4NTBA

Mus musculus ltc4 synthase in gsh complex form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
146
structure length
146
Chain Sequence
b'HHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in GSH complex form
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 59
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntbA00
2Q7RA 4AL0A 4NTFA 5BQGA 2PNOA 4AL1A 5BQIA 5HV9A 4JRZA 5K0IA 4J7YA 4YK5A 3PCVA 4JCZA 4YL3A 3LEOA 3HKKA 4NTAA 2UUHA 2H8AA 3DWWA 4BPMA 4WABA 4YL0A 5BQHA 3B29A 2UUIA 4NTBA 4YL1A 4J7TA 4JC7A
chains in the Genus database with same CATH superfamily
2Q7RA 2JPUA 3SEOA 1G4WR 1VYKA 3AG4C 2XLWA 3UMHA 4BEJA 3DZAA 1CPQA 3ZVRA 3U8VA 3LEVA 1MMNA 1I4ZA 2AWYA 1BR4A 1T01A 3DM5A 1VK5A 3B71A 3TOLA 3FOOA 5KYYB 4RD9A 1APCA 4AK9A 3JRMO 5JUAA 3TULA 2MWQA 3KL4A 2XLEA 3MLGA 1OKKD 5L3VA 2Q9AA 3BEHA 3FDQA 4U5FE 4LDQA 4MVZA 3GM3A 5KYXB 4WABA 5F5HA 3SXKA 4I1OB 3V5YA 2P6VA 3HNIA 1ZYRF 3K6BA 4GQHA 3S0XA 1KTMA 5CI8A 5L0FA 1N1CA 5B1AC 1RKCA 2J9BA 4H4KC 1K05A 2YLDA 1NBBA 4DRHB 2P1AA 3LS1A 2NPUA 3UGPA 4AL1A 3AGTA 3ZC4A 3EHNA 4CJOA 4W8PA 1LKXA 1MNEA 1VLSA 1XZPA 5JRAA 3DJUB 2CNWD 1O3UA 3HNKA 3FAJA 4IGGA 1YDIA 3M4CA 2A69F 2XRHA 3Q6MA 1ZU5A 2A68F 2G3VA 4AE4A 1YLMA 1M6TA 3A9CA 3TK0A 2WZFA 1ZHTA 2WB7A 2LCHA 1YAUO 3ECSA 4YL0A 3QZCA 4PJLA 2EILC 4G7OF 5HV9A 3ATPA 2V3CC 3TQOA 1LS1A 1M2OA 1CGNA 1YA7O 1LVKA 1NLXA 5A6BA 3OEOA 4XWJA 1UFBA 1EA8A 3NG1A 1BBHA 1C17M 2QY9A 3SNHA 4N6CA 1FMWA 4MTGA 2AP3A 3DKAA 3JRTA 4IWBA 2VH3A 4EUKB 3JTLO 1H6GA 3HJCA 3UNGC 3M79A 1MNDA 1E2XA 4BJ1A 4YT5A 1YZAA 2ZXPA 4D4XA 2CYDA 3NKDA 1MQVA 4DBRA 1E86A 4D4NA 4FAPB 1ZHXA 2GDCA 4YN0B 3TJ6A 2R7OA 2EPLX 3O10A 4ULWA 2RSEB 4U5CE 1SR2A 2GWWA 1T6QA 2LD6A 3S28A 2OG2A 4B6IA 4O6MA 3SXZA 2R05A 1AVOB 4Q5SF 3C8GA 4L6RA 2DYRC 1RJ9B 2VCCA 2CDQA 3IHUA 4MNDA 2V26A 4OINF 5CI9A 2DYSC 2A0BA 3IQCA 3ZTZA 2OOCA 1LM3B 3WHNA 4JKVA 1CPRA 4P9FA 5L0GA 4JVSA 2L6GA 2YL7A 3N24A 2PX3A 4CX9A 3F46A 1Q0FA 3L0IA 3H2UA 4DVZA 1O87A 2J7PA 3NYMA 2XSEA 1G4US 1ZW2A 2EPOA 1GGQA 3RFYA 5EHHA 3I5PA 3EG9A 4E7SA 3VRCA 3DM9B 1Z3IX 2IM8A 5L0JA 4I1MA 3DWWA 3B9QA 4N6HA 2J9WA 2X51A 1OCCC 3T9OA 3S90A 2MYSA 1RKEA 3QVYA 4JJGA 1LI7A 2YLGA 1S7ZA 1UG7A 2L6HA 2LK4A 5EK0A 4JURI 3RKOF 1M57C 3TJ5A 2CGEA 3K1HA 4WGYA 4BJTA 2NUPA 3M15A 5L0IA 1B68A 2L7AA 1VOMA 3LLIA 4XQ1A 2PNOA 3B0VC 3UMIA 3LLKA 4N4WA 5A69A 1A0BA 2EPMX 5A6AA 2XL8A 2HJMA 4Q7CA 4JRZA 1TWGA 1ZVZA 2NSFA 4X0RA 3SP1A 2R25A 3TD7A 1OCOC 2A6HF 1YJGA 1L3PA 2OKUA 3DE9A 4JEAA 4YL3A 5T3WA 4XPXA 5L0HA 1TWCA 3ZIBA 3KYIA 4P9TA 2IXMA 2UUHA 3GM2A 5AC4A 2AVKA 1BR2A 4Z9JA 2FGYA 3K66A 1Z6AA 3EH1A 3W8HA 4XPYA 4NY3A 5JT4A 1PCXA 1QZXA 4U5HA 3EJNA 1RCPA 5TJ5E 2Y69C 4JCHA 2UUIA 3L8IA 4J30B 4J7TA 4MVUA 5KYUB 1E84A 3FAPB 1M2VA 2J9UA 4PACA 4CS9C 4XEKA 4NTFA 3ABKC 1IW7F 3MFNA 4DXWA 1L7CA 1QKRA 3R2PA 4EBJA 1OXKA 3AQBA 3AQCA 1WOLA 2Y3HA 3T4RA 3JYYA 2ETSA 1H7IA 1NFOA 2YZSA 3KYJA 3POVA 2W4MA 3DE8A 4IAQA 2I8BA 4CDVA 4YWQA 3C8ZA 3W4YA 2MHRA 256BA 3ZG1A 3ZTMA 4BPMA 3GEHA 3O39A 4MW3A 2NUTA 4CBEA 1D1AA 1XWJA 1HW1A 2WZGA 3NMIA 1ST6A 4IAOA 4YT8A 5B3IA 1S05A 4JE9A 1Z63A 2R7XA 3ASOC 2DI3A 2I15A 2Y3BA 5GPGB 3EGDA 5JP7A 3UMKA 3HTKC 1R4TA 2OEVA 3N0TA 4WJ0A 3MX3A 2R7WA 1JPNA 1JAFA 1FFHA 2WVOA 4MVQA 3KPHA 2PP4A 5FZTA 1OKKA 1SZIA 2QUPA 3DI5A 3IQ6A 4PR9A 4XLNF 4CDAA 3S84A 3EZHA 3WAQA 5JLIA 1LE2A 2VB6A 4CSAC 4OIPF 4BJ5C 1NFNA 2ZD9A 3LEOA 1OR2A 2HKVA 2R02A 5COMA 3HKKA 2J46A 1QLEC 1DOWA 3FHDA 2ZXOA 4KI2A 4U5EE 1QQ3A 4I44A 2W9YA 3AJMA 4EHPA 4ANJA 4E17A 1YZCA 2YWAA 2BL2A 4ZLCA 4NTBA 2Q9CA 3O55A 5IY5C 1OW7A 2D4UA 4AE4B 4JTDB 3EGXA 3QTHA 2KQ9A 4E7ZA 2CNWA 2WZLA 2KNHA 4G0HA 2R7UA 3UR3C 5BUOA 4JTAB 1VMAA 3DXJF 4OD5A 1J8YF 4CS9A 2VASA 3GWNA 1WGWA 1I5NA 3LJBA 3C63A 2OCCC 3AG3C 1Q0MA 3RQEA 2M64A 3PCVA 5CIVA 1ZW3A 1LI5A 1DOVA 4KNWA 3V5XA 4QI0A 5KYNA 3DD7A 3EQLF 1LIHA 1E85A 2R03A 1HE9A 1C03A 1JOGA 1NU9C 1TFKB 2YRFA 3FXHA 3EHMA 1WWPA 2FFHA 1LS4A 4MW8A 5F5FA 3C18A 5L0CA 5KYWA 1MMDA 2C03A 3JZ0A 2GA0A 2KYHA 2Y39A 3ABMC 4J32B 4KC9A 4U9EA 1H9GA 4E18A 1GQAA 2OJQA 1ZU4A 2H7BA 2WVQA 3JSEO 3Q7LA 5E33A 5DLJA 4CDYA 2IXNA 4CS7A 3CAXA 1WTYA 4GEHA 1LE4A 4O6YA 2HJ3A 5AGFA 1H9TA 3OA1A 1MMGA 1Y4CA 5JS5A 2HZ8A 2GAQA 4CJGA 1TWAA 1QSPA 4C3EA 3C8GB 2F22A 1VLTA 3Q7GA 3KKBA 4F4BA 2XXAA 3AGUA 1Z23A 5BQIA 1W2WA 2BC5A 1A7DA 4R32A 4O7GA 2VCBA 2YL0A 2HV6A 1RJ9A 4CSAA 4BJ5A 1PD1A 2J45A 4BEMJ 2J7PD 4OIQF 3NYJA 4XLPF 1G5ZA 3RF3A 2QE9A 1J8MF 2OJED 2P7VA 3DMDA 1O5HA 2IBFA 1D0XA 5BQHA 3B29A 1Q0DA 3NMKA 4U5GA 1A7EA 4I3MA 1FMVA 1FNTc 3LS0A 3ZQYA 2R7QA 1EI7A 1RKEB 2EPKX 2IOQA 3G50A 5BQGA 3EFOA 2XM4A 1A7VA 4EBKA 2NG1A 1C02A 1SF8A 3MYIA 2PX0A 1R5ID 1XZQA 2NUPB 3QVZA 4C7OB 1PD0A 4U5BE 4JCZA 3IQTA 3M4BA 4DOZA 5DQZA 1WN0A 2W45A 1BZ4A 3R7CA 3TOMA 3EZIA 4NTAA 1T5OA 3T6JA 5COGA 2H8AA 2XL6A 1VYIA 3HLZA 5A6KA 2WVNA 4K7BA 1RXQA 1G8XA 1SMYF 3HNLA 5A6JA 1JMWA 1HW2A 4IB4A 3K1IC 1JPJA 3K7DA 1WASA 3RVYA 1HE1A 4Z9HA 3U9JA 2DB4A 2PBEA 2R9RB 3IPMO 2W4BA 3VF0A 4KBLA 2RD9A 3ZWIA 2ZXRA 4BJ6C 4NC3A 2CCYA 2OU6A 2XL4A 3JT1A 4IJJA 4G78A 4O6NA 5EGYA 3EPVA 3C62A 3WODF 3U5SA 1VTMP 2IYLD 4M63A 4PJNA 5D91A 1M2VB 1TQGA 4LERA 4YK5A 4K0DA 2EINC 3LESA 3AG2C 1YYJA 3E9VA 2Q4FA 4LLCA 4JJFA 4CS8C 1YA9A 1Q0GA 1TR2A 1OCRC 4HFFB 3S29A 2QNLA 3NMJA 5KYUA 2Q3TA 3ABLC 4MVRA 5D92A 3U3FA 2LP4A 2YL3A 2Z15A 3US6A 1YYXA 2L9JA 3H65A 4XEFA 5AC5A 1U0BB 4E0HA 3RQGA 2P0NA 3RIPA 3T6GB 2LQGA 1JRAA 4ULVA 3V7OA 1ZHYA 5B3SC 4UDVA 2C04A 3GEIA 4KNVA 5KYYA 4DRIB 3LAYA 5T3TA 3U9MA 2NUTB 3U2LA 3F47A 3SYNA 3VYWA 2EIJC 4ONSA 2D5RB 3LNRA 3UGOA 2L81A 5HSWA 1AUEA 4PFOA 3HNJA 2G3KA 2HMZA 3S9OA 1NG1A 2JX0A 3EGDB 4PFPA 4MS2A 2R7TA 3ZDLA 2LFDA 5KYXA 4W8KA 2HFIA 3FVYA 1ZZPA 5F28E 2Y3DA 1HMDA 3GODA 4MVMA 4FESA 2CW0F 3LNMB 2QLAA 4NQFA 1BDJB 2J0WA 4QDLA 5JSLA 3ZSUA 1U89A 2XS8A 4E0IA 3NDBB 2G62A 2ICWG 4LACB 3MYFA 1Z7Qc 1MMAA 5E3AA 1KU2A 4AX2A 3K1IA 1I4YA 4JC7A 5E3CA 3SZRA 3E70C 2NSGA 4A4AA 3FOPA 4MTOA 4PJJA 1KNYA 2YQYA 3CZ6A 1FAPB 3V5ZA 4YT4A 4G7ZF 1Z5ZA 1RMVA 1EKYA 2PF4E 4PJMA 3AG1C 1V4AA 2HS5A 2Q00A 2E87A 2XM0A 3GANA 4Z9IA 3RVZA 2KK1A 1CGME 4BJ6A 1JR8A 4JZAA 1TWHA 1AEPA 2EIMC 3ASNC 3EGXB 2XLOA 5A6BD 4JW1A 2O9XA 3ZQVA 1OQCA 2R7VA 3U3BA 1QPUA 2HV7A 3DAGA 1D1BA 1WATA 2LSEA 1TFOB 1F1MA 2B0JA 3O6XA 2HSQA 2DGJA 4CS8A 2PFDA 1K04A 3B0PA 3Q6NA 4FX5A 3DJNB 3DAFA 3K33A 2KC3A 1Y6DA 3G4ZA 3BRJA 2KW3C 4RBNA 3PDMP 4YL1A 3VAYA 3H2VA 1FFTC 3C7JA 2HMQA 2KJGA 3X2QC 4EKWA 1U6HA 1T9KA 5KYWB 1HMOA 1D1CA 1D0ZA 1QVXA 1YARO 2JD3A 3AOUA 3C8GD 2YHSA 3S27A 4EBBA 4YT2A 2QTVA 3A11A 4J7YA 3PMRA 2H7OA 4LDKA 2AU5A 1ZHWA 2YVKA 2XXAB 3U0CA 2IXOA 4DVYP 3RH3A 4A2NB 1OW6A 3CEXA 4U5DE 4YJWA 1ORYA 2GFHA 4XTKA 3N2ZB 4ER9A 1FTSA 2HUJA 1FR0A 3GWLA 4P6IC 3W2WA 2XLVA 4DRJB 2XLDA 1NU7D 1OCZC 5JVEA 3L8JA 4HEAJ 2KSFA 4G7HF 2XLHA 4CIPA 3T6BA 3EG9B 1T6UA 4MQ9F 2R7SA 1V54C 1GS9A 4N06A 1OR3A 2IXPA 4DBQA 5L3QA 5DS5A 4DJ9A 1D0YA 2OQMA 2FAPB 4AL0A 3RW0A 4ZLDA 1BR1A 5COFA 4JIOA 4C3BA 5E2QA 1ORSC 2J9VA 2YEVA 2J0XA 3SXYA 4GYTA 2Y3GA 4HE8D 3FMSA 5DS6A 2B0HA 3ITFA 3B0UX 5DVWA 5DQTA 2H7VC 3L34A 1EQ1A 4CIHA 1NZEA 1ZHZA 3CQZA 1LPEA 4LDRA 5DS4A 1V74B 3JSZA 1TKNA 2ASRA 3EFOB 3GORA 5T1DB 3M1CB 2A1DD 3L1MA 3G4XA 3MBGA 4HFKB 4XPWA 3WG7C 1Q0KA 4NCQA 3J06A 1HY5A 3U2MA 4Q4ZF 1IZMA 3GM1A 3NYLA 4OIRF 2HSBA 3NKEA 3IEEA 3JYHA 2A0UA 3LUTB 4MTFA 4MVSA 3RQFA 2WL8A 3NRHA 2A6EF 4OD4A 4U9DA 4WGZA 5B1BC 4BG0A 3SXMA 4RDAA 2EIKC 2VC9A 1GM5A 4K1OA 4C7OA 1CGOA 2XLMA 3RYLA 4XEVA 1A41A 2TMVP 2BE5F 2KGOA 2LFFA 2OEXA 5FCLA 5L0DA 2ZPAA 1YVIA 2EPNA 3CSKA 3KMIA 4PK4A 2Q9BA 2X0CA 4EWCA 5K0IA 1SYQA 2AWCA 1M56C 1NSGB 2J8WA 2YL1A 3JCUQ 3OWTA 4MVOA 4IRUA 3VM6A 3W8IA 3X1OA 1E83A 3KH2A 4LLEA 4IARA 3I5QA 2XS1A 4C3DA 3U8PA 4EIYA 4JEBA 2R7RA 4O79A 3QW1A 1OW8A 1ORJA 1OXBA 1PV3A 3W2VA 1T6IA 4H54A 2YLIA 3GEEA 4FWVA 3QMKA 2L6FA 2LIGA 4OIOF 3IQ5A 2YKZA 3PHF2 4QI2A 1VB5A 2M4EA 2P61A 2VCAA 1V55C 3EH2A 2ZXWC 3I4UA 3QW0A 4JTCB 1K40A
chains in the Genus database with same CATH topology
2Q7RA 4AL0A 4NTFA 5BQGA 2PNOA 4AL1A 5BQIA 5HV9A 4JRZA 5K0IA 4J7YA 4YK5A 3PCVA 4JCZA 4YL3A 3LEOA 3HKKA 4NTAA 2UUHA 2H8AA 3DWWA 4BPMA 4WABA 4YL0A 5BQHA 3B29A 2UUIA 4NTBA 4YL1A 4J7TA 4JC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7R A;  4AL0 A;  4NTF A;  5BQG A;  2PNO A;  4AL1 A;  5BQI A;  5HV9 A;  4JRZ A;  5K0I A;  4J7Y A;  4YK5 A;  3PCV A;  4JCZ A;  4YL3 A;  3LEO A;  3HKK A;  4NTA A;  2UUH A;  2H8A A;  3DWW A;  4BPM A;  4WAB A;  4YL0 A;  5BQH A;  3B29 A;  2UUI A;  4NTB A;  4YL1 A;  4J7T A;  4JC7 A; 
#chains in the Genus database with same CATH topology
 2Q7R A;  2JPU A;  3SEO A;  1G4W R;  1VYK A;  3AG4 C;  2XLW A;  3UMH A;  4BEJ A;  3DZA A;  1CPQ A;  3ZVR A;  3U8V A;  3LEV A;  1MMN A;  1I4Z A;  2AWY A;  1BR4 A;  1T01 A;  3DM5 A;  1VK5 A;  3B71 A;  3TOL A;  3FOO A;  5KYY B;  4RD9 A;  1APC A;  4AK9 A;  3JRM O;  5JUA A;  3TUL A;  2MWQ A;  3KL4 A;  2XLE A;  3MLG A;  1OKK D;  5L3V A;  2Q9A A;  3BEH A;  3FDQ A;  4U5F E;  4LDQ A;  4MVZ A;  3GM3 A;  5KYX B;  4WAB A;  5F5H A;  3SXK A;  4I1O B;  3V5Y A;  2P6V A;  3HNI A;  1ZYR F;  3K6B A;  4GQH A;  3S0X A;  1KTM A;  5CI8 A;  5L0F A;  1N1C A;  5B1A C;  1RKC A;  2J9B A;  4H4K C;  1K05 A;  2YLD A;  1NBB A;  4DRH B;  2P1A A;  3LS1 A;  2NPU A;  3UGP A;  4AL1 A;  3AGT A;  3ZC4 A;  3EHN A;  4CJO A;  4W8P A;  1LKX A;  1MNE A;  1VLS A;  1XZP A;  5JRA A;  3DJU B;  2CNW D;  1O3U A;  3HNK A;  3FAJ A;  4IGG A;  1YDI A;  3M4C A;  2A69 F;  2XRH A;  3Q6M A;  1ZU5 A;  2A68 F;  2G3V A;  4AE4 A;  1YLM A;  1M6T A;  3A9C A;  3TK0 A;  2WZF A;  1ZHT A;  2WB7 A;  2LCH A;  1YAU O;  3ECS A;  4YL0 A;  3QZC A;  4PJL A;  2EIL C;  4G7O F;  5HV9 A;  3ATP A;  2V3C C;  3TQO A;  1LS1 A;  1M2O A;  1CGN A;  1YA7 O;  1LVK A;  1NLX A;  5A6B A;  3OEO A;  4XWJ A;  1UFB A;  1EA8 A;  3NG1 A;  1BBH A;  1C17 M;  2QY9 A;  3SNH A;  4N6C A;  1FMW A;  4MTG A;  2AP3 A;  3DKA A;  3JRT A;  4IWB A;  2VH3 A;  4EUK B;  3JTL O;  1H6G A;  3HJC A;  3UNG C;  3M79 A;  1MND A;  1E2X A;  4BJ1 A;  4YT5 A;  1YZA A;  2ZXP A;  4D4X A;  2CYD A;  3NKD A;  1MQV A;  4DBR A;  1E86 A;  4D4N A;  4FAP B;  1ZHX A;  2GDC A;  4YN0 B;  3TJ6 A;  2R7O A;  2EPL X;  3O10 A;  4ULW A;  2RSE B;  4U5C E;  1SR2 A;  2GWW A;  1T6Q A;  2LD6 A;  3S28 A;  2OG2 A;  4B6I A;  4O6M A;  3SXZ A;  2R05 A;  1AVO B;  4Q5S F;  3C8G A;  4L6R A;  2DYR C;  1RJ9 B;  2VCC A;  2CDQ A;  3IHU A;  4MND A;  2V26 A;  4OIN F;  5CI9 A;  2DYS C;  2A0B A;  3IQC A;  3ZTZ A;  2OOC A;  1LM3 B;  3WHN A;  4JKV A;  1CPR A;  4P9F A;  5L0G A;  4JVS A;  2L6G A;  2YL7 A;  3N24 A;  2PX3 A;  4CX9 A;  3F46 A;  1Q0F A;  3L0I A;  3H2U A;  4DVZ A;  1O87 A;  2J7P A;  3NYM A;  2XSE A;  1G4U S;  1ZW2 A;  2EPO A;  1GGQ A;  3RFY A;  5EHH A;  3I5P A;  3EG9 A;  4E7S A;  3VRC A;  3DM9 B;  1Z3I X;  2IM8 A;  5L0J A;  4I1M A;  3DWW A;  3B9Q A;  4N6H A;  2J9W A;  2X51 A;  1OCC C;  3T9O A;  3S90 A;  2MYS A;  1RKE A;  3QVY A;  4JJG A;  1LI7 A;  2YLG A;  1S7Z A;  1UG7 A;  2L6H A;  2LK4 A;  5EK0 A;  4JUR I;  3RKO F;  1M57 C;  3TJ5 A;  2CGE A;  3K1H A;  4WGY A;  4BJT A;  2NUP A;  3M15 A;  5L0I A;  1B68 A;  2L7A A;  1VOM A;  3LLI A;  4XQ1 A;  2PNO A;  3B0V C;  3UMI A;  3LLK A;  4N4W A;  5A69 A;  1A0B A;  2EPM X;  5A6A A;  2XL8 A;  2HJM A;  4Q7C A;  4JRZ A;  1TWG A;  1ZVZ A;  2NSF A;  4X0R A;  3SP1 A;  2R25 A;  3TD7 A;  1OCO C;  2A6H F;  1YJG A;  1L3P A;  2OKU A;  3DE9 A;  4JEA A;  4YL3 A;  5T3W A;  4XPX A;  5L0H A;  1TWC A;  3ZIB A;  3KYI A;  4P9T A;  2IXM A;  2UUH A;  3GM2 A;  5AC4 A;  2AVK A;  1BR2 A;  4Z9J A;  2FGY A;  3K66 A;  1Z6A A;  3EH1 A;  3W8H A;  4XPY A;  4NY3 A;  5JT4 A;  1PCX A;  1QZX A;  4U5H A;  3EJN A;  1RCP A;  5TJ5 E;  2Y69 C;  4JCH A;  2UUI A;  3L8I A;  4J30 B;  4J7T A;  4MVU A;  5KYU B;  1E84 A;  3FAP B;  1M2V A;  2J9U A;  4PAC A;  4CS9 C;  4XEK A;  4NTF A;  3ABK C;  1IW7 F;  3MFN A;  4DXW A;  1L7C A;  1QKR A;  3R2P A;  4EBJ A;  1OXK A;  3AQB A;  3AQC A;  1WOL A;  2Y3H A;  3T4R A;  3JYY A;  2ETS A;  1H7I A;  1NFO A;  2YZS A;  3KYJ A;  3POV A;  2W4M A;  3DE8 A;  4IAQ A;  2I8B A;  4CDV A;  4YWQ A;  3C8Z A;  3W4Y A;  2MHR A;  256B A;  3ZG1 A;  3ZTM A;  4BPM A;  3GEH A;  3O39 A;  4MW3 A;  2NUT A;  4CBE A;  1D1A A;  1XWJ A;  1HW1 A;  2WZG A;  3NMI A;  1ST6 A;  4IAO A;  4YT8 A;  5B3I A;  1S05 A;  4JE9 A;  1Z63 A;  2R7X A;  3ASO C;  2DI3 A;  2I15 A;  2Y3B A;  5GPG B;  3EGD A;  5JP7 A;  3UMK A;  3HTK C;  1R4T A;  2OEV A;  3N0T A;  4WJ0 A;  3MX3 A;  2R7W A;  1JPN A;  1JAF A;  1FFH A;  2WVO A;  4MVQ A;  3KPH A;  2PP4 A;  5FZT A;  1OKK A;  1SZI A;  2QUP A;  3DI5 A;  3IQ6 A;  4PR9 A;  4XLN F;  4CDA A;  3S84 A;  3EZH A;  3WAQ A;  5JLI A;  1LE2 A;  2VB6 A;  4CSA C;  4OIP F;  4BJ5 C;  1NFN A;  2ZD9 A;  3LEO A;  1OR2 A;  2HKV A;  2R02 A;  5COM A;  3HKK A;  2J46 A;  1QLE C;  1DOW A;  3FHD A;  2ZXO A;  4KI2 A;  4U5E E;  1QQ3 A;  4I44 A;  2W9Y A;  3AJM A;  4EHP A;  4ANJ A;  4E17 A;  1YZC A;  2YWA A;  2BL2 A;  4ZLC A;  4NTB A;  2Q9C A;  3O55 A;  5IY5 C;  1OW7 A;  2D4U A;  4AE4 B;  4JTD B;  3EGX A;  3QTH A;  2KQ9 A;  4E7Z A;  2CNW A;  2WZL A;  2KNH A;  4G0H A;  2R7U A;  3UR3 C;  5BUO A;  4JTA B;  1VMA A;  3DXJ F;  4OD5 A;  1J8Y F;  4CS9 A;  2VAS A;  3GWN A;  1WGW A;  1I5N A;  3LJB A;  3C63 A;  2OCC C;  3AG3 C;  1Q0M A;  3RQE A;  2M64 A;  3PCV A;  5CIV A;  1ZW3 A;  1LI5 A;  1DOV A;  4KNW A;  3V5X A;  4QI0 A;  5KYN A;  3DD7 A;  3EQL F;  1LIH A;  1E85 A;  2R03 A;  1HE9 A;  1C03 A;  1JOG A;  1NU9 C;  1TFK B;  2YRF A;  3FXH A;  3EHM A;  1WWP A;  2FFH A;  1LS4 A;  4MW8 A;  5F5F A;  3C18 A;  5L0C A;  5KYW A;  1MMD A;  2C03 A;  3JZ0 A;  2GA0 A;  2KYH A;  2Y39 A;  3ABM C;  4J32 B;  4KC9 A;  4U9E A;  1H9G A;  4E18 A;  1GQA A;  2OJQ A;  1ZU4 A;  2H7B A;  2WVQ A;  3JSE O;  3Q7L A;  5E33 A;  5DLJ A;  4CDY A;  2IXN A;  4CS7 A;  3CAX A;  1WTY A;  4GEH A;  1LE4 A;  4O6Y A;  2HJ3 A;  5AGF A;  1H9T A;  3OA1 A;  1MMG A;  1Y4C A;  5JS5 A;  2HZ8 A;  2GAQ A;  4CJG A;  1TWA A;  1QSP A;  4C3E A;  3C8G B;  2F22 A;  1VLT A;  3Q7G A;  3KKB A;  4F4B A;  2XXA A;  3AGU A;  1Z23 A;  5BQI A;  1W2W A;  2BC5 A;  1A7D A;  4R32 A;  4O7G A;  2VCB A;  2YL0 A;  2HV6 A;  1RJ9 A;  4CSA A;  4BJ5 A;  1PD1 A;  2J45 A;  4BEM J;  2J7P D;  4OIQ F;  3NYJ A;  4XLP F;  1G5Z A;  3RF3 A;  2QE9 A;  1J8M F;  2OJE D;  2P7V A;  3DMD A;  1O5H A;  2IBF A;  1D0X A;  5BQH A;  3B29 A;  1Q0D A;  3NMK A;  4U5G A;  1A7E A;  4I3M A;  1FMV A;  1FNT c;  3LS0 A;  3ZQY A;  2R7Q A;  1EI7 A;  1RKE B;  2EPK X;  2IOQ A;  3G50 A;  5BQG A;  3EFO A;  2XM4 A;  1A7V A;  4EBK A;  2NG1 A;  1C02 A;  1SF8 A;  3MYI A;  2PX0 A;  1R5I D;  1XZQ A;  2NUP B;  3QVZ A;  4C7O B;  1PD0 A;  4U5B E;  4JCZ A;  3IQT A;  3M4B A;  4DOZ A;  5DQZ A;  1WN0 A;  2W45 A;  1BZ4 A;  3R7C A;  3TOM A;  3EZI A;  4NTA A;  1T5O A;  3T6J A;  5COG A;  2H8A A;  2XL6 A;  1VYI A;  3HLZ A;  5A6K A;  2WVN A;  4K7B A;  1RXQ A;  1G8X A;  1SMY F;  3HNL A;  5A6J A;  1JMW A;  1HW2 A;  4IB4 A;  3K1I C;  1JPJ A;  3K7D A;  1WAS A;  3RVY A;  1HE1 A;  4Z9H A;  3U9J A;  2DB4 A;  2PBE A;  2R9R B;  3IPM O;  2W4B A;  3VF0 A;  4KBL A;  2RD9 A;  3ZWI A;  2ZXR A;  4BJ6 C;  4NC3 A;  2CCY A;  2OU6 A;  2XL4 A;  3JT1 A;  4IJJ A;  4G78 A;  4O6N A;  5EGY A;  3EPV A;  3C62 A;  3WOD F;  3U5S A;  1VTM P;  2IYL D;  4M63 A;  4PJN A;  5D91 A;  1M2V B;  1TQG A;  4LER A;  4YK5 A;  4K0D A;  2EIN C;  3LES A;  3AG2 C;  1YYJ A;  3E9V A;  2Q4F A;  4LLC A;  4JJF A;  4CS8 C;  1YA9 A;  1Q0G A;  1TR2 A;  1OCR C;  4HFF B;  3S29 A;  2QNL A;  3NMJ A;  5KYU A;  2Q3T A;  3ABL C;  4MVR A;  5D92 A;  3U3F A;  2LP4 A;  2YL3 A;  2Z15 A;  3US6 A;  1YYX A;  2L9J A;  3H65 A;  4XEF A;  5AC5 A;  1U0B B;  4E0H A;  3RQG A;  2P0N A;  3RIP A;  3T6G B;  2LQG A;  1JRA A;  4ULV A;  3V7O A;  1ZHY A;  5B3S C;  4UDV A;  2C04 A;  3GEI A;  4KNV A;  5KYY A;  4DRI B;  3LAY A;  5T3T A;  3U9M A;  2NUT B;  3U2L A;  3F47 A;  3SYN A;  3VYW A;  2EIJ C;  4ONS A;  2D5R B;  3LNR A;  3UGO A;  2L81 A;  5HSW A;  1AUE A;  4PFO A;  3HNJ A;  2G3K A;  2HMZ A;  3S9O A;  1NG1 A;  2JX0 A;  3EGD B;  4PFP A;  4MS2 A;  2R7T A;  3ZDL A;  2LFD A;  5KYX A;  4W8K A;  2HFI A;  3FVY A;  1ZZP A;  5F28 E;  2Y3D A;  1HMD A;  3GOD A;  4MVM A;  4FES A;  2CW0 F;  3LNM B;  2QLA A;  4NQF A;  1BDJ B;  2J0W A;  4QDL A;  5JSL A;  3ZSU A;  1U89 A;  2XS8 A;  4E0I A;  3NDB B;  2G62 A;  2ICW G;  4LAC B;  3MYF A;  1Z7Q c;  1MMA A;  5E3A A;  1KU2 A;  4AX2 A;  3K1I A;  1I4Y A;  4JC7 A;  5E3C A;  3SZR A;  3E70 C;  2NSG A;  4A4A A;  3FOP A;  4MTO A;  4PJJ A;  1KNY A;  2YQY A;  3CZ6 A;  1FAP B;  3V5Z A;  4YT4 A;  4G7Z F;  1Z5Z A;  1RMV A;  1EKY A;  2PF4 E;  4PJM A;  3AG1 C;  1V4A A;  2HS5 A;  2Q00 A;  2E87 A;  2XM0 A;  3GAN A;  4Z9I A;  3RVZ A;  2KK1 A;  1CGM E;  4BJ6 A;  1JR8 A;  4JZA A;  1TWH A;  1AEP A;  2EIM C;  3ASN C;  3EGX B;  2XLO A;  5A6B D;  4JW1 A;  2O9X A;  3ZQV A;  1OQC A;  2R7V A;  3U3B A;  1QPU A;  2HV7 A;  3DAG A;  1D1B A;  1WAT A;  2LSE A;  1TFO B;  1F1M A;  2B0J A;  3O6X A;  2HSQ A;  2DGJ A;  4CS8 A;  2PFD A;  1K04 A;  3B0P A;  3Q6N A;  4FX5 A;  3DJN B;  3DAF A;  3K33 A;  2KC3 A;  1Y6D A;  3G4Z A;  3BRJ A;  2KW3 C;  4RBN A;  3PDM P;  4YL1 A;  3VAY A;  3H2V A;  1FFT C;  3C7J A;  2HMQ A;  2KJG A;  3X2Q C;  4EKW A;  1U6H A;  1T9K A;  5KYW B;  1HMO A;  1D1C A;  1D0Z A;  1QVX A;  1YAR O;  2JD3 A;  3AOU A;  3C8G D;  2YHS A;  3S27 A;  4EBB A;  4YT2 A;  2QTV A;  3A11 A;  4J7Y A;  3PMR A;  2H7O A;  4LDK A;  2AU5 A;  1ZHW A;  2YVK A;  2XXA B;  3U0C A;  2IXO A;  4DVY P;  3RH3 A;  4A2N B;  1OW6 A;  3CEX A;  4U5D E;  4YJW A;  1ORY A;  2GFH A;  4XTK A;  3N2Z B;  4ER9 A;  1FTS A;  2HUJ A;  1FR0 A;  3GWL A;  4P6I C;  3W2W A;  2XLV A;  4DRJ B;  2XLD A;  1NU7 D;  1OCZ C;  5JVE A;  3L8J A;  4HEA J;  2KSF A;  4G7H F;  2XLH A;  4CIP A;  3T6B A;  3EG9 B;  1T6U A;  4MQ9 F;  2R7S A;  1V54 C;  1GS9 A;  4N06 A;  1OR3 A;  2IXP A;  4DBQ A;  5L3Q A;  5DS5 A;  4DJ9 A;  1D0Y A;  2OQM A;  2FAP B;  4AL0 A;  3RW0 A;  4ZLD A;  1BR1 A;  5COF A;  4JIO A;  4C3B A;  5E2Q A;  1ORS C;  2J9V A;  2YEV A;  2J0X A;  3SXY A;  4GYT A;  2Y3G A;  4HE8 D;  3FMS A;  5DS6 A;  2B0H A;  3ITF A;  3B0U X;  5DVW A;  5DQT A;  2H7V C;  3L34 A;  1EQ1 A;  4CIH A;  1NZE A;  1ZHZ A;  3CQZ A;  1LPE A;  4LDR A;  5DS4 A;  1V74 B;  3JSZ A;  1TKN A;  2ASR A;  3EFO B;  3GOR A;  5T1D B;  3M1C B;  2A1D D;  3L1M A;  3G4X A;  3MBG A;  4HFK B;  4XPW A;  3WG7 C;  1Q0K A;  4NCQ A;  3J06 A;  1HY5 A;  3U2M A;  4Q4Z F;  1IZM A;  3GM1 A;  3NYL A;  4OIR F;  2HSB A;  3NKE A;  3IEE A;  3JYH A;  2A0U A;  3LUT B;  4MTF A;  4MVS A;  3RQF A;  2WL8 A;  3NRH A;  2A6E F;  4OD4 A;  4U9D A;  4WGZ A;  5B1B C;  4BG0 A;  3SXM A;  4RDA A;  2EIK C;  2VC9 A;  1GM5 A;  4K1O A;  4C7O A;  1CGO A;  2XLM A;  3RYL A;  4XEV A;  1A41 A;  2TMV P;  2BE5 F;  2KGO A;  2LFF A;  2OEX A;  5FCL A;  5L0D A;  2ZPA A;  1YVI A;  2EPN A;  3CSK A;  3KMI A;  4PK4 A;  2Q9B A;  2X0C A;  4EWC A;  5K0I A;  1SYQ A;  2AWC A;  1M56 C;  1NSG B;  2J8W A;  2YL1 A;  3JCU Q;  3OWT A;  4MVO A;  4IRU A;  3VM6 A;  3W8I A;  3X1O A;  1E83 A;  3KH2 A;  4LLE A;  4IAR A;  3I5Q A;  2XS1 A;  4C3D A;  3U8P A;  4EIY A;  4JEB A;  2R7R A;  4O79 A;  3QW1 A;  1OW8 A;  1ORJ A;  1OXB A;  1PV3 A;  3W2V A;  1T6I A;  4H54 A;  2YLI A;  3GEE A;  4FWV A;  3QMK A;  2L6F A;  2LIG A;  4OIO F;  3IQ5 A;  2YKZ A;  3PHF 2;  4QI2 A;  1VB5 A;  2M4E A;  2P61 A;  2VCA A;  1V55 C;  3EH2 A;  2ZXW C;  3I4U A;  3QW0 A;  4JTC B;  1K40 A; 
#chains in the Genus database with same CATH homology
 2Q7R A;  4AL0 A;  4NTF A;  5BQG A;  2PNO A;  4AL1 A;  5BQI A;  5HV9 A;  4JRZ A;  5K0I A;  4J7Y A;  4YK5 A;  3PCV A;  4JCZ A;  4YL3 A;  3LEO A;  3HKK A;  4NTA A;  2UUH A;  2H8A A;  3DWW A;  4BPM A;  4WAB A;  4YL0 A;  5BQH A;  3B29 A;  2UUI A;  4NTB A;  4YL1 A;  4J7T A;  4JC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...