1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
1I4ZA 1HMDA 3AGTA 3WHNA 1I4YA 2HMQA 4XQ1A 1A7EA 4XPYA 1A7DA 1HMOA 2AVKA 2AWCA 3AGUA 2MHRA 4XPWA 2HMZA 2AWYA 4XPXA 3WAQA
chains in the Genus database with same CATH superfamily
5D91A 2WZLA 3TULA 2QY9A 2PNOA 4MVRA 4PFOA 1LS4A 3WHNA 3K7DA 2MYSA 4CDYA 1C17M 3C8GD 3KPHA 4UDVA 2YHSA 1FFHA 2JPUA 3O10A 2HKVA 1YDIA 1ZHYA 4QDLA 3ZVRA 5KYWA 4BEMJ 3C62A 2HJ3A 2EPOA 5JLIA 3DI5A 2R03A 3VYWA 2ASRA 5KYWB 2WVOA 3QMKA 3WODF 1PD1A 2EIMC 4W8KA 2DI3A 1E83A 1RKEB 3C8ZA 3L34A 2W45A 1VLTA 4Z9IA 1VLSA 2FFHA 4IGGA 2XS1A 4P9TA 4ULVA 2L6HA 2FGYA 1I4ZA 4YWQA 3ZC4A 3G50A 1EQ1A 3RFYA 4JRZA 2NUPA 4IAQA 4RD9A 1E85A 1APCA 3LESA 2J0WA 4G0HA 1BR4A 4HFFB 1ORYA 1UFBA 3C18A 3ZG1A 1H9GA 4PJJA 2XLVA 2V3CC 1NU7D 3Q6MA 3DAFA 3RQEA 1YLMA 3JYYA 3C8GA 1LKXA 4FX5A 5A69A 4DVYP 4JC7A 3JSEO 4AX2A 1JR8A 1PCXA 3B0VC 1TQGA 5CI8A 5DS6A 3TJ6A 4ZLDA 3R7CA 2G62A 3W8IA 5HSWA 4CX9A 1Z6AA 2EIJC 1RXQA 3M79A 4E7ZA 1TFOB 1SMYF 2Q9BA 5KYYA 1WASA 3VAYA 3GEIA 4YJWA 4DRJB 3DE9A 2YLIA 2R02A 2E87A 4E18A 3S27A 3K33A 1TR2A 2LCHA 3FVYA 4BJTA 1H6GA 1SZIA 4AK9A 1J8MF 3JCUQ 4YT8A 3LS0A 3UGOA 2OKUA 2R7SA 2CCYA 1GS9A 4U5EE 3LJBA 3LS1A 1SF8A 4MVUA 5DVWA 3OWTA 2J9UA 1NSGB 1VTMP 3PCVA 3ZTZA 5T1DB 2UUHA 3KYJA 4ULWA 3IQTA 4U5GA 1OW7A 2QNLA 1Q0KA 3FXHA 4E0IA 5BQHA 4CBEA 3J06A 3S90A 4CS9C 1OW6A 3ZQYA 4QI0A 2HUJA 4Q4ZF 3LNMB 2MHRA 4I1MA 1TWCA 2OOCA 4G7ZF 1FMVA 1CPQA 3EH1A 3TQOA 2EILC 2Y69C 4BPMA 1WATA 3S84A 2J9VA 4MNDA 5L3VA 2NPUA 2Z15A 2IBFA 2J9WA 4XEKA 3ECSA 4P9FA 1OW8A 3B29A 3FMSA 4Z9HA 3EQLF 2PX3A 2LFFA 2YLDA 2GAQA 4LDRA 3Q7GA 4MVQA 3OA1A 4O6MA 2GFHA 1ORJA 1ORSC 3GORA 4C3BA 1B68A 3AJMA 4N6CA 3LNRA 1OXBA 4XEFA 1GQAA 2R7RA 2W9YA 2YZSA 3CZ6A 4O6YA 2W4MA 4BJ1A 3JRTA 3ZQVA 1E86A 1OR2A 4MVSA 1T6UA 3HNLA 2OU6A 5DS4A 1V74B 3BEHA 5A6BD 3PDMP 1EA8A 4G7OF 2DB4A 2LIGA 4BJ6A 3ZDLA 2P0NA 4PJLA 5D92A 3CSKA 4AL0A 4XLNF 3ITFA 3IQ5A 1Q0DA 4W8PA 1ST6A 4E0HA 3RIPA 4CIPA 5L3QA 1K05A 3X2QC 4NQFA 1FTSA 1PD0A 1YA9A 1TWAA 3AGTA 2Y3BA 3TJ5A 2XL6A 1Y6DA 1AEPA 1XZQA 2EPNA 4EBKA 2O9XA 3EHMA 2CDQA 3FAPB 3PMRA 3NYLA 1OCOC 3AG2C 4JVSA 2YL0A 4EHPA 5AC5A 1CGME 2WZFA 4MTGA 3S29A 4JCZA 4XPYA 2ZXRA 5AC4A 2ETSA 2J9BA 1JMWA 2GDCA 2YEVA 4CS9A 1ZW3A 3ZWIA 2OJED 2KC3A 2A68F 3LUTB 1LM3B 1KU2A 2IXNA 4ZLCA 1J8YF 3SXKA 2EPLX 5A6BA 2WL8A 2PBEA 2OJQA 4JIOA 3W4YA 1I5NA 1L7CA 2EPMX 3U9JA 3TD7A 4DBQA 5JT4A 1K40A 2HS5A 2Q3TA 1XZPA 2IXMA 3H65A 3KYIA 3MYFA 4CJGA 4GQHA 1NG1A 2YL1A 4IB4A 3IPMO 4YK5A 1HMDA 1KNYA 4Q5SF 2B0JA 2OG2A 1ZHWA 2HSQA 4CS8A 4YL1A 1EKYA 4BG0A 3K66A 3Q7LA 2LD6A 2QLAA 4DRIB 4EIYA 1YJGA 4I3MA 4PJMA 4JTAB 1WTYA 3RW0A 2CGEA 2LQGA 3B71A 1W2WA 1FMWA 3B9QA 1XWJA 2IM8A 3K6BA 4P6IC 5JP7A 4C3DA 3I5PA 3EGDA 4NC3A 4XTKA 1RJ9A 5JS5A 5AGFA 3MX3A 3T6BA 3NKDA 5CIVA 3IHUA 4PR9A 3KH2A 3DJUB 3RVYA 3EGDB 2OEXA 3EPVA 1A0BA 1EI7A 1JPJA 1LI5A 1RJ9B 3QTHA 4KBLA 3VRCA 4QI2A 3EFOA 4WABA 3NMIA 1JOGA 2HV6A 3N2ZB 1NZEA 2YRFA 2B0HA 4J32B 4N4WA 4U5BE 4OD4A 5FZTA 4ER9A 2HZ8A 1H7IA 2R7QA 3EFOB 3T6GB 3ZIBA 4MTOA 1Z3IX 3JTLO 2A69F 2A6EF 2XL8A 5L0IA 3ABKC 1QKRA 3RKOF 1A41A 3V5YA 2ZXWC 3UNGC 1ZW2A 2DYRC 2NUPB 2P1AA 3RQFA 3TOMA 1ZYRF 3UMHA 4YT5A 4EBJA 3FDQA 2VCBA 3U8PA 2Y3HA 3QW1A 2VC9A 2BL2A 4CS7A 3C8GB 5KYXA 2L9JA 3DZAA 4X0RA 3RH3A 2ICWG 5B1BC 4CDVA 4LLEA 3IQ6A 2AWYA 3V7OA 2J7PD 1BR2A 4XLPF 2XSEA 3HNJA 4Q7CA 2UUIA 3QZCA 3UR3C 5L0HA 5B1AC 4KNVA 5KYYB 4AL1A 1FFTC 4J7TA 2PP4A 4JKVA 1BBHA 2KYHA 1C02A 4JJGA 3V5ZA 5B3IA 1MMAA 1D1BA 3F47A 3GM3A 1MQVA 4XQ1A 3U2LA 3DKAA 3SP1A 4GYTA 1A7DA 1V55C 4OD5A 3AQCA 2BE5F 4IJJA 2AP3A 3RVZA 5E3AA 1K04A 1HW1A 1M57C 1Q0FA 2QTVA 4WJ0A 4OIQF 4JCHA 3RQGA 1S7ZA 4IWBA 3KMIA 3FAJA 1U6HA 1NFOA 5EK0A 4YT2A 3POVA 1MMGA 2D4UA 3H2UA 3H2VA 4YT4A 3EGXA 3SNHA 4PJNA 3GM1A 3UMIA 3DD7A 2XLEA 2R7OA 3GEEA 3HJCA 4DVZA 5JVEA 2P6VA 3HNIA 2YWAA 4U5DE 2WZGA 4JTDB 2J7PA 2I15A 3GANA 4KC9A 1I4YA 2IYLD 1T5OA 1QZXA 3FOPA 3S9OA 4DJ9A 3U0CA 3S28A 4AE4A 1OCRC 3GEHA 4JURI 3SYNA 4LERA 1YVIA 2LFDA 3I5QA 5COFA 5COMA 1SR2A 2Y39A 2L81A 5T3WA 1FNTc 2R7TA 1G5ZA 1MNDA 1WOLA 1D0XA 1SYQA 2L7AA 3DM5A 1M6TA 2KGOA 4DRHB 4JZAA 4I1OB 3CQZA 5DQTA 2WB7A 3R2PA 4A2NB 4Z9JA 2GA0A 2Q00A 4U5CE 5A6KA 1FR0A 2VASA 4E7SA 3SZRA 3MLGA 4BJ5C 1Z23A 1YZAA 3UMKA 5DQZA 5E2QA 3EHNA 4A4AA 2LK4A 4CS8C 3WG7C 3HTKC 2R7VA 1G8XA 1N1CA 3L8IA 1M2OA 4XPXA 2YL7A 1LPEA 1VYIA 1YYXA 1LE2A 3N0TA 4O6NA 1RKCA 3EG9A 1Z5ZA 3MBGA 3KL4A 5A6JA 2LSEA 4XWJA 2JD3A 1T6QA 3FHDA 1Z63A 2Q4FA 2Y3GA 4LLCA 4IAOA 3TOLA 3EG9B 4EUKB 3K1HA 5EGYA 3E9VA 2NG1A 5L0GA 4J7YA 4CJOA 3GODA 1O87A 2IXOA 2AVKA 2R7UA 3W2WA 2TMVP 1NFNA 1A7VA 2ZPAA 4K0DA 2XS8A 2CYDA 1YZCA 3HNKA 3JSZA 4HEAJ 4LDKA 3VM6A 4EWCA 1PV3A 1WWPA 2Y3DA 1F1MA 2X51A 3ASOC 4ONSA 2R25A 1JPNA 4C7OA 1QLEC 1AUEA 2A1DD 3AG1C 3E70C 1Y4CA 1U89A 1T6IA 1E84A 1JRAA 4ANJA 3MYIA 3G4XA 2H8AA 1NLXA 1M2VA 2XM4A 1QPUA 3EH2A 3F46A 4C7OB 2OQMA 2R05A 4WGYA 2LP4A 3US6A 3JRMO 2C04A 1E2XA 1OQCA 1RCPA 2KSFA 3DWWA 3M4CA 2A6HF 1WN0A 1M2VB 3DAGA 3DM9B 4YL3A 1M56C 3W2VA 4CDAA 3AQBA 2R7WA 3N24A 3ASNC 2J45A 2L6GA 2RSEB 4K7BA 1OXKA 1JAFA 4L6RA 3K1IC 2DYSC 4JEAA 4NCQA 1Z7Qc 3W8HA 1RMVA 2IXPA 1KTMA 3M4BA 3QVZA 5GPGB 4EBBA 2XXAA 3IQCA 1VYKA 3JZ0A 3S0XA 2YKZA 4H54A 5L0JA 4MW8A 3NG1A 3LAYA 4BJ5A 2VCCA 4KNWA 5DLJA 2XXAB 5BQGA 3JYHA 2AU5A 3T6JA 3B0UX 4OIPF 5A6AA 1TWGA 1ZHXA 4XEVA 4PFPA 4XPWA 1CGOA 3QW0A 2Q9AA 3LEVA 4G7HF 2M4EA 1O3UA 2R7XA 4O79A 4RBNA 4G78A 1G4US 4CSAA 1OCZC 1HW2A 1VOMA 1UG7A 2FAPB 2ZXPA 2NSFA 4MVMA 2WVQA 4DXWA 5KYUA 3CEXA 1CGNA 4IRUA 1MMDA 3LLIA 4D4XA 5COGA 3IEEA 2XLWA 4HE8D 5K0IA 5HV9A 2XLDA 3NDBB 3L1MA 2G3KA 1MNEA 4OIOF 5KYUB 3T9OA 1IW7F 1OCCC 1RKEA 3SXZA 3U3BA 4MQ9F 4B6IA 4F4BA 1T9KA 2HFIA 3Q6NA 5CI9A 5BQIA 1YAUO 4JW1A 5BUOA 2P7VA 2XLOA 3JT1A 4JEBA 4N06A 3V5XA 3AG4C 2HMZA 1TWHA 4OIRF 3RYLA 1L3PA 2KQ9A 2M64A 1AVOB 1D1CA 5KYXB 1G4WR 3FOOA 3PHF2 3DJNB 3HKKA 3I4UA 3DMDA 2D5RB 2HJMA 3NMJA 1HE9A 2I8BA 1R4TA 3AOUA 3O6XA 4JTCB 3SXYA 3O39A 5JUAA 4CSAC 2XRHA 5F5FA 2OCCC 5E3CA 2VH3A 3A11A 4BEJA 5L0DA 256BA 3K1IA 3TK0A 5JRAA 3C63A 1Q0MA 1LVKA 5L0FA 1LI7A 3T4RA 3U2MA 2PX0A 4MVZA 1D1AA 1TKNA 4U9DA 3AGUA 4D4NA 4E17A 2QUPA 4BJ6C 1OKKD 1ZU5A 3U5SA 1HE1A 5EHHA 3O55A 4GEHA 3EZIA 3MFNA 2J8WA 3DXJF 2PF4E 1V54C 2P61A 2KNHA 2KW3C 2HV7A 2VB6A 2H7VC 2OEVA 2R9RB 3WAQA 2WVNA 1S05A 4NY3A 3ABMC 4R32A 3U8VA 3HLZA 3DE8A 3EGXB 3X1OA 1D0ZA 4DBRA 5DS5A 4PACA 4NTBA 2HMQA 2X0CA 1CPRA 3ABLC 5T3TA 5F28E 2IOQA 5L0CA 3KKBA 4O7GA 4FESA 2YQYA 3U9MA 2RD9A 3CAXA 4AE4B 2A0UA 3M15A 3UGPA 2CNWD 2AWCA 3SXMA 1YYJA 4YL0A 1NBBA 5TJ5E 1QVXA 2C03A 2YVKA 5KYNA 4FWVA 2GWWA 3G4ZA 4MVOA 3NKEA 3GM2A 3NRHA 4I44A 3RF3A 4N6HA 1O5HA 1OKKA 1V4AA 2Q7RA 3ZTMA 1C03A 1ZU4A 1GGQA 2H7BA 1YA7O 3LLKA 3NMKA 1ZZPA 3GWLA 4HFKB 1LE4A 4C3EA 4U5FE 1VK5A 2XM0A 4RDAA 5F5HA 2QE9A 1U0BB 2CW0F 2XLMA 1BDJB 1A7EA 4MW3A 2BC5A 1ZVZA 2W4BA 3ZSUA 2V26A 1BZ4A 3B0PA 2J0XA 1OR3A 2ZD9A 3A9CA 4FAPB 3LEOA 4K1OA 2G3VA 2KK1A 2EINC 4LDQA 4EKWA 2CNWA 1VMAA 2JX0A 1FAPB 4WGZA 1GM5A 4JE9A 1NU9C 2ZXOA 4YN0B 3EZHA 3L8JA 1BR1A 5JSLA 1HY5A 1H9TA 4IARA 2A0BA 3BRJA 2XL4A 4LACB 4PK4A 1R5ID 1VB5A 2PFDA 3SEOA 3ATPA 1MMNA 2KJGA 2Q9CA 4MTFA 4DOZA 1YARO 2J46A 1IZMA 2DGJA 2NUTA 3VF0A 2EPKX 1DOVA 3C7JA 1WGWA 5E33A 3L0IA 5B3SC 1LS1A 4CIHA 4OINF 2VCAA 1HMOA 3QVYA 4U9EA 2NUTB 5FCLA 3U3FA 2YL3A 1TFKB 2L6FA 1QQ3A 1T01A 3GWNA 2EIKC 2F22A 2XLHA 1ZHZA 1LIHA 3M1CB 4JJFA 2HSBA 4U5HA 1DOWA 1ZHTA 4MS2A 3OEOA 4J30B 4KI2A 4M63A 3NYJA 2H7OA 4H4KC 1D0YA 3NYMA 2YLGA 2NSGA 3AG3C 4NTAA 4NTFA 5IY5C 1QSPA 3EJNA 2MWQA 1Q0GA
chains in the Genus database with same CATH topology
1I4ZA 1HMDA 3AGTA 3WHNA 1I4YA 2HMQA 4XQ1A 1A7EA 4XPYA 1A7DA 1HMOA 2AVKA 2AWCA 3AGUA 2MHRA 4XPWA 2HMZA 2AWYA 4XPXA 3WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4Z A;  1HMD A;  3AGT A;  3WHN A;  1I4Y A;  2HMQ A;  4XQ1 A;  1A7E A;  4XPY A;  1A7D A;  1HMO A;  2AVK A;  2AWC A;  3AGU A;  2MHR A;  4XPW A;  2HMZ A;  2AWY A;  4XPX A;  3WAQ A; 
#chains in the Genus database with same CATH topology
 5D91 A;  2WZL A;  3TUL A;  2QY9 A;  2PNO A;  4MVR A;  4PFO A;  1LS4 A;  3WHN A;  3K7D A;  2MYS A;  4CDY A;  1C17 M;  3C8G D;  3KPH A;  4UDV A;  2YHS A;  1FFH A;  2JPU A;  3O10 A;  2HKV A;  1YDI A;  1ZHY A;  4QDL A;  3ZVR A;  5KYW A;  4BEM J;  3C62 A;  2HJ3 A;  2EPO A;  5JLI A;  3DI5 A;  2R03 A;  3VYW A;  2ASR A;  5KYW B;  2WVO A;  3QMK A;  3WOD F;  1PD1 A;  2EIM C;  4W8K A;  2DI3 A;  1E83 A;  1RKE B;  3C8Z A;  3L34 A;  2W45 A;  1VLT A;  4Z9I A;  1VLS A;  2FFH A;  4IGG A;  2XS1 A;  4P9T A;  4ULV A;  2L6H A;  2FGY A;  1I4Z A;  4YWQ A;  3ZC4 A;  3G50 A;  1EQ1 A;  3RFY A;  4JRZ A;  2NUP A;  4IAQ A;  4RD9 A;  1E85 A;  1APC A;  3LES A;  2J0W A;  4G0H A;  1BR4 A;  4HFF B;  1ORY A;  1UFB A;  3C18 A;  3ZG1 A;  1H9G A;  4PJJ A;  2XLV A;  2V3C C;  1NU7 D;  3Q6M A;  3DAF A;  3RQE A;  1YLM A;  3JYY A;  3C8G A;  1LKX A;  4FX5 A;  5A69 A;  4DVY P;  4JC7 A;  3JSE O;  4AX2 A;  1JR8 A;  1PCX A;  3B0V C;  1TQG A;  5CI8 A;  5DS6 A;  3TJ6 A;  4ZLD A;  3R7C A;  2G62 A;  3W8I A;  5HSW A;  4CX9 A;  1Z6A A;  2EIJ C;  1RXQ A;  3M79 A;  4E7Z A;  1TFO B;  1SMY F;  2Q9B A;  5KYY A;  1WAS A;  3VAY A;  3GEI A;  4YJW A;  4DRJ B;  3DE9 A;  2YLI A;  2R02 A;  2E87 A;  4E18 A;  3S27 A;  3K33 A;  1TR2 A;  2LCH A;  3FVY A;  4BJT A;  1H6G A;  1SZI A;  4AK9 A;  1J8M F;  3JCU Q;  4YT8 A;  3LS0 A;  3UGO A;  2OKU A;  2R7S A;  2CCY A;  1GS9 A;  4U5E E;  3LJB A;  3LS1 A;  1SF8 A;  4MVU A;  5DVW A;  3OWT A;  2J9U A;  1NSG B;  1VTM P;  3PCV A;  3ZTZ A;  5T1D B;  2UUH A;  3KYJ A;  4ULW A;  3IQT A;  4U5G A;  1OW7 A;  2QNL A;  1Q0K A;  3FXH A;  4E0I A;  5BQH A;  4CBE A;  3J06 A;  3S90 A;  4CS9 C;  1OW6 A;  3ZQY A;  4QI0 A;  2HUJ A;  4Q4Z F;  3LNM B;  2MHR A;  4I1M A;  1TWC A;  2OOC A;  4G7Z F;  1FMV A;  1CPQ A;  3EH1 A;  3TQO A;  2EIL C;  2Y69 C;  4BPM A;  1WAT A;  3S84 A;  2J9V A;  4MND A;  5L3V A;  2NPU A;  2Z15 A;  2IBF A;  2J9W A;  4XEK A;  3ECS A;  4P9F A;  1OW8 A;  3B29 A;  3FMS A;  4Z9H A;  3EQL F;  2PX3 A;  2LFF A;  2YLD A;  2GAQ A;  4LDR A;  3Q7G A;  4MVQ A;  3OA1 A;  4O6M A;  2GFH A;  1ORJ A;  1ORS C;  3GOR A;  4C3B A;  1B68 A;  3AJM A;  4N6C A;  3LNR A;  1OXB A;  4XEF A;  1GQA A;  2R7R A;  2W9Y A;  2YZS A;  3CZ6 A;  4O6Y A;  2W4M A;  4BJ1 A;  3JRT A;  3ZQV A;  1E86 A;  1OR2 A;  4MVS A;  1T6U A;  3HNL A;  2OU6 A;  5DS4 A;  1V74 B;  3BEH A;  5A6B D;  3PDM P;  1EA8 A;  4G7O F;  2DB4 A;  2LIG A;  4BJ6 A;  3ZDL A;  2P0N A;  4PJL A;  5D92 A;  3CSK A;  4AL0 A;  4XLN F;  3ITF A;  3IQ5 A;  1Q0D A;  4W8P A;  1ST6 A;  4E0H A;  3RIP A;  4CIP A;  5L3Q A;  1K05 A;  3X2Q C;  4NQF A;  1FTS A;  1PD0 A;  1YA9 A;  1TWA A;  3AGT A;  2Y3B A;  3TJ5 A;  2XL6 A;  1Y6D A;  1AEP A;  1XZQ A;  2EPN A;  4EBK A;  2O9X A;  3EHM A;  2CDQ A;  3FAP B;  3PMR A;  3NYL A;  1OCO C;  3AG2 C;  4JVS A;  2YL0 A;  4EHP A;  5AC5 A;  1CGM E;  2WZF A;  4MTG A;  3S29 A;  4JCZ A;  4XPY A;  2ZXR A;  5AC4 A;  2ETS A;  2J9B A;  1JMW A;  2GDC A;  2YEV A;  4CS9 A;  1ZW3 A;  3ZWI A;  2OJE D;  2KC3 A;  2A68 F;  3LUT B;  1LM3 B;  1KU2 A;  2IXN A;  4ZLC A;  1J8Y F;  3SXK A;  2EPL X;  5A6B A;  2WL8 A;  2PBE A;  2OJQ A;  4JIO A;  3W4Y A;  1I5N A;  1L7C A;  2EPM X;  3U9J A;  3TD7 A;  4DBQ A;  5JT4 A;  1K40 A;  2HS5 A;  2Q3T A;  1XZP A;  2IXM A;  3H65 A;  3KYI A;  3MYF A;  4CJG A;  4GQH A;  1NG1 A;  2YL1 A;  4IB4 A;  3IPM O;  4YK5 A;  1HMD A;  1KNY A;  4Q5S F;  2B0J A;  2OG2 A;  1ZHW A;  2HSQ A;  4CS8 A;  4YL1 A;  1EKY A;  4BG0 A;  3K66 A;  3Q7L A;  2LD6 A;  2QLA A;  4DRI B;  4EIY A;  1YJG A;  4I3M A;  4PJM A;  4JTA B;  1WTY A;  3RW0 A;  2CGE A;  2LQG A;  3B71 A;  1W2W A;  1FMW A;  3B9Q A;  1XWJ A;  2IM8 A;  3K6B A;  4P6I C;  5JP7 A;  4C3D A;  3I5P A;  3EGD A;  4NC3 A;  4XTK A;  1RJ9 A;  5JS5 A;  5AGF A;  3MX3 A;  3T6B A;  3NKD A;  5CIV A;  3IHU A;  4PR9 A;  3KH2 A;  3DJU B;  3RVY A;  3EGD B;  2OEX A;  3EPV A;  1A0B A;  1EI7 A;  1JPJ A;  1LI5 A;  1RJ9 B;  3QTH A;  4KBL A;  3VRC A;  4QI2 A;  3EFO A;  4WAB A;  3NMI A;  1JOG A;  2HV6 A;  3N2Z B;  1NZE A;  2YRF A;  2B0H A;  4J32 B;  4N4W A;  4U5B E;  4OD4 A;  5FZT A;  4ER9 A;  2HZ8 A;  1H7I A;  2R7Q A;  3EFO B;  3T6G B;  3ZIB A;  4MTO A;  1Z3I X;  3JTL O;  2A69 F;  2A6E F;  2XL8 A;  5L0I A;  3ABK C;  1QKR A;  3RKO F;  1A41 A;  3V5Y A;  2ZXW C;  3UNG C;  1ZW2 A;  2DYR C;  2NUP B;  2P1A A;  3RQF A;  3TOM A;  1ZYR F;  3UMH A;  4YT5 A;  4EBJ A;  3FDQ A;  2VCB A;  3U8P A;  2Y3H A;  3QW1 A;  2VC9 A;  2BL2 A;  4CS7 A;  3C8G B;  5KYX A;  2L9J A;  3DZA A;  4X0R A;  3RH3 A;  2ICW G;  5B1B C;  4CDV A;  4LLE A;  3IQ6 A;  2AWY A;  3V7O A;  2J7P D;  1BR2 A;  4XLP F;  2XSE A;  3HNJ A;  4Q7C A;  2UUI A;  3QZC A;  3UR3 C;  5L0H A;  5B1A C;  4KNV A;  5KYY B;  4AL1 A;  1FFT C;  4J7T A;  2PP4 A;  4JKV A;  1BBH A;  2KYH A;  1C02 A;  4JJG A;  3V5Z A;  5B3I A;  1MMA A;  1D1B A;  3F47 A;  3GM3 A;  1MQV A;  4XQ1 A;  3U2L A;  3DKA A;  3SP1 A;  4GYT A;  1A7D A;  1V55 C;  4OD5 A;  3AQC A;  2BE5 F;  4IJJ A;  2AP3 A;  3RVZ A;  5E3A A;  1K04 A;  1HW1 A;  1M57 C;  1Q0F A;  2QTV A;  4WJ0 A;  4OIQ F;  4JCH A;  3RQG A;  1S7Z A;  4IWB A;  3KMI A;  3FAJ A;  1U6H A;  1NFO A;  5EK0 A;  4YT2 A;  3POV A;  1MMG A;  2D4U A;  3H2U A;  3H2V A;  4YT4 A;  3EGX A;  3SNH A;  4PJN A;  3GM1 A;  3UMI A;  3DD7 A;  2XLE A;  2R7O A;  3GEE A;  3HJC A;  4DVZ A;  5JVE A;  2P6V A;  3HNI A;  2YWA A;  4U5D E;  2WZG A;  4JTD B;  2J7P A;  2I15 A;  3GAN A;  4KC9 A;  1I4Y A;  2IYL D;  1T5O A;  1QZX A;  3FOP A;  3S9O A;  4DJ9 A;  3U0C A;  3S28 A;  4AE4 A;  1OCR C;  3GEH A;  4JUR I;  3SYN A;  4LER A;  1YVI A;  2LFD A;  3I5Q A;  5COF A;  5COM A;  1SR2 A;  2Y39 A;  2L81 A;  5T3W A;  1FNT c;  2R7T A;  1G5Z A;  1MND A;  1WOL A;  1D0X A;  1SYQ A;  2L7A A;  3DM5 A;  1M6T A;  2KGO A;  4DRH B;  4JZA A;  4I1O B;  3CQZ A;  5DQT A;  2WB7 A;  3R2P A;  4A2N B;  4Z9J A;  2GA0 A;  2Q00 A;  4U5C E;  5A6K A;  1FR0 A;  2VAS A;  4E7S A;  3SZR A;  3MLG A;  4BJ5 C;  1Z23 A;  1YZA A;  3UMK A;  5DQZ A;  5E2Q A;  3EHN A;  4A4A A;  2LK4 A;  4CS8 C;  3WG7 C;  3HTK C;  2R7V A;  1G8X A;  1N1C A;  3L8I A;  1M2O A;  4XPX A;  2YL7 A;  1LPE A;  1VYI A;  1YYX A;  1LE2 A;  3N0T A;  4O6N A;  1RKC A;  3EG9 A;  1Z5Z A;  3MBG A;  3KL4 A;  5A6J A;  2LSE A;  4XWJ A;  2JD3 A;  1T6Q A;  3FHD A;  1Z63 A;  2Q4F A;  2Y3G A;  4LLC A;  4IAO A;  3TOL A;  3EG9 B;  4EUK B;  3K1H A;  5EGY A;  3E9V A;  2NG1 A;  5L0G A;  4J7Y A;  4CJO A;  3GOD A;  1O87 A;  2IXO A;  2AVK A;  2R7U A;  3W2W A;  2TMV P;  1NFN A;  1A7V A;  2ZPA A;  4K0D A;  2XS8 A;  2CYD A;  1YZC A;  3HNK A;  3JSZ A;  4HEA J;  4LDK A;  3VM6 A;  4EWC A;  1PV3 A;  1WWP A;  2Y3D A;  1F1M A;  2X51 A;  3ASO C;  4ONS A;  2R25 A;  1JPN A;  4C7O A;  1QLE C;  1AUE A;  2A1D D;  3AG1 C;  3E70 C;  1Y4C A;  1U89 A;  1T6I A;  1E84 A;  1JRA A;  4ANJ A;  3MYI A;  3G4X A;  2H8A A;  1NLX A;  1M2V A;  2XM4 A;  1QPU A;  3EH2 A;  3F46 A;  4C7O B;  2OQM A;  2R05 A;  4WGY A;  2LP4 A;  3US6 A;  3JRM O;  2C04 A;  1E2X A;  1OQC A;  1RCP A;  2KSF A;  3DWW A;  3M4C A;  2A6H F;  1WN0 A;  1M2V B;  3DAG A;  3DM9 B;  4YL3 A;  1M56 C;  3W2V A;  4CDA A;  3AQB A;  2R7W A;  3N24 A;  3ASN C;  2J45 A;  2L6G A;  2RSE B;  4K7B A;  1OXK A;  1JAF A;  4L6R A;  3K1I C;  2DYS C;  4JEA A;  4NCQ A;  1Z7Q c;  3W8H A;  1RMV A;  2IXP A;  1KTM A;  3M4B A;  3QVZ A;  5GPG B;  4EBB A;  2XXA A;  3IQC A;  1VYK A;  3JZ0 A;  3S0X A;  2YKZ A;  4H54 A;  5L0J A;  4MW8 A;  3NG1 A;  3LAY A;  4BJ5 A;  2VCC A;  4KNW A;  5DLJ A;  2XXA B;  5BQG A;  3JYH A;  2AU5 A;  3T6J A;  3B0U X;  4OIP F;  5A6A A;  1TWG A;  1ZHX A;  4XEV A;  4PFP A;  4XPW A;  1CGO A;  3QW0 A;  2Q9A A;  3LEV A;  4G7H F;  2M4E A;  1O3U A;  2R7X A;  4O79 A;  4RBN A;  4G78 A;  1G4U S;  4CSA A;  1OCZ C;  1HW2 A;  1VOM A;  1UG7 A;  2FAP B;  2ZXP A;  2NSF A;  4MVM A;  2WVQ A;  4DXW A;  5KYU A;  3CEX A;  1CGN A;  4IRU A;  1MMD A;  3LLI A;  4D4X A;  5COG A;  3IEE A;  2XLW A;  4HE8 D;  5K0I A;  5HV9 A;  2XLD A;  3NDB B;  3L1M A;  2G3K A;  1MNE A;  4OIO F;  5KYU B;  3T9O A;  1IW7 F;  1OCC C;  1RKE A;  3SXZ A;  3U3B A;  4MQ9 F;  4B6I A;  4F4B A;  1T9K A;  2HFI A;  3Q6N A;  5CI9 A;  5BQI A;  1YAU O;  4JW1 A;  5BUO A;  2P7V A;  2XLO A;  3JT1 A;  4JEB A;  4N06 A;  3V5X A;  3AG4 C;  2HMZ A;  1TWH A;  4OIR F;  3RYL A;  1L3P A;  2KQ9 A;  2M64 A;  1AVO B;  1D1C A;  5KYX B;  1G4W R;  3FOO A;  3PHF 2;  3DJN B;  3HKK A;  3I4U A;  3DMD A;  2D5R B;  2HJM A;  3NMJ A;  1HE9 A;  2I8B A;  1R4T A;  3AOU A;  3O6X A;  4JTC B;  3SXY A;  3O39 A;  5JUA A;  4CSA C;  2XRH A;  5F5F A;  2OCC C;  5E3C A;  2VH3 A;  3A11 A;  4BEJ A;  5L0D A;  256B A;  3K1I A;  3TK0 A;  5JRA A;  3C63 A;  1Q0M A;  1LVK A;  5L0F A;  1LI7 A;  3T4R A;  3U2M A;  2PX0 A;  4MVZ A;  1D1A A;  1TKN A;  4U9D A;  3AGU A;  4D4N A;  4E17 A;  2QUP A;  4BJ6 C;  1OKK D;  1ZU5 A;  3U5S A;  1HE1 A;  5EHH A;  3O55 A;  4GEH A;  3EZI A;  3MFN A;  2J8W A;  3DXJ F;  2PF4 E;  1V54 C;  2P61 A;  2KNH A;  2KW3 C;  2HV7 A;  2VB6 A;  2H7V C;  2OEV A;  2R9R B;  3WAQ A;  2WVN A;  1S05 A;  4NY3 A;  3ABM C;  4R32 A;  3U8V A;  3HLZ A;  3DE8 A;  3EGX B;  3X1O A;  1D0Z A;  4DBR A;  5DS5 A;  4PAC A;  4NTB A;  2HMQ A;  2X0C A;  1CPR A;  3ABL C;  5T3T A;  5F28 E;  2IOQ A;  5L0C A;  3KKB A;  4O7G A;  4FES A;  2YQY A;  3U9M A;  2RD9 A;  3CAX A;  4AE4 B;  2A0U A;  3M15 A;  3UGP A;  2CNW D;  2AWC A;  3SXM A;  1YYJ A;  4YL0 A;  1NBB A;  5TJ5 E;  1QVX A;  2C03 A;  2YVK A;  5KYN A;  4FWV A;  2GWW A;  3G4Z A;  4MVO A;  3NKE A;  3GM2 A;  3NRH A;  4I44 A;  3RF3 A;  4N6H A;  1O5H A;  1OKK A;  1V4A A;  2Q7R A;  3ZTM A;  1C03 A;  1ZU4 A;  1GGQ A;  2H7B A;  1YA7 O;  3LLK A;  3NMK A;  1ZZP A;  3GWL A;  4HFK B;  1LE4 A;  4C3E A;  4U5F E;  1VK5 A;  2XM0 A;  4RDA A;  5F5H A;  2QE9 A;  1U0B B;  2CW0 F;  2XLM A;  1BDJ B;  1A7E A;  4MW3 A;  2BC5 A;  1ZVZ A;  2W4B A;  3ZSU A;  2V26 A;  1BZ4 A;  3B0P A;  2J0X A;  1OR3 A;  2ZD9 A;  3A9C A;  4FAP B;  3LEO A;  4K1O A;  2G3V A;  2KK1 A;  2EIN C;  4LDQ A;  4EKW A;  2CNW A;  1VMA A;  2JX0 A;  1FAP B;  4WGZ A;  1GM5 A;  4JE9 A;  1NU9 C;  2ZXO A;  4YN0 B;  3EZH A;  3L8J A;  1BR1 A;  5JSL A;  1HY5 A;  1H9T A;  4IAR A;  2A0B A;  3BRJ A;  2XL4 A;  4LAC B;  4PK4 A;  1R5I D;  1VB5 A;  2PFD A;  3SEO A;  3ATP A;  1MMN A;  2KJG A;  2Q9C A;  4MTF A;  4DOZ A;  1YAR O;  2J46 A;  1IZM A;  2DGJ A;  2NUT A;  3VF0 A;  2EPK X;  1DOV A;  3C7J A;  1WGW A;  5E33 A;  3L0I A;  5B3S C;  1LS1 A;  4CIH A;  4OIN F;  2VCA A;  1HMO A;  3QVY A;  4U9E A;  2NUT B;  5FCL A;  3U3F A;  2YL3 A;  1TFK B;  2L6F A;  1QQ3 A;  1T01 A;  3GWN A;  2EIK C;  2F22 A;  2XLH A;  1ZHZ A;  1LIH A;  3M1C B;  4JJF A;  2HSB A;  4U5H A;  1DOW A;  1ZHT A;  4MS2 A;  3OEO A;  4J30 B;  4KI2 A;  4M63 A;  3NYJ A;  2H7O A;  4H4K C;  1D0Y A;  3NYM A;  2YLG A;  2NSG A;  3AG3 C;  4NTA A;  4NTF A;  5IY5 C;  1QSP A;  3EJN A;  2MWQ A;  1Q0G A; 
#chains in the Genus database with same CATH homology
 1I4Z A;  1HMD A;  3AGT A;  3WHN A;  1I4Y A;  2HMQ A;  4XQ1 A;  1A7E A;  4XPY A;  1A7D A;  1HMO A;  2AVK A;  2AWC A;  3AGU A;  2MHR A;  4XPW A;  2HMZ A;  2AWY A;  4XPX A;  3WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...