3CZ6A

Crystal structure of the rap1 c-terminus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
b'RSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title Structural and functional studies of the Rap1 C-terminus reveal novel separation-of-function mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 48
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3cz6A02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3cz6A01
3K6GA 4BJTA 3CZ6A 3OWTA 4BJ6C 4BJ5C
chains in the Genus database with same CATH superfamily
3TDZC 1RJ9B 3WGHA 5D91A 4U7BA 2Y69C 4YT4A 4CYCB 5HS7A 1J09A 2TDXA 5H20A 3GTGJ 2DB4A 1T33A 3UNGC 2XLEA 1SFEA 4CSAA 2CG4A 3E97A 1WFXA 2QKMB 4RGXA 2V9PA 3K7DA 5JLIA 2KQ9A 3F0CA 5DD4A 3ZQIA 1AEPA 3L9FA 2LIGA 3OEOA 5KYUA 3BC8A 4E7SA 2XV4S 3RFYA 1CGME 2M1BA 3MVPA 1LI5A 3QW0A 2ZC2A 2WAFA 3TBIA 3IQTA 4BJ5C 3VYUB 2JPCA 4HE8D 2Z16A 4N4WA 2NPUA 2NAZA 3BR0A 5LHHA 3JCUQ 2G7HA 2CRGA 4BS9A 3VEPA 1NK2P 2R03A 1HQCA 3A0HC 4M74A 3LNQA 1N1CA 3GEEA 2ME6A 5L3EA 1WGXA 5K7FA 4XPXA 5L0FA 1D8KA 4Y4RA 4NDLA 3F9KA 4GDFA 1VLTA 2Q9BA 4M63A 1W5TA 1YW8A 1S6LA 2E60A 1BW5A 4I0BA 5ILVA 1G4DA 1O5HA 2H6BA 4E7IA 5EYRA 1TQIA 3HGGA 2FA5A 2Y0MA 4WK8F 4S05A 1WN0A 5FJ8J 4XN3A 3VF0A 1EH7A 2PBIA 1IXRC 5C4JJ 2Y2ZA 2CV1A 5FKOA 2HVSA 2P0WA 1HMDA 2KKOA 2UXXA 2I8BA 5CIVA 1S7EA 4R8HA 3HOYJ 3S2HJ 1E3OC 2BV6A 2V1UA 2Y3DA 1O3RA 1T98A 3HOZJ 1SFKA 3N0TA 2QTVA 3MEXA 2FFHA 3PM1A 2VKHA 1F43A 4EV0A 3GF2A 2J5OA 4FETA 4KA4A 3SHFA 3JZ0A 4GQHA 5F08A 3HRTA 5K7HA 2D2WA 5A2QZ 3ZN0A 4B8XA 2CJJA 3A02A 5DS9A 2JMWA 3HTSB 3EQLF 1YTYA 1QGPA 2KGOA 2WC2A 3O8HA 5J3LA 2H27A 4OD5A 5E1ZB 4KITB 4JKVA 1XC5A 4I44A 1U9NA 4LOCA 3HHHA 1OCZC 3DJNB 3DAFA 2CQXA 2V26A 2L0KA 2JA5J 4RB1A 4BU2A 1YO5C 3ZQHA 1O87A 1GHCA 4CCJA 2DDBA 5COMA 3MKYB 2OUMA 1YAUO 4Y7NJ 1ITYA 4AUXA 2E1CA 5A2QK 1USTA 4XKWA 4XN0A 4OIOF 5DYMA 5EZHA 3RQIA 2KK1A 1RC9A 3HG9A 3C8GD 5E8GA 1OYYA 2NUTB 3VRCA 2JTVA 3DFGA 4KIBA 3F8NA 1O3TA 4XEVA 5HLIA 1OKKD 4WCGA 2HVRA 4ZZLA 4NUBA 2VJJA 2X51A 4LIVA 1V55H 4XLAA 3KZIC 4MTOA 3HSRA 4A0YA 3CMEI 3OL4A 1JGGA 1JKQC 2YLGA 3CO7C 4IGGA 3OYJA 3RIRA 3MLGA 1LKXA 2BY2A 2FD5A 1RRJA 2GXAA 3K33A 3HHGA 3M07A 4JX4A 2R5YB 3AG3C 2Q0OA 2A0BA 3NRHA 4RBNA 1I4ZA 4E4HA 2HVQA 3DTEA 3OL3A 3SZPA 1F1MA 4M3FA 3RKYA 3ABMH 4MVQA 1WVRA 3DEEA 2EA2A 3JRMO 2MBFA 1YHQI 2HPMA 2DA4A 1MMDA 2JPBA 2D1VA 1T95A 1JRAA 2L6HA 3CP8A 3KYJA 4LFUA 1CPRA 2M7AA 1U6GA 2LREA 2IGKA 3FXQA 4GCVA 3T5XA 2XM4A 3P7NA 1ZAOA 3HUGA 4A5NA 1VQ4I 5AONA 4BHPA 1G6NA 2EV5A 2DYRC 2Q2EB 4U0VA 3Q7GA 4JTCB 4EBKA 3ZN1A 1FYLA 4KDPA 2EB7A 1I4YA 3RYRA 1XMAA 1IN6A 1T2KA 3QODA 2GOXB 2V9KA 3G2BA 1R71A 2B0JA 3OS2A 4C7OB 3VAYA 5ICCA 1J5YA 2GWWA 4LLLA 3SXMA 3GCMA 1R5GA 2OV7A 3CMYA 2IS1A 3BP8A 1HA8A 5CJ9A 4BXFA 1OCCH 2AO9A 2QQ8A 4KN7X 5KK1A 1B9NA 4HSTA 4KMUX 1Q1HA 5L3GA 3FK7A 2EINH 1JKRC 3BJ6A 2JVHA 5D5WB 3QYEA 4IHTA 2IS6A 4IOCF 2FGYA 3U0CA 4E7HA 1LM3B 2DPDA 3BR3A 3W8HA 2L9NA 4XTKA 2JT1A 2WADA 4U9DA 1Z5ZA 3VODA 3VM6A 2A69F 1V5GA 2ZB9A 4G6TB 4MQ9F 3CCQI 3CLQA 4IHYA 2HZTA 1U8RA 2QNLA 2ELJA 2R7UA 3ZG1A 4KNVA 3CUQA 4OMYA 4PSWA 3CJTB 2VE9A 5HVQC 3KIOA 4AE4B 2RKHA 1REPC 3WU0A 1D1BA 1BIBA 2EFNA 4B47A 2WAQN 3VYTB 1YJNI 1YYVA 2ZXWC 4P5OA 3BPXA 5FD6A 3SZRA 1Z1DA 3L2VA 5F0FA 1SC7A 1QZXA 3ERED 4RGRA 5KHDA 1FIAA 5FRNA 2ISYA 3JYYA 1B4AA 3ABLC 3ABLH 4CIHA 3HNIA 1F9NA 1WJEA 2FNAA 2HOAA 3ZQFA 5LD2C 4EIYA 1H7IA 3I59A 1G4US 2GDCA 2R9RB 5KYYA 3IAS2 2QBYA 3HNLA 4HV5A 3SDGA 2VBZA 3HTKC 3ZMDA 2A6EF 5E3OA 1BJZA 3TULA 2NVUB 3K1HA 1Y39A 2BY3A 5CVRA 3HPHA 1R5ID 2CFOA 2VKVA 3V7SA 4A3LJ 1FBUA 3PNYA 2YS9A 3KEOA 2DA5A 5B1AH 1FYMA 1EKYA 3VYSB 5CVJA 1VQMI 1TW2A 5E17F 3QAHA 2BW3B 1X3UA 5KAFC 2EPNA 2RNGA 4FE4A 3D5SC 3HOWJ 1OPCA 4CO8A 3KFWX 1JKPC 4CSWA 2EIMH 1QLEC 1XSXA 2X6YA 1HXDA 4M9ZA 1ENHA 2AP3A 2LY2A 1QZYA 4F55A 2XC7A 3N2ZB 2CSOA 2LC2A 1Z23A 5JSLA 2CUZA 3DPUA 2LKXA 3LQQA 4DW6A 4XM3A 2XRLA 1PUEE 3PJRA 2E34A 3DEUA 2Z5UA 3KP5A 1X2MA 1ZGJA 3KEQA 1XPXA 2YLIA 4ZYDA 1UG2A 4LERA 1HSTA 4EM1A 5F1JA 1AKHB 3JRBA 2PLYA 1WKMA 4FX5A 3LSPA 3ELKA 3K4NA 1YG2A 4YIIA 4EM0B 4S0HB 4CGZA 2XS1A 2LOOA 1S7OA 3K1MA 4XKCA 3BWGA 2A5YB 3L1PA 4DJ9A 3I71A 1X1CA 3GW2A 1JUMA 5BPDA 5IT9Z 2ZXOA 3K1NA 3S32A 3IHUA 3ABTA 1GT0C 1MMNA 2ZXHA 1NH3A 1PD1A 3BT9A 4ZLDA 3R4KA 2LF8A 3DWLE 4C3HJ 2CV0A 2G3KA 1TWAJ 3OIQA 1L0OC 1TNTA 1YW7A 1A04A 3H35A 3M4CA 1ZHWA 2ZCWA 5D5XB 4B48A 2JJ7A 4NQWB 3UMKA 3FDQA 3M1EA 1ORJA 1ZZPA 4HF0A 4WWCA 1WH5A 3FHNA 1DP7P 4G78A 2NVTJ 3W2VA 3JSPA 1B68A 3A9CA 3K66A 3Q0UA 2F5CA 2HQAA 1ZW3A 2AWCA 3HKZN 1G3SA 5IT9K 4RB3C 4UUTA 4A3DJ 2KDZA 2EPLX 2IPQX 2L4AA 2O3FA 5TISC 1MKMA 3L7WA 1Z63A 2W4SA 3RKXA 2QGUA 1G3WA 2KRHA 2V6EA 3M79A 3WU2C 2KZVA 4LG3A 1IJWC 1R49A 1Z6TA 5FB2A 1UCRA 2LRDA 5KYUB 1MH3A 3KYDB 4PJLA 2Z33A 1GS9A 2IBDA 2HFIA 5B1BH 4NY3A 2W85A 5GAHJ 4HSRA 4BXUA 3Q6MA 4P6IC 3IRRA 2E1MB 5J4YA 1WI9A 4MVOA 4K7BA 4OINF 3PUBA 1NG7A 2XVCA 2KJGA 5F1RA 3EFOB 2G7UA 4AK9A 2DA6A 1FYKA 1PD0A 1HY5A 1F5TA 3ATPA 3HC7A 3FVYA 4QI2A 1KU9A 5L3QA 2ZFWA 1UELB 2F6CA 3JRFA 5T1DB 1IRGA 1OKKA 3LNMB 2RV8A 2RC4A 3TO9A 4PZJA 1FLIA 2A3SA 4K1OA 4KC9A 2OU2A 3PSFA 1T5OA 2J46A 3JW4A 1VQ8I 5CQGA 1XMXA 1EV7A 2JUGA 4YEJA 4YFKF 2H7BA 3AGTA 3MKWB 1W0UA 4CCNA 4XLHA 4UUSA 4EJUA 4G7HF 1EKEA 2VXDA 2IXMA 5EGYA 1FSHA 3HEFA 1JHHA 4EEFG 1IC8A 4KIFA 3AQCA 4A5MA 1Y8QB 1TQMA 2LQGA 4HNTA 3W2WA 2V3CC 4RS8A 5DUIA 1QKRA 4CIPA 1RJ9A 3OOUA 1V54H 3JSZA 1IZ1A 1E3PA 4CYCA 3S9OA 3OYEA 4IHVA 1PP8F 3RDIA 3U8PA 4IJAA 5A6BD 2EV6A 2O5RA 4AVZA 3DLAA 3OYFA 3ECSA 4IJJA 4IWBA 1LJ9A 4LLNA 1K78B 4CS7A 2XSDC 2ZXRA 3W3CA 1BR1A 3GTKJ 3E6MA 1SVOA 3F8FA 3H3VK 1SAXA 1VQ5I 1ZRCA 3WG7H 3ZIBA 5J4VA 1MJAA 2E19A 3OOPA 4RA2A 1YA7O 4C2TA 2WAQA 2HDCA 1ETWA 4LIUA 4BJ5A 2K5CA 3W8IA 4UB8C 1T6UA 3I0TA 3H0GJ 4N4OB 1B8IB 1BI1A 2F5VA 2BOLA 1BOAA 4V2FA 5E3LA 4RDUA 3NEUA 4ZDLA 4NTFA 4MFEA 3RTRA 1MH4A 4FESA 1ODDA 3T6JA 4CA0A 2DOEA 2DTZA 1S5LC 3VFZA 5DCMA 1BA5A 3V8LA 3RKWA 4MTFA 5H6QA 1Y0NA 2CFXA 4DOZA 4XLEA 1OKRA 4C3IJ 5DD8A 1PP7U 4BQOA 5L0DA 1YS7A 4XKBA 1VMAA 4LMYA 2J0WA 2L6FA 5DS5A 4NTAA 4TV7A 2ELHA 3BY6A 4P9FA 1APLC 2KYHA 4I0AA 4XMYA 4BEHB 1ON2A 3HBLA 5IT3A 2GA0A 2X0LA 4AL1A 3WTXC 4BPMA 3IV5A 4JQFA 5DEQA 1ZVZA 2DK8A 4DNCA 4MVUA 4YT8A 4LB6B 2JZYA 2HPIA 2HKOA 4UVAA 4DJAA 5D5VB 3NAUA 1LEBA 1ETKA 2EK5A 1DDNA 3R2PA 5F0CA 4EJWA 3KP3A 1CGNA 2CU7A 2E7XA 1V4AA 3L09A 3TO7A 3B0VC 4AX2A 2JVGA 3CJRB 5EGOA 4O3MA 4XSXF 2PFDA 3BEHA 4L5IA 2P6TA 2VE8A 3SNHA 2IXSA 2EBIA 1FNNA 2PN6A 2JA7J 1OW8A 3BOQA 5JVGF 1PYVA 4D5CA 1ZR2A 3DU6A 1N78A 1QPUA 1Z05A 2JD3A 3PCVA 2M5WA 4E7JA 3OA1A 2CQQA 2HDWA 2HYJA 4DYQA 3RQ4A 4ENNA 5BMZA 2GFHA 2J9WA 3F6OA 4QPQA 3JRTA 4DRIB 2ZJQF 1RKTA 3BR1A 2CCYA 4I99C 4AIHA 3GLXA 2LY9A 1X1PA 2AWYA 3C63A 3HOXJ 3SZGA 5D5UB 4E7LA 4PJMA 3IQ5A 2NUTA 1ZHYA 2UV1A 1V5EA 1DGRM 3CUQC 5L0HA 2K40A 3ITFA 1VTMP 1FSEA 2F5DA 1TFOB 3CUQB 1GM5A 5D92A 3CMMA 3QU3A 4CYDA 1UFMA 2WZLA 1XG1A 3A0BC 4KFCA 1WPKA 3EJNA 3S1NJ 2M64A 2Z15A 4IHXA 4JEBA 3W6JB 2QA4I 3SEOA 5JT4A 3KP6A 5CVVA 4KMFA 4Q47A 2M2EA 4A3JJ 2EPMX 4E17A 1OCTC 1GUUA 4EATA 5FROA 2CUJA 1R4MB 4GGGA 2L5QA 1DPRA 5J1RA 3DKAA 3ZTMA 4QWQA 1RPWA 5KYYB 3L00A 2QBYB 1UG7A 4NBQA 3SFIA 2CH0A 2PX3A 2D45A 1JTXA 4MVRA 1ETOA 5DVWA 1AUEA 1FOYA 3WHBA 2Q2EA 3J80Z 1PV3A 1EH8A 1D1CA 3TKYA 3DD7A 1OCPA 1FNTc 3FAJA 3HXLA 3RYLA 3T0YA 4B3AA 2VUMJ 5D4SA 2PMUA 3QWLA 1QU3A 4HEAJ 4E18A 4ZLCA 5B3IA 3B0UX 4C7OA 3B73A 2EZIA 1XZPA 1W7PB 3TO6A 4ZH4F 1JPNA 3HSEA 3NYJA 4H54A 3U9JA 5E3MA 2XB0X 3HRSA 3F23A 5F6FA 4KJZA 4W8KA 3CD6I 4C3JJ 3BCBA 2MD0A 1RKWA 2OQRA 2XM0A 4RBOA 2H6CA 1J8MF 5FD5A 4ZYEA 5J6XA 3IL2A 3K2ZA 3OY9A 3J80K 3EDPA 1GXPA 4FX0A 2M4GA 5M5XJ 5L3CA 1S9HA 4BY7J 4EJTA 4PJNA 2OTJI 1HE1A 1E86A 4PCQA 5FGMA 2HMZA 3JYHA 3X1OA 4YWQA 2W84A 3CCYA 4HAMA 4I01A 3PO3J 4ESFA 2VODA 2VIXA 3SZTA 3JREA 2DMNA 5E79C 1H89C 3I54A 3DI5A 2O0YA 2IS4A 2K02A 3G50A 2BE5F 1MQVA 3Q0WA 4A12A 4IRIA 2K7LA 3AL0C 1AOYA 4FISA 2R7FA 2P7VA 2VN2A 3VDXA 2DLLA 4Q4ZF 3AL0B 2H1KA 2BVLA 4G6DA 5A6AA 4YT5A 3IH3A 1OISA 2IA0A 5LGTA 4Y52J 3GYHX 3FKIJ 1BZ4A 2VOPA 2PG4A 1SVMA 3MMYB 1QZEA 2AXLA 1YYXA 3EHMA 2BXZA 4F3QA 3DE9A 1HDDC 2KW3C 2OBPA 4P96A 3CC4I 1V74B 1X3ZB 2FSWA 1VZ0A 2IAIA 4BDZA 2TRTA 1WJ5A 3F21A 3AG4H 3C2GA 3T8RA 3I5QA 1ZHZA 3Q3SA 1VYIA 1LQ1A 2DAOA 1NSGB 1SANA 2WVNA 3R0AA 4EGYA 1E17A 1PJRA 2M0CA 1F36A 2EIJC 4KYWA 2QLZA 3H3UA 1ZHTA 3KX2A 4N9IA 2LVSA 2M3AA 1Z91A 4Q7CA 2BW3A 3O3KA 3ULQB 1SMYF 4U7DA 3FOPA 1O57A 4IRUA 2Q8KA 3HL2A 4LITA 5HNFA 5JHUA 1LPQA 2LLKA 1XB4A 2OQMA 3MBGA 5A6BA 1FBSA 2AHQA 2DU9A 2R7RA 4HDVA 1IF1A 2OOCA 3NDBB 4B43A 3H5RA 4DYCA 1WJCA 4N6CA 2BC5A 4I76A 2BL2A 3EH2A 2BHYA 3LAJA 3E5XA 4CCKA 4AU7A 2OZ6A 3CJNA 3A03A 1P4AA 1VQOI 1B72B 3FBIB 2MHRA 1QHGA 3QPSA 1RIOH 1FFHA 2B0LA 2ZXJA 2PMZN 2GWRA 2VT2A 4II2A 4F7ZA 2YRFA 2OZUA 3EYYA 3BQZA 2AS5F 5FRMA 2KC3A 3JTLO 4MVMA 3M1CA 4BEJA 1RCPA 4PJJA 2EILC 2KT0A 1D3YA 4LACB 5E3NA 4RB0A 2DBBA 1S7AA 2BYVE 2P8TA 2HSQA 3DJUB 1D0XA 3IQ6A 3L8IA 5DDGA 1S7ZA 1T9KA 4E7KA 4J7TA 4U87A 4W8PA 1X1BA 2OKUA 2K3PA 2XGXA 2ISZA 3ZDLA 3CCRI 5AC5A 2GOMA 3S84A 1HW2A 5K1YA 4FQGA 3VSLA 4NQWA 4H0EA 2QCOA 1R7JA 4O6NA 4XK4A 4LDQA 1T0FC 2O9LA 2ZBKA 2FEZA 3O39A 2YLDA 2V4JC 1JI8A 3LA7A 2WY8Q 1MBKA 1OCOH 1WJFA 1KQ8A 2RQPA 4GYGA 1W7PD 1A7VA 1OCOC 1YDIA 3B0PA 1LUJB 3K4LA 3GM2A 2VKDA 3GBGA 5L3FA 3ASNC 1TWFJ 2LK4A 2Y69H 2YU3A 4L0ZB 1JTYA 3M9AA 1WASA 1SEUA 2VQLA 2YPRA 3C7JA 1BBHA 2V79A 1XDUA 2G9WA 4I1MA 4MTGA 3RKOF 4GO1A 1TBXA 2LD6A 4H4KC 4M73A 2OCCC 4FCYA 3LLIA 2K9QA 1QRYA 1VNDA 1NZEA 4JC7A 4JW1A 2X85A 1Z7Qc 3AAFA 1QSPA 4FT8A 1P92A 1W5SA 1LEAA 4B09A 3K6GA 4HX7A 3SJMA 2VBYA 1A6IA 2ZSIB 4NNJA 2XLVA 2Z3YA 2ZKZA 1AWCA 4RGUA 3IKVA 1LDJA 4CCLA 2DQLA 3ZMVA 4GFBA 2FOWA 1RR8C 1YZCA 3EFOA 3C2BA 2DTRA 4S04A 3OWTA 2CUEA 4MNDA 5JI6A 5E20A 3D5LA 3DKYA 4M72A 5HV9A 3T6GB 2DFFA 2JWTA 2YUSA 3CDHA 1R1TA 1W5CC 5DCMB 1IW7F 4JP0A 5DM7F 3GTOJ 2VCAA 4YL0A 4CZCA 3O6XA 4HQMA 3U5SA 3EUAA 3G4XA 3KZZA 1YS6A 5CVUA 3CC7I 1OW7A 1K79A 3CEXA 3SXZA 3KMIA 2R3SA 4MHGA 3I9V2 2WTEA 2Y30A 4AYBA 3X2QC 3X2QH 1HW5A 5FO5A 5LEKA 4A2UA 3L2QA 1WJAA 4P1WA 4ULWA 5CI8A 2IA1A 5GADJ 1K4TA 2DA3A 2KRFA 3LSRA 4LK0F 1JXSA 4E0HA 2ZSHB 2XSEA 5GPGB 2E2JJ 4ESBA 3ZP5A 2J7PA 1B6AA 2X6WA 3EUHC 3FMQA 3GZNB 3NRVA 4M6VA 4I6ZA 2DXIA 1MNDA 3SEQA 1G59A 1C0WA 2H8WA 1IUYA 1XMKA 4OD4A 1V5FA 1IG7A 4L9VA 5D4RA 5EGOB 5CI9A 5HSWA 4IVNA 4N4NB 4AIJA 2CW7A 2B63J 4DBRA 3BZCA 1SVLA 3IWFA 1K78A 2HQRA 2QE9A 2JPUA 2XAGA 3DTIA 1OCZH 4NC8A 1ZG1A 5H6RA 4OWRB 4M6YA 5E18F 1B1BA 3WTYC 3LFUA 3RZDJ 2B9SA 2XIGA 1LDDA 4CDGA 2ETSA 5HDNA 3TMOA 1LFPA 3QTHA 1SZIA 3DWWA 4OAYA 3BTIA 2YEVA 1B8IA 2XL8A 2Y9ZA 1KU7A 3KYIA 5EEAA 3H92A 2BY1A 3NMJA 2HJMA 2G3VA 4ZDOA 3MCZA 1HDPA 1NFNA 2LBFB 3BZ6A 2VC9A 2DO7A 4UXNA 4E0IA 3DKWA 4XICA 1MBGA 5GTHC 1MBFA 3F8BA 3R60A 2FRHA 3J81Z 2F48A 3WTVC 3V7CA 3AG3H 3HYIA 1BBYA 3OYNA 1LS1A 4JCZA 4ZDPA 4HEA2 3CCSI 2XKPA 2M45A 3GFMA 4BEHA 1YJ9I 2VOOA 2H8RA 1JMWA 3AJMA 2M34A 1TNSA 4XRSG 3C18A 2Q3TA 2R7TA 3BQYA 4LGWA 3EH1A 2K3FA 4NB5A 3M3YJ 2XXAB 1VQ9I 1K6YA 5TGTA 5D8KB 3DZAA 3E6BA 2FJ1A 5LHGA 3K4CA 3VB2A 4HV6A 3OYLA 3D0SA 1M6TA 2DYRH 1SD6A 3J81K 5ICFA 1KYZA 4A4AA 1DOVA 4DVYP 5F5FA 1YLFA 2ICWG 4PR9A 1X3WB 2MH2A 2YZSA 3QRFF 3PIPF 2XS8A 3W4YA 1P2FA 1Y0UA 2A0UA 2CQKA 3E5QA 1AU7A 2J8WA 1YVIA 1JGSA 3LA2A 3S15J 3ASOC 2E1OA 2YL7A 1W4MA 1IXCA 3GWZA 3GFIA 3E1SA 3RIPA 2M87A 3FK6A 5EEGA 1XZQA 3DKXA 5DS6A 1BR2A 1FMWA 3LSKA 1IUFA 4L18B 5K0IA 2HFHA 1R6RA 4U5DE 2O9XA 2VJIA 4HW0A 3TL4X 4CICA 4MW8A 3ZC4A 3M4BA 5GAGJ 3FXKA 4NC3A 1RI7A 4L5EA 1ZRDA 3CO6C 5K5QA 2HXIA 3PMRA 256BA 5GPAA 1S72I 4Z9IA 2D4UA 2Q00A 2FBKA 2ZXWH 2W82A 1P7JA 4D5FA 2P7VB 3CCUI 5DTDA 3K4MA 4KT5C 3HIFA 1XDSA 1BW6A 4U5BE 4YIRX 3ZQCA 4YN0B 2P5VA 3CJQB 2YHSA 1FZPB 2XROA 5DCFA 1H8AC 4BNCA 3V7OA 2QUPA 2DMUA 1E0EA 5FKNA 2Z2SB 1O3QA 3Q7LA 1KONA 2MW8A 1DPUA 2QQAA 5JVTA 4I3MA 1ORYA 4A3FJ 3MD2A 4Q48A 4HBLA 5J47A 1HKTA 4XRMA 5L0CA 1ACIA 3EZHA 1BC8C 3SFZA 1U5TC 3U3FA 4R1HA 5E1WA 2HOSA 3OYKA 1GVDA 2XAHA 1U5TB 1W7PA 2DMTA 1KU3A 5AGFA 4FE7A 1IV6A 1OYWA 1MJBA 3Q5FA 1R4TA 4NTBA 4R79A 3HOTA 3K2AA 1K6OA 1FOXA 4KI2A 4B1RA 1HW1A 2XAQA 3V5ZA 4I02A 2DA2A 2AU5A 1Q0KA 3EZIA 5GPCA 2QLAA 4K2EA 4U5EE 1J9IA 4DZJA 2L9SA 5HLHA 2PF4E 4B3XA 5J1UA 1JKOC 5BQIA 3H9GA 3PSIA 4HLXA 4XSZF 1PVEA 1XWJA 4XL9A 4EKWA 5IP6A 2X1CA 2A68F 2O6GE 2C03A 1IXSB 4M6XA 4YK5A 4DXWA 3LSJA 2FX0A 3RW0A 5F64A 1ETYA 2M0MA 4PFOA 1VK5A 1VQ7I 3P9CA 4J32B 1IRXA 4PUSA 4LLCA 4MW3A 3J7AY 5CKTA 4BJ6C 5EF6A 3P5JA 2CS3A 3M1CB 1ZGAA 4XLCA 2GIZA 2STTA 2QVOA 2IXNA 4XOTA 2IGMA 2XGEA 3WTWC 3N05A 1U8BA 3GFJA 2KIQA 3E0JB 3SYNA 3AKZA 4AD9A 3FOOA 4NCQA 2P81A 3BR2A 2OCEA 2M30A 3AFHA 1IAWA 3RQFA 1R22A 2XAUA 1BDJB 5H2FC 5IYCJ 2UUHA 3OS0A 1X2NA 3K6BA 1Z7UA 2OJED 3S2DJ 2IS2A 1IZMA 1GQAA 1TQPA 4NHJA 2FBHA 2KJCA 3AQBA 2F2EA 2VASA 2P4WA 4A0XA 4BGDA 1HKQA 5DUKA 3LS1A 4KN4X 2XGDA 2FXAA 3NMIA 3KE2A 1TTYA 3ECOA 3FISA 1Z67A 2ZO4A 1M56C 1J0RA 1Q0GA 1U0BB 4A3BJ 2LYCA 2HOTA 3V8JA 2L81A 2WZGA 5C3EJ 2L9RA 4ZTFA 3NKDA 4D7MA 3JT1A 1YIOA 1YARO 2BEOA 1NTCA 5M3MJ 4QPOA 4PGGA 3ZQLA 2ZXPA 2G0EA 2L6GA 2EZKA 3PNVA 4CDAA 4BUPA 2J9BA 2CMPA 2EQRA 1ZH5A 5IOYA 5BQTA 3P9IA 4BKXA 3H9QA 1ETXA 1B72A 3MZ8A 1J8YF 3SEZA 2F4MB 1HE9A 1USSA 3GEZA 4J00A 2LR8A 1MMSA 2IGOA 2IEKA 2HI3A 2BVMA 3S16J 3F6VA 1M57C 4BAYA 1DQUA 3AG2C 3MFKA 3AG2H 2JSCA 2XPUA 3FXRA 1OR3A 2LFFA 2XPWA 1TT0A 1QO0D 3QMKA 5E3CA 2PBEA 3NYLA 2LY1A 5KYWA 1J75A 5DQZA 3A1YA 3BG9A 4UV9A 3H2VA 2WY7Q 3ZXSA 1ZG5A 4CH7A 5CPRB 4IO9F 1T39A 2GZWA 2E2IJ 3LQRA 3ZQYA 1ZN2A 2XUBA 3ZCOA 2Z1DA 3RPQA 1WCMJ 3HNJA 2WVOA 3BTCA 3SYTA 1XCVA 4BBSJ 1TWGA 2JX0A 1RR7A 4IOAF 5BUOA 1POGA 2DYSC 2W4BA 2XAJA 5L0JA 4BY1J 1T0FA 2Y3HA 1ZG3A 1VLSA 4CUGA 1YE9A 4OIPF 3DPLC 3C1DA 3PQJA 3E7LA 3ISPA 1K40A 3S0XA 1XGSA 3GZ5A 3QP5A 1R58A 2ECBA 3K1PA 3S3OA 1BI0A 2CGPA 1BI3A 4WXHA 4QIWN 2DK5A 5J8CA 4JK1X 1Z6RA 1YIJI 3NQOA 3GX4X 3K7AJ 3NG1A 2EFWA 4LG0B 5DS4A 4XLFA 1HBXG 4HX8A 2R7SA 2NUPB 1Y56A 3LA3A 1UHWA 2W9YA 2QENA 3KP4A 5JUAA 3HZJA 2X4HA 4L9TA 3KEYA 3UR3C 1JUPA 1LNWA 1CQTA 1JAFA 1Z6AA 4IAOA 4XNFA 3GM1A 3COAC 1IN7A 2NSFA 4FAPB 2R5ZB 2JA8J 3H1CA 3IH2A 2VCBA 1XS9A 4EWCA 1R1UA 2EFPA 3CUOA 1OMIA 2MYSA 1RXQA 3I3LA 3KYLA 4KIGA 4BE1A 1ZQ3P 1TFKB 2WB7A 1MMAA 3K4KA 1YRNB 3T8TA 2MLGA 1T6QA 3K0LA 2IXOA 5EDNA 2QSFX 3CP2A 5FZTA 5E1XA 2W4MA 4A2NB 1N75A 2QSHX 2WV0A 1SFXA 1F1ZA 3S1QJ 1OJLA 2FQ3A 3JAMZ 2QUFA 3FXUA 3WTTC 3G1MA 3FXMA 2IW5A 2L7FP 1BR4A 1FBQA 1N77A 4X6AJ 1NG1A 1RKCA 2O8XA 2BGCA 5K5OA 2XL6A 4MGRA 1LFBA 1ZLJA 2HR3A 2V9VA 1DU6A 3GTPJ 2A5WA 2L7MP 4NC7A 2IA2A 3QVZA 4UUVA 3I5PA 4JTAB 4LLEA 5HDKA 5JS5A 3VOEA 2VXZA 4HX4A 3FMSA 3QOPA 1P7IA 2IP2A 1OFCX 5IOZA 1A6QA 3HOSA 2YU9J 3R6SA 3C2HA 3CTAA 3JAMK 2ELKA 4ENMA 3NYMA 5ERIA 1ZU4A 3UKGA 4A3MJ 3LL7A 1RUOA 1IGNA 3BPVA 5JHFA 3EUHA 1LIHA 3OYMA 1PDNC 1KTMA 2DFHA 1HLVA 4GYTA 2LSOA 4Z6YA 3H65A 3WGGA 1FFTC 3V4GA 1NU9C 5F28E 4HG2A 1VQLI 3IC7A 4QTRA 4DRHB 4PACA 1X1AA 4RM3A 4ZC3A 5M3FJ 4Y13A 2DI3A 3NARA 4YFXF 3ABKC 3Q9SA 2LKPA 5K7ZA 2ADUA 5KVRA 1LPEA 5M5YJ 2K9NA 3US6A 1IN4A 3GLLA 2FNPA 1FMVA 4EHPA 4FASD 4BEMJ 1YX3A 4RLQA 3TOBA 1M2VB 4LB5A 2KSFA 1FOKA 2ESHA 3J7ZI 2R25A 2VQHA 4JX5A 1BI2A 4BYYA 2A05A 3K1IC 2GAQA 2LBFA 1UZCA 2EZHA 4E7ZA 4O6JA 4RLFA 3N97A 2IT0A 5LRRA 1EI7A 3R61A 1X4OA 5CLSA 4G6QA 1MSFC 1IRZA 3G3ZA 5F0HA 3H2UA 2CYYA 2EPFA 1MMGA 2CQNA 5J40A 4JURI 1FX7A 3PFIA 3WE3A 2R7QA 3WTUC 5TJJA 2ZJPF 3H36A 3HKZA 4XR6A 2P6VA 5HS9A 3JRHA 3LNRA 1G5ZA 2CGEA 4CS8C 2J7PD 2XXAA 1I1GA 1X58A 2P6SA 2QKLB 3KLOA 3ZMZA 1JE8A 3J7AO 3AG1C 1Q1VA 2X0CA 1I6HJ 2EPKX 4PFPA 3DBRB 1CF7B 3QPHA 1E83A 3IAM2 1A0BA 4RAGA 4XPYA 2E1NA 5COGA 3QQAA 4LLGF 4EBBA 5BOXA 2J9VA 2HQNA 4JCHA 4YG2F 2CWEA 3GZ6A 4RD9A 1E85A 5FFZA 2HKXA 2PX0A 4MEXF 3ZWIA 1ON1A 4CDYA 1WJBA 3FHZA 1YITI 5J1YA 2XRHA 1YQAA 3QU6A 1UG0A 2VPRA 3DAGA 1FT9A 1QQIA 2WBMA 3CESA 4D0PA 3WGIA 1UAAA 2DN0A 4IPAA 3OYHA 2YVKA 4CS9C 2PI0A 2OA4A 5B5EC 3V5YA 3K70C 5D6EA 2K9LA 2XKOA 2DOAA 4FTHA 4ULVA 3VSKA 1I5NA 2BXYA 1FR0A 3DM9B 5ED4A 2EIKC 4YL1A 3ZQVA 4M3BA 2UUZA 4JEAA 3BR6A 4UHTA 1HMOA 4XLPF 3ZQQA 3B29A 1W0TA 2IJLA 4U88A 3KZYA 2Y75A 4F91B 2FE3A 3ZMUA 4QLCU 5J8FA 4UNOA 5DV5A 4IKFA 3BDDA 4YELA 3H0DA 2Q4FA 2LMDA 1ZELA 1QVTA 1TW3A 5B3SC 5JLWA 3L8JA 2IOQA 5KCMA 3GO5A 1WRJA 4A3CJ 2IXPA 1FEXA 2MFZA 2M9HA 4HOBA 2L3DA 2R7OA 3HJEA 3F3XA 3PFYA 2IRFG 2V7FA 3OYGA 5BPIA 4BQAA 1OR2A 1YJGA 1YX5A 1RETA 2KZGA 3M8JA 3U1KA 2KIUA 3ZQ7A 4XONA 4MTEA 3S1RJ 4G8XA 3F46A 3RPUD 4DZPA 2DDAA 2Y3GA 1TWHA 2ASRA 2VBWA 3C3WA 1NLXA 2HXOA 2MH9A 2EIJH 5FKLA 1UFBA 2Z9OA 1U0JA 4JOMA 4XEKA 1U5TA 5T3TA 3ESWB 3SXKA 3RH3A 4OU0A 4DVZA 4ZJZA 1WATA 4KT6A 1ZYRF 1ULYA 3HRMA 4I7HA 4EUKB 2GBYA 3MKLA 4C2MJ 3JRDA 2J9UA 2Q9AA 3GUDA 3KH2A 2EV0A 1JJ8C 3H3ZA 1CPQA 5L3VA 5IY5C 1I5ZA 2M7BA 4I98B 1X19A 4LDKA 3RVZA 4LDRA 1EJ9A 2EZLA 3QW1A 3LEVA 1R5HA 1GGQA 1SAUA 3CCJI 1GV2A 2XB5A 4U5GA 1WOLA 2WB1N 4O7GA 2X48A 1ONVA 4HRIA 1HOMA 2FMLA 3OMYA 3TW7A 4WABA 2TMVP 3DXJF 3U21A 3EG9A 2LFBA 4EJOA 1GV5A 2UUIA 4PSXA 4HF2A 2O03A 4N0BA 3ZGKA 4M9XA 1KGSA 4UVBA 1EA3A 1LFUP 2CDQA 2A61A 2R7DA 3DF8A 2EILH 4AVPA 1W36C 1TC3C 2HWVA 2HOEA 4HNVA 2NOJB 4BJ6A 2HYFA 2DODA 5KYWB 2PQ8A 2IBFA 1LE8A 3MAJA 2H94A 3I58A 3WG9A 5E8IA 2PJRA 4HFFB 1MBHA 1FJLA 1FIPA 1G8XA 1Z7LA 2CO5A 4YRVA 1TWCA 3B6CA 3VYRB 2L9JA 2DW4A 4G12A 2LP4A 3C8GB 3ONQA 4IX7A 2HJ3A 3CSKA 3QPLA 2P1AA 1KQ0A 1OR7C 4E70A 2K27A 1T08B 2OG2A 5LGUA 4EBJA 3ASNH 2AQFA 2XAFA 4DBQA 3LAPA 2NOGA 3QOEA 5EG0A 3MZHA 2COBA 3EGXB 3EYIA 4JIOA 2A6HF 1OQYA 2FUG2 4MFDA 3S3NA 4C30A 1S29A 3PQKA 3RYPA 3JRCA 1SD5A 1ZREA 1T8IA 4BQQA 3GEHA 1XN7A 4X1EA 4XOPA 3E9VA 4IRGA 2OCCH 5LHIA 3R7CA 4UDVA 2Y0SN 2ZMEC 4BL0B 3HPGA 1K61A 2ACJA 5B66C 4JZAA 3CLOA 1FTSA 2ZMEB 2NNYA 1FTTA 3MX3A 4CZZA 2LNBA 3JSOA 1T01A 4CCMA 3K9TA 4F4BA 2E2HJ 1VF9A 2RNJA 2W7NA 3FX3A 2XSJC 3CDLA 2PFBA 4MS2A 3JR9A 1RZ4A 4HF1A 4IZZA 3SXYA 3ABUA 4EM2A 3G73A 2GLOA 2CNWA 2OJQA 3CMAI 4G0HA 1OCRC 2MLKA 1OCRH 5DM6F 4UB6C 3FM3A 4IQJA 2YL0A 1M1EB 3QZCA 2JSPA 1ZR4A 3HDDA 4RM2A 4A3IJ 3QVYA 4CX9A 2JQ7A 3GTMJ 2NS0A 1KNYA 2P7CB 4W97A 3K4BA 3ZQGA 1PUFB 1VQNI 5A6KA 3CAXA 3TQOA 2X6OA 3TW6A 3FAPB 4DGWB 1E84A 2D1HA 1MNEA 3T9OA 3DP7A 1MW7A 3IKTA 2NRAC 4D9JA 3F8MA 2KNHA 3NWTA 3OYBA 3TQNA 2H1LA 1E2XA 2M8EA 3L2CA 3LOCA 1MZBA 1TWGJ 1LI7A 3ERMA 3T1BA 3ZTZA 3BG7A 2VT3A 1OLTA 4PDKA 5L3DA 2CQ7A 1KA8A 4J01A 1T6IA 2OPTA 2F22A 2WV1A 2PNOA 3EGDA 3LWFA 2G62A 4LG0A 2CV2A 3CZ6A 3UMHA 2NUPA 3JCUC 1RKEA 5BNGA 4Y3OA 3LUTB 3G4SI 4JVSA 2DCEA 2ZPAA 1XGOA 2X6XA 5LLQA 3S28A 5EEHA 4BJTA 2NNNA 3LEOA 2KRCA 4WX9A 1AVOB 2NG1A 3IH4A 5FLXZ 4K0DA 3RQGA 4GEHA 2BBYA 2X1EA 2R5ZA 3BR5A 2IVMA 3LLKA 1SFOJ 4PGHA 1L3PA 4IQ4A 2HQ5A 2ME0A 1Z3YA 2HKVA 2ESNA 3S1MJ 3IP4B 3G4ZA 1TKNA 3M7GA 3OV8A 3T6BA 2OAZA 1L3LA 3J06A 1LDKB 4OOIA 3CCEI 1I3AA 1YRNA 1KU2A 3PDMP 3UGOA 3U1DA 4HZFA 1WGWA 2PP4A 1TP4A 3I55I 4D4XA 4XEFA 4IF4A 1D0YA 2GXBA 2O8KA 2HYGD 3TGNA 2R4GA 3PNTA 4G94A 1W36D 1YOVB 2R7ZJ 3V42A 4RAYA 2EPOA 2LD5A 1VTNC 2YL1A 1YFHA 2DPUA 3B9QA 5HS8A 2BY0A 3W2AA 1U9OA 2UXNA 2W24A 1ZARA 5FLXK 3FXLA 4I1OB 3TOMA 3HSFA 5EJCA 2F4IA 3ZRGA 3ZMSA 1O7LA 1EA8A 3J7YJ 1J7KA 2W45A 3WAQA 3A01B 3TJ6A 4IRHA 5GAEJ 1V4RA 2XRNA 2HS5A 1FAPB 4U0YA 4RAZA 4ZYAA 2P61A 4J19A 4F93B 5HLGA 2E35A 2A1DD 2UZKA 3M4OJ 3IPMO 1JJ6C 2HSBA 2PX9A 3FDYA 4DQ2A 3CCLI 3OSFA 4IHWA 3GORA 1V55C 3L1MA 4I2OA 5KYNA 4M3DA 2RAEA 1MBJA 2L7AA 2MSYA 4A0ZA 3TP3A 4KNYA 1SD4A 2Q1ZB 4UVCA 4WGYA 2KL4A 5LGNA 4G7ZF 2VQGA 1YA9A 2K86A 3KETA 2V1XA 1H9GA 3RPUA 5BS6A 1A41A 2IM8A 5D6FA 1EQ1A 3TD7A 3DBLB 2GAUA 2MC4A 1LE2A 3G71I 4HQEA 3ABMC 4C3EA 1Y6IA 2Y31A 2WB1A 5E2QA 1NU7D 1SD7A 1HC8A 4F52A 1OXBA 2K4JA 4EGZA 1WZ2A 3PIOF 4IAQA 1DU0A 4A3GJ 4BE2A 2EA4A 2PMZA 2R93J 1K83J 3ASOH 2YL3A 2NS7A 1EF4A 2E5NA 1VI0A 2H09A 4LD5A 2AVKA 2JUCA 4XQFA 3C8ZA 1XSVA 4IHSA 2P5LC 2E36A 2ZJ2A 3S93A 1IDYA 3FKJA 1VQ6I 1M2VA 1K04A 2F4OB 5HDGA 5FKKA 4AWXB 4XIDA 2JN6A 4KNWA 2EFQA 3HJCA 4AM3A 3IQCA 1BIAA 5IP7J 2WVQA 3HLZA 1OQCA 3C62A 3BROA 3W6VA 4OMZA 5KYXB 4YIFA 3K1IA 5JVEA 4N06A 4NQFA 4BG0A 4E6KG 2J45A 1FY7A 1QVUA 1OCCC 5E33A 1X4PA 2XLHA 4IEJA 4BQNA 2EINC 1P4XA 3CQZA 2VC1A 3S2WA 1E3HA 2ZJRF 2XLDA 2Q7RA 1QHHD 1ZGWA 3L2WA 3Q6NA 2MABA 3H5AA 3O55A 1H0MA 1R00A 1G2HA 1Y6DA 3ZVRA 1MDMA 3GTLJ 2E5ZA 3WODF 2HV6A 2I5UA 1M2OA 2R05A 4L5JA 4CS8A 3FF5A 1FOWA 3BG3A 2P5KA 3HNKA 1K4SA 3LSTA 3S27A 3TOLA 4IL6C 2R7WA 1CF7A 1WTYA 3RQEA 2Y0SA 1I39A 1KQ9A 4HFKB 3VYWA 2XF6A 2P0NA 2GA2A 2KDOA 1GLNA 1Z3XA 2NVYJ 1A7EA 2RQQA 4OAZA 1UHMA 2QWWA 2XF7A 4ENJA 3N24A 2X1DA 4KBLA 3TK0A 1A5JA 4A6EA 1SR2A 2EJRA 2VCCA 4YL3A 4UV8A 2V1DA 3HOVJ 1DUXC 3BTLA 3HTUA 3WU1B 1B9MA 1R23A 2W1OA 3RKQA 3GTJJ 4FHTA 4MTDA 2W57A 4HDUA 3U3BA 2DA7A 1AA7A 2OQGA 1STZA 2FBIA 3B6AA 2ZNZA 2VJ5A 4A6DA 1VB5A 2QM3A 3U9MA 3U8VA 1O4XA 3GTQJ 4RDAA 2GA1A 4A3KJ 1TQGA 4B6IA 3OIPA 2YSRA 1U2WA 5FLVA 5JRAA 2K85A 5B1AC 4XQ1A 2HUJA 2RVCA 2LK2A 1J59A 2XF5A 4CS9A 2GIVA 1W1WE 1XTAA 2NXNB 4C9YA 2KLOA 2H7VC 1RNLA 3DEWA 1VYKA 3B71A 3EG9B 1I6XA 2A6TA 1NK3P 4L0YB 2KQRA 3DTKA 1FPQA 3OR2C 2OTLI 5A69A 2HZDA 5LBQA 2MWQA 1C02A 2EIMC 3E5UA 1PCXA 1YYJA 1VQPI 1K05A 2RD9A 2WWYA 4DYRA 1AHDP 3DM5A 1JT6A 4JRZA 2CW0F 4KUMA 1LE8B 2C6YA 4J7YA 2HTSA 2R7VA 4ER9A 4XLNF 3PHF2 5GP9A 2EWNA 2ZNYA 4WXCA 3WHCA 2PJRB 2R92J 1JR8A 1YLMA 1S8NA 3ML6A 2LSEA 1JUSA 5D8LB 2RN7A 3DE8A 5JP7A 2GXGA 2B0HA 3FM5A 1XGMA 4HLYA 2PMHA 3FZVA 1ZU5A 1ETQA 6PAXA 5BQGA 2E7WA 2LP0A 3LESA 3ZMTA 3REOA 4BE0A 5F04A 1QA6A 3Q0VA 2J5PA 2LH9A 3ROUA 5JFRA 1IN5A 2VKEA 4JBAA 2COMA 2ID3A 1TWHJ 5FLMJ 4GYIA 3TEDA 2WL8A 1I3QJ 2K9MA 3F72A 5EG0B 1FWZA 2ETHA 1H88C 1MNMC 5HLTA 1ZTRA 2LDUA 3DBHB 4G9YA 3OYAA 4UY8I 1TL8A 3O10A 4O6MA 3MYFA 4OIQF 1C17M 2DT7B 4HA8A 4ZZDA 4CDVA 3A2KA 1S05A 3MZYA 3DU5A 4KICA 1ERDA 2M8GX 3FMRA 3HGYA 3I4NJ 2Q9CA 1XX5A 1Q0FA 3JRAA 3BCAA 1HSJA 2RREA 5EK0A 4QI0A 4U5CE 2QF7A 4ONSA 2OF7A 1GXQA 4Y15A 3UMIA 4PK4A 1DGWY 3L2RA 4CSAC 2ECCA 2O61A 4V19K 4ZYGA 5F27A 3HRUA 4Y33A 2YKZA 2LFDA 4P9UA 1UHSA 2F5FA 2VBXA 3GVAA 3OSGA 3DLLF 1C03A 4BH9A 3RI4A 2AQEA 4ASNA 4HNUA 2FOKA 3DMDA 1A31A 3GANA 3G6EI 3FBNB 3OYCA 5B1BC 2JRMA 2E1MC 1WWPA 2F5EA 3LFKA 2HGCA 3WHNA 5IYBJ 3BRJA 3FXJA 2VPLA 3BG5A 3A4CA 2OC6A 1VQKI 1FP1D 1Z9CA 2PJPA 4D4NA 1U6HA 1A35A 3SP1A 4Q5SF 4EVIA 2FQ4A 3L0IA 1MGTA 2DMPA 3LSHA 5CQEA 1WWXA 3C8GA 2GM4A 2LF7A 1P9QC 4M71A 2IGNA 5GTIC 2DYSH 3U9GA 3TDUC 2FU4A 1TLHB 1Z0XA 1FP2A 2NS8A 3SDBA 1TWCJ 3BG6A 2HTJA 1ZKGA 2K4BA 1R36A 3I5UA 4B44A 1S3JA 2VJ4A 4X0GA 2XASA 2VQCA 2R7XA 1OR7A 1RESA 4N6HA 3CCVI 3JTHA 3EGXA 3F47A 3EGDB 3GMEA 3E3VA 1KZHA 2DA1A 1RKEB 2M4EA 1MJ9A 3M15A 4RAFA 2I8DA 5AIQA 2WZFA 2B7EA 4BXXJ 4OIRF 1Q0DA 4II3A 5IPAA 2PEXA 2QQ9A 3TOAA 3PO2J 4RMNA 4C3DA 4JJGA 2DT5A 3GM3A 4LJZF 2VH3A 2ZMEA 4Y17A 3ZOBA 1I50J 1R4NB 3S8PA 1U78A 2JK3A 1WJDA 5CYVA 1QPIA 1G4WR 3MYIA 3K69A 4I09A 4EQQA 4U5FE 4L9JA 1V54C 2KMUA 3TP0A 2IYLD 1DOWA 1TT5B 2QZ8A 3KYCB 3IUOA 2YX7A 3I4PA 1OYIA 3S90A 4IB4A 2D5RB 1WQ2A 4XWJA 1IO2A 3LSGA 4L9NA 2KIMA 4AC0A 1G3YA 3EPZA 1QPMA 2C04A 2GQQA 2OU6A 3QYFA 4O79A 1D5YA 3WG7C 2OEVA 4EMSA 4QSHA 3OYIA 1R1VA 1UB9A 2DFEA 1O3SA 2Y48A 4GRIA 3K10A 5T3WA 3ZPLA 4BJ1A 3SQNA 2L01A 3CF2A 3OIOA 1PUFA 3FIWA 1LVAA 3DCFA 1JHFA 3UGPA 2MD5A 1R9TJ 2HEOA 4WJ0A 1LE4A 2E71A 4XORA 1YI2I 2JA6J 3GWNA 2N8GA 4JTDB 4YFNF 2O7OA 5L0IA 2WAEA 1NHAA 2L7KA 4ESJA 5E3AA 3RVYA 1BN5A 2KPMA 2XDVA 1CGPA 3AGUA 3RZOJ 4M3GA 1T56A 4JYKA 3Q9VA 4BBRJ 5C4XJ 4W1UA 2ZD9A 5DQTA 3H5NA 3HB9A 5EZGA 1U3EM 3I4MJ 2ZFUA 1ETVA 5AC4A 4EJVA 3F8CA 2QSGX 1QZZA 4MLOA 5ICGA 1XGNA 3P9KA 1Y1VJ 3JTGA 1NFOA 1OXKA 2XLMA 2DJIA 3GFLA 3IWZA 5COFA 3I4UA 3HOUJ 1XSDA 4ABZA 3I64A 4XBFA 4O6YA 5FKMA 3D1NI 3MFNA 4CCOA 1ZRFA 2BZTA 3LSIA 1T38A 3CCMI 3KKBA 1Z77A 2W00A 3ABKH 2RDPA 3O8GA 1JT0A 4XRFA 3S3MA 3HUGB 3R0JA 3IRQA 4F92B 2Y3BA 1O7FA 1WI3A 1MSEC 3FHDA 4IXAA 4WGZA 4C3BA 1ZLKA 1JOGA 3LSMA 2CNWD 1UJ8A 3JSEO 1ZK8A 2R02A 2OEXA 4CXFA 2V1NA 3O6BB 5IP9J 2DOFA 1D5VA 2KJBA 2DJNA 1I1SA 1KYWA 2OD5A 3JRGA 3L34A 2KIFA 2JA2A 1JPJA 2KP6A 3ECHA 1IV8A 2LG4A 1Y1WJ 5KNLA 2MC3A 2YR2A 5TRDA 3RJPA 1GDTA 2EH3A 3BZKA 4LK1F 2HDDA 1VOMA 2KISA 4ENKA 3A01A 3I53A 2QEXI 2XHKA 2LKSA 4GXOA 5JLXA 3CC2I 1YZAA 4CBEA 1QVXA 2VLAA 2R0QC 1MDMB 3HKKA 2VL8A 4P9TA 4WXDA 5ICEA 3GEIA 1P6RA 1WH7A 3AG1H 3N4MA 1ORKA 3U2LA 2FF4A 2XLOA 4JX6A 3S14J 3RSNA 5TJ5E 5L0GA 2R5YA 2L2OA 4P55A 2YQYA 3POVA 5AIPA 2M4KA 1D0ZA 4CJOA 3NMKA 1Y8RB 1WHUA 1YJWI 1NBBA 2QY9A 3U2MA 3MWMA 1FC3A 4MQVA 3WTSC 1SF8A 4ZYHA 4YJWA 3I59B 1MIJA 2WA0A 2NVXJ 4CHUA 4XRSA 1MBEA 1VFCA 5L3BA 1Y4CA 4PJ0C 1HF0A 5CVIA 2CYDA 4U5HA 4WF2A 3WTZA 1U89A 2DGJA 3T4RA 1T6SA 4L6RA 5ILUA 4ANJA 1H6GA 4AYBN 5LRSA 3LMMA 4XKVA 2DMQA 1EH6A 3EUKL 5LFAA 4NC6A 9ANTA 1F4KA 5KYXA 3G1LA 5C44J 4MEYF 3OS1A 2EIKH 3EETA 4BHBA 3GODA 5ILSA 3GXOA 4N9HA 3LJBA 1L7CA 3O2PE 4ON0A 4QDLA 3B02A 2NYXA 2J0XA 5KAIC 3CDIA 2CUFA 4A69C 1I27A 3CF5F 3ZR8X 5HODA 3CQZJ 2HZ8A 1SFUA 2XL4A 5M5WJ 5JR3A 3KLNA 5B3SH 1Z3IX 4G7OF 4AIKA 1O3UA 3KCCA 5IYDJ 1D8JA 1MD0A 2JRTA 3BJAA 2X9DA 4M9SA 2D5VA 2H8AA 3M8FA 4RGSA 2W25A 3S29A 4ZTJA 1HCRA 4C2UA 1LS4A 3ZSUA 3E6DA 4AE4A 5BQHA 5FCLA 3OYDA 1BM9A 3K4JA 1BC7C 2VONA 2NVQJ 1APCA 2MG4A 2ZXIA 4AL0A 3LS0A 3V5XA 4Z9JA 3OR1C 3KP7A 1HKSA 3JRIA 2RSEB 2YX4A 1TWAA 4YT2A 2L9VA 2MA3A 3L2UA 1TR2A 1ORSC 1RMVA 2I10A 2L02A 2V6CA 2Y9YA 1QBJA 2KFDA 4DRJB 4HPQA 2H7OA 2LCHA 4MVZA 4XPWA 1X1DA 2BHZA 2XGCA 2VC0A 1XD7A 1IDZA 1N25A 2Y39A 3FXOA 4MO7A 3AG4C 3IEEA 5IY5H 4O5VA 4RB2C 1ZW2A 4JJFA 3MKZA 3TJ5A 5EHHA 5HOOA 2QYOA 1XCBA 3V7RA 2Z99A 3BLYA 3LAYA 1NG6A 1LB2A 3PUFA 3VPRA 1J2XA 1DP3A 5F5HA 1WSUA 4ETSA 2STWA 1QQ3A 4Z2YA 2K9SA 3H9JA 4MVSA 3FXHA 3M8EA 2VB6A 3QP6A 3U2RA 2W48A 1CGOA 3HM5A 4ITVA 3VWBA 1TZLA 2HMQA 4D1QA 1W2WA 5FFXA 2A07F 1ZHFA 2LTPA 1IN8A 4M3EA 4B4CA 1BJAA 3RF3A 2UWMA 1A36A 4BACA 2VI6A 3NKEA 3V8KA 3MQ0A 4FX4A 3F22A 3S17J 4A93J 2XLWA 4IARA 2L54A 1IRFA 2CW8A 4D7NA 2QQBA 2HNHA 4AIDA 1BL0A 4A3EJ 2NSGA 1QNTA 1SYQA 1LVKA 2DFIA 3EPVA 1K7AA 3A11A 2FMYA 3E6CC 2E87A 1AKHA 2XPVA 1Z21A 1Q0MA 3DV8A 3G1OA 3D5RC 2MGQA 3WE2A 2HU9A 2DT6A 4MIMA 2AXTC 4HYEA 1FTZA 4X0RA 3DPTA 5HNHA 2FAPB 1UMQA 2ID6A 1H9TA 3DQVC 3PL8A 3MN2A 1A7DA 1G3TA 2I15A 4FWVA 4JE9A 4R32A 4U9EA 3NWSA 4Z9HA 4V2GA 3QYBA 4BHCA 3KP2A 4MNUA 5K5RA 4UUSB 2EFOA 1D1AA 3BJOA 3KL4A 1RUNA 1P4WA 2DQRA 4J30B 2L7ZA 2L4MA 1SMTA 4U0WA 4DIQA 3RCOA 3GWLA 1OW6A 4KISA 3FWEA 5LEJA 1YW9A 2KHMA 3BTJA 3KPHA 3W6KB 3I56I 4BDYA 2RGVA 1ZHXA 3EHNA 1GVJA 1V3FA 2HV7A 5DLJA 2YWAA 5A6JA 4CJGA 1ST6A 2TCTA 3AOUA 3K70D 1BOBA 1B59A 3QPTA 3E70C
chains in the Genus database with same CATH topology
4E6KG 2CH0A 2WY7Q 2J45A 2PX3A 3ZXSA 4CH7A 5CPRB 1RJ9B 1OCCC 4U7BA 2Y69C 5D91A 1X4PA 5E33A 4YT4A 1J09A 3ZCOA 4BQNA 3UNGC 2EINC 2Z1DA 3CQZA 5DVWA 3K7DA 4CSAA 1WFXA 2QKMB 2WVOA 1D1CA 3SYTA 2KQ9A 3DD7A 1TWGA 3FAJA 3HXLA 1QHHD 3L2WA 3Q6NA 2MABA 3OEOA 5KYUA 3BC8A 4E7SA 1QU3A 2DYSC 3H5AA 2W4BA 4HEAJ 2Y3HA 4ZLCA 3B0UX 4C7OA 4CUGA 3ZVRA 1YE9A 4OIPF 1JPNA 3DPLC 2WAFA 2E5ZA 3TBIA 2HV6A 3NYJA 1M2OA 4BJ5C 3VYUB 3WODF 3S0XA 4HE8D 2Z16A 3S3OA 4CS8A 4KJZA 4W8KA 3JCUQ 4BS9A 3NG1A 3S27A 3BCBA 5DS4A 2MD0A 2R7WA 1N1CA 4XLFA 2R7SA 2Y0SA 4Y4RA 1Y56A 2NUPB 4HFKB 1J8MF 2XF6A 2W9YA 3VYWA 3F9KA 2KDOA 1GLNA 1Z3XA 3OY9A 2Q9BA 2RQQA 4M63A 3RIPA 2M4GA 4OAZA 1S9HA 2E60A 2XF7A 4PJNA 2X1DA 3KEYA 3UR3C 3N24A 4IAOA 4KBLA 1O5HA 1Z6AA 2P6VA 4XNFA 4E7IA 3JYHA 3X1OA 4YWQA 2W1OA 2VIXA 4EWCA 2IS4A 2MYSA 4XN3A 3I3LA 3KYLA 4BE1A 2CV1A 2BE5F 2WB7A 1AA7A 2HVSA 2P0WA 1MMAA 3K4KA 3AL0C 2I8BA 2P7VA 2VJ5A 2IXOA 3VDXA 3AL0B 3CP2A 4Q4ZF 2W4MA 3N0TA 2Y3DA 2BVLA 4RDAA 4A2NB 1SFKA 1N75A 4B6IA 3OIPA 4YT5A 2QTVA 2FFHA 5B1AC 2XF5A 4CS9A 2VKHA 4FETA 4C9YA 2KLOA 1N77A 1BR4A 1NG1A 3MMYB 1VYKA 2H7VC 3TD7A 3EG9B 3EHMA 2A6TA 4F3QA 2KQRA 3DTKA 3OR2C 2KW3C 2HZDA 2MWQA 1VZ0A 4BDZA 3EQLF 1WJ5A 2KGOA 3C2GA 1PCXA 2EIMC 2A5WA 1ZHZA 4NC7A 1VYIA 3I5QA 3I5PA 4LLEA 4KITB 3DM5A 2WVNA 4OD5A 2VXZA 4I44A 1PJRA 1OCZC 2CW0F 3DJNB 2EIJC 3DAFA 2V26A 1ZHTA 3HOSA 3KX2A 2M3AA 2R7VA 4Q7CA 3C2HA 4XLNF 4BU2A 3PHF2 2BW3A 1O87A 2PJRB 3NYMA 4CCJA 1ZU4A 3MKYB 2LSEA 1SMYF 2OUMA 4IRUA 3LL7A 3HL2A 4LITA 5HNFA 5JHFA 4XKWA 4XN0A 3OYMA 4OIOF 3HG9A 1ZU5A 2R7RA 4GYTA 2NUTB 3H65A 3LESA 1FFTC 4BE0A 4QI2A 1NU9C 3NDBB 4HG2A 3H5RA 4B43A 2HVRA 1OKKD 4NUBA 2VJJA 1WJCA 1X1AA 2LH9A 2X51A 4LIVA 4RM3A 4XLAA 4ZC3A 3EH2A 3SP1A 4CCKA 2WL8A 4AU7A 3OL4A 2K9MA 3ABKC 3OYJA 5HLTA 3MLGA 1LKXA 3FBIB 1QHGA 3OYAA 4O6MA 4OIQF 1FFHA 2DT7B 3K33A 3AG3C 1FMVA 4II2A 3NRHA 4RBNA 4FASD 5FRMA 3DU5A 4E4HA 1ERDA 2HVQA 3DTEA 1YX3A 3M1CA 3OL3A 4RLQA 4PJJA 1M2VB 2EILC 4BEJA 4LACB 2Q9CA 2VQHA 3BCAA 3DEEA 2RREA 2LBFA 3DJUB 1D0XA 3K1IC 4QI0A 4U5CE 4E7ZA 1S7ZA 4RLFA 2HPMA 4E7KA 1MMDA 1T95A 4U87A 3CP8A 3UMIA 4PK4A 1X1BA 1X4OA 1DGWY 2K3PA 2LREA 2M7AA 2IGKA 3L2RA 4CSAC 2GOMA 1MMGA 4Y33A 4JURI 3VSLA 2DYRC 2Q2EB 3RYLA 2R7QA 3Q7GA 4O6NA 1T0FC 3HKZA 3O39A 2AQEA 4XR6A 3QODA 2GOXB 2V9KA 3G2BA 2V4JC 4HNUA 3OS2A 1JI8A 2WY8Q 3FBNB 3OYCA 1WJFA 1OCOC 5B1BC 3VAYA 4C7OB 2E1MC 3LNRA 2CGEA 4CS8C 3B0PA 3K4LA 2J7PD 2XXAA 2VKDA 3GBGA 2OV7A 2IS1A 2QKLB 1HA8A 3AG1C 2VPLA 3ASNC 4BXFA 3A4CA 2OC6A 4HSTA 3SNHA 2VQLA 4PFPA 5BUOA 2JVHA 2IS6A 3QYEA 4I1MA 3RKOF 4Q5SF 4BG0A 3IAM2 2FGYA 3L0IA 4E7HA 3LSHA 5CQEA 3W8HA 4H4KC 2OCCC 2L9NA 1P9QC 4XTKA 3LLIA 2IGNA 2WADA 4EBBA 1Z5ZA 1NZEA 2J9VA 4JW1A 2X85A 2A69F 1V5GA 4G6TB 4JCHA 4MQ9F 3SDBA 3BG6A 2ELJA 4X0GA 2R7UA 4RD9A 4B44A 2VJ4A 3K6GA 2PX0A 4KNVA 2VQCA 3ZG1A 2R7XA 4PSWA 2ZSIB 5HVQC 4AE4B 4NNJA 3EGXA 3F47A 1WJBA 3EGDB 2XRHA 1D1BA 3EFOA 4CCLA 4B47A 3VYTB 2ZXWC 1UG0A 4P5OA 3SZRA 2M4EA 3DAGA 3L2VA 3OWTA 2WBMA 3CESA 2I8DA 1UAAA 2WZFA 4MNDA 1QZXA 4OIRF 4II3A 5KHDA 5FRNA 3OYHA 4RMNA 3D5LA 3DKYA 3ABLC 4C3DA 4CS9C 4JJGA 4CIHA 1WJEA 2VH3A 3K70C 2K9LA 5LD2C 2DOAA 1IW7F 3S8PA 1WJDA 3VSKA 3IAS2 4CZCA 5KYYA 3O6XA 3EUAA 3DM9B 2EIKC 3HTKC 4U5FE 1V54C 2UUZA 2KMUA 2A6EF 3KMIA 2IYLD 3K1HA 4XLPF 3I9V2 3ZQQA 3IUOA 4AYBA 3X2QC 4F91B 3HPHA 2D5RB 2CFOA 3L2QA 1WJAA 3PNYA 4P1WA 4IKFA 3H0DA 4YELA 4ULWA 3LSGA 4XWJA 5CI8A 1ZELA 3EPZA 3VYSB 5B3SC 2C04A 2IOQA 3QYFA 4O79A 2ZSHB 5KCMA 3WG7C 2XSEA 2IXPA 2MFZA 2BW3B 3OYIA 3PFYA 2R7OA 2J7PA 2V7FA 4GRIA 3K10A 3OYGA 5T3WA 4BJ1A 1YX5A 2RNGA 2X6WA 3D5SC 3CF2A 3EUHC 3M8JA 4OD4A 2DXIA 1MNDA 4XONA 3SEQA 1G59A 3UGPA 5HSWA 1V5FA 3F46A 5CI9A 3RPUD 2Y3GA 4CSWA 1QLEC 4N4NB 4WJ0A 2X6YA 2CW7A 1TWHA 4XORA 4DBRA 2LY2A 4F55A 2XC7A 3N2ZB 4NC8A 2WAEA 2L7KA 3DTIA 2LC2A 5E3AA 4OWRB 1Z23A 2CUZA 3DPUA 1U0JA 2KPMA 2XDVA 3LFUA 4JOMA 4XM3A 3PJRA 5T3TA 3RH3A 4DVZA 4ZJZA 4KT6A 1ZYRF 5DQTA 3H5NA 2ZFUA 3TMOA 1LFPA 2J9UA 4LERA 1SZIA 2Q9AA 3KH2A 4MLOA 4OAYA 2YEVA 2DJIA 4FX5A 3I4UA 5L3VA 3K4NA 5IY5C 2M7BA 2G3VA 4O6YA 4ZDOA 2LOOA 1X19A 2B0JA 4XKCA 1X1CA 2ZXOA 2LBFB 4CCOA 3LEVA 3LSIA 1SAUA 3S32A 4U5GA 1MMNA 2ZXHA 3KKBA 1PD1A 2W00A 4O7GA 4ZLDA 4HRIA 3DWLE 3OMYA 2CV0A 2G3KA 3S3MA 3U21A 3OIQA 3H35A 3DXJF 3EG9A 1ZHWA 3HUGB 4PSXA 3UMKA 4B48A 4F92B 4NQWB 2Y3BA 3OYNA 1LS1A 3FDQA 3ZGKA 3FHDA 4ZDPA 1EA3A 2CDQA 3FHNA 4C3BA 4HEA2 3LSMA 1W36C 2CNWD 3W2VA 4BEHA 4BJ6A 2NOJB 3K66A 5KYWB 2V1NA 2HQAA 2Q3TA 2R7TA 3EH1A 2XXAB 3L34A 1K6YA 2JA2A 5TGTA 2KP6A 1JPJA 3DZAA 2LG4A 5KNLA 1Z63A 2W4SA 2PJRA 4HFFB 3K4CA 2KRHA 2V6EA 3OYLA 1VOMA 1G8XA 1Z7LA 2KZVA 4LG3A 4YRVA 1TWCA 3VYRB 2L9JA 4CBEA 2LRDA 5KYUB 4DVYP 5F5FA 3ONQA 4IX7A 4PJLA 3CSKA 2YZSA 2VLAA 4NY3A 1OR7C 4HSRA 2VL8A 2OG2A 2AQFA 3Q6MA 4P6IC 2E1MB 4DBQA 4K7BA 3QOEA 3EGXB 4OINF 3ASOC 3PUBA 1NG7A 2KJGA 2A6HF 2FUG2 3EFOB 4AK9A 3RSNA 3S3NA 3E1SA 4C30A 3DKXA 5DS6A 2L2OA 1FMWA 1BR2A 3LSKA 4BQQA 2M4KA 1D0ZA 4XOPA 1PD0A 3E9VA 3POVA 1R6RA 4U5DE 3HC7A 2O9XA 2VJIA 3TL4X 3FVYA 4BL0B 3HPGA 5L3QA 3ZC4A 2QY9A 1UELB 2F6CA 4JZAA 5T1DB 1FTSA 1OKKA 1SF8A 4YJWA 4KC9A 3MX3A 2WA0A 3PSFA 4CCMA 2J46A 3PMRA 5CQGA 4F4BA 2JUGA 4YEJA 2H7BA 2W7NA 4U5HA 3MKWB 4CCNA 2W82A 2XSJC 2DGJA 3T4RA 4XLHA 4G7HF 2VXDA 3K4MA 4ANJA 4IZZA 2IXMA 4U5BE 5EGYA 2CNWA 3LMMA 4XKVA 4G0HA 1OCRC 3AQCA 4IQJA 4YN0B 3EUKL 3CJQB 2YHSA 5LFAA 4HNTA 3W2WA 3QZCA 2V3CC 5KYXA 2JSPA 3V7OA 4RM2A 3OS1A 1E0EA 2Z2SB 3GODA 1RJ9A 3OOUA 3JSZA 1KONA 3Q7LA 3K4BA 3LJBA 3OYEA 4I3MA 3MD2A 4QDLA 2J0XA 4DGWB 2O5RA 4AVZA 3DLAA 1MNEA 3OYFA 3ECSA 4IJJA 4IWBA 4CS7A 1MW7A 3EZHA 3ZR8X 2ZXRA 4D9JA 3W3CA 1BR1A 2XL4A 3OYKA 2KNHA 3NWTA 1Z3IX 3OYBA 4G7OF 3ZIBA 3BG7A 4R79A 1OLTA 4J01A 4C2TA 3S29A 2WAQA 3HOTA 4ZTJA 4LIUA 4C2UA 3ZSUA 2K5CA 3W8IA 4AE4A 4BJ5A 5FCLA 3OYDA 3EGDA 4KI2A 2G62A 3K4JA 4N4OB 3CZ6A 2CV2A 3EZIA 3UMHA 2F5VA 2BOLA 2NUPA 4Y3OA 4ZDLA 4JVSA 4U5EE 2DCEA 2ZXIA 3RTRA 2L9SA 2PF4E 2ZPAA 2X6XA 4B3XA 3LS0A 4FESA 4BJTA 3S28A 3H9GA 3PSIA 3OR1C 2KRCA 4CA0A 3T6JA 1TWAA 4XL9A 4YT2A 2NG1A 2X1CA 3L2UA 1TR2A 2A68F 2C03A 4K0DA 4GEHA 2X1EA 3LLKA 2M0MA 4IQ4A 4PFOA 4DOZA 4XLEA 1VK5A 4HPQA 1Z3YA 2H7OA 3IP4B 1X1DA 4BQOA 1TKNA 4J32B 3T6BA 1IRXA 4PUSA 4XKBA 1VMAA 2J0WA 4LLCA 3J7AY 5DS5A 5CKTA 4BJ6C 2Y39A 1LDKB 2CS3A 3M1CB 1KU2A 3UGOA 3AG4C 3IEEA 4XMYA 1WGWA 4XLCA 2PP4A 4BEHB 4JJFA 3MKZA 5EHHA 2IXNA 1D0YA 5HOOA 4XOTA 2R4GA 3PNTA 2IGMA 1W36D 3BLYA 3LAYA 1NG6A 3V42A 3N05A 4JQFA 3B9QA 1DP3A 5F5HA 4YT8A 3W2AA 3E0JB 3SYNA 2HPIA 4DJAA 3AKZA 4I1OB 3H9JA 3ZRGA 2F4IA 3AFHA 3DMDA 3GANA 2VB6A 2XAUA 2W45A 3B0VC 4AX2A 2JVGA 3OS0A 4ITVA 3CJRB 3VWBA 1TZLA 4ZYAA 3K6BA 2IS2A 2PFDA 4F93B 4D1QA 1IZMA 1W2WA 3RFYA 2A1DD 2IXSA 3AQBA 2UWMA 2VASA 4BGDA 3FDYA 4BACA 3LS1A 1V55C 2JD3A 1PYVA 1N78A 3NKEA 3DU6A 5KYNA 2CW8A 4E7JA 3OA1A 2HNHA 2HDWA 2J9WA 3RQ4A 1M56C 2GFHA 3JRTA 4QPQA 1LVKA 2Q1ZB 2KL4A 3EPVA 2LYCA 4G7ZF 2E87A 2VQGA 2L81A 2WZGA 1Z21A 3SZGA 4ZTFA 3NKDA 3D5RC 4E7LA 3JT1A 2HU9A 2DT6A 4PJMA 4X0RA 2NUTA 2MC4A 2UV1A 1V5EA 1ZHYA 1DGRM 3ABMC 4C3EA 3DPTA 5HNHA 1Y6IA 4QPOA 2WB1A 5E2QA 1NU7D 2ZXPA 4F52A 3ITFA 3PNVA 4BUPA 5D92A 2CMPA 3DQVC 3CMMA 2WZLA 3PL8A 4BE2A 4FWVA 2PMZA 3H9QA 3NWSA 3EJNA 2E5NA 1J8YF 3SEZA 3QYBA 2Z15A 4J00A 3SEOA 4XQFA 2IGOA 2BVMA 1M57C 1D1AA 3KL4A 3S93A 4J30B 3FKJA 1DQUA 1M2VA 3AG2C 3QMKA 4DIQA 3RCOA 4KISA 4KNWA 4EATA 2KHMA 1TT0A 2CUJA 5FROA 4BDYA 3HJCA 3NYLA 1ZHXA 2L5QA 3EHNA 2HV7A 2LY1A 5E3CA 2WVQA 5DLJA 5KYWA 3HLZA 5DQZA 3A1YA 1ST6A 5KYYB 5KYXB 3K70D 1BOBA 4N06A 3A2KA 3E70C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K6G A;  4BJT A;  3CZ6 A;  3OWT A;  4BJ6 C;  4BJ5 C; 
#chains in the Genus database with same CATH topology
 3TDZ C;  1RJ9 B;  3WGH A;  5D91 A;  4U7B A;  2Y69 C;  4YT4 A;  4CYC B;  5HS7 A;  1J09 A;  2TDX A;  5H20 A;  3GTG J;  2DB4 A;  1T33 A;  3UNG C;  2XLE A;  1SFE A;  4CSA A;  2CG4 A;  3E97 A;  1WFX A;  2QKM B;  4RGX A;  2V9P A;  3K7D A;  5JLI A;  2KQ9 A;  3F0C A;  5DD4 A;  3ZQI A;  1AEP A;  3L9F A;  2LIG A;  3OEO A;  5KYU A;  3BC8 A;  4E7S A;  2XV4 S;  3RFY A;  1CGM E;  2M1B A;  3MVP A;  1LI5 A;  3QW0 A;  2ZC2 A;  2WAF A;  3TBI A;  3IQT A;  4BJ5 C;  3VYU B;  2JPC A;  4HE8 D;  2Z16 A;  4N4W A;  2NPU A;  2NAZ A;  3BR0 A;  5LHH A;  3JCU Q;  2G7H A;  2CRG A;  4BS9 A;  3VEP A;  1NK2 P;  2R03 A;  1HQC A;  3A0H C;  4M74 A;  3LNQ A;  1N1C A;  3GEE A;  2ME6 A;  5L3E A;  1WGX A;  5K7F A;  4XPX A;  5L0F A;  1D8K A;  4Y4R A;  4NDL A;  3F9K A;  4GDF A;  1VLT A;  2Q9B A;  4M63 A;  1W5T A;  1YW8 A;  1S6L A;  2E60 A;  1BW5 A;  4I0B A;  5ILV A;  1G4D A;  1O5H A;  2H6B A;  4E7I A;  5EYR A;  1TQI A;  3HGG A;  2FA5 A;  2Y0M A;  4WK8 F;  4S05 A;  1WN0 A;  5FJ8 J;  4XN3 A;  3VF0 A;  1EH7 A;  2PBI A;  1IXR C;  5C4J J;  2Y2Z A;  2CV1 A;  5FKO A;  2HVS A;  2P0W A;  1HMD A;  2KKO A;  2UXX A;  2I8B A;  5CIV A;  1S7E A;  4R8H A;  3HOY J;  3S2H J;  1E3O C;  2BV6 A;  2V1U A;  2Y3D A;  1O3R A;  1T98 A;  3HOZ J;  1SFK A;  3N0T A;  2QTV A;  3MEX A;  2FFH A;  3PM1 A;  2VKH A;  1F43 A;  4EV0 A;  3GF2 A;  2J5O A;  4FET A;  4KA4 A;  3SHF A;  3JZ0 A;  4GQH A;  5F08 A;  3HRT A;  5K7H A;  2D2W A;  5A2Q Z;  3ZN0 A;  4B8X A;  2CJJ A;  3A02 A;  5DS9 A;  2JMW A;  3HTS B;  3EQL F;  1YTY A;  1QGP A;  2KGO A;  2WC2 A;  3O8H A;  5J3L A;  2H27 A;  4OD5 A;  5E1Z B;  4KIT B;  4JKV A;  1XC5 A;  4I44 A;  1U9N A;  4LOC A;  3HHH A;  1OCZ C;  3DJN B;  3DAF A;  2CQX A;  2V26 A;  2L0K A;  2JA5 J;  4RB1 A;  4BU2 A;  1YO5 C;  3ZQH A;  1O87 A;  1GHC A;  4CCJ A;  2DDB A;  5COM A;  3MKY B;  2OUM A;  1YAU O;  4Y7N J;  1ITY A;  4AUX A;  2E1C A;  5A2Q K;  1UST A;  4XKW A;  4XN0 A;  4OIO F;  5DYM A;  5EZH A;  3RQI A;  2KK1 A;  1RC9 A;  3HG9 A;  3C8G D;  5E8G A;  1OYY A;  2NUT B;  3VRC A;  2JTV A;  3DFG A;  4KIB A;  3F8N A;  1O3T A;  4XEV A;  5HLI A;  1OKK D;  4WCG A;  2HVR A;  4ZZL A;  4NUB A;  2VJJ A;  2X51 A;  4LIV A;  1V55 H;  4XLA A;  3KZI C;  4MTO A;  3HSR A;  4A0Y A;  3CME I;  3OL4 A;  1JGG A;  1JKQ C;  2YLG A;  3CO7 C;  4IGG A;  3OYJ A;  3RIR A;  3MLG A;  1LKX A;  2BY2 A;  2FD5 A;  1RRJ A;  2GXA A;  3K33 A;  3HHG A;  3M07 A;  4JX4 A;  2R5Y B;  3AG3 C;  2Q0O A;  2A0B A;  3NRH A;  4RBN A;  1I4Z A;  4E4H A;  2HVQ A;  3DTE A;  3OL3 A;  3SZP A;  1F1M A;  4M3F A;  3RKY A;  3ABM H;  4MVQ A;  1WVR A;  3DEE A;  2EA2 A;  3JRM O;  2MBF A;  1YHQ I;  2HPM A;  2DA4 A;  1MMD A;  2JPB A;  2D1V A;  1T95 A;  1JRA A;  2L6H A;  3CP8 A;  3KYJ A;  4LFU A;  1CPR A;  2M7A A;  1U6G A;  2LRE A;  2IGK A;  3FXQ A;  4GCV A;  3T5X A;  2XM4 A;  3P7N A;  1ZAO A;  3HUG A;  4A5N A;  1VQ4 I;  5AON A;  4BHP A;  1G6N A;  2EV5 A;  2DYR C;  2Q2E B;  4U0V A;  3Q7G A;  4JTC B;  4EBK A;  3ZN1 A;  1FYL A;  4KDP A;  2EB7 A;  1I4Y A;  3RYR A;  1XMA A;  1IN6 A;  1T2K A;  3QOD A;  2GOX B;  2V9K A;  3G2B A;  1R71 A;  2B0J A;  3OS2 A;  4C7O B;  3VAY A;  5ICC A;  1J5Y A;  2GWW A;  4LLL A;  3SXM A;  3GCM A;  1R5G A;  2OV7 A;  3CMY A;  2IS1 A;  3BP8 A;  1HA8 A;  5CJ9 A;  4BXF A;  1OCC H;  2AO9 A;  2QQ8 A;  4KN7 X;  5KK1 A;  1B9N A;  4HST A;  4KMU X;  1Q1H A;  5L3G A;  3FK7 A;  2EIN H;  1JKR C;  3BJ6 A;  2JVH A;  5D5W B;  3QYE A;  4IHT A;  2IS6 A;  4IOC F;  2FGY A;  3U0C A;  4E7H A;  1LM3 B;  2DPD A;  3BR3 A;  3W8H A;  2L9N A;  4XTK A;  2JT1 A;  2WAD A;  4U9D A;  1Z5Z A;  3VOD A;  3VM6 A;  2A69 F;  1V5G A;  2ZB9 A;  4G6T B;  4MQ9 F;  3CCQ I;  3CLQ A;  4IHY A;  2HZT A;  1U8R A;  2QNL A;  2ELJ A;  2R7U A;  3ZG1 A;  4KNV A;  3CUQ A;  4OMY A;  4PSW A;  3CJT B;  2VE9 A;  5HVQ C;  3KIO A;  4AE4 B;  2RKH A;  1REP C;  3WU0 A;  1D1B A;  1BIB A;  2EFN A;  4B47 A;  2WAQ N;  3VYT B;  1YJN I;  1YYV A;  2ZXW C;  4P5O A;  3BPX A;  5FD6 A;  3SZR A;  1Z1D A;  3L2V A;  5F0F A;  1SC7 A;  1QZX A;  3ERE D;  4RGR A;  5KHD A;  1FIA A;  5FRN A;  2ISY A;  3JYY A;  1B4A A;  3ABL C;  3ABL H;  4CIH A;  3HNI A;  1F9N A;  1WJE A;  2FNA A;  2HOA A;  3ZQF A;  5LD2 C;  4EIY A;  1H7I A;  3I59 A;  1G4U S;  2GDC A;  2R9R B;  5KYY A;  3IAS 2;  2QBY A;  3HNL A;  4HV5 A;  3SDG A;  2VBZ A;  3HTK C;  3ZMD A;  2A6E F;  5E3O A;  1BJZ A;  3TUL A;  2NVU B;  3K1H A;  1Y39 A;  2BY3 A;  5CVR A;  3HPH A;  1R5I D;  2CFO A;  2VKV A;  3V7S A;  4A3L J;  1FBU A;  3PNY A;  2YS9 A;  3KEO A;  2DA5 A;  5B1A H;  1FYM A;  1EKY A;  3VYS B;  5CVJ A;  1VQM I;  1TW2 A;  5E17 F;  3QAH A;  2BW3 B;  1X3U A;  5KAF C;  2EPN A;  2RNG A;  4FE4 A;  3D5S C;  3HOW J;  1OPC A;  4CO8 A;  3KFW X;  1JKP C;  4CSW A;  2EIM H;  1QLE C;  1XSX A;  2X6Y A;  1HXD A;  4M9Z A;  1ENH A;  2AP3 A;  2LY2 A;  1QZY A;  4F55 A;  2XC7 A;  3N2Z B;  2CSO A;  2LC2 A;  1Z23 A;  5JSL A;  2CUZ A;  3DPU A;  2LKX A;  3LQQ A;  4DW6 A;  4XM3 A;  2XRL A;  1PUE E;  3PJR A;  2E34 A;  3DEU A;  2Z5U A;  3KP5 A;  1X2M A;  1ZGJ A;  3KEQ A;  1XPX A;  2YLI A;  4ZYD A;  1UG2 A;  4LER A;  1HST A;  4EM1 A;  5F1J A;  1AKH B;  3JRB A;  2PLY A;  1WKM A;  4FX5 A;  3LSP A;  3ELK A;  3K4N A;  1YG2 A;  4YII A;  4EM0 B;  4S0H B;  4CGZ A;  2XS1 A;  2LOO A;  1S7O A;  3K1M A;  4XKC A;  3BWG A;  2A5Y B;  3L1P A;  4DJ9 A;  3I71 A;  1X1C A;  3GW2 A;  1JUM A;  5BPD A;  5IT9 Z;  2ZXO A;  3K1N A;  3S32 A;  3IHU A;  3ABT A;  1GT0 C;  1MMN A;  2ZXH A;  1NH3 A;  1PD1 A;  3BT9 A;  4ZLD A;  3R4K A;  2LF8 A;  3DWL E;  4C3H J;  2CV0 A;  2G3K A;  1TWA J;  3OIQ A;  1L0O C;  1TNT A;  1YW7 A;  1A04 A;  3H35 A;  3M4C A;  1ZHW A;  2ZCW A;  5D5X B;  4B48 A;  2JJ7 A;  4NQW B;  3UMK A;  3FDQ A;  3M1E A;  1ORJ A;  1ZZP A;  4HF0 A;  4WWC A;  1WH5 A;  3FHN A;  1DP7 P;  4G78 A;  2NVT J;  3W2V A;  3JSP A;  1B68 A;  3A9C A;  3K66 A;  3Q0U A;  2F5C A;  2HQA A;  1ZW3 A;  2AWC A;  3HKZ N;  1G3S A;  5IT9 K;  4RB3 C;  4UUT A;  4A3D J;  2KDZ A;  2EPL X;  2IPQ X;  2L4A A;  2O3F A;  5TIS C;  1MKM A;  3L7W A;  1Z63 A;  2W4S A;  3RKX A;  2QGU A;  1G3W A;  2KRH A;  2V6E A;  3M79 A;  3WU2 C;  2KZV A;  4LG3 A;  1IJW C;  1R49 A;  1Z6T A;  5FB2 A;  1UCR A;  2LRD A;  5KYU B;  1MH3 A;  3KYD B;  4PJL A;  2Z33 A;  1GS9 A;  2IBD A;  2HFI A;  5B1B H;  4NY3 A;  2W85 A;  5GAH J;  4HSR A;  4BXU A;  3Q6M A;  4P6I C;  3IRR A;  2E1M B;  5J4Y A;  1WI9 A;  4MVO A;  4K7B A;  4OIN F;  3PUB A;  1NG7 A;  2XVC A;  2KJG A;  5F1R A;  3EFO B;  2G7U A;  4AK9 A;  2DA6 A;  1FYK A;  1PD0 A;  1HY5 A;  1F5T A;  3ATP A;  3HC7 A;  3FVY A;  4QI2 A;  1KU9 A;  5L3Q A;  2ZFW A;  1UEL B;  2F6C A;  3JRF A;  5T1D B;  1IRG A;  1OKK A;  3LNM B;  2RV8 A;  2RC4 A;  3TO9 A;  4PZJ A;  1FLI A;  2A3S A;  4K1O A;  4KC9 A;  2OU2 A;  3PSF A;  1T5O A;  2J46 A;  3JW4 A;  1VQ8 I;  5CQG A;  1XMX A;  1EV7 A;  2JUG A;  4YEJ A;  4YFK F;  2H7B A;  3AGT A;  3MKW B;  1W0U A;  4CCN A;  4XLH A;  4UUS A;  4EJU A;  4G7H F;  1EKE A;  2VXD A;  2IXM A;  5EGY A;  1FSH A;  3HEF A;  1JHH A;  4EEF G;  1IC8 A;  4KIF A;  3AQC A;  4A5M A;  1Y8Q B;  1TQM A;  2LQG A;  4HNT A;  3W2W A;  2V3C C;  4RS8 A;  5DUI A;  1QKR A;  4CIP A;  1RJ9 A;  3OOU A;  1V54 H;  3JSZ A;  1IZ1 A;  1E3P A;  4CYC A;  3S9O A;  3OYE A;  4IHV A;  1PP8 F;  3RDI A;  3U8P A;  4IJA A;  5A6B D;  2EV6 A;  2O5R A;  4AVZ A;  3DLA A;  3OYF A;  3ECS A;  4IJJ A;  4IWB A;  1LJ9 A;  4LLN A;  1K78 B;  4CS7 A;  2XSD C;  2ZXR A;  3W3C A;  1BR1 A;  3GTK J;  3E6M A;  1SVO A;  3F8F A;  3H3V K;  1SAX A;  1VQ5 I;  1ZRC A;  3WG7 H;  3ZIB A;  5J4V A;  1MJA A;  2E19 A;  3OOP A;  4RA2 A;  1YA7 O;  4C2T A;  2WAQ A;  2HDC A;  1ETW A;  4LIU A;  4BJ5 A;  2K5C A;  3W8I A;  4UB8 C;  1T6U A;  3I0T A;  3H0G J;  4N4O B;  1B8I B;  1BI1 A;  2F5V A;  2BOL A;  1BOA A;  4V2F A;  5E3L A;  4RDU A;  3NEU A;  4ZDL A;  4NTF A;  4MFE A;  3RTR A;  1MH4 A;  4FES A;  1ODD A;  3T6J A;  4CA0 A;  2DOE A;  2DTZ A;  1S5L C;  3VFZ A;  5DCM A;  1BA5 A;  3V8L A;  3RKW A;  4MTF A;  5H6Q A;  1Y0N A;  2CFX A;  4DOZ A;  4XLE A;  1OKR A;  4C3I J;  5DD8 A;  1PP7 U;  4BQO A;  5L0D A;  1YS7 A;  4XKB A;  1VMA A;  4LMY A;  2J0W A;  2L6F A;  5DS5 A;  4NTA A;  4TV7 A;  2ELH A;  3BY6 A;  4P9F A;  1APL C;  2KYH A;  4I0A A;  4XMY A;  4BEH B;  1ON2 A;  3HBL A;  5IT3 A;  2GA0 A;  2X0L A;  4AL1 A;  3WTX C;  4BPM A;  3IV5 A;  4JQF A;  5DEQ A;  1ZVZ A;  2DK8 A;  4DNC A;  4MVU A;  4YT8 A;  4LB6 B;  2JZY A;  2HPI A;  2HKO A;  4UVA A;  4DJA A;  5D5V B;  3NAU A;  1LEB A;  1ETK A;  2EK5 A;  1DDN A;  3R2P A;  5F0C A;  4EJW A;  3KP3 A;  1CGN A;  2CU7 A;  2E7X A;  1V4A A;  3L09 A;  3TO7 A;  3B0V C;  4AX2 A;  2JVG A;  3CJR B;  5EGO A;  4O3M A;  4XSX F;  2PFD A;  3BEH A;  4L5I A;  2P6T A;  2VE8 A;  3SNH A;  2IXS A;  2EBI A;  1FNN A;  2PN6 A;  2JA7 J;  1OW8 A;  3BOQ A;  5JVG F;  1PYV A;  4D5C A;  1ZR2 A;  3DU6 A;  1N78 A;  1QPU A;  1Z05 A;  2JD3 A;  3PCV A;  2M5W A;  4E7J A;  3OA1 A;  2CQQ A;  2HDW A;  2HYJ A;  4DYQ A;  3RQ4 A;  4ENN A;  5BMZ A;  2GFH A;  2J9W A;  3F6O A;  4QPQ A;  3JRT A;  4DRI B;  2ZJQ F;  1RKT A;  3BR1 A;  2CCY A;  4I99 C;  4AIH A;  3GLX A;  2LY9 A;  1X1P A;  2AWY A;  3C63 A;  3HOX J;  3SZG A;  5D5U B;  4E7L A;  4PJM A;  3IQ5 A;  2NUT A;  1ZHY A;  2UV1 A;  1V5E A;  1DGR M;  3CUQ C;  5L0H A;  2K40 A;  3ITF A;  1VTM P;  1FSE A;  2F5D A;  1TFO B;  3CUQ B;  1GM5 A;  5D92 A;  3CMM A;  3QU3 A;  4CYD A;  1UFM A;  2WZL A;  1XG1 A;  3A0B C;  4KFC A;  1WPK A;  3EJN A;  3S1N J;  2M64 A;  2Z15 A;  4IHX A;  4JEB A;  3W6J B;  2QA4 I;  3SEO A;  5JT4 A;  3KP6 A;  5CVV A;  4KMF A;  4Q47 A;  2M2E A;  4A3J J;  2EPM X;  4E17 A;  1OCT C;  1GUU A;  4EAT A;  5FRO A;  2CUJ A;  1R4M B;  4GGG A;  2L5Q A;  1DPR A;  5J1R A;  3DKA A;  3ZTM A;  4QWQ A;  1RPW A;  5KYY B;  3L00 A;  2QBY B;  1UG7 A;  4NBQ A;  3SFI A;  2CH0 A;  2PX3 A;  2D45 A;  1JTX A;  4MVR A;  1ETO A;  5DVW A;  1AUE A;  1FOY A;  3WHB A;  2Q2E A;  3J80 Z;  1PV3 A;  1EH8 A;  1D1C A;  3TKY A;  3DD7 A;  1OCP A;  1FNT c;  3FAJ A;  3HXL A;  3RYL A;  3T0Y A;  4B3A A;  2VUM J;  5D4S A;  2PMU A;  3QWL A;  1QU3 A;  4HEA J;  4E18 A;  4ZLC A;  5B3I A;  3B0U X;  4C7O A;  3B73 A;  2EZI A;  1XZP A;  1W7P B;  3TO6 A;  4ZH4 F;  1JPN A;  3HSE A;  3NYJ A;  4H54 A;  3U9J A;  5E3M A;  2XB0 X;  3HRS A;  3F23 A;  5F6F A;  4KJZ A;  4W8K A;  3CD6 I;  4C3J J;  3BCB A;  2MD0 A;  1RKW A;  2OQR A;  2XM0 A;  4RBO A;  2H6C A;  1J8M F;  5FD5 A;  4ZYE A;  5J6X A;  3IL2 A;  3K2Z A;  3OY9 A;  3J80 K;  3EDP A;  1GXP A;  4FX0 A;  2M4G A;  5M5X J;  5L3C A;  1S9H A;  4BY7 J;  4EJT A;  4PJN A;  2OTJ I;  1HE1 A;  1E86 A;  4PCQ A;  5FGM A;  2HMZ A;  3JYH A;  3X1O A;  4YWQ A;  2W84 A;  3CCY A;  4HAM A;  4I01 A;  3PO3 J;  4ESF A;  2VOD A;  2VIX A;  3SZT A;  3JRE A;  2DMN A;  5E79 C;  1H89 C;  3I54 A;  3DI5 A;  2O0Y A;  2IS4 A;  2K02 A;  3G50 A;  2BE5 F;  1MQV A;  3Q0W A;  4A12 A;  4IRI A;  2K7L A;  3AL0 C;  1AOY A;  4FIS A;  2R7F A;  2P7V A;  2VN2 A;  3VDX A;  2DLL A;  4Q4Z F;  3AL0 B;  2H1K A;  2BVL A;  4G6D A;  5A6A A;  4YT5 A;  3IH3 A;  1OIS A;  2IA0 A;  5LGT A;  4Y52 J;  3GYH X;  3FKI J;  1BZ4 A;  2VOP A;  2PG4 A;  1SVM A;  3MMY B;  1QZE A;  2AXL A;  1YYX A;  3EHM A;  2BXZ A;  4F3Q A;  3DE9 A;  1HDD C;  2KW3 C;  2OBP A;  4P96 A;  3CC4 I;  1V74 B;  1X3Z B;  2FSW A;  1VZ0 A;  2IAI A;  4BDZ A;  2TRT A;  1WJ5 A;  3F21 A;  3AG4 H;  3C2G A;  3T8R A;  3I5Q A;  1ZHZ A;  3Q3S A;  1VYI A;  1LQ1 A;  2DAO A;  1NSG B;  1SAN A;  2WVN A;  3R0A A;  4EGY A;  1E17 A;  1PJR A;  2M0C A;  1F36 A;  2EIJ C;  4KYW A;  2QLZ A;  3H3U A;  1ZHT A;  3KX2 A;  4N9I A;  2LVS A;  2M3A A;  1Z91 A;  4Q7C A;  2BW3 A;  3O3K A;  3ULQ B;  1SMY F;  4U7D A;  3FOP A;  1O57 A;  4IRU A;  2Q8K A;  3HL2 A;  4LIT A;  5HNF A;  5JHU A;  1LPQ A;  2LLK A;  1XB4 A;  2OQM A;  3MBG A;  5A6B A;  1FBS A;  2AHQ A;  2DU9 A;  2R7R A;  4HDV A;  1IF1 A;  2OOC A;  3NDB B;  4B43 A;  3H5R A;  4DYC A;  1WJC A;  4N6C A;  2BC5 A;  4I76 A;  2BL2 A;  3EH2 A;  2BHY A;  3LAJ A;  3E5X A;  4CCK A;  4AU7 A;  2OZ6 A;  3CJN A;  3A03 A;  1P4A A;  1VQO I;  1B72 B;  3FBI B;  2MHR A;  1QHG A;  3QPS A;  1RIO H;  1FFH A;  2B0L A;  2ZXJ A;  2PMZ N;  2GWR A;  2VT2 A;  4II2 A;  4F7Z A;  2YRF A;  2OZU A;  3EYY A;  3BQZ A;  2AS5 F;  5FRM A;  2KC3 A;  3JTL O;  4MVM A;  3M1C A;  4BEJ A;  1RCP A;  4PJJ A;  2EIL C;  2KT0 A;  1D3Y A;  4LAC B;  5E3N A;  4RB0 A;  2DBB A;  1S7A A;  2BYV E;  2P8T A;  2HSQ A;  3DJU B;  1D0X A;  3IQ6 A;  3L8I A;  5DDG A;  1S7Z A;  1T9K A;  4E7K A;  4J7T A;  4U87 A;  4W8P A;  1X1B A;  2OKU A;  2K3P A;  2XGX A;  2ISZ A;  3ZDL A;  3CCR I;  5AC5 A;  2GOM A;  3S84 A;  1HW2 A;  5K1Y A;  4FQG A;  3VSL A;  4NQW A;  4H0E A;  2QCO A;  1R7J A;  4O6N A;  4XK4 A;  4LDQ A;  1T0F C;  2O9L A;  2ZBK A;  2FEZ A;  3O39 A;  2YLD A;  2V4J C;  1JI8 A;  3LA7 A;  2WY8 Q;  1MBK A;  1OCO H;  1WJF A;  1KQ8 A;  2RQP A;  4GYG A;  1W7P D;  1A7V A;  1OCO C;  1YDI A;  3B0P A;  1LUJ B;  3K4L A;  3GM2 A;  2VKD A;  3GBG A;  5L3F A;  3ASN C;  1TWF J;  2LK4 A;  2Y69 H;  2YU3 A;  4L0Z B;  1JTY A;  3M9A A;  1WAS A;  1SEU A;  2VQL A;  2YPR A;  3C7J A;  1BBH A;  2V79 A;  1XDU A;  2G9W A;  4I1M A;  4MTG A;  3RKO F;  4GO1 A;  1TBX A;  2LD6 A;  4H4K C;  4M73 A;  2OCC C;  4FCY A;  3LLI A;  2K9Q A;  1QRY A;  1VND A;  1NZE A;  4JC7 A;  4JW1 A;  2X85 A;  1Z7Q c;  3AAF A;  1QSP A;  4FT8 A;  1P92 A;  1W5S A;  1LEA A;  4B09 A;  3K6G A;  4HX7 A;  3SJM A;  2VBY A;  1A6I A;  2ZSI B;  4NNJ A;  2XLV A;  2Z3Y A;  2ZKZ A;  1AWC A;  4RGU A;  3IKV A;  1LDJ A;  4CCL A;  2DQL A;  3ZMV A;  4GFB A;  2FOW A;  1RR8 C;  1YZC A;  3EFO A;  3C2B A;  2DTR A;  4S04 A;  3OWT A;  2CUE A;  4MND A;  5JI6 A;  5E20 A;  3D5L A;  3DKY A;  4M72 A;  5HV9 A;  3T6G B;  2DFF A;  2JWT A;  2YUS A;  3CDH A;  1R1T A;  1W5C C;  5DCM B;  1IW7 F;  4JP0 A;  5DM7 F;  3GTO J;  2VCA A;  4YL0 A;  4CZC A;  3O6X A;  4HQM A;  3U5S A;  3EUA A;  3G4X A;  3KZZ A;  1YS6 A;  5CVU A;  3CC7 I;  1OW7 A;  1K79 A;  3CEX A;  3SXZ A;  3KMI A;  2R3S A;  4MHG A;  3I9V 2;  2WTE A;  2Y30 A;  4AYB A;  3X2Q C;  3X2Q H;  1HW5 A;  5FO5 A;  5LEK A;  4A2U A;  3L2Q A;  1WJA A;  4P1W A;  4ULW A;  5CI8 A;  2IA1 A;  5GAD J;  1K4T A;  2DA3 A;  2KRF A;  3LSR A;  4LK0 F;  1JXS A;  4E0H A;  2ZSH B;  2XSE A;  5GPG B;  2E2J J;  4ESB A;  3ZP5 A;  2J7P A;  1B6A A;  2X6W A;  3EUH C;  3FMQ A;  3GZN B;  3NRV A;  4M6V A;  4I6Z A;  2DXI A;  1MND A;  3SEQ A;  1G59 A;  1C0W A;  2H8W A;  1IUY A;  1XMK A;  4OD4 A;  1V5F A;  1IG7 A;  4L9V A;  5D4R A;  5EGO B;  5CI9 A;  5HSW A;  4IVN A;  4N4N B;  4AIJ A;  2CW7 A;  2B63 J;  4DBR A;  3BZC A;  1SVL A;  3IWF A;  1K78 A;  2HQR A;  2QE9 A;  2JPU A;  2XAG A;  3DTI A;  1OCZ H;  4NC8 A;  1ZG1 A;  5H6R A;  4OWR B;  4M6Y A;  5E18 F;  1B1B A;  3WTY C;  3LFU A;  3RZD J;  2B9S A;  2XIG A;  1LDD A;  4CDG A;  2ETS A;  5HDN A;  3TMO A;  1LFP A;  3QTH A;  1SZI A;  3DWW A;  4OAY A;  3BTI A;  2YEV A;  1B8I A;  2XL8 A;  2Y9Z A;  1KU7 A;  3KYI A;  5EEA A;  3H92 A;  2BY1 A;  3NMJ A;  2HJM A;  2G3V A;  4ZDO A;  3MCZ A;  1HDP A;  1NFN A;  2LBF B;  3BZ6 A;  2VC9 A;  2DO7 A;  4UXN A;  4E0I A;  3DKW A;  4XIC A;  1MBG A;  5GTH C;  1MBF A;  3F8B A;  3R60 A;  2FRH A;  3J81 Z;  2F48 A;  3WTV C;  3V7C A;  3AG3 H;  3HYI A;  1BBY A;  3OYN A;  1LS1 A;  4JCZ A;  4ZDP A;  4HEA 2;  3CCS I;  2XKP A;  2M45 A;  3GFM A;  4BEH A;  1YJ9 I;  2VOO A;  2H8R A;  1JMW A;  3AJM A;  2M34 A;  1TNS A;  4XRS G;  3C18 A;  2Q3T A;  2R7T A;  3BQY A;  4LGW A;  3EH1 A;  2K3F A;  4NB5 A;  3M3Y J;  2XXA B;  1VQ9 I;  1K6Y A;  5TGT A;  5D8K B;  3DZA A;  3E6B A;  2FJ1 A;  5LHG A;  3K4C A;  3VB2 A;  4HV6 A;  3OYL A;  3D0S A;  1M6T A;  2DYR H;  1SD6 A;  3J81 K;  5ICF A;  1KYZ A;  4A4A A;  1DOV A;  4DVY P;  5F5F A;  1YLF A;  2ICW G;  4PR9 A;  1X3W B;  2MH2 A;  2YZS A;  3QRF F;  3PIP F;  2XS8 A;  3W4Y A;  1P2F A;  1Y0U A;  2A0U A;  2CQK A;  3E5Q A;  1AU7 A;  2J8W A;  1YVI A;  1JGS A;  3LA2 A;  3S15 J;  3ASO C;  2E1O A;  2YL7 A;  1W4M A;  1IXC A;  3GWZ A;  3GFI A;  3E1S A;  3RIP A;  2M87 A;  3FK6 A;  5EEG A;  1XZQ A;  3DKX A;  5DS6 A;  1BR2 A;  1FMW A;  3LSK A;  1IUF A;  4L18 B;  5K0I A;  2HFH A;  1R6R A;  4U5D E;  2O9X A;  2VJI A;  4HW0 A;  3TL4 X;  4CIC A;  4MW8 A;  3ZC4 A;  3M4B A;  5GAG J;  3FXK A;  4NC3 A;  1RI7 A;  4L5E A;  1ZRD A;  3CO6 C;  5K5Q A;  2HXI A;  3PMR A;  256B A;  5GPA A;  1S72 I;  4Z9I A;  2D4U A;  2Q00 A;  2FBK A;  2ZXW H;  2W82 A;  1P7J A;  4D5F A;  2P7V B;  3CCU I;  5DTD A;  3K4M A;  4KT5 C;  3HIF A;  1XDS A;  1BW6 A;  4U5B E;  4YIR X;  3ZQC A;  4YN0 B;  2P5V A;  3CJQ B;  2YHS A;  1FZP B;  2XRO A;  5DCF A;  1H8A C;  4BNC A;  3V7O A;  2QUP A;  2DMU A;  1E0E A;  5FKN A;  2Z2S B;  1O3Q A;  3Q7L A;  1KON A;  2MW8 A;  1DPU A;  2QQA A;  5JVT A;  4I3M A;  1ORY A;  4A3F J;  3MD2 A;  4Q48 A;  4HBL A;  5J47 A;  1HKT A;  4XRM A;  5L0C A;  1ACI A;  3EZH A;  1BC8 C;  3SFZ A;  1U5T C;  3U3F A;  4R1H A;  5E1W A;  2HOS A;  3OYK A;  1GVD A;  2XAH A;  1U5T B;  1W7P A;  2DMT A;  1KU3 A;  5AGF A;  4FE7 A;  1IV6 A;  1OYW A;  1MJB A;  3Q5F A;  1R4T A;  4NTB A;  4R79 A;  3HOT A;  3K2A A;  1K6O A;  1FOX A;  4KI2 A;  4B1R A;  1HW1 A;  2XAQ A;  3V5Z A;  4I02 A;  2DA2 A;  2AU5 A;  1Q0K A;  3EZI A;  5GPC A;  2QLA A;  4K2E A;  4U5E E;  1J9I A;  4DZJ A;  2L9S A;  5HLH A;  2PF4 E;  4B3X A;  5J1U A;  1JKO C;  5BQI A;  3H9G A;  3PSI A;  4HLX A;  4XSZ F;  1PVE A;  1XWJ A;  4XL9 A;  4EKW A;  5IP6 A;  2X1C A;  2A68 F;  2O6G E;  2C03 A;  1IXS B;  4M6X A;  4YK5 A;  4DXW A;  3LSJ A;  2FX0 A;  3RW0 A;  5F64 A;  1ETY A;  2M0M A;  4PFO A;  1VK5 A;  1VQ7 I;  3P9C A;  4J32 B;  1IRX A;  4PUS A;  4LLC A;  4MW3 A;  3J7A Y;  5CKT A;  4BJ6 C;  5EF6 A;  3P5J A;  2CS3 A;  3M1C B;  1ZGA A;  4XLC A;  2GIZ A;  2STT A;  2QVO A;  2IXN A;  4XOT A;  2IGM A;  2XGE A;  3WTW C;  3N05 A;  1U8B A;  3GFJ A;  2KIQ A;  3E0J B;  3SYN A;  3AKZ A;  4AD9 A;  3FOO A;  4NCQ A;  2P81 A;  3BR2 A;  2OCE A;  2M30 A;  3AFH A;  1IAW A;  3RQF A;  1R22 A;  2XAU A;  1BDJ B;  5H2F C;  5IYC J;  2UUH A;  3OS0 A;  1X2N A;  3K6B A;  1Z7U A;  2OJE D;  3S2D J;  2IS2 A;  1IZM A;  1GQA A;  1TQP A;  4NHJ A;  2FBH A;  2KJC A;  3AQB A;  2F2E A;  2VAS A;  2P4W A;  4A0X A;  4BGD A;  1HKQ A;  5DUK A;  3LS1 A;  4KN4 X;  2XGD A;  2FXA A;  3NMI A;  3KE2 A;  1TTY A;  3ECO A;  3FIS A;  1Z67 A;  2ZO4 A;  1M56 C;  1J0R A;  1Q0G A;  1U0B B;  4A3B J;  2LYC A;  2HOT A;  3V8J A;  2L81 A;  2WZG A;  5C3E J;  2L9R A;  4ZTF A;  3NKD A;  4D7M A;  3JT1 A;  1YIO A;  1YAR O;  2BEO A;  1NTC A;  5M3M J;  4QPO A;  4PGG A;  3ZQL A;  2ZXP A;  2G0E A;  2L6G A;  2EZK A;  3PNV A;  4CDA A;  4BUP A;  2J9B A;  2CMP A;  2EQR A;  1ZH5 A;  5IOY A;  5BQT A;  3P9I A;  4BKX A;  3H9Q A;  1ETX A;  1B72 A;  3MZ8 A;  1J8Y F;  3SEZ A;  2F4M B;  1HE9 A;  1USS A;  3GEZ A;  4J00 A;  2LR8 A;  1MMS A;  2IGO A;  2IEK A;  2HI3 A;  2BVM A;  3S16 J;  3F6V A;  1M57 C;  4BAY A;  1DQU A;  3AG2 C;  3MFK A;  3AG2 H;  2JSC A;  2XPU A;  3FXR A;  1OR3 A;  2LFF A;  2XPW A;  1TT0 A;  1QO0 D;  3QMK A;  5E3C A;  2PBE A;  3NYL A;  2LY1 A;  5KYW A;  1J75 A;  5DQZ A;  3A1Y A;  3BG9 A;  4UV9 A;  3H2V A;  2WY7 Q;  3ZXS A;  1ZG5 A;  4CH7 A;  5CPR B;  4IO9 F;  1T39 A;  2GZW A;  2E2I J;  3LQR A;  3ZQY A;  1ZN2 A;  2XUB A;  3ZCO A;  2Z1D A;  3RPQ A;  1WCM J;  3HNJ A;  2WVO A;  3BTC A;  3SYT A;  1XCV A;  4BBS J;  1TWG A;  2JX0 A;  1RR7 A;  4IOA F;  5BUO A;  1POG A;  2DYS C;  2W4B A;  2XAJ A;  5L0J A;  4BY1 J;  1T0F A;  2Y3H A;  1ZG3 A;  1VLS A;  4CUG A;  1YE9 A;  4OIP F;  3DPL C;  3C1D A;  3PQJ A;  3E7L A;  3ISP A;  1K40 A;  3S0X A;  1XGS A;  3GZ5 A;  3QP5 A;  1R58 A;  2ECB A;  3K1P A;  3S3O A;  1BI0 A;  2CGP A;  1BI3 A;  4WXH A;  4QIW N;  2DK5 A;  5J8C A;  4JK1 X;  1Z6R A;  1YIJ I;  3NQO A;  3GX4 X;  3K7A J;  3NG1 A;  2EFW A;  4LG0 B;  5DS4 A;  4XLF A;  1HBX G;  4HX8 A;  2R7S A;  2NUP B;  1Y56 A;  3LA3 A;  1UHW A;  2W9Y A;  2QEN A;  3KP4 A;  5JUA A;  3HZJ A;  2X4H A;  4L9T A;  3KEY A;  3UR3 C;  1JUP A;  1LNW A;  1CQT A;  1JAF A;  1Z6A A;  4IAO A;  4XNF A;  3GM1 A;  3COA C;  1IN7 A;  2NSF A;  4FAP B;  2R5Z B;  2JA8 J;  3H1C A;  3IH2 A;  2VCB A;  1XS9 A;  4EWC A;  1R1U A;  2EFP A;  3CUO A;  1OMI A;  2MYS A;  1RXQ A;  3I3L A;  3KYL A;  4KIG A;  4BE1 A;  1ZQ3 P;  1TFK B;  2WB7 A;  1MMA A;  3K4K A;  1YRN B;  3T8T A;  2MLG A;  1T6Q A;  3K0L A;  2IXO A;  5EDN A;  2QSF X;  3CP2 A;  5FZT A;  5E1X A;  2W4M A;  4A2N B;  1N75 A;  2QSH X;  2WV0 A;  1SFX A;  1F1Z A;  3S1Q J;  1OJL A;  2FQ3 A;  3JAM Z;  2QUF A;  3FXU A;  3WTT C;  3G1M A;  3FXM A;  2IW5 A;  2L7F P;  1BR4 A;  1FBQ A;  1N77 A;  4X6A J;  1NG1 A;  1RKC A;  2O8X A;  2BGC A;  5K5O A;  2XL6 A;  4MGR A;  1LFB A;  1ZLJ A;  2HR3 A;  2V9V A;  1DU6 A;  3GTP J;  2A5W A;  2L7M P;  4NC7 A;  2IA2 A;  3QVZ A;  4UUV A;  3I5P A;  4JTA B;  4LLE A;  5HDK A;  5JS5 A;  3VOE A;  2VXZ A;  4HX4 A;  3FMS A;  3QOP A;  1P7I A;  2IP2 A;  1OFC X;  5IOZ A;  1A6Q A;  3HOS A;  2YU9 J;  3R6S A;  3C2H A;  3CTA A;  3JAM K;  2ELK A;  4ENM A;  3NYM A;  5ERI A;  1ZU4 A;  3UKG A;  4A3M J;  3LL7 A;  1RUO A;  1IGN A;  3BPV A;  5JHF A;  3EUH A;  1LIH A;  3OYM A;  1PDN C;  1KTM A;  2DFH A;  1HLV A;  4GYT A;  2LSO A;  4Z6Y A;  3H65 A;  3WGG A;  1FFT C;  3V4G A;  1NU9 C;  5F28 E;  4HG2 A;  1VQL I;  3IC7 A;  4QTR A;  4DRH B;  4PAC A;  1X1A A;  4RM3 A;  4ZC3 A;  5M3F J;  4Y13 A;  2DI3 A;  3NAR A;  4YFX F;  3ABK C;  3Q9S A;  2LKP A;  5K7Z A;  2ADU A;  5KVR A;  1LPE A;  5M5Y J;  2K9N A;  3US6 A;  1IN4 A;  3GLL A;  2FNP A;  1FMV A;  4EHP A;  4FAS D;  4BEM J;  1YX3 A;  4RLQ A;  3TOB A;  1M2V B;  4LB5 A;  2KSF A;  1FOK A;  2ESH A;  3J7Z I;  2R25 A;  2VQH A;  4JX5 A;  1BI2 A;  4BYY A;  2A05 A;  3K1I C;  2GAQ A;  2LBF A;  1UZC A;  2EZH A;  4E7Z A;  4O6J A;  4RLF A;  3N97 A;  2IT0 A;  5LRR A;  1EI7 A;  3R61 A;  1X4O A;  5CLS A;  4G6Q A;  1MSF C;  1IRZ A;  3G3Z A;  5F0H A;  3H2U A;  2CYY A;  2EPF A;  1MMG A;  2CQN A;  5J40 A;  4JUR I;  1FX7 A;  3PFI A;  3WE3 A;  2R7Q A;  3WTU C;  5TJJ A;  2ZJP F;  3H36 A;  3HKZ A;  4XR6 A;  2P6V A;  5HS9 A;  3JRH A;  3LNR A;  1G5Z A;  2CGE A;  4CS8 C;  2J7P D;  2XXA A;  1I1G A;  1X58 A;  2P6S A;  2QKL B;  3KLO A;  3ZMZ A;  1JE8 A;  3J7A O;  3AG1 C;  1Q1V A;  2X0C A;  1I6H J;  2EPK X;  4PFP A;  3DBR B;  1CF7 B;  3QPH A;  1E83 A;  3IAM 2;  1A0B A;  4RAG A;  4XPY A;  2E1N A;  5COG A;  3QQA A;  4LLG F;  4EBB A;  5BOX A;  2J9V A;  2HQN A;  4JCH A;  4YG2 F;  2CWE A;  3GZ6 A;  4RD9 A;  1E85 A;  5FFZ A;  2HKX A;  2PX0 A;  4MEX F;  3ZWI A;  1ON1 A;  4CDY A;  1WJB A;  3FHZ A;  1YIT I;  5J1Y A;  2XRH A;  1YQA A;  3QU6 A;  1UG0 A;  2VPR A;  3DAG A;  1FT9 A;  1QQI A;  2WBM A;  3CES A;  4D0P A;  3WGI A;  1UAA A;  2DN0 A;  4IPA A;  3OYH A;  2YVK A;  4CS9 C;  2PI0 A;  2OA4 A;  5B5E C;  3V5Y A;  3K70 C;  5D6E A;  2K9L A;  2XKO A;  2DOA A;  4FTH A;  4ULV A;  3VSK A;  1I5N A;  2BXY A;  1FR0 A;  3DM9 B;  5ED4 A;  2EIK C;  4YL1 A;  3ZQV A;  4M3B A;  2UUZ A;  4JEA A;  3BR6 A;  4UHT A;  1HMO A;  4XLP F;  3ZQQ A;  3B29 A;  1W0T A;  2IJL A;  4U88 A;  3KZY A;  2Y75 A;  4F91 B;  2FE3 A;  3ZMU A;  4QLC U;  5J8F A;  4UNO A;  5DV5 A;  4IKF A;  3BDD A;  4YEL A;  3H0D A;  2Q4F A;  2LMD A;  1ZEL A;  1QVT A;  1TW3 A;  5B3S C;  5JLW A;  3L8J A;  2IOQ A;  5KCM A;  3GO5 A;  1WRJ A;  4A3C J;  2IXP A;  1FEX A;  2MFZ A;  2M9H A;  4HOB A;  2L3D A;  2R7O A;  3HJE A;  3F3X A;  3PFY A;  2IRF G;  2V7F A;  3OYG A;  5BPI A;  4BQA A;  1OR2 A;  1YJG A;  1YX5 A;  1RET A;  2KZG A;  3M8J A;  3U1K A;  2KIU A;  3ZQ7 A;  4XON A;  4MTE A;  3S1R J;  4G8X A;  3F46 A;  3RPU D;  4DZP A;  2DDA A;  2Y3G A;  1TWH A;  2ASR A;  2VBW A;  3C3W A;  1NLX A;  2HXO A;  2MH9 A;  2EIJ H;  5FKL A;  1UFB A;  2Z9O A;  1U0J A;  4JOM A;  4XEK A;  1U5T A;  5T3T A;  3ESW B;  3SXK A;  3RH3 A;  4OU0 A;  4DVZ A;  4ZJZ A;  1WAT A;  4KT6 A;  1ZYR F;  1ULY A;  3HRM A;  4I7H A;  4EUK B;  2GBY A;  3MKL A;  4C2M J;  3JRD A;  2J9U A;  2Q9A A;  3GUD A;  3KH2 A;  2EV0 A;  1JJ8 C;  3H3Z A;  1CPQ A;  5L3V A;  5IY5 C;  1I5Z A;  2M7B A;  4I98 B;  1X19 A;  4LDK A;  3RVZ A;  4LDR A;  1EJ9 A;  2EZL A;  3QW1 A;  3LEV A;  1R5H A;  1GGQ A;  1SAU A;  3CCJ I;  1GV2 A;  2XB5 A;  4U5G A;  1WOL A;  2WB1 N;  4O7G A;  2X48 A;  1ONV A;  4HRI A;  1HOM A;  2FML A;  3OMY A;  3TW7 A;  4WAB A;  2TMV P;  3DXJ F;  3U21 A;  3EG9 A;  2LFB A;  4EJO A;  1GV5 A;  2UUI A;  4PSX A;  4HF2 A;  2O03 A;  4N0B A;  3ZGK A;  4M9X A;  1KGS A;  4UVB A;  1EA3 A;  1LFU P;  2CDQ A;  2A61 A;  2R7D A;  3DF8 A;  2EIL H;  4AVP A;  1W36 C;  1TC3 C;  2HWV A;  2HOE A;  4HNV A;  2NOJ B;  4BJ6 A;  2HYF A;  2DOD A;  5KYW B;  2PQ8 A;  2IBF A;  1LE8 A;  3MAJ A;  2H94 A;  3I58 A;  3WG9 A;  5E8I A;  2PJR A;  4HFF B;  1MBH A;  1FJL A;  1FIP A;  1G8X A;  1Z7L A;  2CO5 A;  4YRV A;  1TWC A;  3B6C A;  3VYR B;  2L9J A;  2DW4 A;  4G12 A;  2LP4 A;  3C8G B;  3ONQ A;  4IX7 A;  2HJ3 A;  3CSK A;  3QPL A;  2P1A A;  1KQ0 A;  1OR7 C;  4E70 A;  2K27 A;  1T08 B;  2OG2 A;  5LGU A;  4EBJ A;  3ASN H;  2AQF A;  2XAF A;  4DBQ A;  3LAP A;  2NOG A;  3QOE A;  5EG0 A;  3MZH A;  2COB A;  3EGX B;  3EYI A;  4JIO A;  2A6H F;  1OQY A;  2FUG 2;  4MFD A;  3S3N A;  4C30 A;  1S29 A;  3PQK A;  3RYP A;  3JRC A;  1SD5 A;  1ZRE A;  1T8I A;  4BQQ A;  3GEH A;  1XN7 A;  4X1E A;  4XOP A;  3E9V A;  4IRG A;  2OCC H;  5LHI A;  3R7C A;  4UDV A;  2Y0S N;  2ZME C;  4BL0 B;  3HPG A;  1K61 A;  2ACJ A;  5B66 C;  4JZA A;  3CLO A;  1FTS A;  2ZME B;  2NNY A;  1FTT A;  3MX3 A;  4CZZ A;  2LNB A;  3JSO A;  1T01 A;  4CCM A;  3K9T A;  4F4B A;  2E2H J;  1VF9 A;  2RNJ A;  2W7N A;  3FX3 A;  2XSJ C;  3CDL A;  2PFB A;  4MS2 A;  3JR9 A;  1RZ4 A;  4HF1 A;  4IZZ A;  3SXY A;  3ABU A;  4EM2 A;  3G73 A;  2GLO A;  2CNW A;  2OJQ A;  3CMA I;  4G0H A;  1OCR C;  2MLK A;  1OCR H;  5DM6 F;  4UB6 C;  3FM3 A;  4IQJ A;  2YL0 A;  1M1E B;  3QZC A;  2JSP A;  1ZR4 A;  3HDD A;  4RM2 A;  4A3I J;  3QVY A;  4CX9 A;  2JQ7 A;  3GTM J;  2NS0 A;  1KNY A;  2P7C B;  4W97 A;  3K4B A;  3ZQG A;  1PUF B;  1VQN I;  5A6K A;  3CAX A;  3TQO A;  2X6O A;  3TW6 A;  3FAP B;  4DGW B;  1E84 A;  2D1H A;  1MNE A;  3T9O A;  3DP7 A;  1MW7 A;  3IKT A;  2NRA C;  4D9J A;  3F8M A;  2KNH A;  3NWT A;  3OYB A;  3TQN A;  2H1L A;  1E2X A;  2M8E A;  3L2C A;  3LOC A;  1MZB A;  1TWG J;  1LI7 A;  3ERM A;  3T1B A;  3ZTZ A;  3BG7 A;  2VT3 A;  1OLT A;  4PDK A;  5L3D A;  2CQ7 A;  1KA8 A;  4J01 A;  1T6I A;  2OPT A;  2F22 A;  2WV1 A;  2PNO A;  3EGD A;  3LWF A;  2G62 A;  4LG0 A;  2CV2 A;  3CZ6 A;  3UMH A;  2NUP A;  3JCU C;  1RKE A;  5BNG A;  4Y3O A;  3LUT B;  3G4S I;  4JVS A;  2DCE A;  2ZPA A;  1XGO A;  2X6X A;  5LLQ A;  3S28 A;  5EEH A;  4BJT A;  2NNN A;  3LEO A;  2KRC A;  4WX9 A;  1AVO B;  2NG1 A;  3IH4 A;  5FLX Z;  4K0D A;  3RQG A;  4GEH A;  2BBY A;  2X1E A;  2R5Z A;  3BR5 A;  2IVM A;  3LLK A;  1SFO J;  4PGH A;  1L3P A;  4IQ4 A;  2HQ5 A;  2ME0 A;  1Z3Y A;  2HKV A;  2ESN A;  3S1M J;  3IP4 B;  3G4Z A;  1TKN A;  3M7G A;  3OV8 A;  3T6B A;  2OAZ A;  1L3L A;  3J06 A;  1LDK B;  4OOI A;  3CCE I;  1I3A A;  1YRN A;  1KU2 A;  3PDM P;  3UGO A;  3U1D A;  4HZF A;  1WGW A;  2PP4 A;  1TP4 A;  3I55 I;  4D4X A;  4XEF A;  4IF4 A;  1D0Y A;  2GXB A;  2O8K A;  2HYG D;  3TGN A;  2R4G A;  3PNT A;  4G94 A;  1W36 D;  1YOV B;  2R7Z J;  3V42 A;  4RAY A;  2EPO A;  2LD5 A;  1VTN C;  2YL1 A;  1YFH A;  2DPU A;  3B9Q A;  5HS8 A;  2BY0 A;  3W2A A;  1U9O A;  2UXN A;  2W24 A;  1ZAR A;  5FLX K;  3FXL A;  4I1O B;  3TOM A;  3HSF A;  5EJC A;  2F4I A;  3ZRG A;  3ZMS A;  1O7L A;  1EA8 A;  3J7Y J;  1J7K A;  2W45 A;  3WAQ A;  3A01 B;  3TJ6 A;  4IRH A;  5GAE J;  1V4R A;  2XRN A;  2HS5 A;  1FAP B;  4U0Y A;  4RAZ A;  4ZYA A;  2P61 A;  4J19 A;  4F93 B;  5HLG A;  2E35 A;  2A1D D;  2UZK A;  3M4O J;  3IPM O;  1JJ6 C;  2HSB A;  2PX9 A;  3FDY A;  4DQ2 A;  3CCL I;  3OSF A;  4IHW A;  3GOR A;  1V55 C;  3L1M A;  4I2O A;  5KYN A;  4M3D A;  2RAE A;  1MBJ A;  2L7A A;  2MSY A;  4A0Z A;  3TP3 A;  4KNY A;  1SD4 A;  2Q1Z B;  4UVC A;  4WGY A;  2KL4 A;  5LGN A;  4G7Z F;  2VQG A;  1YA9 A;  2K86 A;  3KET A;  2V1X A;  1H9G A;  3RPU A;  5BS6 A;  1A41 A;  2IM8 A;  5D6F A;  1EQ1 A;  3TD7 A;  3DBL B;  2GAU A;  2MC4 A;  1LE2 A;  3G71 I;  4HQE A;  3ABM C;  4C3E A;  1Y6I A;  2Y31 A;  2WB1 A;  5E2Q A;  1NU7 D;  1SD7 A;  1HC8 A;  4F52 A;  1OXB A;  2K4J A;  4EGZ A;  1WZ2 A;  3PIO F;  4IAQ A;  1DU0 A;  4A3G J;  4BE2 A;  2EA4 A;  2PMZ A;  2R93 J;  1K83 J;  3ASO H;  2YL3 A;  2NS7 A;  1EF4 A;  2E5N A;  1VI0 A;  2H09 A;  4LD5 A;  2AVK A;  2JUC A;  4XQF A;  3C8Z A;  1XSV A;  4IHS A;  2P5L C;  2E36 A;  2ZJ2 A;  3S93 A;  1IDY A;  3FKJ A;  1VQ6 I;  1M2V A;  1K04 A;  2F4O B;  5HDG A;  5FKK A;  4AWX B;  4XID A;  2JN6 A;  4KNW A;  2EFQ A;  3HJC A;  4AM3 A;  3IQC A;  1BIA A;  5IP7 J;  2WVQ A;  3HLZ A;  1OQC A;  3C62 A;  3BRO A;  3W6V A;  4OMZ A;  5KYX B;  4YIF A;  3K1I A;  5JVE A;  4N06 A;  4NQF A;  4BG0 A;  4E6K G;  2J45 A;  1FY7 A;  1QVU A;  1OCC C;  5E33 A;  1X4P A;  2XLH A;  4IEJ A;  4BQN A;  2EIN C;  1P4X A;  3CQZ A;  2VC1 A;  3S2W A;  1E3H A;  2ZJR F;  2XLD A;  2Q7R A;  1QHH D;  1ZGW A;  3L2W A;  3Q6N A;  2MAB A;  3H5A A;  3O55 A;  1H0M A;  1R00 A;  1G2H A;  1Y6D A;  3ZVR A;  1MDM A;  3GTL J;  2E5Z A;  3WOD F;  2HV6 A;  2I5U A;  1M2O A;  2R05 A;  4L5J A;  4CS8 A;  3FF5 A;  1FOW A;  3BG3 A;  2P5K A;  3HNK A;  1K4S A;  3LST A;  3S27 A;  3TOL A;  4IL6 C;  2R7W A;  1CF7 A;  1WTY A;  3RQE A;  2Y0S A;  1I39 A;  1KQ9 A;  4HFK B;  3VYW A;  2XF6 A;  2P0N A;  2GA2 A;  2KDO A;  1GLN A;  1Z3X A;  2NVY J;  1A7E A;  2RQQ A;  4OAZ A;  1UHM A;  2QWW A;  2XF7 A;  4ENJ A;  3N24 A;  2X1D A;  4KBL A;  3TK0 A;  1A5J A;  4A6E A;  1SR2 A;  2EJR A;  2VCC A;  4YL3 A;  4UV8 A;  2V1D A;  3HOV J;  1DUX C;  3BTL A;  3HTU A;  3WU1 B;  1B9M A;  1R23 A;  2W1O A;  3RKQ A;  3GTJ J;  4FHT A;  4MTD A;  2W57 A;  4HDU A;  3U3B A;  2DA7 A;  1AA7 A;  2OQG A;  1STZ A;  2FBI A;  3B6A A;  2ZNZ A;  2VJ5 A;  4A6D A;  1VB5 A;  2QM3 A;  3U9M A;  3U8V A;  1O4X A;  3GTQ J;  4RDA A;  2GA1 A;  4A3K J;  1TQG A;  4B6I A;  3OIP A;  2YSR A;  1U2W A;  5FLV A;  5JRA A;  2K85 A;  5B1A C;  4XQ1 A;  2HUJ A;  2RVC A;  2LK2 A;  1J59 A;  2XF5 A;  4CS9 A;  2GIV A;  1W1W E;  1XTA A;  2NXN B;  4C9Y A;  2KLO A;  2H7V C;  1RNL A;  3DEW A;  1VYK A;  3B71 A;  3EG9 B;  1I6X A;  2A6T A;  1NK3 P;  4L0Y B;  2KQR A;  3DTK A;  1FPQ A;  3OR2 C;  2OTL I;  5A69 A;  2HZD A;  5LBQ A;  2MWQ A;  1C02 A;  2EIM C;  3E5U A;  1PCX A;  1YYJ A;  1VQP I;  1K05 A;  2RD9 A;  2WWY A;  4DYR A;  1AHD P;  3DM5 A;  1JT6 A;  4JRZ A;  2CW0 F;  4KUM A;  1LE8 B;  2C6Y A;  4J7Y A;  2HTS A;  2R7V A;  4ER9 A;  4XLN F;  3PHF 2;  5GP9 A;  2EWN A;  2ZNY A;  4WXC A;  3WHC A;  2PJR B;  2R92 J;  1JR8 A;  1YLM A;  1S8N A;  3ML6 A;  2LSE A;  1JUS A;  5D8L B;  2RN7 A;  3DE8 A;  5JP7 A;  2GXG A;  2B0H A;  3FM5 A;  1XGM A;  4HLY A;  2PMH A;  3FZV A;  1ZU5 A;  1ETQ A;  6PAX A;  5BQG A;  2E7W A;  2LP0 A;  3LES A;  3ZMT A;  3REO A;  4BE0 A;  5F04 A;  1QA6 A;  3Q0V A;  2J5P A;  2LH9 A;  3ROU A;  5JFR A;  1IN5 A;  2VKE A;  4JBA A;  2COM A;  2ID3 A;  1TWH J;  5FLM J;  4GYI A;  3TED A;  2WL8 A;  1I3Q J;  2K9M A;  3F72 A;  5EG0 B;  1FWZ A;  2ETH A;  1H88 C;  1MNM C;  5HLT A;  1ZTR A;  2LDU A;  3DBH B;  4G9Y A;  3OYA A;  4UY8 I;  1TL8 A;  3O10 A;  4O6M A;  3MYF A;  4OIQ F;  1C17 M;  2DT7 B;  4HA8 A;  4ZZD A;  4CDV A;  3A2K A;  1S05 A;  3MZY A;  3DU5 A;  4KIC A;  1ERD A;  2M8G X;  3FMR A;  3HGY A;  3I4N J;  2Q9C A;  1XX5 A;  1Q0F A;  3JRA A;  3BCA A;  1HSJ A;  2RRE A;  5EK0 A;  4QI0 A;  4U5C E;  2QF7 A;  4ONS A;  2OF7 A;  1GXQ A;  4Y15 A;  3UMI A;  4PK4 A;  1DGW Y;  3L2R A;  4CSA C;  2ECC A;  2O61 A;  4V19 K;  4ZYG A;  5F27 A;  3HRU A;  4Y33 A;  2YKZ A;  2LFD A;  4P9U A;  1UHS A;  2F5F A;  2VBX A;  3GVA A;  3OSG A;  3DLL F;  1C03 A;  4BH9 A;  3RI4 A;  2AQE A;  4ASN A;  4HNU A;  2FOK A;  3DMD A;  1A31 A;  3GAN A;  3G6E I;  3FBN B;  3OYC A;  5B1B C;  2JRM A;  2E1M C;  1WWP A;  2F5E A;  3LFK A;  2HGC A;  3WHN A;  5IYB J;  3BRJ A;  3FXJ A;  2VPL A;  3BG5 A;  3A4C A;  2OC6 A;  1VQK I;  1FP1 D;  1Z9C A;  2PJP A;  4D4N A;  1U6H A;  1A35 A;  3SP1 A;  4Q5S F;  4EVI A;  2FQ4 A;  3L0I A;  1MGT A;  2DMP A;  3LSH A;  5CQE A;  1WWX A;  3C8G A;  2GM4 A;  2LF7 A;  1P9Q C;  4M71 A;  2IGN A;  5GTI C;  2DYS H;  3U9G A;  3TDU C;  2FU4 A;  1TLH B;  1Z0X A;  1FP2 A;  2NS8 A;  3SDB A;  1TWC J;  3BG6 A;  2HTJ A;  1ZKG A;  2K4B A;  1R36 A;  3I5U A;  4B44 A;  1S3J A;  2VJ4 A;  4X0G A;  2XAS A;  2VQC A;  2R7X A;  1OR7 A;  1RES A;  4N6H A;  3CCV I;  3JTH A;  3EGX A;  3F47 A;  3EGD B;  3GME A;  3E3V A;  1KZH A;  2DA1 A;  1RKE B;  2M4E A;  1MJ9 A;  3M15 A;  4RAF A;  2I8D A;  5AIQ A;  2WZF A;  2B7E A;  4BXX J;  4OIR F;  1Q0D A;  4II3 A;  5IPA A;  2PEX A;  2QQ9 A;  3TOA A;  3PO2 J;  4RMN A;  4C3D A;  4JJG A;  2DT5 A;  3GM3 A;  4LJZ F;  2VH3 A;  2ZME A;  4Y17 A;  3ZOB A;  1I50 J;  1R4N B;  3S8P A;  1U78 A;  2JK3 A;  1WJD A;  5CYV A;  1QPI A;  1G4W R;  3MYI A;  3K69 A;  4I09 A;  4EQQ A;  4U5F E;  4L9J A;  1V54 C;  2KMU A;  3TP0 A;  2IYL D;  1DOW A;  1TT5 B;  2QZ8 A;  3KYC B;  3IUO A;  2YX7 A;  3I4P A;  1OYI A;  3S90 A;  4IB4 A;  2D5R B;  1WQ2 A;  4XWJ A;  1IO2 A;  3LSG A;  4L9N A;  2KIM A;  4AC0 A;  1G3Y A;  3EPZ A;  1QPM A;  2C04 A;  2GQQ A;  2OU6 A;  3QYF A;  4O79 A;  1D5Y A;  3WG7 C;  2OEV A;  4EMS A;  4QSH A;  3OYI A;  1R1V A;  1UB9 A;  2DFE A;  1O3S A;  2Y48 A;  4GRI A;  3K10 A;  5T3W A;  3ZPL A;  4BJ1 A;  3SQN A;  2L01 A;  3CF2 A;  3OIO A;  1PUF A;  3FIW A;  1LVA A;  3DCF A;  1JHF A;  3UGP A;  2MD5 A;  1R9T J;  2HEO A;  4WJ0 A;  1LE4 A;  2E71 A;  4XOR A;  1YI2 I;  2JA6 J;  3GWN A;  2N8G A;  4JTD B;  4YFN F;  2O7O A;  5L0I A;  2WAE A;  1NHA A;  2L7K A;  4ESJ A;  5E3A A;  3RVY A;  1BN5 A;  2KPM A;  2XDV A;  1CGP A;  3AGU A;  3RZO J;  4M3G A;  1T56 A;  4JYK A;  3Q9V A;  4BBR J;  5C4X J;  4W1U A;  2ZD9 A;  5DQT A;  3H5N A;  3HB9 A;  5EZG A;  1U3E M;  3I4M J;  2ZFU A;  1ETV A;  5AC4 A;  4EJV A;  3F8C A;  2QSG X;  1QZZ A;  4MLO A;  5ICG A;  1XGN A;  3P9K A;  1Y1V J;  3JTG A;  1NFO A;  1OXK A;  2XLM A;  2DJI A;  3GFL A;  3IWZ A;  5COF A;  3I4U A;  3HOU J;  1XSD A;  4ABZ A;  3I64 A;  4XBF A;  4O6Y A;  5FKM A;  3D1N I;  3MFN A;  4CCO A;  1ZRF A;  2BZT A;  3LSI A;  1T38 A;  3CCM I;  3KKB A;  1Z77 A;  2W00 A;  3ABK H;  2RDP A;  3O8G A;  1JT0 A;  4XRF A;  3S3M A;  3HUG B;  3R0J A;  3IRQ A;  4F92 B;  2Y3B A;  1O7F A;  1WI3 A;  1MSE C;  3FHD A;  4IXA A;  4WGZ A;  4C3B A;  1ZLK A;  1JOG A;  3LSM A;  2CNW D;  1UJ8 A;  3JSE O;  1ZK8 A;  2R02 A;  2OEX A;  4CXF A;  2V1N A;  3O6B B;  5IP9 J;  2DOF A;  1D5V A;  2KJB A;  2DJN A;  1I1S A;  1KYW A;  2OD5 A;  3JRG A;  3L34 A;  2KIF A;  2JA2 A;  1JPJ A;  2KP6 A;  3ECH A;  1IV8 A;  2LG4 A;  1Y1W J;  5KNL A;  2MC3 A;  2YR2 A;  5TRD A;  3RJP A;  1GDT A;  2EH3 A;  3BZK A;  4LK1 F;  2HDD A;  1VOM A;  2KIS A;  4ENK A;  3A01 A;  3I53 A;  2QEX I;  2XHK A;  2LKS A;  4GXO A;  5JLX A;  3CC2 I;  1YZA A;  4CBE A;  1QVX A;  2VLA A;  2R0Q C;  1MDM B;  3HKK A;  2VL8 A;  4P9T A;  4WXD A;  5ICE A;  3GEI A;  1P6R A;  1WH7 A;  3AG1 H;  3N4M A;  1ORK A;  3U2L A;  2FF4 A;  2XLO A;  4JX6 A;  3S14 J;  3RSN A;  5TJ5 E;  5L0G A;  2R5Y A;  2L2O A;  4P55 A;  2YQY A;  3POV A;  5AIP A;  2M4K A;  1D0Z A;  4CJO A;  3NMK A;  1Y8R B;  1WHU A;  1YJW I;  1NBB A;  2QY9 A;  3U2M A;  3MWM A;  1FC3 A;  4MQV A;  3WTS C;  1SF8 A;  4ZYH A;  4YJW A;  3I59 B;  1MIJ A;  2WA0 A;  2NVX J;  4CHU A;  4XRS A;  1MBE A;  1VFC A;  5L3B A;  1Y4C A;  4PJ0 C;  1HF0 A;  5CVI A;  2CYD A;  4U5H A;  4WF2 A;  3WTZ A;  1U89 A;  2DGJ A;  3T4R A;  1T6S A;  4L6R A;  5ILU A;  4ANJ A;  1H6G A;  4AYB N;  5LRS A;  3LMM A;  4XKV A;  2DMQ A;  1EH6 A;  3EUK L;  5LFA A;  4NC6 A;  9ANT A;  1F4K A;  5KYX A;  3G1L A;  5C44 J;  4MEY F;  3OS1 A;  2EIK H;  3EET A;  4BHB A;  3GOD A;  5ILS A;  3GXO A;  4N9H A;  3LJB A;  1L7C A;  3O2P E;  4ON0 A;  4QDL A;  3B02 A;  2NYX A;  2J0X A;  5KAI C;  3CDI A;  2CUF A;  4A69 C;  1I27 A;  3CF5 F;  3ZR8 X;  5HOD A;  3CQZ J;  2HZ8 A;  1SFU A;  2XL4 A;  5M5W J;  5JR3 A;  3KLN A;  5B3S H;  1Z3I X;  4G7O F;  4AIK A;  1O3U A;  3KCC A;  5IYD J;  1D8J A;  1MD0 A;  2JRT A;  3BJA A;  2X9D A;  4M9S A;  2D5V A;  2H8A A;  3M8F A;  4RGS A;  2W25 A;  3S29 A;  4ZTJ A;  1HCR A;  4C2U A;  1LS4 A;  3ZSU A;  3E6D A;  4AE4 A;  5BQH A;  5FCL A;  3OYD A;  1BM9 A;  3K4J A;  1BC7 C;  2VON A;  2NVQ J;  1APC A;  2MG4 A;  2ZXI A;  4AL0 A;  3LS0 A;  3V5X A;  4Z9J A;  3OR1 C;  3KP7 A;  1HKS A;  3JRI A;  2RSE B;  2YX4 A;  1TWA A;  4YT2 A;  2L9V A;  2MA3 A;  3L2U A;  1TR2 A;  1ORS C;  1RMV A;  2I10 A;  2L02 A;  2V6C A;  2Y9Y A;  1QBJ A;  2KFD A;  4DRJ B;  4HPQ A;  2H7O A;  2LCH A;  4MVZ A;  4XPW A;  1X1D A;  2BHZ A;  2XGC A;  2VC0 A;  1XD7 A;  1IDZ A;  1N25 A;  2Y39 A;  3FXO A;  4MO7 A;  3AG4 C;  3IEE A;  5IY5 H;  4O5V A;  4RB2 C;  1ZW2 A;  4JJF A;  3MKZ A;  3TJ5 A;  5EHH A;  5HOO A;  2QYO A;  1XCB A;  3V7R A;  2Z99 A;  3BLY A;  3LAY A;  1NG6 A;  1LB2 A;  3PUF A;  3VPR A;  1J2X A;  1DP3 A;  5F5H A;  1WSU A;  4ETS A;  2STW A;  1QQ3 A;  4Z2Y A;  2K9S A;  3H9J A;  4MVS A;  3FXH A;  3M8E A;  2VB6 A;  3QP6 A;  3U2R A;  2W48 A;  1CGO A;  3HM5 A;  4ITV A;  3VWB A;  1TZL A;  2HMQ A;  4D1Q A;  1W2W A;  5FFX A;  2A07 F;  1ZHF A;  2LTP A;  1IN8 A;  4M3E A;  4B4C A;  1BJA A;  3RF3 A;  2UWM A;  1A36 A;  4BAC A;  2VI6 A;  3NKE A;  3V8K A;  3MQ0 A;  4FX4 A;  3F22 A;  3S17 J;  4A93 J;  2XLW A;  4IAR A;  2L54 A;  1IRF A;  2CW8 A;  4D7N A;  2QQB A;  2HNH A;  4AID A;  1BL0 A;  4A3E J;  2NSG A;  1QNT A;  1SYQ A;  1LVK A;  2DFI A;  3EPV A;  1K7A A;  3A11 A;  2FMY A;  3E6C C;  2E87 A;  1AKH A;  2XPV A;  1Z21 A;  1Q0M A;  3DV8 A;  3G1O A;  3D5R C;  2MGQ A;  3WE2 A;  2HU9 A;  2DT6 A;  4MIM A;  2AXT C;  4HYE A;  1FTZ A;  4X0R A;  3DPT A;  5HNH A;  2FAP B;  1UMQ A;  2ID6 A;  1H9T A;  3DQV C;  3PL8 A;  3MN2 A;  1A7D A;  1G3T A;  2I15 A;  4FWV A;  4JE9 A;  4R32 A;  4U9E A;  3NWS A;  4Z9H A;  4V2G A;  3QYB A;  4BHC A;  3KP2 A;  4MNU A;  5K5R A;  4UUS B;  2EFO A;  1D1A A;  3BJO A;  3KL4 A;  1RUN A;  1P4W A;  2DQR A;  4J30 B;  2L7Z A;  2L4M A;  1SMT A;  4U0W A;  4DIQ A;  3RCO A;  3GWL A;  1OW6 A;  4KIS A;  3FWE A;  5LEJ A;  1YW9 A;  2KHM A;  3BTJ A;  3KPH A;  3W6K B;  3I56 I;  4BDY A;  2RGV A;  1ZHX A;  3EHN A;  1GVJ A;  1V3F A;  2HV7 A;  5DLJ A;  2YWA A;  5A6J A;  4CJG A;  1ST6 A;  2TCT A;  3AOU A;  3K70 D;  1BOB A;  1B59 A;  3QPT A;  3E70 C; 
#chains in the Genus database with same CATH homology
 4E6K G;  2CH0 A;  2WY7 Q;  2J45 A;  2PX3 A;  3ZXS A;  4CH7 A;  5CPR B;  1RJ9 B;  1OCC C;  4U7B A;  2Y69 C;  5D91 A;  1X4P A;  5E33 A;  4YT4 A;  1J09 A;  3ZCO A;  4BQN A;  3UNG C;  2EIN C;  2Z1D A;  3CQZ A;  5DVW A;  3K7D A;  4CSA A;  1WFX A;  2QKM B;  2WVO A;  1D1C A;  3SYT A;  2KQ9 A;  3DD7 A;  1TWG A;  3FAJ A;  3HXL A;  1QHH D;  3L2W A;  3Q6N A;  2MAB A;  3OEO A;  5KYU A;  3BC8 A;  4E7S A;  1QU3 A;  2DYS C;  3H5A A;  2W4B A;  4HEA J;  2Y3H A;  4ZLC A;  3B0U X;  4C7O A;  4CUG A;  3ZVR A;  1YE9 A;  4OIP F;  1JPN A;  3DPL C;  2WAF A;  2E5Z A;  3TBI A;  2HV6 A;  3NYJ A;  1M2O A;  4BJ5 C;  3VYU B;  3WOD F;  3S0X A;  4HE8 D;  2Z16 A;  3S3O A;  4CS8 A;  4KJZ A;  4W8K A;  3JCU Q;  4BS9 A;  3NG1 A;  3S27 A;  3BCB A;  5DS4 A;  2MD0 A;  2R7W A;  1N1C A;  4XLF A;  2R7S A;  2Y0S A;  4Y4R A;  1Y56 A;  2NUP B;  4HFK B;  1J8M F;  2XF6 A;  2W9Y A;  3VYW A;  3F9K A;  2KDO A;  1GLN A;  1Z3X A;  3OY9 A;  2Q9B A;  2RQQ A;  4M63 A;  3RIP A;  2M4G A;  4OAZ A;  1S9H A;  2E60 A;  2XF7 A;  4PJN A;  2X1D A;  3KEY A;  3UR3 C;  3N24 A;  4IAO A;  4KBL A;  1O5H A;  1Z6A A;  2P6V A;  4XNF A;  4E7I A;  3JYH A;  3X1O A;  4YWQ A;  2W1O A;  2VIX A;  4EWC A;  2IS4 A;  2MYS A;  4XN3 A;  3I3L A;  3KYL A;  4BE1 A;  2CV1 A;  2BE5 F;  2WB7 A;  1AA7 A;  2HVS A;  2P0W A;  1MMA A;  3K4K A;  3AL0 C;  2I8B A;  2P7V A;  2VJ5 A;  2IXO A;  3VDX A;  3AL0 B;  3CP2 A;  4Q4Z F;  2W4M A;  3N0T A;  2Y3D A;  2BVL A;  4RDA A;  4A2N B;  1SFK A;  1N75 A;  4B6I A;  3OIP A;  4YT5 A;  2QTV A;  2FFH A;  5B1A C;  2XF5 A;  4CS9 A;  2VKH A;  4FET A;  4C9Y A;  2KLO A;  1N77 A;  1BR4 A;  1NG1 A;  3MMY B;  1VYK A;  2H7V C;  3TD7 A;  3EG9 B;  3EHM A;  2A6T A;  4F3Q A;  2KQR A;  3DTK A;  3OR2 C;  2KW3 C;  2HZD A;  2MWQ A;  1VZ0 A;  4BDZ A;  3EQL F;  1WJ5 A;  2KGO A;  3C2G A;  1PCX A;  2EIM C;  2A5W A;  1ZHZ A;  4NC7 A;  1VYI A;  3I5Q A;  3I5P A;  4LLE A;  4KIT B;  3DM5 A;  2WVN A;  4OD5 A;  2VXZ A;  4I44 A;  1PJR A;  1OCZ C;  2CW0 F;  3DJN B;  2EIJ C;  3DAF A;  2V26 A;  1ZHT A;  3HOS A;  3KX2 A;  2M3A A;  2R7V A;  4Q7C A;  3C2H A;  4XLN F;  4BU2 A;  3PHF 2;  2BW3 A;  1O87 A;  2PJR B;  3NYM A;  4CCJ A;  1ZU4 A;  3MKY B;  2LSE A;  1SMY F;  2OUM A;  4IRU A;  3LL7 A;  3HL2 A;  4LIT A;  5HNF A;  5JHF A;  4XKW A;  4XN0 A;  3OYM A;  4OIO F;  3HG9 A;  1ZU5 A;  2R7R A;  4GYT A;  2NUT B;  3H65 A;  3LES A;  1FFT C;  4BE0 A;  4QI2 A;  1NU9 C;  3NDB B;  4HG2 A;  3H5R A;  4B43 A;  2HVR A;  1OKK D;  4NUB A;  2VJJ A;  1WJC A;  1X1A A;  2LH9 A;  2X51 A;  4LIV A;  4RM3 A;  4XLA A;  4ZC3 A;  3EH2 A;  3SP1 A;  4CCK A;  2WL8 A;  4AU7 A;  3OL4 A;  2K9M A;  3ABK C;  3OYJ A;  5HLT A;  3MLG A;  1LKX A;  3FBI B;  1QHG A;  3OYA A;  4O6M A;  4OIQ F;  1FFH A;  2DT7 B;  3K33 A;  3AG3 C;  1FMV A;  4II2 A;  3NRH A;  4RBN A;  4FAS D;  5FRM A;  3DU5 A;  4E4H A;  1ERD A;  2HVQ A;  3DTE A;  1YX3 A;  3M1C A;  3OL3 A;  4RLQ A;  4PJJ A;  1M2V B;  2EIL C;  4BEJ A;  4LAC B;  2Q9C A;  2VQH A;  3BCA A;  3DEE A;  2RRE A;  2LBF A;  3DJU B;  1D0X A;  3K1I C;  4QI0 A;  4U5C E;  4E7Z A;  1S7Z A;  4RLF A;  2HPM A;  4E7K A;  1MMD A;  1T95 A;  4U87 A;  3CP8 A;  3UMI A;  4PK4 A;  1X1B A;  1X4O A;  1DGW Y;  2K3P A;  2LRE A;  2M7A A;  2IGK A;  3L2R A;  4CSA C;  2GOM A;  1MMG A;  4Y33 A;  4JUR I;  3VSL A;  2DYR C;  2Q2E B;  3RYL A;  2R7Q A;  3Q7G A;  4O6N A;  1T0F C;  3HKZ A;  3O39 A;  2AQE A;  4XR6 A;  3QOD A;  2GOX B;  2V9K A;  3G2B A;  2V4J C;  4HNU A;  3OS2 A;  1JI8 A;  2WY8 Q;  3FBN B;  3OYC A;  1WJF A;  1OCO C;  5B1B C;  3VAY A;  4C7O B;  2E1M C;  3LNR A;  2CGE A;  4CS8 C;  3B0P A;  3K4L A;  2J7P D;  2XXA A;  2VKD A;  3GBG A;  2OV7 A;  2IS1 A;  2QKL B;  1HA8 A;  3AG1 C;  2VPL A;  3ASN C;  4BXF A;  3A4C A;  2OC6 A;  4HST A;  3SNH A;  2VQL A;  4PFP A;  5BUO A;  2JVH A;  2IS6 A;  3QYE A;  4I1M A;  3RKO F;  4Q5S F;  4BG0 A;  3IAM 2;  2FGY A;  3L0I A;  4E7H A;  3LSH A;  5CQE A;  3W8H A;  4H4K C;  2OCC C;  2L9N A;  1P9Q C;  4XTK A;  3LLI A;  2IGN A;  2WAD A;  4EBB A;  1Z5Z A;  1NZE A;  2J9V A;  4JW1 A;  2X85 A;  2A69 F;  1V5G A;  4G6T B;  4JCH A;  4MQ9 F;  3SDB A;  3BG6 A;  2ELJ A;  4X0G A;  2R7U A;  4RD9 A;  4B44 A;  2VJ4 A;  3K6G A;  2PX0 A;  4KNV A;  2VQC A;  3ZG1 A;  2R7X A;  4PSW A;  2ZSI B;  5HVQ C;  4AE4 B;  4NNJ A;  3EGX A;  3F47 A;  1WJB A;  3EGD B;  2XRH A;  1D1B A;  3EFO A;  4CCL A;  4B47 A;  3VYT B;  2ZXW C;  1UG0 A;  4P5O A;  3SZR A;  2M4E A;  3DAG A;  3L2V A;  3OWT A;  2WBM A;  3CES A;  2I8D A;  1UAA A;  2WZF A;  4MND A;  1QZX A;  4OIR F;  4II3 A;  5KHD A;  5FRN A;  3OYH A;  4RMN A;  3D5L A;  3DKY A;  3ABL C;  4C3D A;  4CS9 C;  4JJG A;  4CIH A;  1WJE A;  2VH3 A;  3K70 C;  2K9L A;  5LD2 C;  2DOA A;  1IW7 F;  3S8P A;  1WJD A;  3VSK A;  3IAS 2;  4CZC A;  5KYY A;  3O6X A;  3EUA A;  3DM9 B;  2EIK C;  3HTK C;  4U5F E;  1V54 C;  2UUZ A;  2KMU A;  2A6E F;  3KMI A;  2IYL D;  3K1H A;  4XLP F;  3I9V 2;  3ZQQ A;  3IUO A;  4AYB A;  3X2Q C;  4F91 B;  3HPH A;  2D5R B;  2CFO A;  3L2Q A;  1WJA A;  3PNY A;  4P1W A;  4IKF A;  3H0D A;  4YEL A;  4ULW A;  3LSG A;  4XWJ A;  5CI8 A;  1ZEL A;  3EPZ A;  3VYS B;  5B3S C;  2C04 A;  2IOQ A;  3QYF A;  4O79 A;  2ZSH B;  5KCM A;  3WG7 C;  2XSE A;  2IXP A;  2MFZ A;  2BW3 B;  3OYI A;  3PFY A;  2R7O A;  2J7P A;  2V7F A;  4GRI A;  3K10 A;  3OYG A;  5T3W A;  4BJ1 A;  1YX5 A;  2RNG A;  2X6W A;  3D5S C;  3CF2 A;  3EUH C;  3M8J A;  4OD4 A;  2DXI A;  1MND A;  4XON A;  3SEQ A;  1G59 A;  3UGP A;  5HSW A;  1V5F A;  3F46 A;  5CI9 A;  3RPU D;  2Y3G A;  4CSW A;  1QLE C;  4N4N B;  4WJ0 A;  2X6Y A;  2CW7 A;  1TWH A;  4XOR A;  4DBR A;  2LY2 A;  4F55 A;  2XC7 A;  3N2Z B;  4NC8 A;  2WAE A;  2L7K A;  3DTI A;  2LC2 A;  5E3A A;  4OWR B;  1Z23 A;  2CUZ A;  3DPU A;  1U0J A;  2KPM A;  2XDV A;  3LFU A;  4JOM A;  4XM3 A;  3PJR A;  5T3T A;  3RH3 A;  4DVZ A;  4ZJZ A;  4KT6 A;  1ZYR F;  5DQT A;  3H5N A;  2ZFU A;  3TMO A;  1LFP A;  2J9U A;  4LER A;  1SZI A;  2Q9A A;  3KH2 A;  4MLO A;  4OAY A;  2YEV A;  2DJI A;  4FX5 A;  3I4U A;  5L3V A;  3K4N A;  5IY5 C;  2M7B A;  2G3V A;  4O6Y A;  4ZDO A;  2LOO A;  1X19 A;  2B0J A;  4XKC A;  1X1C A;  2ZXO A;  2LBF B;  4CCO A;  3LEV A;  3LSI A;  1SAU A;  3S32 A;  4U5G A;  1MMN A;  2ZXH A;  3KKB A;  1PD1 A;  2W00 A;  4O7G A;  4ZLD A;  4HRI A;  3DWL E;  3OMY A;  2CV0 A;  2G3K A;  3S3M A;  3U21 A;  3OIQ A;  3H35 A;  3DXJ F;  3EG9 A;  1ZHW A;  3HUG B;  4PSX A;  3UMK A;  4B48 A;  4F92 B;  4NQW B;  2Y3B A;  3OYN A;  1LS1 A;  3FDQ A;  3ZGK A;  3FHD A;  4ZDP A;  1EA3 A;  2CDQ A;  3FHN A;  4C3B A;  4HEA 2;  3LSM A;  1W36 C;  2CNW D;  3W2V A;  4BEH A;  4BJ6 A;  2NOJ B;  3K66 A;  5KYW B;  2V1N A;  2HQA A;  2Q3T A;  2R7T A;  3EH1 A;  2XXA B;  3L34 A;  1K6Y A;  2JA2 A;  5TGT A;  2KP6 A;  1JPJ A;  3DZA A;  2LG4 A;  5KNL A;  1Z63 A;  2W4S A;  2PJR A;  4HFF B;  3K4C A;  2KRH A;  2V6E A;  3OYL A;  1VOM A;  1G8X A;  1Z7L A;  2KZV A;  4LG3 A;  4YRV A;  1TWC A;  3VYR B;  2L9J A;  4CBE A;  2LRD A;  5KYU B;  4DVY P;  5F5F A;  3ONQ A;  4IX7 A;  4PJL A;  3CSK A;  2YZS A;  2VLA A;  4NY3 A;  1OR7 C;  4HSR A;  2VL8 A;  2OG2 A;  2AQF A;  3Q6M A;  4P6I C;  2E1M B;  4DBQ A;  4K7B A;  3QOE A;  3EGX B;  4OIN F;  3ASO C;  3PUB A;  1NG7 A;  2KJG A;  2A6H F;  2FUG 2;  3EFO B;  4AK9 A;  3RSN A;  3S3N A;  3E1S A;  4C30 A;  3DKX A;  5DS6 A;  2L2O A;  1FMW A;  1BR2 A;  3LSK A;  4BQQ A;  2M4K A;  1D0Z A;  4XOP A;  1PD0 A;  3E9V A;  3POV A;  1R6R A;  4U5D E;  3HC7 A;  2O9X A;  2VJI A;  3TL4 X;  3FVY A;  4BL0 B;  3HPG A;  5L3Q A;  3ZC4 A;  2QY9 A;  1UEL B;  2F6C A;  4JZA A;  5T1D B;  1FTS A;  1OKK A;  1SF8 A;  4YJW A;  4KC9 A;  3MX3 A;  2WA0 A;  3PSF A;  4CCM A;  2J46 A;  3PMR A;  5CQG A;  4F4B A;  2JUG A;  4YEJ A;  2H7B A;  2W7N A;  4U5H A;  3MKW B;  4CCN A;  2W82 A;  2XSJ C;  2DGJ A;  3T4R A;  4XLH A;  4G7H F;  2VXD A;  3K4M A;  4ANJ A;  4IZZ A;  2IXM A;  4U5B E;  5EGY A;  2CNW A;  3LMM A;  4XKV A;  4G0H A;  1OCR C;  3AQC A;  4IQJ A;  4YN0 B;  3EUK L;  3CJQ B;  2YHS A;  5LFA A;  4HNT A;  3W2W A;  3QZC A;  2V3C C;  5KYX A;  2JSP A;  3V7O A;  4RM2 A;  3OS1 A;  1E0E A;  2Z2S B;  3GOD A;  1RJ9 A;  3OOU A;  3JSZ A;  1KON A;  3Q7L A;  3K4B A;  3LJB A;  3OYE A;  4I3M A;  3MD2 A;  4QDL A;  2J0X A;  4DGW B;  2O5R A;  4AVZ A;  3DLA A;  1MNE A;  3OYF A;  3ECS A;  4IJJ A;  4IWB A;  4CS7 A;  1MW7 A;  3EZH A;  3ZR8 X;  2ZXR A;  4D9J A;  3W3C A;  1BR1 A;  2XL4 A;  3OYK A;  2KNH A;  3NWT A;  1Z3I X;  3OYB A;  4G7O F;  3ZIB A;  3BG7 A;  4R79 A;  1OLT A;  4J01 A;  4C2T A;  3S29 A;  2WAQ A;  3HOT A;  4ZTJ A;  4LIU A;  4C2U A;  3ZSU A;  2K5C A;  3W8I A;  4AE4 A;  4BJ5 A;  5FCL A;  3OYD A;  3EGD A;  4KI2 A;  2G62 A;  3K4J A;  4N4O B;  3CZ6 A;  2CV2 A;  3EZI A;  3UMH A;  2F5V A;  2BOL A;  2NUP A;  4Y3O A;  4ZDL A;  4JVS A;  4U5E E;  2DCE A;  2ZXI A;  3RTR A;  2L9S A;  2PF4 E;  2ZPA A;  2X6X A;  4B3X A;  3LS0 A;  4FES A;  4BJT A;  3S28 A;  3H9G A;  3PSI A;  3OR1 C;  2KRC A;  4CA0 A;  3T6J A;  1TWA A;  4XL9 A;  4YT2 A;  2NG1 A;  2X1C A;  3L2U A;  1TR2 A;  2A68 F;  2C03 A;  4K0D A;  4GEH A;  2X1E A;  3LLK A;  2M0M A;  4IQ4 A;  4PFO A;  4DOZ A;  4XLE A;  1VK5 A;  4HPQ A;  1Z3Y A;  2H7O A;  3IP4 B;  1X1D A;  4BQO A;  1TKN A;  4J32 B;  3T6B A;  1IRX A;  4PUS A;  4XKB A;  1VMA A;  2J0W A;  4LLC A;  3J7A Y;  5DS5 A;  5CKT A;  4BJ6 C;  2Y39 A;  1LDK B;  2CS3 A;  3M1C B;  1KU2 A;  3UGO A;  3AG4 C;  3IEE A;  4XMY A;  1WGW A;  4XLC A;  2PP4 A;  4BEH B;  4JJF A;  3MKZ A;  5EHH A;  2IXN A;  1D0Y A;  5HOO A;  4XOT A;  2R4G A;  3PNT A;  2IGM A;  1W36 D;  3BLY A;  3LAY A;  1NG6 A;  3V42 A;  3N05 A;  4JQF A;  3B9Q A;  1DP3 A;  5F5H A;  4YT8 A;  3W2A A;  3E0J B;  3SYN A;  2HPI A;  4DJA A;  3AKZ A;  4I1O B;  3H9J A;  3ZRG A;  2F4I A;  3AFH A;  3DMD A;  3GAN A;  2VB6 A;  2XAU A;  2W45 A;  3B0V C;  4AX2 A;  2JVG A;  3OS0 A;  4ITV A;  3CJR B;  3VWB A;  1TZL A;  4ZYA A;  3K6B A;  2IS2 A;  2PFD A;  4F93 B;  4D1Q A;  1IZM A;  1W2W A;  3RFY A;  2A1D D;  2IXS A;  3AQB A;  2UWM A;  2VAS A;  4BGD A;  3FDY A;  4BAC A;  3LS1 A;  1V55 C;  2JD3 A;  1PYV A;  1N78 A;  3NKE A;  3DU6 A;  5KYN A;  2CW8 A;  4E7J A;  3OA1 A;  2HNH A;  2HDW A;  2J9W A;  3RQ4 A;  1M56 C;  2GFH A;  3JRT A;  4QPQ A;  1LVK A;  2Q1Z B;  2KL4 A;  3EPV A;  2LYC A;  4G7Z F;  2E87 A;  2VQG A;  2L81 A;  2WZG A;  1Z21 A;  3SZG A;  4ZTF A;  3NKD A;  3D5R C;  4E7L A;  3JT1 A;  2HU9 A;  2DT6 A;  4PJM A;  4X0R A;  2NUT A;  2MC4 A;  2UV1 A;  1V5E A;  1ZHY A;  1DGR M;  3ABM C;  4C3E A;  3DPT A;  5HNH A;  1Y6I A;  4QPO A;  2WB1 A;  5E2Q A;  1NU7 D;  2ZXP A;  4F52 A;  3ITF A;  3PNV A;  4BUP A;  5D92 A;  2CMP A;  3DQV C;  3CMM A;  2WZL A;  3PL8 A;  4BE2 A;  4FWV A;  2PMZ A;  3H9Q A;  3NWS A;  3EJN A;  2E5N A;  1J8Y F;  3SEZ A;  3QYB A;  2Z15 A;  4J00 A;  3SEO A;  4XQF A;  2IGO A;  2BVM A;  1M57 C;  1D1A A;  3KL4 A;  3S93 A;  4J30 B;  3FKJ A;  1DQU A;  1M2V A;  3AG2 C;  3QMK A;  4DIQ A;  3RCO A;  4KIS A;  4KNW A;  4EAT A;  2KHM A;  1TT0 A;  2CUJ A;  5FRO A;  4BDY A;  3HJC A;  3NYL A;  1ZHX A;  2L5Q A;  3EHN A;  2HV7 A;  2LY1 A;  5E3C A;  2WVQ A;  5DLJ A;  5KYW A;  3HLZ A;  5DQZ A;  3A1Y A;  1ST6 A;  5KYY B;  5KYX B;  3K70 D;  1BOB A;  4N06 A;  3A2K A;  3E70 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...