1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
b'GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHEMERYTHRIN
molecule tags Oxygen storage/transport
source organism Phascolopsis gouldii
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
4XPWA 1HMDA 4XPXA 2AWCA 3WHNA 2HMZA 2AWYA 1A7EA 1I4YA 2AVKA 2MHRA 3AGTA 1HMOA 3AGUA 3WAQA 4XPYA 1A7DA 4XQ1A 1I4ZA 2HMQA
chains in the Genus database with same CATH superfamily
1BR2A 2OG2A 1MMGA 2W4MA 4JJFA 2KNHA 3NMJA 3EZIA 1ORYA 1G4US 5DQTA 3AJMA 2KSFA 4BG0A 3RQEA 5KYYB 1QQ3A 2KQ9A 3NMKA 4JJGA 4O6YA 3NDBB 2L9JA 5AC4A 2YLIA 4Q4ZF 1YA9A 2A0BA 4IB4A 2AU5A 3HJCA 5COFA 4YK5A 1GM5A 1JPJA 1M2VA 1WASA 1LI7A 2XLMA 1APCA 3AQBA 3SXZA 3UMKA 2Y69C 3F46A 4J7TA 4YJWA 1QZXA 2PX0A 1LI5A 4YL0A 4J32B 3SXYA 1T6QA 2BC5A 4O7GA 5CIVA 3ZG1A 2CCYA 1O87A 4KBLA 4BJ6C 4C3EA 2XS8A 3SNHA 1U89A 4JEAA 4K0DA 1SF8A 4QI0A 2XLDA 2R7WA 5T3TA 2G3KA 1E84A 4FAPB 3B0VC 1PD1A 2DYSC 3H2VA 3K33A 1RCPA 4IARA 3UNGC 3GORA 4Q5SF 1IW7F 4LDRA 1J8MF 5FCLA 2DI3A 4FX5A 1NU7D 2C04A 3HLZA 4MTOA 3LS0A 3SP1A 2NG1A 4U5EE 3LAYA 1Y4CA 2AWCA 1GGQA 2L7AA 2PX3A 1RJ9B 4G7HF 1FR0A 5BUOA 3FOOA 3K1IA 4U5BE 4I44A 3GODA 4LACB 4YN0B 2VASA 4HFFB 4XEVA 2QLAA 1OCRC 2R7OA 2YEVA 2J7PA 4X0RA 4RBNA 5K0IA 1WN0A 2IM8A 3JTLO 2XXAA 2PFDA 1G5ZA 2HZ8A 2HMZA 2IXNA 2J0WA 1D1AA 4KNVA 3ZQYA 2NUPB 3U3BA 1OCCC 1HE1A 3AG2C 4YL1A 3I4UA 1T6IA 3K6BA 5IY5C 4NY3A 1O5HA 4MTGA 4D4NA 3RQFA 3S28A 2ZPAA 3DJNB 3M4CA 3V5ZA 4E7ZA 1D0YA 2IYLD 3DAGA 4LDKA 1Z63A 3W8IA 1BR1A 2EPNA 3Q7LA 3DD7A 3GM3A 3I5QA 2HV6A 4ER9A 1D1CA 3UMIA 1OKKD 2A1DD 3BEHA 4JE9A 3DXJF 3IQCA 1MNEA 2XS1A 1MNDA 3NYMA 3TQOA 3U0CA 1NLXA 2ZXOA 2EINC 3VF0A 3ZVRA 3AOUA 1VYIA 1J8YF 1YJGA 3KYIA 4CBEA 2R05A 5TJ5E 4I1OB 3EZHA 1ZYRF 2NSFA 5A6KA 5L0IA 2WZLA 3QZCA 4ULWA 1TFKB 3NRHA 3CAXA 4DXWA 1RKEA 2GDCA 2WVQA 4XTKA 2P0NA 2W4BA 2CDQA 2XSEA 3PMRA 2LK4A 1ST6A 4BJ5C 2LFDA 4U9DA 4U5GA 1ZW2A 5CI9A 3RH3A 1V54C 2A6EF 3GM1A 4MVMA 2Y39A 3CZ6A 3UGOA 3EQLF 5D92A 1BR4A 1QLEC 2CYDA 4N6CA 4IWBA 3RQGA 2DGJA 3ZTMA 3B0PA 3DE8A 4NQFA 3V5YA 2XRHA 5KYUB 5L0FA 1T5OA 2J46A 5KYUA 4JTCB 2AVKA 3AGTA 5T1DB 5JT4A 5JUAA 3TULA 1OW6A 1T6UA 3AGUA 1OXKA 4EHPA 3O10A 2CGEA 3ABKC 4GEHA 2EIMC 1Z3IX 1LIHA 2HFIA 2OCCC 5B1AC 2GAQA 2XL4A 4U9EA 3VAYA 5COGA 1JPNA 3B9QA 1OW8A 3C8GA 4PJJA 3RF3A 1RKEB 1W2WA 3ZTZA 4JTDB 2H7VC 1QVXA 1ZU4A 3IPMO 4D4XA 2IXPA 3LNRA 4WGZA 4CS7A 4Q7CA 1NSGB 4AL0A 1YAUO 2TMVP 1MMDA 4CS9A 2Y3GA 3TJ5A 2LSEA 4EBBA 4EIYA 1CPRA 4YWQA 1KU2A 3L8JA 2D4UA 3S0XA 4G7OF 1ZHZA 4M63A 3R2PA 1G8XA 1PV3A 2OEVA 3GEIA 3LESA 2R7XA 2RD9A 4ZLCA 2QY9A 2VCBA 4ANJA 2R02A 3ZC4A 2J9UA 3IQTA 4XPYA 2Q7RA 4CS8A 3GWLA 3N24A 3EGDA 2LIGA 3EGDB 4F4BA 1WATA 4H54A 3DE9A 2J45A 3VYWA 2O9XA 1OR3A 2IOQA 3M15A 3EH2A 3U9JA 1OW7A 3V5XA 4DRJB 2QTVA 3EFOB 5HV9A 1HW1A 1I5NA 4BEMJ 4XQ1A 4YT5A 3F47A 3T6BA 3RVYA 4PACA 1ZHWA 5FZTA 3SXKA 4J30B 1NU9C 2ZXWC 4O79A 4KC9A 3O39A 2V3CC 4KI2A 3L34A 1SR2A 2NUTB 2NSGA 1G4WR 3E70C 4IRUA 4OIQF 2Q9AA 2FGYA 1O3UA 4RDAA 3SYNA 3A11A 1MMAA 2XM0A 2L6HA 3JRMO 2Y3DA 3C8GB 2MYSA 1SMYF 2JPUA 3U3FA 3MBGA 3PCVA 1JMWA 1VLTA 2EPOA 3EGXB 4NTFA 2GA0A 4EBKA 1QKRA 4BEJA 2J0XA 2H7BA 1OKKA 1HY5A 2DB4A 3B71A 1KNYA 2QUPA 4MVUA 2X0CA 3EHMA 3S27A 3ZWIA 5EK0A 2M64A 5JP7A 1EKYA 5E3AA 4CDVA 1EA8A 2Y3BA 1OR2A 3EPVA 4CDYA 2OOCA 4PJLA 5E33A 4A4AA 1QPUA 1WOLA 1Q0FA 1TKNA 3X1OA 3C8ZA 2ZXRA 4HFKB 1D1BA 2XXAB 3M79A 3NYLA 5L0GA 5DS5A 3HKKA 1JOGA 5DS6A 3EJNA 1E2XA 2OKUA 2EPMX 2EILC 2A68F 2YZSA 2LFFA 1M2OA 1YA7O 5JS5A 5KYWA 3T4RA 5KYYA 1A7DA 1WWPA 1VYKA 4OIOF 4CJOA 3POVA 4U5CE 3JRTA 4PK4A 3ABLC 1Y6DA 3G4ZA 1M57C 3LS1A 4JIOA 2WVNA 4RD9A 4AK9A 3LEVA 1C03A 2KK1A 4QDLA 4XEFA 5F28E 3WG7C 2EPLX 4YL3A 4K1OA 1NFNA 2OJQA 1DOWA 1FFHA 3C7JA 1L3PA 1RJ9A 3JCUQ 1TFOB 3NYJA 3NKDA 4MW3A 3DM9B 4U5DE 4PR9A 3DAFA 4YT2A 3U9MA 2EPKX 3JSZA 3KYJA 1VOMA 3L1MA 4PFOA 3T6JA 1QSPA 3QW0A 1S7ZA 3CEXA 3ZIBA 3O6XA 3K66A 3W8HA 1PCXA 1AUEA 2HSBA 1WGWA 2WZGA 2Q9BA 3ITFA 2H8AA 3UR3C 2HUJA 1GS9A 3C62A 3IQ5A 4OIPF 3FHDA 3RW0A 4E0IA 5DLJA 3FDQA 5KYWB 3FAJA 2Q00A 3U8PA 4BJ5A 1XZPA 1Q0MA 1T01A 4MVRA 2E87A 4AX2A 4BJTA 5A6JA 4JRZA 1JAFA 2LP4A 3ZSUA 4H4KC 3EFOA 1H6GA 1M2VB 1OCZC 3LNMB 3NMIA 4PJNA 1FAPB 1RXQA 2YHSA 1OCOC 2VCAA 4DJ9A 2WZFA 2B0HA 3TK0A 3RIPA 3IEEA 2IXMA 4EWCA 4L6RA 1H9TA 2I15A 2R9RB 1AEPA 3U2MA 3G50A 4PJMA 3SZRA 5JSLA 3HNLA 4IGGA 4CS8C 2JD3A 4EBJA 1F1MA 3JYHA 1LM3B 1M56C 1YZAA 3Q6NA 1LVKA 2Q4FA 4JCZA 4XEKA 4DRIB 5A6AA 2ICWG 4C3BA 3DM5A 2PF4E 3CSKA 1A7EA 1YARO 3W4YA 2D5RB 3IHUA 4K7BA 1LE4A 1EI7A 1N1CA 1U0BB 4P9TA 4MVOA 3ZQVA 4CS9C 1VK5A 2R7UA 1I4YA 3FVYA 5L0CA 2IBFA 2YVKA 2J9WA 4JURI 1UG7A 2A0UA 3E9VA 3RYLA 2XL8A 1R4TA 1Q0GA 2PP4A 2XM4A 3FOPA 3M4BA 3EG9A 4MW8A 1LKXA 5EHHA 5B1BC 4A2NB 3S90A 3MFNA 4C7OB 1A0BA 3KL4A 5F5HA 4FWVA 2G3VA 2PNOA 3GEHA 4G7ZF 2GFHA 2R03A 4IAQA 4DBQA 2L81A 2VH3A 5BQGA 2B0JA 3AG3C 1CGOA 1BZ4A 3S84A 4MVSA 2BE5F 3FMSA 2A69F 1PD0A 3QTHA 1CGME 3JT1A 2R25A 1LS4A 4EUKB 3U5SA 4HEAJ 1JR8A 4GYTA 3V7OA 1YYJA 2Q3TA 1VMAA 4IAOA 2FFHA 4BPMA 2LQGA 4J7YA 256BA 2IXOA 4CJGA 4MVZA 3LEOA 2P61A 1K40A 3N0TA 1H9GA 1TR2A 4YT8A 5L0JA 2YWAA 5GPGB 2R7QA 1S05A 2DYRC 2VB6A 1RKCA 2J9VA 5EGYA 2MWQA 4EKWA 4DBRA 5HSWA 3B0UX 1OQCA 3EH1A 3GANA 3QVYA 5CI8A 5D91A 3R7CA 3PDMP 2R7RA 3Q6MA 4JVSA 2XLEA 1VB5A 4G0HA 2EIJC 4MVQA 3JYYA 4MNDA 3WAQA 1H7IA 2NUPA 3HNIA 4NTBA 1M6TA 3DKAA 4JKVA 3A9CA 1V74B 2ETSA 1LE2A 3K1IC 4NTAA 4FESA 4Z9IA 1NG1A 1C17M 1I4ZA 1OXBA 2ZXPA 3ABMC 4CSAC 1ZU5A 5E3CA 2YL3A 3AG4C 3AG1C 3CQZA 3S9OA 2UUHA 1Z5ZA 3IQ6A 3TOMA 1CPQA 4HE8D 1EQ1A 1MMNA 2P7VA 2P6VA 4JTAB 4P9FA 3B29A 3SEOA 4LLCA 4E18A 5B3SC 2AP3A 1E86A 3K7DA 1BBHA 2HJMA 2XLWA 2J8WA 3LUTB 3NKEA 4Z9HA 2NUTA 3TD7A 3US6A 1RMVA 4ONSA 5BQIA 2OJED 3DJUB 4JW1A 4O6NA 3AQCA 1SZIA 3DZAA 3FXHA 1NFOA 3H2UA 3S29A 1FMVA 1TWAA 1E85A 1D0ZA 5L3VA 2R7TA 3ZDLA 2YL0A 4BJ1A 3MLGA 5JRAA 2GWWA 3W2VA 1TQGA 3JSEO 4CDAA 1K04A 5KYXA 1NZEA 4WGYA 1YLMA 3DWWA 4JZAA 4OINF 1VLSA 1FNTc 2Z15A 3TOLA 2CNWA 4LLEA 2W45A 3EGXA 4PFPA 2M4EA 2P1AA 5A69A 5B3IA 2LCHA 2YL1A 1V55C 2HS5A 3EHNA 3H65A 1A41A 5A6BA 1Q0KA 2HV7A 2YL7A 3FAPB 4Z9JA 4XPXA 5E2QA 3OA1A 2CNWD 4LERA 5L3QA 5JLIA 3PHF2 4UDVA 2YKZA 2KJGA 2KYHA 1T9KA 1R5ID 1SYQA 3LLKA 3C18A 4XLNF 4E0HA 3J06A 4NC3A 2KGOA 5COMA 2L6FA 4I1MA 1A7VA 3LJBA 1HW2A 4OD5A 3WODF 5DS4A 3KMIA 1TWHA 1Z6AA 2V26A 4ULVA 3QVZA 4W8KA 3K1HA 2ASRA 2ZD9A 3HTKC 4E7SA 1HE9A 4XWJA 4N06A 2HMQA 3OEOA 2XLVA 3LLIA 3NG1A 4CIHA 1UFBA 2J7PD 2YRFA 3N2ZB 1FTSA 4XLPF 1Z7Qc 4OIRF 2YLGA 4AE4B 2YQYA 4JC7A 3U8VA 3VM6A 4C3DA 4MS2A 4U5FE 3GEEA 4P6IC 4DRHB 1HMDA 2C03A 2G62A 3M1CB 3L8IA 3MYFA 2XL6A 2R7SA 2YLDA 2HKVA 2RSEB 2Y3HA 4CSAA 3C63A 4YT4A 3Q7GA 5JVEA 4MQ9F 2NPUA 4G78A 3SXMA 4DVZA 1E83A 1TWCA 3EG9B 4C7OA 3ECSA 1VTMP 1V4AA 1BDJB 3RFYA 5T3WA 2A6HF 3KKBA 3QMKA 1AVOB 1LPEA 4AL1A 5KYXB 2VCCA 3BRJA 4MTFA 3HNKA 3U2LA 2J9BA 4CX9A 3MX3A 3O55A 3UGPA 4N6HA 4AE4A 1ZHTA 2FAPB 1MQVA 1YDIA 2JX0A 3ATPA 2QE9A 3GM2A 1ZHXA 5BQHA 4BJ6A 4DVYP 1CGNA 5F5FA 3X2QC 4LDQA 1FFTC 1L7CA 3KH2A 5AC5A 4R32A 3T6GB 4I3MA 1ORJA 3WHNA 2AWYA 2KC3A 3G4XA 3KPHA 3RKOF 1ZVZA 3I5PA 2L6GA 3DMDA 3HNJA 1JRAA 2WB7A 4XPWA 3GWNA 3ASOC 3VRCA 1TWGA 1ZW3A 5A6BD 2R7VA 1Z23A 4GQHA 4W8PA 2OU6A 1NBBA 2CW0F 2PBEA 5DVWA 5L0DA 4E17A 4ZLDA 2WVOA 1D0XA 3JZ0A 1XZQA 3L0IA 3QW1A 4IJJA 4KNWA 4OD4A 3TJ6A 2Q9CA 2XLOA 5DQZA 4QI2A 4NCQA 5L0HA 2OEXA 2BL2A 1ZZPA 2EIKC 2H7OA 3ASNC 2F22A 2X51A 3OWTA 1ORSC 1XWJA 1U6HA 2UUIA 2OQMA 1B68A 3W2WA 4CIPA 1C02A 1YVIA 1DOVA 2MHRA 1Q0DA 4WABA 4N4WA 4B6IA 1HMOA 4JEBA 5AGFA 2QNLA 5KYNA 4O6MA 4JCHA 3MYIA 1LS1A 1GQAA 4U5HA 2HJ3A 3T9OA 1FMWA 4WJ0A 1KTMA 1K05A 1YZCA 3RVZA 4DOZA 2W9YA 3C8GD 1YYXA 2I8BA 1IZMA 2HSQA 1ZHYA 2KW3C 2LD6A 2VC9A 2WL8A 2XLHA 3DI5A 3UMHA 1WTYA
chains in the Genus database with same CATH topology
4XPWA 1HMDA 4XPXA 2AWCA 3WHNA 2HMZA 2AWYA 1A7EA 1I4YA 2AVKA 2MHRA 3AGTA 1HMOA 3AGUA 3WAQA 4XPYA 1A7DA 4XQ1A 1I4ZA 2HMQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPW A;  1HMD A;  4XPX A;  2AWC A;  3WHN A;  2HMZ A;  2AWY A;  1A7E A;  1I4Y A;  2AVK A;  2MHR A;  3AGT A;  1HMO A;  3AGU A;  3WAQ A;  4XPY A;  1A7D A;  4XQ1 A;  1I4Z A;  2HMQ A; 
#chains in the Genus database with same CATH topology
 1BR2 A;  2OG2 A;  1MMG A;  2W4M A;  4JJF A;  2KNH A;  3NMJ A;  3EZI A;  1ORY A;  1G4U S;  5DQT A;  3AJM A;  2KSF A;  4BG0 A;  3RQE A;  5KYY B;  1QQ3 A;  2KQ9 A;  3NMK A;  4JJG A;  4O6Y A;  3NDB B;  2L9J A;  5AC4 A;  2YLI A;  4Q4Z F;  1YA9 A;  2A0B A;  4IB4 A;  2AU5 A;  3HJC A;  5COF A;  4YK5 A;  1GM5 A;  1JPJ A;  1M2V A;  1WAS A;  1LI7 A;  2XLM A;  1APC A;  3AQB A;  3SXZ A;  3UMK A;  2Y69 C;  3F46 A;  4J7T A;  4YJW A;  1QZX A;  2PX0 A;  1LI5 A;  4YL0 A;  4J32 B;  3SXY A;  1T6Q A;  2BC5 A;  4O7G A;  5CIV A;  3ZG1 A;  2CCY A;  1O87 A;  4KBL A;  4BJ6 C;  4C3E A;  2XS8 A;  3SNH A;  1U89 A;  4JEA A;  4K0D A;  1SF8 A;  4QI0 A;  2XLD A;  2R7W A;  5T3T A;  2G3K A;  1E84 A;  4FAP B;  3B0V C;  1PD1 A;  2DYS C;  3H2V A;  3K33 A;  1RCP A;  4IAR A;  3UNG C;  3GOR A;  4Q5S F;  1IW7 F;  4LDR A;  1J8M F;  5FCL A;  2DI3 A;  4FX5 A;  1NU7 D;  2C04 A;  3HLZ A;  4MTO A;  3LS0 A;  3SP1 A;  2NG1 A;  4U5E E;  3LAY A;  1Y4C A;  2AWC A;  1GGQ A;  2L7A A;  2PX3 A;  1RJ9 B;  4G7H F;  1FR0 A;  5BUO A;  3FOO A;  3K1I A;  4U5B E;  4I44 A;  3GOD A;  4LAC B;  4YN0 B;  2VAS A;  4HFF B;  4XEV A;  2QLA A;  1OCR C;  2R7O A;  2YEV A;  2J7P A;  4X0R A;  4RBN A;  5K0I A;  1WN0 A;  2IM8 A;  3JTL O;  2XXA A;  2PFD A;  1G5Z A;  2HZ8 A;  2HMZ A;  2IXN A;  2J0W A;  1D1A A;  4KNV A;  3ZQY A;  2NUP B;  3U3B A;  1OCC C;  1HE1 A;  3AG2 C;  4YL1 A;  3I4U A;  1T6I A;  3K6B A;  5IY5 C;  4NY3 A;  1O5H A;  4MTG A;  4D4N A;  3RQF A;  3S28 A;  2ZPA A;  3DJN B;  3M4C A;  3V5Z A;  4E7Z A;  1D0Y A;  2IYL D;  3DAG A;  4LDK A;  1Z63 A;  3W8I A;  1BR1 A;  2EPN A;  3Q7L A;  3DD7 A;  3GM3 A;  3I5Q A;  2HV6 A;  4ER9 A;  1D1C A;  3UMI A;  1OKK D;  2A1D D;  3BEH A;  4JE9 A;  3DXJ F;  3IQC A;  1MNE A;  2XS1 A;  1MND A;  3NYM A;  3TQO A;  3U0C A;  1NLX A;  2ZXO A;  2EIN C;  3VF0 A;  3ZVR A;  3AOU A;  1VYI A;  1J8Y F;  1YJG A;  3KYI A;  4CBE A;  2R05 A;  5TJ5 E;  4I1O B;  3EZH A;  1ZYR F;  2NSF A;  5A6K A;  5L0I A;  2WZL A;  3QZC A;  4ULW A;  1TFK B;  3NRH A;  3CAX A;  4DXW A;  1RKE A;  2GDC A;  2WVQ A;  4XTK A;  2P0N A;  2W4B A;  2CDQ A;  2XSE A;  3PMR A;  2LK4 A;  1ST6 A;  4BJ5 C;  2LFD A;  4U9D A;  4U5G A;  1ZW2 A;  5CI9 A;  3RH3 A;  1V54 C;  2A6E F;  3GM1 A;  4MVM A;  2Y39 A;  3CZ6 A;  3UGO A;  3EQL F;  5D92 A;  1BR4 A;  1QLE C;  2CYD A;  4N6C A;  4IWB A;  3RQG A;  2DGJ A;  3ZTM A;  3B0P A;  3DE8 A;  4NQF A;  3V5Y A;  2XRH A;  5KYU B;  5L0F A;  1T5O A;  2J46 A;  5KYU A;  4JTC B;  2AVK A;  3AGT A;  5T1D B;  5JT4 A;  5JUA A;  3TUL A;  1OW6 A;  1T6U A;  3AGU A;  1OXK A;  4EHP A;  3O10 A;  2CGE A;  3ABK C;  4GEH A;  2EIM C;  1Z3I X;  1LIH A;  2HFI A;  2OCC C;  5B1A C;  2GAQ A;  2XL4 A;  4U9E A;  3VAY A;  5COG A;  1JPN A;  3B9Q A;  1OW8 A;  3C8G A;  4PJJ A;  3RF3 A;  1RKE B;  1W2W A;  3ZTZ A;  4JTD B;  2H7V C;  1QVX A;  1ZU4 A;  3IPM O;  4D4X A;  2IXP A;  3LNR A;  4WGZ A;  4CS7 A;  4Q7C A;  1NSG B;  4AL0 A;  1YAU O;  2TMV P;  1MMD A;  4CS9 A;  2Y3G A;  3TJ5 A;  2LSE A;  4EBB A;  4EIY A;  1CPR A;  4YWQ A;  1KU2 A;  3L8J A;  2D4U A;  3S0X A;  4G7O F;  1ZHZ A;  4M63 A;  3R2P A;  1G8X A;  1PV3 A;  2OEV A;  3GEI A;  3LES A;  2R7X A;  2RD9 A;  4ZLC A;  2QY9 A;  2VCB A;  4ANJ A;  2R02 A;  3ZC4 A;  2J9U A;  3IQT A;  4XPY A;  2Q7R A;  4CS8 A;  3GWL A;  3N24 A;  3EGD A;  2LIG A;  3EGD B;  4F4B A;  1WAT A;  4H54 A;  3DE9 A;  2J45 A;  3VYW A;  2O9X A;  1OR3 A;  2IOQ A;  3M15 A;  3EH2 A;  3U9J A;  1OW7 A;  3V5X A;  4DRJ B;  2QTV A;  3EFO B;  5HV9 A;  1HW1 A;  1I5N A;  4BEM J;  4XQ1 A;  4YT5 A;  3F47 A;  3T6B A;  3RVY A;  4PAC A;  1ZHW A;  5FZT A;  3SXK A;  4J30 B;  1NU9 C;  2ZXW C;  4O79 A;  4KC9 A;  3O39 A;  2V3C C;  4KI2 A;  3L34 A;  1SR2 A;  2NUT B;  2NSG A;  1G4W R;  3E70 C;  4IRU A;  4OIQ F;  2Q9A A;  2FGY A;  1O3U A;  4RDA A;  3SYN A;  3A11 A;  1MMA A;  2XM0 A;  2L6H A;  3JRM O;  2Y3D A;  3C8G B;  2MYS A;  1SMY F;  2JPU A;  3U3F A;  3MBG A;  3PCV A;  1JMW A;  1VLT A;  2EPO A;  3EGX B;  4NTF A;  2GA0 A;  4EBK A;  1QKR A;  4BEJ A;  2J0X A;  2H7B A;  1OKK A;  1HY5 A;  2DB4 A;  3B71 A;  1KNY A;  2QUP A;  4MVU A;  2X0C A;  3EHM A;  3S27 A;  3ZWI A;  5EK0 A;  2M64 A;  5JP7 A;  1EKY A;  5E3A A;  4CDV A;  1EA8 A;  2Y3B A;  1OR2 A;  3EPV A;  4CDY A;  2OOC A;  4PJL A;  5E33 A;  4A4A A;  1QPU A;  1WOL A;  1Q0F A;  1TKN A;  3X1O A;  3C8Z A;  2ZXR A;  4HFK B;  1D1B A;  2XXA B;  3M79 A;  3NYL A;  5L0G A;  5DS5 A;  3HKK A;  1JOG A;  5DS6 A;  3EJN A;  1E2X A;  2OKU A;  2EPM X;  2EIL C;  2A68 F;  2YZS A;  2LFF A;  1M2O A;  1YA7 O;  5JS5 A;  5KYW A;  3T4R A;  5KYY A;  1A7D A;  1WWP A;  1VYK A;  4OIO F;  4CJO A;  3POV A;  4U5C E;  3JRT A;  4PK4 A;  3ABL C;  1Y6D A;  3G4Z A;  1M57 C;  3LS1 A;  4JIO A;  2WVN A;  4RD9 A;  4AK9 A;  3LEV A;  1C03 A;  2KK1 A;  4QDL A;  4XEF A;  5F28 E;  3WG7 C;  2EPL X;  4YL3 A;  4K1O A;  1NFN A;  2OJQ A;  1DOW A;  1FFH A;  3C7J A;  1L3P A;  1RJ9 A;  3JCU Q;  1TFO B;  3NYJ A;  3NKD A;  4MW3 A;  3DM9 B;  4U5D E;  4PR9 A;  3DAF A;  4YT2 A;  3U9M A;  2EPK X;  3JSZ A;  3KYJ A;  1VOM A;  3L1M A;  4PFO A;  3T6J A;  1QSP A;  3QW0 A;  1S7Z A;  3CEX A;  3ZIB A;  3O6X A;  3K66 A;  3W8H A;  1PCX A;  1AUE A;  2HSB A;  1WGW A;  2WZG A;  2Q9B A;  3ITF A;  2H8A A;  3UR3 C;  2HUJ A;  1GS9 A;  3C62 A;  3IQ5 A;  4OIP F;  3FHD A;  3RW0 A;  4E0I A;  5DLJ A;  3FDQ A;  5KYW B;  3FAJ A;  2Q00 A;  3U8P A;  4BJ5 A;  1XZP A;  1Q0M A;  1T01 A;  4MVR A;  2E87 A;  4AX2 A;  4BJT A;  5A6J A;  4JRZ A;  1JAF A;  2LP4 A;  3ZSU A;  4H4K C;  3EFO A;  1H6G A;  1M2V B;  1OCZ C;  3LNM B;  3NMI A;  4PJN A;  1FAP B;  1RXQ A;  2YHS A;  1OCO C;  2VCA A;  4DJ9 A;  2WZF A;  2B0H A;  3TK0 A;  3RIP A;  3IEE A;  2IXM A;  4EWC A;  4L6R A;  1H9T A;  2I15 A;  2R9R B;  1AEP A;  3U2M A;  3G50 A;  4PJM A;  3SZR A;  5JSL A;  3HNL A;  4IGG A;  4CS8 C;  2JD3 A;  4EBJ A;  1F1M A;  3JYH A;  1LM3 B;  1M56 C;  1YZA A;  3Q6N A;  1LVK A;  2Q4F A;  4JCZ A;  4XEK A;  4DRI B;  5A6A A;  2ICW G;  4C3B A;  3DM5 A;  2PF4 E;  3CSK A;  1A7E A;  1YAR O;  3W4Y A;  2D5R B;  3IHU A;  4K7B A;  1LE4 A;  1EI7 A;  1N1C A;  1U0B B;  4P9T A;  4MVO A;  3ZQV A;  4CS9 C;  1VK5 A;  2R7U A;  1I4Y A;  3FVY A;  5L0C A;  2IBF A;  2YVK A;  2J9W A;  4JUR I;  1UG7 A;  2A0U A;  3E9V A;  3RYL A;  2XL8 A;  1R4T A;  1Q0G A;  2PP4 A;  2XM4 A;  3FOP A;  3M4B A;  3EG9 A;  4MW8 A;  1LKX A;  5EHH A;  5B1B C;  4A2N B;  3S90 A;  3MFN A;  4C7O B;  1A0B A;  3KL4 A;  5F5H A;  4FWV A;  2G3V A;  2PNO A;  3GEH A;  4G7Z F;  2GFH A;  2R03 A;  4IAQ A;  4DBQ A;  2L81 A;  2VH3 A;  5BQG A;  2B0J A;  3AG3 C;  1CGO A;  1BZ4 A;  3S84 A;  4MVS A;  2BE5 F;  3FMS A;  2A69 F;  1PD0 A;  3QTH A;  1CGM E;  3JT1 A;  2R25 A;  1LS4 A;  4EUK B;  3U5S A;  4HEA J;  1JR8 A;  4GYT A;  3V7O A;  1YYJ A;  2Q3T A;  1VMA A;  4IAO A;  2FFH A;  4BPM A;  2LQG A;  4J7Y A;  256B A;  2IXO A;  4CJG A;  4MVZ A;  3LEO A;  2P61 A;  1K40 A;  3N0T A;  1H9G A;  1TR2 A;  4YT8 A;  5L0J A;  2YWA A;  5GPG B;  2R7Q A;  1S05 A;  2DYR C;  2VB6 A;  1RKC A;  2J9V A;  5EGY A;  2MWQ A;  4EKW A;  4DBR A;  5HSW A;  3B0U X;  1OQC A;  3EH1 A;  3GAN A;  3QVY A;  5CI8 A;  5D91 A;  3R7C A;  3PDM P;  2R7R A;  3Q6M A;  4JVS A;  2XLE A;  1VB5 A;  4G0H A;  2EIJ C;  4MVQ A;  3JYY A;  4MND A;  3WAQ A;  1H7I A;  2NUP A;  3HNI A;  4NTB A;  1M6T A;  3DKA A;  4JKV A;  3A9C A;  1V74 B;  2ETS A;  1LE2 A;  3K1I C;  4NTA A;  4FES A;  4Z9I A;  1NG1 A;  1C17 M;  1I4Z A;  1OXB A;  2ZXP A;  3ABM C;  4CSA C;  1ZU5 A;  5E3C A;  2YL3 A;  3AG4 C;  3AG1 C;  3CQZ A;  3S9O A;  2UUH A;  1Z5Z A;  3IQ6 A;  3TOM A;  1CPQ A;  4HE8 D;  1EQ1 A;  1MMN A;  2P7V A;  2P6V A;  4JTA B;  4P9F A;  3B29 A;  3SEO A;  4LLC A;  4E18 A;  5B3S C;  2AP3 A;  1E86 A;  3K7D A;  1BBH A;  2HJM A;  2XLW A;  2J8W A;  3LUT B;  3NKE A;  4Z9H A;  2NUT A;  3TD7 A;  3US6 A;  1RMV A;  4ONS A;  5BQI A;  2OJE D;  3DJU B;  4JW1 A;  4O6N A;  3AQC A;  1SZI A;  3DZA A;  3FXH A;  1NFO A;  3H2U A;  3S29 A;  1FMV A;  1TWA A;  1E85 A;  1D0Z A;  5L3V A;  2R7T A;  3ZDL A;  2YL0 A;  4BJ1 A;  3MLG A;  5JRA A;  2GWW A;  3W2V A;  1TQG A;  3JSE O;  4CDA A;  1K04 A;  5KYX A;  1NZE A;  4WGY A;  1YLM A;  3DWW A;  4JZA A;  4OIN F;  1VLS A;  1FNT c;  2Z15 A;  3TOL A;  2CNW A;  4LLE A;  2W45 A;  3EGX A;  4PFP A;  2M4E A;  2P1A A;  5A69 A;  5B3I A;  2LCH A;  2YL1 A;  1V55 C;  2HS5 A;  3EHN A;  3H65 A;  1A41 A;  5A6B A;  1Q0K A;  2HV7 A;  2YL7 A;  3FAP B;  4Z9J A;  4XPX A;  5E2Q A;  3OA1 A;  2CNW D;  4LER A;  5L3Q A;  5JLI A;  3PHF 2;  4UDV A;  2YKZ A;  2KJG A;  2KYH A;  1T9K A;  1R5I D;  1SYQ A;  3LLK A;  3C18 A;  4XLN F;  4E0H A;  3J06 A;  4NC3 A;  2KGO A;  5COM A;  2L6F A;  4I1M A;  1A7V A;  3LJB A;  1HW2 A;  4OD5 A;  3WOD F;  5DS4 A;  3KMI A;  1TWH A;  1Z6A A;  2V26 A;  4ULV A;  3QVZ A;  4W8K A;  3K1H A;  2ASR A;  2ZD9 A;  3HTK C;  4E7S A;  1HE9 A;  4XWJ A;  4N06 A;  2HMQ A;  3OEO A;  2XLV A;  3LLI A;  3NG1 A;  4CIH A;  1UFB A;  2J7P D;  2YRF A;  3N2Z B;  1FTS A;  4XLP F;  1Z7Q c;  4OIR F;  2YLG A;  4AE4 B;  2YQY A;  4JC7 A;  3U8V A;  3VM6 A;  4C3D A;  4MS2 A;  4U5F E;  3GEE A;  4P6I C;  4DRH B;  1HMD A;  2C03 A;  2G62 A;  3M1C B;  3L8I A;  3MYF A;  2XL6 A;  2R7S A;  2YLD A;  2HKV A;  2RSE B;  2Y3H A;  4CSA A;  3C63 A;  4YT4 A;  3Q7G A;  5JVE A;  4MQ9 F;  2NPU A;  4G78 A;  3SXM A;  4DVZ A;  1E83 A;  1TWC A;  3EG9 B;  4C7O A;  3ECS A;  1VTM P;  1V4A A;  1BDJ B;  3RFY A;  5T3W A;  2A6H F;  3KKB A;  3QMK A;  1AVO B;  1LPE A;  4AL1 A;  5KYX B;  2VCC A;  3BRJ A;  4MTF A;  3HNK A;  3U2L A;  2J9B A;  4CX9 A;  3MX3 A;  3O55 A;  3UGP A;  4N6H A;  4AE4 A;  1ZHT A;  2FAP B;  1MQV A;  1YDI A;  2JX0 A;  3ATP A;  2QE9 A;  3GM2 A;  1ZHX A;  5BQH A;  4BJ6 A;  4DVY P;  1CGN A;  5F5F A;  3X2Q C;  4LDQ A;  1FFT C;  1L7C A;  3KH2 A;  5AC5 A;  4R32 A;  3T6G B;  4I3M A;  1ORJ A;  3WHN A;  2AWY A;  2KC3 A;  3G4X A;  3KPH A;  3RKO F;  1ZVZ A;  3I5P A;  2L6G A;  3DMD A;  3HNJ A;  1JRA A;  2WB7 A;  4XPW A;  3GWN A;  3ASO C;  3VRC A;  1TWG A;  1ZW3 A;  5A6B D;  2R7V A;  1Z23 A;  4GQH A;  4W8P A;  2OU6 A;  1NBB A;  2CW0 F;  2PBE A;  5DVW A;  5L0D A;  4E17 A;  4ZLD A;  2WVO A;  1D0X A;  3JZ0 A;  1XZQ A;  3L0I A;  3QW1 A;  4IJJ A;  4KNW A;  4OD4 A;  3TJ6 A;  2Q9C A;  2XLO A;  5DQZ A;  4QI2 A;  4NCQ A;  5L0H A;  2OEX A;  2BL2 A;  1ZZP A;  2EIK C;  2H7O A;  3ASN C;  2F22 A;  2X51 A;  3OWT A;  1ORS C;  1XWJ A;  1U6H A;  2UUI A;  2OQM A;  1B68 A;  3W2W A;  4CIP A;  1C02 A;  1YVI A;  1DOV A;  2MHR A;  1Q0D A;  4WAB A;  4N4W A;  4B6I A;  1HMO A;  4JEB A;  5AGF A;  2QNL A;  5KYN A;  4O6M A;  4JCH A;  3MYI A;  1LS1 A;  1GQA A;  4U5H A;  2HJ3 A;  3T9O A;  1FMW A;  4WJ0 A;  1KTM A;  1K05 A;  1YZC A;  3RVZ A;  4DOZ A;  2W9Y A;  3C8G D;  1YYX A;  2I8B A;  1IZM A;  2HSQ A;  1ZHY A;  2KW3 C;  2LD6 A;  2VC9 A;  2WL8 A;  2XLH A;  3DI5 A;  3UMH A;  1WTY A; 
#chains in the Genus database with same CATH homology
 4XPW A;  1HMD A;  4XPX A;  2AWC A;  3WHN A;  2HMZ A;  2AWY A;  1A7E A;  1I4Y A;  2AVK A;  2MHR A;  3AGT A;  1HMO A;  3AGU A;  3WAQ A;  4XPY A;  1A7D A;  4XQ1 A;  1I4Z A;  2HMQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...