1I4YA

The crystal structure of phascolopsis gouldii wild type methemerythrin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
113
structure length
113
Chain Sequence
GFPIPDPYVWDPSFRTFYSIIDDEHKTLFNGIFHLAIDDNADNLGELRRCTGKHFLNEQVLMQASQYQFYDEHKKEHETFIHALDNWKGDVKWAKSWLVNHIKTIDFKYKGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords METHEMERYTHRIN
publication title The crystal structures of Phascolopsis gouldii wild type and L98Y methemerythrins: structural and functional alterations of the O2 binding pocket.
pubmed doi rcsb
source organism Phascolopsis gouldii
total genus 47
structure length 113
sequence length 113
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.50 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hemerythrin-like 1i4yA00
4XPXA 2AWYA 4XPWA 2HMZA 4XPYA 1I4ZA 4XQ1A 2AVKA 1HMOA 1A7DA 1A7EA 2AWCA 3WAQA 3AGTA 3WHNA 3AGUA 2HMQA 2MHRA 1HMDA 1I4YA
chains in the Genus database with same CATH superfamily
3S29A 1S05A 1E2XA 2BL2A 3FVYA 4G0HA 4K0DA 4BJ1A 4N6HA 2IM8A 3DE9A 1F1MA 1WASA 1LM3B 3F47A 4NY3A 5E2QA 4CJOA 4FAPB 3MBGA 3HTKC 4DRIB 2UUHA 3F46A 3WG7C 3B0VC 4JC7A 2XM0A 4KBLA 3S0XA 4U5EE 3EFOA 3JSZA 3KL4A 2HJMA 3JT1A 4E17A 4ULVA 1JAFA 1A41A 3Q7LA 4RDAA 4KI2A 1JOGA 1JRAA 3JZ0A 2TMVP 2XL4A 1LPEA 3GWNA 3AGTA 3QVYA 5KYWB 2OKUA 2HMQA 2HKVA 3GORA 1NBBA 3N0TA 1DOWA 3I5QA 4CS7A 4E0HA 1YDIA 2WVQA 3C7JA 1BR1A 1UFBA 4P9TA 2EPKX 2B0HA 2PX0A 4JCHA 2J7PD 2CDQA 2J8WA 3AG1C 3DKAA 3C63A 2HUJA 3K1HA 4D4NA 4YN0B 1H6GA 1O87A 3DXJF 4LDKA 3PMRA 3VM6A 2YLIA 3E70C 2ICWG 4XEVA 1HW1A 1QLEC 3W2WA 5JVEA 2V3CC 1Q0FA 2NSGA 3KYJA 5T3WA 1A7EA 1JMWA 2FGYA 2ZD9A 3GODA 3H65A 1S7ZA 2VB6A 3ZTMA 3J06A 1V54C 1KTMA 2Y3HA 3WAQA 4JZAA 2XXAA 3QTHA 5TJ5E 5KYXA 1CPRA 3LESA 1T01A 2YKZA 1Z63A 3HKKA 3T6GB 1T6UA 5DQZA 1BDJB 3KH2A 3IEEA 2AP3A 2Y69C 3NMJA 4QDLA 1YZCA 1J8YF 4CJGA 3BRJA 5A6BD 3JSEO 2JPUA 1Q0DA 2BC5A 2H8AA 2LK4A 3ZQYA 2VCCA 4XQ1A 4EBKA 2EIMC 2IBFA 2OEVA 3RIPA 3ZDLA 4U5CE 3ZTZA 4GQHA 3FAPB 2YQYA 2Y3GA 1TR2A 4MTOA 1V55C 5KYUA 4KNVA 2YRFA 4JCZA 2Y39A 1M6TA 5A6JA 1G8XA 2RSEB 3W8HA 4XLPF 1Z5ZA 5BQGA 3SXMA 5A6KA 3RQFA 2XL6A 3KPHA 5D91A 3EHNA 3RKOF 1V74B 2WZFA 1ZHZA 2HFIA 4E7ZA 3RW0A 3IQCA 1OW8A 4PK4A 4JEBA 4YJWA 1NLXA 4YL3A 4KNWA 1WOLA 4CSAA 4MVSA 1EI7A 4WGYA 4CSAC 3IQ6A 1VLSA 3LJBA 4IAQA 3EZHA 4IWBA 1OKKD 4RD9A 4CBEA 2OU6A 2YL0A 3HNKA 3M4CA 2J0XA 5BUOA 1L3PA 2YL3A 4D4XA 3T9OA 1QVXA 4A4AA 5E3CA 3GM2A 1JR8A 2GDCA 3DMDA 3L8JA 2J9BA 3TD7A 1V4AA 3VF0A 1MMGA 3LLIA 1WGWA 5JT4A 1QZXA 2KK1A 4FWVA 4J7YA 1CGME 5F5FA 4NTBA 3IQTA 1M2VA 2XLEA 3DM9B 3HJCA 4IGGA 1FNTc 2XLVA 1T6IA 3QW1A 1D1BA 2PF4E 4CS9A 2P1AA 4M63A 4P9FA 3DJUB 3R2PA 2F22A 2Y3DA 3NG1A 1HE9A 4PFOA 5EK0A 1I4YA 1QPUA 2R03A 3GEIA 3KKBA 1MNDA 1G4US 3CQZA 3HNJA 4MVOA 3JRTA 4B6IA 4DVZA 1LI7A 1ZHTA 4EUKB 4Q5SF 1M56C 1RKEA 1ZW3A 2LSEA 2GAQA 2OQMA 3K1IA 2P0NA 4O6NA 4RBNA 4W8PA 4XTKA 3T6BA 3UNGC 2XM4A 3L1MA 2H7OA 2D5RB 2GA0A 4XEKA 3ZC4A 2A0BA 4BEJA 3GM1A 3M15A 2XL8A 3B71A 2O9XA 1T6QA 2QUPA 4G78A 4N6CA 1HMOA 4YT5A 2KYHA 2X51A 1HW2A 4Q7CA 1E83A 2Q00A 2J45A 1AEPA 1SYQA 2QLAA 5JSLA 3AQBA 5T3TA 5L0DA 3NYLA 2L6FA 1HE1A 3AGUA 1ORJA 2LD6A 2QTVA 3UR3C 2FFHA 4U9EA 1SF8A 4LLEA 3EGXA 1K40A 3TJ5A 3M79A 1G5ZA 1CPQA 3UGPA 1MQVA 4EBJA 4OIPF 1OR2A 4PJMA 1Z7Qc 3C62A 5KYYB 4JVSA 1QSPA 1TWHA 2ZXOA 2EPMX 2P7VA 3M1CB 3DAFA 4XPWA 1L7CA 2HMZA 1O3UA 4NTAA 4CDYA 3K7DA 1FR0A 3HNLA 1H7IA 4DOZA 2PP4A 4MTFA 2WL8A 1NZEA 3DAGA 4H4KC 2VASA 1Z23A 2C03A 2R05A 2OJED 4LERA 3Q6MA 3RFYA 1GM5A 1C17M 2EPLX 3G4ZA 3NMIA 1KU2A 1C02A 5GPGB 4AL1A 3GANA 1MNEA 3NMKA 4HFKB 5KYNA 1RJ9B 3MX3A 3L8IA 3NKEA 2KQ9A 3EG9B 1D1CA 5CI9A 3JCUQ 1H9GA 1TFKB 4MS2A 1YARO 2NUTB 3K66A 1NSGB 2IOQA 4AE4A 3NDBB 2NSFA 3CSKA 1ZHYA 1TFOB 2OOCA 2G62A 2PFDA 3QVZA 2L6HA 5COMA 1OXBA 3EJNA 1OCCC 2LCHA 2YEVA 2YVKA 4DXWA 1O5HA 2J46A 1HY5A 3EGDA 2XLWA 2IXOA 4BJ5A 4BJTA 3X2QC 1RXQA 3QMKA 1YA7O 4JURI 3SXZA 2L81A 4BJ5C 5L0GA 5L0JA 1LVKA 2E87A 3EFOB 4YT2A 2OG2A 3KYIA 3V7OA 2EINC 5L3QA 1K05A 2Q9AA 2Q3TA 3E9VA 1ZZPA 3A11A 3RYLA 4YL0A 3U9MA 3DI5A 2EIKC 4FESA 4E7SA 4U5DE 2R7UA 1SMYF 3TOMA 5L3VA 3H2VA 5DS5A 1Y4CA 4JJGA 4OD5A 1NU9C 2NUPA 3LAYA 2DB4A 3K6BA 1LS1A 4ANJA 3LLKA 3W2VA 4HEAJ 3LEVA 4MNDA 1FTSA 2LQGA 3FDQA 2B0JA 2CCYA 4R32A 5EGYA 4BPMA 4BG0A 2HSQA 2G3VA 1TKNA 1ST6A 4Z9HA 1J8MF 2QY9A 2KC3A 3AOUA 1BBHA 4OD4A 4IJJA 3C8GD 1ZHWA 2J9UA 5JUAA 4C3BA 2XRHA 2W9YA 1NG1A 3DZAA 2L9JA 4NCQA 5DS6A 1FMWA 3U2MA 4CDAA 1TWCA 3T6JA 1XZPA 5E33A 4DJ9A 2J7PA 2H7VC 2XXAB 3WODF 5DQTA 3ITFA 2UUIA 4MW8A 4C3DA 5KYXB 1RKCA 2LIGA 2FAPB 2CW0F 4U5HA 4EIYA 3C18A 5AGFA 1E85A 1GQAA 3OWTA 1Q0GA 4WGZA 2ZXRA 3EHMA 4XPXA 3RVZA 4BJ6A 3PHF2 1YYXA 3L34A 3IHUA 4BJ6C 2W45A 1XZQA 1U6HA 4LDRA 4QI0A 2Q4FA 4H54A 3LEOA 4MVZA 4PJNA 4U5BE 3RH3A 2YZSA 4JTCB 4O6YA 5D92A 3ZQVA 2XLDA 2IXNA 1TWAA 2R9RB 4N4WA 2WVOA 2WZLA 1DOVA 3O39A 3NKDA 5A69A 3X1OA 1BR4A 5KYUB 3CEXA 3CZ6A 1LE4A 2AWCA 4PACA 5B3IA 1YVIA 4WABA 2JD3A 3WHNA 1VOMA 4YT8A 5HV9A 4MTGA 5B3SC 2RD9A 1MMNA 2EILC 1JPNA 4MVUA 3ZSUA 4YT4A 2DGJA 3LS0A 3ATPA 5A6BA 4C7OA 1WATA 3U8VA 1T9KA 3U9JA 1YJGA 2OJQA 4ONSA 2YWAA 3C8GB 1LKXA 5FCLA 3W4YA 3OA1A 3ECSA 4IAOA 1OCRC 1EQ1A 2G3KA 3LS1A 1CGOA 1OQCA 1ORYA 1D1AA 1BR2A 1LE2A 3S28A 2IXPA 3CAXA 4I44A 2NG1A 1A0BA 2A0UA 4P6IC 2NPUA 4Z9IA 3ZIBA 3AG3C 4IRUA 4O7GA 4PJLA 3AG2C 3AQCA 3NYJA 4EHPA 4JJFA 4ULWA 1OW7A 5HSWA 2R02A 3QW0A 4MVMA 2A6EF 3N24A 4G7ZF 4GEHA 1M2VB 1UG7A 4DRJB 5A6AA 5JRAA 4FX5A 1LS4A 4AK9A 3S84A 2R25A 3ASNC 4JE9A 3NYMA 3Q6NA 3PDMP 1ZW2A 1HMDA 1A7DA 2M4EA 3TOLA 3UMIA 1ORSC 3B9QA 2ZXPA 5AC4A 1U0BB 1IZMA 1NFOA 1FFHA 2L6GA 1EKYA 1RKEB 2HS5A 2YL1A 5COFA 3EH2A 1R4TA 2GFHA 3RVYA 1JPJA 3ZG1A 3GM3A 3MYFA 1W2WA 1WN0A 1TWGA 4E0IA 3FHDA 3V5ZA 2JX0A 4MW3A 5IY5C 4J30B 4OINF 3TQOA 2W4MA 4OIQF 2D4UA 2VC9A 3I4UA 1VYKA 2PBEA 3HLZA 4DBQA 2EPOA 1Z3IX 3QZCA 4CX9A 3DM5A 2A69F 4EBBA 3LUTB 3U0CA 4Q4ZF 3G4XA 3GWLA 5F28E 3B0UX 3FOOA 2MYSA 5KYWA 1YAUO 1OCOC 4ER9A 2CNWA 4PR9A 1GGQA 2IXMA 3EGXB 4IARA 3S90A 1WWPA 2CGEA 256BA 3S9OA 5JS5A 1OXKA 5AC5A 3V5YA 3A9CA 4I1OB 1VLTA 4U5FE 4U5GA 3SYNA 2R7VA 2HZ8A 2WVNA 3Q7GA 3SZRA 4F4BA 2H7BA 4JTDB 4LLCA 5BQIA 2QNLA 2VCAA 4QI2A 5JLIA 3AG4C 2OEXA 1R5ID 1CGNA 1VMAA 2HV6A 1IW7F 2LFFA 4XPYA 1TQGA 2YLGA 3DJNB 5DLJA 3GEHA 1E86A 1FMVA 2ZXWC 4O6MA 4U9DA 1PD0A 1ZVZA 5DVWA 1MMDA 3C8ZA 2Z15A 1WTYA 4MVRA 3POVA 3N2ZB 5DS4A 4YL1A 2I15A 3OEOA 1APCA 2QE9A 3B29A 4K1OA 2Q7RA 4J32B 1OCZC 3I5PA 5FZTA 2KJGA 2HSBA 2R7SA 2LFDA 1FFTC 2MHRA 4ZLDA 1GS9A 1PV3A 2R7TA 2A68F 1E84A 4AE4B 3FAJA 3RQGA 2Q9BA 2XLOA 4LDQA 3UGOA 3SP1A 1YA9A 3DWWA 4OIRF 1ZHXA 2XS1A 5BQHA 5L0IA 2XS8A 2LP4A 1FAPB 1XWJA 1N1CA 2IYLD 3EGDB 3W8IA 3L0IA 2AU5A 2M64A 3KMIA 4A2NB 1K04A 3JYYA 3ABKC 2L7AA 4XWJA 3SEOA 4CIPA 5L0HA 4CDVA 2V26A 4ZLCA 4JTAB 4NC3A 1D0ZA 1M57C 4IB4A 1EA8A 3DE8A 5COGA 3U5SA 1B68A 1NU7D 1LI5A 2PNOA 3DD7A 3HNIA 1U89A 3IPMO 1QQ3A 4G7HF 3B0PA 2WB7A 3SNHA 2ZPAA 4Z9JA 5CI8A 4WJ0A 1YYJA 3S27A 4CS8A 4EWCA 4HFFB 4KC9A 2HJ3A 4I3MA 3G50A 2XSEA 2OCCC 3MFNA 2MWQA 4JKVA 4CS8C 2WZGA 2NUPB 4JW1A 2KW3C 1AVOB 4NQFA 2P61A 4L6RA 5E3AA 3FXHA 1KNYA 2KGOA 2DYRC 2AWYA 4K7BA 3MYIA 1ZU4A 4JEAA 5F5HA 1Q0KA 2YL7A 1I4ZA 1I5NA 1BZ4A 3FMSA 3O55A 4GYTA 5JP7A 3TJ6A 4YWQA 2AVKA 1PCXA 4NTFA 5B1AC 2DI3A 4UDVA 2W4BA 5EHHA 1PD1A 4AX2A 2R7WA 3JTLO 3AJMA 5T1DB 1A7VA 4PJJA 3MLGA 3UMKA 1RMVA 4MVQA 3M4BA 1Y6DA 2KNHA 3FOPA 1VYIA 4MQ9F 3JYHA 1OR3A 2R7XA 4DVYP 2EIJC 2GWWA 2Q9CA 3TK0A 4G7OF 3H2UA 3O6XA 3C8GA 5L0CA 2ASRA 4N06A 2YHSA 1NFNA 3LNMB 1MMAA 3VYWA 3U3FA 3ZVRA 3ABMC 3NRHA 2XLMA 2XLHA 1Z6AA 4DRHB 2DYSC 3US6A 4O79A 5K0IA 2A1DD 3T4RA 1M2OA 2ETSA 3LNRA 3EPVA 3UMHA 1H9TA 4PFPA 1T5OA 3GEEA 3SXKA 4JIOA 1VB5A 1G4WR 4LACB 5L0FA 2I8BA 3SXYA 2YLDA 4YK5A 3K33A 4W8KA 2A6HF 3RF3A 2VCBA 2C04A 4E18A 3EZIA 4XLNF 3V5XA 3ZWIA 3JRMO 2J0WA 1ZYRF 4BEMJ 4X0RA 4CS9C 3IQ5A 4C7OB 3TULA 3O10A 1OKKA 2R7QA 1LIHA 3R7CA 1RCPA 4DBRA 1VK5A 1YZAA 3U3BA 2P6VA 4I1MA 3EH1A 2R7OA 5KYYA 3VRCA 3PCVA 2CNWD 2BE5F 2VH3A 4EKWA 3RQEA 3VAYA 2Y3BA 2R7RA 4OIOF 3K1IC 4J7TA 2J9WA 4C3EA 1D0YA 2X0CA 2CYDA 4CIHA 3BEHA 3ASOC 1OW6A 2J9VA 4XEFA 4AL0A 5CIVA 3U2LA 1C03A 4JRZA 3U8PA 3EQLF 1ZU5A 5B1BC 2PX3A 2EPNA 3ABLC 2KSFA 1D0XA 1Q0MA 1RJ9A 1SR2A 1VTMP 1QKRA 2HV7A 4HE8D 3EG9A 2NUTA 1YLMA 1SZIA 1AUEA
chains in the Genus database with same CATH topology
4XPXA 2AWYA 4XPWA 2HMZA 4XPYA 1I4ZA 4XQ1A 2AVKA 1HMOA 1A7DA 1A7EA 2AWCA 3WAQA 3AGTA 3WHNA 3AGUA 2HMQA 2MHRA 1HMDA 1I4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPX A;  2AWY A;  4XPW A;  2HMZ A;  4XPY A;  1I4Z A;  4XQ1 A;  2AVK A;  1HMO A;  1A7D A;  1A7E A;  2AWC A;  3WAQ A;  3AGT A;  3WHN A;  3AGU A;  2HMQ A;  2MHR A;  1HMD A;  1I4Y A; 
#chains in the Genus database with same CATH topology
 3S29 A;  1S05 A;  1E2X A;  2BL2 A;  3FVY A;  4G0H A;  4K0D A;  4BJ1 A;  4N6H A;  2IM8 A;  3DE9 A;  1F1M A;  1WAS A;  1LM3 B;  3F47 A;  4NY3 A;  5E2Q A;  4CJO A;  4FAP B;  3MBG A;  3HTK C;  4DRI B;  2UUH A;  3F46 A;  3WG7 C;  3B0V C;  4JC7 A;  2XM0 A;  4KBL A;  3S0X A;  4U5E E;  3EFO A;  3JSZ A;  3KL4 A;  2HJM A;  3JT1 A;  4E17 A;  4ULV A;  1JAF A;  1A41 A;  3Q7L A;  4RDA A;  4KI2 A;  1JOG A;  1JRA A;  3JZ0 A;  2TMV P;  2XL4 A;  1LPE A;  3GWN A;  3AGT A;  3QVY A;  5KYW B;  2OKU A;  2HMQ A;  2HKV A;  3GOR A;  1NBB A;  3N0T A;  1DOW A;  3I5Q A;  4CS7 A;  4E0H A;  1YDI A;  2WVQ A;  3C7J A;  1BR1 A;  1UFB A;  4P9T A;  2EPK X;  2B0H A;  2PX0 A;  4JCH A;  2J7P D;  2CDQ A;  2J8W A;  3AG1 C;  3DKA A;  3C63 A;  2HUJ A;  3K1H A;  4D4N A;  4YN0 B;  1H6G A;  1O87 A;  3DXJ F;  4LDK A;  3PMR A;  3VM6 A;  2YLI A;  3E70 C;  2ICW G;  4XEV A;  1HW1 A;  1QLE C;  3W2W A;  5JVE A;  2V3C C;  1Q0F A;  2NSG A;  3KYJ A;  5T3W A;  1A7E A;  1JMW A;  2FGY A;  2ZD9 A;  3GOD A;  3H65 A;  1S7Z A;  2VB6 A;  3ZTM A;  3J06 A;  1V54 C;  1KTM A;  2Y3H A;  3WAQ A;  4JZA A;  2XXA A;  3QTH A;  5TJ5 E;  5KYX A;  1CPR A;  3LES A;  1T01 A;  2YKZ A;  1Z63 A;  3HKK A;  3T6G B;  1T6U A;  5DQZ A;  1BDJ B;  3KH2 A;  3IEE A;  2AP3 A;  2Y69 C;  3NMJ A;  4QDL A;  1YZC A;  1J8Y F;  4CJG A;  3BRJ A;  5A6B D;  3JSE O;  2JPU A;  1Q0D A;  2BC5 A;  2H8A A;  2LK4 A;  3ZQY A;  2VCC A;  4XQ1 A;  4EBK A;  2EIM C;  2IBF A;  2OEV A;  3RIP A;  3ZDL A;  4U5C E;  3ZTZ A;  4GQH A;  3FAP B;  2YQY A;  2Y3G A;  1TR2 A;  4MTO A;  1V55 C;  5KYU A;  4KNV A;  2YRF A;  4JCZ A;  2Y39 A;  1M6T A;  5A6J A;  1G8X A;  2RSE B;  3W8H A;  4XLP F;  1Z5Z A;  5BQG A;  3SXM A;  5A6K A;  3RQF A;  2XL6 A;  3KPH A;  5D91 A;  3EHN A;  3RKO F;  1V74 B;  2WZF A;  1ZHZ A;  2HFI A;  4E7Z A;  3RW0 A;  3IQC A;  1OW8 A;  4PK4 A;  4JEB A;  4YJW A;  1NLX A;  4YL3 A;  4KNW A;  1WOL A;  4CSA A;  4MVS A;  1EI7 A;  4WGY A;  4CSA C;  3IQ6 A;  1VLS A;  3LJB A;  4IAQ A;  3EZH A;  4IWB A;  1OKK D;  4RD9 A;  4CBE A;  2OU6 A;  2YL0 A;  3HNK A;  3M4C A;  2J0X A;  5BUO A;  1L3P A;  2YL3 A;  4D4X A;  3T9O A;  1QVX A;  4A4A A;  5E3C A;  3GM2 A;  1JR8 A;  2GDC A;  3DMD A;  3L8J A;  2J9B A;  3TD7 A;  1V4A A;  3VF0 A;  1MMG A;  3LLI A;  1WGW A;  5JT4 A;  1QZX A;  2KK1 A;  4FWV A;  4J7Y A;  1CGM E;  5F5F A;  4NTB A;  3IQT A;  1M2V A;  2XLE A;  3DM9 B;  3HJC A;  4IGG A;  1FNT c;  2XLV A;  1T6I A;  3QW1 A;  1D1B A;  2PF4 E;  4CS9 A;  2P1A A;  4M63 A;  4P9F A;  3DJU B;  3R2P A;  2F22 A;  2Y3D A;  3NG1 A;  1HE9 A;  4PFO A;  5EK0 A;  1I4Y A;  1QPU A;  2R03 A;  3GEI A;  3KKB A;  1MND A;  1G4U S;  3CQZ A;  3HNJ A;  4MVO A;  3JRT A;  4B6I A;  4DVZ A;  1LI7 A;  1ZHT A;  4EUK B;  4Q5S F;  1M56 C;  1RKE A;  1ZW3 A;  2LSE A;  2GAQ A;  2OQM A;  3K1I A;  2P0N A;  4O6N A;  4RBN A;  4W8P A;  4XTK A;  3T6B A;  3UNG C;  2XM4 A;  3L1M A;  2H7O A;  2D5R B;  2GA0 A;  4XEK A;  3ZC4 A;  2A0B A;  4BEJ A;  3GM1 A;  3M15 A;  2XL8 A;  3B71 A;  2O9X A;  1T6Q A;  2QUP A;  4G78 A;  4N6C A;  1HMO A;  4YT5 A;  2KYH A;  2X51 A;  1HW2 A;  4Q7C A;  1E83 A;  2Q00 A;  2J45 A;  1AEP A;  1SYQ A;  2QLA A;  5JSL A;  3AQB A;  5T3T A;  5L0D A;  3NYL A;  2L6F A;  1HE1 A;  3AGU A;  1ORJ A;  2LD6 A;  2QTV A;  3UR3 C;  2FFH A;  4U9E A;  1SF8 A;  4LLE A;  3EGX A;  1K40 A;  3TJ5 A;  3M79 A;  1G5Z A;  1CPQ A;  3UGP A;  1MQV A;  4EBJ A;  4OIP F;  1OR2 A;  4PJM A;  1Z7Q c;  3C62 A;  5KYY B;  4JVS A;  1QSP A;  1TWH A;  2ZXO A;  2EPM X;  2P7V A;  3M1C B;  3DAF A;  4XPW A;  1L7C A;  2HMZ A;  1O3U A;  4NTA A;  4CDY A;  3K7D A;  1FR0 A;  3HNL A;  1H7I A;  4DOZ A;  2PP4 A;  4MTF A;  2WL8 A;  1NZE A;  3DAG A;  4H4K C;  2VAS A;  1Z23 A;  2C03 A;  2R05 A;  2OJE D;  4LER A;  3Q6M A;  3RFY A;  1GM5 A;  1C17 M;  2EPL X;  3G4Z A;  3NMI A;  1KU2 A;  1C02 A;  5GPG B;  4AL1 A;  3GAN A;  1MNE A;  3NMK A;  4HFK B;  5KYN A;  1RJ9 B;  3MX3 A;  3L8I A;  3NKE A;  2KQ9 A;  3EG9 B;  1D1C A;  5CI9 A;  3JCU Q;  1H9G A;  1TFK B;  4MS2 A;  1YAR O;  2NUT B;  3K66 A;  1NSG B;  2IOQ A;  4AE4 A;  3NDB B;  2NSF A;  3CSK A;  1ZHY A;  1TFO B;  2OOC A;  2G62 A;  2PFD A;  3QVZ A;  2L6H A;  5COM A;  1OXB A;  3EJN A;  1OCC C;  2LCH A;  2YEV A;  2YVK A;  4DXW A;  1O5H A;  2J46 A;  1HY5 A;  3EGD A;  2XLW A;  2IXO A;  4BJ5 A;  4BJT A;  3X2Q C;  1RXQ A;  3QMK A;  1YA7 O;  4JUR I;  3SXZ A;  2L81 A;  4BJ5 C;  5L0G A;  5L0J A;  1LVK A;  2E87 A;  3EFO B;  4YT2 A;  2OG2 A;  3KYI A;  3V7O A;  2EIN C;  5L3Q A;  1K05 A;  2Q9A A;  2Q3T A;  3E9V A;  1ZZP A;  3A11 A;  3RYL A;  4YL0 A;  3U9M A;  3DI5 A;  2EIK C;  4FES A;  4E7S A;  4U5D E;  2R7U A;  1SMY F;  3TOM A;  5L3V A;  3H2V A;  5DS5 A;  1Y4C A;  4JJG A;  4OD5 A;  1NU9 C;  2NUP A;  3LAY A;  2DB4 A;  3K6B A;  1LS1 A;  4ANJ A;  3LLK A;  3W2V A;  4HEA J;  3LEV A;  4MND A;  1FTS A;  2LQG A;  3FDQ A;  2B0J A;  2CCY A;  4R32 A;  5EGY A;  4BPM A;  4BG0 A;  2HSQ A;  2G3V A;  1TKN A;  1ST6 A;  4Z9H A;  1J8M F;  2QY9 A;  2KC3 A;  3AOU A;  1BBH A;  4OD4 A;  4IJJ A;  3C8G D;  1ZHW A;  2J9U A;  5JUA A;  4C3B A;  2XRH A;  2W9Y A;  1NG1 A;  3DZA A;  2L9J A;  4NCQ A;  5DS6 A;  1FMW A;  3U2M A;  4CDA A;  1TWC A;  3T6J A;  1XZP A;  5E33 A;  4DJ9 A;  2J7P A;  2H7V C;  2XXA B;  3WOD F;  5DQT A;  3ITF A;  2UUI A;  4MW8 A;  4C3D A;  5KYX B;  1RKC A;  2LIG A;  2FAP B;  2CW0 F;  4U5H A;  4EIY A;  3C18 A;  5AGF A;  1E85 A;  1GQA A;  3OWT A;  1Q0G A;  4WGZ A;  2ZXR A;  3EHM A;  4XPX A;  3RVZ A;  4BJ6 A;  3PHF 2;  1YYX A;  3L34 A;  3IHU A;  4BJ6 C;  2W45 A;  1XZQ A;  1U6H A;  4LDR A;  4QI0 A;  2Q4F A;  4H54 A;  3LEO A;  4MVZ A;  4PJN A;  4U5B E;  3RH3 A;  2YZS A;  4JTC B;  4O6Y A;  5D92 A;  3ZQV A;  2XLD A;  2IXN A;  1TWA A;  2R9R B;  4N4W A;  2WVO A;  2WZL A;  1DOV A;  3O39 A;  3NKD A;  5A69 A;  3X1O A;  1BR4 A;  5KYU B;  3CEX A;  3CZ6 A;  1LE4 A;  2AWC A;  4PAC A;  5B3I A;  1YVI A;  4WAB A;  2JD3 A;  3WHN A;  1VOM A;  4YT8 A;  5HV9 A;  4MTG A;  5B3S C;  2RD9 A;  1MMN A;  2EIL C;  1JPN A;  4MVU A;  3ZSU A;  4YT4 A;  2DGJ A;  3LS0 A;  3ATP A;  5A6B A;  4C7O A;  1WAT A;  3U8V A;  1T9K A;  3U9J A;  1YJG A;  2OJQ A;  4ONS A;  2YWA A;  3C8G B;  1LKX A;  5FCL A;  3W4Y A;  3OA1 A;  3ECS A;  4IAO A;  1OCR C;  1EQ1 A;  2G3K A;  3LS1 A;  1CGO A;  1OQC A;  1ORY A;  1D1A A;  1BR2 A;  1LE2 A;  3S28 A;  2IXP A;  3CAX A;  4I44 A;  2NG1 A;  1A0B A;  2A0U A;  4P6I C;  2NPU A;  4Z9I A;  3ZIB A;  3AG3 C;  4IRU A;  4O7G A;  4PJL A;  3AG2 C;  3AQC A;  3NYJ A;  4EHP A;  4JJF A;  4ULW A;  1OW7 A;  5HSW A;  2R02 A;  3QW0 A;  4MVM A;  2A6E F;  3N24 A;  4G7Z F;  4GEH A;  1M2V B;  1UG7 A;  4DRJ B;  5A6A A;  5JRA A;  4FX5 A;  1LS4 A;  4AK9 A;  3S84 A;  2R25 A;  3ASN C;  4JE9 A;  3NYM A;  3Q6N A;  3PDM P;  1ZW2 A;  1HMD A;  1A7D A;  2M4E A;  3TOL A;  3UMI A;  1ORS C;  3B9Q A;  2ZXP A;  5AC4 A;  1U0B B;  1IZM A;  1NFO A;  1FFH A;  2L6G A;  1EKY A;  1RKE B;  2HS5 A;  2YL1 A;  5COF A;  3EH2 A;  1R4T A;  2GFH A;  3RVY A;  1JPJ A;  3ZG1 A;  3GM3 A;  3MYF A;  1W2W A;  1WN0 A;  1TWG A;  4E0I A;  3FHD A;  3V5Z A;  2JX0 A;  4MW3 A;  5IY5 C;  4J30 B;  4OIN F;  3TQO A;  2W4M A;  4OIQ F;  2D4U A;  2VC9 A;  3I4U A;  1VYK A;  2PBE A;  3HLZ A;  4DBQ A;  2EPO A;  1Z3I X;  3QZC A;  4CX9 A;  3DM5 A;  2A69 F;  4EBB A;  3LUT B;  3U0C A;  4Q4Z F;  3G4X A;  3GWL A;  5F28 E;  3B0U X;  3FOO A;  2MYS A;  5KYW A;  1YAU O;  1OCO C;  4ER9 A;  2CNW A;  4PR9 A;  1GGQ A;  2IXM A;  3EGX B;  4IAR A;  3S90 A;  1WWP A;  2CGE A;  256B A;  3S9O A;  5JS5 A;  1OXK A;  5AC5 A;  3V5Y A;  3A9C A;  4I1O B;  1VLT A;  4U5F E;  4U5G A;  3SYN A;  2R7V A;  2HZ8 A;  2WVN A;  3Q7G A;  3SZR A;  4F4B A;  2H7B A;  4JTD B;  4LLC A;  5BQI A;  2QNL A;  2VCA A;  4QI2 A;  5JLI A;  3AG4 C;  2OEX A;  1R5I D;  1CGN A;  1VMA A;  2HV6 A;  1IW7 F;  2LFF A;  4XPY A;  1TQG A;  2YLG A;  3DJN B;  5DLJ A;  3GEH A;  1E86 A;  1FMV A;  2ZXW C;  4O6M A;  4U9D A;  1PD0 A;  1ZVZ A;  5DVW A;  1MMD A;  3C8Z A;  2Z15 A;  1WTY A;  4MVR A;  3POV A;  3N2Z B;  5DS4 A;  4YL1 A;  2I15 A;  3OEO A;  1APC A;  2QE9 A;  3B29 A;  4K1O A;  2Q7R A;  4J32 B;  1OCZ C;  3I5P A;  5FZT A;  2KJG A;  2HSB A;  2R7S A;  2LFD A;  1FFT C;  2MHR A;  4ZLD A;  1GS9 A;  1PV3 A;  2R7T A;  2A68 F;  1E84 A;  4AE4 B;  3FAJ A;  3RQG A;  2Q9B A;  2XLO A;  4LDQ A;  3UGO A;  3SP1 A;  1YA9 A;  3DWW A;  4OIR F;  1ZHX A;  2XS1 A;  5BQH A;  5L0I A;  2XS8 A;  2LP4 A;  1FAP B;  1XWJ A;  1N1C A;  2IYL D;  3EGD B;  3W8I A;  3L0I A;  2AU5 A;  2M64 A;  3KMI A;  4A2N B;  1K04 A;  3JYY A;  3ABK C;  2L7A A;  4XWJ A;  3SEO A;  4CIP A;  5L0H A;  4CDV A;  2V26 A;  4ZLC A;  4JTA B;  4NC3 A;  1D0Z A;  1M57 C;  4IB4 A;  1EA8 A;  3DE8 A;  5COG A;  3U5S A;  1B68 A;  1NU7 D;  1LI5 A;  2PNO A;  3DD7 A;  3HNI A;  1U89 A;  3IPM O;  1QQ3 A;  4G7H F;  3B0P A;  2WB7 A;  3SNH A;  2ZPA A;  4Z9J A;  5CI8 A;  4WJ0 A;  1YYJ A;  3S27 A;  4CS8 A;  4EWC A;  4HFF B;  4KC9 A;  2HJ3 A;  4I3M A;  3G50 A;  2XSE A;  2OCC C;  3MFN A;  2MWQ A;  4JKV A;  4CS8 C;  2WZG A;  2NUP B;  4JW1 A;  2KW3 C;  1AVO B;  4NQF A;  2P61 A;  4L6R A;  5E3A A;  3FXH A;  1KNY A;  2KGO A;  2DYR C;  2AWY A;  4K7B A;  3MYI A;  1ZU4 A;  4JEA A;  5F5H A;  1Q0K A;  2YL7 A;  1I4Z A;  1I5N A;  1BZ4 A;  3FMS A;  3O55 A;  4GYT A;  5JP7 A;  3TJ6 A;  4YWQ A;  2AVK A;  1PCX A;  4NTF A;  5B1A C;  2DI3 A;  4UDV A;  2W4B A;  5EHH A;  1PD1 A;  4AX2 A;  2R7W A;  3JTL O;  3AJM A;  5T1D B;  1A7V A;  4PJJ A;  3MLG A;  3UMK A;  1RMV A;  4MVQ A;  3M4B A;  1Y6D A;  2KNH A;  3FOP A;  1VYI A;  4MQ9 F;  3JYH A;  1OR3 A;  2R7X A;  4DVY P;  2EIJ C;  2GWW A;  2Q9C A;  3TK0 A;  4G7O F;  3H2U A;  3O6X A;  3C8G A;  5L0C A;  2ASR A;  4N06 A;  2YHS A;  1NFN A;  3LNM B;  1MMA A;  3VYW A;  3U3F A;  3ZVR A;  3ABM C;  3NRH A;  2XLM A;  2XLH A;  1Z6A A;  4DRH B;  2DYS C;  3US6 A;  4O79 A;  5K0I A;  2A1D D;  3T4R A;  1M2O A;  2ETS A;  3LNR A;  3EPV A;  3UMH A;  1H9T A;  4PFP A;  1T5O A;  3GEE A;  3SXK A;  4JIO A;  1VB5 A;  1G4W R;  4LAC B;  5L0F A;  2I8B A;  3SXY A;  2YLD A;  4YK5 A;  3K33 A;  4W8K A;  2A6H F;  3RF3 A;  2VCB A;  2C04 A;  4E18 A;  3EZI A;  4XLN F;  3V5X A;  3ZWI A;  3JRM O;  2J0W A;  1ZYR F;  4BEM J;  4X0R A;  4CS9 C;  3IQ5 A;  4C7O B;  3TUL A;  3O10 A;  1OKK A;  2R7Q A;  1LIH A;  3R7C A;  1RCP A;  4DBR A;  1VK5 A;  1YZA A;  3U3B A;  2P6V A;  4I1M A;  3EH1 A;  2R7O A;  5KYY A;  3VRC A;  3PCV A;  2CNW D;  2BE5 F;  2VH3 A;  4EKW A;  3RQE A;  3VAY A;  2Y3B A;  2R7R A;  4OIO F;  3K1I C;  4J7T A;  2J9W A;  4C3E A;  1D0Y A;  2X0C A;  2CYD A;  4CIH A;  3BEH A;  3ASO C;  1OW6 A;  2J9V A;  4XEF A;  4AL0 A;  5CIV A;  3U2L A;  1C03 A;  4JRZ A;  3U8P A;  3EQL F;  1ZU5 A;  5B1B C;  2PX3 A;  2EPN A;  3ABL C;  2KSF A;  1D0X A;  1Q0M A;  1RJ9 A;  1SR2 A;  1VTM P;  1QKR A;  2HV7 A;  4HE8 D;  3EG9 A;  2NUT A;  1YLM A;  1SZI A;  1AUE A; 
#chains in the Genus database with same CATH homology
 4XPX A;  2AWY A;  4XPW A;  2HMZ A;  4XPY A;  1I4Z A;  4XQ1 A;  2AVK A;  1HMO A;  1A7D A;  1A7E A;  2AWC A;  3WAQ A;  3AGT A;  3WHN A;  3AGU A;  2HMQ A;  2MHR A;  1HMD A;  1I4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...