3CZ6A

Crystal structure of the rap1 c-terminus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
RSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title Structural and functional studies of the Rap1 C-terminus reveal novel separation-of-function mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 48
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3cz6A02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3cz6A01
3K6GA 4BJTA 3CZ6A 3OWTA 4BJ5C 4BJ6C
chains in the Genus database with same CATH superfamily
1J8YF 3EFOB 5E3MA 1T38A 3L34A 2OG2A 3R6SA 1OCCH 1V54H 4MTFA 2CNWD 1W5CC 1ZU4A 2WAQA 4RGUA 2WZFA 2K9MA 3JAMK 4CSAC 5EEAA 4GQHA 4R1HA 1PUFA 2XSEA 3HDDA 2CQQA 3SQNA 1W7PB 2BXZA 4G94A 4LERA 2QCOA 2RQPA 3K69A 4BXFA 2D1HA 5DD8A 1T8IA 2TDXA 1G2HA 2FUG2 1ZN2A 4E7JA 3E70C 3MZ8A 1OJLA 4IWBA 4DVZA 2M9HA 3JREA 3HPHA 3SEQA 1HE9A 1ZHZA 3O2PE 1OW6A 5KYXA 5M5WJ 2BVMA 5EZHA 1NFOA 2HZ8A 1FTZA 3L2CA 2W45A 4HA8A 2P0WA 2CV2A 3S8PA 3ZQHA 4BQQA 1M6TA 4JIOA 5K5QA 1DQUA 3D0SA 2EFPA 1WJ5A 2FSWA 3OWTA 3T6GB 1F36A 1Z7LA 1MJ9A 3REOA 3B71A 1TP4A 2A07F 5FRMA 4IOCF 1WJBA 5EG0A 2NG1A 2DA1A 3POVA 2WTEA 1TWGA 4RD9A 2EIMC 2MSYA 1XB4A 1I39A 2GXGA 1X1CA 1FPQA 5TGTA 1XTAA 2JJ7A 3R60A 3ZQIA 1D3YA 2Y0SA 3IQ6A 3F22A 3OL3A 2KGOA 2ESNA 2KQRA 5J40A 4NQFA 1U6GA 2OBPA 1DP3A 2GA1A 3MAJA 2Y9YA 3R0JA 4ZYGA 1U9OA 3F8NA 3DBRB 1MIJA 1UG2A 5DUKA 2M45A 1X1AA 2DODA 2X6WA 5JVTA 1IUYA 4YT5A 1BA5A 3P5JA 3FHNA 2QEXI 1WWPA 1XN7A 4N4WA 3F72A 3O3KA 5F5FA 1HKSA 1U78A 1FSHA 3OYHA 3CJRB 5B1AH 2NVXJ 1DPUA 5BOXA 3EYIA 1OCCC 1V54C 2G3VA 4EMSA 2YSRA 5DQTA 1Z1DA 3LUTB 3J7AY 2O7OA 3S27A 3PDMP 2FEZA 2J0XA 3KP5A 1SVOA 1MBKA 5T3TA 1BOBA 3G71I 5GAGJ 2IXNA 1FOXA 4MEXF 3FK6A 4W8KA 3EYYA 2EPLX 4YN0B 4DIQA 3S1MJ 1JGGA 1VQ7I 1X1BA 3IQTA 1BN5A 4PGGA 4XLNF 2JSPA 1GXPA 1DU0A 1PD0A 2VCCA 2CGPA 1XGSA 3U8VA 4PACA 4XPXA 1VK5A 2A6TA 2F5FA 3JT1A 5F27A 4J00A 1OQCA 2VQHA 3QAHA 4O6YA 2CO5A 1A35A 4RGRA 1YAUO 3LSMA 3A2KA 4IAQA 1TWAJ 5FROA 3T8RA 4UB8C 3G4ZA 3PMRA 3SP1A 1X2NA 2DLLA 2P81A 3VEPA 1XSDA 3PNTA 4ZH4F 3T6JA 3RQFA 2N8GA 3LSHA 4L5EA 1PD1A 4HAMA 2PFDA 2JRMA 4CZZA 1I5ZA 4U0YA 3TOMA 2QLZA 4BE0A 1YS7A 2ZXOA 1FT9A 3O8HA 3S29A 2L7MP 1O7LA 4IHSA 1IAWA 1TNSA 1ITYA 1ON2A 2NAZA 2FFHA 1WH5A 1IV8A 3BG5A 5JR3A 3SZPA 2KNHA 3RCOA 3TDUC 1QBJA 4YT8A 1LE8A 1J59A 2D4UA 2HSBA 1Y56A 2WA0A 3LFKA 3JSEO 3GZ6A 5EJCA 4I1OB 4C30A 2ZFWA 3O6XA 2QM3A 2QQAA 3LSIA 3ZQ7A 2J46A 3LOCA 4J19A 1JXSA 1OCPA 4GYTA 3B9QA 4ENNA 3M07A 3L1PA 3R0AA 3SXMA 4DYRA 4LLLA 2R5ZB 4NTAA 3PQJA 2PG4A 1YS6A 3FWEA 3G1MA 3HL2A 4A3CJ 1OCOC 5KYWB 1RMVA 4JCHA 1R71A 3DE9A 4EWCA 3NEUA 4N4OB 3M3YJ 2YR2A 2J9WA 3RYRA 4RS8A 4BY1J 4YRVA 2CYYA 4XONA 2FBHA 3A01B 3TULA 3S28A 1PDNC 3DQVC 3U9GA 3NRVA 4B3XA 1XX5A 1IXRC 1BC8C 3U2LA 4UVCA 2C04A 2JPCA 2RDPA 5H6RA 1MBGA 2P8TA 2QKLB 3HZJA 4LK0F 4NQWA 1FOKA 4MS2A 1Y6IA 3IH4A 4G7HF 1XPXA 4E7SA 3ERMA 4LJZF 3NYMA 3V7OA 3ZCOA 4N4NB 2R03A 4U5GA 2ELJA 2H8RA 2F5VA 4UXNA 4B3AA 3S17J 3HM5A 5DQZA 2HV6A 1CGME 5L3VA 5JHFA 1TFKB 1SVMA 2ME0A 3G1OA 2B0LA 2OKUA 2KC3A 1WN0A 5CVJA 4RAZA 4CSWA 2MLKA 3VAYA 1IUFA 3KEYA 1YW9A 5C4XJ 1DOWA 3VDXA 3RYPA 2ETSA 4HE8D 1ETYA 1QZYA 1TBXA 2EPKX 4A3JJ 1HW2A 3EUKL 1O4XA 5AONA 4ENMA 4E6KG 5COFA 1YOVB 4XOPA 1O3QA 5E33A 2IA0A 4AC0A 4F55A 2IXMA 3HBLA 3T9OA 4LMYA 2M4GA 2OUMA 2QSGX 2UV1A 3CJNA 3OIPA 2JRTA 1H88C 5A6BA 2Q2EB 2EFQA 3OS2A 2FD5A 3JRTA 3CUQB 5CYVA 1GM5A 1NG1A 4HG2A 3F23A 4ENJA 1ZHYA 1CF7A 3IWZA 1P7JA 2LC2A 5KNLA 4JEAA 4CCJA 2K9LA 1BL0A 3BTCA 2WV0A 1WFXA 2ZD9A 2HOSA 3GFMA 5L0CA 3WAQA 4A3DJ 3ECHA 2HVQA 1YYXA 5DUIA 4P1WA 4I1MA 3QPHA 3FXOA 3P9KA 4HFKB 1OLTA 2W57A 4XM3A 1WGWA 3NMKA 3BZCA 2FXAA 3S32A 4D7NA 2PX9A 4KMFA 4QI2A 2WAQN 2ZNYA 5COMA 4B09A 4IHXA 2K9NA 2Y3DA 3E6MA 3JRAA 2DAOA 1S3JA 2CQ7A 2DPDA 3CCRI 3L0IA 3CJQB 3GO5A 1OR2A 5FRNA 2IS2A 3RFYA 4FWVA 5A69A 1MMDA 1JR8A 3L2VA 2JTVA 3F6VA 4JOMA 3U9MA 3IV5A 3C2HA 4XRSA 1E86A 4RAYA 1TWAA 1P4XA 4CS8A 3LA3A 4OINF 4EIYA 2XLOA 1JKOC 3EUHA 3K1IA 1W1WE 3CCMI 3HB9A 4JBAA 4Q5SF 5B3IA 5EDNA 1O3TA 1ETQA 5K7ZA 3F3XA 5T1DB 3K4NA 4JYKA 3F0CA 5L0FA 3UGOA 2QA4I 4BEMJ 3K7AJ 3NKEA 4HX4A 5L3EA 3FDYA 3JRCA 2O5RA 3LLIA 2XSDC 3LEVA 3S3MA 3E1SA 2VC9A 4RM2A 2XSJC 1HF0A 2Y30A 2MYSA 2ID6A 4DGWB 4BPMA 1J0RA 1W0TA 2IS4A 3Q6MA 4EVIA 1R7JA 1S8NA 1X3UA 4F92B 2B9SA 4LG0A 3KL4A 4KNWA 4F7ZA 3V5ZA 1T01A 1VYKA 5KK1A 4I0AA 1H7IA 3WTVC 2HTSA 1FBQA 2A69F 4JJFA 1R9TJ 3SFIA 5M3FJ 1A36A 4AK9A 3NRHA 2Q00A 1A6IA 3DFGA 1OCRC 3ITFA 2ZXWH 5IY5H 4IRHA 4KJZA 4O79A 4IHVA 1PP7U 2HSQA 1IRXA 3IQCA 3HIFA 2DTRA 4C3HJ 3GTGJ 2GWRA 1YZAA 1ZRFA 3C2BA 1JAFA 2PX0A 3OY9A 2NUPA 4IARA 2BY2A 4MTGA 4F93B 1T6SA 4RDAA 5HDNA 1K78B 4KIGA 4EGZA 4OMZA 5LRRA 2K9SA 4B1RA 3HUGA 1S9HA 1K7AA 1LS1A 1EV7A 2E7XA 2NYXA 3RJPA 1ZARA 2JSCA 2M8GX 2LFDA 3SZGA 1PCXA 1CGPA 2RNGA 3PIPF 1UFBA 2J7PA 2ZCWA 3NMIA 4I01A 2P7VA 4KIBA 2Q3TA 3RKOF 3OR2C 1UG0A 2V9VA 3V8LA 5LHHA 1YJ9I 2Z2SB 3HOUJ 1OYIA 3NDBB 4K2EA 4GCVA 1BC7C 4J32B 2XVCA 4MVRA 1VQ8I 1STZA 2P5KA 1SFOJ 2LBFB 1I6HJ 2XB0X 1H8AC 5DM6F 1R5ID 3HNJA 2E60A 4U88A 2PQ8A 2R7SA 2VB6A 2XM4A 1ZGAA 1JHHA 5HLTA 2OQMA 1XD7A 3DEEA 2UUZA 3HSRA 4FQGA 3DXJF 3E9VA 1T08B 2COBA 2FBIA 3GFIA 1UG7A 1GQAA 1OR3A 3NWSA 2V79A 2MWQA 2V3CC 5ILVA 3B6CA 3HOSA 3CJTB 4JZAA 2R5YB 2Y39A 2XC7A 2CW0F 3KZIC 3EFOA 1YX3A 1HKQA 2E5NA 1R5HA 2LFBA 2O3FA 5CIVA 6PAXA 2M4KA 5B3SH 2H7VC 3PO2J 2EV5A 3ZIBA 4DRJB 4M6YA 5M5YJ 5BS6A 2DMPA 4ETSA 3GWNA 3JCUC 3W2WA 3QW0A 4LITA 4CS8C 3CO6C 3PUBA 4B44A 3KYLA 1RRJA 1W7PA 3F9KA 5GTIC 3ECOA 3EUHC 3K1IC 1QO0D 3BQYA 2ZJPF 1OYYA 4G78A 2AQFA 2DOEA 2HXIA 3ABUA 1UFMA 4UHTA 4CCOA 2KK1A 3MLGA 2P6TA 1VYIA 1T56A 3PUFA 1N77A 2IT0A 2YQYA 5IY5C 2M7BA 4O5VA 4CCNA 5J6XA 2GBYA 3RKQA 2HOTA 4C2UA 2R02A 5L3DA 1Y1WJ 2D2WA 1T95A 5K1YA 1YYJA 1PYVA 1ENHA 5BUOA 3HPGA 2V6EA 3T6BA 2CNWA 1R58A 1P92A 5L3QA 4RGXA 1DP7P 1G3WA 3DKYA 4W1UA 4RB1A 3DM5A 4XEKA 2JQ7A 2DDAA 5JRAA 2A0BA 4ZC3A 5KCMA 4A4AA 1D0YA 2GZWA 2MBFA 3RTRA 3E5XA 4HLYA 1MBHA 3KCCA 3K1PA 4YWQA 1OPCA 1K79A 2J5OA 3IAS2 2C03A 2PBEA 1LI5A 3FHDA 4AL0A 4MQVA 4OIOF 1LI7A 5FZTA 3K4BA 1J5YA 2L6HA 4A6DA 1XZPA 2KW3C 4H0EA 1CPRA 2RD9A 3HRMA 3EZIA 4XQ1A 5DS4A 1B6AA 4XMYA 3ZRGA 3LSPA 3NARA 3G3ZA 3S15J 2O61A 2NVQJ 5CPRB 2AVKA 1IXSB 3GWLA 3KETA 2ETHA 2OZUA 1ORKA 3Q0VA 2E35A 3FBIB 1CGNA 4A69C 2W7NA 2HJMA 3SJMA 2A05A 5B66C 2OOCA 1MSEC 2ICWG 2PLYA 2KYHA 3I56I 1FIAA 3PNYA 2XAUA 3OYDA 3LNRA 5B3SC 4FAPB 5KYNA 4MNDA 3FMRA 1OMIA 1IN7A 4U87A 3RPQA 4YL3A 4FETA 3MD2A 2VOPA 2HMQA 2NS7A 2A68F 3FXJA 4XKVA 1QHHD 2QQ8A 3IWFA 4I09A 2VXZA 3Q6NA 2Y48A 3VF0A 3KIOA 4S0HB 3QRFF 1U8BA 4KA4A 4LD5A 2DA3A 5GAEJ 4RAGA 3I0TA 3OYMA 4G7OF 4M3EA 3UMIA 2QTVA 2E1MC 2ZC2A 3ZMTA 2ELKA 4XLEA 1P6RA 2LR8A 4IAOA 1IC8A 4QLCU 3PNVA 2R25A 2L7AA 3K6GA 2MA3A 3HGGA 3RIRA 3VSKA 5D5VB 4Y4RA 4A12A 2F22A 1IF1A 3HJCA 4CJOA 3FX3A 4HZFA 5KYYB 3S9OA 3WTZA 2I5UA 2FBKA 1FR0A 3VFZA 1FNTc 2BV6A 2M30A 1GVJA 4NC7A 5DS9A 3CC2I 1MD0A 1D0ZA 3U21A 3BCBA 3RKWA 3HTSB 1O5HA 3TKYA 1LDJA 5ICGA 3LS0A 2CQNA 3S90A 2VCAA 3LQRA 3LNQA 2P1AA 1LUJB 4B6IA 4HNVA 5JS5A 5JVEA 4KDPA 3V4GA 3OIOA 2V1XA 3WTTC 1F1ZA 2QYOA 2F6CA 1FMVA 2WV1A 3EDPA 2VL8A 3PM1A 3VWBA 5J8FA 2XLMA 2WADA 2DK5A 4IL6C 2XGDA 1WJEA 2K4BA 4I2OA 2JA7J 1ZKGA 1T33A 3A1YA 4OAZA 4HQEA 4XLPF 2VOOA 1HLVA 4QWQA 4A6EA 1B72B 4CZCA 1QRYA 2GAQA 3AGTA 2LG4A 2RNJA 2P5VA 4CS7A 5JP7A 1TNTA 2XS8A 1Z05A 4PUSA 4Y13A 2R5ZA 3BDDA 2JWTA 5FLMJ 4V19K 4E18A 4D5CA 3B02A 4F91B 3C8GB 1K6YA 2KMUA 2QQ9A 2XKOA 3DLLF 2LSOA 2NSGA 1S29A 3SNHA 1TW2A 5KYWA 2VBWA 1OXBA 3OA1A 2P5LC 4BJ5C 4MIMA 3EPZA 3K4KA 1IZMA 2PP4A 3U2MA 2F4MB 3KP6A 2R7VA 2KT0A 1HW5A 4ZYEA 1VNDA 1APLC 2VE8A 1W5SA 5IT3A 1EQ1A 1KQ0A 3E97A 1H9TA 4V2FA 1VQ6I 4ULWA 3H3ZA 1BW6A 4S05A 2FX0A 3E5UA 4II2A 4BACA 1ZHWA 2ME6A 1CQTA 3C18A 3DWLE 3C1DA 1C02A 4GXOA 3U0CA 3ZQLA 2H6BA 3LL7A 1XZQA 4U5CE 1LPEA 4O6JA 1G4US 1SAUA 3OOPA 4MLOA 2FAPB 4CDVA 2L9NA 2VC0A 4AIHA 1TQIA 5K5RA 2J8WA 5TISC 3CCUI 3CCLI 2HQ5A 3OV8A 3TO7A 5L0GA 3BY6A 3S0XA 4MQ9F 3K70D 1YO5C 2LK2A 2DQRA 3IP4B 4Y3OA 1Z23A 3HOTA 2VC1A 3ZTZA 3G6EI 1EA3A 2DTZA 4N06A 2W24A 4CSAA 4M74A 2VBXA 4W97A 3HOZJ 3K10A 4JK1X 3QPTA 3WU0A 3DLAA 1S72I 2BXYA 2HKOA 2L9VA 4QDLA 2Z5UA 1Q0MA 2Q2EA 3BPXA 4DJAA 3CUQA 3ASNC 1M56C 3FXQA 4M3DA 3J06A 2BHYA 2WVOA 1T6UA 1UMQA 1IV6A 3BZ6A 1X1PA 4AWXB 2UWMA 3KP4A 3MFNA 5DCMB 5J1RA 3SZRA 4X1EA 2FQ4A 5C4JJ 2VKEA 2LNBA 2VCBA 4I99C 3PCVA 2R7QA 4JTCB 2PBIA 3LSGA 4KFCA 1WSUA 2WVNA 4L5IA 2YWAA 2LOOA 1SF8A 3ELKA 3T0YA 3M9AA 1T2KA 4A3GJ 2PMUA 4KNYA 2YX7A 2EV6A 3ZMUA 1R49A 1J2XA 2F5DA 3LESA 1C0WA 4N9IA 3ESWB 1A7DA 3L1MA 2BBYA 3CDIA 4E7KA 4N0BA 3V8KA 2W84A 4AUXA 2B0HA 3VYWA 1Q1VA 2Z16A 4YT4A 1B9MA 3OYIA 2EZLA 2EINH 4HW0A 3GXOA 1MNEA 1WJDA 4ZYDA 3Q7LA 3V7CA 3I3LA 2QUFA 2LF7A 2HFIA 2KRFA 4KNVA 3TDZC 4EM2A 3Q7GA 1E2XA 2HUJA 3TQNA 2W00A 4A0XA 1A0BA 4DW6A 1YARO 1A7EA 3ROUA 3A9CA 2CDQA 1USSA 3M8EA 1LE2A 4XEFA 5AGFA 4ITVA 2AHQA 3IRRA 4EHPA 4MVSA 3GLLA 1WKMA 4BEHB 4PK4A 4YFXF 2VPRA 4D4NA 1YVIA 1Q0GA 4M73A 5JLIA 2YS9A 4BDYA 3C8ZA 3ZMZA 4GGGA 2RC4A 3D5LA 3PSFA 1BBYA 2HU9A 2L9SA 2ZXHA 3K2AA 4XORA 3WTWC 1Z3IX 3GEHA 1Y0UA 3ZN1A 1T0FA 1Z21A 4IO9F 4I44A 4LOCA 1HY5A 4NC3A 1S7EA 4B8XA 5F0CA 2R7DA 3HKZN 1UELB 4ZJZA 1ZTRA 4J01A 4HDUA 1EJ9A 3N05A 1X58A 2NVUB 2FMLA 4LLCA 2AWCA 3CEXA 4EBKA 4U9DA 3DAGA 1Z6TA 3V8JA 1VQNI 3L8JA 3ABMH 5TRDA 2VJIA 3QWLA 3IL2A 1SD4A 1K78A 1ZRCA 2KJGA 3CMMA 1W36C 4D9JA 4M3BA 3ZP5A 5GADJ 3OYBA 2XGCA 4AIKA 4KYWA 1WWXA 3DU5A 3WGGA 1HSTA 3K1NA 2X48A 4XSXF 2A1DD 4WABA 1D5VA 4GYIA 4KMUX 2DT6A 3CUQC 2XAHA 4MHGA 1KU3A 3BC8A 1LPQA 2STWA 1E0EA 2W4BA 3U5SA 3FHZA 3MWMA 1QQ3A 1W4MA 3O39A 4RB3C 1VOMA 2ECCA 2IM8A 4A5NA 3OYKA 3UMKA 1OW7A 2EINC 1L7CA 4FISA 4CHUA 1JKRC 4DRIB 1XGNA 2LBFA 3S1NJ 3B0PA 3VM6A 1T98A 1SC7A 3B0UX 1QNTA 3AG2H 4LLNA 1Z6AA 3E6DA 3ML6A 5HSWA 2BEOA 3CCSI 1TT0A 2WVQA 4I98B 4QPOA 3F47A 3DE8A 4YEJA 3UGPA 3S3OA 3ZG1A 1A04A 4CA0A 2DYSH 4R8HA 2R5YA 3ZQYA 3Q5FA 2YLIA 3KP2A 2PJRB 2R7RA 1MNMC 3T8TA 2QKMB 2OJQA 2BL2A 2CSOA 2IPQX 2HV7A 3IKTA 3GZNB 3H3VK 3RH3A 2L6GA 3Q9VA 3DPLC 1ZQ3P 2XGEA 3GZ5A 5HOOA 4XRMA 2HWVA 2IA1A 3RQ4A 3WTXC 5DS5A 2KISA 1ZZPA 3FISA 1AOYA 2XV4S 3KEOA 2L7KA 4IQ4A 3TQOA 1JHFA 1NU9C 4AE4A 4BE2A 5GAHJ 2O03A 1E3OC 3JYHA 4AL1A 2XL6A 4CIPA 4BNCA 3DI5A 4HF0A 2YPRA 4BJTA 1TQGA 1E84A 3QP6A 2K85A 2OAZA 1ZG5A 3AOUA 4AX2A 3P9CA 3L2RA 2YRFA 1JT0A 3ZR8X 4G12A 1SVLA 2DJNA 2NXNB 3MZYA 5D6EA 1VQMI 3AQCA 3QVYA 5AIQA 3K66A 1LB2A 3SXKA 3HNIA 4KIFA 1XCBA 3L2UA 2WY7Q 1YI2I 1T0FC 3JZ0A 3DTIA 4CO8A 1OISA 2IBDA 3DM9B 4PFPA 1JKQC 4E0IA 5HVQC 3W8IA 3DKXA 4E7HA 1C17M 2KFDA 5J3LA 1KU7A 3FOOA 3O10A 2DMTA 5LEJA 4AVZA 1R1VA 1CPQA 5CI8A 4ZZLA 2AO9A 2IBFA 3U1KA 2E19A 3ZQQA 3LSKA 3CCQI 2DYSC 4JX6A 3M1EA 1L0OC 5DEQA 1NK3P 1WI9A 4YFKF 3EH1A 2K4JA 2UUHA 5JVGF 5EGYA 5B1BH 5H6QA 4J7TA 2HS5A 1QKRA 3SXYA 3RPUD 3K7DA 2TRTA 2CU7A 4P9TA 2QY9A 3JTLO 4YG2F 4BQAA 2LF8A 3MYFA 3U9JA 5ED4A 4L0YB 3MCZA 1Q1HA 3ERED 3KMIA 5FLXZ 1DPRA 5FKMA 4ON0A 2RVCA 3HRTA 2P61A 2IW5A 1RUOA 3WU2C 2DDBA 2LP0A 2V9PA 3OIQA 2XPUA 3BTLA 4IRIA 2QSHX 4MO7A 3BJAA 3G50A 2RN7A 4RLFA 2W4MA 1FYLA 1K04A 1BJZA 4XRFA 5B1AC 1Q0FA 1V5FA 3I5PA 3GEZA 3TO9A 5BQIA 3K4LA 1QSPA 1IN5A 2OCCH 1BJAA 3LSJA 4HF2A 4JW1A 3QYBA 2OTJI 1X4PA 4HF1A 3UKGA 1FTSA 1OXKA 5KYYA 2HJ3A 2IS1A 2HOAA 1DDNA 1BI2A 3GTPJ 2ISYA 5CQGA 4JE9A 5CI9A 1SD5A 2VKVA 1BR2A 1LDDA 2ZXIA 1WZ2A 3X1OA 3LAPA 2FQ3A 2XIGA 1Y39A 3FZVA 1OCZH 1XMXA 1MQVA 2XRNA 1TC3C 3FDQA 1WJCA 3S93A 2HTJA 2VH3A 1JTXA 4XEVA 4JP0A 4GRIA 4A2NB 3BJOA 3X2QH 5EZGA 2H94A 2KSFA 4FT8A 2XGXA 3VPRA 4EKWA 1LKXA 2PMHA 2DA5A 1OKRA 1LFPA 2EFNA 1AEPA 2OA4A 1ETWA 5CLSA 1GXQA 3R61A 2UXXA 1B72A 3GM3A 1O7FA 5CQEA 4QI0A 5J1YA 1VQ4I 1ZK8A 2R9RB 2HNHA 5CVIA 3AAFA 1K83J 1S7AA 2ISZA 1POGA 3FK7A 1LEAA 2ZNZA 3IKVA 1XDUA 3QTHA 3PSIA 4C3BA 4C2MJ 1FYMA 4PGHA 3MFKA 5E8GA 3C8GA 2ELHA 1IXCA 3ZXSA 5E17F 2KHMA 2WY8Q 5IP6A 1MKMA 4U7BA 4IOAF 2DBBA 2KZVA 3GTOJ 1ORYA 4XPYA 4JEBA 1WATA 1PJRA 2XLVA 2WC2A 4HBLA 4ESBA 3K4CA 3RQEA 3QPSA 4PSXA 1SMYF 1R4NB 2EILH 1YA7O 3BLYA 2GOMA 2ESHA 3GW2A 2CV1A 2XAGA 1RC9A 1SYQA 1D8KA 3CLOA 3VYRB 3FKIJ 4WGYA 3IAM2 5HODA 1BI3A 2KDZA 2D45A 1Z63A 1VTMP 2CFXA 3EETA 1U2WA 2OCCC 5F04A 1T39A 3BT9A 5T3WA 5K5OA 4ONSA 2X85A 3SZTA 1JGSA 4EGYA 4FASD 4A3EJ 4IEJA 2NNYA 3M4BA 2P6VA 4AVPA 4U5EE 4RBNA 2M64A 1XCVA 4JX4A 1D1CA 1APCA 1WCMJ 4L5JA 2AU5A 2HOEA 1GVDA 2YL1A 3BR1A 4LIVA 1O3RA 5ERIA 2VBZA 2BE5F 4IRGA 3OS1A 3QZCA 1OW8A 1YIOA 1M2VB 1WASA 3BRJA 1QZXA 2JZYA 3EJNA 4NTFA 5KVRA 3JSPA 2VN2A 3MN2A 4ZYHA 1QVUA 3BR2A 2GIZA 2PMZA 5IOZA 3DBLB 1SR2A 1V4RA 3M15A 4MTOA 2LKPA 1O57A 1Z77A 3U3BA 2EZHA 3DKAA 3EQLF 4V2GA 1DUXC 1T6IA 3T5XA 9ANTA 4GYGA 4LDQA 2CH0A 1QZEA 2L5QA 4Y7NJ 2DJIA 1AKHB 2OF7A 2ZJ2A 3K9TA 4L9TA 3KEQA 3I5UA 2X1CA 2RKHA 2IYLD 2K5CA 2VI6A 2W9YA 3FM3A 2OEXA 1G3TA 4HRIA 1QGPA 4X6AJ 4U5FE 2VQGA 2X1DA 5DCMA 2A3SA 5J1UA 2R92J 3RKYA 2FF4A 3BROA 3E7LA 4E7IA 1B68A 1B4AA 1QLEC 2H8WA 3FXKA 3TOLA 1A31A 3AKZA 2Y0SN 2R3SA 2EILC 2HGCA 1WTYA 1GV2A 3MVPA 2YKZA 2LD5A 3CTAA 1MZBA 1MNDA 2OU2A 1ACIA 4G8XA 5GPCA 1X19A 3GTQJ 1U0JA 2ZXRA 3E0JB 5FKNA 4AIJA 2DXIA 4XLFA 4CCLA 1BR1A 2ZMEB 4Q4ZF 3EH2A 4M6XA 3NMJA 5EHHA 1G5ZA 2B63J 1KYWA 2PEXA 3HOXJ 5LLQA 1DGWY 2ECBA 2VODA 2OEVA 3TBIA 3FXHA 3G2BA 1D0XA 4HEAJ 2UUIA 5D92A 3U8PA 1I50J 3S14J 2PNOA 4HFFB 2FE3A 3JRMO 1Y4CA 1NLXA 2GWWA 2E34A 1A41A 2JD3A 2IGNA 5D4RA 4RB2C 3DTKA 1JRAA 4D0PA 1KNYA 4C3EA 1TTYA 2X0LA 3CMYA 2GAUA 5J8CA 4M3FA 1GUUA 2MH9A 4EV0A 3GYHX 4E4HA 1U3EM 1RKCA 3IH2A 4BEHA 3L8IA 4BGDA 5L3CA 1Z67A 2CS3A 2OQGA 3LNMB 4KBLA 2K40A 2IXOA 4JURI 4BHCA 4ESJA 3QW1A 4NHJA 2EJRA 4A2UA 2E71A 1IZ1A 1PVEA 4JTDB 2TMVP 3AJMA 1G3SA 2CUZA 2XM0A 1V5GA 4BBRJ 2A6HF 1E3PA 1IGNA 1OKKD 4CYCB 2CW7A 4LGWA 1JOGA 4G6DA 1R4MB 2V4JC 2CMPA 4LB6B 4DYCA 5D6FA 1FP1D 5D5UB 1LQ1A 2E2JJ 2NRAC 1GS9A 3ZQVA 4XR6A 5AC4A 2L4MA 4WX9A 3I5QA 2MGQA 5LGNA 1ZYRF 1GT0C 1ZG3A 4XTKA 5GP9A 4XIDA 3BG7A 2JUGA 3CDLA 1HQCA 4IB4A 3ZOBA 4QTRA 4C7OB 2IGKA 1L3LA 1FYKA 2IS6A 1YFHA 2H7OA 3GTLJ 3IUOA 4M6VA 4AE4B 5HDKA 1V74B 2F48A 4M3GA 2QWWA 2ZXWC 3KH2A 4DBRA 4ZZDA 1FEXA 1AVOB 3K70C 3AG3H 4FE7A 4Q7CA 3OMYA 4O3MA 3GX4X 1IJWC 3BR5A 1D1AA 4M71A 3FXUA 2HFHA 2EIJH 1JT6A 3V7SA 3JRFA 4UVAA 5JLWA 4JKVA 2PX3A 4L9VA 4DZPA 1JUSA 1Z0XA 1SFKA 2E36A 2O8XA 2R7OA 3EGXB 4EUKB 3WU1B 1ZREA 4MVUA 3OYEA 2M7AA 2LY9A 5HS7A 4PJLA 3RQGA 4WCGA 4I0BA 4G6QA 4HX7A 2PJRA 4OIPF 3LA2A 3W6JB 2DK8A 4A3LJ 1YJWI 1ZG1A 2FGYA 2L2OA 1GLNA 4BJ5A 3TW7A 5EGOB 3HNKA 2MFZA 3QVZA 3ZSUA 4BYYA 1RJ9B 1J9IA 4P9UA 2X6OA 5JSLA 1TWFJ 2XAFA 2Y75A 4LK1F 2VASA 2DGJA 2Z15A 2GA0A 2IA2A 4LLGF 1FIPA 3HEFA 4RMNA 4IHTA 4BE1A 2G7HA 2DFFA 2KL4A 2LH9A 2M87A 5M5XJ 2GOXB 2J9VA 4I02A 3RSNA 1UAAA 4B47A 5EF6A 2I8BA 4ESFA 4ZDPA 4YIRX 2KPMA 3GBGA 5DCFA 5AC5A 5K0IA 2Q9AA 4WXHA 4FESA 2BW3B 4HV5A 2OQRA 2OCEA 3BR6A 4M9ZA 2D5RB 2XLHA 4Z9IA 1YRNB 1YLMA 1LFBA 5D8KB 2L0KA 3HKKA 2LY2A 3CF2A 3CLQA 3W6VA 2V1DA 1TWCJ 4Y15A 2H8AA 2R7TA 1YG2A 2Z33A 1D5YA 4ZLCA 3H0GJ 3GODA 3OSGA 2YLDA 3ABLH 2X1EA 2VJJA 4IZZA 3C63A 3LQQA 2DU9A 4I3MA 1LIHA 3P9IA 4KICA 3KLNA 4I6ZA 1LVAA 1I4YA 5IYBJ 1ZHTA 1KYZA 3AG3C 2KDOA 2CFOA 2K86A 2DT7B 2L7FP 3DEUA 4BXXJ 3WGHA 2BZTA 3DKWA 2EIJC 2KRCA 2OJED 3JRDA 3HC7A 3K0LA 4LB5A 4J7YA 1JE8A 5F28E 2KJBA 3CESA 1HSJA 1ZAOA 2E5ZA 3GWZA 1YHQI 2O9LA 4LLEA 1GDTA 2AP3A 5IP7J 1KQ9A 5D8LB 3HOYJ 2XS1A 3TGNA 3HHHA 4FX0A 1FFHA 3GTJJ 2JPUA 4A0ZA 1E85A 3DAFA 2W1OA 1R22A 4EEFG 2X0CA 1O87A 2KIFA 3K4MA 2NOJB 4XK4A 3JRIA 1X4OA 1XGMA 2YUSA 1MGTA 1EF4A 2BGCA 3OYGA 1AHDP 1T9KA 4G0HA 3BQZA 2PMZN 1HC8A 1I5NA 4O6NA 3WHBA 2UXNA 3BCAA 3GTMJ 1R6RA 1LJ9A 1UB9A 5DDGA 3GM1A 3ZTMA 1RR7A 1VQPI 3OR1C 2J5PA 1JUMA 2EZKA 2I10A 3AL0B 3QYEA 1ORJA 3TJ5A 1DOVA 1NHAA 1TFOB 5IT9Z 4MNUA 3MBGA 1GV5A 4BHPA 2CG4A 2KZGA 2VJ5A 5A6KA 3QPLA 3CSKA 4F3QA 3KYDB 3OL4A 1UJ8A 2IGMA 4MW8A 1ZR2A 3ABLC 1FSEA 2EBIA 4BQNA 2QUPA 3VYUB 3D1NI 3J80K 4P96A 5JT4A 3LAJA 2E7WA 4EJWA 4PZJA 4DNCA 4OIQF 1KZHA 2HKVA 5A6BD 3MEXA 1IDYA 2V26A 5HS9A 4XKBA 3CAXA 2MD5A 2K7LA 4BHBA 2IXPA 1V5EA 3JRHA 3C3WA 4E17A 2JA8J 1QZZA 3V5XA 1TKNA 3I54A 3K33A 3WG9A 4U7DA 2CYDA 3TK0A 4K0DA 2COMA 3U1DA 4HQMA 2HQRA 4D1QA 3FXLA 2HI3A 3BG9A 4YIFA 5L3BA 2HMZA 5GTHC 3OEOA 2PN6A 4FTHA 3H5AA 2H09A 3DJUB 4ASNA 2E1NA 2K3PA 2CUJA 2LIGA 2DCEA 2XLEA 5JI6A 4C2TA 1ZELA 3K1MA 2XAQA 1Y8RB 4IRUA 3PHF2 4RB0A 5CVVA 5KAFC 5DV5A 1Q0DA 2MW8A 3CZ6A 3LLKA 1MBFA 5J4YA 2R7UA 3ABKH 4WXCA 3GCMA 1FOWA 3N24A 4Z9JA 5FJ8J 2NNNA 1FOYA 3TOBA 5IP9J 3MKYB 4AM3A 3DCFA 2DYRH 3BTJA 4BAYA 5H20A 2GDCA 3Q3SA 1VQKI 5FLXK 3LAYA 256BA 4ZLDA 4KISA 2IP2A 2HDWA 1MDMB 1TWCA 3D5RC 3TL4X 3H65A 1ZU5A 3NWTA 3H9JA 4ZTFA 2P7CB 5IYDJ 5AIPA 4DBQA 1G59A 4MVMA 3A02A 5F5HA 4P5OA 4CX9A 1MH3A 2CUEA 2L7ZA 2V1NA 1BIAA 2EFOA 3AGUA 4XN0A 3SYTA 1OQYA 1FJLA 2EPNA 3EHNA 1X3ZB 1WH7A 1F9NA 2VT3A 2P4WA 4OU0A 1M2VA 2MHRA 3HJEA 3E6BA 3QOPA 5DVWA 5J4VA 2VQCA 3GVAA 2KLOA 1RZ4A 3LWFA 1W5TA 3DWWA 3M4CA 2OV7A 3MMYB 2NSFA 3NG1A 1K4SA 3QP5A 1QA6A 1IRZA 3MKZA 5FGMA 2XF7A 1TWHJ 1XC5A 1FTTA 4YT2A 1TZLA 4YELA 3GTKJ 1Z7Qc 5FCLA 4HNTA 2VT2A 5HDGA 2MC3A 4WWCA 4RBOA 1AKHA 1LEBA 2XRHA 2LKSA 1B9NA 1RKTA 1LE4A 4OD4A 5LGTA 3ZN0A 3DPUA 4XPWA 1XS9A 5E3NA 1G4WR 1KTMA 2Q4FA 2EK5A 1BM9A 1JPNA 2CWEA 1RI7A 4FX4A 1YZCA 4NC6A 4UUTA 3F46A 1XDSA 3HTKC 5FB2A 3BEHA 2J7PD 2P6SA 3QYFA 3KX2A 3WHNA 2XL4A 2YX4A 3I4PA 2VLAA 3JSZA 5E3LA 2CW8A 3ABKC 3DTEA 3U2RA 2QSFX 1LNWA 4BUPA 4WJ0A 4HLXA 5E79C 4HDVA 2FJ1A 2RAEA 3K1HA 5FFZA 4RLQA 2R0QC 2DYRC 3R4KA 1ZRDA 1TLHB 1QPIA 1RKEB 1FX7A 1N78A 3UMHA 2HQAA 4DQ2A 2EIMH 1U89A 3MX3A 2ZMEA 4G6TB 4K1OA 2YLGA 3AQBA 4MVZA 4P9FA 4A0YA 1ORSC 1VI0A 3DEWA 3BR3A 2VPLA 3WTYC 2HYFA 3BWGA 1IN6A 5ICFA 4P55A 1NG7A 2H6CA 1YJGA 4P6IC 1F4KA 3CMAI 4LDKA 3GUDA 1YTYA 1FWZA 3S2WA 2FU4A 3L7WA 1DU6A 4FHTA 2F5CA 3H2UA 2KRHA 2OD5A 1MMGA 2RREA 3TO6A 4G7ZF 3SFZA 5A2QZ 2C6YA 3SYNA 1J7KA 1HE1A 1MBJA 1RIOH 2H27A 3CCYA 3B73A 2XB5A 5C44J 3SHFA 2M1BA 3FOPA 2A5YB 1TL8A 3JRBA 2MD0A 3GFJA 4ZTJA 2GM4A 3W3CA 4EQQA 1K05A 1Z91A 2M8EA 5K7HA 2GLOA 2DB4A 1I27A 1VQ5I 2XLWA 2IEKA 1FC3A 1EI7A 4D5FA 3ZC4A 3OYNA 2ZJRF 5FLVA 1TT5B 4C9YA 2LD6A 3SXZA 2HPIA 4CYCA 3VODA 2DOAA 2HYJA 2B7EA 2LKXA 3JW4A 2IGOA 1RCPA 1H0MA 4O7GA 5DS6A 2EFWA 5E1XA 2VKDA 3GEEA 5BPIA 3HYIA 3KLOA 3J81Z 4IX7A 1G3YA 3CDHA 2F5EA 2WAFA 2DMUA 1VQ9I 4L9JA 1U8RA 1K4TA 3R7CA 1Y0NA 4KN7X 4EJOA 2HXOA 4MGRA 4ZYAA 2O6GE 3CD6I 2YL0A 4KITB 1OCTC 2VQLA 4ZDOA 3T4RA 3F8BA 4KI2A 3N2ZB 4IPAA 2FMYA 2Y69H 2W85A 4C7OA 3GFLA 4YIIA 3SEZA 4DYQA 1QU3A 1HOMA 1D8JA 3VYTB 2BY0A 1OKKA 4Y33A 1ETXA 1YX5A 3F8MA 1NFNA 1AA7A 3E3VA 3IHUA 3W2VA 3FXMA 2BVLA 2XKPA 3GMEA 2XROA 2PJPA 2G62A 4MVQA 1R23A 2Y31A 5CKTA 3DV8A 1BBHA 4H4KC 1R1TA 2M2EA 2Z99A 4BDZA 1J75A 2AS5F 4M63A 2XF5A 2DA6A 2XRLA 1RNLA 4ANJA 4UUSA 1NTCA 5B5EC 1BR4A 1SD6A 2X6YA 4E7ZA 3KYCB 3J80Z 1JJ8C 2OTLI 1BW5A 3ZMDA 2A0UA 3EGDB 4EBBA 1REPC 2OZ6A 1QVTA 1RXQA 1FMWA 3EGXA 4Q47A 4RM3A 2BOLA 2NVTJ 3WTUC 5E3AA 5IPAA 5KYUB 1S7OA 1VLTA 3QODA 4EBJA 1WJFA 3RF3A 4CS9A 2IXSA 2V7FA 3MKLA 1I3AA 1X3WB 3E6CC 2DA7A 5CVRA 5BQHA 1TWHA 5C3EJ 2MH2A 2CQXA 3FIWA 1YW8A 2ZMEC 2P0NA 2ZO4A 1JTYA 2D1VA 2X6XA 3WE2A 5EGOA 2M4EA 2MC4A 3UNGC 2LMDA 4D7MA 1RJ9A 3AG2C 2K9QA 1ZLJA 3Q0WA 5DD4A 3SDGA 3S84A 3P7NA 1QPMA 3FAJA 1OCOH 1ONVA 3S2DJ 3QMKA 2WB1A 4FX5A 5L0IA 3HG9A 4NNJA 4MTDA 3N4MA 1R5GA 3K4JA 1YJNI 3H9QA 5FO5A 4U9EA 3W8HA 1RR8C 1ON1A 3ZWIA 4PCQA 2WZLA 1WGXA 2E2HJ 4NUBA 2E2IJ 4M9SA 5BMZA 2BW3A 5GPGB 1HMDA 3CP8A 4MEYF 3JCUQ 1YRNA 2F4IA 2Y0MA 4KN4X 2M0MA 2WWYA 2KIMA 2YL7A 3CO7C 1XG1A 1JKPC 3C62A 4HEA2 1OR7A 3M1CB 2Y69C 1NG6A 4HSTA 1XSXA 1QQIA 3RQIA 3F21A 1IO2A 2Q9BA 3ZVRA 3CC7I 3B29A 1S7ZA 3ZQGA 3S1QJ 4J30B 2EZIA 1AUEA 3RVYA 5BPDA 1P4WA 1H9GA 4PJ0C 1ZR4A 2QLAA 2KJCA 1FLIA 3JR9A 1U5TB 3GORA 2Y3GA 2Q7RA 5DM7F 1ZH5A 1J09A 1KONA 1PP8F 1R4TA 1MW7A 3SDBA 3M79A 1HKTA 4L0ZB 1ST6A 3L00A 5IOYA 5LFAA 1T6QA 2Q0OA 3J7AO 2JX0A 4OIRF 2OU6A 3NYLA 2FA5A 4XNFA 2NVYJ 2CUFA 4LIUA 3WE3A 4OMYA 3FXRA 1EH8A 3PO3J 4DRHB 3ISPA 5LHGA 4ZDLA 2JA5J 4I7HA 3EUAA 1EH6A 2EPOA 4RGSA 1YYVA 5FKKA 5BNGA 3LJBA 5TJJA 1E3HA 5F0FA 4EJUA 1G8XA 2PF4E 3FM5A 1S6LA 3RDIA 2K02A 4OAYA 2M34A 1K40A 1WPKA 3EPVA 3DPTA 3K2ZA 2VJ4A 2LFFA 4L9NA 4YL0A 1SD7A 2K27A 2HEOA 1I1GA 1WI3A 3F8FA 3C2GA 3I59B 1P2FA 5BQGA 5HLIA 3HNLA 1GHCA 2JT1A 2XXAB 1P7IA 1IG7A 3M8JA 4Z9HA 4XKCA 5E20A 5B1BC 2VIXA 1T5OA 2YEVA 4YJWA 3H0DA 4CS9C 4GDFA 4JQFA 3GF2A 2X51A 2LK4A 3GM2A 3F6OA 4PR9A 3LFUA 1XMKA 4U5DE 3OYFA 3BPVA 1YA9A 3WG7H 1LDKB 3AG1H 1W36D 5JHUA 3NKDA 4II3A 2V1UA 3IPMO 1I4ZA 4WXDA 2J45A 3JTHA 2CQKA 4ENKA 1B8IB 3AFHA 4UVBA 2ZKZA 4OD5A 2OC6A 3BZKA 1M57C 3WODF 4IF4A 1VB5A 2NUTB 4XLCA 4PJNA 5GPAA 2O0YA 2JA2A 4A3IJ 1ZGWA 3HRSA 2WL8A 3ZDLA 3KE2A 3FVYA 2ADUA 1R36A 1BZ4A 5ILSA 2GA2A 5KHDA 1E17A 1EKYA 3H36A 3FF5A 2Z1DA 4UV8A 2BHZA 3JSOA 4XWJA 2MABA 1VQLI 3FAPB 5EEHA 4CCKA 1OR7C 4MTEA 1IDZA 3NAUA 2BY3A 2HZDA 3N0TA 2ZXPA 3PFYA 4NB5A 4A3FJ 4CUGA 3TW6A 2Z9OA 1OCZC 4N6HA 3IH3A 3EG9B 4CXFA 5BQTA 3D5SC 2YU3A 4HV6A 3JAMZ 1KQ8A 1OCRH 2DMNA 2XAJA 4AYBA 4A3MJ 1K6OA 2MLGA 2H7BA 1YITI 4PFOA 4X0RA 3X2QC 2R7WA 2EPFA 5JLXA 4RAFA 3OYAA 2WAEA 5DLJA 2TCTA 4PJJA 3MZHA 4BJ6A 2HKXA 3M8FA 1Z3XA 3I53A 4XN3A 3ABMC 1UZCA 3LSRA 4XQFA 3RYLA 1MJBA 2V9KA 4WK8F 2LRDA 4X0GA 4F4BA 1BOAA 2EIKH 2F2EA 2I8DA 2L01A 2RV8A 4PSWA 2E87A 3MYIA 1V55H 3SEOA 5E8IA 5DTDA 4BJ1A 4U0VA 3AG4H 3L09A 3K6BA 2ZBKA 1FZPB 2NS8A 5ILUA 4Y52J 2R4GA 3RVZA 1MDMA 2ACJA 3H9GA 1M1EB 4Z2YA 2HVRA 4JX5A 3WG7C 3AG1C 2EQRA 5FKOA 2B0JA 3ASOH 1FNNA 2WBMA 1S5LC 3W4YA 2JK3A 4U0WA 4IQJA 1UHWA 4A3BJ 2Y3HA 4MFDA 3JYYA 4UNOA 1JUPA 4XRSG 1ODDA 4UUVA 1ZW2A 5IT9K 3EZHA 2XPWA 3HGYA 3ZQCA 4IHWA 3I4MJ 3IRQA 1Z7UA 3GLXA 1ETVA 1OYWA 3AL0C 2J9UA 2IRFG 3CCVI 1WHUA 2A6EF 2NOGA 3H5RA 2Q9CA 4BU2A 2JVHA 3FKJA 4KT5C 1NZEA 1A6QA 4NCQA 1O3UA 2FNAA 3H2VA 3J7ZI 1SFUA 1NK2P 2XUBA 1I6XA 3VYSB 4CDAA 3N97A 2QGUA 1W0UA 2JMWA 3MKWB 1HXDA 4CICA 1P4AA 2AXLA 5E18F 1LFUP 3TJ6A 4ABZA 3HSFA 2DQLA 1VMAA 3DBHB 2DMQA 2FNPA 2L81A 2R05A 4U5HA 3VRCA 2GFHA 4W8PA 2YHSA 4O6MA 1XWJA 3HHGA 3OYJA 2ZFUA 3CF5F 3PIOF 3B0VC 2BC5A 1YLFA 4FE4A 2QBYB 4NBQA 3ZPLA 1VQOI 2KP6A 4BS9A 2W82A 3I4NJ 3ONQA 3CMEI 4QSHA 2E1CA 2Z3YA 4HPQA 4IJJA 3R2PA 4JC7A 4C3DA 1H6GA 3O55A 1C03A 2EV0A 1JMWA 2KQ9A 5EK0A 3ZGKA 5HLHA 3I71A 2EIKC 1ZHXA 1SEUA 3HTUA 1V55C 2E1OA 1PUFB 5L0DA 3AG4C 2ID3A 3VOEA 1RKEA 2BY1A 4LACB 4XLHA 2WB1N 1IN8A 1EH7A 2IJLA 4CBEA 3V7RA 2M5WA 4JVSA 5KYXB 1K61A 3I55I 1HMOA 3OYCA 3ASOC 1WRJA 3PQKA 2HYGD 1B59A 1SAXA 4WF2A 1O3SA 4BJ6C 1TW3A 3OYLA 1RESA 2XDVA 1BIBA 3WGIA 2LP4A 3C7JA 5JFRA 4NY3A 1ETOA 4E0HA 2HQNA 2X9DA 2GQQA 2X4HA 5EG0B 5LD2C 1F1MA 2DT5A 5E3CA 1U6HA 4DXWA 2MG4A 2PFBA 1JI8A 3HOWJ 4JRZA 1VFCA 5L0HA 2YU9J 4OOIA 1EA8A 3A0BC 4FCYA 4UUSB 1RUNA 4R32A 3TD7A 5F6FA 1Y8QB 3U3FA 4MFEA 2CCYA 2A61A 1XMAA 1NBBA 2YVKA 2LCHA 3BP8A 3RI4A 1YIJI 4L18B 2JUCA 4BXUA 2LQGA 5E1WA 2D5VA 1VLSA 3IQ5A 3TP3A 2L4AA 3CCEI 1HCRA 3W2AA 3KKBA 4KUMA 1MMAA 2LSEA 3KFWX 1U0BB 2V6CA 1I1SA 1X2MA 2XPVA 1F43A 4F52A 3CQZJ 5IYCJ 2AWYA 2LYCA 1I3QJ 4BG0A 3ECSA 4AD9A 3QQAA 3F8CA 2G0EA 2VXDA 1SZIA 2YZSA 1HA8A 3ZQFA 2LREA 5DYMA 2VE9A 1UHMA 2M0CA 5K7FA 3US6A 2G9WA 4GO1A 4JJGA 2OPTA 2W4SA 1DGRM 4C3JJ 4XICA 3EHMA 3G73A 3KPHA 1MSFC 4AU7A 3OS0A 3EGDA 3RW0A 1SANA 3A03A 4CJGA 4IJAA 4EM1A 1LVKA 2JA6J 4CCMA 2EWNA 3O8GA 4B4CA 1L3PA 2QQBA 3LMMA 4IGGA 3H5NA 2CJJA 4S04A 2VONA 5KYUA 4E70A 3HKZA 2PI0A 4MW3A 4B48A 2IAIA 4IXAA 2FOKA 1PV3A 4QPQA 3OOUA 4BQOA 2KKOA 3V42A 3QU6A 2XLDA 1NU7D 2ZSIB 2ASRA 2CGEA 1V3FA 4Q48A 4HOBA 3WTSC 1QHGA 4K7BA 2VUMJ 1YW7A 2QVOA 3RZOJ 5JUAA 2L9RA 5A2QK 5A6JA 3HSEA 1YQAA 3L9FA 1AWCA 1KU9A 1JPJA 1HDDC 5ICEA 4KT6A 5H2FC 2J0WA 3GEIA 1RETA 2GXAA 4EATA 1LE8B 2Q8KA 1D1BA 5FKLA 3M4OJ 4BEJA 1Y6DA 4RDUA 2EA2A 2LY1A 3VB2A 1HBXG 5HV9A 4DZJA 1QPUA 3IEEA 3M7GA 4EJVA 1VF9A 5HLGA 4DVYP 3M1CA 4YL1A 3PJRA 4CDGA 4Z6YA 2CRGA 4BL0B 3TOAA 1TQPA 3HRUA 4TV7A 5CVUA 3J81K 3A4CA 2VBYA 4AYBN 2R7ZJ 3A11A 3KZYA 4CIHA 3I64A 2EB7A 2R7FA 2EH3A 4B43A 3DU6A 4ULVA 1MMNA 4PDKA 3G4SI 1MH4A 3NQOA 1U5TA 3JTGA 5FFXA 1ZLKA 4LFUA 2Y3BA 2GIVA 2NPUA 4BY7J 1VZ0A 4M72A 2LTPA 2NS0A 4IVNA 5LEKA 3WHCA 4IKFA 1IW7F 3RPUA 3KZZA 1H89C 3Q9SA 4XSZF 3C8GD 3CC4I 5L3GA 3E5QA 2W25A 2L3DA 4I76A 3VSLA 1WQ2A 4NQWB 2IVMA 2G7UA 2L54A 2YL3A 2BYVE 2QZ8A 2HVSA 3DMDA 3LEOA 3H92A 4XOTA 2G3KA 2DI3A 1KU2A 3PFIA 4BKXA 4NTBA 1ULYA 3DZAA 3KP7A 5HS8A 1PUEE 3ATPA 2M3AA 2QE9A 3ASNH 5EEGA 2WB7A 1OFCX 3O6BB 1R1UA 2R93J 5A6AA 4UB6C 1FP2A 4JTAB 4WGZA 4Y17A 2IOQA 1IN4A 1Y1VJ 2QENA 1XSVA 2H1LA 5LHIA 4A3KJ 2EPMX 2J9BA 3Q0UA 4XBFA 3KYJA 3LS1A 3I59A 1S05A 2QNLA 1R00A 4N6CA 4NDLA 3COAC 2STTA 3S3NA 4UV9A 2XF6A 2KIUA 3CCJI 2GXBA 1ZW3A 1E83A 3BG6A 2XXAA 1EKEA 3A01A 4LG3A 1HDPA 2H1KA 2DA4A 5COGA 1BI1A 3DF8A 1N25A 3IC7A 3S1RJ 4UDVA 2ZB9A 1FY7A 2DN0A 5F1RA 1MBEA 3ULQB 1XGOA 2DFIA 4XL9A 5L3FA 5EYRA 1P9QC 1JJ6C 3S16J 3G1LA 2DOFA 3CQZA 2KIQA 2FRHA 3CP2A 5LBQA 1CF7B 4CYDA 5F64A 1WOLA 3RZDJ 2LDUA 4OWRB 2Y9ZA 3DJNB 5D4SA 1B8IA 2FOWA 2F4OB 1M2OA 5FD5A 1V4AA 5M3MJ 3W6KB 1SFEA 2EA4A 4DJ9A 2NUTA 2JVGA 1KGSA 4A5MA 2L02A 3UR3C 1IRGA 1WJAA 1A7VA 3RIPA 1TWGJ 3BG3A 3BOQA 4HNUA 2I15A 1USTA 2XHKA 3H1CA 3J7YJ 3QU3A 4AIDA 5D91A 3BR0A 1FAPB 1BDJB 3CUOA 5KAIC 1G4DA 2DO7A 5CJ9A 1YE9A 3H35A 1ZVZA 4KC9A 3JRGA 3GANA 3DP7A 4LDRA 3RKXA 3G4XA 4BH9A 3S2HJ 1TR2A 4ER9A 4UY8I 4G9YA 2DFEA 5HNHA 4R79A 1NH3A 2ZSHB 2LLKA 3EG9A 3L2QA 2XASA 1AU7A 1GGQA 3NYJA 4A93J 4YFNF 1U5TC 1U9NA 1ZGJA 3PL8A 4IHYA 2JPBA 2VKHA 1NSGB 1YDIA 4E7LA 4U5BE 1B1BA 4XLAA 4D4XA 3V5YA 2HDCA 2DFHA 3ABTA 4HSRA 4EJTA 1FBUA 2DW4A 3TMOA 5D5WB 1IRFA 3HOVJ 2R7XA 2HZTA 4NC8A 1J8MF 3ZMSA 1TQMA 2O8KA 3QOEA 3HLZA 2RGVA 1SFXA 5F1JA 2HR3A 3HXLA 1FBSA 4MVOA 1FFTC 1RKWA 2O9XA 3KYIA 3FMQA 4LG0B 3T1BA 2LVSA 5LRSA 1ERDA 3BTIA 3ZMVA 2XL8A 4PJMA 1F5TA 3I9V2 4EM0B 2Y2ZA 2ZJQF 2CV0A 4QIWN 2UZKA 5J47A 2ZXJA 1LM3B 1RPWA 4H54A 5TJ5E 2RSEB 5F08A 1HW1A 2AXTC 4CH7A 5LGUA 1SMTA 2HDDA 1KA8A 5E2QA 5HNFA 3LA7A 3DD7A 1W2WA 2Q1ZB 3A0HC 2NUPB 1VTNC 3BJ6A 5D5XB 3OSFA 1MMSA 3I4UA 4JCZA 2ZPAA 1N75A 4RA2A 5ICCA 3FBNB 1UCRA 2WZGA 3HUGB 4N9HA 5E3OA 1N1CA 1X1DA 5E1ZB 1QVXA 2W48A 2L9JA 2DA2A 1Q0KA 4YK5A 3TP0A 5L0JA 3H3UA 3TEDA 1A5JA 4BBSJ 4M9XA 1G6NA 2QF7A 3MQ0A 2P7VB 2HPMA 1ETKA 2DPUA 1LS4A 4DOZA 1BI0A 2AQEA 4HX8A 1CGOA 1MJAA 4CGZA 1Z6RA 1Z3YA 1Z9CA 3FMSA 1W7PD 2K3FA 5F0HA 3LSTA 2JN6A 3I58A 2A5WA 4XKWA 4GFBA 4HYEA 1Z5ZA 1WVRA 2E1MB 1ZHFA 3B6AA 2QBYA 4CDYA 1UHSA 4C3IJ 5FD6A 3L2WA 4GEHA 2RQQA 2L6FA 4L6RA 3KP3A
chains in the Genus database with same CATH topology
1OKKD 1J8YF 2LG4A 3EFOB 2CW7A 3C2GA 3L34A 2OG2A 4CS7A 4PUSA 2CNWD 1ZU4A 2V4JC 2CMPA 2WAQA 2WZFA 2K9MA 4F91B 4CSAC 1K6YA 2KMUA 4XR6A 3SNHA 5KYWA 2XXAB 3M8JA 2XSEA 4XKCA 3OA1A 5B1BC 4LERA 3T4RA 4KI2A 2VIXA 4BJ5C 4BXFA 3I5QA 2YEVA 4YJWA 3H0DA 4CS9C 3EPZA 2FUG2 3K4KA 4JQFA 1IZMA 2R7VA 1ZYRF 2X51A 4E7JA 2PP4A 3E70C 4IWBA 4XTKA 4DVZA 3HPHA 3LFUA 3SEQA 3BG7A 2JUGA 1ZHZA 5KYXA 4U5DE 3OYFA 2BVMA 4C7OB 1W36D 1LDKB 2IGKA 3NKDA 2IS6A 4II3A 4ULWA 2H7OA 2W45A 2J45A 2P0WA 2CV2A 3IUOA 3S8PA 3AFHA 4BACA 4II2A 4BQQA 4AE4B 4OD5A 2OC6A 1ZHWA 2ZXWC 3KH2A 1DQUA 1M57C 3DWLE 4DBRA 1WJ5A 3OWTA 3WODF 1Z7LA 3K70C 4XLCA 4PJNA 3LL7A 3OMYA 2NUTB 2JA2A 5FRMA 4Q7CA 4U5CE 1WJBA 2NG1A 3POVA 2WL8A 1D1AA 1SAUA 4MLOA 1TWGA 4RD9A 2L9NA 3FVYA 2EIMC 5KHDA 1X1CA 5TGTA 2Z1DA 2PX3A 4XWJA 2MABA 1SFKA 2Y0SA 4CCKA 2R7OA 1OR7C 3EGXB 4MQ9F 3OL3A 3S0XA 2KGOA 2HZDA 2KQRA 3K70D 3K66A 3OYEA 2M7AA 3IP4B 4Y3OA 4PJLA 3HOTA 1DP3A 1Z23A 2ZXPA 3N0TA 3PFYA 2PJRA 4OIPF 4CUGA 1OCZC 1EA3A 4N06A 3EG9B 4CSAA 2FGYA 2L2OA 1GLNA 3D5SC 3K10A 4BJ5A 3DLAA 1X1AA 2X6WA 4AYBA 2H7BA 4X0RA 2MFZA 4YT5A 3ZSUA 4PFOA 3X2QC 1RJ9B 4QDLA 3FHNA 5F5FA 2R7WA 3OYAA 2WAEA 4DJAA 2VASA 4PJJA 2DGJA 2Z15A 1M56C 3ASNC 3OYHA 5DLJA 3CJRB 1Z3XA 4RMNA 4XN3A 1OCCC 4BE1A 1V54C 4XQFA 2LH9A 2KL4A 2WVOA 3RYLA 2GOXB 2V9KA 2LRDA 3RSNA 4X0GA 1UAAA 2J9VA 4B47A 3J7AY 3S27A 5DQTA 2UWMA 4F4BA 2I8DA 4PSWA 2E87A 2I8BA 2J0XA 4ZDPA 3LLKA 2KPMA 3GBGA 3SEOA 5T3TA 3SZRA 4JJGA 1BOBA 2Q9AA 2IXNA 3K6BA 4FESA 2R7QA 2BW3B 4W8KA 2D5RB 3LSGA 4YN0B 2R4GA 4DIQA 4ZLDA 2WVNA 2LY2A 3CF2A 1X1BA 3H9GA 2LOOA 1SF8A 4XLNF 2JSPA 2HVRA 1PD0A 3WG7C 2R7TA 3AG1C 2B0JA 4ZLCA 3GODA 2WBMA 3LESA 1VK5A 2A6TA 2X1EA 4IQJA 2VJJA 4IZZA 2Y3HA 3JT1A 4J00A 4I3MA 2VQHA 4E7KA 4O6YA 3LSMA 3VYWA 3A2KA 1ZHTA 4YT4A 2Z16A 2KDOA 3AG3C 2CFOA 5FROA 3OYIA 3EZHA 3PMRA 3SP1A 2DT7B 1MNEA 1WJDA 2W9YA 3PNTA 2J9UA 3T6JA 3AL0C 3Q7LA 2EIJC 2KRCA 3I3LA 2A6EF 3H5RA 2Q9CA 3HC7A 3LSHA 2JVHA 3FKJA 4BU2A 1PD1A 4KNVA 3Q7GA 1NZEA 3CESA 2PFDA 2W00A 2E5ZA 4LLEA 4BE0A 3VYSB 2CDQA 2ZXOA 3S29A 3MKWB 4ITVA 1FFHA 2FFHA 1VMAA 2L81A 4BEHB 4PK4A 3RCOA 2KNHA 2W1OA 3DAFA 4U5HA 2GFHA 4YT8A 2YHSA 4O6MA 1Y56A 2WA0A 1O87A 3K4MA 3OYJA 2ZFUA 2NOJB 3B0VC 4BDYA 1X4OA 4I1OB 3D5LA 3PSFA 2HU9A 2KP6A 2L9SA 4C30A 3OYGA 2ZXHA 3LSIA 4XORA 4BS9A 2W82A 2J46A 3O6XA 1Z3IX 3ONQA 4GYTA 4O6NA 3BCAA 3B9QA 4HPQA 1Z21A 4I44A 1R6RA 4IJJA 4C3DA 4ZJZA 1UELB 4J01A 2KQ9A 3N05A 3ZGKA 2EIKC 1ZHXA 4LLCA 3OR1C 3HL2A 1OCOC 1V55C 3DAGA 5KYWB 3AL0B 3AG4C 4JCHA 3QYEA 4EWCA 4N4OB 4LACB 2KJGA 2VJIA 2J9WA 4XLHA 3CMMA 1W36C 4D9JA 4YRVA 4XONA 3OYBA 4CBEA 4JVSA 5KYXB 3S28A 2VJ5A 3DQVC 3DU5A 4B3XA 3CSKA 4F3QA 3OYCA 3OL4A 3ASOC 2IGMA 2C04A 2A1DD 3ABLC 5T3WA 2QKLB 2DT6A 4BQNA 1E0EA 4BJ6C 1Y6IA 3BC8A 3OYLA 2W4BA 3V7OA 3VYUB 4E7SA 3NYMA 2XDVA 4G7HF 3ZCOA 3O39A 1VOMA 4N4NB 4OIQF 3OYKA 3UMKA 2EINC 4U5GA 2ELJA 4NY3A 2F5VA 2V26A 2LBFA 3B0PA 5E3CA 4XKBA 5LD2C 5DQZA 2HV6A 3B0UX 5L3VA 5JHFA 1Z6AA 1V5EA 1JI8A 2IXPA 5HSWA 1TT0A 2WVQA 1TKNA 4CSWA 3K33A 4QPOA 3VAYA 3F47A 3KEYA 4K0DA 3VDXA 4YEJA 3UGPA 3TD7A 3S3OA 4HE8D 4CA0A 3ZG1A 4D1QA 3EUKL 2PJRB 2R7RA 3OEOA 4E6KG 2QKMB 3H5AA 5E33A 4XOPA 2HV7A 3DJUB 3RH3A 2K3PA 2CUJA 2DCEA 4F55A 2IXMA 3DPLC 4C2TA 1ZELA 2M4GA 4IRUA 2OUMA 2UV1A 5HOOA 5DS5A 3RQ4A 3PHF2 3OIPA 2Q2EB 4IQ4A 2L7KA 3OS2A 3CZ6A 3W2AA 1NU9C 3JRTA 2R7UA 1NG1A 4HG2A 1MMAA 2LSEA 4BE2A 3JYHA 3KKBA 4AE4A 1ZHYA 3N24A 2LC2A 5KNLA 4CCJA 2K9LA 4BJTA 4F52A 3MKYB 1WFXA 2LYCA 4BG0A 3ECSA 4AX2A 2HVQA 3L2RA 4P1WA 3LAYA 4I1MA 2VXDA 1SZIA 4HFKB 3ZR8X 4KISA 1OLTA 4XM3A 1HA8A 2LREA 1WGWA 2YZSA 3AQCA 3S32A 2HDWA 1TWCA 3D5RC 4QI2A 3TL4X 2W4SA 2Y3DA 1DGRM 3EHMA 1ZU5A 3NWTA 3H9JA 4ZTFA 3H65A 3L0IA 4DBQA 1G59A 3CJQB 4AU7A 3OS0A 5FRNA 2IS2A 5F5HA 4P5OA 3EGDA 4FWVA 1MMDA 3L2UA 2V1NA 1LVKA 3L2VA 2WY7Q 4JOMA 1T0FC 4XN0A 3SYTA 4CCMA 3C2HA 3EHNA 3LMMA 1M2VA 3H5NA 3DTIA 1TWAA 5KYUA 4CS8A 3DM9B 4OINF 3HKZA 5DVWA 4PFPA 2VQCA 4B48A 2KLOA 5HVQC 3W8IA 3DKXA 2OV7A 3MMYB 4E7HA 3NG1A 4Q5SF 4QPQA 3OOUA 4BQOA 3V42A 3MKZA 1NU7D 2ZSIB 2XF7A 5T1DB 3K4NA 2CGEA 4AVZA 5CI8A 4YT2A 1QHGA 4K7BA 1TZLA 4YELA 5FCLA 3NKEA 4HNTA 3ZQQA 3LSKA 3FDYA 2XRHA 2O5RA 2DYSC 3LLIA 3LEVA 3EH1A 3S3MA 3E1SA 4OD4A 1JPJA 4RM2A 3DPUA 2XSJC 4KT6A 5EGYA 2MYSA 4DGWB 2J0WA 3RPUD 3K7DA 4EATA 2IS4A 2QY9A 1JPNA 3Q6MA 1D1BA 4F92B 3F46A 4BEJA 3KL4A 3HTKC 4KNWA 2J7PD 2LY1A 1VYKA 3KMIA 3QYFA 3KX2A 2XL4A 2A69F 3IEEA 2VLAA 3JSZA 4JJFA 4AK9A 2CW8A 3ABKC 3NRHA 3DTEA 3M1CA 3OIQA 4DVYP 1OCRC 4BUPA 3PJRA 4BL0B 3ITFA 4WJ0A 3K1HA 3A4CA 4KJZA 4RLFA 2W4MA 4O79A 4RLQA 1IRXA 2DYRC 4CIHA 5B1AC 1V5FA 3I5PA 1N78A 4B43A 3DU6A 3OY9A 2NUPA 2PX0A 2HQAA 3K4LA 3UMHA 1MMNA 3MX3A 4F93B 4G6TB 4RDAA 3AQBA 4JW1A 3QYBA 2Y3BA 1X4PA 2VPLA 1FTSA 5KYYA 1VZ0A 1S9HA 1LS1A 4IKFA 2IS1A 1NG7A 1IW7F 4P6IC 5CQGA 5CI9A 1BR2A 2ZXIA 3SZGA 3X1OA 3VSLA 1PCXA 2RNGA 4NQWB 2J7PA 2P7VA 2Q3TA 3OR2C 1UG0A 2KRHA 2RREA 1MMGA 4G7ZF 3NDBB 2Z2SB 3SYNA 3FDQA 3DMDA 2HVSA 1WJCA 4J32B 3S93A 4XOTA 2G3KA 2VH3A 2LBFB 4GRIA 1KU2A 3UMIA 4A2NB 2E60A 2R7SA 3DZAA 2VB6A 5HLTA 2M3AA 1LKXA 3DEEA 1LFPA 2WB7A 2UUZA 2MD0A 4ZTJA 2G3VA 3W3CA 3DXJF 3RKOF 3E9VA 2MWQA 2IOQA 3NWSA 5CQEA 4QI0A 3ZC4A 2V3CC 3OYNA 2HNHA 3HOSA 4JZAA 4C9YA 2HPIA 2Y39A 2XC7A 2CW0F 2DOAA 3EFOA 3LS1A 1YX3A 2E5NA 2IGOA 3PSIA 4C3BA 4O7GA 2M4KA 3ZIBA 2H7VC 5DS6A 2VKDA 3S3NA 2XF6A 3W2WA 4LITA 3ZXSA 4CS8C 2XXAA 3BG6A 2KHMA 2WY8Q 3PUBA 4LG3A 4B44A 4U7BA 3KYLA 2KZVA 3F9KA 4IX7A 2WAFA 1PJRA 3EUHC 3K1IC 2AQFA 3K4CA 4ZYAA 4PSXA 1SMYF 4KITB 4ZDOA 2VQLA 4CCOA 4XL9A 3MLGA 1P9QC 2GOMA 3BLYA 1N77A 2CV1A 1VYIA 3N2ZB 5IY5C 3CQZA 3CP2A 2M7BA 4CCNA 4C2UA 3VYRB 4C7OA 3SEZA 1QU3A 1OKKA 1T95A 3IAM2 4OWRB 3VYTB 3DJNB 1PYVA 4Y33A 1YX5A 3HPGA 5BUOA 1AA7A 2V6EA 3T6BA 1Z63A 1M2OA 2CNWA 5L3QA 3W2VA 2OCCC 2X85A 2BVLA 3DKYA 3DM5A 2G62A 2NUTA 4FASD 5CKTA 2JVGA 4H4KC 2P6VA 3UR3C 4ZC3A 5KCMA 4BDZA 1WJAA 4M63A 1D0YA 4U5EE 2XF5A 4RBNA 1D1CA 3ABMC 4ANJA 3RTRA 3RIPA 1BR4A 2X6YA 4E7ZA 4HNUA 4LIVA 3EGDB 4YWQA 2BE5F 5D91A 2C03A 3IAS2 3OS1A 3FHDA 3QZCA 4BJ1A 4EBBA 4OIOF 1FMWA 4KC9A 1YE9A 3H35A 3EGXA 1M2VB 3K4BA 4RM3A 3GANA 2BOLA 5KYUB 1QZXA 5E3AA 2KW3C 3EJNA 5DS4A 1TR2A 3QODA 3EZIA 3ZRGA 1WJFA 4XMYA 4CS9A 2IXSA 2PMZA 2V7FA 4R79A 5HNHA 2ZSHB 3EG9A 3L2QA 5CPRB 1TWHA 3NYJA 3FBIB 3EQLF 3PL8A 2X6XA 2W7NA 2VKHA 2M4EA 2MC4A 2CH0A 2L5QA 3UNGC 4XLAA 4E7LA 4U5BE 1RJ9A 2DJIA 3AG2C 4BJ6A 4HSRA 3PNYA 3TMOA 2R7XA 3FAJA 3QMKA 2X1CA 2XAUA 4NC8A 3OYDA 1J8MF 2IYLD 2K5CA 2WB1A 3LNRA 4FX5A 3QOEA 5B3SC 3HLZA 3HG9A 4NNJA 5KYNA 4HRIA 4MNDA 3HXLA 3K4JA 4U5FE 3H9QA 4U87A 2VQGA 2X1DA 1FFTC 4FETA 3MD2A 2O9XA 3W8HA 2WZLA 4NUBA 2A68F 4XKVA 1QHHD 3Q6NA 3UGOA 2BW3A 2VXZA 3CP8A 1ERDA 4E7IA 1QLEC 3JCUQ 2F4IA 4PJMA 2M0MA 3AKZA 3I9V2 4G7OF 3OYMA 2EILC 4HEA2 2CV0A 3M1CB 2Y69C 1NG6A 4HSTA 2QTVA 2E1MC 4XLEA 2Q9BA 3ZVRA 4CH7A 4IAOA 1MNDA 1S7ZA 3PNVA 4J30B 5E2QA 3K6GA 5HNFA 1X19A 3VSKA 3DD7A 1U0JA 4Y4RA 1W2WA 3E0JB 2ZXRA 2Q1ZB 3HJCA 2NUPB 2DXIA 4XLFA 4CCLA 1BR1A 3I4UA 4Q4ZF 2ZPAA 2Y3GA 3EH2A 5EHHA 1N75A 5KYYB 1J09A 1KONA 3FBNB 2WZGA 3HUGB 1N1CA 1X1DA 1MW7A 1DGWY 4NC7A 2L9JA 3SDBA 3TBIA 1ST6A 3G2BA 1D0XA 1D0ZA 4HEAJ 5D92A 3U21A 5LFAA 3BCBA 1O5HA 3LS0A 4OIRF 4HFFB 3NYLA 4XNFA 4LIUA 2JD3A 2IGNA 2HPMA 4B6IA 3DTKA 4C3EA 4DOZA 2AQEA 4ZDLA 2F6CA 1FMVA 1Z3YA 4E4HA 2VL8A 3EUAA 4BEHA 3VWBA 4BGDA 2WADA 4KBLA 2CS3A 4G0HA 1WJEA 3LJBA 2A5WA 2IXOA 4OAZA 3A1YA 4XKWA 4JURI 1Z5ZA 1G8XA 2PF4E 2E1MB 4XLPF 4OAYA 3EPVA 3DPTA 3L2WA 4GEHA 4CZCA 2VJ4A 2CUZA 2RQQA 1V5GA 2A6HF 3RFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJT A;  3CZ6 A;  3OWT A;  4BJ5 C;  4BJ6 C; 
#chains in the Genus database with same CATH topology
 1J8Y F;  3EFO B;  5E3M A;  1T38 A;  3L34 A;  2OG2 A;  3R6S A;  1OCC H;  1V54 H;  4MTF A;  2CNW D;  1W5C C;  1ZU4 A;  2WAQ A;  4RGU A;  2WZF A;  2K9M A;  3JAM K;  4CSA C;  5EEA A;  4GQH A;  4R1H A;  1PUF A;  2XSE A;  3HDD A;  2CQQ A;  3SQN A;  1W7P B;  2BXZ A;  4G94 A;  4LER A;  2QCO A;  2RQP A;  3K69 A;  4BXF A;  2D1H A;  5DD8 A;  1T8I A;  2TDX A;  1G2H A;  2FUG 2;  1ZN2 A;  4E7J A;  3E70 C;  3MZ8 A;  1OJL A;  4IWB A;  4DVZ A;  2M9H A;  3JRE A;  3HPH A;  3SEQ A;  1HE9 A;  1ZHZ A;  3O2P E;  1OW6 A;  5KYX A;  5M5W J;  2BVM A;  5EZH A;  1NFO A;  2HZ8 A;  1FTZ A;  3L2C A;  2W45 A;  4HA8 A;  2P0W A;  2CV2 A;  3S8P A;  3ZQH A;  4BQQ A;  1M6T A;  4JIO A;  5K5Q A;  1DQU A;  3D0S A;  2EFP A;  1WJ5 A;  2FSW A;  3OWT A;  3T6G B;  1F36 A;  1Z7L A;  1MJ9 A;  3REO A;  3B71 A;  1TP4 A;  2A07 F;  5FRM A;  4IOC F;  1WJB A;  5EG0 A;  2NG1 A;  2DA1 A;  3POV A;  2WTE A;  1TWG A;  4RD9 A;  2EIM C;  2MSY A;  1XB4 A;  1I39 A;  2GXG A;  1X1C A;  1FPQ A;  5TGT A;  1XTA A;  2JJ7 A;  3R60 A;  3ZQI A;  1D3Y A;  2Y0S A;  3IQ6 A;  3F22 A;  3OL3 A;  2KGO A;  2ESN A;  2KQR A;  5J40 A;  4NQF A;  1U6G A;  2OBP A;  1DP3 A;  2GA1 A;  3MAJ A;  2Y9Y A;  3R0J A;  4ZYG A;  1U9O A;  3F8N A;  3DBR B;  1MIJ A;  1UG2 A;  5DUK A;  2M45 A;  1X1A A;  2DOD A;  2X6W A;  5JVT A;  1IUY A;  4YT5 A;  1BA5 A;  3P5J A;  3FHN A;  2QEX I;  1WWP A;  1XN7 A;  4N4W A;  3F72 A;  3O3K A;  5F5F A;  1HKS A;  1U78 A;  1FSH A;  3OYH A;  3CJR B;  5B1A H;  2NVX J;  1DPU A;  5BOX A;  3EYI A;  1OCC C;  1V54 C;  2G3V A;  4EMS A;  2YSR A;  5DQT A;  1Z1D A;  3LUT B;  3J7A Y;  2O7O A;  3S27 A;  3PDM P;  2FEZ A;  2J0X A;  3KP5 A;  1SVO A;  1MBK A;  5T3T A;  1BOB A;  3G71 I;  5GAG J;  2IXN A;  1FOX A;  4MEX F;  3FK6 A;  4W8K A;  3EYY A;  2EPL X;  4YN0 B;  4DIQ A;  3S1M J;  1JGG A;  1VQ7 I;  1X1B A;  3IQT A;  1BN5 A;  4PGG A;  4XLN F;  2JSP A;  1GXP A;  1DU0 A;  1PD0 A;  2VCC A;  2CGP A;  1XGS A;  3U8V A;  4PAC A;  4XPX A;  1VK5 A;  2A6T A;  2F5F A;  3JT1 A;  5F27 A;  4J00 A;  1OQC A;  2VQH A;  3QAH A;  4O6Y A;  2CO5 A;  1A35 A;  4RGR A;  1YAU O;  3LSM A;  3A2K A;  4IAQ A;  1TWA J;  5FRO A;  3T8R A;  4UB8 C;  3G4Z A;  3PMR A;  3SP1 A;  1X2N A;  2DLL A;  2P81 A;  3VEP A;  1XSD A;  3PNT A;  4ZH4 F;  3T6J A;  3RQF A;  2N8G A;  3LSH A;  4L5E A;  1PD1 A;  4HAM A;  2PFD A;  2JRM A;  4CZZ A;  1I5Z A;  4U0Y A;  3TOM A;  2QLZ A;  4BE0 A;  1YS7 A;  2ZXO A;  1FT9 A;  3O8H A;  3S29 A;  2L7M P;  1O7L A;  4IHS A;  1IAW A;  1TNS A;  1ITY A;  1ON2 A;  2NAZ A;  2FFH A;  1WH5 A;  1IV8 A;  3BG5 A;  5JR3 A;  3SZP A;  2KNH A;  3RCO A;  3TDU C;  1QBJ A;  4YT8 A;  1LE8 A;  1J59 A;  2D4U A;  2HSB A;  1Y56 A;  2WA0 A;  3LFK A;  3JSE O;  3GZ6 A;  5EJC A;  4I1O B;  4C30 A;  2ZFW A;  3O6X A;  2QM3 A;  2QQA A;  3LSI A;  3ZQ7 A;  2J46 A;  3LOC A;  4J19 A;  1JXS A;  1OCP A;  4GYT A;  3B9Q A;  4ENN A;  3M07 A;  3L1P A;  3R0A A;  3SXM A;  4DYR A;  4LLL A;  2R5Z B;  4NTA A;  3PQJ A;  2PG4 A;  1YS6 A;  3FWE A;  3G1M A;  3HL2 A;  4A3C J;  1OCO C;  5KYW B;  1RMV A;  4JCH A;  1R71 A;  3DE9 A;  4EWC A;  3NEU A;  4N4O B;  3M3Y J;  2YR2 A;  2J9W A;  3RYR A;  4RS8 A;  4BY1 J;  4YRV A;  2CYY A;  4XON A;  2FBH A;  3A01 B;  3TUL A;  3S28 A;  1PDN C;  3DQV C;  3U9G A;  3NRV A;  4B3X A;  1XX5 A;  1IXR C;  1BC8 C;  3U2L A;  4UVC A;  2C04 A;  2JPC A;  2RDP A;  5H6R A;  1MBG A;  2P8T A;  2QKL B;  3HZJ A;  4LK0 F;  4NQW A;  1FOK A;  4MS2 A;  1Y6I A;  3IH4 A;  4G7H F;  1XPX A;  4E7S A;  3ERM A;  4LJZ F;  3NYM A;  3V7O A;  3ZCO A;  4N4N B;  2R03 A;  4U5G A;  2ELJ A;  2H8R A;  2F5V A;  4UXN A;  4B3A A;  3S17 J;  3HM5 A;  5DQZ A;  2HV6 A;  1CGM E;  5L3V A;  5JHF A;  1TFK B;  1SVM A;  2ME0 A;  3G1O A;  2B0L A;  2OKU A;  2KC3 A;  1WN0 A;  5CVJ A;  4RAZ A;  4CSW A;  2MLK A;  3VAY A;  1IUF A;  3KEY A;  1YW9 A;  5C4X J;  1DOW A;  3VDX A;  3RYP A;  2ETS A;  4HE8 D;  1ETY A;  1QZY A;  1TBX A;  2EPK X;  4A3J J;  1HW2 A;  3EUK L;  1O4X A;  5AON A;  4ENM A;  4E6K G;  5COF A;  1YOV B;  4XOP A;  1O3Q A;  5E33 A;  2IA0 A;  4AC0 A;  4F55 A;  2IXM A;  3HBL A;  3T9O A;  4LMY A;  2M4G A;  2OUM A;  2QSG X;  2UV1 A;  3CJN A;  3OIP A;  2JRT A;  1H88 C;  5A6B A;  2Q2E B;  2EFQ A;  3OS2 A;  2FD5 A;  3JRT A;  3CUQ B;  5CYV A;  1GM5 A;  1NG1 A;  4HG2 A;  3F23 A;  4ENJ A;  1ZHY A;  1CF7 A;  3IWZ A;  1P7J A;  2LC2 A;  5KNL A;  4JEA A;  4CCJ A;  2K9L A;  1BL0 A;  3BTC A;  2WV0 A;  1WFX A;  2ZD9 A;  2HOS A;  3GFM A;  5L0C A;  3WAQ A;  4A3D J;  3ECH A;  2HVQ A;  1YYX A;  5DUI A;  4P1W A;  4I1M A;  3QPH A;  3FXO A;  3P9K A;  4HFK B;  1OLT A;  2W57 A;  4XM3 A;  1WGW A;  3NMK A;  3BZC A;  2FXA A;  3S32 A;  4D7N A;  2PX9 A;  4KMF A;  4QI2 A;  2WAQ N;  2ZNY A;  5COM A;  4B09 A;  4IHX A;  2K9N A;  2Y3D A;  3E6M A;  3JRA A;  2DAO A;  1S3J A;  2CQ7 A;  2DPD A;  3CCR I;  3L0I A;  3CJQ B;  3GO5 A;  1OR2 A;  5FRN A;  2IS2 A;  3RFY A;  4FWV A;  5A69 A;  1MMD A;  1JR8 A;  3L2V A;  2JTV A;  3F6V A;  4JOM A;  3U9M A;  3IV5 A;  3C2H A;  4XRS A;  1E86 A;  4RAY A;  1TWA A;  1P4X A;  4CS8 A;  3LA3 A;  4OIN F;  4EIY A;  2XLO A;  1JKO C;  3EUH A;  3K1I A;  1W1W E;  3CCM I;  3HB9 A;  4JBA A;  4Q5S F;  5B3I A;  5EDN A;  1O3T A;  1ETQ A;  5K7Z A;  3F3X A;  5T1D B;  3K4N A;  4JYK A;  3F0C A;  5L0F A;  3UGO A;  2QA4 I;  4BEM J;  3K7A J;  3NKE A;  4HX4 A;  5L3E A;  3FDY A;  3JRC A;  2O5R A;  3LLI A;  2XSD C;  3LEV A;  3S3M A;  3E1S A;  2VC9 A;  4RM2 A;  2XSJ C;  1HF0 A;  2Y30 A;  2MYS A;  2ID6 A;  4DGW B;  4BPM A;  1J0R A;  1W0T A;  2IS4 A;  3Q6M A;  4EVI A;  1R7J A;  1S8N A;  1X3U A;  4F92 B;  2B9S A;  4LG0 A;  3KL4 A;  4KNW A;  4F7Z A;  3V5Z A;  1T01 A;  1VYK A;  5KK1 A;  4I0A A;  1H7I A;  3WTV C;  2HTS A;  1FBQ A;  2A69 F;  4JJF A;  1R9T J;  3SFI A;  5M3F J;  1A36 A;  4AK9 A;  3NRH A;  2Q00 A;  1A6I A;  3DFG A;  1OCR C;  3ITF A;  2ZXW H;  5IY5 H;  4IRH A;  4KJZ A;  4O79 A;  4IHV A;  1PP7 U;  2HSQ A;  1IRX A;  3IQC A;  3HIF A;  2DTR A;  4C3H J;  3GTG J;  2GWR A;  1YZA A;  1ZRF A;  3C2B A;  1JAF A;  2PX0 A;  3OY9 A;  2NUP A;  4IAR A;  2BY2 A;  4MTG A;  4F93 B;  1T6S A;  4RDA A;  5HDN A;  1K78 B;  4KIG A;  4EGZ A;  4OMZ A;  5LRR A;  2K9S A;  4B1R A;  3HUG A;  1S9H A;  1K7A A;  1LS1 A;  1EV7 A;  2E7X A;  2NYX A;  3RJP A;  1ZAR A;  2JSC A;  2M8G X;  2LFD A;  3SZG A;  1PCX A;  1CGP A;  2RNG A;  3PIP F;  1UFB A;  2J7P A;  2ZCW A;  3NMI A;  4I01 A;  2P7V A;  4KIB A;  2Q3T A;  3RKO F;  3OR2 C;  1UG0 A;  2V9V A;  3V8L A;  5LHH A;  1YJ9 I;  2Z2S B;  3HOU J;  1OYI A;  3NDB B;  4K2E A;  4GCV A;  1BC7 C;  4J32 B;  2XVC A;  4MVR A;  1VQ8 I;  1STZ A;  2P5K A;  1SFO J;  2LBF B;  1I6H J;  2XB0 X;  1H8A C;  5DM6 F;  1R5I D;  3HNJ A;  2E60 A;  4U88 A;  2PQ8 A;  2R7S A;  2VB6 A;  2XM4 A;  1ZGA A;  1JHH A;  5HLT A;  2OQM A;  1XD7 A;  3DEE A;  2UUZ A;  3HSR A;  4FQG A;  3DXJ F;  3E9V A;  1T08 B;  2COB A;  2FBI A;  3GFI A;  1UG7 A;  1GQA A;  1OR3 A;  3NWS A;  2V79 A;  2MWQ A;  2V3C C;  5ILV A;  3B6C A;  3HOS A;  3CJT B;  4JZA A;  2R5Y B;  2Y39 A;  2XC7 A;  2CW0 F;  3KZI C;  3EFO A;  1YX3 A;  1HKQ A;  2E5N A;  1R5H A;  2LFB A;  2O3F A;  5CIV A;  6PAX A;  2M4K A;  5B3S H;  2H7V C;  3PO2 J;  2EV5 A;  3ZIB A;  4DRJ B;  4M6Y A;  5M5Y J;  5BS6 A;  2DMP A;  4ETS A;  3GWN A;  3JCU C;  3W2W A;  3QW0 A;  4LIT A;  4CS8 C;  3CO6 C;  3PUB A;  4B44 A;  3KYL A;  1RRJ A;  1W7P A;  3F9K A;  5GTI C;  3ECO A;  3EUH C;  3K1I C;  1QO0 D;  3BQY A;  2ZJP F;  1OYY A;  4G78 A;  2AQF A;  2DOE A;  2HXI A;  3ABU A;  1UFM A;  4UHT A;  4CCO A;  2KK1 A;  3MLG A;  2P6T A;  1VYI A;  1T56 A;  3PUF A;  1N77 A;  2IT0 A;  2YQY A;  5IY5 C;  2M7B A;  4O5V A;  4CCN A;  5J6X A;  2GBY A;  3RKQ A;  2HOT A;  4C2U A;  2R02 A;  5L3D A;  1Y1W J;  2D2W A;  1T95 A;  5K1Y A;  1YYJ A;  1PYV A;  1ENH A;  5BUO A;  3HPG A;  2V6E A;  3T6B A;  2CNW A;  1R58 A;  1P92 A;  5L3Q A;  4RGX A;  1DP7 P;  1G3W A;  3DKY A;  4W1U A;  4RB1 A;  3DM5 A;  4XEK A;  2JQ7 A;  2DDA A;  5JRA A;  2A0B A;  4ZC3 A;  5KCM A;  4A4A A;  1D0Y A;  2GZW A;  2MBF A;  3RTR A;  3E5X A;  4HLY A;  1MBH A;  3KCC A;  3K1P A;  4YWQ A;  1OPC A;  1K79 A;  2J5O A;  3IAS 2;  2C03 A;  2PBE A;  1LI5 A;  3FHD A;  4AL0 A;  4MQV A;  4OIO F;  1LI7 A;  5FZT A;  3K4B A;  1J5Y A;  2L6H A;  4A6D A;  1XZP A;  2KW3 C;  4H0E A;  1CPR A;  2RD9 A;  3HRM A;  3EZI A;  4XQ1 A;  5DS4 A;  1B6A A;  4XMY A;  3ZRG A;  3LSP A;  3NAR A;  3G3Z A;  3S15 J;  2O61 A;  2NVQ J;  5CPR B;  2AVK A;  1IXS B;  3GWL A;  3KET A;  2ETH A;  2OZU A;  1ORK A;  3Q0V A;  2E35 A;  3FBI B;  1CGN A;  4A69 C;  2W7N A;  2HJM A;  3SJM A;  2A05 A;  5B66 C;  2OOC A;  1MSE C;  2ICW G;  2PLY A;  2KYH A;  3I56 I;  1FIA A;  3PNY A;  2XAU A;  3OYD A;  3LNR A;  5B3S C;  4FAP B;  5KYN A;  4MND A;  3FMR A;  1OMI A;  1IN7 A;  4U87 A;  3RPQ A;  4YL3 A;  4FET A;  3MD2 A;  2VOP A;  2HMQ A;  2NS7 A;  2A68 F;  3FXJ A;  4XKV A;  1QHH D;  2QQ8 A;  3IWF A;  4I09 A;  2VXZ A;  3Q6N A;  2Y48 A;  3VF0 A;  3KIO A;  4S0H B;  3QRF F;  1U8B A;  4KA4 A;  4LD5 A;  2DA3 A;  5GAE J;  4RAG A;  3I0T A;  3OYM A;  4G7O F;  4M3E A;  3UMI A;  2QTV A;  2E1M C;  2ZC2 A;  3ZMT A;  2ELK A;  4XLE A;  1P6R A;  2LR8 A;  4IAO A;  1IC8 A;  4QLC U;  3PNV A;  2R25 A;  2L7A A;  3K6G A;  2MA3 A;  3HGG A;  3RIR A;  3VSK A;  5D5V B;  4Y4R A;  4A12 A;  2F22 A;  1IF1 A;  3HJC A;  4CJO A;  3FX3 A;  4HZF A;  5KYY B;  3S9O A;  3WTZ A;  2I5U A;  2FBK A;  1FR0 A;  3VFZ A;  1FNT c;  2BV6 A;  2M30 A;  1GVJ A;  4NC7 A;  5DS9 A;  3CC2 I;  1MD0 A;  1D0Z A;  3U21 A;  3BCB A;  3RKW A;  3HTS B;  1O5H A;  3TKY A;  1LDJ A;  5ICG A;  3LS0 A;  2CQN A;  3S90 A;  2VCA A;  3LQR A;  3LNQ A;  2P1A A;  1LUJ B;  4B6I A;  4HNV A;  5JS5 A;  5JVE A;  4KDP A;  3V4G A;  3OIO A;  2V1X A;  3WTT C;  1F1Z A;  2QYO A;  2F6C A;  1FMV A;  2WV1 A;  3EDP A;  2VL8 A;  3PM1 A;  3VWB A;  5J8F A;  2XLM A;  2WAD A;  2DK5 A;  4IL6 C;  2XGD A;  1WJE A;  2K4B A;  4I2O A;  2JA7 J;  1ZKG A;  1T33 A;  3A1Y A;  4OAZ A;  4HQE A;  4XLP F;  2VOO A;  1HLV A;  4QWQ A;  4A6E A;  1B72 B;  4CZC A;  1QRY A;  2GAQ A;  3AGT A;  2LG4 A;  2RNJ A;  2P5V A;  4CS7 A;  5JP7 A;  1TNT A;  2XS8 A;  1Z05 A;  4PUS A;  4Y13 A;  2R5Z A;  3BDD A;  2JWT A;  5FLM J;  4V19 K;  4E18 A;  4D5C A;  3B02 A;  4F91 B;  3C8G B;  1K6Y A;  2KMU A;  2QQ9 A;  2XKO A;  3DLL F;  2LSO A;  2NSG A;  1S29 A;  3SNH A;  1TW2 A;  5KYW A;  2VBW A;  1OXB A;  3OA1 A;  2P5L C;  4BJ5 C;  4MIM A;  3EPZ A;  3K4K A;  1IZM A;  2PP4 A;  3U2M A;  2F4M B;  3KP6 A;  2R7V A;  2KT0 A;  1HW5 A;  4ZYE A;  1VND A;  1APL C;  2VE8 A;  1W5S A;  5IT3 A;  1EQ1 A;  1KQ0 A;  3E97 A;  1H9T A;  4V2F A;  1VQ6 I;  4ULW A;  3H3Z A;  1BW6 A;  4S05 A;  2FX0 A;  3E5U A;  4II2 A;  4BAC A;  1ZHW A;  2ME6 A;  1CQT A;  3C18 A;  3DWL E;  3C1D A;  1C02 A;  4GXO A;  3U0C A;  3ZQL A;  2H6B A;  3LL7 A;  1XZQ A;  4U5C E;  1LPE A;  4O6J A;  1G4U S;  1SAU A;  3OOP A;  4MLO A;  2FAP B;  4CDV A;  2L9N A;  2VC0 A;  4AIH A;  1TQI A;  5K5R A;  2J8W A;  5TIS C;  3CCU I;  3CCL I;  2HQ5 A;  3OV8 A;  3TO7 A;  5L0G A;  3BY6 A;  3S0X A;  4MQ9 F;  3K70 D;  1YO5 C;  2LK2 A;  2DQR A;  3IP4 B;  4Y3O A;  1Z23 A;  3HOT A;  2VC1 A;  3ZTZ A;  3G6E I;  1EA3 A;  2DTZ A;  4N06 A;  2W24 A;  4CSA A;  4M74 A;  2VBX A;  4W97 A;  3HOZ J;  3K10 A;  4JK1 X;  3QPT A;  3WU0 A;  3DLA A;  1S72 I;  2BXY A;  2HKO A;  2L9V A;  4QDL A;  2Z5U A;  1Q0M A;  2Q2E A;  3BPX A;  4DJA A;  3CUQ A;  3ASN C;  1M56 C;  3FXQ A;  4M3D A;  3J06 A;  2BHY A;  2WVO A;  1T6U A;  1UMQ A;  1IV6 A;  3BZ6 A;  1X1P A;  4AWX B;  2UWM A;  3KP4 A;  3MFN A;  5DCM B;  5J1R A;  3SZR A;  4X1E A;  2FQ4 A;  5C4J J;  2VKE A;  2LNB A;  2VCB A;  4I99 C;  3PCV A;  2R7Q A;  4JTC B;  2PBI A;  3LSG A;  4KFC A;  1WSU A;  2WVN A;  4L5I A;  2YWA A;  2LOO A;  1SF8 A;  3ELK A;  3T0Y A;  3M9A A;  1T2K A;  4A3G J;  2PMU A;  4KNY A;  2YX7 A;  2EV6 A;  3ZMU A;  1R49 A;  1J2X A;  2F5D A;  3LES A;  1C0W A;  4N9I A;  3ESW B;  1A7D A;  3L1M A;  2BBY A;  3CDI A;  4E7K A;  4N0B A;  3V8K A;  2W84 A;  4AUX A;  2B0H A;  3VYW A;  1Q1V A;  2Z16 A;  4YT4 A;  1B9M A;  3OYI A;  2EZL A;  2EIN H;  4HW0 A;  3GXO A;  1MNE A;  1WJD A;  4ZYD A;  3Q7L A;  3V7C A;  3I3L A;  2QUF A;  2LF7 A;  2HFI A;  2KRF A;  4KNV A;  3TDZ C;  4EM2 A;  3Q7G A;  1E2X A;  2HUJ A;  3TQN A;  2W00 A;  4A0X A;  1A0B A;  4DW6 A;  1YAR O;  1A7E A;  3ROU A;  3A9C A;  2CDQ A;  1USS A;  3M8E A;  1LE2 A;  4XEF A;  5AGF A;  4ITV A;  2AHQ A;  3IRR A;  4EHP A;  4MVS A;  3GLL A;  1WKM A;  4BEH B;  4PK4 A;  4YFX F;  2VPR A;  4D4N A;  1YVI A;  1Q0G A;  4M73 A;  5JLI A;  2YS9 A;  4BDY A;  3C8Z A;  3ZMZ A;  4GGG A;  2RC4 A;  3D5L A;  3PSF A;  1BBY A;  2HU9 A;  2L9S A;  2ZXH A;  3K2A A;  4XOR A;  3WTW C;  1Z3I X;  3GEH A;  1Y0U A;  3ZN1 A;  1T0F A;  1Z21 A;  4IO9 F;  4I44 A;  4LOC A;  1HY5 A;  4NC3 A;  1S7E A;  4B8X A;  5F0C A;  2R7D A;  3HKZ N;  1UEL B;  4ZJZ A;  1ZTR A;  4J01 A;  4HDU A;  1EJ9 A;  3N05 A;  1X58 A;  2NVU B;  2FML A;  4LLC A;  2AWC A;  3CEX A;  4EBK A;  4U9D A;  3DAG A;  1Z6T A;  3V8J A;  1VQN I;  3L8J A;  3ABM H;  5TRD A;  2VJI A;  3QWL A;  3IL2 A;  1SD4 A;  1K78 A;  1ZRC A;  2KJG A;  3CMM A;  1W36 C;  4D9J A;  4M3B A;  3ZP5 A;  5GAD J;  3OYB A;  2XGC A;  4AIK A;  4KYW A;  1WWX A;  3DU5 A;  3WGG A;  1HST A;  3K1N A;  2X48 A;  4XSX F;  2A1D D;  4WAB A;  1D5V A;  4GYI A;  4KMU X;  2DT6 A;  3CUQ C;  2XAH A;  4MHG A;  1KU3 A;  3BC8 A;  1LPQ A;  2STW A;  1E0E A;  2W4B A;  3U5S A;  3FHZ A;  3MWM A;  1QQ3 A;  1W4M A;  3O39 A;  4RB3 C;  1VOM A;  2ECC A;  2IM8 A;  4A5N A;  3OYK A;  3UMK A;  1OW7 A;  2EIN C;  1L7C A;  4FIS A;  4CHU A;  1JKR C;  4DRI B;  1XGN A;  2LBF A;  3S1N J;  3B0P A;  3VM6 A;  1T98 A;  1SC7 A;  3B0U X;  1QNT A;  3AG2 H;  4LLN A;  1Z6A A;  3E6D A;  3ML6 A;  5HSW A;  2BEO A;  3CCS I;  1TT0 A;  2WVQ A;  4I98 B;  4QPO A;  3F47 A;  3DE8 A;  4YEJ A;  3UGP A;  3S3O A;  3ZG1 A;  1A04 A;  4CA0 A;  2DYS H;  4R8H A;  2R5Y A;  3ZQY A;  3Q5F A;  2YLI A;  3KP2 A;  2PJR B;  2R7R A;  1MNM C;  3T8T A;  2QKM B;  2OJQ A;  2BL2 A;  2CSO A;  2IPQ X;  2HV7 A;  3IKT A;  3GZN B;  3H3V K;  3RH3 A;  2L6G A;  3Q9V A;  3DPL C;  1ZQ3 P;  2XGE A;  3GZ5 A;  5HOO A;  4XRM A;  2HWV A;  2IA1 A;  3RQ4 A;  3WTX C;  5DS5 A;  2KIS A;  1ZZP A;  3FIS A;  1AOY A;  2XV4 S;  3KEO A;  2L7K A;  4IQ4 A;  3TQO A;  1JHF A;  1NU9 C;  4AE4 A;  4BE2 A;  5GAH J;  2O03 A;  1E3O C;  3JYH A;  4AL1 A;  2XL6 A;  4CIP A;  4BNC A;  3DI5 A;  4HF0 A;  2YPR A;  4BJT A;  1TQG A;  1E84 A;  3QP6 A;  2K85 A;  2OAZ A;  1ZG5 A;  3AOU A;  4AX2 A;  3P9C A;  3L2R A;  2YRF A;  1JT0 A;  3ZR8 X;  4G12 A;  1SVL A;  2DJN A;  2NXN B;  3MZY A;  5D6E A;  1VQM I;  3AQC A;  3QVY A;  5AIQ A;  3K66 A;  1LB2 A;  3SXK A;  3HNI A;  4KIF A;  1XCB A;  3L2U A;  2WY7 Q;  1YI2 I;  1T0F C;  3JZ0 A;  3DTI A;  4CO8 A;  1OIS A;  2IBD A;  3DM9 B;  4PFP A;  1JKQ C;  4E0I A;  5HVQ C;  3W8I A;  3DKX A;  4E7H A;  1C17 M;  2KFD A;  5J3L A;  1KU7 A;  3FOO A;  3O10 A;  2DMT A;  5LEJ A;  4AVZ A;  1R1V A;  1CPQ A;  5CI8 A;  4ZZL A;  2AO9 A;  2IBF A;  3U1K A;  2E19 A;  3ZQQ A;  3LSK A;  3CCQ I;  2DYS C;  4JX6 A;  3M1E A;  1L0O C;  5DEQ A;  1NK3 P;  1WI9 A;  4YFK F;  3EH1 A;  2K4J A;  2UUH A;  5JVG F;  5EGY A;  5B1B H;  5H6Q A;  4J7T A;  2HS5 A;  1QKR A;  3SXY A;  3RPU D;  3K7D A;  2TRT A;  2CU7 A;  4P9T A;  2QY9 A;  3JTL O;  4YG2 F;  4BQA A;  2LF8 A;  3MYF A;  3U9J A;  5ED4 A;  4L0Y B;  3MCZ A;  1Q1H A;  3ERE D;  3KMI A;  5FLX Z;  1DPR A;  5FKM A;  4ON0 A;  2RVC A;  3HRT A;  2P61 A;  2IW5 A;  1RUO A;  3WU2 C;  2DDB A;  2LP0 A;  2V9P A;  3OIQ A;  2XPU A;  3BTL A;  4IRI A;  2QSH X;  4MO7 A;  3BJA A;  3G50 A;  2RN7 A;  4RLF A;  2W4M A;  1FYL A;  1K04 A;  1BJZ A;  4XRF A;  5B1A C;  1Q0F A;  1V5F A;  3I5P A;  3GEZ A;  3TO9 A;  5BQI A;  3K4L A;  1QSP A;  1IN5 A;  2OCC H;  1BJA A;  3LSJ A;  4HF2 A;  4JW1 A;  3QYB A;  2OTJ I;  1X4P A;  4HF1 A;  3UKG A;  1FTS A;  1OXK A;  5KYY A;  2HJ3 A;  2IS1 A;  2HOA A;  1DDN A;  1BI2 A;  3GTP J;  2ISY A;  5CQG A;  4JE9 A;  5CI9 A;  1SD5 A;  2VKV A;  1BR2 A;  1LDD A;  2ZXI A;  1WZ2 A;  3X1O A;  3LAP A;  2FQ3 A;  2XIG A;  1Y39 A;  3FZV A;  1OCZ H;  1XMX A;  1MQV A;  2XRN A;  1TC3 C;  3FDQ A;  1WJC A;  3S93 A;  2HTJ A;  2VH3 A;  1JTX A;  4XEV A;  4JP0 A;  4GRI A;  4A2N B;  3BJO A;  3X2Q H;  5EZG A;  2H94 A;  2KSF A;  4FT8 A;  2XGX A;  3VPR A;  4EKW A;  1LKX A;  2PMH A;  2DA5 A;  1OKR A;  1LFP A;  2EFN A;  1AEP A;  2OA4 A;  1ETW A;  5CLS A;  1GXQ A;  3R61 A;  2UXX A;  1B72 A;  3GM3 A;  1O7F A;  5CQE A;  4QI0 A;  5J1Y A;  1VQ4 I;  1ZK8 A;  2R9R B;  2HNH A;  5CVI A;  3AAF A;  1K83 J;  1S7A A;  2ISZ A;  1POG A;  3FK7 A;  1LEA A;  2ZNZ A;  3IKV A;  1XDU A;  3QTH A;  3PSI A;  4C3B A;  4C2M J;  1FYM A;  4PGH A;  3MFK A;  5E8G A;  3C8G A;  2ELH A;  1IXC A;  3ZXS A;  5E17 F;  2KHM A;  2WY8 Q;  5IP6 A;  1MKM A;  4U7B A;  4IOA F;  2DBB A;  2KZV A;  3GTO J;  1ORY A;  4XPY A;  4JEB A;  1WAT A;  1PJR A;  2XLV A;  2WC2 A;  4HBL A;  4ESB A;  3K4C A;  3RQE A;  3QPS A;  4PSX A;  1SMY F;  1R4N B;  2EIL H;  1YA7 O;  3BLY A;  2GOM A;  2ESH A;  3GW2 A;  2CV1 A;  2XAG A;  1RC9 A;  1SYQ A;  1D8K A;  3CLO A;  3VYR B;  3FKI J;  4WGY A;  3IAM 2;  5HOD A;  1BI3 A;  2KDZ A;  2D45 A;  1Z63 A;  1VTM P;  2CFX A;  3EET A;  1U2W A;  2OCC C;  5F04 A;  1T39 A;  3BT9 A;  5T3W A;  5K5O A;  4ONS A;  2X85 A;  3SZT A;  1JGS A;  4EGY A;  4FAS D;  4A3E J;  4IEJ A;  2NNY A;  3M4B A;  2P6V A;  4AVP A;  4U5E E;  4RBN A;  2M64 A;  1XCV A;  4JX4 A;  1D1C A;  1APC A;  1WCM J;  4L5J A;  2AU5 A;  2HOE A;  1GVD A;  2YL1 A;  3BR1 A;  4LIV A;  1O3R A;  5ERI A;  2VBZ A;  2BE5 F;  4IRG A;  3OS1 A;  3QZC A;  1OW8 A;  1YIO A;  1M2V B;  1WAS A;  3BRJ A;  1QZX A;  2JZY A;  3EJN A;  4NTF A;  5KVR A;  3JSP A;  2VN2 A;  3MN2 A;  4ZYH A;  1QVU A;  3BR2 A;  2GIZ A;  2PMZ A;  5IOZ A;  3DBL B;  1SR2 A;  1V4R A;  3M15 A;  4MTO A;  2LKP A;  1O57 A;  1Z77 A;  3U3B A;  2EZH A;  3DKA A;  3EQL F;  4V2G A;  1DUX C;  1T6I A;  3T5X A;  9ANT A;  4GYG A;  4LDQ A;  2CH0 A;  1QZE A;  2L5Q A;  4Y7N J;  2DJI A;  1AKH B;  2OF7 A;  2ZJ2 A;  3K9T A;  4L9T A;  3KEQ A;  3I5U A;  2X1C A;  2RKH A;  2IYL D;  2K5C A;  2VI6 A;  2W9Y A;  3FM3 A;  2OEX A;  1G3T A;  4HRI A;  1QGP A;  4X6A J;  4U5F E;  2VQG A;  2X1D A;  5DCM A;  2A3S A;  5J1U A;  2R92 J;  3RKY A;  2FF4 A;  3BRO A;  3E7L A;  4E7I A;  1B68 A;  1B4A A;  1QLE C;  2H8W A;  3FXK A;  3TOL A;  1A31 A;  3AKZ A;  2Y0S N;  2R3S A;  2EIL C;  2HGC A;  1WTY A;  1GV2 A;  3MVP A;  2YKZ A;  2LD5 A;  3CTA A;  1MZB A;  1MND A;  2OU2 A;  1ACI A;  4G8X A;  5GPC A;  1X19 A;  3GTQ J;  1U0J A;  2ZXR A;  3E0J B;  5FKN A;  4AIJ A;  2DXI A;  4XLF A;  4CCL A;  1BR1 A;  2ZME B;  4Q4Z F;  3EH2 A;  4M6X A;  3NMJ A;  5EHH A;  1G5Z A;  2B63 J;  1KYW A;  2PEX A;  3HOX J;  5LLQ A;  1DGW Y;  2ECB A;  2VOD A;  2OEV A;  3TBI A;  3FXH A;  3G2B A;  1D0X A;  4HEA J;  2UUI A;  5D92 A;  3U8P A;  1I50 J;  3S14 J;  2PNO A;  4HFF B;  2FE3 A;  3JRM O;  1Y4C A;  1NLX A;  2GWW A;  2E34 A;  1A41 A;  2JD3 A;  2IGN A;  5D4R A;  4RB2 C;  3DTK A;  1JRA A;  4D0P A;  1KNY A;  4C3E A;  1TTY A;  2X0L A;  3CMY A;  2GAU A;  5J8C A;  4M3F A;  1GUU A;  2MH9 A;  4EV0 A;  3GYH X;  4E4H A;  1U3E M;  1RKC A;  3IH2 A;  4BEH A;  3L8I A;  4BGD A;  5L3C A;  1Z67 A;  2CS3 A;  2OQG A;  3LNM B;  4KBL A;  2K40 A;  2IXO A;  4JUR I;  4BHC A;  4ESJ A;  3QW1 A;  4NHJ A;  2EJR A;  4A2U A;  2E71 A;  1IZ1 A;  1PVE A;  4JTD B;  2TMV P;  3AJM A;  1G3S A;  2CUZ A;  2XM0 A;  1V5G A;  4BBR J;  2A6H F;  1E3P A;  1IGN A;  1OKK D;  4CYC B;  2CW7 A;  4LGW A;  1JOG A;  4G6D A;  1R4M B;  2V4J C;  2CMP A;  4LB6 B;  4DYC A;  5D6F A;  1FP1 D;  5D5U B;  1LQ1 A;  2E2J J;  2NRA C;  1GS9 A;  3ZQV A;  4XR6 A;  5AC4 A;  2L4M A;  4WX9 A;  3I5Q A;  2MGQ A;  5LGN A;  1ZYR F;  1GT0 C;  1ZG3 A;  4XTK A;  5GP9 A;  4XID A;  3BG7 A;  2JUG A;  3CDL A;  1HQC A;  4IB4 A;  3ZOB A;  4QTR A;  4C7O B;  2IGK A;  1L3L A;  1FYK A;  2IS6 A;  1YFH A;  2H7O A;  3GTL J;  3IUO A;  4M6V A;  4AE4 B;  5HDK A;  1V74 B;  2F48 A;  4M3G A;  2QWW A;  2ZXW C;  3KH2 A;  4DBR A;  4ZZD A;  1FEX A;  1AVO B;  3K70 C;  3AG3 H;  4FE7 A;  4Q7C A;  3OMY A;  4O3M A;  3GX4 X;  1IJW C;  3BR5 A;  1D1A A;  4M71 A;  3FXU A;  2HFH A;  2EIJ H;  1JT6 A;  3V7S A;  3JRF A;  4UVA A;  5JLW A;  4JKV A;  2PX3 A;  4L9V A;  4DZP A;  1JUS A;  1Z0X A;  1SFK A;  2E36 A;  2O8X A;  2R7O A;  3EGX B;  4EUK B;  3WU1 B;  1ZRE A;  4MVU A;  3OYE A;  2M7A A;  2LY9 A;  5HS7 A;  4PJL A;  3RQG A;  4WCG A;  4I0B A;  4G6Q A;  4HX7 A;  2PJR A;  4OIP F;  3LA2 A;  3W6J B;  2DK8 A;  4A3L J;  1YJW I;  1ZG1 A;  2FGY A;  2L2O A;  1GLN A;  4BJ5 A;  3TW7 A;  5EGO B;  3HNK A;  2MFZ A;  3QVZ A;  3ZSU A;  4BYY A;  1RJ9 B;  1J9I A;  4P9U A;  2X6O A;  5JSL A;  1TWF J;  2XAF A;  2Y75 A;  4LK1 F;  2VAS A;  2DGJ A;  2Z15 A;  2GA0 A;  2IA2 A;  4LLG F;  1FIP A;  3HEF A;  4RMN A;  4IHT A;  4BE1 A;  2G7H A;  2DFF A;  2KL4 A;  2LH9 A;  2M87 A;  5M5X J;  2GOX B;  2J9V A;  4I02 A;  3RSN A;  1UAA A;  4B47 A;  5EF6 A;  2I8B A;  4ESF A;  4ZDP A;  4YIR X;  2KPM A;  3GBG A;  5DCF A;  5AC5 A;  5K0I A;  2Q9A A;  4WXH A;  4FES A;  2BW3 B;  4HV5 A;  2OQR A;  2OCE A;  3BR6 A;  4M9Z A;  2D5R B;  2XLH A;  4Z9I A;  1YRN B;  1YLM A;  1LFB A;  5D8K B;  2L0K A;  3HKK A;  2LY2 A;  3CF2 A;  3CLQ A;  3W6V A;  2V1D A;  1TWC J;  4Y15 A;  2H8A A;  2R7T A;  1YG2 A;  2Z33 A;  1D5Y A;  4ZLC A;  3H0G J;  3GOD A;  3OSG A;  2YLD A;  3ABL H;  2X1E A;  2VJJ A;  4IZZ A;  3C63 A;  3LQQ A;  2DU9 A;  4I3M A;  1LIH A;  3P9I A;  4KIC A;  3KLN A;  4I6Z A;  1LVA A;  1I4Y A;  5IYB J;  1ZHT A;  1KYZ A;  3AG3 C;  2KDO A;  2CFO A;  2K86 A;  2DT7 B;  2L7F P;  3DEU A;  4BXX J;  3WGH A;  2BZT A;  3DKW A;  2EIJ C;  2KRC A;  2OJE D;  3JRD A;  3HC7 A;  3K0L A;  4LB5 A;  4J7Y A;  1JE8 A;  5F28 E;  2KJB A;  3CES A;  1HSJ A;  1ZAO A;  2E5Z A;  3GWZ A;  1YHQ I;  2O9L A;  4LLE A;  1GDT A;  2AP3 A;  5IP7 J;  1KQ9 A;  5D8L B;  3HOY J;  2XS1 A;  3TGN A;  3HHH A;  4FX0 A;  1FFH A;  3GTJ J;  2JPU A;  4A0Z A;  1E85 A;  3DAF A;  2W1O A;  1R22 A;  4EEF G;  2X0C A;  1O87 A;  2KIF A;  3K4M A;  2NOJ B;  4XK4 A;  3JRI A;  1X4O A;  1XGM A;  2YUS A;  1MGT A;  1EF4 A;  2BGC A;  3OYG A;  1AHD P;  1T9K A;  4G0H A;  3BQZ A;  2PMZ N;  1HC8 A;  1I5N A;  4O6N A;  3WHB A;  2UXN A;  3BCA A;  3GTM J;  1R6R A;  1LJ9 A;  1UB9 A;  5DDG A;  3GM1 A;  3ZTM A;  1RR7 A;  1VQP I;  3OR1 C;  2J5P A;  1JUM A;  2EZK A;  2I10 A;  3AL0 B;  3QYE A;  1ORJ A;  3TJ5 A;  1DOV A;  1NHA A;  1TFO B;  5IT9 Z;  4MNU A;  3MBG A;  1GV5 A;  4BHP A;  2CG4 A;  2KZG A;  2VJ5 A;  5A6K A;  3QPL A;  3CSK A;  4F3Q A;  3KYD B;  3OL4 A;  1UJ8 A;  2IGM A;  4MW8 A;  1ZR2 A;  3ABL C;  1FSE A;  2EBI A;  4BQN A;  2QUP A;  3VYU B;  3D1N I;  3J80 K;  4P96 A;  5JT4 A;  3LAJ A;  2E7W A;  4EJW A;  4PZJ A;  4DNC A;  4OIQ F;  1KZH A;  2HKV A;  5A6B D;  3MEX A;  1IDY A;  2V26 A;  5HS9 A;  4XKB A;  3CAX A;  2MD5 A;  2K7L A;  4BHB A;  2IXP A;  1V5E A;  3JRH A;  3C3W A;  4E17 A;  2JA8 J;  1QZZ A;  3V5X A;  1TKN A;  3I54 A;  3K33 A;  3WG9 A;  4U7D A;  2CYD A;  3TK0 A;  4K0D A;  2COM A;  3U1D A;  4HQM A;  2HQR A;  4D1Q A;  3FXL A;  2HI3 A;  3BG9 A;  4YIF A;  5L3B A;  2HMZ A;  5GTH C;  3OEO A;  2PN6 A;  4FTH A;  3H5A A;  2H09 A;  3DJU B;  4ASN A;  2E1N A;  2K3P A;  2CUJ A;  2LIG A;  2DCE A;  2XLE A;  5JI6 A;  4C2T A;  1ZEL A;  3K1M A;  2XAQ A;  1Y8R B;  4IRU A;  3PHF 2;  4RB0 A;  5CVV A;  5KAF C;  5DV5 A;  1Q0D A;  2MW8 A;  3CZ6 A;  3LLK A;  1MBF A;  5J4Y A;  2R7U A;  3ABK H;  4WXC A;  3GCM A;  1FOW A;  3N24 A;  4Z9J A;  5FJ8 J;  2NNN A;  1FOY A;  3TOB A;  5IP9 J;  3MKY B;  4AM3 A;  3DCF A;  2DYR H;  3BTJ A;  4BAY A;  5H20 A;  2GDC A;  3Q3S A;  1VQK I;  5FLX K;  3LAY A;  256B A;  4ZLD A;  4KIS A;  2IP2 A;  2HDW A;  1MDM B;  1TWC A;  3D5R C;  3TL4 X;  3H65 A;  1ZU5 A;  3NWT A;  3H9J A;  4ZTF A;  2P7C B;  5IYD J;  5AIP A;  4DBQ A;  1G59 A;  4MVM A;  3A02 A;  5F5H A;  4P5O A;  4CX9 A;  1MH3 A;  2CUE A;  2L7Z A;  2V1N A;  1BIA A;  2EFO A;  3AGU A;  4XN0 A;  3SYT A;  1OQY A;  1FJL A;  2EPN A;  3EHN A;  1X3Z B;  1WH7 A;  1F9N A;  2VT3 A;  2P4W A;  4OU0 A;  1M2V A;  2MHR A;  3HJE A;  3E6B A;  3QOP A;  5DVW A;  5J4V A;  2VQC A;  3GVA A;  2KLO A;  1RZ4 A;  3LWF A;  1W5T A;  3DWW A;  3M4C A;  2OV7 A;  3MMY B;  2NSF A;  3NG1 A;  1K4S A;  3QP5 A;  1QA6 A;  1IRZ A;  3MKZ A;  5FGM A;  2XF7 A;  1TWH J;  1XC5 A;  1FTT A;  4YT2 A;  1TZL A;  4YEL A;  3GTK J;  1Z7Q c;  5FCL A;  4HNT A;  2VT2 A;  5HDG A;  2MC3 A;  4WWC A;  4RBO A;  1AKH A;  1LEB A;  2XRH A;  2LKS A;  1B9N A;  1RKT A;  1LE4 A;  4OD4 A;  5LGT A;  3ZN0 A;  3DPU A;  4XPW A;  1XS9 A;  5E3N A;  1G4W R;  1KTM A;  2Q4F A;  2EK5 A;  1BM9 A;  1JPN A;  2CWE A;  1RI7 A;  4FX4 A;  1YZC A;  4NC6 A;  4UUT A;  3F46 A;  1XDS A;  3HTK C;  5FB2 A;  3BEH A;  2J7P D;  2P6S A;  3QYF A;  3KX2 A;  3WHN A;  2XL4 A;  2YX4 A;  3I4P A;  2VLA A;  3JSZ A;  5E3L A;  2CW8 A;  3ABK C;  3DTE A;  3U2R A;  2QSF X;  1LNW A;  4BUP A;  4WJ0 A;  4HLX A;  5E79 C;  4HDV A;  2FJ1 A;  2RAE A;  3K1H A;  5FFZ A;  4RLQ A;  2R0Q C;  2DYR C;  3R4K A;  1ZRD A;  1TLH B;  1QPI A;  1RKE B;  1FX7 A;  1N78 A;  3UMH A;  2HQA A;  4DQ2 A;  2EIM H;  1U89 A;  3MX3 A;  2ZME A;  4G6T B;  4K1O A;  2YLG A;  3AQB A;  4MVZ A;  4P9F A;  4A0Y A;  1ORS C;  1VI0 A;  3DEW A;  3BR3 A;  2VPL A;  3WTY C;  2HYF A;  3BWG A;  1IN6 A;  5ICF A;  4P55 A;  1NG7 A;  2H6C A;  1YJG A;  4P6I C;  1F4K A;  3CMA I;  4LDK A;  3GUD A;  1YTY A;  1FWZ A;  3S2W A;  2FU4 A;  3L7W A;  1DU6 A;  4FHT A;  2F5C A;  3H2U A;  2KRH A;  2OD5 A;  1MMG A;  2RRE A;  3TO6 A;  4G7Z F;  3SFZ A;  5A2Q Z;  2C6Y A;  3SYN A;  1J7K A;  1HE1 A;  1MBJ A;  1RIO H;  2H27 A;  3CCY A;  3B73 A;  2XB5 A;  5C44 J;  3SHF A;  2M1B A;  3FOP A;  2A5Y B;  1TL8 A;  3JRB A;  2MD0 A;  3GFJ A;  4ZTJ A;  2GM4 A;  3W3C A;  4EQQ A;  1K05 A;  1Z91 A;  2M8E A;  5K7H A;  2GLO A;  2DB4 A;  1I27 A;  1VQ5 I;  2XLW A;  2IEK A;  1FC3 A;  1EI7 A;  4D5F A;  3ZC4 A;  3OYN A;  2ZJR F;  5FLV A;  1TT5 B;  4C9Y A;  2LD6 A;  3SXZ A;  2HPI A;  4CYC A;  3VOD A;  2DOA A;  2HYJ A;  2B7E A;  2LKX A;  3JW4 A;  2IGO A;  1RCP A;  1H0M A;  4O7G A;  5DS6 A;  2EFW A;  5E1X A;  2VKD A;  3GEE A;  5BPI A;  3HYI A;  3KLO A;  3J81 Z;  4IX7 A;  1G3Y A;  3CDH A;  2F5E A;  2WAF A;  2DMU A;  1VQ9 I;  4L9J A;  1U8R A;  1K4T A;  3R7C A;  1Y0N A;  4KN7 X;  4EJO A;  2HXO A;  4MGR A;  4ZYA A;  2O6G E;  3CD6 I;  2YL0 A;  4KIT B;  1OCT C;  2VQL A;  4ZDO A;  3T4R A;  3F8B A;  4KI2 A;  3N2Z B;  4IPA A;  2FMY A;  2Y69 H;  2W85 A;  4C7O A;  3GFL A;  4YII A;  3SEZ A;  4DYQ A;  1QU3 A;  1HOM A;  1D8J A;  3VYT B;  2BY0 A;  1OKK A;  4Y33 A;  1ETX A;  1YX5 A;  3F8M A;  1NFN A;  1AA7 A;  3E3V A;  3IHU A;  3W2V A;  3FXM A;  2BVL A;  2XKP A;  3GME A;  2XRO A;  2PJP A;  2G62 A;  4MVQ A;  1R23 A;  2Y31 A;  5CKT A;  3DV8 A;  1BBH A;  4H4K C;  1R1T A;  2M2E A;  2Z99 A;  4BDZ A;  1J75 A;  2AS5 F;  4M63 A;  2XF5 A;  2DA6 A;  2XRL A;  1RNL A;  4ANJ A;  4UUS A;  1NTC A;  5B5E C;  1BR4 A;  1SD6 A;  2X6Y A;  4E7Z A;  3KYC B;  3J80 Z;  1JJ8 C;  2OTL I;  1BW5 A;  3ZMD A;  2A0U A;  3EGD B;  4EBB A;  1REP C;  2OZ6 A;  1QVT A;  1RXQ A;  1FMW A;  3EGX A;  4Q47 A;  4RM3 A;  2BOL A;  2NVT J;  3WTU C;  5E3A A;  5IPA A;  5KYU B;  1S7O A;  1VLT A;  3QOD A;  4EBJ A;  1WJF A;  3RF3 A;  4CS9 A;  2IXS A;  2V7F A;  3MKL A;  1I3A A;  1X3W B;  3E6C C;  2DA7 A;  5CVR A;  5BQH A;  1TWH A;  5C3E J;  2MH2 A;  2CQX A;  3FIW A;  1YW8 A;  2ZME C;  2P0N A;  2ZO4 A;  1JTY A;  2D1V A;  2X6X A;  3WE2 A;  5EGO A;  2M4E A;  2MC4 A;  3UNG C;  2LMD A;  4D7M A;  1RJ9 A;  3AG2 C;  2K9Q A;  1ZLJ A;  3Q0W A;  5DD4 A;  3SDG A;  3S84 A;  3P7N A;  1QPM A;  3FAJ A;  1OCO H;  1ONV A;  3S2D J;  3QMK A;  2WB1 A;  4FX5 A;  5L0I A;  3HG9 A;  4NNJ A;  4MTD A;  3N4M A;  1R5G A;  3K4J A;  1YJN I;  3H9Q A;  5FO5 A;  4U9E A;  3W8H A;  1RR8 C;  1ON1 A;  3ZWI A;  4PCQ A;  2WZL A;  1WGX A;  2E2H J;  4NUB A;  2E2I J;  4M9S A;  5BMZ A;  2BW3 A;  5GPG B;  1HMD A;  3CP8 A;  4MEY F;  3JCU Q;  1YRN A;  2F4I A;  2Y0M A;  4KN4 X;  2M0M A;  2WWY A;  2KIM A;  2YL7 A;  3CO7 C;  1XG1 A;  1JKP C;  3C62 A;  4HEA 2;  1OR7 A;  3M1C B;  2Y69 C;  1NG6 A;  4HST A;  1XSX A;  1QQI A;  3RQI A;  3F21 A;  1IO2 A;  2Q9B A;  3ZVR A;  3CC7 I;  3B29 A;  1S7Z A;  3ZQG A;  3S1Q J;  4J30 B;  2EZI A;  1AUE A;  3RVY A;  5BPD A;  1P4W A;  1H9G A;  4PJ0 C;  1ZR4 A;  2QLA A;  2KJC A;  1FLI A;  3JR9 A;  1U5T B;  3GOR A;  2Y3G A;  2Q7R A;  5DM7 F;  1ZH5 A;  1J09 A;  1KON A;  1PP8 F;  1R4T A;  1MW7 A;  3SDB A;  3M79 A;  1HKT A;  4L0Z B;  1ST6 A;  3L00 A;  5IOY A;  5LFA A;  1T6Q A;  2Q0O A;  3J7A O;  2JX0 A;  4OIR F;  2OU6 A;  3NYL A;  2FA5 A;  4XNF A;  2NVY J;  2CUF A;  4LIU A;  3WE3 A;  4OMY A;  3FXR A;  1EH8 A;  3PO3 J;  4DRH B;  3ISP A;  5LHG A;  4ZDL A;  2JA5 J;  4I7H A;  3EUA A;  1EH6 A;  2EPO A;  4RGS A;  1YYV A;  5FKK A;  5BNG A;  3LJB A;  5TJJ A;  1E3H A;  5F0F A;  4EJU A;  1G8X A;  2PF4 E;  3FM5 A;  1S6L A;  3RDI A;  2K02 A;  4OAY A;  2M34 A;  1K40 A;  1WPK A;  3EPV A;  3DPT A;  3K2Z A;  2VJ4 A;  2LFF A;  4L9N A;  4YL0 A;  1SD7 A;  2K27 A;  2HEO A;  1I1G A;  1WI3 A;  3F8F A;  3C2G A;  3I59 B;  1P2F A;  5BQG A;  5HLI A;  3HNL A;  1GHC A;  2JT1 A;  2XXA B;  1P7I A;  1IG7 A;  3M8J A;  4Z9H A;  4XKC A;  5E20 A;  5B1B C;  2VIX A;  1T5O A;  2YEV A;  4YJW A;  3H0D A;  4CS9 C;  4GDF A;  4JQF A;  3GF2 A;  2X51 A;  2LK4 A;  3GM2 A;  3F6O A;  4PR9 A;  3LFU A;  1XMK A;  4U5D E;  3OYF A;  3BPV A;  1YA9 A;  3WG7 H;  1LDK B;  3AG1 H;  1W36 D;  5JHU A;  3NKD A;  4II3 A;  2V1U A;  3IPM O;  1I4Z A;  4WXD A;  2J45 A;  3JTH A;  2CQK A;  4ENK A;  1B8I B;  3AFH A;  4UVB A;  2ZKZ A;  4OD5 A;  2OC6 A;  3BZK A;  1M57 C;  3WOD F;  4IF4 A;  1VB5 A;  2NUT B;  4XLC A;  4PJN A;  5GPA A;  2O0Y A;  2JA2 A;  4A3I J;  1ZGW A;  3HRS A;  2WL8 A;  3ZDL A;  3KE2 A;  3FVY A;  2ADU A;  1R36 A;  1BZ4 A;  5ILS A;  2GA2 A;  5KHD A;  1E17 A;  1EKY A;  3H36 A;  3FF5 A;  2Z1D A;  4UV8 A;  2BHZ A;  3JSO A;  4XWJ A;  2MAB A;  1VQL I;  3FAP B;  5EEH A;  4CCK A;  1OR7 C;  4MTE A;  1IDZ A;  3NAU A;  2BY3 A;  2HZD A;  3N0T A;  2ZXP A;  3PFY A;  4NB5 A;  4A3F J;  4CUG A;  3TW6 A;  2Z9O A;  1OCZ C;  4N6H A;  3IH3 A;  3EG9 B;  4CXF A;  5BQT A;  3D5S C;  2YU3 A;  4HV6 A;  3JAM Z;  1KQ8 A;  1OCR H;  2DMN A;  2XAJ A;  4AYB A;  4A3M J;  1K6O A;  2MLG A;  2H7B A;  1YIT I;  4PFO A;  4X0R A;  3X2Q C;  2R7W A;  2EPF A;  5JLX A;  4RAF A;  3OYA A;  2WAE A;  5DLJ A;  2TCT A;  4PJJ A;  3MZH A;  4BJ6 A;  2HKX A;  3M8F A;  1Z3X A;  3I53 A;  4XN3 A;  3ABM C;  1UZC A;  3LSR A;  4XQF A;  3RYL A;  1MJB A;  2V9K A;  4WK8 F;  2LRD A;  4X0G A;  4F4B A;  1BOA A;  2EIK H;  2F2E A;  2I8D A;  2L01 A;  2RV8 A;  4PSW A;  2E87 A;  3MYI A;  1V55 H;  3SEO A;  5E8I A;  5DTD A;  4BJ1 A;  4U0V A;  3AG4 H;  3L09 A;  3K6B A;  2ZBK A;  1FZP B;  2NS8 A;  5ILU A;  4Y52 J;  2R4G A;  3RVZ A;  1MDM A;  2ACJ A;  3H9G A;  1M1E B;  4Z2Y A;  2HVR A;  4JX5 A;  3WG7 C;  3AG1 C;  2EQR A;  5FKO A;  2B0J A;  3ASO H;  1FNN A;  2WBM A;  1S5L C;  3W4Y A;  2JK3 A;  4U0W A;  4IQJ A;  1UHW A;  4A3B J;  2Y3H A;  4MFD A;  3JYY A;  4UNO A;  1JUP A;  4XRS G;  1ODD A;  4UUV A;  1ZW2 A;  5IT9 K;  3EZH A;  2XPW A;  3HGY A;  3ZQC A;  4IHW A;  3I4M J;  3IRQ A;  1Z7U A;  3GLX A;  1ETV A;  1OYW A;  3AL0 C;  2J9U A;  2IRF G;  3CCV I;  1WHU A;  2A6E F;  2NOG A;  3H5R A;  2Q9C A;  4BU2 A;  2JVH A;  3FKJ A;  4KT5 C;  1NZE A;  1A6Q A;  4NCQ A;  1O3U A;  2FNA A;  3H2V A;  3J7Z I;  1SFU A;  1NK2 P;  2XUB A;  1I6X A;  3VYS B;  4CDA A;  3N97 A;  2QGU A;  1W0U A;  2JMW A;  3MKW B;  1HXD A;  4CIC A;  1P4A A;  2AXL A;  5E18 F;  1LFU P;  3TJ6 A;  4ABZ A;  3HSF A;  2DQL A;  1VMA A;  3DBH B;  2DMQ A;  2FNP A;  2L81 A;  2R05 A;  4U5H A;  3VRC A;  2GFH A;  4W8P A;  2YHS A;  4O6M A;  1XWJ A;  3HHG A;  3OYJ A;  2ZFU A;  3CF5 F;  3PIO F;  3B0V C;  2BC5 A;  1YLF A;  4FE4 A;  2QBY B;  4NBQ A;  3ZPL A;  1VQO I;  2KP6 A;  4BS9 A;  2W82 A;  3I4N J;  3ONQ A;  3CME I;  4QSH A;  2E1C A;  2Z3Y A;  4HPQ A;  4IJJ A;  3R2P A;  4JC7 A;  4C3D A;  1H6G A;  3O55 A;  1C03 A;  2EV0 A;  1JMW A;  2KQ9 A;  5EK0 A;  3ZGK A;  5HLH A;  3I71 A;  2EIK C;  1ZHX A;  1SEU A;  3HTU A;  1V55 C;  2E1O A;  1PUF B;  5L0D A;  3AG4 C;  2ID3 A;  3VOE A;  1RKE A;  2BY1 A;  4LAC B;  4XLH A;  2WB1 N;  1IN8 A;  1EH7 A;  2IJL A;  4CBE A;  3V7R A;  2M5W A;  4JVS A;  5KYX B;  1K61 A;  3I55 I;  1HMO A;  3OYC A;  3ASO C;  1WRJ A;  3PQK A;  2HYG D;  1B59 A;  1SAX A;  4WF2 A;  1O3S A;  4BJ6 C;  1TW3 A;  3OYL A;  1RES A;  2XDV A;  1BIB A;  3WGI A;  2LP4 A;  3C7J A;  5JFR A;  4NY3 A;  1ETO A;  4E0H A;  2HQN A;  2X9D A;  2GQQ A;  2X4H A;  5EG0 B;  5LD2 C;  1F1M A;  2DT5 A;  5E3C A;  1U6H A;  4DXW A;  2MG4 A;  2PFB A;  1JI8 A;  3HOW J;  4JRZ A;  1VFC A;  5L0H A;  2YU9 J;  4OOI A;  1EA8 A;  3A0B C;  4FCY A;  4UUS B;  1RUN A;  4R32 A;  3TD7 A;  5F6F A;  1Y8Q B;  3U3F A;  4MFE A;  2CCY A;  2A61 A;  1XMA A;  1NBB A;  2YVK A;  2LCH A;  3BP8 A;  3RI4 A;  1YIJ I;  4L18 B;  2JUC A;  4BXU A;  2LQG A;  5E1W A;  2D5V A;  1VLS A;  3IQ5 A;  3TP3 A;  2L4A A;  3CCE I;  1HCR A;  3W2A A;  3KKB A;  4KUM A;  1MMA A;  2LSE A;  3KFW X;  1U0B B;  2V6C A;  1I1S A;  1X2M A;  2XPV A;  1F43 A;  4F52 A;  3CQZ J;  5IYC J;  2AWY A;  2LYC A;  1I3Q J;  4BG0 A;  3ECS A;  4AD9 A;  3QQA A;  3F8C A;  2G0E A;  2VXD A;  1SZI A;  2YZS A;  1HA8 A;  3ZQF A;  2LRE A;  5DYM A;  2VE9 A;  1UHM A;  2M0C A;  5K7F A;  3US6 A;  2G9W A;  4GO1 A;  4JJG A;  2OPT A;  2W4S A;  1DGR M;  4C3J J;  4XIC A;  3EHM A;  3G73 A;  3KPH A;  1MSF C;  4AU7 A;  3OS0 A;  3EGD A;  3RW0 A;  1SAN A;  3A03 A;  4CJG A;  4IJA A;  4EM1 A;  1LVK A;  2JA6 J;  4CCM A;  2EWN A;  3O8G A;  4B4C A;  1L3P A;  2QQB A;  3LMM A;  4IGG A;  3H5N A;  2CJJ A;  4S04 A;  2VON A;  5KYU A;  4E70 A;  3HKZ A;  2PI0 A;  4MW3 A;  4B48 A;  2IAI A;  4IXA A;  2FOK A;  1PV3 A;  4QPQ A;  3OOU A;  4BQO A;  2KKO A;  3V42 A;  3QU6 A;  2XLD A;  1NU7 D;  2ZSI B;  2ASR A;  2CGE A;  1V3F A;  4Q48 A;  4HOB A;  3WTS C;  1QHG A;  4K7B A;  2VUM J;  1YW7 A;  2QVO A;  3RZO J;  5JUA A;  2L9R A;  5A2Q K;  5A6J A;  3HSE A;  1YQA A;  3L9F A;  1AWC A;  1KU9 A;  1JPJ A;  1HDD C;  5ICE A;  4KT6 A;  5H2F C;  2J0W A;  3GEI A;  1RET A;  2GXA A;  4EAT A;  1LE8 B;  2Q8K A;  1D1B A;  5FKL A;  3M4O J;  4BEJ A;  1Y6D A;  4RDU A;  2EA2 A;  2LY1 A;  3VB2 A;  1HBX G;  5HV9 A;  4DZJ A;  1QPU A;  3IEE A;  3M7G A;  4EJV A;  1VF9 A;  5HLG A;  4DVY P;  3M1C A;  4YL1 A;  3PJR A;  4CDG A;  4Z6Y A;  2CRG A;  4BL0 B;  3TOA A;  1TQP A;  3HRU A;  4TV7 A;  5CVU A;  3J81 K;  3A4C A;  2VBY A;  4AYB N;  2R7Z J;  3A11 A;  3KZY A;  4CIH A;  3I64 A;  2EB7 A;  2R7F A;  2EH3 A;  4B43 A;  3DU6 A;  4ULV A;  1MMN A;  4PDK A;  3G4S I;  1MH4 A;  3NQO A;  1U5T A;  3JTG A;  5FFX A;  1ZLK A;  4LFU A;  2Y3B A;  2GIV A;  2NPU A;  4BY7 J;  1VZ0 A;  4M72 A;  2LTP A;  2NS0 A;  4IVN A;  5LEK A;  3WHC A;  4IKF A;  1IW7 F;  3RPU A;  3KZZ A;  1H89 C;  3Q9S A;  4XSZ F;  3C8G D;  3CC4 I;  5L3G A;  3E5Q A;  2W25 A;  2L3D A;  4I76 A;  3VSL A;  1WQ2 A;  4NQW B;  2IVM A;  2G7U A;  2L54 A;  2YL3 A;  2BYV E;  2QZ8 A;  2HVS A;  3DMD A;  3LEO A;  3H92 A;  4XOT A;  2G3K A;  2DI3 A;  1KU2 A;  3PFI A;  4BKX A;  4NTB A;  1ULY A;  3DZA A;  3KP7 A;  5HS8 A;  1PUE E;  3ATP A;  2M3A A;  2QE9 A;  3ASN H;  5EEG A;  2WB7 A;  1OFC X;  3O6B B;  1R1U A;  2R93 J;  5A6A A;  4UB6 C;  1FP2 A;  4JTA B;  4WGZ A;  4Y17 A;  2IOQ A;  1IN4 A;  1Y1V J;  2QEN A;  1XSV A;  2H1L A;  5LHI A;  4A3K J;  2EPM X;  2J9B A;  3Q0U A;  4XBF A;  3KYJ A;  3LS1 A;  3I59 A;  1S05 A;  2QNL A;  1R00 A;  4N6C A;  4NDL A;  3COA C;  2STT A;  3S3N A;  4UV9 A;  2XF6 A;  2KIU A;  3CCJ I;  2GXB A;  1ZW3 A;  1E83 A;  3BG6 A;  2XXA A;  1EKE A;  3A01 A;  4LG3 A;  1HDP A;  2H1K A;  2DA4 A;  5COG A;  1BI1 A;  3DF8 A;  1N25 A;  3IC7 A;  3S1R J;  4UDV A;  2ZB9 A;  1FY7 A;  2DN0 A;  5F1R A;  1MBE A;  3ULQ B;  1XGO A;  2DFI A;  4XL9 A;  5L3F A;  5EYR A;  1P9Q C;  1JJ6 C;  3S16 J;  3G1L A;  2DOF A;  3CQZ A;  2KIQ A;  2FRH A;  3CP2 A;  5LBQ A;  1CF7 B;  4CYD A;  5F64 A;  1WOL A;  3RZD J;  2LDU A;  4OWR B;  2Y9Z A;  3DJN B;  5D4S A;  1B8I A;  2FOW A;  2F4O B;  1M2O A;  5FD5 A;  1V4A A;  5M3M J;  3W6K B;  1SFE A;  2EA4 A;  4DJ9 A;  2NUT A;  2JVG A;  1KGS A;  4A5M A;  2L02 A;  3UR3 C;  1IRG A;  1WJA A;  1A7V A;  3RIP A;  1TWG J;  3BG3 A;  3BOQ A;  4HNU A;  2I15 A;  1UST A;  2XHK A;  3H1C A;  3J7Y J;  3QU3 A;  4AID A;  5D91 A;  3BR0 A;  1FAP B;  1BDJ B;  3CUO A;  5KAI C;  1G4D A;  2DO7 A;  5CJ9 A;  1YE9 A;  3H35 A;  1ZVZ A;  4KC9 A;  3JRG A;  3GAN A;  3DP7 A;  4LDR A;  3RKX A;  3G4X A;  4BH9 A;  3S2H J;  1TR2 A;  4ER9 A;  4UY8 I;  4G9Y A;  2DFE A;  5HNH A;  4R79 A;  1NH3 A;  2ZSH B;  2LLK A;  3EG9 A;  3L2Q A;  2XAS A;  1AU7 A;  1GGQ A;  3NYJ A;  4A93 J;  4YFN F;  1U5T C;  1U9N A;  1ZGJ A;  3PL8 A;  4IHY A;  2JPB A;  2VKH A;  1NSG B;  1YDI A;  4E7L A;  4U5B E;  1B1B A;  4XLA A;  4D4X A;  3V5Y A;  2HDC A;  2DFH A;  3ABT A;  4HSR A;  4EJT A;  1FBU A;  2DW4 A;  3TMO A;  5D5W B;  1IRF A;  3HOV J;  2R7X A;  2HZT A;  4NC8 A;  1J8M F;  3ZMS A;  1TQM A;  2O8K A;  3QOE A;  3HLZ A;  2RGV A;  1SFX A;  5F1J A;  2HR3 A;  3HXL A;  1FBS A;  4MVO A;  1FFT C;  1RKW A;  2O9X A;  3KYI A;  3FMQ A;  4LG0 B;  3T1B A;  2LVS A;  5LRS A;  1ERD A;  3BTI A;  3ZMV A;  2XL8 A;  4PJM A;  1F5T A;  3I9V 2;  4EM0 B;  2Y2Z A;  2ZJQ F;  2CV0 A;  4QIW N;  2UZK A;  5J47 A;  2ZXJ A;  1LM3 B;  1RPW A;  4H54 A;  5TJ5 E;  2RSE B;  5F08 A;  1HW1 A;  2AXT C;  4CH7 A;  5LGU A;  1SMT A;  2HDD A;  1KA8 A;  5E2Q A;  5HNF A;  3LA7 A;  3DD7 A;  1W2W A;  2Q1Z B;  3A0H C;  2NUP B;  1VTN C;  3BJ6 A;  5D5X B;  3OSF A;  1MMS A;  3I4U A;  4JCZ A;  2ZPA A;  1N75 A;  4RA2 A;  5ICC A;  3FBN B;  1UCR A;  2WZG A;  3HUG B;  4N9H A;  5E3O A;  1N1C A;  1X1D A;  5E1Z B;  1QVX A;  2W48 A;  2L9J A;  2DA2 A;  1Q0K A;  4YK5 A;  3TP0 A;  5L0J A;  3H3U A;  3TED A;  1A5J A;  4BBS J;  4M9X A;  1G6N A;  2QF7 A;  3MQ0 A;  2P7V B;  2HPM A;  1ETK A;  2DPU A;  1LS4 A;  4DOZ A;  1BI0 A;  2AQE A;  4HX8 A;  1CGO A;  1MJA A;  4CGZ A;  1Z6R A;  1Z3Y A;  1Z9C A;  3FMS A;  1W7P D;  2K3F A;  5F0H A;  3LST A;  2JN6 A;  3I58 A;  2A5W A;  4XKW A;  4GFB A;  4HYE A;  1Z5Z A;  1WVR A;  2E1M B;  1ZHF A;  3B6A A;  2QBY A;  4CDY A;  1UHS A;  4C3I J;  5FD6 A;  3L2W A;  4GEH A;  2RQQ A;  2L6F A;  4L6R A;  3KP3 A; 
#chains in the Genus database with same CATH homology
 1OKK D;  1J8Y F;  2LG4 A;  3EFO B;  2CW7 A;  3C2G A;  3L34 A;  2OG2 A;  4CS7 A;  4PUS A;  2CNW D;  1ZU4 A;  2V4J C;  2CMP A;  2WAQ A;  2WZF A;  2K9M A;  4F91 B;  4CSA C;  1K6Y A;  2KMU A;  4XR6 A;  3SNH A;  5KYW A;  2XXA B;  3M8J A;  2XSE A;  4XKC A;  3OA1 A;  5B1B C;  4LER A;  3T4R A;  4KI2 A;  2VIX A;  4BJ5 C;  4BXF A;  3I5Q A;  2YEV A;  4YJW A;  3H0D A;  4CS9 C;  3EPZ A;  2FUG 2;  3K4K A;  4JQF A;  1IZM A;  2R7V A;  1ZYR F;  2X51 A;  4E7J A;  2PP4 A;  3E70 C;  4IWB A;  4XTK A;  4DVZ A;  3HPH A;  3LFU A;  3SEQ A;  3BG7 A;  2JUG A;  1ZHZ A;  5KYX A;  4U5D E;  3OYF A;  2BVM A;  4C7O B;  1W36 D;  1LDK B;  2IGK A;  3NKD A;  2IS6 A;  4II3 A;  4ULW A;  2H7O A;  2W45 A;  2J45 A;  2P0W A;  2CV2 A;  3IUO A;  3S8P A;  3AFH A;  4BAC A;  4II2 A;  4BQQ A;  4AE4 B;  4OD5 A;  2OC6 A;  1ZHW A;  2ZXW C;  3KH2 A;  1DQU A;  1M57 C;  3DWL E;  4DBR A;  1WJ5 A;  3OWT A;  3WOD F;  1Z7L A;  3K70 C;  4XLC A;  4PJN A;  3LL7 A;  3OMY A;  2NUT B;  2JA2 A;  5FRM A;  4Q7C A;  4U5C E;  1WJB A;  2NG1 A;  3POV A;  2WL8 A;  1D1A A;  1SAU A;  4MLO A;  1TWG A;  4RD9 A;  2L9N A;  3FVY A;  2EIM C;  5KHD A;  1X1C A;  5TGT A;  2Z1D A;  2PX3 A;  4XWJ A;  2MAB A;  1SFK A;  2Y0S A;  4CCK A;  2R7O A;  1OR7 C;  3EGX B;  4MQ9 F;  3OL3 A;  3S0X A;  2KGO A;  2HZD A;  2KQR A;  3K70 D;  3K66 A;  3OYE A;  2M7A A;  3IP4 B;  4Y3O A;  4PJL A;  3HOT A;  1DP3 A;  1Z23 A;  2ZXP A;  3N0T A;  3PFY A;  2PJR A;  4OIP F;  4CUG A;  1OCZ C;  1EA3 A;  4N06 A;  3EG9 B;  4CSA A;  2FGY A;  2L2O A;  1GLN A;  3D5S C;  3K10 A;  4BJ5 A;  3DLA A;  1X1A A;  2X6W A;  4AYB A;  2H7B A;  4X0R A;  2MFZ A;  4YT5 A;  3ZSU A;  4PFO A;  3X2Q C;  1RJ9 B;  4QDL A;  3FHN A;  5F5F A;  2R7W A;  3OYA A;  2WAE A;  4DJA A;  2VAS A;  4PJJ A;  2DGJ A;  2Z15 A;  1M56 C;  3ASN C;  3OYH A;  5DLJ A;  3CJR B;  1Z3X A;  4RMN A;  4XN3 A;  1OCC C;  4BE1 A;  1V54 C;  4XQF A;  2LH9 A;  2KL4 A;  2WVO A;  3RYL A;  2GOX B;  2V9K A;  2LRD A;  3RSN A;  4X0G A;  1UAA A;  2J9V A;  4B47 A;  3J7A Y;  3S27 A;  5DQT A;  2UWM A;  4F4B A;  2I8D A;  4PSW A;  2E87 A;  2I8B A;  2J0X A;  4ZDP A;  3LLK A;  2KPM A;  3GBG A;  3SEO A;  5T3T A;  3SZR A;  4JJG A;  1BOB A;  2Q9A A;  2IXN A;  3K6B A;  4FES A;  2R7Q A;  2BW3 B;  4W8K A;  2D5R B;  3LSG A;  4YN0 B;  2R4G A;  4DIQ A;  4ZLD A;  2WVN A;  2LY2 A;  3CF2 A;  1X1B A;  3H9G A;  2LOO A;  1SF8 A;  4XLN F;  2JSP A;  2HVR A;  1PD0 A;  3WG7 C;  2R7T A;  3AG1 C;  2B0J A;  4ZLC A;  3GOD A;  2WBM A;  3LES A;  1VK5 A;  2A6T A;  2X1E A;  4IQJ A;  2VJJ A;  4IZZ A;  2Y3H A;  3JT1 A;  4J00 A;  4I3M A;  2VQH A;  4E7K A;  4O6Y A;  3LSM A;  3VYW A;  3A2K A;  1ZHT A;  4YT4 A;  2Z16 A;  2KDO A;  3AG3 C;  2CFO A;  5FRO A;  3OYI A;  3EZH A;  3PMR A;  3SP1 A;  2DT7 B;  1MNE A;  1WJD A;  2W9Y A;  3PNT A;  2J9U A;  3T6J A;  3AL0 C;  3Q7L A;  2EIJ C;  2KRC A;  3I3L A;  2A6E F;  3H5R A;  2Q9C A;  3HC7 A;  3LSH A;  2JVH A;  3FKJ A;  4BU2 A;  1PD1 A;  4KNV A;  3Q7G A;  1NZE A;  3CES A;  2PFD A;  2W00 A;  2E5Z A;  4LLE A;  4BE0 A;  3VYS B;  2CDQ A;  2ZXO A;  3S29 A;  3MKW B;  4ITV A;  1FFH A;  2FFH A;  1VMA A;  2L81 A;  4BEH B;  4PK4 A;  3RCO A;  2KNH A;  2W1O A;  3DAF A;  4U5H A;  2GFH A;  4YT8 A;  2YHS A;  4O6M A;  1Y56 A;  2WA0 A;  1O87 A;  3K4M A;  3OYJ A;  2ZFU A;  2NOJ B;  3B0V C;  4BDY A;  1X4O A;  4I1O B;  3D5L A;  3PSF A;  2HU9 A;  2KP6 A;  2L9S A;  4C30 A;  3OYG A;  2ZXH A;  3LSI A;  4XOR A;  4BS9 A;  2W82 A;  2J46 A;  3O6X A;  1Z3I X;  3ONQ A;  4GYT A;  4O6N A;  3BCA A;  3B9Q A;  4HPQ A;  1Z21 A;  4I44 A;  1R6R A;  4IJJ A;  4C3D A;  4ZJZ A;  1UEL B;  4J01 A;  2KQ9 A;  3N05 A;  3ZGK A;  2EIK C;  1ZHX A;  4LLC A;  3OR1 C;  3HL2 A;  1OCO C;  1V55 C;  3DAG A;  5KYW B;  3AL0 B;  3AG4 C;  4JCH A;  3QYE A;  4EWC A;  4N4O B;  4LAC B;  2KJG A;  2VJI A;  2J9W A;  4XLH A;  3CMM A;  1W36 C;  4D9J A;  4YRV A;  4XON A;  3OYB A;  4CBE A;  4JVS A;  5KYX B;  3S28 A;  2VJ5 A;  3DQV C;  3DU5 A;  4B3X A;  3CSK A;  4F3Q A;  3OYC A;  3OL4 A;  3ASO C;  2IGM A;  2C04 A;  2A1D D;  3ABL C;  5T3W A;  2QKL B;  2DT6 A;  4BQN A;  1E0E A;  4BJ6 C;  1Y6I A;  3BC8 A;  3OYL A;  2W4B A;  3V7O A;  3VYU B;  4E7S A;  3NYM A;  2XDV A;  4G7H F;  3ZCO A;  3O39 A;  1VOM A;  4N4N B;  4OIQ F;  3OYK A;  3UMK A;  2EIN C;  4U5G A;  2ELJ A;  4NY3 A;  2F5V A;  2V26 A;  2LBF A;  3B0P A;  5E3C A;  4XKB A;  5LD2 C;  5DQZ A;  2HV6 A;  3B0U X;  5L3V A;  5JHF A;  1Z6A A;  1V5E A;  1JI8 A;  2IXP A;  5HSW A;  1TT0 A;  2WVQ A;  1TKN A;  4CSW A;  3K33 A;  4QPO A;  3VAY A;  3F47 A;  3KEY A;  4K0D A;  3VDX A;  4YEJ A;  3UGP A;  3TD7 A;  3S3O A;  4HE8 D;  4CA0 A;  3ZG1 A;  4D1Q A;  3EUK L;  2PJR B;  2R7R A;  3OEO A;  4E6K G;  2QKM B;  3H5A A;  5E33 A;  4XOP A;  2HV7 A;  3DJU B;  3RH3 A;  2K3P A;  2CUJ A;  2DCE A;  4F55 A;  2IXM A;  3DPL C;  4C2T A;  1ZEL A;  2M4G A;  4IRU A;  2OUM A;  2UV1 A;  5HOO A;  5DS5 A;  3RQ4 A;  3PHF 2;  3OIP A;  2Q2E B;  4IQ4 A;  2L7K A;  3OS2 A;  3CZ6 A;  3W2A A;  1NU9 C;  3JRT A;  2R7U A;  1NG1 A;  4HG2 A;  1MMA A;  2LSE A;  4BE2 A;  3JYH A;  3KKB A;  4AE4 A;  1ZHY A;  3N24 A;  2LC2 A;  5KNL A;  4CCJ A;  2K9L A;  4BJT A;  4F52 A;  3MKY B;  1WFX A;  2LYC A;  4BG0 A;  3ECS A;  4AX2 A;  2HVQ A;  3L2R A;  4P1W A;  3LAY A;  4I1M A;  2VXD A;  1SZI A;  4HFK B;  3ZR8 X;  4KIS A;  1OLT A;  4XM3 A;  1HA8 A;  2LRE A;  1WGW A;  2YZS A;  3AQC A;  3S32 A;  2HDW A;  1TWC A;  3D5R C;  4QI2 A;  3TL4 X;  2W4S A;  2Y3D A;  1DGR M;  3EHM A;  1ZU5 A;  3NWT A;  3H9J A;  4ZTF A;  3H65 A;  3L0I A;  4DBQ A;  1G59 A;  3CJQ B;  4AU7 A;  3OS0 A;  5FRN A;  2IS2 A;  5F5H A;  4P5O A;  3EGD A;  4FWV A;  1MMD A;  3L2U A;  2V1N A;  1LVK A;  3L2V A;  2WY7 Q;  4JOM A;  1T0F C;  4XN0 A;  3SYT A;  4CCM A;  3C2H A;  3EHN A;  3LMM A;  1M2V A;  3H5N A;  3DTI A;  1TWA A;  5KYU A;  4CS8 A;  3DM9 B;  4OIN F;  3HKZ A;  5DVW A;  4PFP A;  2VQC A;  4B48 A;  2KLO A;  5HVQ C;  3W8I A;  3DKX A;  2OV7 A;  3MMY B;  4E7H A;  3NG1 A;  4Q5S F;  4QPQ A;  3OOU A;  4BQO A;  3V42 A;  3MKZ A;  1NU7 D;  2ZSI B;  2XF7 A;  5T1D B;  3K4N A;  2CGE A;  4AVZ A;  5CI8 A;  4YT2 A;  1QHG A;  4K7B A;  1TZL A;  4YEL A;  5FCL A;  3NKE A;  4HNT A;  3ZQQ A;  3LSK A;  3FDY A;  2XRH A;  2O5R A;  2DYS C;  3LLI A;  3LEV A;  3EH1 A;  3S3M A;  3E1S A;  4OD4 A;  1JPJ A;  4RM2 A;  3DPU A;  2XSJ C;  4KT6 A;  5EGY A;  2MYS A;  4DGW B;  2J0W A;  3RPU D;  3K7D A;  4EAT A;  2IS4 A;  2QY9 A;  1JPN A;  3Q6M A;  1D1B A;  4F92 B;  3F46 A;  4BEJ A;  3KL4 A;  3HTK C;  4KNW A;  2J7P D;  2LY1 A;  1VYK A;  3KMI A;  3QYF A;  3KX2 A;  2XL4 A;  2A69 F;  3IEE A;  2VLA A;  3JSZ A;  4JJF A;  4AK9 A;  2CW8 A;  3ABK C;  3NRH A;  3DTE A;  3M1C A;  3OIQ A;  4DVY P;  1OCR C;  4BUP A;  3PJR A;  4BL0 B;  3ITF A;  4WJ0 A;  3K1H A;  3A4C A;  4KJZ A;  4RLF A;  2W4M A;  4O79 A;  4RLQ A;  1IRX A;  2DYR C;  4CIH A;  5B1A C;  1V5F A;  3I5P A;  1N78 A;  4B43 A;  3DU6 A;  3OY9 A;  2NUP A;  2PX0 A;  2HQA A;  3K4L A;  3UMH A;  1MMN A;  3MX3 A;  4F93 B;  4G6T B;  4RDA A;  3AQB A;  4JW1 A;  3QYB A;  2Y3B A;  1X4P A;  2VPL A;  1FTS A;  5KYY A;  1VZ0 A;  1S9H A;  1LS1 A;  4IKF A;  2IS1 A;  1NG7 A;  1IW7 F;  4P6I C;  5CQG A;  5CI9 A;  1BR2 A;  2ZXI A;  3SZG A;  3X1O A;  3VSL A;  1PCX A;  2RNG A;  4NQW B;  2J7P A;  2P7V A;  2Q3T A;  3OR2 C;  1UG0 A;  2KRH A;  2RRE A;  1MMG A;  4G7Z F;  3NDB B;  2Z2S B;  3SYN A;  3FDQ A;  3DMD A;  2HVS A;  1WJC A;  4J32 B;  3S93 A;  4XOT A;  2G3K A;  2VH3 A;  2LBF B;  4GRI A;  1KU2 A;  3UMI A;  4A2N B;  2E60 A;  2R7S A;  3DZA A;  2VB6 A;  5HLT A;  2M3A A;  1LKX A;  3DEE A;  1LFP A;  2WB7 A;  2UUZ A;  2MD0 A;  4ZTJ A;  2G3V A;  3W3C A;  3DXJ F;  3RKO F;  3E9V A;  2MWQ A;  2IOQ A;  3NWS A;  5CQE A;  4QI0 A;  3ZC4 A;  2V3C C;  3OYN A;  2HNH A;  3HOS A;  4JZA A;  4C9Y A;  2HPI A;  2Y39 A;  2XC7 A;  2CW0 F;  2DOA A;  3EFO A;  3LS1 A;  1YX3 A;  2E5N A;  2IGO A;  3PSI A;  4C3B A;  4O7G A;  2M4K A;  3ZIB A;  2H7V C;  5DS6 A;  2VKD A;  3S3N A;  2XF6 A;  3W2W A;  4LIT A;  3ZXS A;  4CS8 C;  2XXA A;  3BG6 A;  2KHM A;  2WY8 Q;  3PUB A;  4LG3 A;  4B44 A;  4U7B A;  3KYL A;  2KZV A;  3F9K A;  4IX7 A;  2WAF A;  1PJR A;  3EUH C;  3K1I C;  2AQF A;  3K4C A;  4ZYA A;  4PSX A;  1SMY F;  4KIT B;  4ZDO A;  2VQL A;  4CCO A;  4XL9 A;  3MLG A;  1P9Q C;  2GOM A;  3BLY A;  1N77 A;  2CV1 A;  1VYI A;  3N2Z B;  5IY5 C;  3CQZ A;  3CP2 A;  2M7B A;  4CCN A;  4C2U A;  3VYR B;  4C7O A;  3SEZ A;  1QU3 A;  1OKK A;  1T95 A;  3IAM 2;  4OWR B;  3VYT B;  3DJN B;  1PYV A;  4Y33 A;  1YX5 A;  3HPG A;  5BUO A;  1AA7 A;  2V6E A;  3T6B A;  1Z63 A;  1M2O A;  2CNW A;  5L3Q A;  3W2V A;  2OCC C;  2X85 A;  2BVL A;  3DKY A;  3DM5 A;  2G62 A;  2NUT A;  4FAS D;  5CKT A;  2JVG A;  4H4K C;  2P6V A;  3UR3 C;  4ZC3 A;  5KCM A;  4BDZ A;  1WJA A;  4M63 A;  1D0Y A;  4U5E E;  2XF5 A;  4RBN A;  1D1C A;  3ABM C;  4ANJ A;  3RTR A;  3RIP A;  1BR4 A;  2X6Y A;  4E7Z A;  4HNU A;  4LIV A;  3EGD B;  4YWQ A;  2BE5 F;  5D91 A;  2C03 A;  3IAS 2;  3OS1 A;  3FHD A;  3QZC A;  4BJ1 A;  4EBB A;  4OIO F;  1FMW A;  4KC9 A;  1YE9 A;  3H35 A;  3EGX A;  1M2V B;  3K4B A;  4RM3 A;  3GAN A;  2BOL A;  5KYU B;  1QZX A;  5E3A A;  2KW3 C;  3EJN A;  5DS4 A;  1TR2 A;  3QOD A;  3EZI A;  3ZRG A;  1WJF A;  4XMY A;  4CS9 A;  2IXS A;  2PMZ A;  2V7F A;  4R79 A;  5HNH A;  2ZSH B;  3EG9 A;  3L2Q A;  5CPR B;  1TWH A;  3NYJ A;  3FBI B;  3EQL F;  3PL8 A;  2X6X A;  2W7N A;  2VKH A;  2M4E A;  2MC4 A;  2CH0 A;  2L5Q A;  3UNG C;  4XLA A;  4E7L A;  4U5B E;  1RJ9 A;  2DJI A;  3AG2 C;  4BJ6 A;  4HSR A;  3PNY A;  3TMO A;  2R7X A;  3FAJ A;  3QMK A;  2X1C A;  2XAU A;  4NC8 A;  3OYD A;  1J8M F;  2IYL D;  2K5C A;  2WB1 A;  3LNR A;  4FX5 A;  3QOE A;  5B3S C;  3HLZ A;  3HG9 A;  4NNJ A;  5KYN A;  4HRI A;  4MND A;  3HXL A;  3K4J A;  4U5F E;  3H9Q A;  4U87 A;  2VQG A;  2X1D A;  1FFT C;  4FET A;  3MD2 A;  2O9X A;  3W8H A;  2WZL A;  4NUB A;  2A68 F;  4XKV A;  1QHH D;  3Q6N A;  3UGO A;  2BW3 A;  2VXZ A;  3CP8 A;  1ERD A;  4E7I A;  1QLE C;  3JCU Q;  2F4I A;  4PJM A;  2M0M A;  3AKZ A;  3I9V 2;  4G7O F;  3OYM A;  2EIL C;  4HEA 2;  2CV0 A;  3M1C B;  2Y69 C;  1NG6 A;  4HST A;  2QTV A;  2E1M C;  4XLE A;  2Q9B A;  3ZVR A;  4CH7 A;  4IAO A;  1MND A;  1S7Z A;  3PNV A;  4J30 B;  5E2Q A;  3K6G A;  5HNF A;  1X19 A;  3VSK A;  3DD7 A;  1U0J A;  4Y4R A;  1W2W A;  3E0J B;  2ZXR A;  2Q1Z B;  3HJC A;  2NUP B;  2DXI A;  4XLF A;  4CCL A;  1BR1 A;  3I4U A;  4Q4Z F;  2ZPA A;  2Y3G A;  3EH2 A;  5EHH A;  1N75 A;  5KYY B;  1J09 A;  1KON A;  3FBN B;  2WZG A;  3HUG B;  1N1C A;  1X1D A;  1MW7 A;  1DGW Y;  4NC7 A;  2L9J A;  3SDB A;  3TBI A;  1ST6 A;  3G2B A;  1D0X A;  1D0Z A;  4HEA J;  5D92 A;  3U21 A;  5LFA A;  3BCB A;  1O5H A;  3LS0 A;  4OIR F;  4HFF B;  3NYL A;  4XNF A;  4LIU A;  2JD3 A;  2IGN A;  2HPM A;  4B6I A;  3DTK A;  4C3E A;  4DOZ A;  2AQE A;  4ZDL A;  2F6C A;  1FMV A;  1Z3Y A;  4E4H A;  2VL8 A;  3EUA A;  4BEH A;  3VWB A;  4BGD A;  2WAD A;  4KBL A;  2CS3 A;  4G0H A;  1WJE A;  3LJB A;  2A5W A;  2IXO A;  4OAZ A;  3A1Y A;  4XKW A;  4JUR I;  1Z5Z A;  1G8X A;  2PF4 E;  2E1M B;  4XLP F;  4OAY A;  3EPV A;  3DPT A;  3L2W A;  4GEH A;  4CZC A;  2VJ4 A;  2CUZ A;  2RQQ A;  1V5G A;  2A6H F;  3RFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...