4NTBA

Mus musculus ltc4 synthase in gsh complex form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
146
structure length
146
Chain Sequence
HHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mus Musculus LTC4 synthase in GSH complex form
rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 59
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntbA00
3B29A 4JRZA 4NTBA 4NTAA 5K0IA 5HV9A 5BQHA 4AL1A 3PCVA 4YK5A 4NTFA 2Q7RA 2UUHA 4JC7A 4WABA 2PNOA 4J7TA 3DWWA 5BQIA 4JCZA 3HKKA 4AL0A 4YL3A 2H8AA 4YL0A 2UUIA 4YL1A 4J7YA 4BPMA 5BQGA 3LEOA
chains in the Genus database with same CATH superfamily
3T4RA 3QMKA 3T6GB 2X0CA 1HW1A 2BL2A 4B6IA 1H9GA 3K1IC 3M4CA 4J32B 4PK4A 1VYIA 3I4UA 5BQHA 3EPVA 5E2QA 2OU6A 2XLMA 1T5OA 2IYLD 4U9EA 2J0XA 3ZWIA 3DE9A 4EHPA 3JRTA 1WOLA 3G50A 1T01A 4ZLDA 4U5EE 4MTFA 1CPQA 3C8GA 3AGUA 4WGZA 5KYNA 3ITFA 1H6GA 2Q9BA 1M2OA 3KL4A 1DOVA 1LI5A 4G7HF 2I15A 3OA1A 4KNWA 5T3TA 4C3DA 2IOQA 2P6VA 4BPMA 3PMRA 3WODF 1M6TA 1NFNA 3GODA 1ZYRF 3ZG1A 2H7BA 3RVZA 5EGYA 3RQEA 2LSEA 3W2WA 4MVMA 2P61A 2OJED 2R7QA 3B29A 4LDQA 3W2VA 4OIPF 2LP4A 1G8XA 4R32A 1Y4CA 4A2NB 4AE4A 4RDAA 2M4EA 2HSQA 3PCVA 2KW3C 3DZAA 5L0FA 2A69F 1LS4A 3LS1A 1NSGB 1IW7F 3PDMP 2R7SA 1N1CA 1ORSC 3N24A 4MVUA 3PHF2 1XZPA 3X2QC 3EZIA 1BDJB 4FESA 2FAPB 2XM0A 2A1DD 2BC5A 2W4BA 2IBFA 1SF8A 1A7DA 2KGOA 2YHSA 1LIHA 3HNJA 4O7GA 3DI5A 3R2PA 2YRFA 1GGQA 1LVKA 3E9VA 4JTCB 3ZSUA 1H7IA 3MX3A 2Y3GA 2OG2A 2WVQA 3JSZA 4U5HA 5JLIA 4JRZA 2YWAA 3O10A 3LAYA 3U0CA 3L8IA 3DAGA 4D4NA 1I4ZA 256BA 4IAQA 5L0GA 2VCCA 1RKEA 3K1HA 3NMJA 1T9KA 2YZSA 5L3QA 2LQGA 1ZVZA 4JCHA 3SXYA 2E87A 3IQCA 5EHHA 5A6BD 1G5ZA 3EFOB 4P6IC 1O87A 3NMKA 3U8VA 3RQGA 1ORYA 4MVRA 4MW8A 2R7TA 1D1BA 2NSFA 3HJCA 4W8KA 2LFFA 1OCZC 2B0JA 3R7CA 4AX2A 2MYSA 3Q6MA 4BG0A 4E0IA 1RJ9A 2OEXA 3N0TA 3NYJA 4CDAA 2B0HA 1E84A 4BEMJ 1VTMP 2R7UA 1NU7D 2YLDA 2YL3A 4EKWA 2YKZA 5AC4A 2KYHA 1V55C 2YL1A 1VK5A 1F1MA 3E70C 3IQ6A 3MLGA 3U5SA 4EWCA 3J06A 4K0DA 3W4YA 1WN0A 1ZU4A 3NG1A 2RD9A 3RW0A 3U9MA 1SR2A 3LS0A 3UMHA 1Z6AA 4BJ6C 5KYWB 1D1AA 1JPNA 1OKKA 2HJ3A 2ZPAA 3AG2C 3CEXA 3N2ZB 5E3CA 1NZEA 1ZHXA 3JCUQ 4PR9A 1D0XA 4I1MA 1YARO 3FAPB 2P1AA 4YK5A 1BBHA 2HMQA 4U5BE 2XLVA 1ZU5A 3AG4C 4G78A 3VRCA 1VOMA 3AGTA 1PD1A 4PFPA 4DRJB 5L0DA 5T1DB 4CSAC 1QQ3A 4PJMA 2J9VA 2HFIA 1JPJA 1Q0MA 3S9OA 3DJUB 4O6NA 2MWQA 3M79A 2H8AA 3SYNA 4C7OA 5KYUA 4YT2A 1YVIA 2A6EF 4OIRF 4KBLA 3K66A 4Q7CA 3U3FA 3FOOA 4O79A 2A68F 3RIPA 4XPYA 4Z9JA 5DLJA 1A7EA 3IEEA 2R02A 3WG7C 4NTBA 3AG1C 3HLZA 5KYYB 3EZHA 4EBKA 1WWPA 3NKEA 3QW1A 5EK0A 2I8BA 3Q6NA 1BR1A 2YVKA 2PBEA 3EGXA 4J30B 4C7OB 1U6HA 2J9WA 4IB4A 4PACA 1JR8A 1K04A 2H7OA 3SZRA 1FAPB 4ONSA 2ZXPA 2L6GA 2V26A 4YJWA 2FGYA 2VASA 1H9TA 3LLIA 3KYJA 2FFHA 2YEVA 4JJFA 1VB5A 4J7TA 1MNEA 3V5YA 2TMVP 2R25A 3V5ZA 4IWBA 1FFHA 2NG1A 1EKYA 4LERA 4G0HA 2R03A 1UFBA 2PF4E 4EUKB 2IXPA 3IHUA 1WGWA 1YA9A 3C8GB 3SXMA 3TULA 1HW2A 3SP1A 1M57C 3U9JA 1D0ZA 4MNDA 1R4TA 2YLIA 1VYKA 3K33A 3LEOA 2BE5F 2HUJA 2WZGA 1Z7Qc 3ABKC 2PX3A 3CQZA 5K0IA 2D4UA 1RJ9B 2XLWA 2A6HF 2GDCA 4IAOA 1L3PA 5B3IA 5JVEA 5F5FA 1AVOB 2HV6A 1ZHTA 1E83A 4XTKA 2L7AA 1APCA 5CI8A 2WB7A 3L0IA 2CW0F 3EG9B 1QKRA 1BZ4A 3W8HA 3UGPA 5JS5A 3S27A 5DQTA 5JP7A 2VB6A 2XS1A 3CAXA 5CIVA 2JPUA 4XWJA 3RF3A 3UMIA 4DVYP 1V4AA 2GAQA 2L81A 2DB4A 4IJJA 3AQCA 4BJ6A 3K6BA 1I4YA 1MNDA 1TWCA 1R5ID 4LDRA 4OIOF 4MTOA 1YZCA 2OKUA 1M2VB 1HMDA 2EPLX 1TR2A 3NYLA 2KK1A 1LS1A 3GM3A 5COMA 3I5PA 2YQYA 3M4BA 2YL0A 1YA7O 2EPNA 5A6AA 1C17M 3BRJA 3F47A 4U5DE 1Z63A 5JRAA 1OXKA 1S05A 2HSBA 4YT8A 3VM6A 4CX9A 5DS6A 2YL7A 4Z9IA 3HNIA 1OR2A 3WHNA 5B3SC 2KC3A 1FFTC 4KI2A 1Z3IX 1ZHZA 2R9RB 3B9QA 1HY5A 4MQ9F 5A6KA 2PP4A 5KYXA 3LEVA 3S84A 1GQAA 3EGDB 4N6CA 3FAJA 3JZ0A 3U2MA 1YYJA 4XEKA 4OIQF 4HE8D 5GPGB 4BJ5C 1LM3B 4OD4A 1TWHA 3ZDLA 1JMWA 2DYSC 1HE1A 5E33A 1OW8A 4DRIB 3EHMA 4W8PA 4JEAA 2LCHA 5AGFA 3UR3C 1A0BA 4DRHB 3C18A 4PJLA 1OXBA 2J8WA 2AP3A 3O6XA 4MTGA 4MVZA 4AL1A 1FMWA 1YYXA 1ZHYA 1Y6DA 2IM8A 3KYIA 1VLTA 4CIPA 4CS8A 5A69A 3US6A 1CPRA 2F22A 1OKKD 5IY5C 4OD5A 2CNWD 2DYRC 3C7JA 3JRMO 4PFOA 3X1OA 4JE9A 1RXQA 4YT5A 3TOLA 4XPWA 1E85A 3W8IA 4BJ1A 1K05A 3DM9B 4ANJA 2Y39A 1YAUO 3B71A 4NQFA 3GEIA 3TOMA 4Q5SF 5D91A 5F28E 2NUPB 3ECSA 1OQCA 3H2VA 3G4XA 4G7ZF 2EIJC 3JYYA 1E86A 5L3VA 3KH2A 2R7VA 2EPKX 2Q9CA 4IRUA 4YT4A 4HFKB 2CDQA 2ZD9A 3B0PA 3NDBB 3DJNB 4E18A 3AG3C 5COGA 3GEHA 4CIHA 3EH1A 3FVYA 3KPHA 3S29A 2J45A 2WL8A 3GWLA 2NUPA 3HNLA 2Y3DA 2J9BA 1K40A 1C02A 3L8JA 2L6HA 3RKOF 2XXAB 2W4MA 3ZVRA 3TK0A 3RVYA 4IARA 4FWVA 3VF0A 3C62A 1QLEC 4XLPF 4H54A 2KQ9A 1QZXA 5FCLA 2HS5A 3ZIBA 5JT4A 2OEVA 2OOCA 3ABMC 4HEAJ 2J7PD 1QPUA 1A7VA 1O3UA 2EPMX 2NPUA 3ATPA 4JTAB 3TJ5A 4CSAA 1HMOA 1LE2A 3LNMB 4C3BA 1OCCC 5B1BC 3ZTZA 1AEPA 2AWYA 2EILC 2XLOA 4JTDB 2Z15A 4Z9HA 5DVWA 2W9YA 1D1CA 1TWGA 3GANA 3QTHA 4JURI 4C3EA 4D4XA 3DXJF 4DVZA 4Q4ZF 3EQLF 1KNYA 1M2VA 2IXOA 1DOWA 1FTSA 1W2WA 4NCQA 3FOPA 2PNOA 1RKCA 4MVOA 1KTMA 2P0NA 1PV3A 3DWWA 2KSFA 4FX5A 3LNRA 1WTYA 5DS4A 5BQIA 4U5FE 3U3BA 5KYYA 3H2UA 1CGME 3HKKA 1MMNA 2J46A 4ER9A 1MMGA 1T6IA 2HMZA 2GWWA 2O9XA 3ZQVA 2AWCA 3A11A 2Q00A 2VCBA 1U0BB 1JAFA 4YL0A 2XRHA 4CS7A 2Y3HA 2A0UA 4QI0A 4LDKA 4X0RA 2JX0A 2J9UA 1OCRC 3AJMA 1YDIA 4JIOA 3SNHA 2LD6A 2LIGA 3NKDA 3IQTA 1CGNA 2WZLA 3FMSA 3V7OA 2PFDA 3NYMA 4AK9A 1OCOC 2XM4A 3EH2A 2QNLA 2ZXRA 3KMIA 4N06A 4ULWA 5D92A 2DGJA 3EJNA 3DM5A 2GFHA 3QW0A 3Q7LA 3CSKA 4LLEA 1ZZPA 2QUPA 5BUOA 1FR0A 3UMKA 2XSEA 4P9TA 2WVNA 3JSEO 3GM1A 2C04A 2NUTA 4P9FA 5JUAA 4BEJA 2R7XA 1WASA 4CDVA 1AUEA 4N6HA 4BJ5A 1OW6A 4MS2A 4AL0A 5KYWA 5DS5A 3M15A 2Q4FA 4QDLA 3T9OA 2KJGA 2IXMA 4UDVA 2V3CC 2XL4A 4LACB 3MBGA 2AVKA 3RFYA 2AU5A 2NSGA 1TFKB 3O39A 2YLGA 2NUTB 5L0CA 1MMDA 3Q7GA 2OQMA 5KYXB 2ICWG 4H4KC 1MMAA 2L6FA 3DKAA 1ORJA 1QVXA 4PJNA 5COFA 2EPOA 1LPEA 3FXHA 4U9DA 3I5QA 4A4AA 3OWTA 4NTAA 2XLHA 3U8PA 3POVA 3FHDA 3MFNA 2W45A 1PD0A 3SEOA 3UNGC 4MVQA 4E7SA 1BR2A 1GS9A 4JEBA 4LLCA 4PJJA 4FAPB 3ZTMA 1KU2A 4JC7A 3B0UX 1FNTc 3HNKA 4WABA 2CYDA 3A9CA 2VCAA 3L34A 3QZCA 4I1OB 1OR3A 2R7WA 1J8YF 3V5XA 3S90A 3QVYA 4F4BA 1ZHWA 4BJTA 3LJBA 1PCXA 4YL1A 1G4WR 4CS9A 1RCPA 1OW7A 3EHNA 4IGGA 4G7OF 1BR4A 2OCCC 3JYHA 4YN0B 3EGXB 1U89A 4ZLCA 4JJGA 2R05A 2XLEA 5L0JA 2LFDA 1T6QA 3SXZA 5HV9A 2A0BA 2R7RA 3G4ZA 5E3AA 1S7ZA 3U2LA 1V54C 3HTKC 3EG9A 3TQOA 1SZIA 1ZW3A 2ZXWC 2QLAA 1XZQA 4U5GA 1Q0FA 3M1CB 4O6MA 4NY3A 3RYLA 2H7VC 3NMIA 4HFFB 3DD7A 3JTLO 1O5HA 3T6JA 3SXKA 3T6BA 4CJOA 4YL3A 1L7CA 3MYIA 4DBQA 1YZAA 1EQ1A 1Q0GA 2CNWA 2GA0A 2WZFA 3EFOA 2QY9A 2M64A 1M56C 1LKXA 1VMAA 1SYQA 2VH3A 3GEEA 3DE8A 5F5HA 1C03A 2XL6A 4JVSA 3BEHA 1RKEB 4CS9C 4DXWA 1D0YA 4MW3A 5A6BA 4E17A 5T3WA 2WVOA 2J7PA 1QSPA 2PX0A 3GORA 3LUTB 3F46A 5JSLA 3ZC4A 5HSWA 4I3MA 1Q0KA 1TQGA 4NTFA 1B68A 1G4US 1CGOA 1ST6A 2UUHA 4JKVA 3ZQYA 4DOZA 4KC9A 1HE9A 4U5CE 4K7BA 3OEOA 2HKVA 3L1MA 2EIKC 1J8MF 4XPXA 5L0IA 4E0HA 4ULVA 1EI7A 4RBNA 2G3KA 4E7ZA 1IZMA 2XLDA 3IPMO 2R7OA 4NC3A 1TFOB 3RH3A 3DMDA 1Q0DA 2MHRA 2KNHA 2UUIA 1NLXA 4EIYA 2HJMA 3S0XA 1LI7A 1NFOA 1V74B 3MYFA 2XXAA 4EBJA 2EINC 2D5RB 4XQ1A 5BQGA 5KYUB 2G3VA 1Z23A 3NRHA 4L6RA 4AE4B 4CJGA 4KNVA 2C03A 2VC9A 1Z5ZA 3C63A 3VYWA 3LESA 2CGEA 1TKNA 2X51A 1XWJA 4OINF 3B0VC 4MVSA 3ASOC 5B1AC 1NBBA 2QE9A 4QI2A 2Y3BA 2J0WA 3RQFA 3KKBA 3FDQA 4JW1A 2EIMC 2HZ8A 3AOUA 1I5NA 1YJGA 2LK4A 3TJ6A 1LE4A 1T6UA 4CBEA 2L9JA 4JCZA 2G62A 2ZXOA 3LLKA 4GYTA 5A6JA 1RMVA 1YLMA 4WJ0A 5L0HA 5DQZA 3DAFA 4N4WA 5CI9A 5FZTA 1UG7A 1FMVA 1MQVA 3JT1A 3ASNC 3K1IA 3GM2A 1E2XA 4CS8C 4XEVA 4EBBA 3GWNA 1A41A 3O55A 4CDYA 4XEFA 1NG1A 2Y69C 4YWQA 4GQHA 1EA8A 3K7DA 2JD3A 4RD9A 3ABLC 2OJQA 2XS8A 4WGYA 1GM5A 2Q7RA 2IXNA 1VLSA 4JZAA 5TJ5E 2Q9AA 3H65A 2ASRA 2CCYA 2QTVA 2HV7A 4I44A 2XL8A 4M63A 4O6YA 3TD7A 3EGDA 2DI3A 2ETSA 3AQBA 3S28A 1JRAA 4XLNF 1WATA 4K1OA 3UGOA 5AC5A 1JOGA 1TWAA 2P7VA 1ZW2A 3C8ZA 3QVZA 2Q3TA 4J7YA 2RSEB 3WAQA 4DBRA 3IQ5A 3VAYA 1SMYF 3C8GD 4DJ9A 1NU9C 3CZ6A 4GEHA
chains in the Genus database with same CATH topology
3B29A 4JRZA 4NTBA 4NTAA 5K0IA 5HV9A 5BQHA 4AL1A 3PCVA 4YK5A 4NTFA 2Q7RA 2UUHA 4JC7A 4WABA 2PNOA 4J7TA 3DWWA 5BQIA 4JCZA 3HKKA 4AL0A 4YL3A 2H8AA 4YL0A 2UUIA 4YL1A 4J7YA 4BPMA 5BQGA 3LEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B29 A;  4JRZ A;  4NTB A;  4NTA A;  5K0I A;  5HV9 A;  5BQH A;  4AL1 A;  3PCV A;  4YK5 A;  4NTF A;  2Q7R A;  2UUH A;  4JC7 A;  4WAB A;  2PNO A;  4J7T A;  3DWW A;  5BQI A;  4JCZ A;  3HKK A;  4AL0 A;  4YL3 A;  2H8A A;  4YL0 A;  2UUI A;  4YL1 A;  4J7Y A;  4BPM A;  5BQG A;  3LEO A; 
#chains in the Genus database with same CATH topology
 3T4R A;  3QMK A;  3T6G B;  2X0C A;  1HW1 A;  2BL2 A;  4B6I A;  1H9G A;  3K1I C;  3M4C A;  4J32 B;  4PK4 A;  1VYI A;  3I4U A;  5BQH A;  3EPV A;  5E2Q A;  2OU6 A;  2XLM A;  1T5O A;  2IYL D;  4U9E A;  2J0X A;  3ZWI A;  3DE9 A;  4EHP A;  3JRT A;  1WOL A;  3G50 A;  1T01 A;  4ZLD A;  4U5E E;  4MTF A;  1CPQ A;  3C8G A;  3AGU A;  4WGZ A;  5KYN A;  3ITF A;  1H6G A;  2Q9B A;  1M2O A;  3KL4 A;  1DOV A;  1LI5 A;  4G7H F;  2I15 A;  3OA1 A;  4KNW A;  5T3T A;  4C3D A;  2IOQ A;  2P6V A;  4BPM A;  3PMR A;  3WOD F;  1M6T A;  1NFN A;  3GOD A;  1ZYR F;  3ZG1 A;  2H7B A;  3RVZ A;  5EGY A;  3RQE A;  2LSE A;  3W2W A;  4MVM A;  2P61 A;  2OJE D;  2R7Q A;  3B29 A;  4LDQ A;  3W2V A;  4OIP F;  2LP4 A;  1G8X A;  4R32 A;  1Y4C A;  4A2N B;  4AE4 A;  4RDA A;  2M4E A;  2HSQ A;  3PCV A;  2KW3 C;  3DZA A;  5L0F A;  2A69 F;  1LS4 A;  3LS1 A;  1NSG B;  1IW7 F;  3PDM P;  2R7S A;  1N1C A;  1ORS C;  3N24 A;  4MVU A;  3PHF 2;  1XZP A;  3X2Q C;  3EZI A;  1BDJ B;  4FES A;  2FAP B;  2XM0 A;  2A1D D;  2BC5 A;  2W4B A;  2IBF A;  1SF8 A;  1A7D A;  2KGO A;  2YHS A;  1LIH A;  3HNJ A;  4O7G A;  3DI5 A;  3R2P A;  2YRF A;  1GGQ A;  1LVK A;  3E9V A;  4JTC B;  3ZSU A;  1H7I A;  3MX3 A;  2Y3G A;  2OG2 A;  2WVQ A;  3JSZ A;  4U5H A;  5JLI A;  4JRZ A;  2YWA A;  3O10 A;  3LAY A;  3U0C A;  3L8I A;  3DAG A;  4D4N A;  1I4Z A;  256B A;  4IAQ A;  5L0G A;  2VCC A;  1RKE A;  3K1H A;  3NMJ A;  1T9K A;  2YZS A;  5L3Q A;  2LQG A;  1ZVZ A;  4JCH A;  3SXY A;  2E87 A;  3IQC A;  5EHH A;  5A6B D;  1G5Z A;  3EFO B;  4P6I C;  1O87 A;  3NMK A;  3U8V A;  3RQG A;  1ORY A;  4MVR A;  4MW8 A;  2R7T A;  1D1B A;  2NSF A;  3HJC A;  4W8K A;  2LFF A;  1OCZ C;  2B0J A;  3R7C A;  4AX2 A;  2MYS A;  3Q6M A;  4BG0 A;  4E0I A;  1RJ9 A;  2OEX A;  3N0T A;  3NYJ A;  4CDA A;  2B0H A;  1E84 A;  4BEM J;  1VTM P;  2R7U A;  1NU7 D;  2YLD A;  2YL3 A;  4EKW A;  2YKZ A;  5AC4 A;  2KYH A;  1V55 C;  2YL1 A;  1VK5 A;  1F1M A;  3E70 C;  3IQ6 A;  3MLG A;  3U5S A;  4EWC A;  3J06 A;  4K0D A;  3W4Y A;  1WN0 A;  1ZU4 A;  3NG1 A;  2RD9 A;  3RW0 A;  3U9M A;  1SR2 A;  3LS0 A;  3UMH A;  1Z6A A;  4BJ6 C;  5KYW B;  1D1A A;  1JPN A;  1OKK A;  2HJ3 A;  2ZPA A;  3AG2 C;  3CEX A;  3N2Z B;  5E3C A;  1NZE A;  1ZHX A;  3JCU Q;  4PR9 A;  1D0X A;  4I1M A;  1YAR O;  3FAP B;  2P1A A;  4YK5 A;  1BBH A;  2HMQ A;  4U5B E;  2XLV A;  1ZU5 A;  3AG4 C;  4G78 A;  3VRC A;  1VOM A;  3AGT A;  1PD1 A;  4PFP A;  4DRJ B;  5L0D A;  5T1D B;  4CSA C;  1QQ3 A;  4PJM A;  2J9V A;  2HFI A;  1JPJ A;  1Q0M A;  3S9O A;  3DJU B;  4O6N A;  2MWQ A;  3M79 A;  2H8A A;  3SYN A;  4C7O A;  5KYU A;  4YT2 A;  1YVI A;  2A6E F;  4OIR F;  4KBL A;  3K66 A;  4Q7C A;  3U3F A;  3FOO A;  4O79 A;  2A68 F;  3RIP A;  4XPY A;  4Z9J A;  5DLJ A;  1A7E A;  3IEE A;  2R02 A;  3WG7 C;  4NTB A;  3AG1 C;  3HLZ A;  5KYY B;  3EZH A;  4EBK A;  1WWP A;  3NKE A;  3QW1 A;  5EK0 A;  2I8B A;  3Q6N A;  1BR1 A;  2YVK A;  2PBE A;  3EGX A;  4J30 B;  4C7O B;  1U6H A;  2J9W A;  4IB4 A;  4PAC A;  1JR8 A;  1K04 A;  2H7O A;  3SZR A;  1FAP B;  4ONS A;  2ZXP A;  2L6G A;  2V26 A;  4YJW A;  2FGY A;  2VAS A;  1H9T A;  3LLI A;  3KYJ A;  2FFH A;  2YEV A;  4JJF A;  1VB5 A;  4J7T A;  1MNE A;  3V5Y A;  2TMV P;  2R25 A;  3V5Z A;  4IWB A;  1FFH A;  2NG1 A;  1EKY A;  4LER A;  4G0H A;  2R03 A;  1UFB A;  2PF4 E;  4EUK B;  2IXP A;  3IHU A;  1WGW A;  1YA9 A;  3C8G B;  3SXM A;  3TUL A;  1HW2 A;  3SP1 A;  1M57 C;  3U9J A;  1D0Z A;  4MND A;  1R4T A;  2YLI A;  1VYK A;  3K33 A;  3LEO A;  2BE5 F;  2HUJ A;  2WZG A;  1Z7Q c;  3ABK C;  2PX3 A;  3CQZ A;  5K0I A;  2D4U A;  1RJ9 B;  2XLW A;  2A6H F;  2GDC A;  4IAO A;  1L3P A;  5B3I A;  5JVE A;  5F5F A;  1AVO B;  2HV6 A;  1ZHT A;  1E83 A;  4XTK A;  2L7A A;  1APC A;  5CI8 A;  2WB7 A;  3L0I A;  2CW0 F;  3EG9 B;  1QKR A;  1BZ4 A;  3W8H A;  3UGP A;  5JS5 A;  3S27 A;  5DQT A;  5JP7 A;  2VB6 A;  2XS1 A;  3CAX A;  5CIV A;  2JPU A;  4XWJ A;  3RF3 A;  3UMI A;  4DVY P;  1V4A A;  2GAQ A;  2L81 A;  2DB4 A;  4IJJ A;  3AQC A;  4BJ6 A;  3K6B A;  1I4Y A;  1MND A;  1TWC A;  1R5I D;  4LDR A;  4OIO F;  4MTO A;  1YZC A;  2OKU A;  1M2V B;  1HMD A;  2EPL X;  1TR2 A;  3NYL A;  2KK1 A;  1LS1 A;  3GM3 A;  5COM A;  3I5P A;  2YQY A;  3M4B A;  2YL0 A;  1YA7 O;  2EPN A;  5A6A A;  1C17 M;  3BRJ A;  3F47 A;  4U5D E;  1Z63 A;  5JRA A;  1OXK A;  1S05 A;  2HSB A;  4YT8 A;  3VM6 A;  4CX9 A;  5DS6 A;  2YL7 A;  4Z9I A;  3HNI A;  1OR2 A;  3WHN A;  5B3S C;  2KC3 A;  1FFT C;  4KI2 A;  1Z3I X;  1ZHZ A;  2R9R B;  3B9Q A;  1HY5 A;  4MQ9 F;  5A6K A;  2PP4 A;  5KYX A;  3LEV A;  3S84 A;  1GQA A;  3EGD B;  4N6C A;  3FAJ A;  3JZ0 A;  3U2M A;  1YYJ A;  4XEK A;  4OIQ F;  4HE8 D;  5GPG B;  4BJ5 C;  1LM3 B;  4OD4 A;  1TWH A;  3ZDL A;  1JMW A;  2DYS C;  1HE1 A;  5E33 A;  1OW8 A;  4DRI B;  3EHM A;  4W8P A;  4JEA A;  2LCH A;  5AGF A;  3UR3 C;  1A0B A;  4DRH B;  3C18 A;  4PJL A;  1OXB A;  2J8W A;  2AP3 A;  3O6X A;  4MTG A;  4MVZ A;  4AL1 A;  1FMW A;  1YYX A;  1ZHY A;  1Y6D A;  2IM8 A;  3KYI A;  1VLT A;  4CIP A;  4CS8 A;  5A69 A;  3US6 A;  1CPR A;  2F22 A;  1OKK D;  5IY5 C;  4OD5 A;  2CNW D;  2DYR C;  3C7J A;  3JRM O;  4PFO A;  3X1O A;  4JE9 A;  1RXQ A;  4YT5 A;  3TOL A;  4XPW A;  1E85 A;  3W8I A;  4BJ1 A;  1K05 A;  3DM9 B;  4ANJ A;  2Y39 A;  1YAU O;  3B71 A;  4NQF A;  3GEI A;  3TOM A;  4Q5S F;  5D91 A;  5F28 E;  2NUP B;  3ECS A;  1OQC A;  3H2V A;  3G4X A;  4G7Z F;  2EIJ C;  3JYY A;  1E86 A;  5L3V A;  3KH2 A;  2R7V A;  2EPK X;  2Q9C A;  4IRU A;  4YT4 A;  4HFK B;  2CDQ A;  2ZD9 A;  3B0P A;  3NDB B;  3DJN B;  4E18 A;  3AG3 C;  5COG A;  3GEH A;  4CIH A;  3EH1 A;  3FVY A;  3KPH A;  3S29 A;  2J45 A;  2WL8 A;  3GWL A;  2NUP A;  3HNL A;  2Y3D A;  2J9B A;  1K40 A;  1C02 A;  3L8J A;  2L6H A;  3RKO F;  2XXA B;  2W4M A;  3ZVR A;  3TK0 A;  3RVY A;  4IAR A;  4FWV A;  3VF0 A;  3C62 A;  1QLE C;  4XLP F;  4H54 A;  2KQ9 A;  1QZX A;  5FCL A;  2HS5 A;  3ZIB A;  5JT4 A;  2OEV A;  2OOC A;  3ABM C;  4HEA J;  2J7P D;  1QPU A;  1A7V A;  1O3U A;  2EPM X;  2NPU A;  3ATP A;  4JTA B;  3TJ5 A;  4CSA A;  1HMO A;  1LE2 A;  3LNM B;  4C3B A;  1OCC C;  5B1B C;  3ZTZ A;  1AEP A;  2AWY A;  2EIL C;  2XLO A;  4JTD B;  2Z15 A;  4Z9H A;  5DVW A;  2W9Y A;  1D1C A;  1TWG A;  3GAN A;  3QTH A;  4JUR I;  4C3E A;  4D4X A;  3DXJ F;  4DVZ A;  4Q4Z F;  3EQL F;  1KNY A;  1M2V A;  2IXO A;  1DOW A;  1FTS A;  1W2W A;  4NCQ A;  3FOP A;  2PNO A;  1RKC A;  4MVO A;  1KTM A;  2P0N A;  1PV3 A;  3DWW A;  2KSF A;  4FX5 A;  3LNR A;  1WTY A;  5DS4 A;  5BQI A;  4U5F E;  3U3B A;  5KYY A;  3H2U A;  1CGM E;  3HKK A;  1MMN A;  2J46 A;  4ER9 A;  1MMG A;  1T6I A;  2HMZ A;  2GWW A;  2O9X A;  3ZQV A;  2AWC A;  3A11 A;  2Q00 A;  2VCB A;  1U0B B;  1JAF A;  4YL0 A;  2XRH A;  4CS7 A;  2Y3H A;  2A0U A;  4QI0 A;  4LDK A;  4X0R A;  2JX0 A;  2J9U A;  1OCR C;  3AJM A;  1YDI A;  4JIO A;  3SNH A;  2LD6 A;  2LIG A;  3NKD A;  3IQT A;  1CGN A;  2WZL A;  3FMS A;  3V7O A;  2PFD A;  3NYM A;  4AK9 A;  1OCO C;  2XM4 A;  3EH2 A;  2QNL A;  2ZXR A;  3KMI A;  4N06 A;  4ULW A;  5D92 A;  2DGJ A;  3EJN A;  3DM5 A;  2GFH A;  3QW0 A;  3Q7L A;  3CSK A;  4LLE A;  1ZZP A;  2QUP A;  5BUO A;  1FR0 A;  3UMK A;  2XSE A;  4P9T A;  2WVN A;  3JSE O;  3GM1 A;  2C04 A;  2NUT A;  4P9F A;  5JUA A;  4BEJ A;  2R7X A;  1WAS A;  4CDV A;  1AUE A;  4N6H A;  4BJ5 A;  1OW6 A;  4MS2 A;  4AL0 A;  5KYW A;  5DS5 A;  3M15 A;  2Q4F A;  4QDL A;  3T9O A;  2KJG A;  2IXM A;  4UDV A;  2V3C C;  2XL4 A;  4LAC B;  3MBG A;  2AVK A;  3RFY A;  2AU5 A;  2NSG A;  1TFK B;  3O39 A;  2YLG A;  2NUT B;  5L0C A;  1MMD A;  3Q7G A;  2OQM A;  5KYX B;  2ICW G;  4H4K C;  1MMA A;  2L6F A;  3DKA A;  1ORJ A;  1QVX A;  4PJN A;  5COF A;  2EPO A;  1LPE A;  3FXH A;  4U9D A;  3I5Q A;  4A4A A;  3OWT A;  4NTA A;  2XLH A;  3U8P A;  3POV A;  3FHD A;  3MFN A;  2W45 A;  1PD0 A;  3SEO A;  3UNG C;  4MVQ A;  4E7S A;  1BR2 A;  1GS9 A;  4JEB A;  4LLC A;  4PJJ A;  4FAP B;  3ZTM A;  1KU2 A;  4JC7 A;  3B0U X;  1FNT c;  3HNK A;  4WAB A;  2CYD A;  3A9C A;  2VCA A;  3L34 A;  3QZC A;  4I1O B;  1OR3 A;  2R7W A;  1J8Y F;  3V5X A;  3S90 A;  3QVY A;  4F4B A;  1ZHW A;  4BJT A;  3LJB A;  1PCX A;  4YL1 A;  1G4W R;  4CS9 A;  1RCP A;  1OW7 A;  3EHN A;  4IGG A;  4G7O F;  1BR4 A;  2OCC C;  3JYH A;  4YN0 B;  3EGX B;  1U89 A;  4ZLC A;  4JJG A;  2R05 A;  2XLE A;  5L0J A;  2LFD A;  1T6Q A;  3SXZ A;  5HV9 A;  2A0B A;  2R7R A;  3G4Z A;  5E3A A;  1S7Z A;  3U2L A;  1V54 C;  3HTK C;  3EG9 A;  3TQO A;  1SZI A;  1ZW3 A;  2ZXW C;  2QLA A;  1XZQ A;  4U5G A;  1Q0F A;  3M1C B;  4O6M A;  4NY3 A;  3RYL A;  2H7V C;  3NMI A;  4HFF B;  3DD7 A;  3JTL O;  1O5H A;  3T6J A;  3SXK A;  3T6B A;  4CJO A;  4YL3 A;  1L7C A;  3MYI A;  4DBQ A;  1YZA A;  1EQ1 A;  1Q0G A;  2CNW A;  2GA0 A;  2WZF A;  3EFO A;  2QY9 A;  2M64 A;  1M56 C;  1LKX A;  1VMA A;  1SYQ A;  2VH3 A;  3GEE A;  3DE8 A;  5F5H A;  1C03 A;  2XL6 A;  4JVS A;  3BEH A;  1RKE B;  4CS9 C;  4DXW A;  1D0Y A;  4MW3 A;  5A6B A;  4E17 A;  5T3W A;  2WVO A;  2J7P A;  1QSP A;  2PX0 A;  3GOR A;  3LUT B;  3F46 A;  5JSL A;  3ZC4 A;  5HSW A;  4I3M A;  1Q0K A;  1TQG A;  4NTF A;  1B68 A;  1G4U S;  1CGO A;  1ST6 A;  2UUH A;  4JKV A;  3ZQY A;  4DOZ A;  4KC9 A;  1HE9 A;  4U5C E;  4K7B A;  3OEO A;  2HKV A;  3L1M A;  2EIK C;  1J8M F;  4XPX A;  5L0I A;  4E0H A;  4ULV A;  1EI7 A;  4RBN A;  2G3K A;  4E7Z A;  1IZM A;  2XLD A;  3IPM O;  2R7O A;  4NC3 A;  1TFO B;  3RH3 A;  3DMD A;  1Q0D A;  2MHR A;  2KNH A;  2UUI A;  1NLX A;  4EIY A;  2HJM A;  3S0X A;  1LI7 A;  1NFO A;  1V74 B;  3MYF A;  2XXA A;  4EBJ A;  2EIN C;  2D5R B;  4XQ1 A;  5BQG A;  5KYU B;  2G3V A;  1Z23 A;  3NRH A;  4L6R A;  4AE4 B;  4CJG A;  4KNV A;  2C03 A;  2VC9 A;  1Z5Z A;  3C63 A;  3VYW A;  3LES A;  2CGE A;  1TKN A;  2X51 A;  1XWJ A;  4OIN F;  3B0V C;  4MVS A;  3ASO C;  5B1A C;  1NBB A;  2QE9 A;  4QI2 A;  2Y3B A;  2J0W A;  3RQF A;  3KKB A;  3FDQ A;  4JW1 A;  2EIM C;  2HZ8 A;  3AOU A;  1I5N A;  1YJG A;  2LK4 A;  3TJ6 A;  1LE4 A;  1T6U A;  4CBE A;  2L9J A;  4JCZ A;  2G62 A;  2ZXO A;  3LLK A;  4GYT A;  5A6J A;  1RMV A;  1YLM A;  4WJ0 A;  5L0H A;  5DQZ A;  3DAF A;  4N4W A;  5CI9 A;  5FZT A;  1UG7 A;  1FMV A;  1MQV A;  3JT1 A;  3ASN C;  3K1I A;  3GM2 A;  1E2X A;  4CS8 C;  4XEV A;  4EBB A;  3GWN A;  1A41 A;  3O55 A;  4CDY A;  4XEF A;  1NG1 A;  2Y69 C;  4YWQ A;  4GQH A;  1EA8 A;  3K7D A;  2JD3 A;  4RD9 A;  3ABL C;  2OJQ A;  2XS8 A;  4WGY A;  1GM5 A;  2Q7R A;  2IXN A;  1VLS A;  4JZA A;  5TJ5 E;  2Q9A A;  3H65 A;  2ASR A;  2CCY A;  2QTV A;  2HV7 A;  4I44 A;  2XL8 A;  4M63 A;  4O6Y A;  3TD7 A;  3EGD A;  2DI3 A;  2ETS A;  3AQB A;  3S28 A;  1JRA A;  4XLN F;  1WAT A;  4K1O A;  3UGO A;  5AC5 A;  1JOG A;  1TWA A;  2P7V A;  1ZW2 A;  3C8Z A;  3QVZ A;  2Q3T A;  4J7Y A;  2RSE B;  3WAQ A;  4DBR A;  3IQ5 A;  3VAY A;  1SMY F;  3C8G D;  4DJ9 A;  1NU9 C;  3CZ6 A;  4GEH A; 
#chains in the Genus database with same CATH homology
 3B29 A;  4JRZ A;  4NTB A;  4NTA A;  5K0I A;  5HV9 A;  5BQH A;  4AL1 A;  3PCV A;  4YK5 A;  4NTF A;  2Q7R A;  2UUH A;  4JC7 A;  4WAB A;  2PNO A;  4J7T A;  3DWW A;  5BQI A;  4JCZ A;  3HKK A;  4AL0 A;  4YL3 A;  2H8A A;  4YL0 A;  2UUI A;  4YL1 A;  4J7Y A;  4BPM A;  5BQG A;  3LEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...