3CZ6A

Crystal structure of the rap1 c-terminus
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
RSDFSNEDIYDNIDPDTISFPPKIATTDLFLPLFFHFGSTRQFMDKLHEVISGDYEPSQAEKLVQDLCDETGIRKNFSTSILTCLSGDLMVFPRYFLNMFKDNVNPPPNVPGIWTHDDDESLKSNDQEQIRKLVKKHGTGRMEMRKRFFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords DNA-binding protein RAP1
publication title Structural and functional studies of the Rap1 C-terminus reveal novel separation-of-function mutants.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 48
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3cz6A02
1.20.120.1480 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3cz6A01
3CZ6A 3K6GA 4BJ6C 4BJ5C 4BJTA 3OWTA
chains in the Genus database with same CATH superfamily
4ESJA 3KYDB 3L7WA 2ESHA 1K05A 4OD5A 3G4ZA 3ABMC 1LKXA 2H7OA 3C8GB 4PJMA 2NOGA 2XPUA 4A3FJ 4IWBA 4M3BA 4CH7A 2E7WA 3ECHA 2Q8KA 2YQYA 3DWWA 1ZR2A 1ZN2A 2MBFA 4E7LA 2LKSA 3ZMDA 3ABKH 1TWCJ 2XGDA 3RQEA 1JTXA 3SZGA 1FEXA 4PFPA 1UHMA 4HX8A 1N25A 1TFKB 3CQZA 4XLNF 4EM2A 4PJNA 1QA6A 1X4OA 2JWTA 2K7LA 3HPGA 3JW4A 3QQAA 2H7VC 1MJBA 2WV1A 4YFNF 2F6CA 4P9FA 1M6TA 2X4HA 3VWBA 4Q47A 1USSA 5F04A 4U7BA 4DBRA 1T0FC 3G3ZA 3RIRA 3CDHA 3AG1H 2HOTA 2GM4A 2DB4A 2WTEA 3TOAA 2LP4A 3FAPB 2NS0A 2C03A 4YL0A 1QQIA 3BJOA 1ETVA 3WGIA 3WHBA 5KCMA 3CC4I 2N8GA 2DI3A 4HA8A 1L0OC 3OYLA 5A6BD 4AC0A 5CJ9A 2XXAA 1N1CA 1GV2A 2XASA 3CP2A 3EUKL 3P9CA 4S0HB 2Y3HA 4GO1A 2BGCA 5DD8A 2ZB9A 5DS5A 3CD6I 3BDDA 3P9IA 3GWLA 2BYVE 3ZTMA 1PYVA 2LK2A 3JRDA 5ICGA 1I5ZA 5GTHC 3W6VA 2DMTA 2EA4A 3TL4X 2J0WA 2VKEA 1HCRA 4BKXA 4RBNA 2XL8A 1EA3A 1JT6A 3HC7A 1CGNA 2Y9ZA 4IRUA 4EM0B 2PX0A 2M1BA 4KDPA 2OG2A 2XB0X 4HNVA 1VQ4I 1O87A 1UG7A 3E7LA 2DK8A 1TFOB 2R7WA 1VK5A 2OBPA 3TJ5A 1IN5A 2LFBA 2VI6A 1ETKA 4PJLA 4U88A 2GAUA 3Q9VA 1ZQ3P 5GAGJ 3H3VK 3EGXB 2DFHA 5K7FA 2XLVA 3PL8A 3H2UA 1D0YA 2O8KA 2ZC2A 2IXMA 3PO2J 2CO5A 3CO7C 3VDXA 1D0XA 2BY1A 2XROA 4GFBA 2LTPA 2LVSA 2NAZA 2W57A 3ESWB 4XK4A 4HQMA 3QP6A 4IXAA 3U2RA 4I2OA 1ZLKA 3HOVJ 1YIJI 3RH3A 3C2GA 4O7GA 2P5KA 5KNLA 5J3LA 5A6BA 1BR4A 2E2IJ 4MVOA 1XC5A 1ST6A 1YQAA 2IXNA 2F22A 4AIHA 3CUQB 2XM4A 3IQ6A 3K1MA 4WJ0A 2Y31A 4M71A 3WU0A 4E7HA 2K85A 2HVSA 2IBDA 1WJ5A 3R0JA 3B9QA 3PQJA 1JXSA 1POGA 3W6KB 3QTHA 2AO9A 2X0LA 4K0DA 2FBHA 2P6VA 4U0YA 2UWMA 3K10A 2OUMA 4CZZA 3NMJA 1OCCC 2XIGA 3BG3A 1T2KA 2VQCA 3I0TA 2EINH 1SFUA 3B29A 3H92A 5B1BC 4IHWA 1PUFB 1IXRC 3GM2A 3GEEA 2LIGA 2ECBA 3T0YA 3RYRA 3PIOF 4L9JA 2V9KA 3HPHA 1J75A 1Z3YA 3OMYA 2PBEA 2OKUA 5EGYA 3TULA 1APCA 3BLYA 3R6SA 2XVCA 4XLAA 2J9BA 5J4VA 1AHDP 3EZHA 5DD4A 3RW0A 4NC8A 3HYIA 4HF1A 3JRHA 2OF7A 3I53A 3NAUA 1P4AA 2IPQX 2NVXJ 5IT9K 4YN0B 4JTDB 5D91A 1TW2A 4MTEA 1FY7A 3TBIA 3CCLI 2VT3A 4J00A 1XSXA 2CQ7A 4E70A 3OYBA 1MBGA 2G3VA 5BQTA 4KN4X 4AIKA 5HNHA 3U9GA 4S04A 2R7SA 3JRCA 3RQFA 2M5WA 5EEAA 3M4BA 4AD9A 3V5XA 1N78A 4EBJA 1ETQA 4G7OF 4JYKA 1T9KA 4HX7A 1T56A 3L1PA 2KISA 5FLXK 4N06A 1TR2A 1IV8A 1OXBA 2XRLA 2VOOA 2WB1N 2W84A 3BWGA 4F92B 1FBQA 2DN0A 3GBGA 2EQRA 4XRFA 5DTDA 4HW0A 4HLYA 3MZHA 2OTLI 3L1MA 1SFEA 2QF7A 2HKXA 5BNGA 1OR7C 2I8DA 4N4WA 2J5OA 5L3BA 2UUHA 5COMA 5M5WJ 4EHPA 1LJ9A 3HRMA 3BR0A 2LFFA 5DCFA 3MKLA 3IH3A 1EA8A 4CCOA 4D4NA 1LVAA 5L0JA 3HLZA 2CJJA 3HHGA 1Z7Qc 4NTAA 1R4MB 1PUFA 3ABTA 4A5MA 1SD4A 4ZTFA 4A12A 4FETA 2IS4A 2J7PD 3EHNA 2IJLA 4LG0A 2MH2A 5JLWA 3DFGA 5D8KB 1MH3A 2CW7A 4D1QA 3D1NI 3HHHA 3LSKA 4J19A 1YX3A 1ZHFA 3ABLH 4QTRA 3ABKC 4C2MJ 4HV6A 4KI2A 2XC7A 2P5LC 2XSEA 2QENA 2CMPA 4IEJA 1DQUA 2KDOA 2NS8A 2AXTC 3EYYA 2MWQA 2FQ3A 3FVYA 5A6JA 1E86A 4KITB 3TO9A 4EBKA 1A7EA 2VN2A 4A5NA 3DMDA 1HOMA 1MMDA 5CIVA 3ZQVA 3TOMA 3MZYA 2M0CA 3S2HJ 3FOOA 1A31A 4YWQA 3DEWA 3LSIA 4Z9IA 3DV8A 1VTNC 3B6CA 1WQ2A 5M3MJ 1VOMA 1BDJB 4XORA 2YL3A 1SMYF 2M30A 1ODDA 2CSOA 2DMNA 1VTMP 4M9XA 4AIDA 2HVQA 2YL0A 3S1RJ 4CX9A 1P2FA 1XDSA 1I6XA 3M1CA 4H4KC 3BCBA 3N97A 3HKZN 3DJUB 2OQRA 2PJPA 3RYLA 2M9HA 1G59A 2AS5F 4CYCB 2TCTA 4JE9A 4CUGA 2PG4A 2ZXPA 2HTJA 2XB5A 1XMAA 1AWCA 4EQQA 2M34A 3D5RC 4A6DA 2UZKA 1OYWA 1U8BA 3K9TA 2VIXA 4ZDPA 4BXUA 3CO6C 1XZQA 2G7HA 2HVRA 4BG0A 4MEYF 2BY3A 2EPLX 5A2QZ 5E3CA 5F28E 1WJEA 2EB7A 2IVMA 1HMOA 1J7KA 1V5GA 3BQZA 3LQRA 1OXKA 2KQRA 2VC0A 1GVDA 3JSZA 1T6SA 3KEYA 3AQCA 3BOQA 3DEEA 4M9ZA 4RAGA 1UG0A 1F9NA 1WI3A 3KP7A 1ZHWA 3IRRA 1LB2A 5HODA 1MH4A 1IC8A 1CPRA 4YT8A 2PX3A 3FBNB 1IN4A 1NK3P 4BHBA 4KIBA 2HYGD 3EDPA 4DW6A 1FOYA 2O7OA 3OR2C 3WTTC 5HNFA 2P5VA 2VT2A 2E87A 1YA7O 5ICEA 2NRAC 3AG3H 2V6CA 5EF6A 2QWWA 4ZDLA 3DTEA 1G4WR 2CYYA 2DTZA 2IGOA 2IT0A 4MVRA 2K3FA 1KQ8A 3SYTA 5ILVA 3AGUA 1T0FA 3GTKJ 2ZSHB 2L02A 1RETA 4B3XA 4JEAA 2BY0A 2X6XA 2VC1A 4HV5A 1BOAA 4OWRB 4AU7A 2FBKA 1E3OC 2FXAA 4U5EE 2L5QA 4NDLA 3TKYA 2PEXA 3NEUA 3BTCA 4CYCA 1S6LA 3ERED 3C63A 1JMWA 2GAQA 3WGHA 1SAUA 3E97A 1AU7A 3BEHA 5KAIC 4E6KG 3QRFF 3EYIA 4LIUA 1BI3A 3GORA 4A0YA 4ULVA 3VYRB 4AYBA 2LBFA 1XMXA 2Y75A 4HF0A 4LITA 3KP3A 3WTYC 1OCOC 4PGGA 3CMMA 1QZYA 4NTBA 3RVYA 2X6OA 1FIAA 4XLHA 2EINC 1NH3A 2A1DD 5BOXA 3OYCA 3SZTA 4ASNA 2YPRA 2IP2A 4BEHB 3FXQA 1VQ5I 3FZVA 5IYDJ 1ZG3A 2ZBKA 2O0YA 2F2EA 3AL0B 1W1WE 5LEJA 4D7MA 5FD6A 1D0ZA 2RQPA 4PDKA 1MJ9A 4B8XA 4HOBA 1OJLA 3PUBA 2KL4A 2KPMA 2LF7A 3TDZC 3NDBB 1V5FA 3MMYB 5DVWA 5EHHA 4W8PA 1YS6A 2LD5A 3LJBA 4HQEA 4IHSA 3JCUQ 2QCOA 1H89C 2VL8A 3NYLA 4FCYA 3KX2A 3U8PA 2LG4A 2NSGA 1REPC 3D0SA 1W7PB 2R7OA 4UV8A 5DUIA 1T6QA 3L2CA 2L7AA 3FMSA 4K1OA 4MVQA 2DYRH 4IJAA 3ZRGA 3EFOA 4EIYA 3EG9B 1PD1A 4C3JJ 1FFHA 2K27A 3F22A 1O3QA 4FASD 5JT4A 3OEOA 5KYWA 1A0BA 4ON0A 1OCTC 1IRZA 1WWPA 2HYFA 3W6JB 1Y6IA 2JA8J 3K66A 4AE4B 3HTSB 2CRGA 4EJTA 2HJMA 2ZJPF 2JRMA 2M7BA 2TDXA 4HSRA 3DXJF 3DPLC 4HYEA 2HKOA 5IP7J 5FB2A 3QPLA 1T38A 2ZXOA 3O6XA 4LLEA 4M73A 5FD5A 4AX2A 4BEMJ 3MEXA 5K7ZA 4BQAA 3WG7H 1Y56A 3PNVA 3DM5A 5COGA 3ZIBA 4D5CA 1SMTA 1TQPA 2EFPA 1Z7LA 2JPBA 3LLIA 4IKFA 3CEXA 3MWMA 3E6DA 3L2VA 1OYYA 1BI0A 2H1KA 4ZYAA 1OYIA 1O3RA 1JKRC 3S27A 2M7AA 2BEOA 2H6BA 3ABLC 1I39A 2LKPA 2HMQA 2OV7A 1SD7A 5L3GA 3C62A 5JP7A 3FKJA 2XF5A 1APLC 3DKYA 4FESA 2M4KA 2CQKA 1I6HJ 3HB9A 4JK1X 3BR6A 2QLZA 2GOMA 3H5RA 1NBBA 4J01A 4RMNA 2R7UA 1MBEA 1Z77A 5CI9A 4N4OB 2AU5A 2Y30A 3R7CA 1X1DA 1BA5A 1W7PA 3I5UA 4AIJA 4XPWA 4FE4A 3HOXJ 5B3IA 3LMMA 4XPXA 2D5RB 5JSLA 3PDMP 1MMNA 3IWZA 4RM3A 3CMEI 1LE2A 4DYRA 1KU7A 4OIRF 2M4GA 1ZARA 4MLOA 1ZKGA 4YL3A 5HLIA 3KZIC 2XS1A 4CDAA 3NWTA 1K78A 5K1YA 3JRTA 5HLHA 4J32B 2IBFA 3FK6A 1QVUA 3JTGA 1ZRFA 2ZKZA 2GWRA 2TRTA 3IV5A 3W8HA 3RIPA 3ZQGA 3M1EA 4DZPA 1GUUA 2XGXA 3AAFA 2R93J 4JBAA 3EUHC 1RXQA 2FFHA 2VKVA 1OR7A 2F5FA 3MKWB 4CCJA 2W4MA 4HNUA 3OIQA 3HEFA 3H9JA 1BIAA 3ONQA 4XN0A 1WN0A 5EK0A 2W4SA 1FIPA 2H09A 3OL4A 1HW5A 2K9MA 4MQVA 5EJCA 2L81A 3HTUA 1TZLA 3LSJA 4LDKA 3H35A 3US6A 2IAIA 3GWZA 3OIOA 2V26A 4CZCA 4JOMA 4MTFA 2XLMA 1R1VA 3VPRA 2EV5A 4D9JA 1OCRC 2YSRA 4JJGA 2X6WA 4M74A 1WRJA 4MEXF 4EV0A 1R6RA 4QSHA 3F8MA 2A69F 4L5JA 2YKZA 4CS9C 5FROA 3T6JA 4HFKB 1BI1A 3AG3C 3UGOA 4MFEA 1KQ9A 2DW4A 3QYBA 2L7KA 1QZEA 2JZYA 1V74B 3ZWIA 3W2WA 1U0JA 3QW1A 2Q7RA 2HXOA 1VF9A 3IAM2 2DU9A 1J09A 4LERA 1FLIA 2HQ5A 1YA9A 3BTJA 3SFIA 1WGXA 4U5FE 3JSPA 5D92A 1LE4A 3GFLA 4XEKA 5BQIA 4I09A 1G4DA 3OYHA 1X2NA 2VJ4A 5D8LB 3ZOBA 2IYLD 4JZAA 1ONVA 2A6EF 4WX9A 1X1BA 1Y4CA 2J9WA 2LDUA 4AUXA 1B8IB 2DLLA 1MNEA 1DGWY 3CCYA 3I4PA 1ORKA 1QVTA 1YW9A 3VYSB 4I01A 2A5WA 1R7JA 4NQWA 4ITVA 1TLHB 5KVRA 1QVXA 4R1HA 3F0CA 4FX0A 4O3MA 2AWCA 3O10A 3FXKA 2P7VB 2L4MA 1VQ6I 2PF4E 1ZAOA 5KK1A 3LAJA 2J7PA 2YLDA 4J7TA 5KYYB 3V7OA 2E19A 4EM1A 2EILH 3GM1A 1C02A 4BBSJ 1PP7U 3IKTA 2L6FA 4BDYA 1MIJA 4ER9A 2K3PA 4HAMA 1R00A 2BW3A 2B9SA 5K5RA 4XONA 4B09A 1XD7A 4CIPA 2FQ4A 1G2HA 5GPAA 3M8FA 1ZRDA 2XGCA 2VPLA 1SF8A 1ZHYA 2AQFA 4HZFA 4NC6A 1H9TA 5EG0B 4XR6A 2OZ6A 1MJAA 1Z7UA 1W4MA 2L9VA 5F0FA 2OA4A 3RQIA 1HQCA 1ZTRA 1XS9A 3ZN1A 2PNOA 5L0HA 3OYKA 1I27A 3VFZA 2PMZA 4WWCA 3U3BA 4F4BA 3K2ZA 1FBSA 4GEHA 3I71A 3U21A 2L9JA 4CCNA 5JVEA 1FR0A 4RB1A 1WJFA 3MFNA 4KN7X 5E20A 3JAMK 4EJWA 2Y3DA 1E84A 1MGTA 3GWNA 3BJ6A 1HLVA 2AQEA 1ZGWA 1HMDA 2QQ9A 1QZZA 4GYTA 4OMZA 1GDTA 3WG7C 1IUYA 2K9LA 4XRSA 3GX4X 4YK5A 1D5VA 4FTHA 3H0GJ 1PP8F 1Y0NA 2KIUA 4E7ZA 3SNHA 1A6IA 2QQ8A 2HSQA 1RCPA 2DBBA 1O3SA 4O6NA 1EKEA 1TWGA 4BS9A 2TMVP 3BR1A 2MC4A 1ZELA 4CS8C 2HOAA 3V42A 4J30B 1TP4A 1LDKB 3HSRA 2D5VA 3O39A 3S9OA 1IXCA 3GO5A 3RKYA 2IA0A 1K6YA 4UVCA 1EJ9A 4UY8I 2I5UA 3KYLA 4JQFA 4XKVA 2W48A 2R05A 3IQ5A 3IQCA 3OYMA 4WABA 2ZXWH 1V4RA 3WTUC 4BJ6C 4KFCA 3TW6A 1VB5A 2EZIA 2OQGA 1ERDA 4MNDA 1ZH5A 2DK5A 1YX5A 4G7ZF 1FJLA 2E2JJ 1FOWA 1S9HA 1P4WA 5JR3A 4A3DJ 1IN6A 4EWCA 1JKPC 3MYIA 1Y0UA 3OS2A 5GPGB 4S05A 5DCMA 3UKGA 1J5YA 4A3IJ 1RKTA 3QAHA 3S8PA 2HDDA 2C04A 5ERIA 1FYMA 4XL9A 1DGRM 2EBIA 3C7JA 3RF3A 4DGWB 2IGMA 5CVIA 1K79A 1R23A 4M72A 2CGPA 1UAAA 4A3GJ 3F8FA 1DOWA 4XOPA 3K4CA 1IDZA 5ILUA 4ZLCA 1YLFA 3GCMA 2QA4I 1TNSA 2DMPA 4A69C 3VF0A 2JVHA 4K2EA 1Y1WJ 1OKRA 4RGXA 3PSFA 2ZJ2A 5K5OA 3F21A 2JJ7A 4YEJA 2VOPA 2DT6A 2H8AA 3ERMA 2RSEB 3Q6MA 4BU2A 4I44A 3A1YA 2ID6A 4G6QA 1U3EM 1Y8RB 1E3HA 1SVMA 4CA0A 3S3NA 5CVUA 4GDFA 2Z15A 3S90A 3EJNA 3DI5A 2CNWD 2DA4A 2HFHA 1SR2A 4HE8D 3BG5A 5L0GA 5JHFA 1Z6AA 3NRVA 2PJRB 1FYLA 2IS2A 2QQBA 1JKQC 3GANA 3N2ZB 3BP8A 3E6MA 4RGRA 3G1OA 4UUSB 3S17J 3OOPA 2VXZA 5ICCA 1BOBA 3TK0A 2XSDC 1TWGJ 5E2QA 1W0UA 3JRIA 2A05A 1AOYA 4QIWN 3DKXA 1JOGA 3HOYJ 4O6YA 3A9CA 5JVGF 4JIOA 2M64A 2Z16A 1X19A 4B6IA 5HLTA 3QPSA 2XXAB 1OLTA 5E3AA 2K86A 2NVUB 3QP5A 2QTVA 4MVUA 3WHCA 2XLHA 3DP7A 1JJ6C 1CQTA 3M3YJ 2PBIA 1JKOC 6PAXA 3LLKA 3H1CA 1I1SA 2DT7B 2VBXA 3GZ6A 4ENNA 1X58A 5C3EJ 3PMRA 1LFPA 2R4GA 3GZNB 1X3ZB 4Y15A 4CDYA 5IYCJ 3ASOH 1QQ3A 2XF7A 1NHAA 3DWLE 4KA4A 1KZHA 3GMEA 1SC7A 2L7MP 5D5WB 4NC7A 4BJTA 4BQOA 4DZJA 1C03A 4XOTA 2F4IA 3OYAA 4JTAB 4BH9A 3O8GA 3PFYA 5EEGA 1BJZA 4ZYDA 2L9NA 4PFOA 3IC7A 4A6EA 3KL4A 1A36A 3SP1A 1VLTA 3IKVA 2MABA 2CWEA 2KFDA 3BG6A 2DYSH 2XAJA 3EUHA 3I54A 3S93A 2QVOA 4R79A 1K6OA 2KZGA 4KICA 4DIQA 2PJRA 3JRGA 4JRZA 3L2UA 4UUSA 1K40A 2XPWA 4UNOA 1Q0MA 2EILC 4HDUA 1WH7A 3KETA 2EH3A 3E5QA 3CJQB 4KT5C 2ZXJA 2EFQA 3IAS2 1K7AA 1YITI 1ZG1A 1JTYA 1GHCA 4ESBA 3HOTA 2FNPA 4CCKA 5LHHA 1CF7A 2F5EA 4KJZA 4NCQA 2YR2A 5JRAA 3GUDA 4NHJA 1YRNB 3HKKA 2ETSA 2QGUA 4BL0B 3ISPA 2M0MA 2HDCA 2ZO4A 1DU0A 1BBHA 3CC7I 3ZMTA 3OWTA 1NZEA 3J81K 3B71A 4JURI 4OIPF 4W1UA 1PVEA 3K6GA 2JX0A 4IQJA 1A41A 3KMIA 3RZOJ 3K1NA 4Q5SF 4CS9A 2LLKA 1I3QJ 5J1UA 4IVNA 2EWNA 3IEEA 5FRNA 2IGKA 3I56I 2BL2A 3U8VA 3OS0A 3BR2A 2GDCA 2GXBA 3FHNA 5HS9A 3C2HA 3OS1A 4K7BA 1FMWA 4U87A 3ZMZA 3S15J 4I0BA 2Q00A 5HDGA 1FT9A 1HXDA 3HJEA 3Q0UA 2KW3C 1JUSA 1LFBA 1A7VA 2WB7A 4IAOA 1RZ4A 3L8JA 3T6BA 2XAQA 1WJBA 3TD7A 4LOCA 5C44J 1O4XA 1XSVA 1R4NB 3RPUD 1S7OA 4Z6YA 4IZZA 1FYKA 4RAYA 1FSHA 3V8LA 3DD7A 1WJCA 3PHF2 1H88C 2RNJA 4YT4A 3HDDA 3EUAA 3GEHA 2PFDA 1BL0A 4XKWA 2YRFA 4X6AJ 1NG6A 2EFWA 2JTVA 4ZH4F 1YRNA 2VPRA 3LOCA 2ZXWC 5DQTA 3FXJA 2DMUA 1RC9A 2VKHA 2WY8Q 5K7HA 4RM2A 2O9LA 5HS8A 3BPXA 1J0RA 1LNWA 2V1XA 1ZVZA 4BJ1A 1Q0KA 5J1RA 1PUEE 1VNDA 1ZR4A 4A3LJ 1WWXA 2WC2A 5FGMA 3JREA 3U2MA 1B9NA 4ZC3A 1OKKD 2K02A 4BYYA 1G6NA 1F43A 3V7SA 4IRHA 1FP2A 3HRUA 2GA2A 1QPIA 3EQLF 5CVRA 1H6GA 2Y39A 4ZYHA 4UV9A 2KT0A 3J80Z 1HC8A 3GW2A 4LG0B 2CYDA 2HXIA 4NC3A 3FISA 5IT9Z 4ENMA 3IRQA 5L3EA 4HRIA 3RKQA 1YDIA 2LCHA 3QMKA 5DDGA 3HIFA 5GAEJ 2FE3A 2QSFX 2W45A 5IPAA 1LM3B 1IZ1A 4F52A 4WXCA 5J6XA 2Y69H 2OAZA 3Q0WA 5LGUA 2JA6J 1U9OA 3KP2A 2ZPAA 3LNMB 3QZCA 2H7BA 4IO9F 4XEFA 3EH2A 2CW0F 3PM1A 1GXPA 1WCMJ 2ZJQF 4QDLA 2XL6A 3SYNA 2BOLA 2WBMA 2RC4A 1UB9A 2CW8A 2V79A 2FF4A 1LDDA 1RI7A 1GT0C 4CS8A 3CJNA 2KIFA 1TC3C 2L9RA 2E5ZA 4CIHA 1I5NA 2MD0A 2LY2A 2AHQA 1UMQA 2GFHA 4A3BJ 1XN7A 3M1CB 3L2QA 4OMYA 2COMA 1AEPA 2EIMH 2ELHA 3FDYA 2IOQA 3ZG1A 3E5XA 4BJ6A 2JRTA 2E71A 3TW7A 4FE7A 4PSWA 4RAZA 4X1EA 3FDQA 3KFWX 5FJ8J 5B1AH 4F91B 5LLQA 1YJWI 3WTVC 2I15A 3WE2A 5FLVA 1ORSC 3Q7LA 3K4JA 4A3KJ 3GODA 4LLLA 3K1IC 3P9KA 5J47A 2OU6A 5D5XB 3I59A 3ASOC 3R0AA 4UVBA 2IRFG 1NTCA 1ZYRF 4OOIA 3ZQHA 4OU0A 5CLSA 4CGZA 4BXXJ 3K4BA 1EH8A 1A5JA 2DDAA 3M8JA 4WXHA 2RD9A 2EA2A 3SQNA 2NVQJ 1KGSA 3J7ZI 4Q7CA 2YS9A 1R71A 2ADUA 2KJCA 1R5ID 3FMRA 3F72A 2X6YA 4A93J 2V7FA 2HS5A 4N9HA 2ID3A 2DOFA 2XAGA 3CDLA 2A07F 3KYIA 3UGPA 2V4JC 1U78A 2WVNA 3PNYA 3UNGC 2L01A 5D6EA 3GFMA 4DOZA 5EZHA 2MGQA 5FLMJ 5FRMA 3C8ZA 2RQQA 4JX4A 5AONA 3AG1C 3U5SA 3ZQYA 1O5HA 1QU3A 4BY1J 1YJGA 1R22A 1XG1A 1U6HA 4A0ZA 2KNHA 4L9NA 3LA2A 2HGCA 2YHSA 4CJGA 2DFEA 4WF2A 1PV3A 4EVIA 1R4TA 1TQIA 3JCUC 4MS2A 1S72I 4OAZA 4XSXF 2DOAA 2EV6A 1TWFJ 2CDQA 2M2EA 3KE2A 1RUNA 5H2FC 4IHXA 5GADJ 2H94A 2O3FA 3N05A 4TV7A 2CFXA 4LB5A 5AGFA 4JCZA 4I0AA 2CH0A 4AYBN 3CCVI 4YL1A 1YIOA 1W5TA 1SFOJ 2P0NA 2DTRA 2FGYA 3R2PA 5KYXB 2LBFB 4YG2F 3BG7A 3HXLA 4I02A 2HZTA 4N4NB 2R5YA 3PCVA 4ZLDA 3OYFA 5EDNA 1ACIA 3SXMA 4MW8A 4BEJA 3BROA 2GXAA 1WASA 3MYFA 1D1AA 2GZWA 3RCOA 2KQ9A 3SXKA 3TO7A 4BJ5C 4XRSG 2DA6A 5BPDA 1VQ9I 1Z3XA 3G71I 1TT0A 4XNFA 2W7NA 4HF2A 1RKCA 5AC5A 1KYWA 2FOKA 4L9TA 4RS8A 1P7JA 3LSPA 3F23A 4A3CJ 3I4NJ 1PD0A 4QPOA 1V4AA 2L9SA 1Q0DA 2CNWA 4U5BE 3V5YA 2R7ZJ 4U5GA 3ASNH 3PO3J 5LRRA 4D7NA 2F5DA 4E7JA 1I1GA 4EGYA 3QPTA 1V54H 1OCPA 4KT6A 4WGYA 1Z6RA 2JVGA 3DZAA 3NG1A 4MNUA 1IN8A 4JJFA 4IRIA 2HTSA 2JPCA 4CDVA 3WU2C 4KNVA 3EFOB 4F93B 4N9IA 1UFMA 5F0CA 3ULQB 2EPOA 1TQMA 1XDUA 5JLXA 1T8IA 4LJZF 2R03A 3RVZA 3GTMJ 1FPQA 5KYWB 2QBYA 5F08A 4KIFA 4DJAA 3CP8A 3NYJA 5FKLA 2WAQA 2ZJRF 5DS4A 3JTLO 4PZJA 4JCHA 2X0CA 2YZSA 4AL1A 4Y3OA 3AG4H 5LBQA 2LD6A 4B1RA 4WK8F 2GQQA 2P6TA 3WTZA 3S1MJ 5KYXA 1MQVA 3LWFA 3GTQJ 4AVPA 2QNLA 1XGNA 2O6GE 3VYTB 2IM8A 2Y2ZA 4IL6C 1F36A 3I9V2 3TP3A 3OYJA 1BC8C 3AKZA 4XMYA 4LD5A 2P6SA 1Y39A 1YW7A 1QHHD 1F1MA 3HG9A 3VEPA 1K4TA 4EATA 4IHTA 5BS6A 4BE1A 3I4MJ 2ZMEC 4C2TA 4LDRA 1RESA 4B3AA 3W2AA 3DU6A 2W9YA 2X48A 3GF2A 4Q48A 2Z9OA 1Q0GA 2DA3A 4O5VA 2Y69C 4O6MA 3G1LA 2HKVA 2NUTB 3V5ZA 3SEQA 4KNWA 1LEAA 4M6VA 1SVOA 4F3QA 2R7RA 1HY5A 3G50A 2VQLA 3U1KA 4N6HA 1B4AA 2ASRA 1VQ7I 2WY7Q 1B1BA 1Z21A 2DA5A 2KJGA 2UUIA 3GVAA 3FHDA 3OL3A 4UDVA 1IXSB 2XKPA 2HWVA 2HMZA 1HDDC 1HSJA 5LFAA 1M2VA 3K4MA 4IF4A 2FU4A 1FFTC 5DQZA 4N0BA 2LF8A 2RKHA 4G7HF 4LMYA 2XPVA 3FBIB 2CUEA 2E5NA 5E1XA 3W2VA 4CYDA 2EIMC 4L6RA 3T4RA 3T6GB 2BE5F 4IARA 1K78B 4IOAF 2HYJA 2LR8A 4I76A 2BY2A 2O03A 2R7DA 3CCRI 1T6IA 3TOLA 1BN5A 3VODA 2QSHX 2HZDA 1PCXA 4DVZA 2KC3A 1QLEC 1FZPB 5B1AC 4IAQA 1XGSA 3NRHA 3RDIA 3I58A 2IA1A 3AOUA 2VKDA 1MW7A 2DFIA 5F6FA 1BI2A 5IY5H 5D5VB 3VM6A 2JUGA 5H6QA 3CMAI 2CQNA 2ZCWA 3CESA 3S3OA 5BQHA 3CZ6A 3ATPA 2DT5A 4I7HA 4L0YB 2VQGA 4LIVA 4FX5A 3DF8A 4IB4A 1Z63A 2YL1A 2QUFA 1DUXC 2NUTA 2MSYA 2Q9AA 2GIVA 4CBEA 5DM6F 2Q3TA 3X2QH 1Q0FA 3FK7A 4DQ2A 3NMIA 2BHZA 5ICFA 4XLFA 1SEUA 2FBIA 5E3OA 4X0GA 1MBHA 3H5NA 3KIOA 2R92J 4YFKF 4IPAA 2XLDA 2M8GX 3VAYA 3KYCB 4FISA 4E18A 3LS0A 4JX6A 1XX5A 2BHYA 4XTKA 3HUGB 1Z91A 3ZPLA 1QO0D 2HQAA 2NUPA 4ZZDA 5CVJA 4U0VA 1KQ0A 4YIFA 1UELB 3S2DJ 3ZQ7A 4ZJZA 1MKMA 4IGGA 3GM3A 3B02A 3A11A 1FC3A 3SXYA 1HW2A 4M3FA 4A0XA 2B0LA 4XQ1A 1X1CA 3SZRA 1W36D 1R1UA 1ZW2A 3TGNA 1YZCA 3HOWJ 3E5UA 5L0FA 2P7CB 4IJJA 1D1CA 3ZMSA 1K61A 2HR3A 5IYBJ 3FXUA 2CUFA 2MLGA 1BW6A 1ENHA 3C8GD 4NQWB 4CO8A 3K1IA 3A01B 4EBBA 4II3A 3VYUB 2Q9CA 1XMKA 3KYJA 1MBJA 4XEVA 2OJQA 5CQGA 3OV8A 2LSEA 2ELJA 3IHUA 1HW1A 4ZYEA 3JRBA 1QPMA 3MFKA 2JA5J 1LEBA 4C3IJ 4ENKA 2BC5A 2MG4A 1HKTA 3S29A 3FM5A 1X3UA 3ZCOA 2BW3B 2HPIA 1ULYA 1YHQI 1YS7A 3O6BB 4GRIA 2NNNA 2KSFA 5F64A 2R9RB 2ME6A 2Y48A 5E18F 1Z9CA 4PSXA 3EPVA 2EIKH 3MKYB 3M7GA 1H9GA 3CJRB 2E1CA 1V54C 2KP6A 1LUJB 2MYSA 3K4KA 2X1CA 3N4MA 2KGOA 3S2WA 3HUGA 3H3UA 4DYQA 4L18B 2PMZN 2G62A 4AL0A 4YRVA 3H3ZA 3ABUA 4O79A 5CKTA 3CF2A 3CLQA 2YLIA 3B0UX 5M5XJ 3MN2A 1MNDA 1L7CA 3V8KA 1V55H 4MHGA 4MTOA 1W36C 2XF6A 3VSLA 4RDAA 4U5CE 3HSFA 4D4XA 3NARA 3AG4C 1DPRA 2JUCA 3CCSI 5J4YA 1GS9A 3RTRA 4PGHA 1QBJA 4C2UA 1P92A 4GCVA 2DMQA 4OAYA 4U9EA 3L09A 1VFCA 3W3CA 1AVOB 2R5ZA 4AWXB 3IL2A 4P55A 3A01A 2A61A 4Q4ZF 1P7IA 3KP5A 4NY3A 2NG1A 1GGQA 3R61A 1G3SA 2V1UA 2COBA 1P6RA 3KPHA 5E1WA 1R58A 3V7CA 4EMSA 1FOKA 4I1MA 4E0IA 4CSAC 3JRAA 4RLFA 1WPKA 3LAPA 1UHSA 2K40A 2OPTA 1IRFA 5LGNA 3KEQA 3K70D 3LESA 1VYKA 1Z6TA 2XAUA 2Q9BA 2GBYA 2ZMEB 1FTTA 3WHNA 3CLOA 4BJ5A 3RQ4A 4Z9JA 1IO2A 2ESNA 1R49A 3IUOA 1O3UA 3KP4A 1B59A 1X1AA 2K9NA 1ZREA 1LIHA 1ZU4A 5LGTA 1XTAA 4YIIA 3TP0A 1R9TJ 3K6BA 1IRXA 3HOUJ 3CUOA 3HZJA 2QQAA 5TGTA 2AXLA 3ML6A 3S84A 1MBKA 3ZSUA 1OR3A 1J59A 1IDYA 5DCMB 2QKLB 5DS9A 1G8XA 2F48A 2DYRC 4XKCA 4R32A 2KHMA 3WODF 2VE9A 2STTA 5L0DA 4UVAA 4CSWA 3OA1A 5E33A 1W0TA 1DU6A 4JEBA 1YYJA 4V2FA 4JTCB 3R4KA 1JPNA 1M57C 2LREA 3M4CA 3TJ6A 1WI9A 2Z3YA 2ICWG 3NQOA 3O8HA 1AA7A 3MD2A 4XIDA 1YTYA 1RJ9A 2WZGA 3FXHA 2UXXA 3O2PE 3ZGKA 4ZZLA 1D5YA 1D8JA 1QNTA 2JPUA 1SD6A 2PX9A 3F46A 3GFIA 5CQEA 2C6YA 2RVCA 2EZLA 5L3DA 1JRAA 2ME0A 2HQNA 1MSFC 2ZXRA 1RR7A 1XGMA 4XLCA 4E7IA 2HZ8A 2M4EA 3KP6A 4Y17A 4C7OB 3ZQIA 3DPTA 1JT0A 3JRFA 5IY5C 2HV7A 3HGYA 3DLAA 1E85A 4MTGA 3KEOA 3SDGA 3IWFA 2Y0MA 2M87A 2Z1DA 2MC3A 4GGGA 3W4YA 3UMKA 2WAFA 2XLWA 2E36A 2MA3A 3L2WA 1OISA 3IQTA 2OC6A 2PQ8A 3K70C 2MD5A 2H8RA 2FA5A 3FKIJ 2Y0SN 4XICA 2FSWA 2I10A 3J7YJ 1TBXA 2ZMEA 2ZSIB 3FXMA 1HKSA 3VYWA 1T39A 2CU7A 4DYCA 2LK4A 3JSEO 1F5TA 1JPJA 2VXDA 2KRFA 5TRDA 4LFUA 1ZU5A 1B9MA 5HS7A 2VASA 3TQNA 3QOPA 1BIBA 3HOSA 1AKHB 4WCGA 4E17A 5JUAA 4RB0A 3AQBA 1G3YA 4CICA 3WTWC 1BZ4A 3O3KA 3K2AA 3GTLJ 2OCCH 3K33A 1T33A 2F5CA 3HBLA 3QPHA 3DBHB 2NNYA 4G12A 1U5TC 2ACJA 1TQGA 3K1HA 4LG3A 1QPUA 3CUQC 5AC4A 4J7YA 3B0VC 2BXYA 1RNLA 5B3SH 3WG9A 2FMLA 2HQRA 2W24A 2ISYA 3GXOA 3PQKA 4HEA2 3DBLB 4KYWA 3T5XA 2LNBA 2IXOA 2OU2A 3LA7A 1TKNA 2RN7A 2PN6A 3S28A 5FFZA 3RI4A 1YOVB 3K4NA 2EZKA 1UHWA 2QM3A 3I55I 4C30A 4C7OA 5AIQA 3MAJA 5BPIA 2B63J 3DAGA 4PJJA 2XGEA 4IHYA 3NYMA 1FTZA 3POVA 1QZXA 1Z0XA 4P5OA 4WXDA 3OYGA 2XAFA 4ZDOA 4A3JJ 2GWWA 3HTKC 1IRGA 4NTFA 2LKXA 3HRTA 1TL8A 4L0ZB 1J2XA 4XQFA 4ZYGA 3LEVA 2FD5A 3V4GA 5E17F 2WVQA 5EGOA 1CF7B 2XRHA 3L34A 1KNYA 5L3VA 1V3FA 4OIQF 1W5SA 1TW3A 2R25A 1ZLJA 1AKHA 2EIKC 1Z05A 2V6EA 1O3TA 4U7DA 2CV2A 3HNLA 2K9QA 4RBOA 2Z33A 4C3DA 1SAXA 4DNCA 2ZFWA 2CGEA 1LDJA 1U2WA 2BV6A 2UV1A 4RB3C 4I1OB 1USTA 2ELKA 2NVYJ 5FKOA 2WWYA 3S16J 1NU7D 2WZFA 3ZC4A 2VCAA 5D6FA 2RAEA 3EZIA 4A3EJ 1VYIA 2HFIA 1FP1D 1S5LC 3QVYA 3FOPA 1V55C 1JJ8C 5ED4A 2G3KA 1HBXG 2V9PA 4BE2A 3CCMI 1KONA 2QY9A 2YLGA 3FAJA 3VSKA 1ZK8A 4CXFA 1NG7A 5DV5A 1MZBA 5HLGA 3GTJJ 4V2GA 2KJBA 3OYIA 1YO5C 4BGDA 1ZG5A 3K1PA 1QGPA 2FNAA 2G9WA 1SD5A 4Y7NJ 4HNTA 5L3FA 3CF5F 1GVJA 2LQGA 3FIWA 3MKZA 2L54A 4B44A 1LVKA 4NQFA 3F9KA 5E8GA 3Q9SA 3MZ8A 3F47A 3I64A 3B6AA 3GTGJ 3DKWA 1FOXA 1KU9A 3HL2A 5FZTA 1DDNA 1FTSA 3V8JA 1MMSA 2DAOA 4NNJA 2E35A 3J81Z 2DFFA 2EJRA 1IV6A 1D3YA 5FKKA 4ZTJA 4UXNA 1YFHA 3CSKA 3BRJA 2L4AA 3BPVA 3QYEA 1DP7P 1ORYA 3K7AJ 4KC9A 1IG7A 2I8BA 1VQPI 3LSGA 4RA2A 2GXGA 3T9OA 4NB5A 2J0XA 2ISZA 4ETSA 3TOBA 3AJMA 3RYPA 3OYEA 4L9VA 2OOCA 5FCLA 1SZIA 3FM3A 4MO7A 3BQYA 2BXZA 3RJPA 1FNTc 2MFZA 2EV0A 2YWAA 4FQGA 1YZAA 5IP9J 2AWYA 4LLGF 2WV0A 2KK1A 1JHHA 1EH6A 2OZUA 2W4BA 3L2RA 2DODA 2VUMJ 5GPCA 4YELA 3BG9A 1HE9A 1FBUA 3BCAA 2JK3A 1LS1A 3ZTZA 3CCEI 1XWJA 4QWQA 3MLGA 3H36A 2Q2EA 1VQ8I 5HV9A 3MCZA 1KYZA 1EV7A 5LHIA 1ON2A 1QHGA 2VBYA 2E1OA 1XPXA 2J9VA 2G0EA 2KKOA 1M2OA 4UB8C 3CAXA 1IZMA 4A3MJ 2EIJH 3ZQCA 4LLNA 3H0DA 4KBLA 2GA0A 3HGGA 1H8AC 1VZ0A 1U0BB 3Q6NA 3JYYA 5JVTA 3C8GA 4JW1A 2FJ1A 1P9QC 2YX4A 3IP4B 4YIRX 4L5IA 1M56C 4Z2YA 1CGME 5J40A 1JAFA 1ORJA 2RREA 3BC8A 3D5SC 1EI7A 4ONSA 1VI0A 4ENJA 1D1BA 3JRMO 2R0QC 5L0CA 4CSAA 1TT5B 1Z1DA 3D5LA 4CCMA 3JZ0A 3ZQFA 2JN6A 5GP9A 4W8KA 4W97A 4MVMA 1S7EA 4DBQA 5DM7F 2D45A 1E3PA 1BW5A 5K0IA 3QU3A 3F6VA 3DAFA 5L3QA 5TJ5E 3S14J 3CQZJ 1A35A 1W7PD 2A68F 3PFIA 5D4RA 2E2HJ 2HI3A 2NOJB 3U9JA 3FHZA 1Q1VA 3A2KA 2OCCC 3I5QA 4F7ZA 3MVPA 4FT8A 4MQ9F 3SDBA 2F5VA 1RR8C 1LPEA 2LY1A 4IX7A 1YVIA 1SVLA 5IP6A 3OY9A 3AFHA 2R7QA 1KU2A 3I59B 4Y52J 5B3SC 2F4OB 3E6BA 3OOUA 2X1EA 1U5TB 5IT3A 1WVRA 3LSMA 2VB6A 2P8TA 3KKBA 3PIPF 4JX5A 1EKYA 3Q7GA 2CS3A 3AG2H 1EF4A 3DTIA 3T1BA 1FMVA 2EPNA 2MW8A 2QYOA 4HFFB 1N77A 4XN3A 1RMVA 1ZZPA 3GFJA 3J7AO 5FFXA 3PJRA 1BR1A 1CGPA 5LHGA 2XKOA 1YI2I 4G78A 1OCOH 3S32A 5FLXZ 4LK0F 2ETHA 1YE9A 2DGJA 3AL0C 3SZPA 3SEOA 3UMHA 2KIQA 2A6HF 2OQMA 4RDUA 2K4BA 2MLKA 4G0HA 2XV4S 5F5HA 1JGSA 1KU3A 3N0TA 1Z3IX 2DJIA 1HA8A 2F4MB 4XLEA 2V3CC 2K9SA 3BJAA 3EGXA 4B48A 3A0HC 1JGGA 1J8YF 4I3MA 2D1VA 4G6TB 3IH2A 4II2A 5DUKA 2AVKA 3J80K 3DEUA 1HDPA 3BTIA 3HSEA 2IW5A 3Q3SA 2CV0A 3M15A 4RGUA 4F55A 3LFUA 5A6AA 4KIGA 3ECOA 2L7ZA 4NUBA 4HSTA 3VOEA 2B7EA 3U0CA 2RNGA 5LD2C 1UG2A 1XGOA 1U5TA 1HSTA 4UB6C 1LFUP 9ANTA 1A7DA 3CUQA 4M9SA 4M63A 2R5YB 1FAPB 2XAHA 1F1ZA 1XSDA 1J8MF 2CG4A 3CTAA 1I3AA 2DQRA 3WU1B 3CJTB 2LFDA 3ELKA 4GQHA 1VQLI 1WTYA 2FUG2 5T3TA 2KRHA 3U9MA 2DYSC 3RSNA 3K69A 4PACA 1OR2A 3GYHX 1WHUA 1ZW3A 4B47A 4ESFA 5E3NA 2LC2A 5F27A 3LNRA 4PJ0C 1G3WA 4JC7A 3UMIA 5HSWA 3LS1A 3ITFA 5KYNA 1S3JA 1HF0A 2JMWA 3E1SA 1VQOI 1RKEB 3C18A 3ZR8X 2IS6A 1YW8A 4MTDA 1OQCA 1EQ1A 2DO7A 4UUVA 5BMZA 3HOZJ 4NBQA 2OEVA 2XL4A 4U5HA 2H1LA 2WAQN 5EEHA 2B0HA 3RFYA 5D4SA 3E3VA 3OR1C 4BY7J 2QBYB 1ITYA 2CV1A 4R8HA 2GIZA 1NG1A 2XHKA 3L0IA 2IS1A 4RD9A 4Y4RA 4BACA 3OIPA 4KISA 1Y8QB 2NPUA 3U1DA 1MMAA 1T5OA 4CDGA 4MVZA 4U9DA 3LQQA 4XBFA 1NK2P 3H5AA 4XPYA 5J8CA 4EKWA 2J46A 2EZHA 5L3CA 3LNQA 1MDMB 2Q4FA 3LEOA 3WE3A 3ZMVA 4FHTA 2HOEA 4BUPA 1M1EB 1LQ1A 1B68A 1YAUO 4KNYA 1L3PA 3WTXC 3G2BA 2GOXB 1R5GA 4UHTA 2R7FA 3H2VA 2D4UA 3WTSC 2NS7A 3S1QJ 3HJCA 3ECSA 2WB1A 2YU3A 4BBRJ 5TISC 2BVMA 4EJVA 2EIJC 4C3EA 4YJWA 4JP0A 2A6TA 3SFZA 5GTIC 1IW7F 1DPUA 2LP0A 3DJNB 1R5HA 5IOZA 2WA0A 4JVSA 4DJ9A 3T8RA 3DTKA 4BPMA 4GYIA 2LYCA 2R3SA 2R7XA 4LLCA 5JLIA 2J5PA 1QSPA 1OW7A 1C0WA 2M45A 3JTHA 4BE0A 2A0BA 4P9UA 2PI0A 2W25A 3G4XA 3TMOA 3SXZA 1RKEA 3HRSA 2EFOA 2E34A 3L9FA 5JHUA 3ZP5A 1VMAA 4P1WA 2A0UA 5F1JA 5A2QK 1M2VB 1LI5A 1LS4A 2KYHA 3C3WA 2YVKA 4N6CA 2JSPA 1OCRH 3X1OA 2J9UA 1FWZA 4B43A 4H54A 2H6CA 3TO6A 2LSOA 1NSGB 4HBLA 2QZ8A 2J8WA 1U89A 2OJED 4G94A 3DCFA 5E3MA 4I6ZA 2PP4A 1MNMC 2OEXA 2NVTJ 3KLNA 1MDMA 3HNJA 2HV6A 2HPMA 3QOEA 2DPDA 4D5FA 2FAPB 3DE9A 4I98B 5E1ZB 2QKMB 4WGZA 3JR9A 4BXFA 2WVOA 2B0JA 2A3SA 1VQNI 1WATA 2VLAA 2EPKX 5J1YA 1EH7A 1ZGJA 3WAQA 1I50J 2L2OA 3AG2C 2H8WA 3HKZA 4C3HJ 3QU6A 2YX7A 1PDNC 2HJ3A 2V1NA 4HG2A 2KRCA 2M8EA 3ZN0A 3CDIA 4RB2C 3KZYA 1XCVA 5IOYA 5KYUB 2RGVA 1WGWA 1VQMI 2IEKA 3G73A 2KDZA 3R60A 3S1NJ 4HEAJ 3CCUI 4OIOF 5JI6A 5FKMA 3I5PA 5K5QA 3E6CC 3E70C 4OINF 2DA7A 1U8RA 3I4UA 2KZVA 3BT9A 3DM9B 1W2WA 3RKXA 2W85A 2P4WA 1C17M 1T6UA 3A0BC 1NFOA 1N75A 1JR8A 4IOCF 2L6HA 2NUPB 4E0HA 3BR5A 2K5CA 4PUSA 1ZHZA 4C3BA 2QEXI 1GXQA 2STWA 3RQGA 2LMDA 3JYHA 1XCBA 2E1MC 4DRIB 3UR3C 4XLPF 3P7NA 3K7DA 2O61A 1OQYA 3OSGA 1B6AA 3O55A 4YFXF 1OCZH 2VBWA 3M9AA 4I99C 1YG2A 4XRMA 3DKAA 4ANJA 4EGZA 3M8EA 2YUSA 3L00A 5JFRA 4CJOA 2DA2A 4BHCA 4A4AA 3H9QA 1GQAA 5ILSA 1OW6A 5FO5A 2PFBA 5B5EC 3LSRA 1DOVA 1Z23A 1ZHTA 4BDZA 2EPMX 2Y3GA 3M79A 2DDBA 3H65A 1WFXA 5A69A 1OPCA 3ZQQA 4QLCU 4PR9A 1JI8A 3ZDLA 4V19K 2YL7A 3NMKA 4MVSA 1G3TA 3P5JA 3T8TA 1L3LA 2HEOA 2E7XA 1LI7A 3W8IA 2VONA 5KYUA 3EHMA 4XWJA 3GZ5A 2BVLA 4XKBA 2YEVA 1MD0A 4DXWA 4Y33A 2Y3BA 2LOOA 3IH4A 3BR3A 1X3WB 2V9VA 5GAHJ 1RPWA 1BJAA 2GA1A 5CYVA 3RPUA 2XLOA 5LEKA 1ON1A 3IPMO 3U3FA 2LY9A 1NLXA 4A2NB 3M07A 3NWSA 4BEHA 2JD3A 1TWHA 4FX4A 1ETOA 1TWAA 1E0EA 3F8BA 5T1DB 1G4US 3M4OJ 1MMGA 3QWLA 3FX3A 2XRNA 4G9YA 3QVZA 3SHFA 1E83A 3Q5FA 3LL7A 3FXRA 4LDQA 1GM5A 4A2UA 2FEZA 3GEIA 1U6GA 1O7FA 2BZTA 2XS8A 1ETXA 2IXSA 4QI2A 2BBYA 2ZXIA 3TEDA 3KLOA 3KZZA 4Z9HA 1FSEA 1BBYA 2OD5A 2QSGX 3GEZA 3EG9A 1OKKA 3BTLA 5H20A 4H0EA 1HE1A 4GXOA 2QE9A 2R5ZB 2EPFA 2IGNA 5E8IA 2VJIA 3FMQA 4Y13A 1K4SA 4LGWA 2X51A 1R1TA 1D8KA 4IQ4A 5B66C 2P1AA 2W82A 4AE4A 3OSFA 2PLYA 2DOEA 1ZHXA 2NXNB 4P96A 4BHPA 1OMIA 2IXPA 2KMUA 2HU9A 2Q1ZB 2JA2A 1MSEC 1WKMA 4G6DA 2HUJA 3B73A 3GTOJ 2K4JA 1RUOA 1BR2A 2D1HA 4EJOA 2KIMA 4FAPB 3JT1A 4KUMA 3ASNC 3EGDB 2X85A 3GLLA 4QI0A 4HPQA 3GTPJ 3BY6A 3E0JB 1YJ9I 3CMYA 1TTYA 1UFBA 4OD4A 3OYNA 2Z5UA 3NKEA 1DP3A 2QUPA 3B0PA 4AVZA 2O5RA 4EEFG 5JS5A 4EJUA 3ROUA 1IAWA 2PMUA 3S3MA 1SANA 3DQVC 5CPRB 2LH9A 1S7AA 1TWHJ 1STZA 2VJJA 4RAFA 1TWAJ 2J45A 4M3DA 2QLAA 2WZLA 1F4KA 3K0LA 1R36A 1RJ9B 1S7ZA 4HLXA 2HNHA 3G6EI 2NYXA 2M3AA 2WADA 2HDWA 5COFA 2ZD9A 4DVYP 4E4HA 5L0IA 2JQ7A 1JHFA 3GLXA 4CS7A 1UZCA 3S0XA 1RIOH 1YLMA 2ZXHA 5KHDA 1S8NA 3NKDA 1H0MA 1P4XA 5AIPA 3SJMA 3U2LA 5C4XJ 1Y1VJ 1WJDA 2VCCA 1X4PA 2CCYA 2OCEA 1J9IA 2P81A 4MIMA 2L6GA 3ABMH 3QYFA 1FNNA 3FXLA 5BQGA 1IUFA 2E60A 2L3DA 3VB2A 5HVQC 1O57A 5CVVA 1I4ZA 1E17A 3LFKA 5EYRA 4U0WA 3DU5A 256BA 4LACB 3G1MA 4YT5A 2HOSA 3LAYA 4HDVA 3A03A 3FXOA 4PCQA 1H7IA 3EGDA 4AK9A 5TJJA 3SEZA 5E79C 3QODA 3MQ0A 5FKNA 1QRYA 1UCRA 3TDUC 3V7RA 1QKRA 3I3LA 5F1RA 2ZFUA 3F6OA 3F8NA 4EUKB 1B72B 2GLOA 2O9XA 3LUTB 3JAMZ 1Z5ZA 3FF5A 4M3EA 3RKWA 1YYXA 3FWEA 4XSZF 1G5ZA 3E9VA 2JSCA 2XSJC 1GLNA 2R02A 1JUMA 2ZNZA 3A02A 3WGGA 1YARO 5C4JJ 3AGTA 2VJ5A 1ZRCA 2CQXA 1YJNI 1V5EA 5DLJA 4P6IC 3KH2A 3BZ6A 4G8XA 2UUZA 3TQOA 1U9NA 2CUJA 3CCJI 1BC7C 1XZPA 1X2MA 1T95A 3EPZA 3K4LA 4QPQA 5E3LA 1IF1A 1A6QA 2CUZA 3KCCA 2CQQA 1KA8A 4BQNA 1UJ8A 2VE8A 5BUOA 4YT2A 2MH9A 5LRSA 1OCZC 2X1DA 1JE8A 3J7AY 2EFNA 3RPQA 2E1MB 1Q1HA 1XB4A 5DEQA 2CFOA 1ETYA 2PMHA 3DPUA 5EZGA 4P9TA 1FX7A 2FX0A 1SFKA 2FRHA 2JT1A 1LE8B 5DS6A 4GYGA 3ZQLA 2H27A 2D2WA 2FMYA 4LK1F 1HKQA 5J8FA 3F8CA 1X1PA 1WOLA 4MGRA 3CCQI 2Y9YA 2O8XA 3LSHA 2WL8A 3C2BA 2KLOA 1RKWA 2G7UA 4E7KA 3MX3A 1TNTA 2ECCA 3RKOF 2L7FP 1B8IA 3LA3A 4RLQA 3X2QC 1WZ2A 5EGOB 4XM3A 5T3WA 2UXNA 3PUFA 4IRGA 5D5UB 2DPUA 2VH3A 3EH1A 1K04A 1SYQA 1B72A 2EK5A 1CPQA 1IN7A 4L5EA 3BZKA 2VC9A 4FWVA 4E7SA 2ZNYA 1OFCX 2R7VA 2P7VA 1ZGAA 2W1OA 2FOWA 2RDPA 1BM9A 3JSOA 5KYYA 5HDKA 4M6YA 1RRJA 1CGOA 4ULWA 2XLEA 2P0WA 2XDVA 5HDNA 2VBZA 2R7TA 2A5YB 3F3XA 4AM3A 1WSUA 4CHUA 4O6JA 4DRJB 2X9DA 1IGNA 3VRCA 2YU9J 3LSTA 3L8IA 5EG0A 3OYDA 1SFXA 1Y6DA 1VQKI 4B4CA 4BNCA 2IA2A 2Z99A 4DRHB 1PJRA 1AUEA 2LRDA 5F0HA 2Z2SB 2NSFA 4CCLA 5H6RA 1VLSA 2DJNA 1ETWA 1NFNA 1LE8A 1JUPA 4C9YA 3QW0A 5M3FJ 1LPQA 1OCCH 2DCEA 3H9GA 2P61A 1MBFA 2E1NA 2L0KA 1NU9C 1TWCA 3ZVRA 1I4YA 2V1DA 5B1BH 4D0PA 3REOA 5HOOA 3G4SI 4BAYA 4IHVA 3DLLF 2W00A 4HX4A 2VODA 5DYMA 2DA1A 3A4CA 1KTMA 3MBGA 2Q0OA 5CI8A 2WAEA 1T08B 2VQHA 1GV5A 3HM5A 3Q0VA 4LB6B 1T01A 3DBRB 2XM0A 4PK4A 2JA7J 4M3GA 5F5FA 4KMUX 3DE8A 1S05A 1T98A 5KAFC 5A6KA 4UUTA 3EETA 1WJAA 4KMFA 4MW3A 2MHRA 2DXIA 4X0RA 3CC2I 3RZDJ 4JKVA 3ZXSA 3BZCA 1K83J 4MFDA 2VCBA 1W5CC 2HSBA 1O7LA 3COAC 1OW8A 2XUBA 3ZMUA 1YYVA 3N24A 3PNTA 2Y0SA 3HNKA 1WH5A 2RV8A 2OTJI 1A04A 2DQLA 1S29A 2Q2EB 3C1DA 3HNIA 4BQQA 1IJWC 2AP3A 4M6XA 3PSIA 1Z67A 4RGSA 4U5DE 5M5YJ 4ABZA 1E2XA 3J06A
chains in the Genus database with same CATH topology
4ITVA 4NUBA 2WY7Q 4HSTA 1Z21A 2KJGA 4OD5A 2PF4E 3OL3A 2J7PA 3ABMC 1LKXA 3FHDA 2H7OA 5KYYB 3V7OA 4PJMA 2RNGA 4IWBA 5LD2C 4CH7A 5LFAA 1M2VA 3K4MA 1FFTC 4M63A 4BDYA 5DQZA 2K3PA 4G7HF 3FBIB 1J8MF 2EIMC 2BW3A 2E5NA 3W2VA 4E7LA 3T4RA 2BE5F 3SZGA 4PFPA 4XONA 3CQZA 1PCXA 2FUG2 4XLNF 2HZDA 2KRHA 5T3TA 4DVZA 4QDLA 4PJNA 2VPLA 1X4OA 1QLEC 2AQFA 3HPGA 1SF8A 1ZHYA 3RSNA 4XR6A 2DYSC 2H7VC 5B1AC 2F6CA 3NRHA 5L3QA 3VWBA 4B47A 2VKDA 1MW7A 4U7BA 2LC2A 4DBRA 2JUGA 3OYKA 1T0FC 2CV0A 3LNRA 2PMZA 4HE8D 3CESA 4F4BA 3UMIA 3S3OA 2C03A 5HSWA 4GEHA 3CZ6A 3U21A 4CCNA 2L9JA 3ITFA 3LS1A 5KYNA 1WJFA 5KCMA 3E1SA 2VQGA 3OYLA 4LIVA 4FX5A 2Y3DA 3NDBB 3ZR8X 2IS6A 1Z63A 2XXAA 2XL4A 2AQEA 1N1CA 4U5HA 2NUTA 2Q9AA 3EUKL 3CP2A 3RFYA 4CBEA 4GYTA 3OR1C 2Y3HA 3WG7C 2K9LA 2CV1A 4XLFA 1NG1A 4X0GA 2IS1A 3L0IA 3H5NA 4RD9A 4Y4RA 4BACA 3OIPA 4E7ZA 4KISA 3VAYA 5DS5A 1MMAA 3SNHA 1PYVA 4O6NA 3H5AA 1TWGA 4BS9A 2J46A 3TL4X 2J0WA 4RBNA 2MC4A 1ZELA 4CS8C 3V42A 1EA3A 4J30B 3HUGB 3HC7A 1LDKB 4XTKA 4BUPA 3O39A 4IRUA 2PX0A 2NUPA 2HQAA 1K6YA 2OG2A 3G2BA 1O87A 3KYLA 2GOXB 4JQFA 1UELB 4XKVA 4ZJZA 2R7WA 1VK5A 3HJCA 3OYMA 4PJLA 3ECSA 4BJ6C 2WB1A 1X1CA 3SZRA 1W36D 2BVMA 1ERDA 4MNDA 2EIJC 3EGXB 1YX5A 4YJWA 4C3EA 4G7ZF 1S9HA 4IJJA 3PL8A 2A6TA 1D0YA 1IW7F 4EWCA 1D1CA 2IXMA 3OS2A 3DJNB 3VDXA 2WA0A 4JVSA 1D0XA 3S8PA 2C04A 3DTKA 2LYCA 4XL9A 1DGRM 2R7XA 4LLCA 4NQWB 4DGWB 2IGMA 1UAAA 4EBBA 4II3A 3VYUB 4BE0A 2Q9CA 4XOPA 3K4CA 4ZLCA 3TMOA 5CQGA 3C2GA 4O7GA 3RH3A 5KNLA 1BR4A 2JVHA 2ELJA 4P1WA 1VMAA 2KGOA 2LSEA 3PSFA 1ST6A 2IXNA 1M2VB 4YEJA 4WJ0A 2DT6A 3Q6MA 3S29A 4E7HA 4BU2A 2JSPA 4I44A 2HVSA 3ZCOA 3X1OA 2BW3B 1WJ5A 2HPIA 3A1YA 4B43A 2J9UA 3B9QA 4GRIA 4CA0A 3S3NA 2Z15A 4PSXA 3EJNA 3EPVA 4K0DA 3MKYB 2P6VA 2CNWD 2PP4A 2UWMA 3CJRB 3K10A 1V54C 2KP6A 2OUMA 2HV6A 2MYSA 3K4KA 2X1CA 5JHFA 2HPMA 2PJRB 2IS2A 1OCCC 3QOEA 1Z6AA 2G62A 2VQCA 3GANA 2QKMB 3N2ZB 5B1BC 4BXFA 4YRVA 2WVOA 2VXZA 2B0JA 1BOBA 4O79A 5CKTA 3CF2A 2VLAA 5E2QA 3B0UX 1MNDA 2V9KA 3HPHA 2L2OA 1Z3YA 3HKZA 3OMYA 3AG2C 3DKXA 5EGYA 4O6YA 1W36C 3BLYA 2XF6A 3VSLA 2V1NA 2Z16A 4HG2A 4XLAA 1X19A 2KRCA 5HLTA 4RDAA 4U5CE 4B6IA 3EZHA 5KYUB 3AG4C 2XXAB 1OLTA 4NC8A 1WGWA 5E3AA 2QTVA 3RTRA 4C2UA 4OAYA 4HEAJ 4YN0B 3W3CA 4OIOF 5D91A 3LLKA 3TBIA 3I5PA 2DT7B 4J00A 4Q4ZF 3OYBA 2G3VA 3E70C 4NY3A 3PMRA 2NG1A 4OINF 1LFPA 5HNHA 2R4GA 2KZVA 3I4UA 2R7SA 3DM9B 1W2WA 2XF7A 3DWLE 4I1MA 4CSAC 1N78A 4RLFA 1N75A 4G7OF 4N06A 4NC7A 4BJTA 2NUPB 4BQOA 1TR2A 4PUSA 2K5CA 3K70D 1ZHZA 4XOTA 1VYKA 2F4IA 3OYAA 3LESA 4C3BA 3PFYA 2XAUA 2Q9BA 4F92B 3GBGA 2L9NA 4BJ5A 3JYHA 3RQ4A 4PFOA 2E1MC 3KL4A 3UR3C 1OR7C 2I8DA 3SP1A 3K7DA 4XLPF 2MABA 3IUOA 3BG6A 3S93A 1X1AA 4R79A 1ZU4A 4DIQA 3K6BA 1IRXA 2PJRA 4ANJA 4CCOA 5TGTA 3L2UA 3HLZA 3ZSUA 2DYRC 3H9QA 2QKLB 1G8XA 4ZTFA 2EILC 4XKCA 2KHMA 3WODF 3CJQB 4FETA 2IS4A 3IAS2 1Z23A 4CSWA 4BDZA 1ZHTA 2J7PD 2Y3GA 3EHNA 3OA1A 3H65A 5E33A 1WFXA 2CW7A 4D1QA 3ZQQA 3HOTA 3LSKA 4CCKA 1JI8A 1JPNA 1M57C 1YX3A 2LREA 4KJZA 1RJ9A 3ABKC 1AA7A 3MD2A 2WZGA 3W8IA 4KI2A 2XC7A 3ZGKA 2XSEA 5KYUA 4BL0B 3EHMA 2CMPA 4XWJA 2M0MA 2BVLA 1DQUA 2KDOA 1NZEA 2MWQA 3OWTA 3F46A 4XKBA 5CQEA 2YEVA 3FVYA 4Y33A 4KITB 2Y3BA 4JURI 2ZXRA 2LOOA 4LLEA 3DMDA 3K6GA 4OIPF 4IQJA 4E7IA 1MMDA 4XLCA 3KMIA 2M4EA 4CS9A 4Q5SF 4C7OB 4A2NB 3DPTA 5IY5C 2HV7A 4BEHA 3DLAA 3NWSA 3LSIA 3IEEA 4YWQA 5FRNA 2JD3A 2IGKA 1TWHA 1VOMA 3OS0A 4XORA 2Z1DA 1SMYF 1TWAA 1E0EA 5T1DB 3FHNA 3UMKA 2HVQA 2WAFA 3C2HA 3OS1A 3L2WA 1MMGA 4K7BA 1FMWA 2OC6A 3M1CA 4U87A 4H4KC 3BCBA 3K70C 3DJUB 3RYLA 3LL7A 1G59A 2ZSIB 3VYWA 2KW3C 1JPJA 2VXDA 4CUGA 1ZU5A 2ZXPA 2IXSA 2WB7A 4QI2A 4IAOA 2VASA 2ZXIA 3D5RC 3T6BA 3HOSA 1WJBA 3TD7A 4ZDPA 2VIXA 3RPUD 4IZZA 2HVRA 3AQBA 4BG0A 3DD7A 3EG9A 1OKKA 1WJCA 5E3CA 3PHF2 1WJEA 4YT4A 2IGNA 3K33A 2VJIA 3EUAA 2PFDA 1V5GA 2X51A 4IQ4A 3K1HA 4LG3A 2KQRA 4XKWA 2W82A 1NG6A 4AE4A 3JSZA 3KEYA 1ZHXA 3B0VC 3AQCA 3DEEA 2ZXWC 5DQTA 1UG0A 1ZHWA 2IXPA 2KMUA 2HU9A 4HEA2 2VKHA 2Q1ZB 2IXOA 2WY8Q 4YT8A 4RM2A 2JA2A 1TKNA 2PX3A 4BJ1A 3S28A 3FBNB 3K4NA 1BR2A 4C30A 3DAFA 3OR2C 4C7OA 2E87A 5HNFA 3JT1A 3ASNC 3EGDB 2X85A 4QI0A 4HPQA 3DAGA 4PJJA 4ZC3A 3E0JB 4ZDLA 3DTEA 1OKKD 4OD4A 3OYNA 3NYMA 3POVA 2IGOA 1QZXA 3NKEA 4P5OA 1DP3A 3SYTA 3OYGA 4AVZA 2O5RA 2ZSHB 3B0PA 4ZDOA 3EQLF 3S3MA 4B3XA 3DQVC 3HTKC 5CPRB 2X6XA 2LH9A 2Y39A 4AU7A 4OWRB 4U5EE 2L5QA 4XQFA 2VJJA 3LEVA 2J45A 4HRIA 3QMKA 2WVQA 2WZLA 2XRHA 3L34A 1RJ9B 1S7ZA 5L3VA 4OIQF 2HNHA 2W45A 1SAUA 2M3AA 2WADA 4F52A 2HDWA 4E6KG 2EIKC 2V6EA 4DVYP 4LIUA 4E4HA 2CV2A 2ZPAA 4C3DA 3QZCA 3VYRB 4AYBA 2LBFA 2H7BA 4CS7A 4LITA 1OCOC 2CGEA 2CW0F 3EH2A 3CMMA 4I1OB 2UV1A 3SYNA 3S0XA 2BOLA 2WBMA 2ZXHA 5KHDA 4XLHA 3NKDA 2EINC 1NU7D 2CW8A 2WZFA 2A1DD 3OYCA 1WJDA 1X4PA 4BEHB 3EZIA 4CS8A 1VYIA 3QYFA 2E5ZA 2E60A 4CIHA 2MD0A 5HVQC 3AL0B 1V55C 2LY2A 2G3KA 1D0ZA 4BE2A 2GFHA 3DU5A 3M1CB 3L2QA 1KONA 2QY9A 3FAJA 3PUBA 4LACB 2KL4A 2KPMA 3VSKA 4YT5A 3FDYA 1V5FA 1NG7A 3MMYB 2IOQA 3LAYA 5DVWA 3ZG1A 4BJ6A 5EHHA 3OYIA 3LJBA 4BGDA 3EGDA 4AK9A 4PSWA 3SEZA 2Q3TA 3JCUQ 3QODA 4HNTA 3FDQA 2VL8A 3MKZA 3NYLA 3I3LA 4B44A 2ZFUA 1LVKA 3KX2A 4F91B 2LG4A 2O9XA 3Q7LA 3F9KA 3K4JA 1Z5ZA 3GODA 2R7OA 3K1IC 3F47A 3E9VA 2XSJC 3ASOC 1GLNA 3ZRGA 3EFOA 3HL2A 1ZYRF 3EG9B 1PD1A 1FTSA 1FFHA 2VJ5A 3K4BA 4NNJA 4FASD 3OEOA 5KYWA 3M8JA 1V5EA 5DLJA 4ZTJA 4P6IC 3KH2A 1Y6IA 3CSKA 2UUZA 3K66A 4AE4B 2CUJA 4Q7CA 3QYEA 1T95A 3EPZA 2M7BA 3K4LA 4HSRA 3LSGA 3DPLC 4QPQA 2I8BA 2X6YA 2CUZA 2J0XA 2ZXOA 3DXJF 3O6XA 2V7FA 4BQNA 3OYEA 3UGPA 5BUOA 4AX2A 4YT2A 1OCZC 2V4JC 1SZIA 2X1DA 5FCLA 3J7AY 1Y56A 3PNVA 2WVNA 2MFZA 2E1MB 3PNYA 3UNGC 3DM5A 3ZIBA 4DOZA 1Z7LA 2CFOA 3LLIA 4IKFA 3DPUA 3L2VA 5FRMA 2RQQA 3AG1C 1SFKA 4ZYAA 5DS6A 1O5HA 1QU3A 2W4BA 3S27A 3L2RA 2KNHA 2M7AA 2YHSA 3ABLC 4YELA 3LSHA 3BCAA 1LS1A 2OV7A 2WL8A 2KLOA 4E7KA 4OAZA 3FKJA 2XF5A 3MLGA 3MX3A 2DOAA 3DKYA 2M4KA 4FESA 3RKOF 2CDQA 4RLQA 3H5RA 2GOMA 3X2QC 2J9VA 1QHGA 4J01A 4RMNA 3N05A 4XM3A 5T3WA 2R7UA 1M2OA 1IZMA 2CH0A 2VH3A 5CI9A 3EH1A 4N4OB 3H0DA 4KBLA 1X1DA 1VZ0A 3Q6NA 4FWVA 4E7SA 2R7VA 2P7VA 2FGYA 5KYXB 2W1OA 3LMMA 5KYYA 2D5RB 2LBFB 4JW1A 1MMNA 3BG7A 4RM3A 3HXLA 4ULWA 1P9QC 2P0WA 3IP4B 1M56C 2M4GA 2XDVA 4N4NB 4OIRF 2RREA 3BC8A 2R7TA 3D5SC 4ZLDA 4MLOA 3OYFA 1D1BA 4BEJA 4CSAA 3NWTA 3JRTA 4J32B 1D1AA 3D5LA 3RCOA 4CCMA 2KQ9A 4BJ5C 3W8HA 3RIPA 3ZC4A 1Z3XA 4W8KA 3OYDA 1TT0A 4XNFA 2W7NA 4DBQA 3EUHC 2FFHA 1PD0A 3LS0A 4QPOA 1PJRA 2L9SA 4CCJA 4HNUA 2LRDA 3MKWB 2CNWA 2W4MA 2Z2SB 3OIQA 4U5GA 4CCLA 2A68F 3H9JA 3ONQA 2NOJB 4XN0A 2W4SA 4E7JA 3A2KA 2OCCC 3I5QA 4KT6A 4C9YA 3OL4A 2JVGA 3DZAA 3NG1A 4MQ9F 3SDBA 2DCEA 2F5VA 2K9MA 3H9GA 2LY1A 1NU9C 4IX7A 1TWCA 4JJFA 3ZVRA 3OY9A 2L81A 1TZLA 3AFHA 2R7QA 1KU2A 3H35A 4KNVA 3EFOB 4F93B 3OOUA 5HOOA 4U5BE 5B3SC 2X1EA 2V26A 4CZCA 4JOMA 3KKBA 3LSMA 2VB6A 5KYWB 2W00A 3Q7GA 2CS3A 1OCRC 4D9JA 3A4CA 4JJGA 4DJAA 3CP8A 2X6WA 3DTIA 3NYJA 2WAEA 2VQHA 5CI8A 2WAQA 1FMVA 5DS4A 4HFFB 1N77A 1R6RA 4XN3A 4PK4A 4JCHA 2YZSA 2A69F 4Y3OA 5F5FA 4CS9C 5FROA 3T6JA 4HFKB 3PJRA 5KYXA 3AG3C 1BR1A 3UGOA 1WJAA 3S32A 4X0RA 3QYBA 2DXIA 2L7KA 3ZXSA 3W2WA 1U0JA 1YE9A 3VYTB 2DGJA 3AL0C 3SEOA 3IAM2 3I9V2 3OYJA 3UMHA 1J09A 2A6HF 4LERA 3AKZA 4XMYA 1QHHD 4G0HA 3HG9A 4U5FE 5F5HA 3N0TA 4EATA 3PNTA 3N24A 4BE1A 2Y0SA 1Z3IX 4C2TA 5D92A 2DJIA 3W2AA 1HA8A 4KC9A 3DU6A 4XLEA 2W9YA 2V3CC 3EGXA 4B48A 3OYHA 2VJ4A 1J8YF 4I3MA 4G6TB 2IYLD 2Y69C 4JZAA 4II2A 2NUTB 2A6EF 4O6MA 1X1BA 2Q2EB 2J9WA 3SEQA 4BQQA 2R7RA 4F3QA 1MNEA 1DGWY 3PSIA 4KNWA 2VQLA 4U5DE 3VYSB 4F55A 3LFUA 2A5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZ6 A;  3K6G A;  4BJ6 C;  4BJ5 C;  4BJT A;  3OWT A; 
#chains in the Genus database with same CATH topology
 4ESJ A;  3KYD B;  3L7W A;  2ESH A;  1K05 A;  4OD5 A;  3G4Z A;  3ABM C;  1LKX A;  2H7O A;  3C8G B;  4PJM A;  2NOG A;  2XPU A;  4A3F J;  4IWB A;  4M3B A;  4CH7 A;  2E7W A;  3ECH A;  2Q8K A;  2YQY A;  3DWW A;  1ZR2 A;  1ZN2 A;  2MBF A;  4E7L A;  2LKS A;  3ZMD A;  3ABK H;  1TWC J;  2XGD A;  3RQE A;  1JTX A;  3SZG A;  1FEX A;  4PFP A;  1UHM A;  4HX8 A;  1N25 A;  1TFK B;  3CQZ A;  4XLN F;  4EM2 A;  4PJN A;  1QA6 A;  1X4O A;  2JWT A;  2K7L A;  3HPG A;  3JW4 A;  3QQA A;  2H7V C;  1MJB A;  2WV1 A;  4YFN F;  2F6C A;  4P9F A;  1M6T A;  2X4H A;  3VWB A;  4Q47 A;  1USS A;  5F04 A;  4U7B A;  4DBR A;  1T0F C;  3G3Z A;  3RIR A;  3CDH A;  3AG1 H;  2HOT A;  2GM4 A;  2DB4 A;  2WTE A;  3TOA A;  2LP4 A;  3FAP B;  2NS0 A;  2C03 A;  4YL0 A;  1QQI A;  3BJO A;  1ETV A;  3WGI A;  3WHB A;  5KCM A;  3CC4 I;  2N8G A;  2DI3 A;  4HA8 A;  1L0O C;  3OYL A;  5A6B D;  4AC0 A;  5CJ9 A;  2XXA A;  1N1C A;  1GV2 A;  2XAS A;  3CP2 A;  3EUK L;  3P9C A;  4S0H B;  2Y3H A;  4GO1 A;  2BGC A;  5DD8 A;  2ZB9 A;  5DS5 A;  3CD6 I;  3BDD A;  3P9I A;  3GWL A;  2BYV E;  3ZTM A;  1PYV A;  2LK2 A;  3JRD A;  5ICG A;  1I5Z A;  5GTH C;  3W6V A;  2DMT A;  2EA4 A;  3TL4 X;  2J0W A;  2VKE A;  1HCR A;  4BKX A;  4RBN A;  2XL8 A;  1EA3 A;  1JT6 A;  3HC7 A;  1CGN A;  2Y9Z A;  4IRU A;  4EM0 B;  2PX0 A;  2M1B A;  4KDP A;  2OG2 A;  2XB0 X;  4HNV A;  1VQ4 I;  1O87 A;  1UG7 A;  3E7L A;  2DK8 A;  1TFO B;  2R7W A;  1VK5 A;  2OBP A;  3TJ5 A;  1IN5 A;  2LFB A;  2VI6 A;  1ETK A;  4PJL A;  4U88 A;  2GAU A;  3Q9V A;  1ZQ3 P;  5GAG J;  3H3V K;  3EGX B;  2DFH A;  5K7F A;  2XLV A;  3PL8 A;  3H2U A;  1D0Y A;  2O8K A;  2ZC2 A;  2IXM A;  3PO2 J;  2CO5 A;  3CO7 C;  3VDX A;  1D0X A;  2BY1 A;  2XRO A;  4GFB A;  2LTP A;  2LVS A;  2NAZ A;  2W57 A;  3ESW B;  4XK4 A;  4HQM A;  3QP6 A;  4IXA A;  3U2R A;  4I2O A;  1ZLK A;  3HOV J;  1YIJ I;  3RH3 A;  3C2G A;  4O7G A;  2P5K A;  5KNL A;  5J3L A;  5A6B A;  1BR4 A;  2E2I J;  4MVO A;  1XC5 A;  1ST6 A;  1YQA A;  2IXN A;  2F22 A;  4AIH A;  3CUQ B;  2XM4 A;  3IQ6 A;  3K1M A;  4WJ0 A;  2Y31 A;  4M71 A;  3WU0 A;  4E7H A;  2K85 A;  2HVS A;  2IBD A;  1WJ5 A;  3R0J A;  3B9Q A;  3PQJ A;  1JXS A;  1POG A;  3W6K B;  3QTH A;  2AO9 A;  2X0L A;  4K0D A;  2FBH A;  2P6V A;  4U0Y A;  2UWM A;  3K10 A;  2OUM A;  4CZZ A;  3NMJ A;  1OCC C;  2XIG A;  3BG3 A;  1T2K A;  2VQC A;  3I0T A;  2EIN H;  1SFU A;  3B29 A;  3H92 A;  5B1B C;  4IHW A;  1PUF B;  1IXR C;  3GM2 A;  3GEE A;  2LIG A;  2ECB A;  3T0Y A;  3RYR A;  3PIO F;  4L9J A;  2V9K A;  3HPH A;  1J75 A;  1Z3Y A;  3OMY A;  2PBE A;  2OKU A;  5EGY A;  3TUL A;  1APC A;  3BLY A;  3R6S A;  2XVC A;  4XLA A;  2J9B A;  5J4V A;  1AHD P;  3EZH A;  5DD4 A;  3RW0 A;  4NC8 A;  3HYI A;  4HF1 A;  3JRH A;  2OF7 A;  3I53 A;  3NAU A;  1P4A A;  2IPQ X;  2NVX J;  5IT9 K;  4YN0 B;  4JTD B;  5D91 A;  1TW2 A;  4MTE A;  1FY7 A;  3TBI A;  3CCL I;  2VT3 A;  4J00 A;  1XSX A;  2CQ7 A;  4E70 A;  3OYB A;  1MBG A;  2G3V A;  5BQT A;  4KN4 X;  4AIK A;  5HNH A;  3U9G A;  4S04 A;  2R7S A;  3JRC A;  3RQF A;  2M5W A;  5EEA A;  3M4B A;  4AD9 A;  3V5X A;  1N78 A;  4EBJ A;  1ETQ A;  4G7O F;  4JYK A;  1T9K A;  4HX7 A;  1T56 A;  3L1P A;  2KIS A;  5FLX K;  4N06 A;  1TR2 A;  1IV8 A;  1OXB A;  2XRL A;  2VOO A;  2WB1 N;  2W84 A;  3BWG A;  4F92 B;  1FBQ A;  2DN0 A;  3GBG A;  2EQR A;  4XRF A;  5DTD A;  4HW0 A;  4HLY A;  3MZH A;  2OTL I;  3L1M A;  1SFE A;  2QF7 A;  2HKX A;  5BNG A;  1OR7 C;  2I8D A;  4N4W A;  2J5O A;  5L3B A;  2UUH A;  5COM A;  5M5W J;  4EHP A;  1LJ9 A;  3HRM A;  3BR0 A;  2LFF A;  5DCF A;  3MKL A;  3IH3 A;  1EA8 A;  4CCO A;  4D4N A;  1LVA A;  5L0J A;  3HLZ A;  2CJJ A;  3HHG A;  1Z7Q c;  4NTA A;  1R4M B;  1PUF A;  3ABT A;  4A5M A;  1SD4 A;  4ZTF A;  4A12 A;  4FET A;  2IS4 A;  2J7P D;  3EHN A;  2IJL A;  4LG0 A;  2MH2 A;  5JLW A;  3DFG A;  5D8K B;  1MH3 A;  2CW7 A;  4D1Q A;  3D1N I;  3HHH A;  3LSK A;  4J19 A;  1YX3 A;  1ZHF A;  3ABL H;  4QTR A;  3ABK C;  4C2M J;  4HV6 A;  4KI2 A;  2XC7 A;  2P5L C;  2XSE A;  2QEN A;  2CMP A;  4IEJ A;  1DQU A;  2KDO A;  2NS8 A;  2AXT C;  3EYY A;  2MWQ A;  2FQ3 A;  3FVY A;  5A6J A;  1E86 A;  4KIT B;  3TO9 A;  4EBK A;  1A7E A;  2VN2 A;  4A5N A;  3DMD A;  1HOM A;  1MMD A;  5CIV A;  3ZQV A;  3TOM A;  3MZY A;  2M0C A;  3S2H J;  3FOO A;  1A31 A;  4YWQ A;  3DEW A;  3LSI A;  4Z9I A;  3DV8 A;  1VTN C;  3B6C A;  1WQ2 A;  5M3M J;  1VOM A;  1BDJ B;  4XOR A;  2YL3 A;  1SMY F;  2M30 A;  1ODD A;  2CSO A;  2DMN A;  1VTM P;  4M9X A;  4AID A;  2HVQ A;  2YL0 A;  3S1R J;  4CX9 A;  1P2F A;  1XDS A;  1I6X A;  3M1C A;  4H4K C;  3BCB A;  3N97 A;  3HKZ N;  3DJU B;  2OQR A;  2PJP A;  3RYL A;  2M9H A;  1G59 A;  2AS5 F;  4CYC B;  2TCT A;  4JE9 A;  4CUG A;  2PG4 A;  2ZXP A;  2HTJ A;  2XB5 A;  1XMA A;  1AWC A;  4EQQ A;  2M34 A;  3D5R C;  4A6D A;  2UZK A;  1OYW A;  1U8B A;  3K9T A;  2VIX A;  4ZDP A;  4BXU A;  3CO6 C;  1XZQ A;  2G7H A;  2HVR A;  4BG0 A;  4MEY F;  2BY3 A;  2EPL X;  5A2Q Z;  5E3C A;  5F28 E;  1WJE A;  2EB7 A;  2IVM A;  1HMO A;  1J7K A;  1V5G A;  3BQZ A;  3LQR A;  1OXK A;  2KQR A;  2VC0 A;  1GVD A;  3JSZ A;  1T6S A;  3KEY A;  3AQC A;  3BOQ A;  3DEE A;  4M9Z A;  4RAG A;  1UG0 A;  1F9N A;  1WI3 A;  3KP7 A;  1ZHW A;  3IRR A;  1LB2 A;  5HOD A;  1MH4 A;  1IC8 A;  1CPR A;  4YT8 A;  2PX3 A;  3FBN B;  1IN4 A;  1NK3 P;  4BHB A;  4KIB A;  2HYG D;  3EDP A;  4DW6 A;  1FOY A;  2O7O A;  3OR2 C;  3WTT C;  5HNF A;  2P5V A;  2VT2 A;  2E87 A;  1YA7 O;  5ICE A;  2NRA C;  3AG3 H;  2V6C A;  5EF6 A;  2QWW A;  4ZDL A;  3DTE A;  1G4W R;  2CYY A;  2DTZ A;  2IGO A;  2IT0 A;  4MVR A;  2K3F A;  1KQ8 A;  3SYT A;  5ILV A;  3AGU A;  1T0F A;  3GTK J;  2ZSH B;  2L02 A;  1RET A;  4B3X A;  4JEA A;  2BY0 A;  2X6X A;  2VC1 A;  4HV5 A;  1BOA A;  4OWR B;  4AU7 A;  2FBK A;  1E3O C;  2FXA A;  4U5E E;  2L5Q A;  4NDL A;  3TKY A;  2PEX A;  3NEU A;  3BTC A;  4CYC A;  1S6L A;  3ERE D;  3C63 A;  1JMW A;  2GAQ A;  3WGH A;  1SAU A;  3E97 A;  1AU7 A;  3BEH A;  5KAI C;  4E6K G;  3QRF F;  3EYI A;  4LIU A;  1BI3 A;  3GOR A;  4A0Y A;  4ULV A;  3VYR B;  4AYB A;  2LBF A;  1XMX A;  2Y75 A;  4HF0 A;  4LIT A;  3KP3 A;  3WTY C;  1OCO C;  4PGG A;  3CMM A;  1QZY A;  4NTB A;  3RVY A;  2X6O A;  1FIA A;  4XLH A;  2EIN C;  1NH3 A;  2A1D D;  5BOX A;  3OYC A;  3SZT A;  4ASN A;  2YPR A;  2IP2 A;  4BEH B;  3FXQ A;  1VQ5 I;  3FZV A;  5IYD J;  1ZG3 A;  2ZBK A;  2O0Y A;  2F2E A;  3AL0 B;  1W1W E;  5LEJ A;  4D7M A;  5FD6 A;  1D0Z A;  2RQP A;  4PDK A;  1MJ9 A;  4B8X A;  4HOB A;  1OJL A;  3PUB A;  2KL4 A;  2KPM A;  2LF7 A;  3TDZ C;  3NDB B;  1V5F A;  3MMY B;  5DVW A;  5EHH A;  4W8P A;  1YS6 A;  2LD5 A;  3LJB A;  4HQE A;  4IHS A;  3JCU Q;  2QCO A;  1H89 C;  2VL8 A;  3NYL A;  4FCY A;  3KX2 A;  3U8P A;  2LG4 A;  2NSG A;  1REP C;  3D0S A;  1W7P B;  2R7O A;  4UV8 A;  5DUI A;  1T6Q A;  3L2C A;  2L7A A;  3FMS A;  4K1O A;  4MVQ A;  2DYR H;  4IJA A;  3ZRG A;  3EFO A;  4EIY A;  3EG9 B;  1PD1 A;  4C3J J;  1FFH A;  2K27 A;  3F22 A;  1O3Q A;  4FAS D;  5JT4 A;  3OEO A;  5KYW A;  1A0B A;  4ON0 A;  1OCT C;  1IRZ A;  1WWP A;  2HYF A;  3W6J B;  1Y6I A;  2JA8 J;  3K66 A;  4AE4 B;  3HTS B;  2CRG A;  4EJT A;  2HJM A;  2ZJP F;  2JRM A;  2M7B A;  2TDX A;  4HSR A;  3DXJ F;  3DPL C;  4HYE A;  2HKO A;  5IP7 J;  5FB2 A;  3QPL A;  1T38 A;  2ZXO A;  3O6X A;  4LLE A;  4M73 A;  5FD5 A;  4AX2 A;  4BEM J;  3MEX A;  5K7Z A;  4BQA A;  3WG7 H;  1Y56 A;  3PNV A;  3DM5 A;  5COG A;  3ZIB A;  4D5C A;  1SMT A;  1TQP A;  2EFP A;  1Z7L A;  2JPB A;  3LLI A;  4IKF A;  3CEX A;  3MWM A;  3E6D A;  3L2V A;  1OYY A;  1BI0 A;  2H1K A;  4ZYA A;  1OYI A;  1O3R A;  1JKR C;  3S27 A;  2M7A A;  2BEO A;  2H6B A;  3ABL C;  1I39 A;  2LKP A;  2HMQ A;  2OV7 A;  1SD7 A;  5L3G A;  3C62 A;  5JP7 A;  3FKJ A;  2XF5 A;  1APL C;  3DKY A;  4FES A;  2M4K A;  2CQK A;  1I6H J;  3HB9 A;  4JK1 X;  3BR6 A;  2QLZ A;  2GOM A;  3H5R A;  1NBB A;  4J01 A;  4RMN A;  2R7U A;  1MBE A;  1Z77 A;  5CI9 A;  4N4O B;  2AU5 A;  2Y30 A;  3R7C A;  1X1D A;  1BA5 A;  1W7P A;  3I5U A;  4AIJ A;  4XPW A;  4FE4 A;  3HOX J;  5B3I A;  3LMM A;  4XPX A;  2D5R B;  5JSL A;  3PDM P;  1MMN A;  3IWZ A;  4RM3 A;  3CME I;  1LE2 A;  4DYR A;  1KU7 A;  4OIR F;  2M4G A;  1ZAR A;  4MLO A;  1ZKG A;  4YL3 A;  5HLI A;  3KZI C;  2XS1 A;  4CDA A;  3NWT A;  1K78 A;  5K1Y A;  3JRT A;  5HLH A;  4J32 B;  2IBF A;  3FK6 A;  1QVU A;  3JTG A;  1ZRF A;  2ZKZ A;  2GWR A;  2TRT A;  3IV5 A;  3W8H A;  3RIP A;  3ZQG A;  3M1E A;  4DZP A;  1GUU A;  2XGX A;  3AAF A;  2R93 J;  4JBA A;  3EUH C;  1RXQ A;  2FFH A;  2VKV A;  1OR7 A;  2F5F A;  3MKW B;  4CCJ A;  2W4M A;  4HNU A;  3OIQ A;  3HEF A;  3H9J A;  1BIA A;  3ONQ A;  4XN0 A;  1WN0 A;  5EK0 A;  2W4S A;  1FIP A;  2H09 A;  3OL4 A;  1HW5 A;  2K9M A;  4MQV A;  5EJC A;  2L81 A;  3HTU A;  1TZL A;  3LSJ A;  4LDK A;  3H35 A;  3US6 A;  2IAI A;  3GWZ A;  3OIO A;  2V26 A;  4CZC A;  4JOM A;  4MTF A;  2XLM A;  1R1V A;  3VPR A;  2EV5 A;  4D9J A;  1OCR C;  2YSR A;  4JJG A;  2X6W A;  4M74 A;  1WRJ A;  4MEX F;  4EV0 A;  1R6R A;  4QSH A;  3F8M A;  2A69 F;  4L5J A;  2YKZ A;  4CS9 C;  5FRO A;  3T6J A;  4HFK B;  1BI1 A;  3AG3 C;  3UGO A;  4MFE A;  1KQ9 A;  2DW4 A;  3QYB A;  2L7K A;  1QZE A;  2JZY A;  1V74 B;  3ZWI A;  3W2W A;  1U0J A;  3QW1 A;  2Q7R A;  2HXO A;  1VF9 A;  3IAM 2;  2DU9 A;  1J09 A;  4LER A;  1FLI A;  2HQ5 A;  1YA9 A;  3BTJ A;  3SFI A;  1WGX A;  4U5F E;  3JSP A;  5D92 A;  1LE4 A;  3GFL A;  4XEK A;  5BQI A;  4I09 A;  1G4D A;  3OYH A;  1X2N A;  2VJ4 A;  5D8L B;  3ZOB A;  2IYL D;  4JZA A;  1ONV A;  2A6E F;  4WX9 A;  1X1B A;  1Y4C A;  2J9W A;  2LDU A;  4AUX A;  1B8I B;  2DLL A;  1MNE A;  1DGW Y;  3CCY A;  3I4P A;  1ORK A;  1QVT A;  1YW9 A;  3VYS B;  4I01 A;  2A5W A;  1R7J A;  4NQW A;  4ITV A;  1TLH B;  5KVR A;  1QVX A;  4R1H A;  3F0C A;  4FX0 A;  4O3M A;  2AWC A;  3O10 A;  3FXK A;  2P7V B;  2L4M A;  1VQ6 I;  2PF4 E;  1ZAO A;  5KK1 A;  3LAJ A;  2J7P A;  2YLD A;  4J7T A;  5KYY B;  3V7O A;  2E19 A;  4EM1 A;  2EIL H;  3GM1 A;  1C02 A;  4BBS J;  1PP7 U;  3IKT A;  2L6F A;  4BDY A;  1MIJ A;  4ER9 A;  2K3P A;  4HAM A;  1R00 A;  2BW3 A;  2B9S A;  5K5R A;  4XON A;  4B09 A;  1XD7 A;  4CIP A;  2FQ4 A;  1G2H A;  5GPA A;  3M8F A;  1ZRD A;  2XGC A;  2VPL A;  1SF8 A;  1ZHY A;  2AQF A;  4HZF A;  4NC6 A;  1H9T A;  5EG0 B;  4XR6 A;  2OZ6 A;  1MJA A;  1Z7U A;  1W4M A;  2L9V A;  5F0F A;  2OA4 A;  3RQI A;  1HQC A;  1ZTR A;  1XS9 A;  3ZN1 A;  2PNO A;  5L0H A;  3OYK A;  1I27 A;  3VFZ A;  2PMZ A;  4WWC A;  3U3B A;  4F4B A;  3K2Z A;  1FBS A;  4GEH A;  3I71 A;  3U21 A;  2L9J A;  4CCN A;  5JVE A;  1FR0 A;  4RB1 A;  1WJF A;  3MFN A;  4KN7 X;  5E20 A;  3JAM K;  4EJW A;  2Y3D A;  1E84 A;  1MGT A;  3GWN A;  3BJ6 A;  1HLV A;  2AQE A;  1ZGW A;  1HMD A;  2QQ9 A;  1QZZ A;  4GYT A;  4OMZ A;  1GDT A;  3WG7 C;  1IUY A;  2K9L A;  4XRS A;  3GX4 X;  4YK5 A;  1D5V A;  4FTH A;  3H0G J;  1PP8 F;  1Y0N A;  2KIU A;  4E7Z A;  3SNH A;  1A6I A;  2QQ8 A;  2HSQ A;  1RCP A;  2DBB A;  1O3S A;  4O6N A;  1EKE A;  1TWG A;  4BS9 A;  2TMV P;  3BR1 A;  2MC4 A;  1ZEL A;  4CS8 C;  2HOA A;  3V42 A;  4J30 B;  1TP4 A;  1LDK B;  3HSR A;  2D5V A;  3O39 A;  3S9O A;  1IXC A;  3GO5 A;  3RKY A;  2IA0 A;  1K6Y A;  4UVC A;  1EJ9 A;  4UY8 I;  2I5U A;  3KYL A;  4JQF A;  4XKV A;  2W48 A;  2R05 A;  3IQ5 A;  3IQC A;  3OYM A;  4WAB A;  2ZXW H;  1V4R A;  3WTU C;  4BJ6 C;  4KFC A;  3TW6 A;  1VB5 A;  2EZI A;  2OQG A;  1ERD A;  4MND A;  1ZH5 A;  2DK5 A;  1YX5 A;  4G7Z F;  1FJL A;  2E2J J;  1FOW A;  1S9H A;  1P4W A;  5JR3 A;  4A3D J;  1IN6 A;  4EWC A;  1JKP C;  3MYI A;  1Y0U A;  3OS2 A;  5GPG B;  4S05 A;  5DCM A;  3UKG A;  1J5Y A;  4A3I J;  1RKT A;  3QAH A;  3S8P A;  2HDD A;  2C04 A;  5ERI A;  1FYM A;  4XL9 A;  1DGR M;  2EBI A;  3C7J A;  3RF3 A;  4DGW B;  2IGM A;  5CVI A;  1K79 A;  1R23 A;  4M72 A;  2CGP A;  1UAA A;  4A3G J;  3F8F A;  1DOW A;  4XOP A;  3K4C A;  1IDZ A;  5ILU A;  4ZLC A;  1YLF A;  3GCM A;  2QA4 I;  1TNS A;  2DMP A;  4A69 C;  3VF0 A;  2JVH A;  4K2E A;  1Y1W J;  1OKR A;  4RGX A;  3PSF A;  2ZJ2 A;  5K5O A;  3F21 A;  2JJ7 A;  4YEJ A;  2VOP A;  2DT6 A;  2H8A A;  3ERM A;  2RSE B;  3Q6M A;  4BU2 A;  4I44 A;  3A1Y A;  2ID6 A;  4G6Q A;  1U3E M;  1Y8R B;  1E3H A;  1SVM A;  4CA0 A;  3S3N A;  5CVU A;  4GDF A;  2Z15 A;  3S90 A;  3EJN A;  3DI5 A;  2CNW D;  2DA4 A;  2HFH A;  1SR2 A;  4HE8 D;  3BG5 A;  5L0G A;  5JHF A;  1Z6A A;  3NRV A;  2PJR B;  1FYL A;  2IS2 A;  2QQB A;  1JKQ C;  3GAN A;  3N2Z B;  3BP8 A;  3E6M A;  4RGR A;  3G1O A;  4UUS B;  3S17 J;  3OOP A;  2VXZ A;  5ICC A;  1BOB A;  3TK0 A;  2XSD C;  1TWG J;  5E2Q A;  1W0U A;  3JRI A;  2A05 A;  1AOY A;  4QIW N;  3DKX A;  1JOG A;  3HOY J;  4O6Y A;  3A9C A;  5JVG F;  4JIO A;  2M64 A;  2Z16 A;  1X19 A;  4B6I A;  5HLT A;  3QPS A;  2XXA B;  1OLT A;  5E3A A;  2K86 A;  2NVU B;  3QP5 A;  2QTV A;  4MVU A;  3WHC A;  2XLH A;  3DP7 A;  1JJ6 C;  1CQT A;  3M3Y J;  2PBI A;  1JKO C;  6PAX A;  3LLK A;  3H1C A;  1I1S A;  2DT7 B;  2VBX A;  3GZ6 A;  4ENN A;  1X58 A;  5C3E J;  3PMR A;  1LFP A;  2R4G A;  3GZN B;  1X3Z B;  4Y15 A;  4CDY A;  5IYC J;  3ASO H;  1QQ3 A;  2XF7 A;  1NHA A;  3DWL E;  4KA4 A;  1KZH A;  3GME A;  1SC7 A;  2L7M P;  5D5W B;  4NC7 A;  4BJT A;  4BQO A;  4DZJ A;  1C03 A;  4XOT A;  2F4I A;  3OYA A;  4JTA B;  4BH9 A;  3O8G A;  3PFY A;  5EEG A;  1BJZ A;  4ZYD A;  2L9N A;  4PFO A;  3IC7 A;  4A6E A;  3KL4 A;  1A36 A;  3SP1 A;  1VLT A;  3IKV A;  2MAB A;  2CWE A;  2KFD A;  3BG6 A;  2DYS H;  2XAJ A;  3EUH A;  3I54 A;  3S93 A;  2QVO A;  4R79 A;  1K6O A;  2KZG A;  4KIC A;  4DIQ A;  2PJR A;  3JRG A;  4JRZ A;  3L2U A;  4UUS A;  1K40 A;  2XPW A;  4UNO A;  1Q0M A;  2EIL C;  4HDU A;  1WH7 A;  3KET A;  2EH3 A;  3E5Q A;  3CJQ B;  4KT5 C;  2ZXJ A;  2EFQ A;  3IAS 2;  1K7A A;  1YIT I;  1ZG1 A;  1JTY A;  1GHC A;  4ESB A;  3HOT A;  2FNP A;  4CCK A;  5LHH A;  1CF7 A;  2F5E A;  4KJZ A;  4NCQ A;  2YR2 A;  5JRA A;  3GUD A;  4NHJ A;  1YRN B;  3HKK A;  2ETS A;  2QGU A;  4BL0 B;  3ISP A;  2M0M A;  2HDC A;  2ZO4 A;  1DU0 A;  1BBH A;  3CC7 I;  3ZMT A;  3OWT A;  1NZE A;  3J81 K;  3B71 A;  4JUR I;  4OIP F;  4W1U A;  1PVE A;  3K6G A;  2JX0 A;  4IQJ A;  1A41 A;  3KMI A;  3RZO J;  3K1N A;  4Q5S F;  4CS9 A;  2LLK A;  1I3Q J;  5J1U A;  4IVN A;  2EWN A;  3IEE A;  5FRN A;  2IGK A;  3I56 I;  2BL2 A;  3U8V A;  3OS0 A;  3BR2 A;  2GDC A;  2GXB A;  3FHN A;  5HS9 A;  3C2H A;  3OS1 A;  4K7B A;  1FMW A;  4U87 A;  3ZMZ A;  3S15 J;  4I0B A;  2Q00 A;  5HDG A;  1FT9 A;  1HXD A;  3HJE A;  3Q0U A;  2KW3 C;  1JUS A;  1LFB A;  1A7V A;  2WB7 A;  4IAO A;  1RZ4 A;  3L8J A;  3T6B A;  2XAQ A;  1WJB A;  3TD7 A;  4LOC A;  5C44 J;  1O4X A;  1XSV A;  1R4N B;  3RPU D;  1S7O A;  4Z6Y A;  4IZZ A;  1FYK A;  4RAY A;  1FSH A;  3V8L A;  3DD7 A;  1WJC A;  3PHF 2;  1H88 C;  2RNJ A;  4YT4 A;  3HDD A;  3EUA A;  3GEH A;  2PFD A;  1BL0 A;  4XKW A;  2YRF A;  4X6A J;  1NG6 A;  2EFW A;  2JTV A;  4ZH4 F;  1YRN A;  2VPR A;  3LOC A;  2ZXW C;  5DQT A;  3FXJ A;  2DMU A;  1RC9 A;  2VKH A;  2WY8 Q;  5K7H A;  4RM2 A;  2O9L A;  5HS8 A;  3BPX A;  1J0R A;  1LNW A;  2V1X A;  1ZVZ A;  4BJ1 A;  1Q0K A;  5J1R A;  1PUE E;  1VND A;  1ZR4 A;  4A3L J;  1WWX A;  2WC2 A;  5FGM A;  3JRE A;  3U2M A;  1B9N A;  4ZC3 A;  1OKK D;  2K02 A;  4BYY A;  1G6N A;  1F43 A;  3V7S A;  4IRH A;  1FP2 A;  3HRU A;  2GA2 A;  1QPI A;  3EQL F;  5CVR A;  1H6G A;  2Y39 A;  4ZYH A;  4UV9 A;  2KT0 A;  3J80 Z;  1HC8 A;  3GW2 A;  4LG0 B;  2CYD A;  2HXI A;  4NC3 A;  3FIS A;  5IT9 Z;  4ENM A;  3IRQ A;  5L3E A;  4HRI A;  3RKQ A;  1YDI A;  2LCH A;  3QMK A;  5DDG A;  3HIF A;  5GAE J;  2FE3 A;  2QSF X;  2W45 A;  5IPA A;  1LM3 B;  1IZ1 A;  4F52 A;  4WXC A;  5J6X A;  2Y69 H;  2OAZ A;  3Q0W A;  5LGU A;  2JA6 J;  1U9O A;  3KP2 A;  2ZPA A;  3LNM B;  3QZC A;  2H7B A;  4IO9 F;  4XEF A;  3EH2 A;  2CW0 F;  3PM1 A;  1GXP A;  1WCM J;  2ZJQ F;  4QDL A;  2XL6 A;  3SYN A;  2BOL A;  2WBM A;  2RC4 A;  1UB9 A;  2CW8 A;  2V79 A;  2FF4 A;  1LDD A;  1RI7 A;  1GT0 C;  4CS8 A;  3CJN A;  2KIF A;  1TC3 C;  2L9R A;  2E5Z A;  4CIH A;  1I5N A;  2MD0 A;  2LY2 A;  2AHQ A;  1UMQ A;  2GFH A;  4A3B J;  1XN7 A;  3M1C B;  3L2Q A;  4OMY A;  2COM A;  1AEP A;  2EIM H;  2ELH A;  3FDY A;  2IOQ A;  3ZG1 A;  3E5X A;  4BJ6 A;  2JRT A;  2E71 A;  3TW7 A;  4FE7 A;  4PSW A;  4RAZ A;  4X1E A;  3FDQ A;  3KFW X;  5FJ8 J;  5B1A H;  4F91 B;  5LLQ A;  1YJW I;  3WTV C;  2I15 A;  3WE2 A;  5FLV A;  1ORS C;  3Q7L A;  3K4J A;  4A3K J;  3GOD A;  4LLL A;  3K1I C;  3P9K A;  5J47 A;  2OU6 A;  5D5X B;  3I59 A;  3ASO C;  3R0A A;  4UVB A;  2IRF G;  1NTC A;  1ZYR F;  4OOI A;  3ZQH A;  4OU0 A;  5CLS A;  4CGZ A;  4BXX J;  3K4B A;  1EH8 A;  1A5J A;  2DDA A;  3M8J A;  4WXH A;  2RD9 A;  2EA2 A;  3SQN A;  2NVQ J;  1KGS A;  3J7Z I;  4Q7C A;  2YS9 A;  1R71 A;  2ADU A;  2KJC A;  1R5I D;  3FMR A;  3F72 A;  2X6Y A;  4A93 J;  2V7F A;  2HS5 A;  4N9H A;  2ID3 A;  2DOF A;  2XAG A;  3CDL A;  2A07 F;  3KYI A;  3UGP A;  2V4J C;  1U78 A;  2WVN A;  3PNY A;  3UNG C;  2L01 A;  5D6E A;  3GFM A;  4DOZ A;  5EZH A;  2MGQ A;  5FLM J;  5FRM A;  3C8Z A;  2RQQ A;  4JX4 A;  5AON A;  3AG1 C;  3U5S A;  3ZQY A;  1O5H A;  1QU3 A;  4BY1 J;  1YJG A;  1R22 A;  1XG1 A;  1U6H A;  4A0Z A;  2KNH A;  4L9N A;  3LA2 A;  2HGC A;  2YHS A;  4CJG A;  2DFE A;  4WF2 A;  1PV3 A;  4EVI A;  1R4T A;  1TQI A;  3JCU C;  4MS2 A;  1S72 I;  4OAZ A;  4XSX F;  2DOA A;  2EV6 A;  1TWF J;  2CDQ A;  2M2E A;  3KE2 A;  1RUN A;  5H2F C;  4IHX A;  5GAD J;  2H94 A;  2O3F A;  3N05 A;  4TV7 A;  2CFX A;  4LB5 A;  5AGF A;  4JCZ A;  4I0A A;  2CH0 A;  4AYB N;  3CCV I;  4YL1 A;  1YIO A;  1W5T A;  1SFO J;  2P0N A;  2DTR A;  2FGY A;  3R2P A;  5KYX B;  2LBF B;  4YG2 F;  3BG7 A;  3HXL A;  4I02 A;  2HZT A;  4N4N B;  2R5Y A;  3PCV A;  4ZLD A;  3OYF A;  5EDN A;  1ACI A;  3SXM A;  4MW8 A;  4BEJ A;  3BRO A;  2GXA A;  1WAS A;  3MYF A;  1D1A A;  2GZW A;  3RCO A;  2KQ9 A;  3SXK A;  3TO7 A;  4BJ5 C;  4XRS G;  2DA6 A;  5BPD A;  1VQ9 I;  1Z3X A;  3G71 I;  1TT0 A;  4XNF A;  2W7N A;  4HF2 A;  1RKC A;  5AC5 A;  1KYW A;  2FOK A;  4L9T A;  4RS8 A;  1P7J A;  3LSP A;  3F23 A;  4A3C J;  3I4N J;  1PD0 A;  4QPO A;  1V4A A;  2L9S A;  1Q0D A;  2CNW A;  4U5B E;  3V5Y A;  2R7Z J;  4U5G A;  3ASN H;  3PO3 J;  5LRR A;  4D7N A;  2F5D A;  4E7J A;  1I1G A;  4EGY A;  3QPT A;  1V54 H;  1OCP A;  4KT6 A;  4WGY A;  1Z6R A;  2JVG A;  3DZA A;  3NG1 A;  4MNU A;  1IN8 A;  4JJF A;  4IRI A;  2HTS A;  2JPC A;  4CDV A;  3WU2 C;  4KNV A;  3EFO B;  4F93 B;  4N9I A;  1UFM A;  5F0C A;  3ULQ B;  2EPO A;  1TQM A;  1XDU A;  5JLX A;  1T8I A;  4LJZ F;  2R03 A;  3RVZ A;  3GTM J;  1FPQ A;  5KYW B;  2QBY A;  5F08 A;  4KIF A;  4DJA A;  3CP8 A;  3NYJ A;  5FKL A;  2WAQ A;  2ZJR F;  5DS4 A;  3JTL O;  4PZJ A;  4JCH A;  2X0C A;  2YZS A;  4AL1 A;  4Y3O A;  3AG4 H;  5LBQ A;  2LD6 A;  4B1R A;  4WK8 F;  2GQQ A;  2P6T A;  3WTZ A;  3S1M J;  5KYX A;  1MQV A;  3LWF A;  3GTQ J;  4AVP A;  2QNL A;  1XGN A;  2O6G E;  3VYT B;  2IM8 A;  2Y2Z A;  4IL6 C;  1F36 A;  3I9V 2;  3TP3 A;  3OYJ A;  1BC8 C;  3AKZ A;  4XMY A;  4LD5 A;  2P6S A;  1Y39 A;  1YW7 A;  1QHH D;  1F1M A;  3HG9 A;  3VEP A;  1K4T A;  4EAT A;  4IHT A;  5BS6 A;  4BE1 A;  3I4M J;  2ZME C;  4C2T A;  4LDR A;  1RES A;  4B3A A;  3W2A A;  3DU6 A;  2W9Y A;  2X48 A;  3GF2 A;  4Q48 A;  2Z9O A;  1Q0G A;  2DA3 A;  4O5V A;  2Y69 C;  4O6M A;  3G1L A;  2HKV A;  2NUT B;  3V5Z A;  3SEQ A;  4KNW A;  1LEA A;  4M6V A;  1SVO A;  4F3Q A;  2R7R A;  1HY5 A;  3G50 A;  2VQL A;  3U1K A;  4N6H A;  1B4A A;  2ASR A;  1VQ7 I;  2WY7 Q;  1B1B A;  1Z21 A;  2DA5 A;  2KJG A;  2UUI A;  3GVA A;  3FHD A;  3OL3 A;  4UDV A;  1IXS B;  2XKP A;  2HWV A;  2HMZ A;  1HDD C;  1HSJ A;  5LFA A;  1M2V A;  3K4M A;  4IF4 A;  2FU4 A;  1FFT C;  5DQZ A;  4N0B A;  2LF8 A;  2RKH A;  4G7H F;  4LMY A;  2XPV A;  3FBI B;  2CUE A;  2E5N A;  5E1X A;  3W2V A;  4CYD A;  2EIM C;  4L6R A;  3T4R A;  3T6G B;  2BE5 F;  4IAR A;  1K78 B;  4IOA F;  2HYJ A;  2LR8 A;  4I76 A;  2BY2 A;  2O03 A;  2R7D A;  3CCR I;  1T6I A;  3TOL A;  1BN5 A;  3VOD A;  2QSH X;  2HZD A;  1PCX A;  4DVZ A;  2KC3 A;  1QLE C;  1FZP B;  5B1A C;  4IAQ A;  1XGS A;  3NRH A;  3RDI A;  3I58 A;  2IA1 A;  3AOU A;  2VKD A;  1MW7 A;  2DFI A;  5F6F A;  1BI2 A;  5IY5 H;  5D5V B;  3VM6 A;  2JUG A;  5H6Q A;  3CMA I;  2CQN A;  2ZCW A;  3CES A;  3S3O A;  5BQH A;  3CZ6 A;  3ATP A;  2DT5 A;  4I7H A;  4L0Y B;  2VQG A;  4LIV A;  4FX5 A;  3DF8 A;  4IB4 A;  1Z63 A;  2YL1 A;  2QUF A;  1DUX C;  2NUT A;  2MSY A;  2Q9A A;  2GIV A;  4CBE A;  5DM6 F;  2Q3T A;  3X2Q H;  1Q0F A;  3FK7 A;  4DQ2 A;  3NMI A;  2BHZ A;  5ICF A;  4XLF A;  1SEU A;  2FBI A;  5E3O A;  4X0G A;  1MBH A;  3H5N A;  3KIO A;  2R92 J;  4YFK F;  4IPA A;  2XLD A;  2M8G X;  3VAY A;  3KYC B;  4FIS A;  4E18 A;  3LS0 A;  4JX6 A;  1XX5 A;  2BHY A;  4XTK A;  3HUG B;  1Z91 A;  3ZPL A;  1QO0 D;  2HQA A;  2NUP A;  4ZZD A;  5CVJ A;  4U0V A;  1KQ0 A;  4YIF A;  1UEL B;  3S2D J;  3ZQ7 A;  4ZJZ A;  1MKM A;  4IGG A;  3GM3 A;  3B02 A;  3A11 A;  1FC3 A;  3SXY A;  1HW2 A;  4M3F A;  4A0X A;  2B0L A;  4XQ1 A;  1X1C A;  3SZR A;  1W36 D;  1R1U A;  1ZW2 A;  3TGN A;  1YZC A;  3HOW J;  3E5U A;  5L0F A;  2P7C B;  4IJJ A;  1D1C A;  3ZMS A;  1K61 A;  2HR3 A;  5IYB J;  3FXU A;  2CUF A;  2MLG A;  1BW6 A;  1ENH A;  3C8G D;  4NQW B;  4CO8 A;  3K1I A;  3A01 B;  4EBB A;  4II3 A;  3VYU B;  2Q9C A;  1XMK A;  3KYJ A;  1MBJ A;  4XEV A;  2OJQ A;  5CQG A;  3OV8 A;  2LSE A;  2ELJ A;  3IHU A;  1HW1 A;  4ZYE A;  3JRB A;  1QPM A;  3MFK A;  2JA5 J;  1LEB A;  4C3I J;  4ENK A;  2BC5 A;  2MG4 A;  1HKT A;  3S29 A;  3FM5 A;  1X3U A;  3ZCO A;  2BW3 B;  2HPI A;  1ULY A;  1YHQ I;  1YS7 A;  3O6B B;  4GRI A;  2NNN A;  2KSF A;  5F64 A;  2R9R B;  2ME6 A;  2Y48 A;  5E18 F;  1Z9C A;  4PSX A;  3EPV A;  2EIK H;  3MKY B;  3M7G A;  1H9G A;  3CJR B;  2E1C A;  1V54 C;  2KP6 A;  1LUJ B;  2MYS A;  3K4K A;  2X1C A;  3N4M A;  2KGO A;  3S2W A;  3HUG A;  3H3U A;  4DYQ A;  4L18 B;  2PMZ N;  2G62 A;  4AL0 A;  4YRV A;  3H3Z A;  3ABU A;  4O79 A;  5CKT A;  3CF2 A;  3CLQ A;  2YLI A;  3B0U X;  5M5X J;  3MN2 A;  1MND A;  1L7C A;  3V8K A;  1V55 H;  4MHG A;  4MTO A;  1W36 C;  2XF6 A;  3VSL A;  4RDA A;  4U5C E;  3HSF A;  4D4X A;  3NAR A;  3AG4 C;  1DPR A;  2JUC A;  3CCS I;  5J4Y A;  1GS9 A;  3RTR A;  4PGH A;  1QBJ A;  4C2U A;  1P92 A;  4GCV A;  2DMQ A;  4OAY A;  4U9E A;  3L09 A;  1VFC A;  3W3C A;  1AVO B;  2R5Z A;  4AWX B;  3IL2 A;  4P55 A;  3A01 A;  2A61 A;  4Q4Z F;  1P7I A;  3KP5 A;  4NY3 A;  2NG1 A;  1GGQ A;  3R61 A;  1G3S A;  2V1U A;  2COB A;  1P6R A;  3KPH A;  5E1W A;  1R58 A;  3V7C A;  4EMS A;  1FOK A;  4I1M A;  4E0I A;  4CSA C;  3JRA A;  4RLF A;  1WPK A;  3LAP A;  1UHS A;  2K40 A;  2OPT A;  1IRF A;  5LGN A;  3KEQ A;  3K70 D;  3LES A;  1VYK A;  1Z6T A;  2XAU A;  2Q9B A;  2GBY A;  2ZME B;  1FTT A;  3WHN A;  3CLO A;  4BJ5 A;  3RQ4 A;  4Z9J A;  1IO2 A;  2ESN A;  1R49 A;  3IUO A;  1O3U A;  3KP4 A;  1B59 A;  1X1A A;  2K9N A;  1ZRE A;  1LIH A;  1ZU4 A;  5LGT A;  1XTA A;  4YII A;  3TP0 A;  1R9T J;  3K6B A;  1IRX A;  3HOU J;  3CUO A;  3HZJ A;  2QQA A;  5TGT A;  2AXL A;  3ML6 A;  3S84 A;  1MBK A;  3ZSU A;  1OR3 A;  1J59 A;  1IDY A;  5DCM B;  2QKL B;  5DS9 A;  1G8X A;  2F48 A;  2DYR C;  4XKC A;  4R32 A;  2KHM A;  3WOD F;  2VE9 A;  2STT A;  5L0D A;  4UVA A;  4CSW A;  3OA1 A;  5E33 A;  1W0T A;  1DU6 A;  4JEB A;  1YYJ A;  4V2F A;  4JTC B;  3R4K A;  1JPN A;  1M57 C;  2LRE A;  3M4C A;  3TJ6 A;  1WI9 A;  2Z3Y A;  2ICW G;  3NQO A;  3O8H A;  1AA7 A;  3MD2 A;  4XID A;  1YTY A;  1RJ9 A;  2WZG A;  3FXH A;  2UXX A;  3O2P E;  3ZGK A;  4ZZL A;  1D5Y A;  1D8J A;  1QNT A;  2JPU A;  1SD6 A;  2PX9 A;  3F46 A;  3GFI A;  5CQE A;  2C6Y A;  2RVC A;  2EZL A;  5L3D A;  1JRA A;  2ME0 A;  2HQN A;  1MSF C;  2ZXR A;  1RR7 A;  1XGM A;  4XLC A;  4E7I A;  2HZ8 A;  2M4E A;  3KP6 A;  4Y17 A;  4C7O B;  3ZQI A;  3DPT A;  1JT0 A;  3JRF A;  5IY5 C;  2HV7 A;  3HGY A;  3DLA A;  1E85 A;  4MTG A;  3KEO A;  3SDG A;  3IWF A;  2Y0M A;  2M87 A;  2Z1D A;  2MC3 A;  4GGG A;  3W4Y A;  3UMK A;  2WAF A;  2XLW A;  2E36 A;  2MA3 A;  3L2W A;  1OIS A;  3IQT A;  2OC6 A;  2PQ8 A;  3K70 C;  2MD5 A;  2H8R A;  2FA5 A;  3FKI J;  2Y0S N;  4XIC A;  2FSW A;  2I10 A;  3J7Y J;  1TBX A;  2ZME A;  2ZSI B;  3FXM A;  1HKS A;  3VYW A;  1T39 A;  2CU7 A;  4DYC A;  2LK4 A;  3JSE O;  1F5T A;  1JPJ A;  2VXD A;  2KRF A;  5TRD A;  4LFU A;  1ZU5 A;  1B9M A;  5HS7 A;  2VAS A;  3TQN A;  3QOP A;  1BIB A;  3HOS A;  1AKH B;  4WCG A;  4E17 A;  5JUA A;  4RB0 A;  3AQB A;  1G3Y A;  4CIC A;  3WTW C;  1BZ4 A;  3O3K A;  3K2A A;  3GTL J;  2OCC H;  3K33 A;  1T33 A;  2F5C A;  3HBL A;  3QPH A;  3DBH B;  2NNY A;  4G12 A;  1U5T C;  2ACJ A;  1TQG A;  3K1H A;  4LG3 A;  1QPU A;  3CUQ C;  5AC4 A;  4J7Y A;  3B0V C;  2BXY A;  1RNL A;  5B3S H;  3WG9 A;  2FML A;  2HQR A;  2W24 A;  2ISY A;  3GXO A;  3PQK A;  4HEA 2;  3DBL B;  4KYW A;  3T5X A;  2LNB A;  2IXO A;  2OU2 A;  3LA7 A;  1TKN A;  2RN7 A;  2PN6 A;  3S28 A;  5FFZ A;  3RI4 A;  1YOV B;  3K4N A;  2EZK A;  1UHW A;  2QM3 A;  3I55 I;  4C30 A;  4C7O A;  5AIQ A;  3MAJ A;  5BPI A;  2B63 J;  3DAG A;  4PJJ A;  2XGE A;  4IHY A;  3NYM A;  1FTZ A;  3POV A;  1QZX A;  1Z0X A;  4P5O A;  4WXD A;  3OYG A;  2XAF A;  4ZDO A;  4A3J J;  2GWW A;  3HTK C;  1IRG A;  4NTF A;  2LKX A;  3HRT A;  1TL8 A;  4L0Z B;  1J2X A;  4XQF A;  4ZYG A;  3LEV A;  2FD5 A;  3V4G A;  5E17 F;  2WVQ A;  5EGO A;  1CF7 B;  2XRH A;  3L34 A;  1KNY A;  5L3V A;  1V3F A;  4OIQ F;  1W5S A;  1TW3 A;  2R25 A;  1ZLJ A;  1AKH A;  2EIK C;  1Z05 A;  2V6E A;  1O3T A;  4U7D A;  2CV2 A;  3HNL A;  2K9Q A;  4RBO A;  2Z33 A;  4C3D A;  1SAX A;  4DNC A;  2ZFW A;  2CGE A;  1LDJ A;  1U2W A;  2BV6 A;  2UV1 A;  4RB3 C;  4I1O B;  1UST A;  2ELK A;  2NVY J;  5FKO A;  2WWY A;  3S16 J;  1NU7 D;  2WZF A;  3ZC4 A;  2VCA A;  5D6F A;  2RAE A;  3EZI A;  4A3E J;  1VYI A;  2HFI A;  1FP1 D;  1S5L C;  3QVY A;  3FOP A;  1V55 C;  1JJ8 C;  5ED4 A;  2G3K A;  1HBX G;  2V9P A;  4BE2 A;  3CCM I;  1KON A;  2QY9 A;  2YLG A;  3FAJ A;  3VSK A;  1ZK8 A;  4CXF A;  1NG7 A;  5DV5 A;  1MZB A;  5HLG A;  3GTJ J;  4V2G A;  2KJB A;  3OYI A;  1YO5 C;  4BGD A;  1ZG5 A;  3K1P A;  1QGP A;  2FNA A;  2G9W A;  1SD5 A;  4Y7N J;  4HNT A;  5L3F A;  3CF5 F;  1GVJ A;  2LQG A;  3FIW A;  3MKZ A;  2L54 A;  4B44 A;  1LVK A;  4NQF A;  3F9K A;  5E8G A;  3Q9S A;  3MZ8 A;  3F47 A;  3I64 A;  3B6A A;  3GTG J;  3DKW A;  1FOX A;  1KU9 A;  3HL2 A;  5FZT A;  1DDN A;  1FTS A;  3V8J A;  1MMS A;  2DAO A;  4NNJ A;  2E35 A;  3J81 Z;  2DFF A;  2EJR A;  1IV6 A;  1D3Y A;  5FKK A;  4ZTJ A;  4UXN A;  1YFH A;  3CSK A;  3BRJ A;  2L4A A;  3BPV A;  3QYE A;  1DP7 P;  1ORY A;  3K7A J;  4KC9 A;  1IG7 A;  2I8B A;  1VQP I;  3LSG A;  4RA2 A;  2GXG A;  3T9O A;  4NB5 A;  2J0X A;  2ISZ A;  4ETS A;  3TOB A;  3AJM A;  3RYP A;  3OYE A;  4L9V A;  2OOC A;  5FCL A;  1SZI A;  3FM3 A;  4MO7 A;  3BQY A;  2BXZ A;  3RJP A;  1FNT c;  2MFZ A;  2EV0 A;  2YWA A;  4FQG A;  1YZA A;  5IP9 J;  2AWY A;  4LLG F;  2WV0 A;  2KK1 A;  1JHH A;  1EH6 A;  2OZU A;  2W4B A;  3L2R A;  2DOD A;  2VUM J;  5GPC A;  4YEL A;  3BG9 A;  1HE9 A;  1FBU A;  3BCA A;  2JK3 A;  1LS1 A;  3ZTZ A;  3CCE I;  1XWJ A;  4QWQ A;  3MLG A;  3H36 A;  2Q2E A;  1VQ8 I;  5HV9 A;  3MCZ A;  1KYZ A;  1EV7 A;  5LHI A;  1ON2 A;  1QHG A;  2VBY A;  2E1O A;  1XPX A;  2J9V A;  2G0E A;  2KKO A;  1M2O A;  4UB8 C;  3CAX A;  1IZM A;  4A3M J;  2EIJ H;  3ZQC A;  4LLN A;  3H0D A;  4KBL A;  2GA0 A;  3HGG A;  1H8A C;  1VZ0 A;  1U0B B;  3Q6N A;  3JYY A;  5JVT A;  3C8G A;  4JW1 A;  2FJ1 A;  1P9Q C;  2YX4 A;  3IP4 B;  4YIR X;  4L5I A;  1M56 C;  4Z2Y A;  1CGM E;  5J40 A;  1JAF A;  1ORJ A;  2RRE A;  3BC8 A;  3D5S C;  1EI7 A;  4ONS A;  1VI0 A;  4ENJ A;  1D1B A;  3JRM O;  2R0Q C;  5L0C A;  4CSA A;  1TT5 B;  1Z1D A;  3D5L A;  4CCM A;  3JZ0 A;  3ZQF A;  2JN6 A;  5GP9 A;  4W8K A;  4W97 A;  4MVM A;  1S7E A;  4DBQ A;  5DM7 F;  2D45 A;  1E3P A;  1BW5 A;  5K0I A;  3QU3 A;  3F6V A;  3DAF A;  5L3Q A;  5TJ5 E;  3S14 J;  3CQZ J;  1A35 A;  1W7P D;  2A68 F;  3PFI A;  5D4R A;  2E2H J;  2HI3 A;  2NOJ B;  3U9J A;  3FHZ A;  1Q1V A;  3A2K A;  2OCC C;  3I5Q A;  4F7Z A;  3MVP A;  4FT8 A;  4MQ9 F;  3SDB A;  2F5V A;  1RR8 C;  1LPE A;  2LY1 A;  4IX7 A;  1YVI A;  1SVL A;  5IP6 A;  3OY9 A;  3AFH A;  2R7Q A;  1KU2 A;  3I59 B;  4Y52 J;  5B3S C;  2F4O B;  3E6B A;  3OOU A;  2X1E A;  1U5T B;  5IT3 A;  1WVR A;  3LSM A;  2VB6 A;  2P8T A;  3KKB A;  3PIP F;  4JX5 A;  1EKY A;  3Q7G A;  2CS3 A;  3AG2 H;  1EF4 A;  3DTI A;  3T1B A;  1FMV A;  2EPN A;  2MW8 A;  2QYO A;  4HFF B;  1N77 A;  4XN3 A;  1RMV A;  1ZZP A;  3GFJ A;  3J7A O;  5FFX A;  3PJR A;  1BR1 A;  1CGP A;  5LHG A;  2XKO A;  1YI2 I;  4G78 A;  1OCO H;  3S32 A;  5FLX Z;  4LK0 F;  2ETH A;  1YE9 A;  2DGJ A;  3AL0 C;  3SZP A;  3SEO A;  3UMH A;  2KIQ A;  2A6H F;  2OQM A;  4RDU A;  2K4B A;  2MLK A;  4G0H A;  2XV4 S;  5F5H A;  1JGS A;  1KU3 A;  3N0T A;  1Z3I X;  2DJI A;  1HA8 A;  2F4M B;  4XLE A;  2V3C C;  2K9S A;  3BJA A;  3EGX A;  4B48 A;  3A0H C;  1JGG A;  1J8Y F;  4I3M A;  2D1V A;  4G6T B;  3IH2 A;  4II2 A;  5DUK A;  2AVK A;  3J80 K;  3DEU A;  1HDP A;  3BTI A;  3HSE A;  2IW5 A;  3Q3S A;  2CV0 A;  3M15 A;  4RGU A;  4F55 A;  3LFU A;  5A6A A;  4KIG A;  3ECO A;  2L7Z A;  4NUB A;  4HST A;  3VOE A;  2B7E A;  3U0C A;  2RNG A;  5LD2 C;  1UG2 A;  1XGO A;  1U5T A;  1HST A;  4UB6 C;  1LFU P;  9ANT A;  1A7D A;  3CUQ A;  4M9S A;  4M63 A;  2R5Y B;  1FAP B;  2XAH A;  1F1Z A;  1XSD A;  1J8M F;  2CG4 A;  3CTA A;  1I3A A;  2DQR A;  3WU1 B;  3CJT B;  2LFD A;  3ELK A;  4GQH A;  1VQL I;  1WTY A;  2FUG 2;  5T3T A;  2KRH A;  3U9M A;  2DYS C;  3RSN A;  3K69 A;  4PAC A;  1OR2 A;  3GYH X;  1WHU A;  1ZW3 A;  4B47 A;  4ESF A;  5E3N A;  2LC2 A;  5F27 A;  3LNR A;  4PJ0 C;  1G3W A;  4JC7 A;  3UMI A;  5HSW A;  3LS1 A;  3ITF A;  5KYN A;  1S3J A;  1HF0 A;  2JMW A;  3E1S A;  1VQO I;  1RKE B;  3C18 A;  3ZR8 X;  2IS6 A;  1YW8 A;  4MTD A;  1OQC A;  1EQ1 A;  2DO7 A;  4UUV A;  5BMZ A;  3HOZ J;  4NBQ A;  2OEV A;  2XL4 A;  4U5H A;  2H1L A;  2WAQ N;  5EEH A;  2B0H A;  3RFY A;  5D4S A;  3E3V A;  3OR1 C;  4BY7 J;  2QBY B;  1ITY A;  2CV1 A;  4R8H A;  2GIZ A;  1NG1 A;  2XHK A;  3L0I A;  2IS1 A;  4RD9 A;  4Y4R A;  4BAC A;  3OIP A;  4KIS A;  1Y8Q B;  2NPU A;  3U1D A;  1MMA A;  1T5O A;  4CDG A;  4MVZ A;  4U9D A;  3LQQ A;  4XBF A;  1NK2 P;  3H5A A;  4XPY A;  5J8C A;  4EKW A;  2J46 A;  2EZH A;  5L3C A;  3LNQ A;  1MDM B;  2Q4F A;  3LEO A;  3WE3 A;  3ZMV A;  4FHT A;  2HOE A;  4BUP A;  1M1E B;  1LQ1 A;  1B68 A;  1YAU O;  4KNY A;  1L3P A;  3WTX C;  3G2B A;  2GOX B;  1R5G A;  4UHT A;  2R7F A;  3H2V A;  2D4U A;  3WTS C;  2NS7 A;  3S1Q J;  3HJC A;  3ECS A;  2WB1 A;  2YU3 A;  4BBR J;  5TIS C;  2BVM A;  4EJV A;  2EIJ C;  4C3E A;  4YJW A;  4JP0 A;  2A6T A;  3SFZ A;  5GTI C;  1IW7 F;  1DPU A;  2LP0 A;  3DJN B;  1R5H A;  5IOZ A;  2WA0 A;  4JVS A;  4DJ9 A;  3T8R A;  3DTK A;  4BPM A;  4GYI A;  2LYC A;  2R3S A;  2R7X A;  4LLC A;  5JLI A;  2J5P A;  1QSP A;  1OW7 A;  1C0W A;  2M45 A;  3JTH A;  4BE0 A;  2A0B A;  4P9U A;  2PI0 A;  2W25 A;  3G4X A;  3TMO A;  3SXZ A;  1RKE A;  3HRS A;  2EFO A;  2E34 A;  3L9F A;  5JHU A;  3ZP5 A;  1VMA A;  4P1W A;  2A0U A;  5F1J A;  5A2Q K;  1M2V B;  1LI5 A;  1LS4 A;  2KYH A;  3C3W A;  2YVK A;  4N6C A;  2JSP A;  1OCR H;  3X1O A;  2J9U A;  1FWZ A;  4B43 A;  4H54 A;  2H6C A;  3TO6 A;  2LSO A;  1NSG B;  4HBL A;  2QZ8 A;  2J8W A;  1U89 A;  2OJE D;  4G94 A;  3DCF A;  5E3M A;  4I6Z A;  2PP4 A;  1MNM C;  2OEX A;  2NVT J;  3KLN A;  1MDM A;  3HNJ A;  2HV6 A;  2HPM A;  3QOE A;  2DPD A;  4D5F A;  2FAP B;  3DE9 A;  4I98 B;  5E1Z B;  2QKM B;  4WGZ A;  3JR9 A;  4BXF A;  2WVO A;  2B0J A;  2A3S A;  1VQN I;  1WAT A;  2VLA A;  2EPK X;  5J1Y A;  1EH7 A;  1ZGJ A;  3WAQ A;  1I50 J;  2L2O A;  3AG2 C;  2H8W A;  3HKZ A;  4C3H J;  3QU6 A;  2YX7 A;  1PDN C;  2HJ3 A;  2V1N A;  4HG2 A;  2KRC A;  2M8E A;  3ZN0 A;  3CDI A;  4RB2 C;  3KZY A;  1XCV A;  5IOY A;  5KYU B;  2RGV A;  1WGW A;  1VQM I;  2IEK A;  3G73 A;  2KDZ A;  3R60 A;  3S1N J;  4HEA J;  3CCU I;  4OIO F;  5JI6 A;  5FKM A;  3I5P A;  5K5Q A;  3E6C C;  3E70 C;  4OIN F;  2DA7 A;  1U8R A;  3I4U A;  2KZV A;  3BT9 A;  3DM9 B;  1W2W A;  3RKX A;  2W85 A;  2P4W A;  1C17 M;  1T6U A;  3A0B C;  1NFO A;  1N75 A;  1JR8 A;  4IOC F;  2L6H A;  2NUP B;  4E0H A;  3BR5 A;  2K5C A;  4PUS A;  1ZHZ A;  4C3B A;  2QEX I;  1GXQ A;  2STW A;  3RQG A;  2LMD A;  3JYH A;  1XCB A;  2E1M C;  4DRI B;  3UR3 C;  4XLP F;  3P7N A;  3K7D A;  2O61 A;  1OQY A;  3OSG A;  1B6A A;  3O55 A;  4YFX F;  1OCZ H;  2VBW A;  3M9A A;  4I99 C;  1YG2 A;  4XRM A;  3DKA A;  4ANJ A;  4EGZ A;  3M8E A;  2YUS A;  3L00 A;  5JFR A;  4CJO A;  2DA2 A;  4BHC A;  4A4A A;  3H9Q A;  1GQA A;  5ILS A;  1OW6 A;  5FO5 A;  2PFB A;  5B5E C;  3LSR A;  1DOV A;  1Z23 A;  1ZHT A;  4BDZ A;  2EPM X;  2Y3G A;  3M79 A;  2DDB A;  3H65 A;  1WFX A;  5A69 A;  1OPC A;  3ZQQ A;  4QLC U;  4PR9 A;  1JI8 A;  3ZDL A;  4V19 K;  2YL7 A;  3NMK A;  4MVS A;  1G3T A;  3P5J A;  3T8T A;  1L3L A;  2HEO A;  2E7X A;  1LI7 A;  3W8I A;  2VON A;  5KYU A;  3EHM A;  4XWJ A;  3GZ5 A;  2BVL A;  4XKB A;  2YEV A;  1MD0 A;  4DXW A;  4Y33 A;  2Y3B A;  2LOO A;  3IH4 A;  3BR3 A;  1X3W B;  2V9V A;  5GAH J;  1RPW A;  1BJA A;  2GA1 A;  5CYV A;  3RPU A;  2XLO A;  5LEK A;  1ON1 A;  3IPM O;  3U3F A;  2LY9 A;  1NLX A;  4A2N B;  3M07 A;  3NWS A;  4BEH A;  2JD3 A;  1TWH A;  4FX4 A;  1ETO A;  1TWA A;  1E0E A;  3F8B A;  5T1D B;  1G4U S;  3M4O J;  1MMG A;  3QWL A;  3FX3 A;  2XRN A;  4G9Y A;  3QVZ A;  3SHF A;  1E83 A;  3Q5F A;  3LL7 A;  3FXR A;  4LDQ A;  1GM5 A;  4A2U A;  2FEZ A;  3GEI A;  1U6G A;  1O7F A;  2BZT A;  2XS8 A;  1ETX A;  2IXS A;  4QI2 A;  2BBY A;  2ZXI A;  3TED A;  3KLO A;  3KZZ A;  4Z9H A;  1FSE A;  1BBY A;  2OD5 A;  2QSG X;  3GEZ A;  3EG9 A;  1OKK A;  3BTL A;  5H20 A;  4H0E A;  1HE1 A;  4GXO A;  2QE9 A;  2R5Z B;  2EPF A;  2IGN A;  5E8I A;  2VJI A;  3FMQ A;  4Y13 A;  1K4S A;  4LGW A;  2X51 A;  1R1T A;  1D8K A;  4IQ4 A;  5B66 C;  2P1A A;  2W82 A;  4AE4 A;  3OSF A;  2PLY A;  2DOE A;  1ZHX A;  2NXN B;  4P96 A;  4BHP A;  1OMI A;  2IXP A;  2KMU A;  2HU9 A;  2Q1Z B;  2JA2 A;  1MSE C;  1WKM A;  4G6D A;  2HUJ A;  3B73 A;  3GTO J;  2K4J A;  1RUO A;  1BR2 A;  2D1H A;  4EJO A;  2KIM A;  4FAP B;  3JT1 A;  4KUM A;  3ASN C;  3EGD B;  2X85 A;  3GLL A;  4QI0 A;  4HPQ A;  3GTP J;  3BY6 A;  3E0J B;  1YJ9 I;  3CMY A;  1TTY A;  1UFB A;  4OD4 A;  3OYN A;  2Z5U A;  3NKE A;  1DP3 A;  2QUP A;  3B0P A;  4AVZ A;  2O5R A;  4EEF G;  5JS5 A;  4EJU A;  3ROU A;  1IAW A;  2PMU A;  3S3M A;  1SAN A;  3DQV C;  5CPR B;  2LH9 A;  1S7A A;  1TWH J;  1STZ A;  2VJJ A;  4RAF A;  1TWA J;  2J45 A;  4M3D A;  2QLA A;  2WZL A;  1F4K A;  3K0L A;  1R36 A;  1RJ9 B;  1S7Z A;  4HLX A;  2HNH A;  3G6E I;  2NYX A;  2M3A A;  2WAD A;  2HDW A;  5COF A;  2ZD9 A;  4DVY P;  4E4H A;  5L0I A;  2JQ7 A;  1JHF A;  3GLX A;  4CS7 A;  1UZC A;  3S0X A;  1RIO H;  1YLM A;  2ZXH A;  5KHD A;  1S8N A;  3NKD A;  1H0M A;  1P4X A;  5AIP A;  3SJM A;  3U2L A;  5C4X J;  1Y1V J;  1WJD A;  2VCC A;  1X4P A;  2CCY A;  2OCE A;  1J9I A;  2P81 A;  4MIM A;  2L6G A;  3ABM H;  3QYF A;  1FNN A;  3FXL A;  5BQG A;  1IUF A;  2E60 A;  2L3D A;  3VB2 A;  5HVQ C;  1O57 A;  5CVV A;  1I4Z A;  1E17 A;  3LFK A;  5EYR A;  4U0W A;  3DU5 A;  256B A;  4LAC B;  3G1M A;  4YT5 A;  2HOS A;  3LAY A;  4HDV A;  3A03 A;  3FXO A;  4PCQ A;  1H7I A;  3EGD A;  4AK9 A;  5TJJ A;  3SEZ A;  5E79 C;  3QOD A;  3MQ0 A;  5FKN A;  1QRY A;  1UCR A;  3TDU C;  3V7R A;  1QKR A;  3I3L A;  5F1R A;  2ZFU A;  3F6O A;  3F8N A;  4EUK B;  1B72 B;  2GLO A;  2O9X A;  3LUT B;  3JAM Z;  1Z5Z A;  3FF5 A;  4M3E A;  3RKW A;  1YYX A;  3FWE A;  4XSZ F;  1G5Z A;  3E9V A;  2JSC A;  2XSJ C;  1GLN A;  2R02 A;  1JUM A;  2ZNZ A;  3A02 A;  3WGG A;  1YAR O;  5C4J J;  3AGT A;  2VJ5 A;  1ZRC A;  2CQX A;  1YJN I;  1V5E A;  5DLJ A;  4P6I C;  3KH2 A;  3BZ6 A;  4G8X A;  2UUZ A;  3TQO A;  1U9N A;  2CUJ A;  3CCJ I;  1BC7 C;  1XZP A;  1X2M A;  1T95 A;  3EPZ A;  3K4L A;  4QPQ A;  5E3L A;  1IF1 A;  1A6Q A;  2CUZ A;  3KCC A;  2CQQ A;  1KA8 A;  4BQN A;  1UJ8 A;  2VE8 A;  5BUO A;  4YT2 A;  2MH9 A;  5LRS A;  1OCZ C;  2X1D A;  1JE8 A;  3J7A Y;  2EFN A;  3RPQ A;  2E1M B;  1Q1H A;  1XB4 A;  5DEQ A;  2CFO A;  1ETY A;  2PMH A;  3DPU A;  5EZG A;  4P9T A;  1FX7 A;  2FX0 A;  1SFK A;  2FRH A;  2JT1 A;  1LE8 B;  5DS6 A;  4GYG A;  3ZQL A;  2H27 A;  2D2W A;  2FMY A;  4LK1 F;  1HKQ A;  5J8F A;  3F8C A;  1X1P A;  1WOL A;  4MGR A;  3CCQ I;  2Y9Y A;  2O8X A;  3LSH A;  2WL8 A;  3C2B A;  2KLO A;  1RKW A;  2G7U A;  4E7K A;  3MX3 A;  1TNT A;  2ECC A;  3RKO F;  2L7F P;  1B8I A;  3LA3 A;  4RLQ A;  3X2Q C;  1WZ2 A;  5EGO B;  4XM3 A;  5T3W A;  2UXN A;  3PUF A;  4IRG A;  5D5U B;  2DPU A;  2VH3 A;  3EH1 A;  1K04 A;  1SYQ A;  1B72 A;  2EK5 A;  1CPQ A;  1IN7 A;  4L5E A;  3BZK A;  2VC9 A;  4FWV A;  4E7S A;  2ZNY A;  1OFC X;  2R7V A;  2P7V A;  1ZGA A;  2W1O A;  2FOW A;  2RDP A;  1BM9 A;  3JSO A;  5KYY A;  5HDK A;  4M6Y A;  1RRJ A;  1CGO A;  4ULW A;  2XLE A;  2P0W A;  2XDV A;  5HDN A;  2VBZ A;  2R7T A;  2A5Y B;  3F3X A;  4AM3 A;  1WSU A;  4CHU A;  4O6J A;  4DRJ B;  2X9D A;  1IGN A;  3VRC A;  2YU9 J;  3LST A;  3L8I A;  5EG0 A;  3OYD A;  1SFX A;  1Y6D A;  1VQK I;  4B4C A;  4BNC A;  2IA2 A;  2Z99 A;  4DRH B;  1PJR A;  1AUE A;  2LRD A;  5F0H A;  2Z2S B;  2NSF A;  4CCL A;  5H6R A;  1VLS A;  2DJN A;  1ETW A;  1NFN A;  1LE8 A;  1JUP A;  4C9Y A;  3QW0 A;  5M3F J;  1LPQ A;  1OCC H;  2DCE A;  3H9G A;  2P61 A;  1MBF A;  2E1N A;  2L0K A;  1NU9 C;  1TWC A;  3ZVR A;  1I4Y A;  2V1D A;  5B1B H;  4D0P A;  3REO A;  5HOO A;  3G4S I;  4BAY A;  4IHV A;  3DLL F;  2W00 A;  4HX4 A;  2VOD A;  5DYM A;  2DA1 A;  3A4C A;  1KTM A;  3MBG A;  2Q0O A;  5CI8 A;  2WAE A;  1T08 B;  2VQH A;  1GV5 A;  3HM5 A;  3Q0V A;  4LB6 B;  1T01 A;  3DBR B;  2XM0 A;  4PK4 A;  2JA7 J;  4M3G A;  5F5F A;  4KMU X;  3DE8 A;  1S05 A;  1T98 A;  5KAF C;  5A6K A;  4UUT A;  3EET A;  1WJA A;  4KMF A;  4MW3 A;  2MHR A;  2DXI A;  4X0R A;  3CC2 I;  3RZD J;  4JKV A;  3ZXS A;  3BZC A;  1K83 J;  4MFD A;  2VCB A;  1W5C C;  2HSB A;  1O7L A;  3COA C;  1OW8 A;  2XUB A;  3ZMU A;  1YYV A;  3N24 A;  3PNT A;  2Y0S A;  3HNK A;  1WH5 A;  2RV8 A;  2OTJ I;  1A04 A;  2DQL A;  1S29 A;  2Q2E B;  3C1D A;  3HNI A;  4BQQ A;  1IJW C;  2AP3 A;  4M6X A;  3PSI A;  1Z67 A;  4RGS A;  4U5D E;  5M5Y J;  4ABZ A;  1E2X A;  3J06 A; 
#chains in the Genus database with same CATH homology
 4ITV A;  4NUB A;  2WY7 Q;  4HST A;  1Z21 A;  2KJG A;  4OD5 A;  2PF4 E;  3OL3 A;  2J7P A;  3ABM C;  1LKX A;  3FHD A;  2H7O A;  5KYY B;  3V7O A;  4PJM A;  2RNG A;  4IWB A;  5LD2 C;  4CH7 A;  5LFA A;  1M2V A;  3K4M A;  1FFT C;  4M63 A;  4BDY A;  5DQZ A;  2K3P A;  4G7H F;  3FBI B;  1J8M F;  2EIM C;  2BW3 A;  2E5N A;  3W2V A;  4E7L A;  3T4R A;  2BE5 F;  3SZG A;  4PFP A;  4XON A;  3CQZ A;  1PCX A;  2FUG 2;  4XLN F;  2HZD A;  2KRH A;  5T3T A;  4DVZ A;  4QDL A;  4PJN A;  2VPL A;  1X4O A;  1QLE C;  2AQF A;  3HPG A;  1SF8 A;  1ZHY A;  3RSN A;  4XR6 A;  2DYS C;  2H7V C;  5B1A C;  2F6C A;  3NRH A;  5L3Q A;  3VWB A;  4B47 A;  2VKD A;  1MW7 A;  4U7B A;  2LC2 A;  4DBR A;  2JUG A;  3OYK A;  1T0F C;  2CV0 A;  3LNR A;  2PMZ A;  4HE8 D;  3CES A;  4F4B A;  3UMI A;  3S3O A;  2C03 A;  5HSW A;  4GEH A;  3CZ6 A;  3U21 A;  4CCN A;  2L9J A;  3ITF A;  3LS1 A;  5KYN A;  1WJF A;  5KCM A;  3E1S A;  2VQG A;  3OYL A;  4LIV A;  4FX5 A;  2Y3D A;  3NDB B;  3ZR8 X;  2IS6 A;  1Z63 A;  2XXA A;  2XL4 A;  2AQE A;  1N1C A;  4U5H A;  2NUT A;  2Q9A A;  3EUK L;  3CP2 A;  3RFY A;  4CBE A;  4GYT A;  3OR1 C;  2Y3H A;  3WG7 C;  2K9L A;  2CV1 A;  4XLF A;  1NG1 A;  4X0G A;  2IS1 A;  3L0I A;  3H5N A;  4RD9 A;  4Y4R A;  4BAC A;  3OIP A;  4E7Z A;  4KIS A;  3VAY A;  5DS5 A;  1MMA A;  3SNH A;  1PYV A;  4O6N A;  3H5A A;  1TWG A;  4BS9 A;  2J46 A;  3TL4 X;  2J0W A;  4RBN A;  2MC4 A;  1ZEL A;  4CS8 C;  3V42 A;  1EA3 A;  4J30 B;  3HUG B;  3HC7 A;  1LDK B;  4XTK A;  4BUP A;  3O39 A;  4IRU A;  2PX0 A;  2NUP A;  2HQA A;  1K6Y A;  2OG2 A;  3G2B A;  1O87 A;  3KYL A;  2GOX B;  4JQF A;  1UEL B;  4XKV A;  4ZJZ A;  2R7W A;  1VK5 A;  3HJC A;  3OYM A;  4PJL A;  3ECS A;  4BJ6 C;  2WB1 A;  1X1C A;  3SZR A;  1W36 D;  2BVM A;  1ERD A;  4MND A;  2EIJ C;  3EGX B;  1YX5 A;  4YJW A;  4C3E A;  4G7Z F;  1S9H A;  4IJJ A;  3PL8 A;  2A6T A;  1D0Y A;  1IW7 F;  4EWC A;  1D1C A;  2IXM A;  3OS2 A;  3DJN B;  3VDX A;  2WA0 A;  4JVS A;  1D0X A;  3S8P A;  2C04 A;  3DTK A;  2LYC A;  4XL9 A;  1DGR M;  2R7X A;  4LLC A;  4NQW B;  4DGW B;  2IGM A;  1UAA A;  4EBB A;  4II3 A;  3VYU B;  4BE0 A;  2Q9C A;  4XOP A;  3K4C A;  4ZLC A;  3TMO A;  5CQG A;  3C2G A;  4O7G A;  3RH3 A;  5KNL A;  1BR4 A;  2JVH A;  2ELJ A;  4P1W A;  1VMA A;  2KGO A;  2LSE A;  3PSF A;  1ST6 A;  2IXN A;  1M2V B;  4YEJ A;  4WJ0 A;  2DT6 A;  3Q6M A;  3S29 A;  4E7H A;  4BU2 A;  2JSP A;  4I44 A;  2HVS A;  3ZCO A;  3X1O A;  2BW3 B;  1WJ5 A;  2HPI A;  3A1Y A;  4B43 A;  2J9U A;  3B9Q A;  4GRI A;  4CA0 A;  3S3N A;  2Z15 A;  4PSX A;  3EJN A;  3EPV A;  4K0D A;  3MKY B;  2P6V A;  2CNW D;  2PP4 A;  2UWM A;  3CJR B;  3K10 A;  1V54 C;  2KP6 A;  2OUM A;  2HV6 A;  2MYS A;  3K4K A;  2X1C A;  5JHF A;  2HPM A;  2PJR B;  2IS2 A;  1OCC C;  3QOE A;  1Z6A A;  2G62 A;  2VQC A;  3GAN A;  2QKM B;  3N2Z B;  5B1B C;  4BXF A;  4YRV A;  2WVO A;  2VXZ A;  2B0J A;  1BOB A;  4O79 A;  5CKT A;  3CF2 A;  2VLA A;  5E2Q A;  3B0U X;  1MND A;  2V9K A;  3HPH A;  2L2O A;  1Z3Y A;  3HKZ A;  3OMY A;  3AG2 C;  3DKX A;  5EGY A;  4O6Y A;  1W36 C;  3BLY A;  2XF6 A;  3VSL A;  2V1N A;  2Z16 A;  4HG2 A;  4XLA A;  1X19 A;  2KRC A;  5HLT A;  4RDA A;  4U5C E;  4B6I A;  3EZH A;  5KYU B;  3AG4 C;  2XXA B;  1OLT A;  4NC8 A;  1WGW A;  5E3A A;  2QTV A;  3RTR A;  4C2U A;  4OAY A;  4HEA J;  4YN0 B;  3W3C A;  4OIO F;  5D91 A;  3LLK A;  3TBI A;  3I5P A;  2DT7 B;  4J00 A;  4Q4Z F;  3OYB A;  2G3V A;  3E70 C;  4NY3 A;  3PMR A;  2NG1 A;  4OIN F;  1LFP A;  5HNH A;  2R4G A;  2KZV A;  3I4U A;  2R7S A;  3DM9 B;  1W2W A;  2XF7 A;  3DWL E;  4I1M A;  4CSA C;  1N78 A;  4RLF A;  1N75 A;  4G7O F;  4N06 A;  4NC7 A;  4BJT A;  2NUP B;  4BQO A;  1TR2 A;  4PUS A;  2K5C A;  3K70 D;  1ZHZ A;  4XOT A;  1VYK A;  2F4I A;  3OYA A;  3LES A;  4C3B A;  3PFY A;  2XAU A;  2Q9B A;  4F92 B;  3GBG A;  2L9N A;  4BJ5 A;  3JYH A;  3RQ4 A;  4PFO A;  2E1M C;  3KL4 A;  3UR3 C;  1OR7 C;  2I8D A;  3SP1 A;  3K7D A;  4XLP F;  2MAB A;  3IUO A;  3BG6 A;  3S93 A;  1X1A A;  4R79 A;  1ZU4 A;  4DIQ A;  3K6B A;  1IRX A;  2PJR A;  4ANJ A;  4CCO A;  5TGT A;  3L2U A;  3HLZ A;  3ZSU A;  2DYR C;  3H9Q A;  2QKL B;  1G8X A;  4ZTF A;  2EIL C;  4XKC A;  2KHM A;  3WOD F;  3CJQ B;  4FET A;  2IS4 A;  3IAS 2;  1Z23 A;  4CSW A;  4BDZ A;  1ZHT A;  2J7P D;  2Y3G A;  3EHN A;  3OA1 A;  3H65 A;  5E33 A;  1WFX A;  2CW7 A;  4D1Q A;  3ZQQ A;  3HOT A;  3LSK A;  4CCK A;  1JI8 A;  1JPN A;  1M57 C;  1YX3 A;  2LRE A;  4KJZ A;  1RJ9 A;  3ABK C;  1AA7 A;  3MD2 A;  2WZG A;  3W8I A;  4KI2 A;  2XC7 A;  3ZGK A;  2XSE A;  5KYU A;  4BL0 B;  3EHM A;  2CMP A;  4XWJ A;  2M0M A;  2BVL A;  1DQU A;  2KDO A;  1NZE A;  2MWQ A;  3OWT A;  3F46 A;  4XKB A;  5CQE A;  2YEV A;  3FVY A;  4Y33 A;  4KIT B;  2Y3B A;  4JUR I;  2ZXR A;  2LOO A;  4LLE A;  3DMD A;  3K6G A;  4OIP F;  4IQJ A;  4E7I A;  1MMD A;  4XLC A;  3KMI A;  2M4E A;  4CS9 A;  4Q5S F;  4C7O B;  4A2N B;  3DPT A;  5IY5 C;  2HV7 A;  4BEH A;  3DLA A;  3NWS A;  3LSI A;  3IEE A;  4YWQ A;  5FRN A;  2JD3 A;  2IGK A;  1TWH A;  1VOM A;  3OS0 A;  4XOR A;  2Z1D A;  1SMY F;  1TWA A;  1E0E A;  5T1D B;  3FHN A;  3UMK A;  2HVQ A;  2WAF A;  3C2H A;  3OS1 A;  3L2W A;  1MMG A;  4K7B A;  1FMW A;  2OC6 A;  3M1C A;  4U87 A;  4H4K C;  3BCB A;  3K70 C;  3DJU B;  3RYL A;  3LL7 A;  1G59 A;  2ZSI B;  3VYW A;  2KW3 C;  1JPJ A;  2VXD A;  4CUG A;  1ZU5 A;  2ZXP A;  2IXS A;  2WB7 A;  4QI2 A;  4IAO A;  2VAS A;  2ZXI A;  3D5R C;  3T6B A;  3HOS A;  1WJB A;  3TD7 A;  4ZDP A;  2VIX A;  3RPU D;  4IZZ A;  2HVR A;  3AQB A;  4BG0 A;  3DD7 A;  3EG9 A;  1OKK A;  1WJC A;  5E3C A;  3PHF 2;  1WJE A;  4YT4 A;  2IGN A;  3K33 A;  2VJI A;  3EUA A;  2PFD A;  1V5G A;  2X51 A;  4IQ4 A;  3K1H A;  4LG3 A;  2KQR A;  4XKW A;  2W82 A;  1NG6 A;  4AE4 A;  3JSZ A;  3KEY A;  1ZHX A;  3B0V C;  3AQC A;  3DEE A;  2ZXW C;  5DQT A;  1UG0 A;  1ZHW A;  2IXP A;  2KMU A;  2HU9 A;  4HEA 2;  2VKH A;  2Q1Z B;  2IXO A;  2WY8 Q;  4YT8 A;  4RM2 A;  2JA2 A;  1TKN A;  2PX3 A;  4BJ1 A;  3S28 A;  3FBN B;  3K4N A;  1BR2 A;  4C30 A;  3DAF A;  3OR2 C;  4C7O A;  2E87 A;  5HNF A;  3JT1 A;  3ASN C;  3EGD B;  2X85 A;  4QI0 A;  4HPQ A;  3DAG A;  4PJJ A;  4ZC3 A;  3E0J B;  4ZDL A;  3DTE A;  1OKK D;  4OD4 A;  3OYN A;  3NYM A;  3POV A;  2IGO A;  1QZX A;  3NKE A;  4P5O A;  1DP3 A;  3SYT A;  3OYG A;  4AVZ A;  2O5R A;  2ZSH B;  3B0P A;  4ZDO A;  3EQL F;  3S3M A;  4B3X A;  3DQV C;  3HTK C;  5CPR B;  2X6X A;  2LH9 A;  2Y39 A;  4AU7 A;  4OWR B;  4U5E E;  2L5Q A;  4XQF A;  2VJJ A;  3LEV A;  2J45 A;  4HRI A;  3QMK A;  2WVQ A;  2WZL A;  2XRH A;  3L34 A;  1RJ9 B;  1S7Z A;  5L3V A;  4OIQ F;  2HNH A;  2W45 A;  1SAU A;  2M3A A;  2WAD A;  4F52 A;  2HDW A;  4E6K G;  2EIK C;  2V6E A;  4DVY P;  4LIU A;  4E4H A;  2CV2 A;  2ZPA A;  4C3D A;  3QZC A;  3VYR B;  4AYB A;  2LBF A;  2H7B A;  4CS7 A;  4LIT A;  1OCO C;  2CGE A;  2CW0 F;  3EH2 A;  3CMM A;  4I1O B;  2UV1 A;  3SYN A;  3S0X A;  2BOL A;  2WBM A;  2ZXH A;  5KHD A;  4XLH A;  3NKD A;  2EIN C;  1NU7 D;  2CW8 A;  2WZF A;  2A1D D;  3OYC A;  1WJD A;  1X4P A;  4BEH B;  3EZI A;  4CS8 A;  1VYI A;  3QYF A;  2E5Z A;  2E60 A;  4CIH A;  2MD0 A;  5HVQ C;  3AL0 B;  1V55 C;  2LY2 A;  2G3K A;  1D0Z A;  4BE2 A;  2GFH A;  3DU5 A;  3M1C B;  3L2Q A;  1KON A;  2QY9 A;  3FAJ A;  3PUB A;  4LAC B;  2KL4 A;  2KPM A;  3VSK A;  4YT5 A;  3FDY A;  1V5F A;  1NG7 A;  3MMY B;  2IOQ A;  3LAY A;  5DVW A;  3ZG1 A;  4BJ6 A;  5EHH A;  3OYI A;  3LJB A;  4BGD A;  3EGD A;  4AK9 A;  4PSW A;  3SEZ A;  2Q3T A;  3JCU Q;  3QOD A;  4HNT A;  3FDQ A;  2VL8 A;  3MKZ A;  3NYL A;  3I3L A;  4B44 A;  2ZFU A;  1LVK A;  3KX2 A;  4F91 B;  2LG4 A;  2O9X A;  3Q7L A;  3F9K A;  3K4J A;  1Z5Z A;  3GOD A;  2R7O A;  3K1I C;  3F47 A;  3E9V A;  2XSJ C;  3ASO C;  1GLN A;  3ZRG A;  3EFO A;  3HL2 A;  1ZYR F;  3EG9 B;  1PD1 A;  1FTS A;  1FFH A;  2VJ5 A;  3K4B A;  4NNJ A;  4FAS D;  3OEO A;  5KYW A;  3M8J A;  1V5E A;  5DLJ A;  4ZTJ A;  4P6I C;  3KH2 A;  1Y6I A;  3CSK A;  2UUZ A;  3K66 A;  4AE4 B;  2CUJ A;  4Q7C A;  3QYE A;  1T95 A;  3EPZ A;  2M7B A;  3K4L A;  4HSR A;  3LSG A;  3DPL C;  4QPQ A;  2I8B A;  2X6Y A;  2CUZ A;  2J0X A;  2ZXO A;  3DXJ F;  3O6X A;  2V7F A;  4BQN A;  3OYE A;  3UGP A;  5BUO A;  4AX2 A;  4YT2 A;  1OCZ C;  2V4J C;  1SZI A;  2X1D A;  5FCL A;  3J7A Y;  1Y56 A;  3PNV A;  2WVN A;  2MFZ A;  2E1M B;  3PNY A;  3UNG C;  3DM5 A;  3ZIB A;  4DOZ A;  1Z7L A;  2CFO A;  3LLI A;  4IKF A;  3DPU A;  3L2V A;  5FRM A;  2RQQ A;  3AG1 C;  1SFK A;  4ZYA A;  5DS6 A;  1O5H A;  1QU3 A;  2W4B A;  3S27 A;  3L2R A;  2KNH A;  2M7A A;  2YHS A;  3ABL C;  4YEL A;  3LSH A;  3BCA A;  1LS1 A;  2OV7 A;  2WL8 A;  2KLO A;  4E7K A;  4OAZ A;  3FKJ A;  2XF5 A;  3MLG A;  3MX3 A;  2DOA A;  3DKY A;  2M4K A;  4FES A;  3RKO F;  2CDQ A;  4RLQ A;  3H5R A;  2GOM A;  3X2Q C;  2J9V A;  1QHG A;  4J01 A;  4RMN A;  3N05 A;  4XM3 A;  5T3W A;  2R7U A;  1M2O A;  1IZM A;  2CH0 A;  2VH3 A;  5CI9 A;  3EH1 A;  4N4O B;  3H0D A;  4KBL A;  1X1D A;  1VZ0 A;  3Q6N A;  4FWV A;  4E7S A;  2R7V A;  2P7V A;  2FGY A;  5KYX B;  2W1O A;  3LMM A;  5KYY A;  2D5R B;  2LBF B;  4JW1 A;  1MMN A;  3BG7 A;  4RM3 A;  3HXL A;  4ULW A;  1P9Q C;  2P0W A;  3IP4 B;  1M56 C;  2M4G A;  2XDV A;  4N4N B;  4OIR F;  2RRE A;  3BC8 A;  2R7T A;  3D5S C;  4ZLD A;  4MLO A;  3OYF A;  1D1B A;  4BEJ A;  4CSA A;  3NWT A;  3JRT A;  4J32 B;  1D1A A;  3D5L A;  3RCO A;  4CCM A;  2KQ9 A;  4BJ5 C;  3W8H A;  3RIP A;  3ZC4 A;  1Z3X A;  4W8K A;  3OYD A;  1TT0 A;  4XNF A;  2W7N A;  4DBQ A;  3EUH C;  2FFH A;  1PD0 A;  3LS0 A;  4QPO A;  1PJR A;  2L9S A;  4CCJ A;  4HNU A;  2LRD A;  3MKW B;  2CNW A;  2W4M A;  2Z2S B;  3OIQ A;  4U5G A;  4CCL A;  2A68 F;  3H9J A;  3ONQ A;  2NOJ B;  4XN0 A;  2W4S A;  4E7J A;  3A2K A;  2OCC C;  3I5Q A;  4KT6 A;  4C9Y A;  3OL4 A;  2JVG A;  3DZA A;  3NG1 A;  4MQ9 F;  3SDB A;  2DCE A;  2F5V A;  2K9M A;  3H9G A;  2LY1 A;  1NU9 C;  4IX7 A;  1TWC A;  4JJF A;  3ZVR A;  3OY9 A;  2L81 A;  1TZL A;  3AFH A;  2R7Q A;  1KU2 A;  3H35 A;  4KNV A;  3EFO B;  4F93 B;  3OOU A;  5HOO A;  4U5B E;  5B3S C;  2X1E A;  2V26 A;  4CZC A;  4JOM A;  3KKB A;  3LSM A;  2VB6 A;  5KYW B;  2W00 A;  3Q7G A;  2CS3 A;  1OCR C;  4D9J A;  3A4C A;  4JJG A;  4DJA A;  3CP8 A;  2X6W A;  3DTI A;  3NYJ A;  2WAE A;  2VQH A;  5CI8 A;  2WAQ A;  1FMV A;  5DS4 A;  4HFF B;  1N77 A;  1R6R A;  4XN3 A;  4PK4 A;  4JCH A;  2YZS A;  2A69 F;  4Y3O A;  5F5F A;  4CS9 C;  5FRO A;  3T6J A;  4HFK B;  3PJR A;  5KYX A;  3AG3 C;  1BR1 A;  3UGO A;  1WJA A;  3S32 A;  4X0R A;  3QYB A;  2DXI A;  2L7K A;  3ZXS A;  3W2W A;  1U0J A;  1YE9 A;  3VYT B;  2DGJ A;  3AL0 C;  3SEO A;  3IAM 2;  3I9V 2;  3OYJ A;  3UMH A;  1J09 A;  2A6H F;  4LER A;  3AKZ A;  4XMY A;  1QHH D;  4G0H A;  3HG9 A;  4U5F E;  5F5H A;  3N0T A;  4EAT A;  3PNT A;  3N24 A;  4BE1 A;  2Y0S A;  1Z3I X;  4C2T A;  5D92 A;  2DJI A;  3W2A A;  1HA8 A;  4KC9 A;  3DU6 A;  4XLE A;  2W9Y A;  2V3C C;  3EGX A;  4B48 A;  3OYH A;  2VJ4 A;  1J8Y F;  4I3M A;  4G6T B;  2IYL D;  2Y69 C;  4JZA A;  4II2 A;  2NUT B;  2A6E F;  4O6M A;  1X1B A;  2Q2E B;  2J9W A;  3SEQ A;  4BQQ A;  2R7R A;  4F3Q A;  1MNE A;  1DGW Y;  3PSI A;  4KNW A;  2VQL A;  4U5D E;  3VYS B;  4F55 A;  3LFU A;  2A5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...