1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
molecule tags Oxygen storage/transport
molecule keywords METHEMERYTHRIN
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
2HMZA 1HMOA 2AVKA 3AGTA 1I4ZA 3WHNA 2MHRA 4XQ1A 4XPYA 3WAQA 2AWCA 3AGUA 2HMQA 2AWYA 1HMDA 4XPXA 4XPWA 1A7DA 1I4YA 1A7EA
chains in the Genus database with same CATH superfamily
2UUHA 3G4XA 3Q6NA 5BQGA 4CJOA 3MLGA 4CS7A 1VYKA 2ZXRA 4O6YA 3HNKA 5E3AA 3L1MA 3AGTA 4YT2A 2YL0A 1YLMA 4P9TA 3TJ5A 2R7VA 3B0PA 3EPVA 1TQGA 4K1OA 2PFDA 3EG9B 3GODA 1J8MF 1LS1A 3SXZA 2LCHA 2MWQA 5T3WA 2YKZA 4CSAC 4OD5A 1OXKA 5T3TA 1LI5A 1C17M 2IXNA 4NQFA 3F47A 3V5YA 4BEMJ 3IQ5A 3LAYA 4H54A 2L7AA 4AK9A 2Y39A 1UFBA 4QI0A 3T4RA 3AQBA 3ASOC 1QZXA 1O3UA 5KYYA 4JCHA 4WJ0A 2NUPA 3NYLA 3DMDA 3L0IA 3W2WA 2PF4E 4MVQA 4CDVA 1M2VB 2EPMX 5DS4A 5A6BA 5D91A 3KPHA 2A0BA 3M4BA 4CS8C 3EG9A 1CGNA 2R7SA 2OCCC 2YL3A 3C18A 2YZSA 3JRMO 2OOCA 1O87A 2J8WA 1EA8A 2XL6A 1G4WR 4YL0A 1JRAA 4L6RA 2KJGA 4RBNA 4B6IA 3FAPB 2CNWD 1QQ3A 2OJED 1S7ZA 2QLAA 1OCZC 4BJ5A 1ZHTA 3IHUA 3IQ6A 1S05A 4U5HA 3UNGC 4BJ6A 4G7ZF 1E85A 3ZWIA 1QLEC 3X1OA 1LE4A 3A11A 1JPJA 1A7EA 1ORYA 2DI3A 4J30B 3FHDA 3K66A 4QDLA 4BJ6C 2Q9CA 3W2VA 5BUOA 3GM3A 1HE1A 4OINF 3VF0A 1GS9A 3S9OA 4DRJB 4CBEA 3FXHA 1H9TA 4YL1A 1RMVA 5KYUB 1D1BA 2HKVA 1MQVA 2XM4A 3QW1A 4EBKA 3POVA 2R7WA 4XPXA 4HFKB 1GQAA 1MMAA 1OQCA 1XWJA 3DE9A 1SYQA 2CCYA 4PJNA 2J0WA 4C3DA 4NC3A 2Y3BA 1VLSA 1WOLA 1T6IA 3BEHA 1UG7A 3IEEA 1YZAA 1RKEB 2KW3C 4N6HA 4BJ1A 1M57C 1ORJA 2KYHA 2L9JA 5L0DA 5F28E 1E84A 3SZRA 2P0NA 2OQMA 2V26A 1E86A 4MW8A 2E87A 2IOQA 2Q9BA 2GWWA 1LE2A 1ZU4A 2G3KA 3WHNA 3FMSA 3OEOA 2ZD9A 3DJNB 2HUJA 3OWTA 3MFNA 3ECSA 4JVSA 3RVZA 2W4MA 1JAFA 3QZCA 3WG7C 4ZLDA 2ZPAA 4RD9A 2L6HA 3U8VA 1ST6A 3EGXA 5B3IA 1Z23A 2WB7A 2NSFA 3C8GD 2BL2A 2VCCA 3M15A 1V4AA 2NUTB 3NMIA 4CDYA 5EHHA 5L3QA 4AE4A 2A68F 5JVEA 1ZW3A 2XLWA 1Q0FA 2AWYA 3B29A 4G7OF 1T01A 3AOUA 2R25A 3SNHA 4JIOA 5JP7A 3ZIBA 2MHRA 3K33A 1D0XA 3SYNA 3JYYA 4K7BA 2XLVA 3WAQA 1RJ9B 4FX5A 5L0HA 2IXOA 5D92A 2GDCA 1G4US 4NTBA 3W8HA 3JSZA 3U2LA 2HS5A 2PX3A 5GPGB 4XEVA 3CQZA 2KSFA 2PBEA 3KYJA 5COGA 3C8GB 1BR2A 1PCXA 1Y4CA 2Y69C 1MNDA 3NKDA 4IWBA 5L0CA 1LKXA 1O5HA 5COFA 2J9BA 1NU9C 1VMAA 1C03A 1VYIA 2HSBA 2HV7A 3JCUQ 2I15A 4G7HF 3SP1A 2EILC 5DQTA 1QPUA 3CEXA 4JTAB 1SF8A 2OEXA 4K0DA 1FFHA 2H7VC 1FMVA 2IBFA 3M4CA 5BQHA 4XEFA 4Q4ZF 3LEVA 3LJBA 1A41A 3LLKA 4YT8A 3A9CA 1K05A 2QTVA 3DAFA 1Z6AA 3HJCA 3T6BA 2ZXWC 4NCQA 3O39A 3B0VC 3R7CA 4IAQA 1OXBA 2YL1A 3C7JA 2WZLA 5EGYA 2Y3HA 4OD4A 4IJJA 3UGPA 2Q3TA 1QSPA 4YT5A 1YARO 2J9VA 3M79A 1Q0KA 2W9YA 4F4BA 2CGEA 1ORSC 3E9VA 4U5BE 4ER9A 5JLIA 2JX0A 1OR3A 4ULVA 3ZC4A 4MNDA 4PACA 4E18A 2OKUA 3GANA 1JMWA 2B0JA 2IXMA 4X0RA 2Q00A 4MVMA 1T9KA 4WGYA 2W4BA 2B0HA 4ZLCA 2LD6A 4PFOA 5JUAA 4IRUA 3NMKA 1YA9A 1YYJA 3RVYA 4I44A 3HNIA 3S29A 2NUTA 5DLJA 2HJMA 4PJLA 2TMVP 1WASA 5L0JA 2BE5F 3MYIA 5A6KA 2OG2A 1HE9A 3DJUB 3VAYA 2F22A 3N24A 1FAPB 1RXQA 1U6HA 2J9WA 4PJMA 4NY3A 2KK1A 3T6JA 4CJGA 4EUKB 2IXPA 1T5OA 4XPYA 3PHF2 4YT4A 4EHPA 1ZHYA 2A69F 4DBQA 1EQ1A 1W2WA 2VCAA 4FWVA 4E0HA 4E0IA 2XLMA 2OU6A 2KC3A 1DOWA 4Z9HA 4MVOA 1V74B 2A1DD 4MW3A 2R7RA 3V5ZA 1YJGA 2YEVA 3EJNA 4PR9A 3W4YA 2XSEA 4M63A 2FAPB 3US6A 1NG1A 5JT4A 3C8ZA 2WZFA 3ITFA 1V54C 1M6TA 2WVQA 3RFYA 3HKKA 4U9EA 2EPNA 4U5FE 4BPMA 2P1AA 3LNRA 2QE9A 5B1BC 4O79A 3RF3A 2J0XA 3KH2A 3ABMC 5AC4A 2OEVA 2L6GA 5AGFA 3I4UA 3RQFA 3V7OA 3ZDLA 1HW1A 5JRAA 2R7UA 4PJJA 5AC5A 2H7BA 3EFOA 4HFFB 1E83A 2G3VA 1A7DA 2XXAA 4JC7A 5B1AC 3RW0A 4QI2A 4EBBA 3EZHA 4JEAA 3TOMA 2J45A 4CSAA 2XLOA 3QMKA 1G5ZA 3DM9B 3SXYA 4BJTA 5HV9A 1CGOA 1E2XA 4JTDB 3UMHA 2A0UA 2QUPA 2YHSA 3AG1C 3JYHA 3QVZA 3E70C 1SR2A 3DXJF 4HEAJ 4CX9A 4DXWA 3H65A 2A6HF 3GEEA 1Z7Qc 3IQCA 1K04A 4KC9A 3DM5A 2X51A 2PP4A 5KYXB 4KNVA 1OKKA 1LS4A 3W8IA 5KYWA 1M56C 2YL7A 2GAQA 2H7OA 2LFDA 2AU5A 4IB4A 1VTMP 1CGME 1LIHA 4JCZA 4W8PA 5DQZA 1IZMA 4OIQF 2DB4A 5KYWB 2Y3DA 3RH3A 2R03A 2YRFA 4XLPF 2LK4A 3DKAA 1IW7F 2DYRC 2R7XA 3X2QC 1NZEA 256BA 3DAGA 4XLNF 2KQ9A 1VOMA 3U5SA 1TWGA 1AEPA 3RYLA 2J46A 2V3CC 3H2UA 3TQOA 1R4TA 4WGZA 4BG0A 2RSEB 1M2OA 4YWQA 2XS1A 2W45A 3TK0A 1BBHA 1D0YA 4Q7CA 3K6BA 3V5XA 5BQIA 3U9MA 4R32A 3B0UX 1GGQA 3FVYA 1Q0DA 3UGOA 4A4AA 3KKBA 1YYXA 3J06A 3B71A 3ZSUA 2NSGA 2R05A 3LUTB 3EH1A 4CS9A 1H9GA 5EK0A 4KBLA 2HMQA 3EGDA 4MTFA 1NSGB 1ZZPA 3ZTZA 5KYYB 5KYUA 2EIJC 3ABKC 4JZAA 1ZHWA 4MQ9F 3T6GB 1OW8A 3IQTA 2AVKA 2G62A 4JKVA 1F1MA 1HY5A 1APCA 1H6GA 1OR2A 3GEHA 5T1DB 1KU2A 3SXMA 3UMKA 3U2MA 1WGWA 4E7ZA 3F46A 4IARA 5CI8A 2NPUA 4XPWA 3GM2A 2R7TA 1JR8A 1J8YF 2ZXOA 1V55C 3L34A 3LNMB 1FTSA 4I1OB 1LPEA 1WATA 1YAUO 3UR3C 1HMDA 1WN0A 3SXKA 1BR1A 2IYLD 2D5RB 4DJ9A 5JS5A 1VLTA 4NTAA 2OJQA 5K0IA 2P7VA 4GYTA 4YK5A 4FESA 4MVZA 4DVYP 3QTHA 4JURI 4OIOF 1C02A 2WVOA 3HNJA 3ZQYA 5JSLA 2PNOA 2DYSC 3VRCA 3MYFA 3NMJA 3ZG1A 1ZW2A 4JE9A 4MS2A 3AGUA 2UUIA 3U3BA 1PD0A 3EGXB 4O7GA 2GFHA 3L8IA 2LSEA 1CPQA 3RIPA 3TOLA 3ASNC 3U8PA 1ZHZA 5CI9A 5A69A 5L0GA 3M1CB 3EHMA 3RKOF 4Z9IA 1OCOC 4U9DA 4C7OA 1TFOB 1VB5A 1WTYA 3EZIA 1A7VA 3OA1A 3TJ6A 2L6FA 2CW0F 4LLEA 1JOGA 3ZVRA 4CIPA 3NDBB 3HNLA 2KGOA 2EPOA 1KNYA 1OCRC 2EINC 3EHNA 3MBGA 1BR4A 3NKEA 3UMIA 3S0XA 1U0BB 4EKWA 2XLHA 3AJMA 3GWLA 4IGGA 5L0IA 4OIPF 3GM1A 1NFNA 3C8GA 1FFTC 1D1AA 3PMRA 4G78A 4DVZA 3S90A 4JJGA 1BZ4A 4MTOA 1OCCC 4O6NA 5DS6A 3NRHA 2ASRA 2JD3A 4DBRA 2A6EF 2R02A 3QW0A 1B68A 2EPKX 3AG4C 3Q7LA 3FDQA 3S28A 2P61A 1TWCA 1I4ZA 2WZGA 3ZTMA 3K7DA 4BEJA 3AQCA 2AWCA 1EI7A 1L7CA 4AE4B 5IY5C 2Z15A 3FAJA 4LDQA 4OIRF 2I8BA 4D4NA 3GWNA 3TD7A 4ONSA 2LFFA 3CZ6A 4BJ5C 2HFIA 1PD1A 1M2VA 1ZU5A 1SZIA 1ZVZA 2VCBA 3KYIA 1AUEA 4XWJA 2D4UA 2Y3GA 3S84A 5A6AA 1L3PA 1MMGA 3FOPA 4HE8D 2L81A 3IPMO 5E2QA 4E17A 4CIHA 2XM0A 5DS5A 4KNWA 2JPUA 3C62A 3JRTA 1Z5ZA 4DRIB 3DD7A 1YA7O 1Z3IX 2RD9A 3CAXA 2ETSA 4EWCA 3AG2C 4MVUA 2M4EA 3DE8A 3C63A 4J7TA 1YDIA 3JSEO 4J32B 4AL1A 2YLGA 2J9UA 4MVSA 4U5DE 3RQGA 5CIVA 1JPNA 3PCVA 3HLZA 3ZQVA 4FAPB 3L8JA 3LESA 4C3EA 4D4XA 1OKKD 4C7OB 2LQGA 3NG1A 2Q9AA 1A0BA 4DRHB 1OW7A 4LACB 4LDRA 4U5CE 1I4YA 2HV6A 3HTKC 3NYMA 4MVRA 2CNWA 2H8AA 4Z9JA 2J7PA 4E7SA 1RJ9A 1AVOB 4DOZA 5KYNA 2C04A 2VASA 1FR0A 3LLIA 4J7YA 3VYWA 4U5EE 4O6MA 1BDJB 1N1CA 2HZ8A 3I5PA 4GEHA 2XL8A 1XZPA 1GM5A 3H2VA 3AG3C 3U0CA 5A6BD 3ABLC 1G8XA 4N4WA 5KYXA 1NU7D 4PK4A 1Q0MA 2YQYA 1T6QA 5FZTA 1TR2A 1QVXA 2XLEA 1TFKB 2VB6A 3LS1A 4G0HA 5L3VA 1HW2A 5L0FA 3TULA 4PFPA 1R5ID 2EIKC 4WABA 5COMA 4AX2A 3FOOA 2R7OA 2YWAA 4RDAA 5B3SC 1Q0GA 1I5NA 1MMDA 3GORA 3DI5A 4JRZA 4W8KA 5E3CA 4EIYA 4IAOA 2FFHA 4JJFA 1FMWA 4YN0B 2YLDA 1MNEA 2X0CA 1OW6A 2ICWG 2MYSA 3B9QA 2VH3A 3JTLO 4YL3A 2EPLX 1EKYA 1RCPA 2AP3A 4KI2A 2C03A 3QVYA 2BC5A 2O9XA 3O6XA 1CPRA 1LVKA 4N06A 1NFOA 2QY9A 1ZYRF 1TKNA 1RKCA 3K1IC 1Z63A 3WODF 1NLXA 2PX0A 3T9OA 4U5GA 2NG1A 3EFOB 5F5HA 2KNHA 2XXAB 2HMZA 2LP4A 4ANJA 3I5QA 1DOVA 3RQEA 1NBBA 3EQLF 4LLCA 2WVNA 2CYDA 1WWPA 4Q5SF 2VC9A 4C3BA 1TWAA 4XQ1A 2XL4A 1LI7A 2DGJA 4MTGA 1K40A 5E33A 2R7QA 2J7PD 4LERA 1HMOA 4YJWA 2QNLA 3KMIA 3LS0A 3MX3A 2WL8A 1U89A 3CSKA 3VM6A 4A2NB 4JW1A 4UDVA 3N0TA 4P9FA 1FNTc 2Q4FA 2Q7RA 2GA0A 3PDMP 4CS9C 4H4KC 2R9RB 1LM3B 2NUPB 3LEOA 4P6IC 4I1MA 4EBJA 3O10A 4ULWA 1ZHXA 1XZQA 1H7IA 5DVWA 2M64A 2ZXPA 3G50A 1PV3A 3R2PA 2CDQA 1T6UA 3K1IA 4JEBA 1TWHA 4XEKA 3SEOA 3U3FA 5F5FA 5FCLA 4CS8A 1MMNA 3DZAA 1YZCA 4JTCB 3EH2A 1RKEA 3Q7GA 2XRHA 3G4ZA 3K1HA 3ATPA 2FGYA 3DWWA 5HSWA 1QKRA 2LIGA 3GEIA 1KTMA 2EIMC 2YVKA 3Q6MA 3S27A 3U9JA 3KL4A 5A6JA 4I3MA 1D0ZA 3BRJA 3EGDB 2IM8A 4AL0A 2XLDA 1SMYF 1YVIA 5TJ5E 4CDAA 1D1CA 4N6CA 2P6VA 3O55A 3JT1A 2HSQA 3N2ZB 1Y6DA 4GQHA 1VK5A 3NYJA 3JZ0A 4XTKA 4NTFA 2YLIA 4LDKA 2HJ3A 2XS8A
chains in the Genus database with same CATH topology
2HMZA 1HMOA 2AVKA 3AGTA 1I4ZA 3WHNA 2MHRA 4XQ1A 4XPYA 3WAQA 2AWCA 3AGUA 2HMQA 2AWYA 1HMDA 4XPXA 4XPWA 1A7DA 1I4YA 1A7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMZ A;  1HMO A;  2AVK A;  3AGT A;  1I4Z A;  3WHN A;  2MHR A;  4XQ1 A;  4XPY A;  3WAQ A;  2AWC A;  3AGU A;  2HMQ A;  2AWY A;  1HMD A;  4XPX A;  4XPW A;  1A7D A;  1I4Y A;  1A7E A; 
#chains in the Genus database with same CATH topology
 2UUH A;  3G4X A;  3Q6N A;  5BQG A;  4CJO A;  3MLG A;  4CS7 A;  1VYK A;  2ZXR A;  4O6Y A;  3HNK A;  5E3A A;  3L1M A;  3AGT A;  4YT2 A;  2YL0 A;  1YLM A;  4P9T A;  3TJ5 A;  2R7V A;  3B0P A;  3EPV A;  1TQG A;  4K1O A;  2PFD A;  3EG9 B;  3GOD A;  1J8M F;  1LS1 A;  3SXZ A;  2LCH A;  2MWQ A;  5T3W A;  2YKZ A;  4CSA C;  4OD5 A;  1OXK A;  5T3T A;  1LI5 A;  1C17 M;  2IXN A;  4NQF A;  3F47 A;  3V5Y A;  4BEM J;  3IQ5 A;  3LAY A;  4H54 A;  2L7A A;  4AK9 A;  2Y39 A;  1UFB A;  4QI0 A;  3T4R A;  3AQB A;  3ASO C;  1QZX A;  1O3U A;  5KYY A;  4JCH A;  4WJ0 A;  2NUP A;  3NYL A;  3DMD A;  3L0I A;  3W2W A;  2PF4 E;  4MVQ A;  4CDV A;  1M2V B;  2EPM X;  5DS4 A;  5A6B A;  5D91 A;  3KPH A;  2A0B A;  3M4B A;  4CS8 C;  3EG9 A;  1CGN A;  2R7S A;  2OCC C;  2YL3 A;  3C18 A;  2YZS A;  3JRM O;  2OOC A;  1O87 A;  2J8W A;  1EA8 A;  2XL6 A;  1G4W R;  4YL0 A;  1JRA A;  4L6R A;  2KJG A;  4RBN A;  4B6I A;  3FAP B;  2CNW D;  1QQ3 A;  2OJE D;  1S7Z A;  2QLA A;  1OCZ C;  4BJ5 A;  1ZHT A;  3IHU A;  3IQ6 A;  1S05 A;  4U5H A;  3UNG C;  4BJ6 A;  4G7Z F;  1E85 A;  3ZWI A;  1QLE C;  3X1O A;  1LE4 A;  3A11 A;  1JPJ A;  1A7E A;  1ORY A;  2DI3 A;  4J30 B;  3FHD A;  3K66 A;  4QDL A;  4BJ6 C;  2Q9C A;  3W2V A;  5BUO A;  3GM3 A;  1HE1 A;  4OIN F;  3VF0 A;  1GS9 A;  3S9O A;  4DRJ B;  4CBE A;  3FXH A;  1H9T A;  4YL1 A;  1RMV A;  5KYU B;  1D1B A;  2HKV A;  1MQV A;  2XM4 A;  3QW1 A;  4EBK A;  3POV A;  2R7W A;  4XPX A;  4HFK B;  1GQA A;  1MMA A;  1OQC A;  1XWJ A;  3DE9 A;  1SYQ A;  2CCY A;  4PJN A;  2J0W A;  4C3D A;  4NC3 A;  2Y3B A;  1VLS A;  1WOL A;  1T6I A;  3BEH A;  1UG7 A;  3IEE A;  1YZA A;  1RKE B;  2KW3 C;  4N6H A;  4BJ1 A;  1M57 C;  1ORJ A;  2KYH A;  2L9J A;  5L0D A;  5F28 E;  1E84 A;  3SZR A;  2P0N A;  2OQM A;  2V26 A;  1E86 A;  4MW8 A;  2E87 A;  2IOQ A;  2Q9B A;  2GWW A;  1LE2 A;  1ZU4 A;  2G3K A;  3WHN A;  3FMS A;  3OEO A;  2ZD9 A;  3DJN B;  2HUJ A;  3OWT A;  3MFN A;  3ECS A;  4JVS A;  3RVZ A;  2W4M A;  1JAF A;  3QZC A;  3WG7 C;  4ZLD A;  2ZPA A;  4RD9 A;  2L6H A;  3U8V A;  1ST6 A;  3EGX A;  5B3I A;  1Z23 A;  2WB7 A;  2NSF A;  3C8G D;  2BL2 A;  2VCC A;  3M15 A;  1V4A A;  2NUT B;  3NMI A;  4CDY A;  5EHH A;  5L3Q A;  4AE4 A;  2A68 F;  5JVE A;  1ZW3 A;  2XLW A;  1Q0F A;  2AWY A;  3B29 A;  4G7O F;  1T01 A;  3AOU A;  2R25 A;  3SNH A;  4JIO A;  5JP7 A;  3ZIB A;  2MHR A;  3K33 A;  1D0X A;  3SYN A;  3JYY A;  4K7B A;  2XLV A;  3WAQ A;  1RJ9 B;  4FX5 A;  5L0H A;  2IXO A;  5D92 A;  2GDC A;  1G4U S;  4NTB A;  3W8H A;  3JSZ A;  3U2L A;  2HS5 A;  2PX3 A;  5GPG B;  4XEV A;  3CQZ A;  2KSF A;  2PBE A;  3KYJ A;  5COG A;  3C8G B;  1BR2 A;  1PCX A;  1Y4C A;  2Y69 C;  1MND A;  3NKD A;  4IWB A;  5L0C A;  1LKX A;  1O5H A;  5COF A;  2J9B A;  1NU9 C;  1VMA A;  1C03 A;  1VYI A;  2HSB A;  2HV7 A;  3JCU Q;  2I15 A;  4G7H F;  3SP1 A;  2EIL C;  5DQT A;  1QPU A;  3CEX A;  4JTA B;  1SF8 A;  2OEX A;  4K0D A;  1FFH A;  2H7V C;  1FMV A;  2IBF A;  3M4C A;  5BQH A;  4XEF A;  4Q4Z F;  3LEV A;  3LJB A;  1A41 A;  3LLK A;  4YT8 A;  3A9C A;  1K05 A;  2QTV A;  3DAF A;  1Z6A A;  3HJC A;  3T6B A;  2ZXW C;  4NCQ A;  3O39 A;  3B0V C;  3R7C A;  4IAQ A;  1OXB A;  2YL1 A;  3C7J A;  2WZL A;  5EGY A;  2Y3H A;  4OD4 A;  4IJJ A;  3UGP A;  2Q3T A;  1QSP A;  4YT5 A;  1YAR O;  2J9V A;  3M79 A;  1Q0K A;  2W9Y A;  4F4B A;  2CGE A;  1ORS C;  3E9V A;  4U5B E;  4ER9 A;  5JLI A;  2JX0 A;  1OR3 A;  4ULV A;  3ZC4 A;  4MND A;  4PAC A;  4E18 A;  2OKU A;  3GAN A;  1JMW A;  2B0J A;  2IXM A;  4X0R A;  2Q00 A;  4MVM A;  1T9K A;  4WGY A;  2W4B A;  2B0H A;  4ZLC A;  2LD6 A;  4PFO A;  5JUA A;  4IRU A;  3NMK A;  1YA9 A;  1YYJ A;  3RVY A;  4I44 A;  3HNI A;  3S29 A;  2NUT A;  5DLJ A;  2HJM A;  4PJL A;  2TMV P;  1WAS A;  5L0J A;  2BE5 F;  3MYI A;  5A6K A;  2OG2 A;  1HE9 A;  3DJU B;  3VAY A;  2F22 A;  3N24 A;  1FAP B;  1RXQ A;  1U6H A;  2J9W A;  4PJM A;  4NY3 A;  2KK1 A;  3T6J A;  4CJG A;  4EUK B;  2IXP A;  1T5O A;  4XPY A;  3PHF 2;  4YT4 A;  4EHP A;  1ZHY A;  2A69 F;  4DBQ A;  1EQ1 A;  1W2W A;  2VCA A;  4FWV A;  4E0H A;  4E0I A;  2XLM A;  2OU6 A;  2KC3 A;  1DOW A;  4Z9H A;  4MVO A;  1V74 B;  2A1D D;  4MW3 A;  2R7R A;  3V5Z A;  1YJG A;  2YEV A;  3EJN A;  4PR9 A;  3W4Y A;  2XSE A;  4M63 A;  2FAP B;  3US6 A;  1NG1 A;  5JT4 A;  3C8Z A;  2WZF A;  3ITF A;  1V54 C;  1M6T A;  2WVQ A;  3RFY A;  3HKK A;  4U9E A;  2EPN A;  4U5F E;  4BPM A;  2P1A A;  3LNR A;  2QE9 A;  5B1B C;  4O79 A;  3RF3 A;  2J0X A;  3KH2 A;  3ABM C;  5AC4 A;  2OEV A;  2L6G A;  5AGF A;  3I4U A;  3RQF A;  3V7O A;  3ZDL A;  1HW1 A;  5JRA A;  2R7U A;  4PJJ A;  5AC5 A;  2H7B A;  3EFO A;  4HFF B;  1E83 A;  2G3V A;  1A7D A;  2XXA A;  4JC7 A;  5B1A C;  3RW0 A;  4QI2 A;  4EBB A;  3EZH A;  4JEA A;  3TOM A;  2J45 A;  4CSA A;  2XLO A;  3QMK A;  1G5Z A;  3DM9 B;  3SXY A;  4BJT A;  5HV9 A;  1CGO A;  1E2X A;  4JTD B;  3UMH A;  2A0U A;  2QUP A;  2YHS A;  3AG1 C;  3JYH A;  3QVZ A;  3E70 C;  1SR2 A;  3DXJ F;  4HEA J;  4CX9 A;  4DXW A;  3H65 A;  2A6H F;  3GEE A;  1Z7Q c;  3IQC A;  1K04 A;  4KC9 A;  3DM5 A;  2X51 A;  2PP4 A;  5KYX B;  4KNV A;  1OKK A;  1LS4 A;  3W8I A;  5KYW A;  1M56 C;  2YL7 A;  2GAQ A;  2H7O A;  2LFD A;  2AU5 A;  4IB4 A;  1VTM P;  1CGM E;  1LIH A;  4JCZ A;  4W8P A;  5DQZ A;  1IZM A;  4OIQ F;  2DB4 A;  5KYW B;  2Y3D A;  3RH3 A;  2R03 A;  2YRF A;  4XLP F;  2LK4 A;  3DKA A;  1IW7 F;  2DYR C;  2R7X A;  3X2Q C;  1NZE A;  256B A;  3DAG A;  4XLN F;  2KQ9 A;  1VOM A;  3U5S A;  1TWG A;  1AEP A;  3RYL A;  2J46 A;  2V3C C;  3H2U A;  3TQO A;  1R4T A;  4WGZ A;  4BG0 A;  2RSE B;  1M2O A;  4YWQ A;  2XS1 A;  2W45 A;  3TK0 A;  1BBH A;  1D0Y A;  4Q7C A;  3K6B A;  3V5X A;  5BQI A;  3U9M A;  4R32 A;  3B0U X;  1GGQ A;  3FVY A;  1Q0D A;  3UGO A;  4A4A A;  3KKB A;  1YYX A;  3J06 A;  3B71 A;  3ZSU A;  2NSG A;  2R05 A;  3LUT B;  3EH1 A;  4CS9 A;  1H9G A;  5EK0 A;  4KBL A;  2HMQ A;  3EGD A;  4MTF A;  1NSG B;  1ZZP A;  3ZTZ A;  5KYY B;  5KYU A;  2EIJ C;  3ABK C;  4JZA A;  1ZHW A;  4MQ9 F;  3T6G B;  1OW8 A;  3IQT A;  2AVK A;  2G62 A;  4JKV A;  1F1M A;  1HY5 A;  1APC A;  1H6G A;  1OR2 A;  3GEH A;  5T1D B;  1KU2 A;  3SXM A;  3UMK A;  3U2M A;  1WGW A;  4E7Z A;  3F46 A;  4IAR A;  5CI8 A;  2NPU A;  4XPW A;  3GM2 A;  2R7T A;  1JR8 A;  1J8Y F;  2ZXO A;  1V55 C;  3L34 A;  3LNM B;  1FTS A;  4I1O B;  1LPE A;  1WAT A;  1YAU O;  3UR3 C;  1HMD A;  1WN0 A;  3SXK A;  1BR1 A;  2IYL D;  2D5R B;  4DJ9 A;  5JS5 A;  1VLT A;  4NTA A;  2OJQ A;  5K0I A;  2P7V A;  4GYT A;  4YK5 A;  4FES A;  4MVZ A;  4DVY P;  3QTH A;  4JUR I;  4OIO F;  1C02 A;  2WVO A;  3HNJ A;  3ZQY A;  5JSL A;  2PNO A;  2DYS C;  3VRC A;  3MYF A;  3NMJ A;  3ZG1 A;  1ZW2 A;  4JE9 A;  4MS2 A;  3AGU A;  2UUI A;  3U3B A;  1PD0 A;  3EGX B;  4O7G A;  2GFH A;  3L8I A;  2LSE A;  1CPQ A;  3RIP A;  3TOL A;  3ASN C;  3U8P A;  1ZHZ A;  5CI9 A;  5A69 A;  5L0G A;  3M1C B;  3EHM A;  3RKO F;  4Z9I A;  1OCO C;  4U9D A;  4C7O A;  1TFO B;  1VB5 A;  1WTY A;  3EZI A;  1A7V A;  3OA1 A;  3TJ6 A;  2L6F A;  2CW0 F;  4LLE A;  1JOG A;  3ZVR A;  4CIP A;  3NDB B;  3HNL A;  2KGO A;  2EPO A;  1KNY A;  1OCR C;  2EIN C;  3EHN A;  3MBG A;  1BR4 A;  3NKE A;  3UMI A;  3S0X A;  1U0B B;  4EKW A;  2XLH A;  3AJM A;  3GWL A;  4IGG A;  5L0I A;  4OIP F;  3GM1 A;  1NFN A;  3C8G A;  1FFT C;  1D1A A;  3PMR A;  4G78 A;  4DVZ A;  3S90 A;  4JJG A;  1BZ4 A;  4MTO A;  1OCC C;  4O6N A;  5DS6 A;  3NRH A;  2ASR A;  2JD3 A;  4DBR A;  2A6E F;  2R02 A;  3QW0 A;  1B68 A;  2EPK X;  3AG4 C;  3Q7L A;  3FDQ A;  3S28 A;  2P61 A;  1TWC A;  1I4Z A;  2WZG A;  3ZTM A;  3K7D A;  4BEJ A;  3AQC A;  2AWC A;  1EI7 A;  1L7C A;  4AE4 B;  5IY5 C;  2Z15 A;  3FAJ A;  4LDQ A;  4OIR F;  2I8B A;  4D4N A;  3GWN A;  3TD7 A;  4ONS A;  2LFF A;  3CZ6 A;  4BJ5 C;  2HFI A;  1PD1 A;  1M2V A;  1ZU5 A;  1SZI A;  1ZVZ A;  2VCB A;  3KYI A;  1AUE A;  4XWJ A;  2D4U A;  2Y3G A;  3S84 A;  5A6A A;  1L3P A;  1MMG A;  3FOP A;  4HE8 D;  2L81 A;  3IPM O;  5E2Q A;  4E17 A;  4CIH A;  2XM0 A;  5DS5 A;  4KNW A;  2JPU A;  3C62 A;  3JRT A;  1Z5Z A;  4DRI B;  3DD7 A;  1YA7 O;  1Z3I X;  2RD9 A;  3CAX A;  2ETS A;  4EWC A;  3AG2 C;  4MVU A;  2M4E A;  3DE8 A;  3C63 A;  4J7T A;  1YDI A;  3JSE O;  4J32 B;  4AL1 A;  2YLG A;  2J9U A;  4MVS A;  4U5D E;  3RQG A;  5CIV A;  1JPN A;  3PCV A;  3HLZ A;  3ZQV A;  4FAP B;  3L8J A;  3LES A;  4C3E A;  4D4X A;  1OKK D;  4C7O B;  2LQG A;  3NG1 A;  2Q9A A;  1A0B A;  4DRH B;  1OW7 A;  4LAC B;  4LDR A;  4U5C E;  1I4Y A;  2HV6 A;  3HTK C;  3NYM A;  4MVR A;  2CNW A;  2H8A A;  4Z9J A;  2J7P A;  4E7S A;  1RJ9 A;  1AVO B;  4DOZ A;  5KYN A;  2C04 A;  2VAS A;  1FR0 A;  3LLI A;  4J7Y A;  3VYW A;  4U5E E;  4O6M A;  1BDJ B;  1N1C A;  2HZ8 A;  3I5P A;  4GEH A;  2XL8 A;  1XZP A;  1GM5 A;  3H2V A;  3AG3 C;  3U0C A;  5A6B D;  3ABL C;  1G8X A;  4N4W A;  5KYX A;  1NU7 D;  4PK4 A;  1Q0M A;  2YQY A;  1T6Q A;  5FZT A;  1TR2 A;  1QVX A;  2XLE A;  1TFK B;  2VB6 A;  3LS1 A;  4G0H A;  5L3V A;  1HW2 A;  5L0F A;  3TUL A;  4PFP A;  1R5I D;  2EIK C;  4WAB A;  5COM A;  4AX2 A;  3FOO A;  2R7O A;  2YWA A;  4RDA A;  5B3S C;  1Q0G A;  1I5N A;  1MMD A;  3GOR A;  3DI5 A;  4JRZ A;  4W8K A;  5E3C A;  4EIY A;  4IAO A;  2FFH A;  4JJF A;  1FMW A;  4YN0 B;  2YLD A;  1MNE A;  2X0C A;  1OW6 A;  2ICW G;  2MYS A;  3B9Q A;  2VH3 A;  3JTL O;  4YL3 A;  2EPL X;  1EKY A;  1RCP A;  2AP3 A;  4KI2 A;  2C03 A;  3QVY A;  2BC5 A;  2O9X A;  3O6X A;  1CPR A;  1LVK A;  4N06 A;  1NFO A;  2QY9 A;  1ZYR F;  1TKN A;  1RKC A;  3K1I C;  1Z63 A;  3WOD F;  1NLX A;  2PX0 A;  3T9O A;  4U5G A;  2NG1 A;  3EFO B;  5F5H A;  2KNH A;  2XXA B;  2HMZ A;  2LP4 A;  4ANJ A;  3I5Q A;  1DOV A;  3RQE A;  1NBB A;  3EQL F;  4LLC A;  2WVN A;  2CYD A;  1WWP A;  4Q5S F;  2VC9 A;  4C3B A;  1TWA A;  4XQ1 A;  2XL4 A;  1LI7 A;  2DGJ A;  4MTG A;  1K40 A;  5E33 A;  2R7Q A;  2J7P D;  4LER A;  1HMO A;  4YJW A;  2QNL A;  3KMI A;  3LS0 A;  3MX3 A;  2WL8 A;  1U89 A;  3CSK A;  3VM6 A;  4A2N B;  4JW1 A;  4UDV A;  3N0T A;  4P9F A;  1FNT c;  2Q4F A;  2Q7R A;  2GA0 A;  3PDM P;  4CS9 C;  4H4K C;  2R9R B;  1LM3 B;  2NUP B;  3LEO A;  4P6I C;  4I1M A;  4EBJ A;  3O10 A;  4ULW A;  1ZHX A;  1XZQ A;  1H7I A;  5DVW A;  2M64 A;  2ZXP A;  3G50 A;  1PV3 A;  3R2P A;  2CDQ A;  1T6U A;  3K1I A;  4JEB A;  1TWH A;  4XEK A;  3SEO A;  3U3F A;  5F5F A;  5FCL A;  4CS8 A;  1MMN A;  3DZA A;  1YZC A;  4JTC B;  3EH2 A;  1RKE A;  3Q7G A;  2XRH A;  3G4Z A;  3K1H A;  3ATP A;  2FGY A;  3DWW A;  5HSW A;  1QKR A;  2LIG A;  3GEI A;  1KTM A;  2EIM C;  2YVK A;  3Q6M A;  3S27 A;  3U9J A;  3KL4 A;  5A6J A;  4I3M A;  1D0Z A;  3BRJ A;  3EGD B;  2IM8 A;  4AL0 A;  2XLD A;  1SMY F;  1YVI A;  5TJ5 E;  4CDA A;  1D1C A;  4N6C A;  2P6V A;  3O55 A;  3JT1 A;  2HSQ A;  3N2Z B;  1Y6D A;  4GQH A;  1VK5 A;  3NYJ A;  3JZ0 A;  4XTK A;  4NTF A;  2YLI A;  4LDK A;  2HJ3 A;  2XS8 A; 
#chains in the Genus database with same CATH homology
 2HMZ A;  1HMO A;  2AVK A;  3AGT A;  1I4Z A;  3WHN A;  2MHR A;  4XQ1 A;  4XPY A;  3WAQ A;  2AWC A;  3AGU A;  2HMQ A;  2AWY A;  1HMD A;  4XPX A;  4XPW A;  1A7D A;  1I4Y A;  1A7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...