1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
molecule keywords METHEMERYTHRIN
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
2AWCA 2AVKA 1HMDA 1HMOA 3AGTA 1A7EA 1A7DA 4XQ1A 4XPWA 1I4ZA 1I4YA 3WAQA 4XPYA 3WHNA 2HMQA 3AGUA 4XPXA 2AWYA 2MHRA 2HMZA
chains in the Genus database with same CATH superfamily
1GQAA 4CS8A 3AGTA 3ZDLA 4I1MA 5A6KA 3RQFA 3Q7GA 1TFOB 2X51A 2LP4A 4L6RA 4BJ6A 1LS4A 2MYSA 2TMVP 4C3EA 4OIPF 3GM2A 2YL0A 1CGME 2A0UA 3O10A 4FAPB 3LNMB 4EHPA 2OOCA 4UDVA 2KW3C 3HNKA 3SP1A 3FXHA 3FOPA 5DS6A 3GODA 5L0CA 2R7UA 3S29A 3SXKA 4EIYA 3RFYA 3S90A 1RMVA 1ZU5A 4PR9A 5E33A 4BJTA 1RKEA 4OIQF 1QLEC 4NY3A 3C8GA 2B0JA 3GORA 1YA9A 4U9DA 2I8BA 3LS0A 2KC3A 1OR3A 3U3BA 1Z6AA 3EJNA 4C7OA 4YL0A 3U3FA 1MQVA 1OXKA 1MNEA 3I5QA 4YT2A 1VB5A 2BC5A 1C03A 1EQ1A 1BDJB 1T5OA 1L3PA 1LI7A 2C04A 4IWBA 4N6CA 2E87A 3CQZA 2KQ9A 4JIOA 3SXZA 2NUPB 1K40A 1OKKA 3NYJA 2ZXOA 3HTKC 1NG1A 3OA1A 4KC9A 4YK5A 5L0DA 4JE9A 3WODF 2ZPAA 1ORJA 1YARO 3TJ5A 2XXAA 2CGEA 1HW1A 4CSAC 1GM5A 2IXPA 4CDAA 3U8VA 2BE5F 2WZGA 2R7VA 2FGYA 3GEIA 3B0PA 2HZ8A 3K66A 2P1AA 5L0GA 3GWLA 2W9YA 3QW0A 4CDVA 2NSGA 4BEMJ 4ER9A 3K7DA 4JTAB 3B0VC 5L3VA 1LM3B 4U5EE 3TQOA 1D1CA 4LDRA 1OW8A 3VYWA 5GPGB 1E85A 3C8GD 2A6HF 2QUPA 3K1IC 4K0DA 5KYXA 3TJ6A 3M79A 3ASNC 4N06A 2HMZA 3GM1A 4O7GA 4MTGA 4NTAA 4KI2A 1GS9A 1A7DA 4P9TA 4MNDA 2YLIA 1JOGA 4QDLA 2H7BA 5F5HA 5HV9A 3L0IA 1XZPA 2L9JA 2A1DD 4IGGA 1Z3IX 4MTFA 4XLNF 1VLTA 3N2ZB 4BPMA 5BQHA 1YJGA 2XLHA 1KU2A 3C8GB 2J8WA 1M2OA 4HFFB 3B9QA 3T4RA 1FFTC 1HE1A 2XLWA 3SXYA 1HMDA 1XZQA 3HNJA 4JVSA 5KYYB 2IYLD 3BRJA 3US6A 2W4MA 2L81A 4U5BE 4YN0B 5JUAA 3ASOC 3GM3A 3VF0A 3FMSA 2YL3A 1D1AA 2CW0F 2J9VA 2ZXPA 5KYWA 4MW3A 1C02A 1NU9C 1RXQA 3DMDA 2AP3A 3WHNA 2H7OA 3Q6MA 2RSEB 4AE4A 2HSQA 5E3AA 4I3MA 5JVEA 3HNLA 3DI5A 1NLXA 2FFHA 2KJGA 2HKVA 1TFKB 5CI8A 1Z63A 4BEJA 3MYIA 3QVYA 1NFNA 4E7SA 3B29A 4G0HA 3S84A 1OXBA 2R9RB 1VK5A 1F1MA 3G4XA 1NSGB 1WOLA 1XWJA 4MTOA 4Z9IA 3LEVA 3ZWIA 5DLJA 2YWAA 2R7SA 4LLCA 1NZEA 1ZHTA 3Q6NA 4JCZA 2EILC 2NSFA 4CS9A 1YAUO 2OCCC 4XPXA 5K0IA 1MMNA 3VRCA 3LESA 4P6IC 4FESA 3Q7LA 1D0ZA 2L6FA 5COGA 4MW8A 1AVOB 3R7CA 2GAQA 4JEAA 1H7IA 5F5FA 1O87A 2R25A 3EPVA 4LERA 5IY5C 1JR8A 3JYHA 2Y3GA 3RH3A 2JPUA 4OIOF 1FTSA 1MMDA 1Y4CA 1TR2A 1ZHYA 4U5GA 1A7VA 1D0XA 1ZVZA 2A0BA 2J9WA 3LLKA 3U5SA 4K7BA 4D4XA 4XLPF 1GGQA 4YT8A 1N1CA 1H6GA 3O6XA 4MVOA 1TWAA 5CI9A 1H9GA 5EK0A 3SXMA 1ZHWA 4JJFA 5L3QA 1IW7F 1T01A 1I5NA 2LFDA 3LJBA 3K6BA 3QZCA 1HE9A 2IXNA 2EPNA 4IRUA 5JLIA 5DS5A 3NMJA 3TD7A 1Z23A 2XRHA 2DYRC 4HFKB 2NG1A 2XLDA 1SZIA 2XL4A 4NQFA 4JURI 3RW0A 1ZHZA 3FAJA 4P9FA 3T6BA 2CYDA 3O55A 3I4UA 3H2UA 5L0IA 5F28E 1UG7A 4AX2A 2WVQA 4AE4B 4YJWA 1J8YF 1E2XA 1Q0DA 4JC7A 3FVYA 1QKRA 1EI7A 1TQGA 4MVZA 1ZU4A 1QSPA 1E83A 1FR0A 5DS4A 3W8HA 5JRAA 3NMKA 1C17M 1CGOA 4JEBA 3L1MA 3EH1A 3M15A 3MX3A 4RD9A 2P0NA 3T6GB 1BZ4A 1EA8A 1FFHA 2BL2A 3EQLF 3U9JA 3V5ZA 3CSKA 2IM8A 1K05A 2HS5A 4OD5A 2L7AA 2NPUA 3HLZA 2KYHA 4DOZA 2I15A 3GANA 1HW2A 3U9MA 4C3BA 3G4ZA 1G5ZA 4N4WA 3T9OA 2DB4A 1ORSC 4XQ1A 3AQCA 3LNRA 1S05A 4N6HA 3PHF2 3NMIA 3V5XA 2PX3A 2DYSC 4WGYA 5EHHA 3RKOF 1K04A 2KK1A 2IXMA 4EKWA 2XM0A 4FWVA 5COMA 4ZLCA 4JRZA 3R2PA 3UMHA 1NFOA 4CS9C 4DRHB 3SZRA 1L7CA 1BR2A 1QQ3A 3NYMA 1VTMP 3PMRA 5JS5A 3T6JA 3L8JA 1KNYA 3IPMO 1R5ID 1U6HA 4E18A 2R7QA 4F4BA 1A0BA 2PBEA 4GQHA 4DRJB 4DVYP 3AOUA 5T3WA 3MBGA 5AC5A 3FHDA 2GA0A 1LI5A 1CPQA 3C18A 3HNIA 3M1CB 4PJJA 3J06A 4HEAJ 3M4CA 4NCQA 3WAQA 1YYJA 4Q5SF 3AG2C 1PV3A 2J9BA 4CX9A 2OJED 2H7VC 3CEXA 4GEHA 4JTDB 4PFOA 4CJOA 1ZZPA 3EHMA 4XEVA 1YZCA 4QI2A 4RBNA 4IARA 2Q3TA 2H8AA 1CPRA 2YLDA 3LAYA 3TK0A 1LE4A 4B6IA 4PJLA 4LACB 1Z7Qc 5DQTA 1ST6A 3ZC4A 2P61A 3IQTA 3LLIA 4PACA 4OD4A 3ZG1A 1NBBA 3VAYA 3UGOA 2Y39A 3X1OA 2IXOA 1ZYRF 3PCVA 2J45A 2R7WA 2XS8A 3EGDB 2ZXRA 5AC4A 2PNOA 3AG3C 1OCCC 3IQCA 3JTLO 3K1HA 3MFNA 1ZHXA 4BJ6C 3G50A 2QE9A 1MMGA 3SYNA 1RKCA 5A69A 2VCCA 2HV6A 5DVWA 2UUHA 4H54A 3ZTMA 4EBJA 3IEEA 3AGUA 2R02A 3IHUA 5JSLA 2OQMA 3EH2A 5FCLA 3EGXB 3ITFA 3QTHA 4EBBA 2ASRA 3TOLA 1H9TA 4DBQA 2CNWA 1DOWA 2J9UA 3W2VA 1UFBA 2XL8A 2NUPA 3B0UX 4WABA 2YL7A 3A9CA 3DE9A 2AU5A 4U5DE 2F22A 4I1OB 2EINC 3W2WA 1V74B 3TULA 2OEXA 3U2LA 1LIHA 4AL1A 2ETSA 1RJ9B 3RIPA 3GWNA 1BBHA 2Y3HA 1QPUA 2R03A 2ZD9A 2PP4A 2MHRA 3QVZA 1VOMA 1ORYA 2R7TA 1SMYF 4ZLDA 3JRTA 1T6IA 1T6QA 1DOVA 1TKNA 2J7PD 4PK4A 1TWCA 1T9KA 2O9XA 4CDYA 5KYWB 2EPMX 1G8XA 4G7ZF 4CSAA 1CGNA 1Q0GA 1WTYA 1YA7O 2OKUA 4OINF 1PCXA 4PJMA 2EIJC 4KBLA 2DGJA 1YZAA 2XS1A 4U5CE 2AWCA 2X0CA 5E2QA 3ZQVA 1D0YA 3W8IA 2CDQA 3LUTB 5KYYA 3U0CA 1Z5ZA 1V54C 3ABKC 3AJMA 1B68A 2EPOA 1PD1A 4O6NA 3ZTZA 2LK4A 4CBEA 3H2VA 4JTCB 1WASA 4MVRA 3ZVRA 1AEPA 3DE8A 2B0HA 4U5FE 4YL3A 2YL1A 3K1IA 3POVA 3O39A 2PF4E 1FNTc 2EIKC 4W8PA 3SNHA 3FAPB 1E84A 4DRIB 3KMIA 4LLEA 1Y6DA 2G3KA 4NTBA 2J0XA 5T3TA 3H65A 2HV7A 2L6GA 4M63A 5COFA 2YZSA 5L0HA 2AVKA 4JW1A 4EBKA 2EPLX 3I5PA 1IZMA 1APCA 1T6UA 2AWYA 1EKYA 3ZSUA 1M56C 2XM4A 1QZXA 2XL6A 4K1OA 2KGOA 5A6AA 3PDMP 3SEOA 3EFOA 4XPYA 1YYXA 2XXAB 4BJ1A 1PD0A 5B3SC 4DJ9A 1SR2A 2OG2A 2KSFA 3AQBA 2CNWD 4KNVA 1LS1A 4HE8D 3QW1A 3S9OA 2Y3DA 3L34A 5B3IA 5CIVA 2VC9A 2YVKA 4KNWA 4WGZA 3KYJA 3UR3C 3DJNB 5B1BC 5JT4A 4E0HA 1WWPA 2IOQA 4YL1A 5E3CA 5BQGA 2Z15A 1YLMA 3NRHA 3JRMO 4Z9HA 2WZFA 4J7YA 3HKKA 1YDIA 3EGXA 3OEOA 1QVXA 4JZAA 3ATPA 4MVUA 2P7VA 1HMOA 4JCHA 2LIGA 2XLOA 4CIPA 2LD6A 2XSEA 3LEOA 1LE2A 2VB6A 4ULVA 3EG9B 2EIMC 2GFHA 5EGYA 2Y69C 1AUEA 3MLGA 2OU6A 2R7OA 4WJ0A 3ZIBA 2EPKX 1U89A 5TJ5E 2VCAA 3N24A 1OKKD 3JSEO 3NYLA 3A11A 3BEHA 4U5HA 2NUTA 3U8PA 3CZ6A 4C7OB 4G7OF 4AK9A 4MS2A 1M6TA 2YHSA 1WGWA 5BUOA 2J7PA 2A69F 2XLMA 2ZXWC 2A6EF 3C63A 3JYYA 3RYLA 3UGPA 1HY5A 3MYFA 4D4NA 2HJMA 4CJGA 2V3CC 1M57C 4MVSA 1A41A 5KYNA 3IQ5A 3RQGA 5DQZA 3DXJF 4I44A 4E17A 2NUTB 4EWCA 3B71A 3DAGA 4W8KA 1NU7D 4A4AA 3C8ZA 3ABMC 3KL4A 1VMAA 4GYTA 4XWJA 3OWTA 3FDQA 1V55C 3E70C 1G4US 2IBFA 4DVZA 4RDAA 5BQIA 2GWWA 4G78A 1OCRC 3JSZA 2ICWG 2YRFA 1OW7A 2YLGA 4JJGA 2GDCA 5JP7A 3UNGC 2LSEA 4OIRF 2Q7RA 2R7XA 4E0IA 1A7EA 2VCBA 5HSWA 1OW6A 2PX0A 2W4BA 5T1DB 1JPNA 5FZTA 4AL0A 3EZHA 3W4YA 4PJNA 4BJ5A 4Q7CA 1BR1A 1I4YA 2JX0A 3HJCA 3DAFA 4X0RA 5A6BA 3DZAA 1R4TA 2HJ3A 3LS1A 2LCHA 2V26A 1KTMA 2PFDA 3ABLC 1OQCA 3M4BA 5D91A 1TWHA 2FAPB 3EG9A 3RVYA 4EUKB 1ZW3A 2M4EA 1Q0FA 2D5RB 4CIHA 4LDKA 1BR4A 4XPWA 3UMIA 5KYUB 3JCUQ 4PFPA 4IAOA 3S27A 4XEKA 3DKAA 2QNLA 3U2MA 1OCOC 1FMVA 3AG1C 4Q4ZF 3GEHA 2L6HA 2JD3A 4CS8C 2Q9BA 1ZW2A 3V5YA 4J32B 3WG7C 4XTKA 4Z9JA 2Q4FA 2VASA 4DXWA 5KYXB 3C62A 2G3VA 2WL8A 4BJ5C 2W45A 2Y3BA 4IB4A 3F47A 4MQ9F 5KYUA 3CAXA 2LFFA 1S7ZA 2OJQA 1JPJA 1JAFA 1SYQA 1M2VA 2DI3A 2MWQA 2QTVA 1M2VB 3JZ0A 3KPHA 3KYIA 2HUJA 3NKDA 3V7OA 3KH2A 4LDQA 1W2WA 1J8MF 2OEVA 2WVNA 1RKEB 3JT1A 2LQGA 4ULWA 1RJ9A 5A6BD 1RCPA 5B1AC 1FMWA 2XLEA 1MMAA 1G4WR 2D4UA 3X2QC 1JRAA 4G7HF 1WN0A 1JMWA 1O5HA 3IQ6A 3TOMA 4C3DA 3RQEA 2VH3A 4YWQA 1VLSA 1YVIA 3FOOA 3DM5A 4O79A 1TWGA 3QMKA 2R7RA 1V4AA 4IAQA 3EZIA 5AGFA 4BG0A 2YQYA 4R32A 3NDBB 4DBRA 3ECSA 1LPEA 1FAPB 5L0JA 2HSBA 2XLVA 4A2NB 4O6MA 1D1BA 2QLAA 256BA 2C03A 3DWWA 3L8IA 2A68F 3NG1A 2HMQA 4ONSA 1O3UA 5D92A 4ANJA 4QI0A 2P6VA 3E9VA 4O6YA 3F46A 2HFIA 2Q9AA 2Q00A 2RD9A 1I4ZA 3N0TA 1SF8A 2R05A 1LKXA 2M64A 2CCYA 2YEVA 3DJUB 3K33A 4YT5A 4YT4A 1OCZC 3GEEA 4MVQA 2YKZA 4JKVA 3C7JA 2QY9A 4J7TA 3EFOB 4MVMA 3NKEA 2WB7A 3S0XA 2J46A 2UUIA 3RVZA 1Q0MA 4CS7A 2WZLA 1VYKA 5A6JA 4IJJA 4XEFA 1U0BB 3DM9B 4U9EA 3ZQYA 1E86A 2G62A 2J0WA 2WVOA 3EGDA 1OR2A 4H4KC 2KNHA 3DD7A 4NC3A 2Q9CA 3S28A 3UMKA 1Q0KA 1LVKA 4J30B 1VYIA 4NTFA 5L0FA 4E7ZA 3KKBA 4FX5A 3EHNA 1WATA 3AG4C 3RF3A 1MNDA 3VM6A
chains in the Genus database with same CATH topology
2AWCA 2AVKA 1HMDA 1HMOA 3AGTA 1A7EA 1A7DA 4XQ1A 4XPWA 1I4ZA 1I4YA 3WAQA 4XPYA 3WHNA 2HMQA 3AGUA 4XPXA 2AWYA 2MHRA 2HMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWC A;  2AVK A;  1HMD A;  1HMO A;  3AGT A;  1A7E A;  1A7D A;  4XQ1 A;  4XPW A;  1I4Z A;  1I4Y A;  3WAQ A;  4XPY A;  3WHN A;  2HMQ A;  3AGU A;  4XPX A;  2AWY A;  2MHR A;  2HMZ A; 
#chains in the Genus database with same CATH topology
 1GQA A;  4CS8 A;  3AGT A;  3ZDL A;  4I1M A;  5A6K A;  3RQF A;  3Q7G A;  1TFO B;  2X51 A;  2LP4 A;  4L6R A;  4BJ6 A;  1LS4 A;  2MYS A;  2TMV P;  4C3E A;  4OIP F;  3GM2 A;  2YL0 A;  1CGM E;  2A0U A;  3O10 A;  4FAP B;  3LNM B;  4EHP A;  2OOC A;  4UDV A;  2KW3 C;  3HNK A;  3SP1 A;  3FXH A;  3FOP A;  5DS6 A;  3GOD A;  5L0C A;  2R7U A;  3S29 A;  3SXK A;  4EIY A;  3RFY A;  3S90 A;  1RMV A;  1ZU5 A;  4PR9 A;  5E33 A;  4BJT A;  1RKE A;  4OIQ F;  1QLE C;  4NY3 A;  3C8G A;  2B0J A;  3GOR A;  1YA9 A;  4U9D A;  2I8B A;  3LS0 A;  2KC3 A;  1OR3 A;  3U3B A;  1Z6A A;  3EJN A;  4C7O A;  4YL0 A;  3U3F A;  1MQV A;  1OXK A;  1MNE A;  3I5Q A;  4YT2 A;  1VB5 A;  2BC5 A;  1C03 A;  1EQ1 A;  1BDJ B;  1T5O A;  1L3P A;  1LI7 A;  2C04 A;  4IWB A;  4N6C A;  2E87 A;  3CQZ A;  2KQ9 A;  4JIO A;  3SXZ A;  2NUP B;  1K40 A;  1OKK A;  3NYJ A;  2ZXO A;  3HTK C;  1NG1 A;  3OA1 A;  4KC9 A;  4YK5 A;  5L0D A;  4JE9 A;  3WOD F;  2ZPA A;  1ORJ A;  1YAR O;  3TJ5 A;  2XXA A;  2CGE A;  1HW1 A;  4CSA C;  1GM5 A;  2IXP A;  4CDA A;  3U8V A;  2BE5 F;  2WZG A;  2R7V A;  2FGY A;  3GEI A;  3B0P A;  2HZ8 A;  3K66 A;  2P1A A;  5L0G A;  3GWL A;  2W9Y A;  3QW0 A;  4CDV A;  2NSG A;  4BEM J;  4ER9 A;  3K7D A;  4JTA B;  3B0V C;  5L3V A;  1LM3 B;  4U5E E;  3TQO A;  1D1C A;  4LDR A;  1OW8 A;  3VYW A;  5GPG B;  1E85 A;  3C8G D;  2A6H F;  2QUP A;  3K1I C;  4K0D A;  5KYX A;  3TJ6 A;  3M79 A;  3ASN C;  4N06 A;  2HMZ A;  3GM1 A;  4O7G A;  4MTG A;  4NTA A;  4KI2 A;  1GS9 A;  1A7D A;  4P9T A;  4MND A;  2YLI A;  1JOG A;  4QDL A;  2H7B A;  5F5H A;  5HV9 A;  3L0I A;  1XZP A;  2L9J A;  2A1D D;  4IGG A;  1Z3I X;  4MTF A;  4XLN F;  1VLT A;  3N2Z B;  4BPM A;  5BQH A;  1YJG A;  2XLH A;  1KU2 A;  3C8G B;  2J8W A;  1M2O A;  4HFF B;  3B9Q A;  3T4R A;  1FFT C;  1HE1 A;  2XLW A;  3SXY A;  1HMD A;  1XZQ A;  3HNJ A;  4JVS A;  5KYY B;  2IYL D;  3BRJ A;  3US6 A;  2W4M A;  2L81 A;  4U5B E;  4YN0 B;  5JUA A;  3ASO C;  3GM3 A;  3VF0 A;  3FMS A;  2YL3 A;  1D1A A;  2CW0 F;  2J9V A;  2ZXP A;  5KYW A;  4MW3 A;  1C02 A;  1NU9 C;  1RXQ A;  3DMD A;  2AP3 A;  3WHN A;  2H7O A;  3Q6M A;  2RSE B;  4AE4 A;  2HSQ A;  5E3A A;  4I3M A;  5JVE A;  3HNL A;  3DI5 A;  1NLX A;  2FFH A;  2KJG A;  2HKV A;  1TFK B;  5CI8 A;  1Z63 A;  4BEJ A;  3MYI A;  3QVY A;  1NFN A;  4E7S A;  3B29 A;  4G0H A;  3S84 A;  1OXB A;  2R9R B;  1VK5 A;  1F1M A;  3G4X A;  1NSG B;  1WOL A;  1XWJ A;  4MTO A;  4Z9I A;  3LEV A;  3ZWI A;  5DLJ A;  2YWA A;  2R7S A;  4LLC A;  1NZE A;  1ZHT A;  3Q6N A;  4JCZ A;  2EIL C;  2NSF A;  4CS9 A;  1YAU O;  2OCC C;  4XPX A;  5K0I A;  1MMN A;  3VRC A;  3LES A;  4P6I C;  4FES A;  3Q7L A;  1D0Z A;  2L6F A;  5COG A;  4MW8 A;  1AVO B;  3R7C A;  2GAQ A;  4JEA A;  1H7I A;  5F5F A;  1O87 A;  2R25 A;  3EPV A;  4LER A;  5IY5 C;  1JR8 A;  3JYH A;  2Y3G A;  3RH3 A;  2JPU A;  4OIO F;  1FTS A;  1MMD A;  1Y4C A;  1TR2 A;  1ZHY A;  4U5G A;  1A7V A;  1D0X A;  1ZVZ A;  2A0B A;  2J9W A;  3LLK A;  3U5S A;  4K7B A;  4D4X A;  4XLP F;  1GGQ A;  4YT8 A;  1N1C A;  1H6G A;  3O6X A;  4MVO A;  1TWA A;  5CI9 A;  1H9G A;  5EK0 A;  3SXM A;  1ZHW A;  4JJF A;  5L3Q A;  1IW7 F;  1T01 A;  1I5N A;  2LFD A;  3LJB A;  3K6B A;  3QZC A;  1HE9 A;  2IXN A;  2EPN A;  4IRU A;  5JLI A;  5DS5 A;  3NMJ A;  3TD7 A;  1Z23 A;  2XRH A;  2DYR C;  4HFK B;  2NG1 A;  2XLD A;  1SZI A;  2XL4 A;  4NQF A;  4JUR I;  3RW0 A;  1ZHZ A;  3FAJ A;  4P9F A;  3T6B A;  2CYD A;  3O55 A;  3I4U A;  3H2U A;  5L0I A;  5F28 E;  1UG7 A;  4AX2 A;  2WVQ A;  4AE4 B;  4YJW A;  1J8Y F;  1E2X A;  1Q0D A;  4JC7 A;  3FVY A;  1QKR A;  1EI7 A;  1TQG A;  4MVZ A;  1ZU4 A;  1QSP A;  1E83 A;  1FR0 A;  5DS4 A;  3W8H A;  5JRA A;  3NMK A;  1C17 M;  1CGO A;  4JEB A;  3L1M A;  3EH1 A;  3M15 A;  3MX3 A;  4RD9 A;  2P0N A;  3T6G B;  1BZ4 A;  1EA8 A;  1FFH A;  2BL2 A;  3EQL F;  3U9J A;  3V5Z A;  3CSK A;  2IM8 A;  1K05 A;  2HS5 A;  4OD5 A;  2L7A A;  2NPU A;  3HLZ A;  2KYH A;  4DOZ A;  2I15 A;  3GAN A;  1HW2 A;  3U9M A;  4C3B A;  3G4Z A;  1G5Z A;  4N4W A;  3T9O A;  2DB4 A;  1ORS C;  4XQ1 A;  3AQC A;  3LNR A;  1S05 A;  4N6H A;  3PHF 2;  3NMI A;  3V5X A;  2PX3 A;  2DYS C;  4WGY A;  5EHH A;  3RKO F;  1K04 A;  2KK1 A;  2IXM A;  4EKW A;  2XM0 A;  4FWV A;  5COM A;  4ZLC A;  4JRZ A;  3R2P A;  3UMH A;  1NFO A;  4CS9 C;  4DRH B;  3SZR A;  1L7C A;  1BR2 A;  1QQ3 A;  3NYM A;  1VTM P;  3PMR A;  5JS5 A;  3T6J A;  3L8J A;  1KNY A;  3IPM O;  1R5I D;  1U6H A;  4E18 A;  2R7Q A;  4F4B A;  1A0B A;  2PBE A;  4GQH A;  4DRJ B;  4DVY P;  3AOU A;  5T3W A;  3MBG A;  5AC5 A;  3FHD A;  2GA0 A;  1LI5 A;  1CPQ A;  3C18 A;  3HNI A;  3M1C B;  4PJJ A;  3J06 A;  4HEA J;  3M4C A;  4NCQ A;  3WAQ A;  1YYJ A;  4Q5S F;  3AG2 C;  1PV3 A;  2J9B A;  4CX9 A;  2OJE D;  2H7V C;  3CEX A;  4GEH A;  4JTD B;  4PFO A;  4CJO A;  1ZZP A;  3EHM A;  4XEV A;  1YZC A;  4QI2 A;  4RBN A;  4IAR A;  2Q3T A;  2H8A A;  1CPR A;  2YLD A;  3LAY A;  3TK0 A;  1LE4 A;  4B6I A;  4PJL A;  4LAC B;  1Z7Q c;  5DQT A;  1ST6 A;  3ZC4 A;  2P61 A;  3IQT A;  3LLI A;  4PAC A;  4OD4 A;  3ZG1 A;  1NBB A;  3VAY A;  3UGO A;  2Y39 A;  3X1O A;  2IXO A;  1ZYR F;  3PCV A;  2J45 A;  2R7W A;  2XS8 A;  3EGD B;  2ZXR A;  5AC4 A;  2PNO A;  3AG3 C;  1OCC C;  3IQC A;  3JTL O;  3K1H A;  3MFN A;  1ZHX A;  4BJ6 C;  3G50 A;  2QE9 A;  1MMG A;  3SYN A;  1RKC A;  5A69 A;  2VCC A;  2HV6 A;  5DVW A;  2UUH A;  4H54 A;  3ZTM A;  4EBJ A;  3IEE A;  3AGU A;  2R02 A;  3IHU A;  5JSL A;  2OQM A;  3EH2 A;  5FCL A;  3EGX B;  3ITF A;  3QTH A;  4EBB A;  2ASR A;  3TOL A;  1H9T A;  4DBQ A;  2CNW A;  1DOW A;  2J9U A;  3W2V A;  1UFB A;  2XL8 A;  2NUP A;  3B0U X;  4WAB A;  2YL7 A;  3A9C A;  3DE9 A;  2AU5 A;  4U5D E;  2F22 A;  4I1O B;  2EIN C;  3W2W A;  1V74 B;  3TUL A;  2OEX A;  3U2L A;  1LIH A;  4AL1 A;  2ETS A;  1RJ9 B;  3RIP A;  3GWN A;  1BBH A;  2Y3H A;  1QPU A;  2R03 A;  2ZD9 A;  2PP4 A;  2MHR A;  3QVZ A;  1VOM A;  1ORY A;  2R7T A;  1SMY F;  4ZLD A;  3JRT A;  1T6I A;  1T6Q A;  1DOV A;  1TKN A;  2J7P D;  4PK4 A;  1TWC A;  1T9K A;  2O9X A;  4CDY A;  5KYW B;  2EPM X;  1G8X A;  4G7Z F;  4CSA A;  1CGN A;  1Q0G A;  1WTY A;  1YA7 O;  2OKU A;  4OIN F;  1PCX A;  4PJM A;  2EIJ C;  4KBL A;  2DGJ A;  1YZA A;  2XS1 A;  4U5C E;  2AWC A;  2X0C A;  5E2Q A;  3ZQV A;  1D0Y A;  3W8I A;  2CDQ A;  3LUT B;  5KYY A;  3U0C A;  1Z5Z A;  1V54 C;  3ABK C;  3AJM A;  1B68 A;  2EPO A;  1PD1 A;  4O6N A;  3ZTZ A;  2LK4 A;  4CBE A;  3H2V A;  4JTC B;  1WAS A;  4MVR A;  3ZVR A;  1AEP A;  3DE8 A;  2B0H A;  4U5F E;  4YL3 A;  2YL1 A;  3K1I A;  3POV A;  3O39 A;  2PF4 E;  1FNT c;  2EIK C;  4W8P A;  3SNH A;  3FAP B;  1E84 A;  4DRI B;  3KMI A;  4LLE A;  1Y6D A;  2G3K A;  4NTB A;  2J0X A;  5T3T A;  3H65 A;  2HV7 A;  2L6G A;  4M63 A;  5COF A;  2YZS A;  5L0H A;  2AVK A;  4JW1 A;  4EBK A;  2EPL X;  3I5P A;  1IZM A;  1APC A;  1T6U A;  2AWY A;  1EKY A;  3ZSU A;  1M56 C;  2XM4 A;  1QZX A;  2XL6 A;  4K1O A;  2KGO A;  5A6A A;  3PDM P;  3SEO A;  3EFO A;  4XPY A;  1YYX A;  2XXA B;  4BJ1 A;  1PD0 A;  5B3S C;  4DJ9 A;  1SR2 A;  2OG2 A;  2KSF A;  3AQB A;  2CNW D;  4KNV A;  1LS1 A;  4HE8 D;  3QW1 A;  3S9O A;  2Y3D A;  3L34 A;  5B3I A;  5CIV A;  2VC9 A;  2YVK A;  4KNW A;  4WGZ A;  3KYJ A;  3UR3 C;  3DJN B;  5B1B C;  5JT4 A;  4E0H A;  1WWP A;  2IOQ A;  4YL1 A;  5E3C A;  5BQG A;  2Z15 A;  1YLM A;  3NRH A;  3JRM O;  4Z9H A;  2WZF A;  4J7Y A;  3HKK A;  1YDI A;  3EGX A;  3OEO A;  1QVX A;  4JZA A;  3ATP A;  4MVU A;  2P7V A;  1HMO A;  4JCH A;  2LIG A;  2XLO A;  4CIP A;  2LD6 A;  2XSE A;  3LEO A;  1LE2 A;  2VB6 A;  4ULV A;  3EG9 B;  2EIM C;  2GFH A;  5EGY A;  2Y69 C;  1AUE A;  3MLG A;  2OU6 A;  2R7O A;  4WJ0 A;  3ZIB A;  2EPK X;  1U89 A;  5TJ5 E;  2VCA A;  3N24 A;  1OKK D;  3JSE O;  3NYL A;  3A11 A;  3BEH A;  4U5H A;  2NUT A;  3U8P A;  3CZ6 A;  4C7O B;  4G7O F;  4AK9 A;  4MS2 A;  1M6T A;  2YHS A;  1WGW A;  5BUO A;  2J7P A;  2A69 F;  2XLM A;  2ZXW C;  2A6E F;  3C63 A;  3JYY A;  3RYL A;  3UGP A;  1HY5 A;  3MYF A;  4D4N A;  2HJM A;  4CJG A;  2V3C C;  1M57 C;  4MVS A;  1A41 A;  5KYN A;  3IQ5 A;  3RQG A;  5DQZ A;  3DXJ F;  4I44 A;  4E17 A;  2NUT B;  4EWC A;  3B71 A;  3DAG A;  4W8K A;  1NU7 D;  4A4A A;  3C8Z A;  3ABM C;  3KL4 A;  1VMA A;  4GYT A;  4XWJ A;  3OWT A;  3FDQ A;  1V55 C;  3E70 C;  1G4U S;  2IBF A;  4DVZ A;  4RDA A;  5BQI A;  2GWW A;  4G78 A;  1OCR C;  3JSZ A;  2ICW G;  2YRF A;  1OW7 A;  2YLG A;  4JJG A;  2GDC A;  5JP7 A;  3UNG C;  2LSE A;  4OIR F;  2Q7R A;  2R7X A;  4E0I A;  1A7E A;  2VCB A;  5HSW A;  1OW6 A;  2PX0 A;  2W4B A;  5T1D B;  1JPN A;  5FZT A;  4AL0 A;  3EZH A;  3W4Y A;  4PJN A;  4BJ5 A;  4Q7C A;  1BR1 A;  1I4Y A;  2JX0 A;  3HJC A;  3DAF A;  4X0R A;  5A6B A;  3DZA A;  1R4T A;  2HJ3 A;  3LS1 A;  2LCH A;  2V26 A;  1KTM A;  2PFD A;  3ABL C;  1OQC A;  3M4B A;  5D91 A;  1TWH A;  2FAP B;  3EG9 A;  3RVY A;  4EUK B;  1ZW3 A;  2M4E A;  1Q0F A;  2D5R B;  4CIH A;  4LDK A;  1BR4 A;  4XPW A;  3UMI A;  5KYU B;  3JCU Q;  4PFP A;  4IAO A;  3S27 A;  4XEK A;  3DKA A;  2QNL A;  3U2M A;  1OCO C;  1FMV A;  3AG1 C;  4Q4Z F;  3GEH A;  2L6H A;  2JD3 A;  4CS8 C;  2Q9B A;  1ZW2 A;  3V5Y A;  4J32 B;  3WG7 C;  4XTK A;  4Z9J A;  2Q4F A;  2VAS A;  4DXW A;  5KYX B;  3C62 A;  2G3V A;  2WL8 A;  4BJ5 C;  2W45 A;  2Y3B A;  4IB4 A;  3F47 A;  4MQ9 F;  5KYU A;  3CAX A;  2LFF A;  1S7Z A;  2OJQ A;  1JPJ A;  1JAF A;  1SYQ A;  1M2V A;  2DI3 A;  2MWQ A;  2QTV A;  1M2V B;  3JZ0 A;  3KPH A;  3KYI A;  2HUJ A;  3NKD A;  3V7O A;  3KH2 A;  4LDQ A;  1W2W A;  1J8M F;  2OEV A;  2WVN A;  1RKE B;  3JT1 A;  2LQG A;  4ULW A;  1RJ9 A;  5A6B D;  1RCP A;  5B1A C;  1FMW A;  2XLE A;  1MMA A;  1G4W R;  2D4U A;  3X2Q C;  1JRA A;  4G7H F;  1WN0 A;  1JMW A;  1O5H A;  3IQ6 A;  3TOM A;  4C3D A;  3RQE A;  2VH3 A;  4YWQ A;  1VLS A;  1YVI A;  3FOO A;  3DM5 A;  4O79 A;  1TWG A;  3QMK A;  2R7R A;  1V4A A;  4IAQ A;  3EZI A;  5AGF A;  4BG0 A;  2YQY A;  4R32 A;  3NDB B;  4DBR A;  3ECS A;  1LPE A;  1FAP B;  5L0J A;  2HSB A;  2XLV A;  4A2N B;  4O6M A;  1D1B A;  2QLA A;  256B A;  2C03 A;  3DWW A;  3L8I A;  2A68 F;  3NG1 A;  2HMQ A;  4ONS A;  1O3U A;  5D92 A;  4ANJ A;  4QI0 A;  2P6V A;  3E9V A;  4O6Y A;  3F46 A;  2HFI A;  2Q9A A;  2Q00 A;  2RD9 A;  1I4Z A;  3N0T A;  1SF8 A;  2R05 A;  1LKX A;  2M64 A;  2CCY A;  2YEV A;  3DJU B;  3K33 A;  4YT5 A;  4YT4 A;  1OCZ C;  3GEE A;  4MVQ A;  2YKZ A;  4JKV A;  3C7J A;  2QY9 A;  4J7T A;  3EFO B;  4MVM A;  3NKE A;  2WB7 A;  3S0X A;  2J46 A;  2UUI A;  3RVZ A;  1Q0M A;  4CS7 A;  2WZL A;  1VYK A;  5A6J A;  4IJJ A;  4XEF A;  1U0B B;  3DM9 B;  4U9E A;  3ZQY A;  1E86 A;  2G62 A;  2J0W A;  2WVO A;  3EGD A;  1OR2 A;  4H4K C;  2KNH A;  3DD7 A;  4NC3 A;  2Q9C A;  3S28 A;  3UMK A;  1Q0K A;  1LVK A;  4J30 B;  1VYI A;  4NTF A;  5L0F A;  4E7Z A;  3KKB A;  4FX5 A;  3EHN A;  1WAT A;  3AG4 C;  3RF3 A;  1MND A;  3VM6 A; 
#chains in the Genus database with same CATH homology
 2AWC A;  2AVK A;  1HMD A;  1HMO A;  3AGT A;  1A7E A;  1A7D A;  4XQ1 A;  4XPW A;  1I4Z A;  1I4Y A;  3WAQ A;  4XPY A;  3WHN A;  2HMQ A;  3AGU A;  4XPX A;  2AWY A;  2MHR A;  2HMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...