1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
4XPXA 3WAQA 2HMQA 2AWCA 1A7EA 3WHNA 2AWYA 4XPWA 1I4YA 2AVKA 2MHRA 3AGTA 1HMOA 4XQ1A 3AGUA 1I4ZA 1HMDA 1A7DA 2HMZA 4XPYA
chains in the Genus database with same CATH superfamily
3CAXA 3ABLC 1YARO 1ZVZA 2AWCA 1D0YA 1N1CA 4FESA 4CS9C 1UG7A 5KYXA 4U5GA 3RVYA 2OG2A 1LS4A 4PJNA 3T6GB 2D4UA 4BJ6A 3ZTZA 2XS8A 3G50A 5L0JA 2LSEA 3HNLA 3AQCA 2L9JA 1Z7Qc 3V5XA 1OR2A 3AG1C 4CDVA 1JPJA 3QZCA 3SZRA 2V3CC 4A2NB 1AEPA 2ZPAA 3K1IC 2YVKA 2CDQA 1TQGA 1EA8A 2EINC 4XQ1A 3UMHA 2GFHA 3QW1A 4LDKA 4QI0A 2Q7RA 2JX0A 2M64A 2KW3C 1Q0GA 1VLTA 2L6FA 5JLIA 1TKNA 3UNGC 1VTMP 2XM0A 3SYNA 4E17A 1L3PA 1K40A 1A41A 1FNTc 3VYWA 1M2OA 3EGDB 3SNHA 4BG0A 4CDYA 1CGNA 1NFOA 2NUTB 2KGOA 1E2XA 1XZQA 1A7VA 2Y3DA 3K7DA 3MBGA 2X0CA 4JC7A 2LQGA 2OEXA 5KYUA 2Q00A 1WASA 3RYLA 3U8PA 3GEEA 3I5PA 3W2VA 3ZIBA 2J9UA 1OCOC 3ABKC 2O9XA 4FX5A 3ZG1A 4LERA 5CIVA 5KYWB 5JS5A 4YT5A 3U8VA 2EIJC 2J9WA 2KYHA 2Q4FA 2NPUA 2Q9BA 2IBFA 1Y4CA 2YLDA 3NMJA 4G0HA 4XEVA 4YT2A 2C03A 3M1CB 3AG3C 4Z9HA 4JZAA 5KYXB 3QVZA 1V74B 3EGXA 2HKVA 2NSFA 2OJQA 2DB4A 2EPOA 1DOWA 2VCAA 1SR2A 3GORA 4XPXA 4HE8D 3SEOA 4JVSA 2R7WA 5L0CA 2OKUA 4YN0B 2H8AA 2J0XA 5A6BA 3M79A 4G7ZF 2I8BA 2J9VA 4MTFA 5GPGB 3EG9A 3NKDA 4EBKA 2WVQA 4W8PA 2JD3A 4DBRA 5DS4A 4CSAC 2Y3GA 3JTLO 3K66A 3PCVA 4WABA 3DE8A 2YL7A 3C8ZA 3EHMA 2MHRA 1E84A 1JRAA 2DYSC 3EFOA 4MS2A 4CX9A 4AL1A 1M6TA 1OKKD 3CSKA 2G3KA 3BRJA 5KYYA 2HJ3A 3H2VA 2R7RA 5DS6A 1I5NA 3VF0A 2FAPB 2P0NA 1H6GA 5JSLA 4F4BA 2L7AA 5B3IA 1OW6A 2EIMC 2PF4E 3ABMC 4IARA 4O6NA 1D1BA 1JPNA 2KNHA 3EPVA 3G4ZA 3MYFA 2HV6A 2P7VA 2XM4A 2R9RB 3GODA 3U5SA 3HLZA 5KYUB 1C03A 2VASA 2IM8A 4PJJA 3PDMP 1APCA 1YDIA 1U0BB 3TQOA 2EILC 4CS8C 3UGPA 3TD7A 1SZIA 4DJ9A 2AVKA 4EIYA 3C7JA 3TJ6A 4AK9A 2KSFA 2YQYA 1VOMA 5A6AA 1OQCA 3Q6MA 3JRTA 4N06A 3GM3A 1T9KA 1O5HA 2XLOA 1J8YF 2Q9AA 2Y3BA 2B0JA 1NLXA 5AGFA 4E18A 3Q7GA 2MWQA 1FFTC 3LJBA 4LLCA 5F28E 4J7YA 2HV7A 4BEJA 2EIKC 4XLNF 2EPMX 2QNLA 1NG1A 3T6BA 4ANJA 4YWQA 1EI7A 1MQVA 4Q7CA 1PD1A 4IGGA 1LI7A 2XSEA 5B1AC 1HMDA 3EG9B 1IW7F 2J46A 1QVXA 4JTDB 4EHPA 2R7TA 5F5FA 4U5FE 3HNIA 1LE4A 3S9OA 4PK4A 5A6JA 3DM5A 3WHNA 4JRZA 5T3WA 3NKEA 4D4NA 2HJMA 2YZSA 3EFOB 3U3BA 5L0IA 1GM5A 1M2VA 4U5EE 2ZXWC 1B68A 2IXOA 2LIGA 3AOUA 3MX3A 4JTCB 4LLEA 4R32A 5COFA 4BJ5A 5KYYB 1IZMA 4C3BA 1D1CA 3GM2A 3RVZA 4MVQA 1WTYA 2RSEB 3ITFA 4I1OB 2OEVA 1KTMA 5IY5C 1KU2A 2HSQA 3LEOA 5DQTA 2ZD9A 4OIOF 4DVZA 4MVOA 2J0WA 3JYYA 2IYLD 2P61A 3JZ0A 3LLKA 4XPYA 3O55A 3L34A 4BPMA 4CS9A 4FAPB 3S84A 3U0CA 3JRMO 1V54C 3U9MA 3RIPA 5A69A 4XEKA 4U5DE 2HSBA 2Q3TA 1ZW3A 4CBEA 5EGYA 1ZZPA 1CGME 1PCXA 1FAPB 2H7BA 3Q7LA 4OIRF 4N6HA 3NG1A 3TOMA 3K1IA 5T3TA 4ZLCA 3IQ5A 4JCZA 4HFKB 3S28A 3RQEA 3R7CA 4JURI 5E33A 4EWCA 2Y3HA 4M63A 1O87A 1E85A 4XLPF 1ZHTA 2XLVA 2XLMA 2J7PD 2YL0A 2OQMA 3IQCA 3TJ5A 3N0TA 3RW0A 3RH3A 2OU6A 1Z23A 1I4ZA 2A0BA 4WGYA 1HY5A 2QLAA 5JVEA 4E7SA 4U5HA 1V4AA 4AX2A 4W8KA 2BL2A 2ZXOA 1MNEA 2A0UA 2HZ8A 3AJMA 3CZ6A 1M2VB 4RDAA 4DBQA 3X2QC 4CJOA 2R7QA 3NDBB 2UUHA 3V7OA 3CQZA 3DJNB 3M4CA 2XLWA 3NMIA 3B0VC 5HV9A 3RKOF 4DOZA 1RJ9A 3B0UX 5BQIA 5L0FA 1FMVA 2QTVA 2F22A 3ZSUA 3K33A 3JSEO 3QVYA 3JYHA 2WZGA 3QMKA 3SXZA 1G4US 2LK4A 4WGZA 1W2WA 1OW7A 2VH3A 4IB4A 5COMA 2XL8A 1ORYA 1VYKA 4C3EA 1V55C 5E3AA 4DRHB 5L0HA 1TWAA 4O7GA 4BJTA 2IXMA 4I44A 3POVA 2A1DD 2MYSA 2OJED 2PX3A 2YHSA 1MMAA 2WZFA 4DRIB 2G3VA 3C18A 1K05A 3I4UA 3FOOA 2BE5F 4CSAA 1QLEC 4BEMJ 1XZPA 4NC3A 1OW8A 1RCPA 1TR2A 3EHNA 1SYQA 2EPLX 2XLDA 2IXNA 3KL4A 1NFNA 4RD9A 3US6A 2HUJA 1FFHA 1MMDA 2PNOA 3HKKA 3OA1A 1I4YA 4XWJA 2P1AA 3LNRA 1NBBA 3RQGA 5DLJA 4YL3A 3T9OA 1L7CA 2R7XA 3DD7A 3IQ6A 4HEAJ 4JEAA 3FMSA 4Q4ZF 2TMVP 4RBNA 2NG1A 4JJFA 4Z9JA 4EKWA 3IHUA 3NYJA 2UUIA 1Q0KA 1QSPA 1EKYA 2HS5A 4HFFB 3UGOA 3LESA 3AG2C 1YVIA 1OCRC 3MLGA 3WODF 4E7ZA 3RFYA 2W4BA 3E70C 3ECSA 1RJ9B 4CS8A 2XL6A 1T01A 3KYIA 1RKCA 1T5OA 2L6HA 2LD6A 4I1MA 2DGJA 1T6IA 2PBEA 3A9CA 3C8GD 3DM9B 3DWWA 1GQAA 4IAQA 4JCHA 3JSZA 1J8MF 2NSGA 4C3DA 1Z6AA 2D5RB 1QQ3A 3LUTB 3U2MA 1HE1A 4CDAA 3V5YA 1TFOB 1ZW2A 256BA 4PFOA 2QUPA 1ZHYA 1RKEA 1ZHWA 3I5QA 1LPEA 2Y39A 2W4MA 3AGTA 2EPNA 2R7OA 2H7VC 2J7PA 5K0IA 1C02A 3NYLA 5AC5A 4NTAA 4KNWA 3MFNA 4Q5SF 3LAYA 3UMIA 2AU5A 1KNYA 3KKBA 3ZVRA 4JEBA 1CGOA 4P9TA 3HTKC 2KQ9A 1YA7O 3T4RA 4Z9IA 2H7OA 1LVKA 4A4AA 1XWJA 1SF8A 2J8WA 4NTFA 4NTBA 1Q0MA 3T6JA 1YAUO 3KH2A 1Z63A 4P9FA 2GWWA 2J9BA 1O3UA 4JTAB 4MW3A 4GQHA 4OD4A 1DOVA 1RXQA 3KMIA 2FFHA 3H65A 3RQFA 1D0XA 3SXKA 4G7HF 2Q9CA 1FR0A 2XL4A 5EHHA 2VCCA 1LKXA 4E0IA 2OCCC 3PMRA 4UDVA 2ZXRA 1TWGA 1G8XA 1TFKB 3BEHA 5KYNA 1ORJA 1NU9C 2YLGA 3B0PA 3W4YA 3V5ZA 3QW0A 1LS1A 3IQTA 3HNJA 5JRAA 1MMNA 1ZHXA 3GWNA 4EUKB 4J7TA 2A6EF 3B29A 1VLSA 1U6HA 4J32B 3VRCA 3S0XA 3W8HA 3UMKA 3S29A 3R2PA 2HMZA 1PD0A 4MVSA 4AE4B 5JUAA 1YZAA 4YK5A 5DS5A 3M4BA 3U3FA 5BUOA 3F47A 5DVWA 2WVNA 1MMGA 3W8IA 1LM3B 4G78A 1BR1A 5A6BD 2XLEA 2P6VA 4CS7A 4OIQF 2PP4A 5L0DA 1RKEB 4JIOA 4O79A 4XTKA 5COGA 4U5CE 3EJNA 1R5ID 2ICWG 2YL1A 3CEXA 2DI3A 3L8JA 3LLIA 1WOLA 3LS0A 1D0ZA 3FHDA 3GEHA 1TWCA 2CNWD 5CI8A 3TOLA 3W2WA 4PJLA 2R7SA 4P6IC 4CIHA 1H9GA 1FMWA 1HW1A 1OKKA 5FCLA 4MQ9F 1U89A 1LI5A 4MNDA 5TJ5E 2WL8A 3FDQA 3OWTA 4IRUA 1AVOB 3AGUA 4N6CA 3VM6A 5F5HA 2XRHA 4E0HA 4K0DA 4KI2A 4OIPF 3FAPB 1EQ1A 3B9QA 1VK5A 2XS1A 5L0GA 1WATA 3C62A 4GEHA 5A6KA 2WB7A 3EH2A 3L1MA 1PV3A 3DE9A 3C63A 5JT4A 3NMKA 3ASOC 3FAJA 4AL0A 3C8GA 1NSGB 3N24A 4LDQA 3FOPA 1Q0DA 4IWBA 2ETSA 1BR2A 1Z5ZA 3ASNC 1OCCC 2B0HA 2C04A 2LFFA 2LP4A 2YL3A 4U9EA 4B6IA 1AUEA 1K04A 4MVMA 5JP7A 2A69F 1BDJB 4BJ6C 2A68F 2DYRC 1SMYF 2XXAA 1ZHZA 4MVRA 4WJ0A 4D4XA 3ZDLA 4YT8A 4N4WA 3AQBA 1Y6DA 3LEVA 3JCUQ 3FVYA 2RD9A 3QTHA 1NZEA 4CJGA 2IOQA 3DKAA 2R05A 2VC9A 5B1BC 3PHF2 4XEFA 2J45A 4DXWA 1E86A 1OXKA 2CW0F 3TULA 2YWAA 4NCQA 2PFDA 1A7EA 2NUPB 1WGWA 3KYJA 2R03A 3DAGA 1OCZC 5B3SC 1BZ4A 2XLHA 1LIHA 2KC3A 2KJGA 4H4KC 4I3MA 4K7BA 4MW8A 4YJWA 1JOGA 5BQGA 4OINF 3EQLF 1Q0FA 1OXBA 1E83A 2QY9A 1HMOA 2X51A 1UFBA 1YZCA 2YKZA 3GEIA 3IEEA 3N2ZB 2Y69C 1JMWA 1BR4A 4C7OA 1ORSC 1TWHA 4GYTA 4ONSA 5FZTA 4U9DA 1WWPA 2L81A 3DXJF 3C8GB 5E3CA 2OOCA 3GANA 1T6QA 1ZU4A 3F46A 3KPHA 4LACB 3ZQVA 3WAQA 1VB5A 2GAQA 2HFIA 4KC9A 2HMQA 3HJCA 3JT1A 4JJGA 1HE9A 4OD5A 1M56C 3M15A 1D1AA 1NU7D 2LCHA 5E2QA 2Z15A 3O6XA 4AE4A 3A11A 3EH1A 2XXAB 1S7ZA 4PJMA 1LE2A 4MTGA 2CNWA 3DJUB 2R02A 2WVOA 2A6HF 3HNKA 4EBJA 1ZU5A 2PX0A 1YLMA 4L6RA 5EK0A 4K1OA 4KBLA 1BBHA 4DVYP 1G5ZA 4IJJA 4JE9A 3S27A 3U2LA 3LNMB 4YT4A 5D91A 1VYIA 2JPUA 4BJ1A 5HSWA 2W45A 1ST6A 1YYXA 4X0RA 4J30B 1R4TA 2AP3A 3LS1A 2KK1A 3G4XA 2IXPA 5L3QA 1FTSA 3K1HA 1A7DA 1YJGA 2AWYA 2LFDA 4IAOA 3EZHA 4KNVA 1OR3A 2W9YA 3ATPA 4PACA 3L8IA 4YL1A 1HW2A 1YA9A 4O6MA 3ZWIA 3K6BA 2V26A 5D92A 2CGEA 1VMAA 3DZAA 2M4EA 1JR8A 1C17M 2QE9A 3AG4C 1G4WR 1M57C 4ULVA 3WG7C 2ASRA 1GGQA 3DMDA 3FXHA 4NQFA 4C7OB 2E87A 5BQHA 1QPUA 2GDCA 3MYIA 4H54A 3ZQYA 3EGXB 1QKRA 2VB6A 3J06A 4LDRA 1S05A 5CI9A 1H9TA 3Q6NA 1ZYRF 3O39A 3E9VA 1RMVA 4ZLDA 2L6GA 3EZIA 1T6UA 4YL0A 3DAFA 3ZC4A 3O10A 5T1DB 4JKVA 3GM1A 3IPMO 1YYJA 3RF3A 3SXYA 1H7IA 2YRFA 4ER9A 5AC4A 2R7UA 2CCYA 4MVUA 4FWVA 4PR9A 4ULWA 3U9JA 3ZTMA 2R25A 5DQZA 1CPQA 4JW1A 3NYMA 1WN0A 2CYDA 3VAYA 4G7OF 1JAFA 4QDLA 1A0BA 4XPWA 1MNDA 1F1MA 2R7VA 2WZLA 4NY3A 4MTOA 4EBBA 3EGDA 4MVZA 2NUPA 3GWLA 2NUTA 3SXMA 3UR3C 1Z3IX 2I15A 3X1OA 4U5BE 3DI5A 2YEVA 4BJ5C 5L3VA 3L0IA 4CIPA 1QZXA 3TK0A 4PFPA 2ZXPA 4QI2A 2YLIA 3NRHA 1CPRA 2G62A 3B71A 4DRJB 2FGYA 5KYWA 2BC5A 1GS9A 3S90A 2GA0A 2EPKX 4O6YA 3SP1A 3OEOA 2VCBA 3H2UA
chains in the Genus database with same CATH topology
4XPXA 3WAQA 2HMQA 2AWCA 1A7EA 3WHNA 2AWYA 4XPWA 1I4YA 2AVKA 2MHRA 3AGTA 1HMOA 4XQ1A 3AGUA 1I4ZA 1HMDA 1A7DA 2HMZA 4XPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPX A;  3WAQ A;  2HMQ A;  2AWC A;  1A7E A;  3WHN A;  2AWY A;  4XPW A;  1I4Y A;  2AVK A;  2MHR A;  3AGT A;  1HMO A;  4XQ1 A;  3AGU A;  1I4Z A;  1HMD A;  1A7D A;  2HMZ A;  4XPY A; 
#chains in the Genus database with same CATH topology
 3CAX A;  3ABL C;  1YAR O;  1ZVZ A;  2AWC A;  1D0Y A;  1N1C A;  4FES A;  4CS9 C;  1UG7 A;  5KYX A;  4U5G A;  3RVY A;  2OG2 A;  1LS4 A;  4PJN A;  3T6G B;  2D4U A;  4BJ6 A;  3ZTZ A;  2XS8 A;  3G50 A;  5L0J A;  2LSE A;  3HNL A;  3AQC A;  2L9J A;  1Z7Q c;  3V5X A;  1OR2 A;  3AG1 C;  4CDV A;  1JPJ A;  3QZC A;  3SZR A;  2V3C C;  4A2N B;  1AEP A;  2ZPA A;  3K1I C;  2YVK A;  2CDQ A;  1TQG A;  1EA8 A;  2EIN C;  4XQ1 A;  3UMH A;  2GFH A;  3QW1 A;  4LDK A;  4QI0 A;  2Q7R A;  2JX0 A;  2M64 A;  2KW3 C;  1Q0G A;  1VLT A;  2L6F A;  5JLI A;  1TKN A;  3UNG C;  1VTM P;  2XM0 A;  3SYN A;  4E17 A;  1L3P A;  1K40 A;  1A41 A;  1FNT c;  3VYW A;  1M2O A;  3EGD B;  3SNH A;  4BG0 A;  4CDY A;  1CGN A;  1NFO A;  2NUT B;  2KGO A;  1E2X A;  1XZQ A;  1A7V A;  2Y3D A;  3K7D A;  3MBG A;  2X0C A;  4JC7 A;  2LQG A;  2OEX A;  5KYU A;  2Q00 A;  1WAS A;  3RYL A;  3U8P A;  3GEE A;  3I5P A;  3W2V A;  3ZIB A;  2J9U A;  1OCO C;  3ABK C;  2O9X A;  4FX5 A;  3ZG1 A;  4LER A;  5CIV A;  5KYW B;  5JS5 A;  4YT5 A;  3U8V A;  2EIJ C;  2J9W A;  2KYH A;  2Q4F A;  2NPU A;  2Q9B A;  2IBF A;  1Y4C A;  2YLD A;  3NMJ A;  4G0H A;  4XEV A;  4YT2 A;  2C03 A;  3M1C B;  3AG3 C;  4Z9H A;  4JZA A;  5KYX B;  3QVZ A;  1V74 B;  3EGX A;  2HKV A;  2NSF A;  2OJQ A;  2DB4 A;  2EPO A;  1DOW A;  2VCA A;  1SR2 A;  3GOR A;  4XPX A;  4HE8 D;  3SEO A;  4JVS A;  2R7W A;  5L0C A;  2OKU A;  4YN0 B;  2H8A A;  2J0X A;  5A6B A;  3M79 A;  4G7Z F;  2I8B A;  2J9V A;  4MTF A;  5GPG B;  3EG9 A;  3NKD A;  4EBK A;  2WVQ A;  4W8P A;  2JD3 A;  4DBR A;  5DS4 A;  4CSA C;  2Y3G A;  3JTL O;  3K66 A;  3PCV A;  4WAB A;  3DE8 A;  2YL7 A;  3C8Z A;  3EHM A;  2MHR A;  1E84 A;  1JRA A;  2DYS C;  3EFO A;  4MS2 A;  4CX9 A;  4AL1 A;  1M6T A;  1OKK D;  3CSK A;  2G3K A;  3BRJ A;  5KYY A;  2HJ3 A;  3H2V A;  2R7R A;  5DS6 A;  1I5N A;  3VF0 A;  2FAP B;  2P0N A;  1H6G A;  5JSL A;  4F4B A;  2L7A A;  5B3I A;  1OW6 A;  2EIM C;  2PF4 E;  3ABM C;  4IAR A;  4O6N A;  1D1B A;  1JPN A;  2KNH A;  3EPV A;  3G4Z A;  3MYF A;  2HV6 A;  2P7V A;  2XM4 A;  2R9R B;  3GOD A;  3U5S A;  3HLZ A;  5KYU B;  1C03 A;  2VAS A;  2IM8 A;  4PJJ A;  3PDM P;  1APC A;  1YDI A;  1U0B B;  3TQO A;  2EIL C;  4CS8 C;  3UGP A;  3TD7 A;  1SZI A;  4DJ9 A;  2AVK A;  4EIY A;  3C7J A;  3TJ6 A;  4AK9 A;  2KSF A;  2YQY A;  1VOM A;  5A6A A;  1OQC A;  3Q6M A;  3JRT A;  4N06 A;  3GM3 A;  1T9K A;  1O5H A;  2XLO A;  1J8Y F;  2Q9A A;  2Y3B A;  2B0J A;  1NLX A;  5AGF A;  4E18 A;  3Q7G A;  2MWQ A;  1FFT C;  3LJB A;  4LLC A;  5F28 E;  4J7Y A;  2HV7 A;  4BEJ A;  2EIK C;  4XLN F;  2EPM X;  2QNL A;  1NG1 A;  3T6B A;  4ANJ A;  4YWQ A;  1EI7 A;  1MQV A;  4Q7C A;  1PD1 A;  4IGG A;  1LI7 A;  2XSE A;  5B1A C;  1HMD A;  3EG9 B;  1IW7 F;  2J46 A;  1QVX A;  4JTD B;  4EHP A;  2R7T A;  5F5F A;  4U5F E;  3HNI A;  1LE4 A;  3S9O A;  4PK4 A;  5A6J A;  3DM5 A;  3WHN A;  4JRZ A;  5T3W A;  3NKE A;  4D4N A;  2HJM A;  2YZS A;  3EFO B;  3U3B A;  5L0I A;  1GM5 A;  1M2V A;  4U5E E;  2ZXW C;  1B68 A;  2IXO A;  2LIG A;  3AOU A;  3MX3 A;  4JTC B;  4LLE A;  4R32 A;  5COF A;  4BJ5 A;  5KYY B;  1IZM A;  4C3B A;  1D1C A;  3GM2 A;  3RVZ A;  4MVQ A;  1WTY A;  2RSE B;  3ITF A;  4I1O B;  2OEV A;  1KTM A;  5IY5 C;  1KU2 A;  2HSQ A;  3LEO A;  5DQT A;  2ZD9 A;  4OIO F;  4DVZ A;  4MVO A;  2J0W A;  3JYY A;  2IYL D;  2P61 A;  3JZ0 A;  3LLK A;  4XPY A;  3O55 A;  3L34 A;  4BPM A;  4CS9 A;  4FAP B;  3S84 A;  3U0C A;  3JRM O;  1V54 C;  3U9M A;  3RIP A;  5A69 A;  4XEK A;  4U5D E;  2HSB A;  2Q3T A;  1ZW3 A;  4CBE A;  5EGY A;  1ZZP A;  1CGM E;  1PCX A;  1FAP B;  2H7B A;  3Q7L A;  4OIR F;  4N6H A;  3NG1 A;  3TOM A;  3K1I A;  5T3T A;  4ZLC A;  3IQ5 A;  4JCZ A;  4HFK B;  3S28 A;  3RQE A;  3R7C A;  4JUR I;  5E33 A;  4EWC A;  2Y3H A;  4M63 A;  1O87 A;  1E85 A;  4XLP F;  1ZHT A;  2XLV A;  2XLM A;  2J7P D;  2YL0 A;  2OQM A;  3IQC A;  3TJ5 A;  3N0T A;  3RW0 A;  3RH3 A;  2OU6 A;  1Z23 A;  1I4Z A;  2A0B A;  4WGY A;  1HY5 A;  2QLA A;  5JVE A;  4E7S A;  4U5H A;  1V4A A;  4AX2 A;  4W8K A;  2BL2 A;  2ZXO A;  1MNE A;  2A0U A;  2HZ8 A;  3AJM A;  3CZ6 A;  1M2V B;  4RDA A;  4DBQ A;  3X2Q C;  4CJO A;  2R7Q A;  3NDB B;  2UUH A;  3V7O A;  3CQZ A;  3DJN B;  3M4C A;  2XLW A;  3NMI A;  3B0V C;  5HV9 A;  3RKO F;  4DOZ A;  1RJ9 A;  3B0U X;  5BQI A;  5L0F A;  1FMV A;  2QTV A;  2F22 A;  3ZSU A;  3K33 A;  3JSE O;  3QVY A;  3JYH A;  2WZG A;  3QMK A;  3SXZ A;  1G4U S;  2LK4 A;  4WGZ A;  1W2W A;  1OW7 A;  2VH3 A;  4IB4 A;  5COM A;  2XL8 A;  1ORY A;  1VYK A;  4C3E A;  1V55 C;  5E3A A;  4DRH B;  5L0H A;  1TWA A;  4O7G A;  4BJT A;  2IXM A;  4I44 A;  3POV A;  2A1D D;  2MYS A;  2OJE D;  2PX3 A;  2YHS A;  1MMA A;  2WZF A;  4DRI B;  2G3V A;  3C18 A;  1K05 A;  3I4U A;  3FOO A;  2BE5 F;  4CSA A;  1QLE C;  4BEM J;  1XZP A;  4NC3 A;  1OW8 A;  1RCP A;  1TR2 A;  3EHN A;  1SYQ A;  2EPL X;  2XLD A;  2IXN A;  3KL4 A;  1NFN A;  4RD9 A;  3US6 A;  2HUJ A;  1FFH A;  1MMD A;  2PNO A;  3HKK A;  3OA1 A;  1I4Y A;  4XWJ A;  2P1A A;  3LNR A;  1NBB A;  3RQG A;  5DLJ A;  4YL3 A;  3T9O A;  1L7C A;  2R7X A;  3DD7 A;  3IQ6 A;  4HEA J;  4JEA A;  3FMS A;  4Q4Z F;  2TMV P;  4RBN A;  2NG1 A;  4JJF A;  4Z9J A;  4EKW A;  3IHU A;  3NYJ A;  2UUI A;  1Q0K A;  1QSP A;  1EKY A;  2HS5 A;  4HFF B;  3UGO A;  3LES A;  3AG2 C;  1YVI A;  1OCR C;  3MLG A;  3WOD F;  4E7Z A;  3RFY A;  2W4B A;  3E70 C;  3ECS A;  1RJ9 B;  4CS8 A;  2XL6 A;  1T01 A;  3KYI A;  1RKC A;  1T5O A;  2L6H A;  2LD6 A;  4I1M A;  2DGJ A;  1T6I A;  2PBE A;  3A9C A;  3C8G D;  3DM9 B;  3DWW A;  1GQA A;  4IAQ A;  4JCH A;  3JSZ A;  1J8M F;  2NSG A;  4C3D A;  1Z6A A;  2D5R B;  1QQ3 A;  3LUT B;  3U2M A;  1HE1 A;  4CDA A;  3V5Y A;  1TFO B;  1ZW2 A;  256B A;  4PFO A;  2QUP A;  1ZHY A;  1RKE A;  1ZHW A;  3I5Q A;  1LPE A;  2Y39 A;  2W4M A;  3AGT A;  2EPN A;  2R7O A;  2H7V C;  2J7P A;  5K0I A;  1C02 A;  3NYL A;  5AC5 A;  4NTA A;  4KNW A;  3MFN A;  4Q5S F;  3LAY A;  3UMI A;  2AU5 A;  1KNY A;  3KKB A;  3ZVR A;  4JEB A;  1CGO A;  4P9T A;  3HTK C;  2KQ9 A;  1YA7 O;  3T4R A;  4Z9I A;  2H7O A;  1LVK A;  4A4A A;  1XWJ A;  1SF8 A;  2J8W A;  4NTF A;  4NTB A;  1Q0M A;  3T6J A;  1YAU O;  3KH2 A;  1Z63 A;  4P9F A;  2GWW A;  2J9B A;  1O3U A;  4JTA B;  4MW3 A;  4GQH A;  4OD4 A;  1DOV A;  1RXQ A;  3KMI A;  2FFH A;  3H65 A;  3RQF A;  1D0X A;  3SXK A;  4G7H F;  2Q9C A;  1FR0 A;  2XL4 A;  5EHH A;  2VCC A;  1LKX A;  4E0I A;  2OCC C;  3PMR A;  4UDV A;  2ZXR A;  1TWG A;  1G8X A;  1TFK B;  3BEH A;  5KYN A;  1ORJ A;  1NU9 C;  2YLG A;  3B0P A;  3W4Y A;  3V5Z A;  3QW0 A;  1LS1 A;  3IQT A;  3HNJ A;  5JRA A;  1MMN A;  1ZHX A;  3GWN A;  4EUK B;  4J7T A;  2A6E F;  3B29 A;  1VLS A;  1U6H A;  4J32 B;  3VRC A;  3S0X A;  3W8H A;  3UMK A;  3S29 A;  3R2P A;  2HMZ A;  1PD0 A;  4MVS A;  4AE4 B;  5JUA A;  1YZA A;  4YK5 A;  5DS5 A;  3M4B A;  3U3F A;  5BUO A;  3F47 A;  5DVW A;  2WVN A;  1MMG A;  3W8I A;  1LM3 B;  4G78 A;  1BR1 A;  5A6B D;  2XLE A;  2P6V A;  4CS7 A;  4OIQ F;  2PP4 A;  5L0D A;  1RKE B;  4JIO A;  4O79 A;  4XTK A;  5COG A;  4U5C E;  3EJN A;  1R5I D;  2ICW G;  2YL1 A;  3CEX A;  2DI3 A;  3L8J A;  3LLI A;  1WOL A;  3LS0 A;  1D0Z A;  3FHD A;  3GEH A;  1TWC A;  2CNW D;  5CI8 A;  3TOL A;  3W2W A;  4PJL A;  2R7S A;  4P6I C;  4CIH A;  1H9G A;  1FMW A;  1HW1 A;  1OKK A;  5FCL A;  4MQ9 F;  1U89 A;  1LI5 A;  4MND A;  5TJ5 E;  2WL8 A;  3FDQ A;  3OWT A;  4IRU A;  1AVO B;  3AGU A;  4N6C A;  3VM6 A;  5F5H A;  2XRH A;  4E0H A;  4K0D A;  4KI2 A;  4OIP F;  3FAP B;  1EQ1 A;  3B9Q A;  1VK5 A;  2XS1 A;  5L0G A;  1WAT A;  3C62 A;  4GEH A;  5A6K A;  2WB7 A;  3EH2 A;  3L1M A;  1PV3 A;  3DE9 A;  3C63 A;  5JT4 A;  3NMK A;  3ASO C;  3FAJ A;  4AL0 A;  3C8G A;  1NSG B;  3N24 A;  4LDQ A;  3FOP A;  1Q0D A;  4IWB A;  2ETS A;  1BR2 A;  1Z5Z A;  3ASN C;  1OCC C;  2B0H A;  2C04 A;  2LFF A;  2LP4 A;  2YL3 A;  4U9E A;  4B6I A;  1AUE A;  1K04 A;  4MVM A;  5JP7 A;  2A69 F;  1BDJ B;  4BJ6 C;  2A68 F;  2DYR C;  1SMY F;  2XXA A;  1ZHZ A;  4MVR A;  4WJ0 A;  4D4X A;  3ZDL A;  4YT8 A;  4N4W A;  3AQB A;  1Y6D A;  3LEV A;  3JCU Q;  3FVY A;  2RD9 A;  3QTH A;  1NZE A;  4CJG A;  2IOQ A;  3DKA A;  2R05 A;  2VC9 A;  5B1B C;  3PHF 2;  4XEF A;  2J45 A;  4DXW A;  1E86 A;  1OXK A;  2CW0 F;  3TUL A;  2YWA A;  4NCQ A;  2PFD A;  1A7E A;  2NUP B;  1WGW A;  3KYJ A;  2R03 A;  3DAG A;  1OCZ C;  5B3S C;  1BZ4 A;  2XLH A;  1LIH A;  2KC3 A;  2KJG A;  4H4K C;  4I3M A;  4K7B A;  4MW8 A;  4YJW A;  1JOG A;  5BQG A;  4OIN F;  3EQL F;  1Q0F A;  1OXB A;  1E83 A;  2QY9 A;  1HMO A;  2X51 A;  1UFB A;  1YZC A;  2YKZ A;  3GEI A;  3IEE A;  3N2Z B;  2Y69 C;  1JMW A;  1BR4 A;  4C7O A;  1ORS C;  1TWH A;  4GYT A;  4ONS A;  5FZT A;  4U9D A;  1WWP A;  2L81 A;  3DXJ F;  3C8G B;  5E3C A;  2OOC A;  3GAN A;  1T6Q A;  1ZU4 A;  3F46 A;  3KPH A;  4LAC B;  3ZQV A;  3WAQ A;  1VB5 A;  2GAQ A;  2HFI A;  4KC9 A;  2HMQ A;  3HJC A;  3JT1 A;  4JJG A;  1HE9 A;  4OD5 A;  1M56 C;  3M15 A;  1D1A A;  1NU7 D;  2LCH A;  5E2Q A;  2Z15 A;  3O6X A;  4AE4 A;  3A11 A;  3EH1 A;  2XXA B;  1S7Z A;  4PJM A;  1LE2 A;  4MTG A;  2CNW A;  3DJU B;  2R02 A;  2WVO A;  2A6H F;  3HNK A;  4EBJ A;  1ZU5 A;  2PX0 A;  1YLM A;  4L6R A;  5EK0 A;  4K1O A;  4KBL A;  1BBH A;  4DVY P;  1G5Z A;  4IJJ A;  4JE9 A;  3S27 A;  3U2L A;  3LNM B;  4YT4 A;  5D91 A;  1VYI A;  2JPU A;  4BJ1 A;  5HSW A;  2W45 A;  1ST6 A;  1YYX A;  4X0R A;  4J30 B;  1R4T A;  2AP3 A;  3LS1 A;  2KK1 A;  3G4X A;  2IXP A;  5L3Q A;  1FTS A;  3K1H A;  1A7D A;  1YJG A;  2AWY A;  2LFD A;  4IAO A;  3EZH A;  4KNV A;  1OR3 A;  2W9Y A;  3ATP A;  4PAC A;  3L8I A;  4YL1 A;  1HW2 A;  1YA9 A;  4O6M A;  3ZWI A;  3K6B A;  2V26 A;  5D92 A;  2CGE A;  1VMA A;  3DZA A;  2M4E A;  1JR8 A;  1C17 M;  2QE9 A;  3AG4 C;  1G4W R;  1M57 C;  4ULV A;  3WG7 C;  2ASR A;  1GGQ A;  3DMD A;  3FXH A;  4NQF A;  4C7O B;  2E87 A;  5BQH A;  1QPU A;  2GDC A;  3MYI A;  4H54 A;  3ZQY A;  3EGX B;  1QKR A;  2VB6 A;  3J06 A;  4LDR A;  1S05 A;  5CI9 A;  1H9T A;  3Q6N A;  1ZYR F;  3O39 A;  3E9V A;  1RMV A;  4ZLD A;  2L6G A;  3EZI A;  1T6U A;  4YL0 A;  3DAF A;  3ZC4 A;  3O10 A;  5T1D B;  4JKV A;  3GM1 A;  3IPM O;  1YYJ A;  3RF3 A;  3SXY A;  1H7I A;  2YRF A;  4ER9 A;  5AC4 A;  2R7U A;  2CCY A;  4MVU A;  4FWV A;  4PR9 A;  4ULW A;  3U9J A;  3ZTM A;  2R25 A;  5DQZ A;  1CPQ A;  4JW1 A;  3NYM A;  1WN0 A;  2CYD A;  3VAY A;  4G7O F;  1JAF A;  4QDL A;  1A0B A;  4XPW A;  1MND A;  1F1M A;  2R7V A;  2WZL A;  4NY3 A;  4MTO A;  4EBB A;  3EGD A;  4MVZ A;  2NUP A;  3GWL A;  2NUT A;  3SXM A;  3UR3 C;  1Z3I X;  2I15 A;  3X1O A;  4U5B E;  3DI5 A;  2YEV A;  4BJ5 C;  5L3V A;  3L0I A;  4CIP A;  1QZX A;  3TK0 A;  4PFP A;  2ZXP A;  4QI2 A;  2YLI A;  3NRH A;  1CPR A;  2G62 A;  3B71 A;  4DRJ B;  2FGY A;  5KYW A;  2BC5 A;  1GS9 A;  3S90 A;  2GA0 A;  2EPK X;  4O6Y A;  3SP1 A;  3OEO A;  2VCB A;  3H2U A; 
#chains in the Genus database with same CATH homology
 4XPX A;  3WAQ A;  2HMQ A;  2AWC A;  1A7E A;  3WHN A;  2AWY A;  4XPW A;  1I4Y A;  2AVK A;  2MHR A;  3AGT A;  1HMO A;  4XQ1 A;  3AGU A;  1I4Z A;  1HMD A;  1A7D A;  2HMZ A;  4XPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...