4NTBA

Mus musculus ltc4 synthase in gsh complex form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
146
structure length
146
Chain Sequence
HHKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Mus Musculus LTC4 synthase in GSH complex form
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 59
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntbA00
2Q7RA 4AL0A 4NTAA 5K0IA 4WABA 3LEOA 4NTBA 4YL1A 4BPMA 5HV9A 2UUIA 5BQHA 4JRZA 2PNOA 4J7TA 4J7YA 5BQGA 2H8AA 3PCVA 3DWWA 4YL0A 3HKKA 4NTFA 2UUHA 4JCZA 4YL3A 5BQIA 3B29A 4JC7A 4YK5A 4AL1A
chains in the Genus database with same CATH superfamily
2Q7RA 4CIPA 2XM4A 1WASA 2XLWA 1Q0MA 5F5HA 4CS9C 1T5OA 1LI5A 2KJGA 2EPOA 3GEEA 3MBGA 2BC5A 4HFFB 3R7CA 3UGPA 3O55A 3ZG1A 3AG2C 3X1OA 5KYWB 3K1HA 3GWLA 4E17A 1LM3B 2AVKA 1E2XA 2LIGA 2GFHA 2J8WA 2OJQA 1NSGB 4LLEA 1YZAA 3RW0A 3ZIBA 2A0UA 2X51A 3T9OA 1Y4CA 5JS5A 3LJBA 1OKKD 1QQ3A 2PNOA 3VF0A 3NDBB 1Q0FA 2EIMC 1J8MF 4U5HA 2I15A 5AGFA 2H8AA 3EFOB 4OIOF 2WVOA 3QW1A 4W8KA 1LIHA 5DS5A 4OIPF 2KQ9A 4MTFA 1H9TA 3JRMO 4W8PA 3FOPA 4KNWA 2PBEA 4JJFA 1QKRA 1WWPA 2IBFA 4C3EA 4G7OF 2A0BA 5A6BD 2IXNA 1MMAA 5L0GA 2Q9CA 3JRTA 4MVMA 2J0WA 3L0IA 1TKNA 2O9XA 1YJGA 1BBHA 3S29A 2Y39A 1I4ZA 3AGUA 3T6JA 1CGME 2M4EA 5F28E 3RQFA 3KYJA 4PJLA 3K33A 3VYWA 1VLTA 3MYIA 3K1IA 4PFOA 5HV9A 2YLIA 3C8GA 2YLDA 1CGOA 3E70C 4NQFA 4XLNF 3W8IA 3ZC4A 2IOQA 2XRHA 1NBBA 4BEMJ 1V74B 4MNDA 5L0CA 3LESA 4JTCB 4WGZA 1A7VA 2KK1A 2LQGA 4Z9IA 3LNRA 4CDYA 3FMSA 3Q6NA 3S28A 2L6FA 1T9KA 1HE1A 3Q6MA 2EILC 2HV6A 2V3CC 3T4RA 3IPMO 3ABKC 2ZPAA 4CS9A 1RXQA 2XLEA 2KC3A 3F46A 3Q7GA 5A6JA 2KNHA 1YA7O 3LAYA 3DXJF 3G50A 4Q7CA 4U5GA 4MW8A 3DMDA 3DKAA 4JTDB 4PACA 4EBKA 1F1MA 4JURI 5L3VA 4MVQA 3K7DA 4ZLCA 3ASOC 4U5DE 2TMVP 3NMIA 2VASA 2AU5A 1Q0DA 3NYLA 4JIOA 3ECSA 3NYMA 1M6TA 4Z9JA 2PF4E 1Z3IX 3RKOF 1QZXA 3CSKA 3K66A 5KYNA 2HFIA 5DQZA 1I4YA 4J30B 2LCHA 4N06A 3DD7A 4NTFA 3ZQVA 2AWYA 5KYXA 2ZXPA 4PFPA 4IAOA 1MMNA 2IXPA 2YL1A 1BR4A 2DGJA 4QI0A 4PJNA 1Z63A 5L0HA 2GWWA 5DVWA 2HS5A 4KNVA 1CPQA 4E18A 5T1DB 1A41A 4JE9A 2W4BA 3H2UA 5L0JA 1NFOA 2WVQA 4Q4ZF 2H7VC 3AG3C 3U5SA 256BA 4EBBA 2L6GA 1EKYA 3ABMC 3SYNA 3C8GD 3EHNA 4U5EE 4RD9A 5E3CA 4DJ9A 2IYLD 5JVEA 3DAFA 3C8ZA 4JEBA 1QVXA 2P0NA 3VM6A 5EGYA 5BQGA 3UR3C 1C02A 1AUEA 1TQGA 1G5ZA 1WOLA 2R25A 3KH2A 3WAQA 3B0VC 1BZ4A 2DYRC 3TJ6A 3TQOA 2C04A 1OKKA 4E0IA 5B3IA 1A7EA 2VB6A 3UGOA 2XL4A 5EK0A 1YAUO 2Q3TA 4A2NB 1OW6A 4NTAA 2A1DD 4MVZA 3QW0A 2L9JA 3DJNB 2CCYA 1KU2A 5COFA 3GORA 2Q00A 3U3BA 1SZIA 3EQLF 5JRAA 2Y3HA 4YT2A 2X0CA 3ABLC 1M57C 4AX2A 1YLMA 1RMVA 4DVYP 3I5QA 3C18A 1ZHTA 3FAPB 3FOOA 4JW1A 5T3TA 2EPKX 3LLIA 1ZHZA 3QTHA 4DOZA 3I5PA 4Z9HA 1O5HA 5AC5A 3B0UX 3M15A 3LNMB 4LLCA 2R02A 2Z15A 1RKCA 2ZD9A 1Q0KA 1FMVA 1ZHXA 4JZAA 2NUPB 2IM8A 1TFOB 2L7AA 1HE9A 2XL8A 3KKBA 3RF3A 3NMJA 3HKKA 1R5ID 1GGQA 4GYTA 3L8JA 1OW7A 1EI7A 4NY3A 2MYSA 1E84A 2ETSA 3TK0A 1O87A 3NKDA 4CSAA 3J06A 4GEHA 3V5YA 4YWQA 3MLGA 2PX3A 1WN0A 1D0YA 1MMDA 3S90A 4PJMA 5FCLA 4XPXA 4EIYA 4RDAA 2HKVA 2XS8A 1VTMP 3EH1A 1VOMA 1M2OA 4I1OB 4F4BA 4O6YA 4PK4A 5JLIA 3PDMP 4YT8A 4ONSA 2W9YA 3OEOA 4IGGA 2OQMA 4HFKB 5AC4A 3U8VA 1ZHWA 3RH3A 3QMKA 4IRUA 3EPVA 1ZW2A 2JPUA 4E7SA 4U9DA 4OD4A 3V5ZA 5IY5C 1PV3A 2A68F 2PP4A 4K0DA 1LE4A 1BR2A 3SXKA 4YN0B 3AGTA 4MVRA 3B29A 3W2VA 3ZSUA 2IXOA 4CJOA 2J9UA 1HW2A 3K6BA 3US6A 3LUTB 1T6IA 3EG9B 4K1OA 3U8PA 3KL4A 1YA9A 1U89A 3S27A 1D1BA 3W2WA 5L3QA 3JCUQ 4LACB 2VCCA 3HLZA 1OCOC 1KTMA 2JX0A 2R9RB 3ASNC 3C8GB 3JSZA 3O6XA 4FX5A 2J7PD 1M2VB 2LK4A 1T6UA 3GEHA 4CX9A 3EG9A 1ZW3A 1YYXA 2HJMA 1Z6AA 2Y69C 4MQ9F 4O79A 4XEVA 2CGEA 1ZU5A 4JRZA 4MVOA 1H6GA 3KYIA 1LVKA 2WL8A 3SNHA 4XLPF 2LP4A 2GAQA 2OG2A 1M2VA 3V7OA 1Y6DA 1NFNA 3ITFA 1ST6A 3SP1A 2W4MA 4DRIB 3JYYA 3L8IA 2YL3A 3SXZA 5A6KA 1D0ZA 2YWAA 3M4BA 3SXYA 5DLJA 4XEFA 2WZFA 1GM5A 1YVIA 3TOLA 3TD7A 4I3MA 1VYKA 3V5XA 2YL0A 3ZWIA 4CS7A 2ASRA 5GPGB 4CBEA 3M79A 3Q7LA 4PR9A 4U5FE 4QDLA 2XS1A 4IJJA 4MVSA 4CDVA 4C7OB 4I1MA 3MYFA 4HEAJ 5HSWA 3ATPA 3MFNA 4ANJA 1TFKB 4LERA 2EIKC 1RKEA 1S05A 1M56C 1VLSA 1JR8A 5E2QA 4RBNA 4CIHA 5KYXB 1PD0A 5COGA 2HSBA 1T01A 4C7OA 3IQCA 1KNYA 4MTGA 1RCPA 4LDKA 2WZLA 1EQ1A 4EKWA 2Q4FA 5CI9A 3I4UA 3DZAA 4DRJB 2F22A 4Q5SF 1OQCA 3ZQYA 3RYLA 1QPUA 1V54C 4CSAC 4WGYA 1B68A 3B0PA 3EHMA 4LDQA 4BJ5C 2C03A 1AVOB 2P1AA 3C63A 3MX3A 4B6IA 3PHF2 2QLAA 2XLMA 5JP7A 4D4XA 2WB7A 2NPUA 1LS1A 4ER9A 4XPYA 5E33A 4CDAA 2YL7A 1K05A 2P61A 4X0RA 3U3FA 4BPMA 1G4US 2GA0A 1TR2A 2XLHA 3DM5A 5JUAA 3DM9B 1E86A 4LDRA 3M1CB 3JZ0A 3WHNA 1FFHA 3IQTA 1TWCA 3LS1A 3GWNA 4DRHB 1XWJA 3W8HA 3RVYA 5D92A 3G4XA 5TJ5E 5A6AA 1TWHA 2XLDA 3U9MA 4EHPA 2WVNA 3LEVA 2RD9A 5JSLA 5KYUB 2UUHA 3WG7C 1XZQA 4R32A 4YT5A 4YK5A 4QI2A 1J8YF 2OOCA 3TJ5A 1D1AA 2P6VA 5JT4A 3GODA 5E3AA 1IZMA 5B1AC 5KYUA 3WODF 1FAPB 2XM0A 1WTYA 2QY9A 4JCHA 4E7ZA 4KI2A 1D1CA 3VRCA 3W4YA 4N6HA 4NC3A 1VYIA 2OEVA 1OCRC 2HJ3A 2MHRA 1NLXA 3AQCA 3HNIA 1V4AA 1BR1A 1G8XA 1HW1A 1LPEA 1ZHYA 2AWCA 2J7PA 2L81A 3F47A 4J7YA 4M63A 4FESA 3N2ZB 4DBRA 5KYYB 1NZEA 1OCZC 3E9VA 4P6IC 3AG4C 3DE9A 1NU7D 1S7ZA 3O39A 4XWJA 1FFTC 4OD5A 3DJUB 3L1MA 3U9JA 4OIQF 2XSEA 3T6BA 5KYYA 4EWCA 2M64A 4P9TA 2CW0F 3C7JA 1ZVZA 3NYJA 1L7CA 2I8BA 1BDJB 1JAFA 3HNJA 2WZGA 4BJ5A 2FAPB 1HMDA 2NUTB 3QVZA 4N6CA 4WABA 3AG1C 3U2LA 3LEOA 4J32B 3BRJA 2VC9A 1ZYRF 1YDIA 2Y3BA 1I5NA 3NKEA 1OR3A 4ULVA 2ZXRA 1GS9A 4O6MA 3JTLO 2NUTA 1Q0GA 2KSFA 2OEXA 2KYHA 2A69F 4J7TA 3LLKA 3UMKA 3UNGC 4XEKA 2XLVA 4CJGA 3S0XA 3EGDB 1NU9C 2EPNA 3N24A 5L0IA 4YL0A 2XXAA 5DS4A 3B71A 2HSQA 1AEPA 3HJCA 2R7TA 3A9CA 3R2PA 2CNWA 4YL3A 5EHHA 4JC7A 5CI8A 5F5FA 4BG0A 4C3BA 2NSFA 3HNLA 2J45A 3IEEA 1A0BA 1C03A 2VH3A 3EGDA 3O10A 5FZTA 1G4WR 1W2WA 1ZU4A 2ZXWC 3SXMA 3VAYA 4H54A 4BEJA 2KW3C 4JJGA 5K0IA 1IW7F 1VMAA 1R4TA 1ORSC 2LD6A 2R7UA 3CQZA 4G7ZF 2AP3A 2BE5F 1YZCA 3POVA 2LSEA 3KMIA 3CZ6A 4XTKA 1E85A 1DOWA 3T6GB 5KYWA 5DQTA 2YQYA 2XLOA 1UG7A 1GQAA 1ZZPA 3IQ6A 4MTOA 4H4KC 4L6RA 2R7SA 1MMGA 2QE9A 3PCVA 4BJTA 2EINC 3OWTA 4DBQA 1SYQA 3FDQA 3AQBA 2OKUA 3DE8A 3SEOA 1K40A 5B1BC 3EFOA 2D5RB 1ORJA 4FAPB 4AL0A 5L0DA 3JT1A 3BEHA 2EPMX 2HUJA 1U6HA 1RKEB 3SZRA 1A7DA 3TULA 2J9WA 2BL2A 4G0HA 4U5CE 4EBJA 4NTBA 1NG1A 4O6NA 4BJ6C 1E83A 3X2QC 2YHSA 3RQEA 3H2VA 1V55C 5A69A 5T3WA 3EZHA 3JSEO 1VB5A 2LFDA 2OCCC 2HMZA 2B0JA 2YEVA 4JVSA 4XQ1A 1N1CA 4E0HA 1LKXA 1SMYF 2CYDA 4ZLDA 2CNWD 3ZTZA 3JYHA 4DXWA 1D0XA 3NMKA 4OINF 3DI5A 2R03A 3EGXB 1UFBA 1Z5ZA 5BQIA 2J9BA 3NG1A 4CS8C 2D4UA 4D4NA 4AL1A 1Z7Qc 2ICWG 2YRFA 3N0TA 1HY5A 4MW3A 1JRAA 4FWVA 1RJ9B 1DOVA 3RFYA 3EGXA 1SF8A 2GDCA 1PD1A 4IB4A 2QTVA 2PX0A 2B0HA 1LE2A 2Y3GA 3U0CA 1PCXA 1LS4A 4WJ0A 3GM3A 2Q9BA 4I44A 1RJ9A 2FGYA 2MWQA 2FFHA 3AOUA 4G78A 4C3DA 5BQHA 2R7WA 1H9GA 2EIJC 3GANA 3GM1A 4YT4A 1FR0A 4EUKB 1OR2A 3GEIA 1MQVA 2E87A 3UMHA 3UMIA 3PMRA 1U0BB 1T6QA 2DB4A 2XL6A 2YVKA 4JEAA 3L34A 4PJJA 4JCZA 1OW8A 2HZ8A 5COMA 1O3UA 2ZXOA 1SR2A 5B3SC 1VK5A 4O7GA 1OXKA 3B9QA 2J46A 4P9FA 3M4CA 3HNKA 3TOMA 3S9OA 3EJNA 4JTAB 2G62A 4G7HF 1CGNA 4KBLA 1FNTc 3FAJA 4YL1A 2NSGA 4GQHA 2HMQA 3RQGA 3IQ5A 3ZDLA 4AE4B 4JKVA 4BJ6A 3S84A 4UDVA 3RIPA 2Y3DA 1C17M 3FHDA 3CAXA 1WATA 5D91A 2R7QA 4BJ1A 3AJMA 3EZIA 1ORYA 1EA8A 2G3VA 1FMWA 2CDQA 3ZVRA 2A6EF 1Z23A 1OCCC 2J9VA 3CEXA 3QZCA 4AE4A 2QUPA 2R7VA 3DWWA 3HTKC 1YARO 3KPHA 2JD3A 2LFFA 3NRHA 2IXMA 4NCQA 2R7RA 3A11A 2R7OA 4XPWA 4HE8D 1CPRA 2P7VA 3ZTMA 4CS8A 3U2MA 5BUOA 2YKZA 1QSPA 5CIVA 4AK9A 2H7OA 3RVZA 1MNEA 3IHUA 2Q9AA 1APCA 1HMOA 1OXBA 2DI3A 2QNLA 4K7BA 4A4AA 2VCAA 1H7IA 3EH2A 2R7XA 2VCBA 5A6BA 3H65A 4DVZA 2RSEB 2EPLX 3FVYA 3QVYA 2J0XA 5DS6A 2L6HA 3GM2A 2YLGA 2NG1A 3G4ZA 4OIRF 1JPNA 3DAGA 4MS2A 2XXAB 3K1IC 2PFDA 3FXHA 1L3PA 2UUIA 1TWAA 2A6HF 2H7BA 4IARA 4IWBA 3OA1A 1MNDA 3LS0A 1LI7A 1JPJA 1FTSA 1JMWA 1K04A 2HV7A 2KGOA 4N4WA 1XZPA 4U9EA 2V26A 1WGWA 1TWGA 2OJED 2W45A 3C62A 4IAQA 4KC9A 4MVUA 4YJWA 1YYJA 2YZSA 1QLEC 4ULWA 2G3KA 1JOGA 4U5BE 2R05A 2DYSC 2OU6A 5L0FA 2NUPA
chains in the Genus database with same CATH topology
2Q7RA 4AL0A 4NTAA 5K0IA 4WABA 3LEOA 4NTBA 4YL1A 4BPMA 5HV9A 2UUIA 5BQHA 4JRZA 2PNOA 4J7TA 4J7YA 5BQGA 2H8AA 3PCVA 3DWWA 4YL0A 3HKKA 4NTFA 2UUHA 4JCZA 4YL3A 5BQIA 3B29A 4JC7A 4YK5A 4AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7R A;  4AL0 A;  4NTA A;  5K0I A;  4WAB A;  3LEO A;  4NTB A;  4YL1 A;  4BPM A;  5HV9 A;  2UUI A;  5BQH A;  4JRZ A;  2PNO A;  4J7T A;  4J7Y A;  5BQG A;  2H8A A;  3PCV A;  3DWW A;  4YL0 A;  3HKK A;  4NTF A;  2UUH A;  4JCZ A;  4YL3 A;  5BQI A;  3B29 A;  4JC7 A;  4YK5 A;  4AL1 A; 
#chains in the Genus database with same CATH topology
 2Q7R A;  4CIP A;  2XM4 A;  1WAS A;  2XLW A;  1Q0M A;  5F5H A;  4CS9 C;  1T5O A;  1LI5 A;  2KJG A;  2EPO A;  3GEE A;  3MBG A;  2BC5 A;  4HFF B;  3R7C A;  3UGP A;  3O55 A;  3ZG1 A;  3AG2 C;  3X1O A;  5KYW B;  3K1H A;  3GWL A;  4E17 A;  1LM3 B;  2AVK A;  1E2X A;  2LIG A;  2GFH A;  2J8W A;  2OJQ A;  1NSG B;  4LLE A;  1YZA A;  3RW0 A;  3ZIB A;  2A0U A;  2X51 A;  3T9O A;  1Y4C A;  5JS5 A;  3LJB A;  1OKK D;  1QQ3 A;  2PNO A;  3VF0 A;  3NDB B;  1Q0F A;  2EIM C;  1J8M F;  4U5H A;  2I15 A;  5AGF A;  2H8A A;  3EFO B;  4OIO F;  2WVO A;  3QW1 A;  4W8K A;  1LIH A;  5DS5 A;  4OIP F;  2KQ9 A;  4MTF A;  1H9T A;  3JRM O;  4W8P A;  3FOP A;  4KNW A;  2PBE A;  4JJF A;  1QKR A;  1WWP A;  2IBF A;  4C3E A;  4G7O F;  2A0B A;  5A6B D;  2IXN A;  1MMA A;  5L0G A;  2Q9C A;  3JRT A;  4MVM A;  2J0W A;  3L0I A;  1TKN A;  2O9X A;  1YJG A;  1BBH A;  3S29 A;  2Y39 A;  1I4Z A;  3AGU A;  3T6J A;  1CGM E;  2M4E A;  5F28 E;  3RQF A;  3KYJ A;  4PJL A;  3K33 A;  3VYW A;  1VLT A;  3MYI A;  3K1I A;  4PFO A;  5HV9 A;  2YLI A;  3C8G A;  2YLD A;  1CGO A;  3E70 C;  4NQF A;  4XLN F;  3W8I A;  3ZC4 A;  2IOQ A;  2XRH A;  1NBB A;  4BEM J;  1V74 B;  4MND A;  5L0C A;  3LES A;  4JTC B;  4WGZ A;  1A7V A;  2KK1 A;  2LQG A;  4Z9I A;  3LNR A;  4CDY A;  3FMS A;  3Q6N A;  3S28 A;  2L6F A;  1T9K A;  1HE1 A;  3Q6M A;  2EIL C;  2HV6 A;  2V3C C;  3T4R A;  3IPM O;  3ABK C;  2ZPA A;  4CS9 A;  1RXQ A;  2XLE A;  2KC3 A;  3F46 A;  3Q7G A;  5A6J A;  2KNH A;  1YA7 O;  3LAY A;  3DXJ F;  3G50 A;  4Q7C A;  4U5G A;  4MW8 A;  3DMD A;  3DKA A;  4JTD B;  4PAC A;  4EBK A;  1F1M A;  4JUR I;  5L3V A;  4MVQ A;  3K7D A;  4ZLC A;  3ASO C;  4U5D E;  2TMV P;  3NMI A;  2VAS A;  2AU5 A;  1Q0D A;  3NYL A;  4JIO A;  3ECS A;  3NYM A;  1M6T A;  4Z9J A;  2PF4 E;  1Z3I X;  3RKO F;  1QZX A;  3CSK A;  3K66 A;  5KYN A;  2HFI A;  5DQZ A;  1I4Y A;  4J30 B;  2LCH A;  4N06 A;  3DD7 A;  4NTF A;  3ZQV A;  2AWY A;  5KYX A;  2ZXP A;  4PFP A;  4IAO A;  1MMN A;  2IXP A;  2YL1 A;  1BR4 A;  2DGJ A;  4QI0 A;  4PJN A;  1Z63 A;  5L0H A;  2GWW A;  5DVW A;  2HS5 A;  4KNV A;  1CPQ A;  4E18 A;  5T1D B;  1A41 A;  4JE9 A;  2W4B A;  3H2U A;  5L0J A;  1NFO A;  2WVQ A;  4Q4Z F;  2H7V C;  3AG3 C;  3U5S A;  256B A;  4EBB A;  2L6G A;  1EKY A;  3ABM C;  3SYN A;  3C8G D;  3EHN A;  4U5E E;  4RD9 A;  5E3C A;  4DJ9 A;  2IYL D;  5JVE A;  3DAF A;  3C8Z A;  4JEB A;  1QVX A;  2P0N A;  3VM6 A;  5EGY A;  5BQG A;  3UR3 C;  1C02 A;  1AUE A;  1TQG A;  1G5Z A;  1WOL A;  2R25 A;  3KH2 A;  3WAQ A;  3B0V C;  1BZ4 A;  2DYR C;  3TJ6 A;  3TQO A;  2C04 A;  1OKK A;  4E0I A;  5B3I A;  1A7E A;  2VB6 A;  3UGO A;  2XL4 A;  5EK0 A;  1YAU O;  2Q3T A;  4A2N B;  1OW6 A;  4NTA A;  2A1D D;  4MVZ A;  3QW0 A;  2L9J A;  3DJN B;  2CCY A;  1KU2 A;  5COF A;  3GOR A;  2Q00 A;  3U3B A;  1SZI A;  3EQL F;  5JRA A;  2Y3H A;  4YT2 A;  2X0C A;  3ABL C;  1M57 C;  4AX2 A;  1YLM A;  1RMV A;  4DVY P;  3I5Q A;  3C18 A;  1ZHT A;  3FAP B;  3FOO A;  4JW1 A;  5T3T A;  2EPK X;  3LLI A;  1ZHZ A;  3QTH A;  4DOZ A;  3I5P A;  4Z9H A;  1O5H A;  5AC5 A;  3B0U X;  3M15 A;  3LNM B;  4LLC A;  2R02 A;  2Z15 A;  1RKC A;  2ZD9 A;  1Q0K A;  1FMV A;  1ZHX A;  4JZA A;  2NUP B;  2IM8 A;  1TFO B;  2L7A A;  1HE9 A;  2XL8 A;  3KKB A;  3RF3 A;  3NMJ A;  3HKK A;  1R5I D;  1GGQ A;  4GYT A;  3L8J A;  1OW7 A;  1EI7 A;  4NY3 A;  2MYS A;  1E84 A;  2ETS A;  3TK0 A;  1O87 A;  3NKD A;  4CSA A;  3J06 A;  4GEH A;  3V5Y A;  4YWQ A;  3MLG A;  2PX3 A;  1WN0 A;  1D0Y A;  1MMD A;  3S90 A;  4PJM A;  5FCL A;  4XPX A;  4EIY A;  4RDA A;  2HKV A;  2XS8 A;  1VTM P;  3EH1 A;  1VOM A;  1M2O A;  4I1O B;  4F4B A;  4O6Y A;  4PK4 A;  5JLI A;  3PDM P;  4YT8 A;  4ONS A;  2W9Y A;  3OEO A;  4IGG A;  2OQM A;  4HFK B;  5AC4 A;  3U8V A;  1ZHW A;  3RH3 A;  3QMK A;  4IRU A;  3EPV A;  1ZW2 A;  2JPU A;  4E7S A;  4U9D A;  4OD4 A;  3V5Z A;  5IY5 C;  1PV3 A;  2A68 F;  2PP4 A;  4K0D A;  1LE4 A;  1BR2 A;  3SXK A;  4YN0 B;  3AGT A;  4MVR A;  3B29 A;  3W2V A;  3ZSU A;  2IXO A;  4CJO A;  2J9U A;  1HW2 A;  3K6B A;  3US6 A;  3LUT B;  1T6I A;  3EG9 B;  4K1O A;  3U8P A;  3KL4 A;  1YA9 A;  1U89 A;  3S27 A;  1D1B A;  3W2W A;  5L3Q A;  3JCU Q;  4LAC B;  2VCC A;  3HLZ A;  1OCO C;  1KTM A;  2JX0 A;  2R9R B;  3ASN C;  3C8G B;  3JSZ A;  3O6X A;  4FX5 A;  2J7P D;  1M2V B;  2LK4 A;  1T6U A;  3GEH A;  4CX9 A;  3EG9 A;  1ZW3 A;  1YYX A;  2HJM A;  1Z6A A;  2Y69 C;  4MQ9 F;  4O79 A;  4XEV A;  2CGE A;  1ZU5 A;  4JRZ A;  4MVO A;  1H6G A;  3KYI A;  1LVK A;  2WL8 A;  3SNH A;  4XLP F;  2LP4 A;  2GAQ A;  2OG2 A;  1M2V A;  3V7O A;  1Y6D A;  1NFN A;  3ITF A;  1ST6 A;  3SP1 A;  2W4M A;  4DRI B;  3JYY A;  3L8I A;  2YL3 A;  3SXZ A;  5A6K A;  1D0Z A;  2YWA A;  3M4B A;  3SXY A;  5DLJ A;  4XEF A;  2WZF A;  1GM5 A;  1YVI A;  3TOL A;  3TD7 A;  4I3M A;  1VYK A;  3V5X A;  2YL0 A;  3ZWI A;  4CS7 A;  2ASR A;  5GPG B;  4CBE A;  3M79 A;  3Q7L A;  4PR9 A;  4U5F E;  4QDL A;  2XS1 A;  4IJJ A;  4MVS A;  4CDV A;  4C7O B;  4I1M A;  3MYF A;  4HEA J;  5HSW A;  3ATP A;  3MFN A;  4ANJ A;  1TFK B;  4LER A;  2EIK C;  1RKE A;  1S05 A;  1M56 C;  1VLS A;  1JR8 A;  5E2Q A;  4RBN A;  4CIH A;  5KYX B;  1PD0 A;  5COG A;  2HSB A;  1T01 A;  4C7O A;  3IQC A;  1KNY A;  4MTG A;  1RCP A;  4LDK A;  2WZL A;  1EQ1 A;  4EKW A;  2Q4F A;  5CI9 A;  3I4U A;  3DZA A;  4DRJ B;  2F22 A;  4Q5S F;  1OQC A;  3ZQY A;  3RYL A;  1QPU A;  1V54 C;  4CSA C;  4WGY A;  1B68 A;  3B0P A;  3EHM A;  4LDQ A;  4BJ5 C;  2C03 A;  1AVO B;  2P1A A;  3C63 A;  3MX3 A;  4B6I A;  3PHF 2;  2QLA A;  2XLM A;  5JP7 A;  4D4X A;  2WB7 A;  2NPU A;  1LS1 A;  4ER9 A;  4XPY A;  5E33 A;  4CDA A;  2YL7 A;  1K05 A;  2P61 A;  4X0R A;  3U3F A;  4BPM A;  1G4U S;  2GA0 A;  1TR2 A;  2XLH A;  3DM5 A;  5JUA A;  3DM9 B;  1E86 A;  4LDR A;  3M1C B;  3JZ0 A;  3WHN A;  1FFH A;  3IQT A;  1TWC A;  3LS1 A;  3GWN A;  4DRH B;  1XWJ A;  3W8H A;  3RVY A;  5D92 A;  3G4X A;  5TJ5 E;  5A6A A;  1TWH A;  2XLD A;  3U9M A;  4EHP A;  2WVN A;  3LEV A;  2RD9 A;  5JSL A;  5KYU B;  2UUH A;  3WG7 C;  1XZQ A;  4R32 A;  4YT5 A;  4YK5 A;  4QI2 A;  1J8Y F;  2OOC A;  3TJ5 A;  1D1A A;  2P6V A;  5JT4 A;  3GOD A;  5E3A A;  1IZM A;  5B1A C;  5KYU A;  3WOD F;  1FAP B;  2XM0 A;  1WTY A;  2QY9 A;  4JCH A;  4E7Z A;  4KI2 A;  1D1C A;  3VRC A;  3W4Y A;  4N6H A;  4NC3 A;  1VYI A;  2OEV A;  1OCR C;  2HJ3 A;  2MHR A;  1NLX A;  3AQC A;  3HNI A;  1V4A A;  1BR1 A;  1G8X A;  1HW1 A;  1LPE A;  1ZHY A;  2AWC A;  2J7P A;  2L81 A;  3F47 A;  4J7Y A;  4M63 A;  4FES A;  3N2Z B;  4DBR A;  5KYY B;  1NZE A;  1OCZ C;  3E9V A;  4P6I C;  3AG4 C;  3DE9 A;  1NU7 D;  1S7Z A;  3O39 A;  4XWJ A;  1FFT C;  4OD5 A;  3DJU B;  3L1M A;  3U9J A;  4OIQ F;  2XSE A;  3T6B A;  5KYY A;  4EWC A;  2M64 A;  4P9T A;  2CW0 F;  3C7J A;  1ZVZ A;  3NYJ A;  1L7C A;  2I8B A;  1BDJ B;  1JAF A;  3HNJ A;  2WZG A;  4BJ5 A;  2FAP B;  1HMD A;  2NUT B;  3QVZ A;  4N6C A;  4WAB A;  3AG1 C;  3U2L A;  3LEO A;  4J32 B;  3BRJ A;  2VC9 A;  1ZYR F;  1YDI A;  2Y3B A;  1I5N A;  3NKE A;  1OR3 A;  4ULV A;  2ZXR A;  1GS9 A;  4O6M A;  3JTL O;  2NUT A;  1Q0G A;  2KSF A;  2OEX A;  2KYH A;  2A69 F;  4J7T A;  3LLK A;  3UMK A;  3UNG C;  4XEK A;  2XLV A;  4CJG A;  3S0X A;  3EGD B;  1NU9 C;  2EPN A;  3N24 A;  5L0I A;  4YL0 A;  2XXA A;  5DS4 A;  3B71 A;  2HSQ A;  1AEP A;  3HJC A;  2R7T A;  3A9C A;  3R2P A;  2CNW A;  4YL3 A;  5EHH A;  4JC7 A;  5CI8 A;  5F5F A;  4BG0 A;  4C3B A;  2NSF A;  3HNL A;  2J45 A;  3IEE A;  1A0B A;  1C03 A;  2VH3 A;  3EGD A;  3O10 A;  5FZT A;  1G4W R;  1W2W A;  1ZU4 A;  2ZXW C;  3SXM A;  3VAY A;  4H54 A;  4BEJ A;  2KW3 C;  4JJG A;  5K0I A;  1IW7 F;  1VMA A;  1R4T A;  1ORS C;  2LD6 A;  2R7U A;  3CQZ A;  4G7Z F;  2AP3 A;  2BE5 F;  1YZC A;  3POV A;  2LSE A;  3KMI A;  3CZ6 A;  4XTK A;  1E85 A;  1DOW A;  3T6G B;  5KYW A;  5DQT A;  2YQY A;  2XLO A;  1UG7 A;  1GQA A;  1ZZP A;  3IQ6 A;  4MTO A;  4H4K C;  4L6R A;  2R7S A;  1MMG A;  2QE9 A;  3PCV A;  4BJT A;  2EIN C;  3OWT A;  4DBQ A;  1SYQ A;  3FDQ A;  3AQB A;  2OKU A;  3DE8 A;  3SEO A;  1K40 A;  5B1B C;  3EFO A;  2D5R B;  1ORJ A;  4FAP B;  4AL0 A;  5L0D A;  3JT1 A;  3BEH A;  2EPM X;  2HUJ A;  1U6H A;  1RKE B;  3SZR A;  1A7D A;  3TUL A;  2J9W A;  2BL2 A;  4G0H A;  4U5C E;  4EBJ A;  4NTB A;  1NG1 A;  4O6N A;  4BJ6 C;  1E83 A;  3X2Q C;  2YHS A;  3RQE A;  3H2V A;  1V55 C;  5A69 A;  5T3W A;  3EZH A;  3JSE O;  1VB5 A;  2LFD A;  2OCC C;  2HMZ A;  2B0J A;  2YEV A;  4JVS A;  4XQ1 A;  1N1C A;  4E0H A;  1LKX A;  1SMY F;  2CYD A;  4ZLD A;  2CNW D;  3ZTZ A;  3JYH A;  4DXW A;  1D0X A;  3NMK A;  4OIN F;  3DI5 A;  2R03 A;  3EGX B;  1UFB A;  1Z5Z A;  5BQI A;  2J9B A;  3NG1 A;  4CS8 C;  2D4U A;  4D4N A;  4AL1 A;  1Z7Q c;  2ICW G;  2YRF A;  3N0T A;  1HY5 A;  4MW3 A;  1JRA A;  4FWV A;  1RJ9 B;  1DOV A;  3RFY A;  3EGX A;  1SF8 A;  2GDC A;  1PD1 A;  4IB4 A;  2QTV A;  2PX0 A;  2B0H A;  1LE2 A;  2Y3G A;  3U0C A;  1PCX A;  1LS4 A;  4WJ0 A;  3GM3 A;  2Q9B A;  4I44 A;  1RJ9 A;  2FGY A;  2MWQ A;  2FFH A;  3AOU A;  4G78 A;  4C3D A;  5BQH A;  2R7W A;  1H9G A;  2EIJ C;  3GAN A;  3GM1 A;  4YT4 A;  1FR0 A;  4EUK B;  1OR2 A;  3GEI A;  1MQV A;  2E87 A;  3UMH A;  3UMI A;  3PMR A;  1U0B B;  1T6Q A;  2DB4 A;  2XL6 A;  2YVK A;  4JEA A;  3L34 A;  4PJJ A;  4JCZ A;  1OW8 A;  2HZ8 A;  5COM A;  1O3U A;  2ZXO A;  1SR2 A;  5B3S C;  1VK5 A;  4O7G A;  1OXK A;  3B9Q A;  2J46 A;  4P9F A;  3M4C A;  3HNK A;  3TOM A;  3S9O A;  3EJN A;  4JTA B;  2G62 A;  4G7H F;  1CGN A;  4KBL A;  1FNT c;  3FAJ A;  4YL1 A;  2NSG A;  4GQH A;  2HMQ A;  3RQG A;  3IQ5 A;  3ZDL A;  4AE4 B;  4JKV A;  4BJ6 A;  3S84 A;  4UDV A;  3RIP A;  2Y3D A;  1C17 M;  3FHD A;  3CAX A;  1WAT A;  5D91 A;  2R7Q A;  4BJ1 A;  3AJM A;  3EZI A;  1ORY A;  1EA8 A;  2G3V A;  1FMW A;  2CDQ A;  3ZVR A;  2A6E F;  1Z23 A;  1OCC C;  2J9V A;  3CEX A;  3QZC A;  4AE4 A;  2QUP A;  2R7V A;  3DWW A;  3HTK C;  1YAR O;  3KPH A;  2JD3 A;  2LFF A;  3NRH A;  2IXM A;  4NCQ A;  2R7R A;  3A11 A;  2R7O A;  4XPW A;  4HE8 D;  1CPR A;  2P7V A;  3ZTM A;  4CS8 A;  3U2M A;  5BUO A;  2YKZ A;  1QSP A;  5CIV A;  4AK9 A;  2H7O A;  3RVZ A;  1MNE A;  3IHU A;  2Q9A A;  1APC A;  1HMO A;  1OXB A;  2DI3 A;  2QNL A;  4K7B A;  4A4A A;  2VCA A;  1H7I A;  3EH2 A;  2R7X A;  2VCB A;  5A6B A;  3H65 A;  4DVZ A;  2RSE B;  2EPL X;  3FVY A;  3QVY A;  2J0X A;  5DS6 A;  2L6H A;  3GM2 A;  2YLG A;  2NG1 A;  3G4Z A;  4OIR F;  1JPN A;  3DAG A;  4MS2 A;  2XXA B;  3K1I C;  2PFD A;  3FXH A;  1L3P A;  2UUI A;  1TWA A;  2A6H F;  2H7B A;  4IAR A;  4IWB A;  3OA1 A;  1MND A;  3LS0 A;  1LI7 A;  1JPJ A;  1FTS A;  1JMW A;  1K04 A;  2HV7 A;  2KGO A;  4N4W A;  1XZP A;  4U9E A;  2V26 A;  1WGW A;  1TWG A;  2OJE D;  2W45 A;  3C62 A;  4IAQ A;  4KC9 A;  4MVU A;  4YJW A;  1YYJ A;  2YZS A;  1QLE C;  4ULW A;  2G3K A;  1JOG A;  4U5B E;  2R05 A;  2DYS C;  2OU6 A;  5L0F A;  2NUP A; 
#chains in the Genus database with same CATH homology
 2Q7R A;  4AL0 A;  4NTA A;  5K0I A;  4WAB A;  3LEO A;  4NTB A;  4YL1 A;  4BPM A;  5HV9 A;  2UUI A;  5BQH A;  4JRZ A;  2PNO A;  4J7T A;  4J7Y A;  5BQG A;  2H8A A;  3PCV A;  3DWW A;  4YL0 A;  3HKK A;  4NTF A;  2UUH A;  4JCZ A;  4YL3 A;  5BQI A;  3B29 A;  4JC7 A;  4YK5 A;  4AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...