IY5C 3QMKA 1Y4CA 3FMSA 5KYUA 1JAFA 4CSAC 1XZPA 4U5HA 1K04A 4O6MA 3GODA 5A6AA 2MYSA 3DI5A 1FNTc 3LNRA 3TQOA 2RSEB 3C8GD 3ABMC 3E9VA 3L34A 4LLCA 3EZHA 3RH3A 4HFFB 4IAQA 3TD7A 3X1OA 3U0CA 3EHNA 3AG1C 3ASOC 4JEAA 5FCLA 3WAQA 2YHSA 3ZWIA 1WASA 2R7SA 1PD1A 1YA7O 3C7JA 4Q7CA 5DQTA 2R7TA 4MTOA 2HSQA 1AEPA 3SXZA 2H7OA 1KTMA 2Q7RA 5CI9A 2PP4A 4LDKA 3U8VA 4W8PA 3UMKA 4BEJA 2BL2A 3PDMP 4JC7A 4ANJA 4LDRA 3T6JA 1OQCA 2HSBA 3LESA 3US6A 1VB5A 4AE4B 3AJMA 5JRAA 5BUOA 2WZFA 2YL7A 3CZ6A 2YL1A 4JCZA 1BBHA 2I8BA 2CW0F 1PV3A 1Q0FA 1D1BA 4ZLCA 2NG1A 4MTGA 1G4US 3EGDA 3F46A 2EIJC 4NC3A 4U5DE 1S7ZA 2UUIA 3DAFA 4U5GA 4YL1A 5BQHA 3EFOB 1G4WR 2YVKA 2BC5A 1GGQA 2WZLA 2GA0A 2XS8A 1EA8A 1LKXA 2XLHA 2IXNA 4XPXA 2IXMA 1E83A 2QLAA 1GQAA 2Q4FA 3E70C 3PCVA 4JW1A 2DGJA 2HV6A 1O87A 1E84A 4E18A 2ZXWC 3FDQA 3M1CB 4P6IC 3VF0A 5CI8A 5JVEA 3U5SA 1LVKA 4DBRA 1HMDA 3EGDB 3V5ZA 1JR8A 4MW3A 5DQZA 4CBEA 4A4AA 1OKKA 1MNDA 2CNWD 5L0HA 3FOOA 1S05A 4U9DA 4WGYA 2WB7A 2EPOA 2W4MA 4MW8A 4XLPF 4E0IA 2LCHA 2KYHA 1ST6A 5JLIA 3POVA 1MMGA 3Q6NA 1NG1A 4CSAA 2OJED 2L6HA 3M4BA 1OCCC 1PCXA 1V74B 2MWQA 3HKKA 4RDAA 3VAYA 3ZSUA 3G50A 4C7OB 3S90A 2GDCA 1M2VB 1Z6AA 3NMJA 2GFHA 4MS2A 3T9OA 4HEAJ 3TK0A 3N24A 1ORYA 3C62A 3RVZA 1NFNA 3ATPA 2ZXPA 3MBGA 1YDIA 3QZCA 3W2WA 2QTVA 3IEEA 1V55C 2QE9A 2LSEA 2KSFA 2LD6A 1UFBA 2Q9AA 3NKEA 4R32A 1I5NA 1YVIA 4OIOF 1OCRC 3S29A 1NFOA 1A41A 4L6RA 1FMVA 3U2LA 2CDQA 4XQ1A 1HE1A 3OWTA 4PJMA 1LS4A 1ZHXA 2Q9CA 1N1CA 3DD7A 4AL1A 1EQ1A 1R4TA 2P7VA 2C04A 4IJJA 4M63A 1TWAA 1EI7A 4MVZA 3IQ5A 2NSFA 1T01A 4MNDA 4NY3A 2PBEA 4U5EE 3MYFA 1Y6DA 1RJ9B 2J7PA 3O6XA 1HE9A 3I5QA 3ZG1A 2ICWG 3EHMA 5B3IA 4H4KC 1LIHA 2A68F 1ZW2A 3T6BA 1VLSA 4JE9A 5B1BC 2W45A 4E7SA 4CS9A 2IXOA 4GYTA 5B3SC 2EINC 4IRUA 2P1AA 1FR0A 2AP3A 3AQCA 3Q6MA 4O7GA 1BR4A 4XEVA 2R05A 3ITFA 5K0IA 4LERA 3V5XA 1OXBA 1TFOB 4KNVA 3ZTZA 4E0HA 1D1AA 5GPGB 1FTSA 4YT8A 2VCBA 4WJ0A 1T9KA 1Z23A 1Z3IX 1G5ZA 1FFHA 2R7XA 3PMRA 2AWCA 4I44A 2G3KA 5T1DB 5COFA 1OCOC 3DWWA 3B0UX 5KYNA 3AQBA 5D91A 1Q0MA 4GQHA 2W9YA 1T5OA 1ZHZA 2RD9A 2UUHA 2Y3BA 2KK1A 1PD0A 1VLTA 2EPNA 2J9WA 3AGUA 4J7YA 4ZLDA 3M4CA 3FOPA 1TWCA 3RW0A 3UMHA 2NUTB 2J46A 1VYKA 5F5HA 3SEOA 2Y3GA 2A0BA 4YL3A 3NMKA 3UNGC 4OIPF 2HMZA 3KYJA 1WWPA 3JCUQ 2ETSA 3FAPB 5F5FA 3QTHA 2GAQA 3QW1A 1RCPA 3DAGA 1VTMP 4JTDB 5JSLA 2VC9A 3K6BA 5JP7A 4ULVA 3RYLA 4FAPB 5DS4A 1ZZPA 4B6IA 1EKYA 1UG7A 3UGOA 1OW6A 4CJOA 2HJ3A 4BEMJ 3SP1A 1R5ID 1YAUO 1ORSC 4JZAA 1ZHYA 4K0DA 3K7DA 2R7UA 3SYNA 4PJLA 3JYYA 3JT1A 4YT2A 2P6VA 1YLMA 1LS1A 3C8ZA 4U5FE 5KYUB 3B9QA 3IQTA 2ZXRA 4KNWA 3WODF 4AE4A 3RQGA 2L6GA 1J8YF 4H54A 1H9TA 4JTAB 3VM6A 1APCA 2MHRA 2YLDA 1LI7A 4OD4A 4P9TA 4XEKA 4CS8C 3AG2C 1CPQA 4OD5A 3WHNA 4Q5SF 1L7CA 3NYLA 1DOWA 3NYMA 4YWQA 1YYXA 2XL6A 3H2VA 4DRIB 5DS6A 5CIVA 3C18A 3ZDLA 4DVYP 1TWHA 2YEVA 3B71A 4AL0A 4CDAA 3AGTA 3BEHA 5L0DA 3I5PA 2OG2A 1OKKD 2WVNA 1WN0A 2ZD9A 1OW7A 1MQVA 1VOMA 2W4BA 3GEHA 4OIRF 1VK5A 2XS1A 2O9XA 2YQYA 1Z63A 1HMOA 1H9GA 4YT4A 1QKRA 1J8MF 1MMAA 2XLWA 3H65A 2A1DD 4ULWA 4YJWA 3HNKA 4XPWA 2P61A 3LJBA 3GORA 3N2ZB 3HLZA 3C8GA 2GWWA 4HFKB 2ZXOA 1M56C 2LIGA 3L8IA 5E2QA 4DBQA 5JS5A 4QI0A 4MVUA 2WZGA 2NUPA 3CAXA 1YYJA 3O55A 5HV9A 1YJGA 4CDVA 3A9CA 2J0XA 2CGEA 3I4UA 3IQCA 2ZPAA 2LQGA 1BDJB 2QNLA 1ZHWA 4X0RA 4DOZA 1V54C 5BQGA 4PK4A 3JSZA 2EPMX 3GM2A 3RKOF 2P0NA 4XLNF 3LLIA 2WVOA 4JTCB 5F28E 4BJ5C 2VCAA 4BG0A 3S28A 3W8IA 5KYXA 3KYIA 1CGME 3S9OA 1QPUA 1T6IA 1SMYF 4EKWA 4O6YA 3UMIA 1TKNA 4PFOA 2A6HF 2KQ9A 2AVKA 2NUPB 4QDLA 1HW2A 2OQMA 4JKVA 2JPUA 2R7QA 4MVSA 4K1OA 2PNOA 3QW0A 2F22A 2IXPA 3R2PA 5EK0A 3TULA 2J7PD 2PF4E 1ZVZA 3KL4A 4CDYA 4E7ZA 1FAPB 4BJ6C 3B0VC 4WABA 3K66A 3DZAA 1D0XA 2FGYA 5KYXB 2L9JA 3B29A 2G62A 1K40A 2XSEA 2Z15A 3ZQYA 3CQZA 4O6NA 2IYLD 5A6BA 1GS9A 2HZ8A 3U3BA 2TMVP 5A69A 3MX3A 4G78A 2FFHA 1JMWA 5HSWA 1NBBA 1E86A 3HNJA 3LAYA 4WGZA 1D1CA 1Q0KA 1LE2A 2YKZA 4EBJA 4FWVA 4I3MA 1VMAA 5KYWA 1TFKB 2M64A 1WGWA 2J45A 3EJNA 3U2MA 2R7RA 1HW1A 1Z7Qc 3KPHA 2Y69C 3U9JA 2IOQA 4LDQA 1SF8A 3IQ6A 4JJGA 2KGOA 4KC9A 5AGFA 4CIHA 1U0BB 1OR2A 1H7IA 1OW8A 1XZQA 2J9BA 3O39A 4YT5A 2R7WA 3W2VA 3H2UA 1A7EA 3TJ5A 2Y3HA 1LM3B 1MMNA 1W2WA 2YZSA 2EIMC 3HNIA 4N4WA 3SZRA 1KU2A 2EPLX 2OCCC 1AVOB 3GWNA 3U3FA 2ASRA 5AC4A 5L0FA 2FAPB 1RMVA 4I1MA 4JURI 4YL0A 5KYWB 5COMA 1B68A 1TQGA 2EIKC 2XL4A 5A6KA 3EZIA 4J7TA 4PJJA 3AG3C 4NQFA 3UGPA 3RFYA 1NSGB 1V4AA 1YARO 3G4XA 1E85A 3AOUA 1O5HA 2OKUA 3SXYA 3TJ6A 2B0HA 4C3EA 3NDBB 3EGXA 1CGOA 2NPUA 3EPVA 4QI2A 2OOCA 4XTKA 4EHPA 1M6TA 1KNYA 3B0PA 4MVRA 1T6UA 2OU6A 3RIPA 3CSKA 1LPEA 4JVSA 4FX5A 3Q7GA 1RXQA 1WOLA 3N0TA 4MVOA 1E2XA 4IARA 1ZU5A 3LS0A 4O79A 4PACA 1DOVA 1Q0GA 2HMQA 1OR3A 2KC3A 1BR1A 1FFTC 3ABKC 4JJFA 3GANA 3LLKA 5DLJA 5L0IA 2JX0A 2XLEA 1FMWA 4N06A 1YZCA 1NU7D 4A2NB 1I4ZA 3GWLA 4NTFA 3W4YA 3EGXB 3OEOA 2XLMA 2M4EA 3BRJA 3K1IC 5DVWA 4PJNA 1TWGA 2LFDA 3DJUB 3DXJF 3KH2A 4DXWA 2J0WA 4N6HA 1D0YA 1NLXA 4JEBA 2JD3A 2LP4A 2WVQA 3X2QC 1CGNA 5L0GA 4EWCA 5KYYA 3NG1A 3EH1A 1BZ4A 4E17A 4XPYA 1ORJA 3JSEO 2X0CA 2CCYA 2HFIA 3NMIA 4KI2A 2WL8A 3HJCA 3JYHA 4G0HA 4G7HF 3TOLA 3MYIA 2VCCA 4PFPA 4YN0B 3DJNB 3T4RA 3Q7LA 3TOMA 1I4YA 2H8AA 4MVQA 3VRCA 5EGYA 2OJQA 4HE8D 3ECSA 4C3BA 4GEHA 3EFOA 3U8PA 4NTBA 2AU5A 3S84A 1K05A 4EBBA 1NZEA 4MQ9F 3ABLC 4Q4ZF 2AWYA 2L81A 1QZXA 2B0JA 3M15A 5KYYB 4D4XA 3NKDA 2Q00A 2DYRC 3GM1A 2HV7A 1SZIA 2L6FA 2QY9A 3HNLA 1D0ZA 3L1MA 2R25A 4MVMA 2OEXA 4EBKA 1G8XA 1U89A 1M57C 2H7VC 2Q9BA 2YLGA 3AG4C 3O10A 3DM9B 1Q0DA 5COGA 5L3QA 3G4ZA 1MMDA 3V5YA 2I15A 3K1HA 3K33A 2R02A 2HS5A 4IAOA 1YA9A 4LLEA 5E33A 1L3PA 4NCQA 3V7OA 4CIPA 4BPMA 4DVZA 3GEEA 4ONSA 3T6GB 2Y3DA 4JIOA 3U9MA 2HUJA 3EG9A 1OCZC 3EH2A 4U5BE 5D92A 4AX2A 3VYWA 4CS9C 3L8JA 2J8WA 1RKEA 4W8KA 1OXKA 1Z5ZA 2XM0A 3GM3A 3MLGA 3LEVA 2KNHA 3C8GB 1JPJA 2IBFA 4RBNA 2Q3TA 1F1MA 5JUAA 5L0JA 5DS5A 5B1AC 2L7AA 2XLOA 1XWJA 4C7OA 3RF3A 3L0IA 2A6EF 2HJMA 4G7ZF 1M2VA 5A6JA 3JRTA 5A6BD 3NYJA 5E3AA 4ER9A 3M79A 4U5CE 4U9EA 4DJ9A 1QQ3A 2Y39A 1U6HA 1JPNA 3EG9B 3J06A 3K1IA 4I1OB 4RD9A 1QSPA 1RKEB 3LEOA 4Z9JA 2VB6A 4YK5A 1ZHTA 2PX0A 4CS8A 4XEFA 1HY5A 2LFFA 3LNMB 4JRZA 1ZYRF 3ZQVA 1C03A 3C63A 5L3VA 1H6GA 3JTLO 1A7VA 4DRHB 3R7CA 1CPRA 3A11A 4LACB 3WG7C 4IWBA 3OA1A 4IGGA 1SR2A 3RQEA 3RVYA 2DI3A 2YRFA 2CNWA 2R7OA 4UDVA 3SXMA 1BR2A 2YL3A 1A0BA 3QVYA 3DM5A 5JT4A 3ZVRA 2A69F 1QLEC 3DE9A 3KKBA 3FXHA 2V26A 3LUTB 1RJ9A 3ZC4A 3ZTMA 1YZAA 1VYIA 1RKCA 3S0XA 4FESA 1AUEA 2KW3C 3F47A 3DMDA 4XWJA 5T3WA 3PHF2 4PR9A 1QVXA 256BA 4K7BA 5T3TA 2D4UA 1MNEA 2PFDA 2E87A 2YL0A 3HTKC 4AK9A 5BQIA 4NTAA 2V3CC 2XM4A 1C02A 3IHUA 3IPMO 4IB4A 1T6QA 2XXAA 2LK4A 2PX3A 1IW7F 2R7VA 3CEXA 1NU9C 1M2OA 2VH3A 3SXKA 2G3VA 2XLVA 2IM8A 3FHDA 2A0UA 2X51A 1ZU4A 2R03A 3ASNC 5FZTA 4OIQF 2DB4A 5AC5A 2HKVA 1JOGA 4BJ5A 4BJ1A 1WATA 2J9VA 1IZMA 2KJGA 3GEIA 4Z9IA 4J30B 4JCHA 3RQFA 2DYSC 4DRJB 3SNHA 2VASA 1O3UA 4G7OF 2NSGA 2YWAA 2XXAB 2NUTA 4CS7A 2J9UA 5L0CA 5TJ5E 3UR3C 1C17M 3EQLF 1ZW3A 3W8HA 4EIYA 4OINF
chains in the Genus database with same CATH topology
2C03A 2EILC 3KMIA 2XRHA 3S27A 3FAJA 4J32B 4BJ6A 5EHHA 3FVYA 4KBLA 4BJTA 4C3DA 3NRHA 4F4BA 3LS1A 5E3CA 2BE5F 2D5RB 1TR2A 3ZIBA 2H7BA 5IY5C 3QMKA 5KYUA 4CSAC 4U5HA 4O6MA 3GODA 2MYSA 3LNRA 4AE4A 4LLCA 3ABMC 3E9VA 3L34A 3RH3A 3EZHA 4HFFB 3TD7A 3X1OA 3EHNA 3AG1C 3ASOC 5FCLA 2YHSA 2R7SA 1PD1A 5DQTA 4Q7CA 2R7TA 2H7OA 5CI9A 2PP4A 3UMKA 4BEJA 4ANJA 4AE4B 3LESA 5BUOA 2WZFA 3CZ6A 2I8BA 2CW0F 1D1BA 4ZLCA 2NG1A 3EGDA 3F46A 2EIJC 4U5DE 1S7ZA 3DAFA 4U5GA 3EFOB 2WZLA 1LKXA 2IXNA 2IXMA 3E70C 4JW1A 2DGJA 2HV6A 1O87A 2ZXWC 3FDQA 3M1CB 4P6IC 5CI8A 1LVKA 4DBRA 3EGDB 4CBEA 5DQZA 1OKKA 1MNDA 2CNWD 2WB7A 2W4MA 4XLPF 1ST6A 3POVA 1MMGA 3Q6NA 1NG1A 4CSAA 1OCCC 1PCXA 2MWQA 4RDAA 3VAYA 3ZSUA 4C7OB 1M2VB 1Z6AA 2GFHA 4HEAJ 3N24A 2ZXPA 3QZCA 3W2WA 3IEEA 1V55C 2LSEA 4OIOF 3NKEA 2Q9AA 1OCRC 3S29A 1FMVA 2CDQA 3OWTA 4PJMA 2Q9CA 1ZHXA 3DD7A 1N1CA 2P7VA 2C04A 4IJJA 4M63A 1TWAA 4MNDA 4NY3A 4U5EE 3O6XA 2J7PA 1RJ9B 3ZG1A 3I5QA 3EHMA 4H4KC 3T6BA 2A68F 4E7SA 5B1BC 2W45A 4CS9A 2IXOA 4GYTA 5B3SC 2EINC 4IRUA 3AQCA 3Q6MA 4O7GA 1BR4A 3ITFA 4LERA 4KNVA 4YT8A 1D1AA 1FTSA 4WJ0A 1Z23A 1Z3IX 1FFHA 2R7XA 3PMRA 4I44A 2G3KA 5T1DB 1OCOC 3B0UX 5KYNA 3AQBA 5D91A 2W9YA 1ZHZA 3X2QC 2Y3BA 1PD0A 2J9WA 4ZLDA 1TWCA 3UMHA 2NUTB 2J46A 1VYKA 5F5HA 3SEOA 2Y3GA 3UNGC 4OIPF 3JCUQ 5F5FA 3DAGA 3K6BA 3RYLA 5DS4A 4B6IA 3UGOA 3SP1A 4JZAA 1ZHYA 4K0DA 3K7DA 2R7UA 3SYNA 4PJLA 3JT1A 4YT2A 2P6VA 1LS1A 4U5FE 5KYUB 3B9QA 2ZXRA 4KNWA 3WODF 1J8YF 4CS8C 4OD4A 3AG2C 4OD5A 4Q5SF 3NYLA 3NYMA 4YWQA 5DS6A 4DVYP 1TWHA 2YEVA 3I5PA 2OG2A 1OKKD 2WVNA 1VOMA 2W4BA 4OIRF 1Z63A 1VK5A 2O9XA 4YT4A 3H65A 1J8MF 1MMAA 4YJWA 2A1DD 4ULWA 3LJBA 3N2ZB 3HLZA 4HFKB 2ZXOA 1M56C 5E2QA 4DBQA 4QI0A 2WZGA 2NUPA 2J0XA 2CGEA 3I4UA 4DOZA 2ZPAA 4X0RA 1ZHWA 1V54C 4PK4A 3JSZA 3RKOF 4XLNF 3LLIA 2WVOA 4BJ5C 4BG0A 3S28A 3W8IA 5KYXA 1SMYF 4O6YA 3UMIA 1TKNA 4PFOA 2A6HF 2KQ9A 2NUPB 4QDLA 2R7QA 2IXPA 2J7PD 2PF4E 3KL4A 4E7ZA 4BJ6C 3B0VC 3K66A 3DZAA 1D0XA 2FGYA 5KYXB 2L9JA 2G62A 2XSEA 2Z15A 3CQZA 4O6NA 2IYLD 3MX3A 5HSWA 2FFHA 3LAYA 1D1CA 4FWVA 4I3MA 1VMAA 5KYWA 3EJNA 1WGWA 2J45A 2Y69C 2IOQA 1SF8A 4JJGA 2KGOA 4KC9A 4CIHA 3O39A 2R7WA 4YT5A 3W2VA 2Y3HA 1MMNA 1W2WA 2YZSA 2EIMC 3SZRA 1KU2A 2OCCC 4I1MA 4JURI 5KYWB 2EIKC 2XL4A 3EZIA 4PJJA 3AG3C 3RFYA 1O5HA 4C3EA 3NDBB 3EGXA 3EPVA 4QI2A 4XTKA 3B0PA 3RIPA 3CSKA 4JVSA 4FX5A 3Q7GA 3N0TA 1ZU5A 3LS0A 4O79A 3ABKC 1BR1A 1FFTC 4JJFA 3LLKA 3GANA 5DLJA 4N06A 1FMWA 4A2NB 1NU7D 3EGXB 3OEOA 2M4EA 5DVWA 3K1IC 4PJNA 1TWGA 3DJUB 3DXJF 3KH2A 2J0WA 1D0YA 2JD3A 2WVQA 4EWCA 5KYYA 3NG1A 3EH1A 4KI2A 2WL8A 3HJCA 3JYHA 4G0HA 4G7HF 4PFPA 3T4RA 4YN0B 3DJNB 3Q7LA 5EGYA 4HE8D 3ECSA 4C3BA 4GEHA 3EFOA 4EBBA 1NZEA 4MQ9F 3ABLC 4Q4ZF 2L81A 1QZXA 2B0JA 5KYYB 3NKDA 2DYRC 3T6JA 2HV7A 1SZIA 3UGPA 2QY9A 1D0ZA 1G8XA 2H7VC 1M57C 3AG4C 2Q9BA 3DM9B 5L3QA 1MMDA 3K1HA 3K33A 4IAOA 4LLEA 5E33A 3V7OA 4DVZA 2Y3DA 3EG9A 1OCZC 3EH2A 4U5BE 5D92A 4AX2A 3VYWA 4CS9C 2R7RA 4W8KA 1Z5ZA 3MLGA 3LEVA 2KNHA 4RBNA 1JPJA 2Q3TA 5DS5A 5B1AC 4C7OA 3L0IA 2A6EF 4G7ZF 1M2VA 3JRTA 3NYJA 5E3AA 4U5CE 2Y39A 3EG9B 1JPNA 4I1OB 4RD9A 2VB6A 1ZHTA 2PX0A 4CS8A 1ZYRF 5L3VA 4LACB 3WG7C 4IWBA 3OA1A 2CNWA 2R7OA 1BR2A 3DM5A 3ZVRA 2A69F 1QLEC 3KKBA 3ZC4A 2V26A 1RJ9A 1VYIA 3S0XA 4FESA 2KW3C 3F47A 3DMDA 4XWJA 5T3WA 3PHF2 4K7BA 5T3TA 1MNEA 2PFDA 2E87A 3HTKC 4AK9A 2V3CC 2XXAA 2PX3A 1IW7F 2R7VA 1NU9C 1M2OA 2VH3A 2G3VA 3FHDA 2X51A 1ZU4A 3ASNC 4OIQF 4BJ5A 4BJ1A 2J9VA 1IZMA 2KJGA 4J30B 4JCHA 2DYSC 3SNHA 2VASA 4G7OF 2XXAB 2NUTA 4CS7A 2J9UA 3UR3C 3EQLF 3W8HA 2QTVA 4OINF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U5C E;  4U5F E;  4U5D E;  4U5E E;  4U5G A;  4U5H A;  4U5B E; 
#chains in the Genus database with same CATH topology
 2C03 A;  2EIL C;  3KMI A;  2XRH A;  4MTF A;  3S27 A;  3QVZ A;  2CYD A;  2QUP A;  1A7D A;  3FAJ A;  3JRM O;  4J32 B;  4BJ6 A;  5EHH A;  2XLD A;  3FVY A;  2YLI A;  4EUK B;  4Z9H A;  4CX9 A;  4KBL A;  4BJT A;  4C3D A;  3NRH A;  4F4B A;  1JRA A;  2OEV A;  4N6C A;  3LS1 A;  2R9R B;  2BE5 F;  2D5R B;  3DE8 A;  3DKA A;  3MFN A;  4P9F A;  1LI5 A;  5E3C A;  1TR2 A;  2EPK X;  4CJG A;  1SYQ A;  3JZ0 A;  1WTY A;  3ZIB A;  2H7B A;  2XL8 A;  1GM5 A;  4D4N A;  1LE4 A;  5IY5 C;  3QMK A;  1Y4C A;  3FMS A;  5KYU A;  1JAF A;  4CSA C;  1XZP A;  4U5H A;  1K04 A;  4O6M A;  3GOD A;  5A6A A;  2MYS A;  3DI5 A;  1FNT c;  3LNR A;  3TQO A;  2RSE B;  3C8G D;  3ABM C;  3E9V A;  3L34 A;  4LLC A;  3EZH A;  3RH3 A;  4HFF B;  4IAQ A;  3TD7 A;  3X1O A;  3U0C A;  3EHN A;  3AG1 C;  3ASO C;  4JEA A;  5FCL A;  3WAQ A;  2YHS A;  3ZWI A;  1WAS A;  2R7S A;  1PD1 A;  1YA7 O;  3C7J A;  4Q7C A;  5DQT A;  2R7T A;  4MTO A;  2HSQ A;  1AEP A;  3SXZ A;  2H7O A;  1KTM A;  2Q7R A;  5CI9 A;  2PP4 A;  4LDK A;  3U8V A;  4W8P A;  3UMK A;  4BEJ A;  2BL2 A;  3PDM P;  4JC7 A;  4ANJ A;  4LDR A;  3T6J A;  1OQC A;  2HSB A;  3LES A;  3US6 A;  1VB5 A;  4AE4 B;  3AJM A;  5JRA A;  5BUO A;  2WZF A;  2YL7 A;  3CZ6 A;  2YL1 A;  4JCZ A;  1BBH A;  2I8B A;  2CW0 F;  1PV3 A;  1Q0F A;  1D1B A;  4ZLC A;  2NG1 A;  4MTG A;  1G4U S;  3EGD A;  3F46 A;  2EIJ C;  4NC3 A;  4U5D E;  1S7Z A;  2UUI A;  3DAF A;  4U5G A;  4YL1 A;  5BQH A;  3EFO B;  1G4W R;  2YVK A;  2BC5 A;  1GGQ A;  2WZL A;  2GA0 A;  2XS8 A;  1EA8 A;  1LKX A;  2XLH A;  2IXN A;  4XPX A;  2IXM A;  1E83 A;  2QLA A;  1GQA A;  2Q4F A;  3E70 C;  3PCV A;  4JW1 A;  2DGJ A;  2HV6 A;  1O87 A;  1E84 A;  4E18 A;  2ZXW C;  3FDQ A;  3M1C B;  4P6I C;  3VF0 A;  5CI8 A;  5JVE A;  3U5S A;  1LVK A;  4DBR A;  1HMD A;  3EGD B;  3V5Z A;  1JR8 A;  4MW3 A;  5DQZ A;  4CBE A;  4A4A A;  1OKK A;  1MND A;  2CNW D;  5L0H A;  3FOO A;  1S05 A;  4U9D A;  4WGY A;  2WB7 A;  2EPO A;  2W4M A;  4MW8 A;  4XLP F;  4E0I A;  2LCH A;  2KYH A;  1ST6 A;  5JLI A;  3POV A;  1MMG A;  3Q6N A;  1NG1 A;  4CSA A;  2OJE D;  2L6H A;  3M4B A;  1OCC C;  1PCX A;  1V74 B;  2MWQ A;  3HKK A;  4RDA A;  3VAY A;  3ZSU A;  3G50 A;  4C7O B;  3S90 A;  2GDC A;  1M2V B;  1Z6A A;  3NMJ A;  2GFH A;  4MS2 A;  3T9O A;  4HEA J;  3TK0 A;  3N24 A;  1ORY A;  3C62 A;  3RVZ A;  1NFN A;  3ATP A;  2ZXP A;  3MBG A;  1YDI A;  3QZC A;  3W2W A;  2QTV A;  3IEE A;  1V55 C;  2QE9 A;  2LSE A;  2KSF A;  2LD6 A;  1UFB A;  2Q9A A;  3NKE A;  4R32 A;  1I5N A;  1YVI A;  4OIO F;  1OCR C;  3S29 A;  1NFO A;  1A41 A;  4L6R A;  1FMV A;  3U2L A;  2CDQ A;  4XQ1 A;  1HE1 A;  3OWT A;  4PJM A;  1LS4 A;  1ZHX A;  2Q9C A;  1N1C A;  3DD7 A;  4AL1 A;  1EQ1 A;  1R4T A;  2P7V A;  2C04 A;  4IJJ A;  4M63 A;  1TWA A;  1EI7 A;  4MVZ A;  3IQ5 A;  2NSF A;  1T01 A;  4MND A;  4NY3 A;  2PBE A;  4U5E E;  3MYF A;  1Y6D A;  1RJ9 B;  2J7P A;  3O6X A;  1HE9 A;  3I5Q A;  3ZG1 A;  2ICW G;  3EHM A;  5B3I A;  4H4K C;  1LIH A;  2A68 F;  1ZW2 A;  3T6B A;  1VLS A;  4JE9 A;  5B1B C;  2W45 A;  4E7S A;  4CS9 A;  2IXO A;  4GYT A;  5B3S C;  2EIN C;  4IRU A;  2P1A A;  1FR0 A;  2AP3 A;  3AQC A;  3Q6M A;  4O7G A;  1BR4 A;  4XEV A;  2R05 A;  3ITF A;  5K0I A;  4LER A;  3V5X A;  1OXB A;  1TFO B;  4KNV A;  3ZTZ A;  4E0H A;  1D1A A;  5GPG B;  1FTS A;  4YT8 A;  2VCB A;  4WJ0 A;  1T9K A;  1Z23 A;  1Z3I X;  1G5Z A;  1FFH A;  2R7X A;  3PMR A;  2AWC A;  4I44 A;  2G3K A;  5T1D B;  5COF A;  1OCO C;  3DWW A;  3B0U X;  5KYN A;  3AQB A;  5D91 A;  1Q0M A;  4GQH A;  2W9Y A;  1T5O A;  1ZHZ A;  2RD9 A;  2UUH A;  2Y3B A;  2KK1 A;  1PD0 A;  1VLT A;  2EPN A;  2J9W A;  3AGU A;  4J7Y A;  4ZLD A;  3M4C A;  3FOP A;  1TWC A;  3RW0 A;  3UMH A;  2NUT B;  2J46 A;  1VYK A;  5F5H A;  3SEO A;  2Y3G A;  2A0B A;  4YL3 A;  3NMK A;  3UNG C;  4OIP F;  2HMZ A;  3KYJ A;  1WWP A;  3JCU Q;  2ETS A;  3FAP B;  5F5F A;  3QTH A;  2GAQ A;  3QW1 A;  1RCP A;  3DAG A;  1VTM P;  4JTD B;  5JSL A;  2VC9 A;  3K6B A;  5JP7 A;  4ULV A;  3RYL A;  4FAP B;  5DS4 A;  1ZZP A;  4B6I A;  1EKY A;  1UG7 A;  3UGO A;  1OW6 A;  4CJO A;  2HJ3 A;  4BEM J;  3SP1 A;  1R5I D;  1YAU O;  1ORS C;  4JZA A;  1ZHY A;  4K0D A;  3K7D A;  2R7U A;  3SYN A;  4PJL A;  3JYY A;  3JT1 A;  4YT2 A;  2P6V A;  1YLM A;  1LS1 A;  3C8Z A;  4U5F E;  5KYU B;  3B9Q A;  3IQT A;  2ZXR A;  4KNW A;  3WOD F;  4AE4 A;  3RQG A;  2L6G A;  1J8Y F;  4H54 A;  1H9T A;  4JTA B;  3VM6 A;  1APC A;  2MHR A;  2YLD A;  1LI7 A;  4OD4 A;  4P9T A;  4XEK A;  4CS8 C;  3AG2 C;  1CPQ A;  4OD5 A;  3WHN A;  4Q5S F;  1L7C A;  3NYL A;  1DOW A;  3NYM A;  4YWQ A;  1YYX A;  2XL6 A;  3H2V A;  4DRI B;  5DS6 A;  5CIV A;  3C18 A;  3ZDL A;  4DVY P;  1TWH A;  2YEV A;  3B71 A;  4AL0 A;  4CDA A;  3AGT A;  3BEH A;  5L0D A;  3I5P A;  2OG2 A;  1OKK D;  2WVN A;  1WN0 A;  2ZD9 A;  1OW7 A;  1MQV A;  1VOM A;  2W4B A;  3GEH A;  4OIR F;  1VK5 A;  2XS1 A;  2O9X A;  2YQY A;  1Z63 A;  1HMO A;  1H9G A;  4YT4 A;  1QKR A;  1J8M F;  1MMA A;  2XLW A;  3H65 A;  2A1D D;  4ULW A;  4YJW A;  3HNK A;  4XPW A;  2P61 A;  3LJB A;  3GOR A;  3N2Z B;  3HLZ A;  3C8G A;  2GWW A;  4HFK B;  2ZXO A;  1M56 C;  2LIG A;  3L8I A;  5E2Q A;  4DBQ A;  5JS5 A;  4QI0 A;  4MVU A;  2WZG A;  2NUP A;  3CAX A;  1YYJ A;  3O55 A;  5HV9 A;  1YJG A;  4CDV A;  3A9C A;  2J0X A;  2CGE A;  3I4U A;  3IQC A;  2ZPA A;  2LQG A;  1BDJ B;  2QNL A;  1ZHW A;  4X0R A;  4DOZ A;  1V54 C;  5BQG A;  4PK4 A;  3JSZ A;  2EPM X;  3GM2 A;  3RKO F;  2P0N A;  4XLN F;  3LLI A;  2WVO A;  4JTC B;  5F28 E;  4BJ5 C;  2VCA A;  4BG0 A;  3S28 A;  3W8I A;  5KYX A;  3KYI A;  1CGM E;  3S9O A;  1QPU A;  1T6I A;  1SMY F;  4EKW A;  4O6Y A;  3UMI A;  1TKN A;  4PFO A;  2A6H F;  2KQ9 A;  2AVK A;  2NUP B;  4QDL A;  1HW2 A;  2OQM A;  4JKV A;  2JPU A;  2R7Q A;  4MVS A;  4K1O A;  2PNO A;  3QW0 A;  2F22 A;  2IXP A;  3R2P A;  5EK0 A;  3TUL A;  2J7P D;  2PF4 E;  1ZVZ A;  3KL4 A;  4CDY A;  4E7Z A;  1FAP B;  4BJ6 C;  3B0V C;  4WAB A;  3K66 A;  3DZA A;  1D0X A;  2FGY A;  5KYX B;  2L9J A;  3B29 A;  2G62 A;  1K40 A;  2XSE A;  2Z15 A;  3ZQY A;  3CQZ A;  4O6N A;  2IYL D;  5A6B A;  1GS9 A;  2HZ8 A;  3U3B A;  2TMV P;  5A69 A;  3MX3 A;  4G78 A;  2FFH A;  1JMW A;  5HSW A;  1NBB A;  1E86 A;  3HNJ A;  3LAY A;  4WGZ A;  1D1C A;  1Q0K A;  1LE2 A;  2YKZ A;  4EBJ A;  4FWV A;  4I3M A;  1VMA A;  5KYW A;  1TFK B;  2M64 A;  1WGW A;  2J45 A;  3EJN A;  3U2M A;  2R7R A;  1HW1 A;  1Z7Q c;  3KPH A;  2Y69 C;  3U9J A;  2IOQ A;  4LDQ A;  1SF8 A;  3IQ6 A;  4JJG A;  2KGO A;  4KC9 A;  5AGF A;  4CIH A;  1U0B B;  1OR2 A;  1H7I A;  1OW8 A;  1XZQ A;  2J9B A;  3O39 A;  4YT5 A;  2R7W A;  3W2V A;  3H2U A;  1A7E A;  3TJ5 A;  2Y3H A;  1LM3 B;  1MMN A;  1W2W A;  2YZS A;  2EIM C;  3HNI A;  4N4W A;  3SZR A;  1KU2 A;  2EPL X;  2OCC C;  1AVO B;  3GWN A;  3U3F A;  2ASR A;  5AC4 A;  5L0F A;  2FAP B;  1RMV A;  4I1M A;  4JUR I;  4YL0 A;  5KYW B;  5COM A;  1B68 A;  1TQG A;  2EIK C;  2XL4 A;  5A6K A;  3EZI A;  4J7T A;  4PJJ A;  3AG3 C;  4NQF A;  3UGP A;  3RFY A;  1NSG B;  1V4A A;  1YAR O;  3G4X A;  1E85 A;  3AOU A;  1O5H A;  2OKU A;  3SXY A;  3TJ6 A;  2B0H A;  4C3E A;  3NDB B;  3EGX A;  1CGO A;  2NPU A;  3EPV A;  4QI2 A;  2OOC A;  4XTK A;  4EHP A;  1M6T A;  1KNY A;  3B0P A;  4MVR A;  1T6U A;  2OU6 A;  3RIP A;  3CSK A;  1LPE A;  4JVS A;  4FX5 A;  3Q7G A;  1RXQ A;  1WOL A;  3N0T A;  4MVO A;  1E2X A;  4IAR A;  1ZU5 A;  3LS0 A;  4O79 A;  4PAC A;  1DOV A;  1Q0G A;  2HMQ A;  1OR3 A;  2KC3 A;  1BR1 A;  1FFT C;  3ABK C;  4JJF A;  3GAN A;  3LLK A;  5DLJ A;  5L0I A;  2JX0 A;  2XLE A;  1FMW A;  4N06 A;  1YZC A;  1NU7 D;  4A2N B;  1I4Z A;  3GWL A;  4NTF A;  3W4Y A;  3EGX B;  3OEO A;  2XLM A;  2M4E A;  3BRJ A;  3K1I C;  5DVW A;  4PJN A;  1TWG A;  2LFD A;  3DJU B;  3DXJ F;  3KH2 A;  4DXW A;  2J0W A;  4N6H A;  1D0Y A;  1NLX A;  4JEB A;  2JD3 A;  2LP4 A;  2WVQ A;  3X2Q C;  1CGN A;  5L0G A;  4EWC A;  5KYY A;  3NG1 A;  3EH1 A;  1BZ4 A;  4E17 A;  4XPY A;  1ORJ A;  3JSE O;  2X0C A;  2CCY A;  2HFI A;  3NMI A;  4KI2 A;  2WL8 A;  3HJC A;  3JYH A;  4G0H A;  4G7H F;  3TOL A;  3MYI A;  2VCC A;  4PFP A;  4YN0 B;  3DJN B;  3T4R A;  3Q7L A;  3TOM A;  1I4Y A;  2H8A A;  4MVQ A;  3VRC A;  5EGY A;  2OJQ A;  4HE8 D;  3ECS A;  4C3B A;  4GEH A;  3EFO A;  3U8P A;  4NTB A;  2AU5 A;  3S84 A;  1K05 A;  4EBB A;  1NZE A;  4MQ9 F;  3ABL C;  4Q4Z F;  2AWY A;  2L81 A;  1QZX A;  2B0J A;  3M15 A;  5KYY B;  4D4X A;  3NKD A;  2Q00 A;  2DYR C;  3GM1 A;  2HV7 A;  1SZI A;  2L6F A;  2QY9 A;  3HNL A;  1D0Z A;  3L1M A;  2R25 A;  4MVM A;  2OEX A;  4EBK A;  1G8X A;  1U89 A;  1M57 C;  2H7V C;  2Q9B A;  2YLG A;  3AG4 C;  3O10 A;  3DM9 B;  1Q0D A;  5COG A;  5L3Q A;  3G4Z A;  1MMD A;  3V5Y A;  2I15 A;  3K1H A;  3K33 A;  2R02 A;  2HS5 A;  4IAO A;  1YA9 A;  4LLE A;  5E33 A;  1L3P A;  4NCQ A;  3V7O A;  4CIP A;  4BPM A;  4DVZ A;  3GEE A;  4ONS A;  3T6G B;  2Y3D A;  4JIO A;  3U9M A;  2HUJ A;  3EG9 A;  1OCZ C;  3EH2 A;  4U5B E;  5D92 A;  4AX2 A;  3VYW A;  4CS9 C;  3L8J A;  2J8W A;  1RKE A;  4W8K A;  1OXK A;  1Z5Z A;  2XM0 A;  3GM3 A;  3MLG A;  3LEV A;  2KNH A;  3C8G B;  1JPJ A;  2IBF A;  4RBN A;  2Q3T A;  1F1M A;  5JUA A;  5L0J A;  5DS5 A;  5B1A C;  2L7A A;  2XLO A;  1XWJ A;  4C7O A;  3RF3 A;  3L0I A;  2A6E F;  2HJM A;  4G7Z F;  1M2V A;  5A6J A;  3JRT A;  5A6B D;  3NYJ A;  5E3A A;  4ER9 A;  3M79 A;  4U5C E;  4U9E A;  4DJ9 A;  1QQ3 A;  2Y39 A;  1U6H A;  1JPN A;  3EG9 B;  3J06 A;  3K1I A;  4I1O B;  4RD9 A;  1QSP A;  1RKE B;  3LEO A;  4Z9J A;  2VB6 A;  4YK5 A;  1ZHT A;  2PX0 A;  4CS8 A;  4XEF A;  1HY5 A;  2LFF A;  3LNM B;  4JRZ A;  1ZYR F;  3ZQV A;  1C03 A;  3C63 A;  5L3V A;  1H6G A;  3JTL O;  1A7V A;  4DRH B;  3R7C A;  1CPR A;  3A11 A;  4LAC B;  3WG7 C;  4IWB A;  3OA1 A;  4IGG A;  1SR2 A;  3RQE A;  3RVY A;  2DI3 A;  2YRF A;  2CNW A;  2R7O A;  4UDV A;  3SXM A;  1BR2 A;  2YL3 A;  1A0B A;  3QVY A;  3DM5 A;  5JT4 A;  3ZVR A;  2A69 F;  1QLE C;  3DE9 A;  3KKB A;  3FXH A;  2V26 A;  3LUT B;  1RJ9 A;  3ZC4 A;  3ZTM A;  1YZA A;  1VYI A;  1RKC A;  3S0X A;  4FES A;  1AUE A;  2KW3 C;  3F47 A;  3DMD A;  4XWJ A;  5T3W A;  3PHF 2;  4PR9 A;  1QVX A;  256B A;  4K7B A;  5T3T A;  2D4U A;  1MNE A;  2PFD A;  2E87 A;  2YL0 A;  3HTK C;  4AK9 A;  5BQI A;  4NTA A;  2V3C C;  2XM4 A;  1C02 A;  3IHU A;  3IPM O;  4IB4 A;  1T6Q A;  2XXA A;  2LK4 A;  2PX3 A;  1IW7 F;  2R7V A;  3CEX A;  1NU9 C;  1M2O A;  2VH3 A;  3SXK A;  2G3V A;  2XLV A;  2IM8 A;  3FHD A;  2A0U A;  2X51 A;  1ZU4 A;  2R03 A;  3ASN C;  5FZT A;  4OIQ F;  2DB4 A;  5AC5 A;  2HKV A;  1JOG A;  4BJ5 A;  4BJ1 A;  1WAT A;  2J9V A;  1IZM A;  2KJG A;  3GEI A;  4Z9I A;  4J30 B;  4JCH A;  3RQF A;  2DYS C;  4DRJ B;  3SNH A;  2VAS A;  1O3U A;  4G7O F;  2NSG A;  2YWA A;  2XXA B;  2NUT A;  4CS7 A;  2J9U A;  5L0C A;  5TJ5 E;  3UR3 C;  1C17 M;  3EQL F;  1ZW3 A;  3W8H A;  4EIY A;  4OIN F; 
#chains in the Genus database with same CATH homology
 2C03 A;  2EIL C;  3KMI A;  2XRH A;  3S27 A;  3FAJ A;  4J32 B;  4BJ6 A;  5EHH A;  3FVY A;  4KBL A;  4BJT A;  4C3D A;  3NRH A;  4F4B A;  3LS1 A;  5E3C A;  2BE5 F;  2D5R B;  1TR2 A;  3ZIB A;  2H7B A;  5IY5 C;  3QMK A;  5KYU A;  4CSA C;  4U5H A;  4O6M A;  3GOD A;  2MYS A;  3LNR A;  4AE4 A;  4LLC A;  3ABM C;  3E9V A;  3L34 A;  3RH3 A;  3EZH A;  4HFF B;  3TD7 A;  3X1O A;  3EHN A;  3AG1 C;  3ASO C;  5FCL A;  2YHS A;  2R7S A;  1PD1 A;  5DQT A;  4Q7C A;  2R7T A;  2H7O A;  5CI9 A;  2PP4 A;  3UMK A;  4BEJ A;  4ANJ A;  4AE4 B;  3LES A;  5BUO A;  2WZF A;  3CZ6 A;  2I8B A;  2CW0 F;  1D1B A;  4ZLC A;  2NG1 A;  3EGD A;  3F46 A;  2EIJ C;  4U5D E;  1S7Z A;  3DAF A;  4U5G A;  3EFO B;  2WZL A;  1LKX A;  2IXN A;  2IXM A;  3E70 C;  4JW1 A;  2DGJ A;  2HV6 A;  1O87 A;  2ZXW C;  3FDQ A;  3M1C B;  4P6I C;  5CI8 A;  1LVK A;  4DBR A;  3EGD B;  4CBE A;  5DQZ A;  1OKK A;  1MND A;  2CNW D;  2WB7 A;  2W4M A;  4XLP F;  1ST6 A;  3POV A;  1MMG A;  3Q6N A;  1NG1 A;  4CSA A;  1OCC C;  1PCX A;  2MWQ A;  4RDA A;  3VAY A;  3ZSU A;  4C7O B;  1M2V B;  1Z6A A;  2GFH A;  4HEA J;  3N24 A;  2ZXP A;  3QZC A;  3W2W A;  3IEE A;  1V55 C;  2LSE A;  4OIO F;  3NKE A;  2Q9A A;  1OCR C;  3S29 A;  1FMV A;  2CDQ A;  3OWT A;  4PJM A;  2Q9C A;  1ZHX A;  3DD7 A;  1N1C A;  2P7V A;  2C04 A;  4IJJ A;  4M63 A;  1TWA A;  4MND A;  4NY3 A;  4U5E E;  3O6X A;  2J7P A;  1RJ9 B;  3ZG1 A;  3I5Q A;  3EHM A;  4H4K C;  3T6B A;  2A68 F;  4E7S A;  5B1B C;  2W45 A;  4CS9 A;  2IXO A;  4GYT A;  5B3S C;  2EIN C;  4IRU A;  3AQC A;  3Q6M A;  4O7G A;  1BR4 A;  3ITF A;  4LER A;  4KNV A;  4YT8 A;  1D1A A;  1FTS A;  4WJ0 A;  1Z23 A;  1Z3I X;  1FFH A;  2R7X A;  3PMR A;  4I44 A;  2G3K A;  5T1D B;  1OCO C;  3B0U X;  5KYN A;  3AQB A;  5D91 A;  2W9Y A;  1ZHZ A;  3X2Q C;  2Y3B A;  1PD0 A;  2J9W A;  4ZLD A;  1TWC A;  3UMH A;  2NUT B;  2J46 A;  1VYK A;  5F5H A;  3SEO A;  2Y3G A;  3UNG C;  4OIP F;  3JCU Q;  5F5F A;  3DAG A;  3K6B A;  3RYL A;  5DS4 A;  4B6I A;  3UGO A;  3SP1 A;  4JZA A;  1ZHY A;  4K0D A;  3K7D A;  2R7U A;  3SYN A;  4PJL A;  3JT1 A;  4YT2 A;  2P6V A;  1LS1 A;  4U5F E;  5KYU B;  3B9Q A;  2ZXR A;  4KNW A;  3WOD F;  1J8Y F;  4CS8 C;  4OD4 A;  3AG2 C;  4OD5 A;  4Q5S F;  3NYL A;  3NYM A;  4YWQ A;  5DS6 A;  4DVY P;  1TWH A;  2YEV A;  3I5P A;  2OG2 A;  1OKK D;  2WVN A;  1VOM A;  2W4B A;  4OIR F;  1Z63 A;  1VK5 A;  2O9X A;  4YT4 A;  3H65 A;  1J8M F;  1MMA A;  4YJW A;  2A1D D;  4ULW A;  3LJB A;  3N2Z B;  3HLZ A;  4HFK B;  2ZXO A;  1M56 C;  5E2Q A;  4DBQ A;  4QI0 A;  2WZG A;  2NUP A;  2J0X A;  2CGE A;  3I4U A;  4DOZ A;  2ZPA A;  4X0R A;  1ZHW A;  1V54 C;  4PK4 A;  3JSZ A;  3RKO F;  4XLN F;  3LLI A;  2WVO A;  4BJ5 C;  4BG0 A;  3S28 A;  3W8I A;  5KYX A;  1SMY F;  4O6Y A;  3UMI A;  1TKN A;  4PFO A;  2A6H F;  2KQ9 A;  2NUP B;  4QDL A;  2R7Q A;  2IXP A;  2J7P D;  2PF4 E;  3KL4 A;  4E7Z A;  4BJ6 C;  3B0V C;  3K66 A;  3DZA A;  1D0X A;  2FGY A;  5KYX B;  2L9J A;  2G62 A;  2XSE A;  2Z15 A;  3CQZ A;  4O6N A;  2IYL D;  3MX3 A;  5HSW A;  2FFH A;  3LAY A;  1D1C A;  4FWV A;  4I3M A;  1VMA A;  5KYW A;  3EJN A;  1WGW A;  2J45 A;  2Y69 C;  2IOQ A;  1SF8 A;  4JJG A;  2KGO A;  4KC9 A;  4CIH A;  3O39 A;  2R7W A;  4YT5 A;  3W2V A;  2Y3H A;  1MMN A;  1W2W A;  2YZS A;  2EIM C;  3SZR A;  1KU2 A;  2OCC C;  4I1M A;  4JUR I;  5KYW B;  2EIK C;  2XL4 A;  3EZI A;  4PJJ A;  3AG3 C;  3RFY A;  1O5H A;  4C3E A;  3NDB B;  3EGX A;  3EPV A;  4QI2 A;  4XTK A;  3B0P A;  3RIP A;  3CSK A;  4JVS A;  4FX5 A;  3Q7G A;  3N0T A;  1ZU5 A;  3LS0 A;  4O79 A;  3ABK C;  1BR1 A;  1FFT C;  4JJF A;  3LLK A;  3GAN A;  5DLJ A;  4N06 A;  1FMW A;  4A2N B;  1NU7 D;  3EGX B;  3OEO A;  2M4E A;  5DVW A;  3K1I C;  4PJN A;  1TWG A;  3DJU B;  3DXJ F;  3KH2 A;  2J0W A;  1D0Y A;  2JD3 A;  2WVQ A;  4EWC A;  5KYY A;  3NG1 A;  3EH1 A;  4KI2 A;  2WL8 A;  3HJC A;  3JYH A;  4G0H A;  4G7H F;  4PFP A;  3T4R A;  4YN0 B;  3DJN B;  3Q7L A;  5EGY A;  4HE8 D;  3ECS A;  4C3B A;  4GEH A;  3EFO A;  4EBB A;  1NZE A;  4MQ9 F;  3ABL C;  4Q4Z F;  2L81 A;  1QZX A;  2B0J A;  5KYY B;  3NKD A;  2DYR C;  3T6J A;  2HV7 A;  1SZI A;  3UGP A;  2QY9 A;  1D0Z A;  1G8X A;  2H7V C;  1M57 C;  3AG4 C;  2Q9B A;  3DM9 B;  5L3Q A;  1MMD A;  3K1H A;  3K33 A;  4IAO A;  4LLE A;  5E33 A;  3V7O A;  4DVZ A;  2Y3D A;  3EG9 A;  1OCZ C;  3EH2 A;  4U5B E;  5D92 A;  4AX2 A;  3VYW A;  4CS9 C;  2R7R A;  4W8K A;  1Z5Z A;  3MLG A;  3LEV A;  2KNH A;  4RBN A;  1JPJ A;  2Q3T A;  5DS5 A;  5B1A C;  4C7O A;  3L0I A;  2A6E F;  4G7Z F;  1M2V A;  3JRT A;  3NYJ A;  5E3A A;  4U5C E;  2Y39 A;  3EG9 B;  1JPN A;  4I1O B;  4RD9 A;  2VB6 A;  1ZHT A;  2PX0 A;  4CS8 A;  1ZYR F;  5L3V A;  4LAC B;  3WG7 C;  4IWB A;  3OA1 A;  2CNW A;  2R7O A;  1BR2 A;  3DM5 A;  3ZVR A;  2A69 F;  1QLE C;  3KKB A;  3ZC4 A;  2V26 A;  1RJ9 A;  1VYI A;  3S0X A;  4FES A;  2KW3 C;  3F47 A;  3DMD A;  4XWJ A;  5T3W A;  3PHF 2;  4K7B A;  5T3T A;  1MNE A;  2PFD A;  2E87 A;  3HTK C;  4AK9 A;  2V3C C;  2XXA A;  2PX3 A;  1IW7 F;  2R7V A;  1NU9 C;  1M2O A;  2VH3 A;  2G3V A;  3FHD A;  2X51 A;  1ZU4 A;  3ASN C;  4OIQ F;  4BJ5 A;  4BJ1 A;  2J9V A;  1IZM A;  2KJG A;  4J30 B;  4JCH A;  2DYS C;  3SNH A;  2VAS A;  4G7O F;  2XXA B;  2NUT A;  4CS7 A;  2J9U A;  3UR3 C;  3EQL F;  3W8H A;  2QTV A;  4OIN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...