3O10A

Crystal structure of the hepn domain from human sacsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
GSVGNPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKLENFMQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of defects in the sacsin HEPN domain responsible for autosomal recessive spastic ataxia of Charlevoix-Saguenay (ARSACS).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Sacsin
total genus 53
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3o10A00
3B71A 3JYYA 1WWPA 1O3UA 2L6GA 3L8JA 3RQGA 1KNYA 4NQFA 3GM2A 3C8GD 4EBKA 4XEKA 3C8GB 2L6HA 3O10A 2JPUA 4XEVA 3TULA 3C8GA 1V4AA 1QVXA 2HSBA 3U3FA 1PV3A 1WTYA 4R32A 3U0CA 1KTMA 1WOLA 2KK1A 3L8IA 1OW6A 2L6FA 3K7DA 1OW7A 2JX0A 3MFNA 1UFBA 3C18A 3RQFA 3AJMA 3RQEA 3GM1A 3S9OA 5F28E 3JZ0A 1K04A 3BRJA 1JOGA 3GM3A 1K40A 4XEFA 4EBJA 1ZZPA 2LK4A 2YWAA 2Q00A 1K05A 2PBEA 1OW8A
chains in the Genus database with same CATH superfamily
2W4BA 3A9CA 5CIVA 3EGXA 2V26A 3B0VC 1ZHXA 2WZLA 3K66A 3V5YA 4YWQA 4MVUA 5B1BC 2BC5A 4RDAA 2Y3GA 4BJ6C 4A2NB 2YRFA 2OU6A 5L0GA 2CDQA 1QVXA 2C03A 1QQ3A 1YDIA 3M4CA 3ZIBA 1T01A 4MVOA 3TOMA 1KTMA 3DJUB 1AEPA 1JPNA 2J46A 2IOQA 3QMKA 4XLPF 2QNLA 3C18A 1ORJA 3KMIA 1BR1A 2HKVA 2JD3A 2HUJA 2O9XA 2OJQA 3H2UA 3KKBA 5F28E 3O6XA 1Y6DA 3IQ6A 1MMNA 2B0HA 4EBJA 2NUPA 5T3TA 2Q7RA 1HE9A 1T9KA 3H2VA 2VH3A 3EHNA 4CDYA 5BQIA 2R7TA 5D92A 1D0YA 1RKCA 2XLWA 3FOOA 1C02A 5FCLA 2L6GA 3AQCA 3ZQYA 2WB7A 2IXOA 2HJ3A 4C3BA 1OKKD 1O87A 4U9DA 5COGA 3FDQA 2YL0A 1GS9A 2GA0A 4RBNA 3EZIA 3MYFA 1N1CA 1Q0DA 2L7AA 3MLGA 2CW0F 5B3IA 2XLEA 3VF0A 5BUOA 3EQLF 1YA9A 1S05A 1IW7F 5JS5A 1UFBA 3AG4C 3U3BA 4Z9HA 1VOMA 1NBBA 2A6EF 1NFNA 2A68F 1K04A 3CEXA 2VC9A 1BDJB 1CGOA 2OEXA 2Q00A 1U89A 2QE9A 3DE9A 1HE1A 1XZPA 2ASRA 2Q9CA 5E33A 1ZHYA 3TOLA 4DRJB 1HW2A 1NZEA 1LPEA 1J8MF 1KNYA 4KNWA 2IBFA 3E70C 3W2VA 2J9VA 5A6BA 2H7VC 1AVOB 2YLDA 3L1MA 3HNJA 1YLMA 3C8GB 4JEBA 2OKUA 3DAGA 3Q6NA 2EPOA 3V5ZA 3NDBB 4DVZA 1PV3A 1TKNA 1D1BA 4E18A 4PJJA 1G4WR 5L0HA 4KBLA 5CI8A 5JUAA 1E2XA 1FTSA 1ORYA 2A0UA 2XM4A 4OD4A 5D91A 3MFNA 2P6VA 1R4TA 3DKAA 4PR9A 4PACA 2R7SA 2AP3A 1LIHA 4P6IC 2ZXPA 3DWWA 1ZW3A 2YWAA 4NTAA 4W8KA 4WGZA 1V74B 3JRMO 1ZU5A 2GDCA 3NG1A 4KNVA 4O6YA 1WWPA 3UR3C 2LSEA 2R03A 4CDAA 4BEJA 2ETSA 2UUIA 2FFHA 3M15A 3N0TA 4J7TA 3SXYA 5L3VA 3IPMO 4PJMA 3EGDB 1OCRC 1EKYA 3W2WA 1WGWA 2G62A 5E3CA 5JRAA 1ZHWA 1MMGA 2KSFA 2Q9AA 3M4BA 4BJ1A 3EG9A 3FVYA 3RW0A 4K7BA 4HE8D 2J9UA 4U5GA 1YARO 1TWGA 2VCAA 2WZFA 3NMJA 4NY3A 4E7SA 2XLMA 1G4US 4YJWA 4DXWA 5KYYA 4UDVA 2R7XA 4I1MA 1MQVA 1RJ9B 1GM5A 3GWLA 3VYWA 4CSAA 2LIGA 2NUTB 2R7RA 2D4UA 3FAJA 5EGYA 3I5QA 3X2QC 2I8BA 2PBEA 4AL0A 4OIOF 5HV9A 1BZ4A 2CGEA 3KH2A 2OQMA 1RKEB 2QY9A 3EPVA 2M64A 4E17A 5AC4A 5K0IA 4CSAC 1ORSC 3AG2C 3FHDA 1LI7A 3US6A 3CAXA 3LS1A 4MTGA 3RF3A 3VRCA 5B3SC 3BEHA 3T6BA 1VB5A 4JCZA 4DOZA 4YT4A 4OIQF 1JMWA 2UUHA 1ZYRF 1GGQA 1WTYA 3POVA 4CIHA 4W8PA 1QLEC 3FAPB 2KGOA 3RKOF 3S90A 2V3CC 1TQGA 1GQAA 2EPLX 4JC7A 2P61A 1TWHA 2WVOA 4JZAA 5F5HA 3VM6A 4MS2A 3ZWIA 3WHNA 1B68A 4ULWA 2NPUA 1SR2A 4OIPF 4C7OB 5GPGB 3LLIA 5F5FA 1V54C 3IEEA 3U8VA 4U5CE 4IB4A 2XXAA 4P9TA 1H7IA 2J7PA 4EWCA 3ABKC 3K1HA 3V5XA 3GANA 1YAUO 3JYYA 1HMDA 3WODF 4EBBA 1D0XA 1WASA 2AWYA 4H4KC 4KI2A 2W4MA 1ZW2A 4H54A 3ZTMA 1Z3IX 1LM3B 3HKKA 4D4NA 2DI3A 3T4RA 2HV7A 3VAYA 3C8GA 2NG1A 3L34A 4JCHA 2BL2A 3QW1A 5EK0A 4JTAB 1C03A 3DMDA 2B0JA 2L9JA 3GEEA 3U2MA 4A4AA 3C7JA 1OW6A 1JR8A 3T6JA 2BE5F 3UGPA 3SYNA 1A0BA 2Y3DA 5E2QA 2W9YA 2FAPB 2PX0A 4G7ZF 2GFHA 4BJ5C 3GODA 1ZVZA 5DVWA 5TJ5E 4D4XA 5DS6A 2QUPA 2LFDA 3NMIA 2HMQA 5IY5C 5JLIA 3S84A 3CZ6A 2ZXOA 3TULA 3C63A 1Q0GA 3C8ZA 3EH1A 2P1AA 3LEOA 4Z9IA 3IQCA 5DLJA 4DVYP 5KYXB 1RXQA 1I5NA 1L7CA 2YEVA 4U5BE 2ZD9A 4U5DE 1Z7Qc 2CYDA 5COMA 2G3KA 4YK5A 5KYUA 2H7OA 3DM5A 1YZAA 2P7VA 5T1DB 4CIPA 4IJJA 3U3FA 4Q4ZF 4G7OF 2J45A 4F4BA 5JT4A 2KK1A 2LD6A 1LE2A 3HLZA 3IHUA 2L6FA 3NRHA 2W45A 3EG9B 4HFKB 4IAOA 1T5OA 2OJED 2R7QA 4RD9A 2OOCA 3GM1A 5KYYB 1I4YA 2YL1A 2Z15A 3ASOC 1VLTA 2GWWA 2VCBA 1Q0FA 3AG1C 1A7DA 3MX3A 3K1IC 1ZZPA 2AVKA 3N24A 5BQHA 2NUTA 1ZHTA 3Q6MA 3G50A 2XLOA 4DBQA 4BJTA 1YVIA 3L8JA 4E7ZA 4AK9A 4LACB 2OEVA 2YL7A 3DE8A 2E87A 3SXZA 3WAQA 3LUTB 4U5FE 4XEVA 1SMYF 1QPUA 4AE4B 4CBEA 3GEIA 3CSKA 3L0IA 3HJCA 3SZRA 3U0CA 1VYIA 4N4WA 3ZQVA 3HNIA 1HW1A 2J9WA 5A6KA 3GORA 3QTHA 1JPJA 3EFOB 3F47A 5L0JA 3AOUA 3HNLA 3RQFA 4QI2A 2PX3A 4BJ5A 1M2OA 4ZLDA 3B0PA 3EH2A 1EA8A 3IQTA 3OEOA 4C7OA 3GEHA 4PFPA 1M2VA 4MVMA 2EPNA 3U8PA 4QDLA 3RYLA 2MYSA 2R9RB 2ZXWC 4K0DA 1L3PA 2DGJA 3QW0A 4FWVA 4G7HF 2Y3HA 4PK4A 2G3VA 1LI5A 1LS1A 2A69F 4N6CA 5L3QA 4E0HA 3JRTA 1VLSA 4IWBA 2L6HA 1WATA 2IXPA 2F22A 5JVEA 3SXMA 3X1OA 2IXMA 3Q7LA 2EILC 4G78A 1V55C 2Y3BA 3S0XA 3JTLO 1WOLA 2H7BA 1PD0A 1U6HA 3L8IA 1VK5A 2LFFA 3A11A 4J32B 4NCQA 5JSLA 3NYLA 2J7PD 5L0IA 2R7VA 4YT5A 1MMAA 4MW8A 3PCVA 2EIJC 1YA7O 4I44A 5CI9A 1RMVA 2YL3A 2XRHA 2KJGA 1TFOB 5DS5A 3J06A 4I1OB 2LK4A 4LDRA 4AX2A 1MNDA 2ZPAA 2NSGA 4O6NA 5FZTA 2VB6A 4ANJA 1OCCC 1T6IA 1H9TA 3KPHA 4NC3A 3K1IA 3T6GB 2YVKA 3TD7A 1DOVA 2J9BA 3ZC4A 5KYXA 4J7YA 1D1CA 3EJNA 1M56C 1OKKA 4MNDA 2LQGA 3DJNB 2KYHA 2R05A 2IYLD 3ABMC 4XPYA 1NFOA 3PHF2 5KYUB 1UG7A 3DM9B 1NG1A 3EGXB 4IAQA 3UMIA 5A6JA 2DB4A 2EPKX 3B29A 2VCCA 4ULVA 4IRUA 3Q7GA 4MVSA 1XZQA 1OQCA 1Z63A 2YLGA 4Q7CA 4KC9A 1JRAA 1OW7A 2XM0A 2P0NA 2TMVP 2LCHA 3S9OA 1D0ZA 2XLVA 1NLXA 3ECSA 4XPWA 3UNGC 1SYQA 3JZ0A 2A6HF 4X0RA 4BG0A 1F1MA 4YL1A 5T3WA 4XTKA 3MBGA 1IZMA 4XLNF 1FMWA 4XQ1A 2PP4A 3ITFA 4HFFB 4XEKA 2PF4E 3FMSA 1TWAA 1CGNA 4MTFA 3M79A 2R7WA 1A7EA 4JVSA 1W2WA 1OR3A 2R02A 4MTOA 1CGME 2CNWA 2VASA 2ZXRA 3LNMB 4G0HA 4I3MA 1Z6AA 2L81A 2A0BA 3DI5A 4JIOA 4DRHB 2Q4FA 1Q0KA 2JPUA 4CS7A 3AQBA 3MYIA 2I15A 1OXBA 2LP4A 2MWQA 1V4AA 2Y39A 3JT1A 4U9EA 3S28A 4WGYA 4CS8A 5L0DA 4AE4A 1OXKA 3K6BA 4BPMA 3E9VA 2J0XA 1A7VA 1D1AA 2EIKC 3QVZA 4EKWA 1QKRA 1TWCA 2KW3C 4C3EA 1FNTc 3AJMA 4O6MA 3EFOA 4JW1A 2XSEA 1FFHA 3SNHA 1S7ZA 1PD1A 4MVQA 2WZGA 1E83A 4JJGA 3OA1A 1CPRA 1RKEA 4O79A 4B6IA 1JOGA 2DYSC 4XEFA 5DQZA 4CS9C 3RFYA 1MNEA 2H8AA 1RCPA 1HY5A 3C62A 4J30B 1YYXA 4LDQA 3ZG1A 3LJBA 1EQ1A 2Q3TA 1G8XA 3SP1A 4YN0B 3B71A 3RQGA 1R5ID 1SZIA 1C17M 1TR2A 4CS8C 2J0WA 1LE4A 2AU5A 3R2PA 4MQ9F 4N6HA 3LAYA 3W8IA 3TJ5A 3QZCA 256BA 3T9OA 3O39A 1LS4A 4ONSA 3ABLC 3U9JA 4MVRA 2HMZA 5A6BD 1TFKB 2WVNA 3I5PA 4EIYA 2OG2A 3NKDA 3NKEA 3U5SA 2YLIA 3EZHA 3N2ZB 2XS1A 4LDKA 2D5RB 3B9QA 2XL6A 3DZAA 4N06A 3RVYA 5DQTA 4YT8A 1O5HA 3S29A 4YT2A 2HV6A 4FESA 2HSQA 3DXJF 1T6UA 1K40A 4U5HA 4XPXA 1SF8A 2EINC 4JE9A 1JAFA 2AWCA 4CX9A 1I4ZA 4DRIB 5HSWA 3PMRA 2R7OA 2IM8A 3LEVA 2CNWD 4CJGA 5DS4A 3ZTZA 1LKXA 3C8GD 4JURI 2WVQA 4DBRA 1E85A 2RSEB 1U0BB 2XS8A 3K33A 3S27A 4CDVA 3U9MA 2EIMC 5A6AA 1QSPA 1CPQA 3QVYA 5COFA 3ZVRA 3W4YA 4GQHA 4EHPA 1FR0A 1YJGA 2KNHA 3LS0A 2Y69C 3EGDA 3UGOA 5L0CA 4MW3A 1MMDA 3OWTA 5KYWB 4HEAJ 1M6TA 5EHHA 4YL3A 2DYRC 3U2LA 3AGTA 2GAQA 2KQ9A 1OCZC 2FGYA 4WABA 4Q5SF 2NSFA 4AL1A 1FFTC 1T6QA 2CCYA 4EUKB 2X0CA 5AGFA 1RJ9A 1ST6A 4GYTA 1O3UA 2PFDA 2YZSA 4JEAA 4OIRF 3AGUA 1HMOA 1A41A 1BR2A 4BJ6A 3GM2A 4OINF 2M4EA 1Q0MA 1H9GA 3JSZA 4LLCA 1FMVA 1OR2A 2R25A 3O10A 4JTCB 2QTVA 2C04A 2YQYA 2XLDA 2HZ8A 3PDMP 1Y4CA 4XWJA 4LERA 4YL0A 3DD7A 3V7OA 1BBHA 3DAFA 4NTFA 3FXHA 3I4UA 4ER9A 2Q9BA 3RIPA 2KC3A 1ZU4A 3RQEA 1PCXA 3LESA 1KU2A 2J8WA 3M1CB 4M63A 2NUPB 3SEOA 3F46A 3G4ZA 1OCOC 2RD9A 2YHSA 1K05A 1J8YF 3NYJA 3FOPA 3W8HA 3JYHA 1BR4A 5L0FA 3LNRA 4L6RA 4P9FA 2WL8A 3ATPA 5B1AC 3KYJA 4NQFA 3TQOA 2HJMA 3LLKA 2XXAB 3JCUQ 3ZDLA 1Z23A 4EBKA 4FX5A 1ZHZA 3TK0A 4LLEA 5A69A 3ASNC 2PNOA 2HFIA 2HSBA 4PJNA 1XWJA 4MVZA 1VYKA 2ICWG 4JTDB 2XL8A 2EPMX 3RVZA 4BEMJ 3GWNA 4C3DA 2HS5A 3JSEO 2JX0A 4OD5A 2R7UA 1YZCA 1M2VB 2XLHA 2YKZA 1E86A 3KL4A 4E0IA 1QZXA 3KYIA 4WJ0A 5BQGA 3HTKC 4U5EE 3RH3A 3ZSUA 1APCA 4QI0A 1NU9C 3G4XA 3BRJA 3GM3A 4PJLA 4PFOA 4K1OA 4IGGA 1WN0A 3UMKA 4FAPB 2QLAA 3WG7C 4CS9A 1Z5ZA 1YYJA 3CQZA 2MHRA 1E84A 3B0UX 4GEHA 1EI7A 1DOWA 1LVKA 1VTMP 4DJ9A 1NU7D 1VMAA 3EHMA 3TJ6A 4ZLCA 1NSGB 1FAPB 3UMHA 3O55A 4CJOA 4R32A 4Z9JA 4IARA 1AUEA 1H6GA 3IQ5A 2A1DD 2IXNA 3AG3C 3K7DA 3R7CA 1M57C 3SXKA 4NTBA 4JRZA 1G5ZA 3H65A 3NYMA 3HNKA 4O7GA 5KYWA 5KYNA 4JKVA 4JJFA 2OCCC 2XL4A 5AC5A 5JP7A 3NMKA 5E3AA 1OW8A 2X51A
chains in the Genus database with same CATH topology
3B71A 3JYYA 1WWPA 1O3UA 2L6GA 3L8JA 3RQGA 1KNYA 4NQFA 3GM2A 3C8GD 4EBKA 4XEKA 3C8GB 2L6HA 3O10A 2JPUA 4XEVA 3TULA 3C8GA 1V4AA 1QVXA 2HSBA 3U3FA 1PV3A 1WTYA 4R32A 3U0CA 1KTMA 1WOLA 2KK1A 3L8IA 1OW6A 2L6FA 3K7DA 1OW7A 2JX0A 3MFNA 1UFBA 3C18A 3RQFA 3AJMA 3RQEA 3GM1A 3S9OA 5F28E 3JZ0A 1K04A 3BRJA 1JOGA 3GM3A 1K40A 4XEFA 4EBJA 1ZZPA 2LK4A 2YWAA 2Q00A 1K05A 2PBEA 1OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B71 A;  3JYY A;  1WWP A;  1O3U A;  2L6G A;  3L8J A;  3RQG A;  1KNY A;  4NQF A;  3GM2 A;  3C8G D;  4EBK A;  4XEK A;  3C8G B;  2L6H A;  3O10 A;  2JPU A;  4XEV A;  3TUL A;  3C8G A;  1V4A A;  1QVX A;  2HSB A;  3U3F A;  1PV3 A;  1WTY A;  4R32 A;  3U0C A;  1KTM A;  1WOL A;  2KK1 A;  3L8I A;  1OW6 A;  2L6F A;  3K7D A;  1OW7 A;  2JX0 A;  3MFN A;  1UFB A;  3C18 A;  3RQF A;  3AJM A;  3RQE A;  3GM1 A;  3S9O A;  5F28 E;  3JZ0 A;  1K04 A;  3BRJ A;  1JOG A;  3GM3 A;  1K40 A;  4XEF A;  4EBJ A;  1ZZP A;  2LK4 A;  2YWA A;  2Q00 A;  1K05 A;  2PBE A;  1OW8 A; 
#chains in the Genus database with same CATH topology
 2W4B A;  3A9C A;  5CIV A;  3EGX A;  2V26 A;  3B0V C;  1ZHX A;  2WZL A;  3K66 A;  3V5Y A;  4YWQ A;  4MVU A;  5B1B C;  2BC5 A;  4RDA A;  2Y3G A;  4BJ6 C;  4A2N B;  2YRF A;  2OU6 A;  5L0G A;  2CDQ A;  1QVX A;  2C03 A;  1QQ3 A;  1YDI A;  3M4C A;  3ZIB A;  1T01 A;  4MVO A;  3TOM A;  1KTM A;  3DJU B;  1AEP A;  1JPN A;  2J46 A;  2IOQ A;  3QMK A;  4XLP F;  2QNL A;  3C18 A;  1ORJ A;  3KMI A;  1BR1 A;  2HKV A;  2JD3 A;  2HUJ A;  2O9X A;  2OJQ A;  3H2U A;  3KKB A;  5F28 E;  3O6X A;  1Y6D A;  3IQ6 A;  1MMN A;  2B0H A;  4EBJ A;  2NUP A;  5T3T A;  2Q7R A;  1HE9 A;  1T9K A;  3H2V A;  2VH3 A;  3EHN A;  4CDY A;  5BQI A;  2R7T A;  5D92 A;  1D0Y A;  1RKC A;  2XLW A;  3FOO A;  1C02 A;  5FCL A;  2L6G A;  3AQC A;  3ZQY A;  2WB7 A;  2IXO A;  2HJ3 A;  4C3B A;  1OKK D;  1O87 A;  4U9D A;  5COG A;  3FDQ A;  2YL0 A;  1GS9 A;  2GA0 A;  4RBN A;  3EZI A;  3MYF A;  1N1C A;  1Q0D A;  2L7A A;  3MLG A;  2CW0 F;  5B3I A;  2XLE A;  3VF0 A;  5BUO A;  3EQL F;  1YA9 A;  1S05 A;  1IW7 F;  5JS5 A;  1UFB A;  3AG4 C;  3U3B A;  4Z9H A;  1VOM A;  1NBB A;  2A6E F;  1NFN A;  2A68 F;  1K04 A;  3CEX A;  2VC9 A;  1BDJ B;  1CGO A;  2OEX A;  2Q00 A;  1U89 A;  2QE9 A;  3DE9 A;  1HE1 A;  1XZP A;  2ASR A;  2Q9C A;  5E33 A;  1ZHY A;  3TOL A;  4DRJ B;  1HW2 A;  1NZE A;  1LPE A;  1J8M F;  1KNY A;  4KNW A;  2IBF A;  3E70 C;  3W2V A;  2J9V A;  5A6B A;  2H7V C;  1AVO B;  2YLD A;  3L1M A;  3HNJ A;  1YLM A;  3C8G B;  4JEB A;  2OKU A;  3DAG A;  3Q6N A;  2EPO A;  3V5Z A;  3NDB B;  4DVZ A;  1PV3 A;  1TKN A;  1D1B A;  4E18 A;  4PJJ A;  1G4W R;  5L0H A;  4KBL A;  5CI8 A;  5JUA A;  1E2X A;  1FTS A;  1ORY A;  2A0U A;  2XM4 A;  4OD4 A;  5D91 A;  3MFN A;  2P6V A;  1R4T A;  3DKA A;  4PR9 A;  4PAC A;  2R7S A;  2AP3 A;  1LIH A;  4P6I C;  2ZXP A;  3DWW A;  1ZW3 A;  2YWA A;  4NTA A;  4W8K A;  4WGZ A;  1V74 B;  3JRM O;  1ZU5 A;  2GDC A;  3NG1 A;  4KNV A;  4O6Y A;  1WWP A;  3UR3 C;  2LSE A;  2R03 A;  4CDA A;  4BEJ A;  2ETS A;  2UUI A;  2FFH A;  3M15 A;  3N0T A;  4J7T A;  3SXY A;  5L3V A;  3IPM O;  4PJM A;  3EGD B;  1OCR C;  1EKY A;  3W2W A;  1WGW A;  2G62 A;  5E3C A;  5JRA A;  1ZHW A;  1MMG A;  2KSF A;  2Q9A A;  3M4B A;  4BJ1 A;  3EG9 A;  3FVY A;  3RW0 A;  4K7B A;  4HE8 D;  2J9U A;  4U5G A;  1YAR O;  1TWG A;  2VCA A;  2WZF A;  3NMJ A;  4NY3 A;  4E7S A;  2XLM A;  1G4U S;  4YJW A;  4DXW A;  5KYY A;  4UDV A;  2R7X A;  4I1M A;  1MQV A;  1RJ9 B;  1GM5 A;  3GWL A;  3VYW A;  4CSA A;  2LIG A;  2NUT B;  2R7R A;  2D4U A;  3FAJ A;  5EGY A;  3I5Q A;  3X2Q C;  2I8B A;  2PBE A;  4AL0 A;  4OIO F;  5HV9 A;  1BZ4 A;  2CGE A;  3KH2 A;  2OQM A;  1RKE B;  2QY9 A;  3EPV A;  2M64 A;  4E17 A;  5AC4 A;  5K0I A;  4CSA C;  1ORS C;  3AG2 C;  3FHD A;  1LI7 A;  3US6 A;  3CAX A;  3LS1 A;  4MTG A;  3RF3 A;  3VRC A;  5B3S C;  3BEH A;  3T6B A;  1VB5 A;  4JCZ A;  4DOZ A;  4YT4 A;  4OIQ F;  1JMW A;  2UUH A;  1ZYR F;  1GGQ A;  1WTY A;  3POV A;  4CIH A;  4W8P A;  1QLE C;  3FAP B;  2KGO A;  3RKO F;  3S90 A;  2V3C C;  1TQG A;  1GQA A;  2EPL X;  4JC7 A;  2P61 A;  1TWH A;  2WVO A;  4JZA A;  5F5H A;  3VM6 A;  4MS2 A;  3ZWI A;  3WHN A;  1B68 A;  4ULW A;  2NPU A;  1SR2 A;  4OIP F;  4C7O B;  5GPG B;  3LLI A;  5F5F A;  1V54 C;  3IEE A;  3U8V A;  4U5C E;  4IB4 A;  2XXA A;  4P9T A;  1H7I A;  2J7P A;  4EWC A;  3ABK C;  3K1H A;  3V5X A;  3GAN A;  1YAU O;  3JYY A;  1HMD A;  3WOD F;  4EBB A;  1D0X A;  1WAS A;  2AWY A;  4H4K C;  4KI2 A;  2W4M A;  1ZW2 A;  4H54 A;  3ZTM A;  1Z3I X;  1LM3 B;  3HKK A;  4D4N A;  2DI3 A;  3T4R A;  2HV7 A;  3VAY A;  3C8G A;  2NG1 A;  3L34 A;  4JCH A;  2BL2 A;  3QW1 A;  5EK0 A;  4JTA B;  1C03 A;  3DMD A;  2B0J A;  2L9J A;  3GEE A;  3U2M A;  4A4A A;  3C7J A;  1OW6 A;  1JR8 A;  3T6J A;  2BE5 F;  3UGP A;  3SYN A;  1A0B A;  2Y3D A;  5E2Q A;  2W9Y A;  2FAP B;  2PX0 A;  4G7Z F;  2GFH A;  4BJ5 C;  3GOD A;  1ZVZ A;  5DVW A;  5TJ5 E;  4D4X A;  5DS6 A;  2QUP A;  2LFD A;  3NMI A;  2HMQ A;  5IY5 C;  5JLI A;  3S84 A;  3CZ6 A;  2ZXO A;  3TUL A;  3C63 A;  1Q0G A;  3C8Z A;  3EH1 A;  2P1A A;  3LEO A;  4Z9I A;  3IQC A;  5DLJ A;  4DVY P;  5KYX B;  1RXQ A;  1I5N A;  1L7C A;  2YEV A;  4U5B E;  2ZD9 A;  4U5D E;  1Z7Q c;  2CYD A;  5COM A;  2G3K A;  4YK5 A;  5KYU A;  2H7O A;  3DM5 A;  1YZA A;  2P7V A;  5T1D B;  4CIP A;  4IJJ A;  3U3F A;  4Q4Z F;  4G7O F;  2J45 A;  4F4B A;  5JT4 A;  2KK1 A;  2LD6 A;  1LE2 A;  3HLZ A;  3IHU A;  2L6F A;  3NRH A;  2W45 A;  3EG9 B;  4HFK B;  4IAO A;  1T5O A;  2OJE D;  2R7Q A;  4RD9 A;  2OOC A;  3GM1 A;  5KYY B;  1I4Y A;  2YL1 A;  2Z15 A;  3ASO C;  1VLT A;  2GWW A;  2VCB A;  1Q0F A;  3AG1 C;  1A7D A;  3MX3 A;  3K1I C;  1ZZP A;  2AVK A;  3N24 A;  5BQH A;  2NUT A;  1ZHT A;  3Q6M A;  3G50 A;  2XLO A;  4DBQ A;  4BJT A;  1YVI A;  3L8J A;  4E7Z A;  4AK9 A;  4LAC B;  2OEV A;  2YL7 A;  3DE8 A;  2E87 A;  3SXZ A;  3WAQ A;  3LUT B;  4U5F E;  4XEV A;  1SMY F;  1QPU A;  4AE4 B;  4CBE A;  3GEI A;  3CSK A;  3L0I A;  3HJC A;  3SZR A;  3U0C A;  1VYI A;  4N4W A;  3ZQV A;  3HNI A;  1HW1 A;  2J9W A;  5A6K A;  3GOR A;  3QTH A;  1JPJ A;  3EFO B;  3F47 A;  5L0J A;  3AOU A;  3HNL A;  3RQF A;  4QI2 A;  2PX3 A;  4BJ5 A;  1M2O A;  4ZLD A;  3B0P A;  3EH2 A;  1EA8 A;  3IQT A;  3OEO A;  4C7O A;  3GEH A;  4PFP A;  1M2V A;  4MVM A;  2EPN A;  3U8P A;  4QDL A;  3RYL A;  2MYS A;  2R9R B;  2ZXW C;  4K0D A;  1L3P A;  2DGJ A;  3QW0 A;  4FWV A;  4G7H F;  2Y3H A;  4PK4 A;  2G3V A;  1LI5 A;  1LS1 A;  2A69 F;  4N6C A;  5L3Q A;  4E0H A;  3JRT A;  1VLS A;  4IWB A;  2L6H A;  1WAT A;  2IXP A;  2F22 A;  5JVE A;  3SXM A;  3X1O A;  2IXM A;  3Q7L A;  2EIL C;  4G78 A;  1V55 C;  2Y3B A;  3S0X A;  3JTL O;  1WOL A;  2H7B A;  1PD0 A;  1U6H A;  3L8I A;  1VK5 A;  2LFF A;  3A11 A;  4J32 B;  4NCQ A;  5JSL A;  3NYL A;  2J7P D;  5L0I A;  2R7V A;  4YT5 A;  1MMA A;  4MW8 A;  3PCV A;  2EIJ C;  1YA7 O;  4I44 A;  5CI9 A;  1RMV A;  2YL3 A;  2XRH A;  2KJG A;  1TFO B;  5DS5 A;  3J06 A;  4I1O B;  2LK4 A;  4LDR A;  4AX2 A;  1MND A;  2ZPA A;  2NSG A;  4O6N A;  5FZT A;  2VB6 A;  4ANJ A;  1OCC C;  1T6I A;  1H9T A;  3KPH A;  4NC3 A;  3K1I A;  3T6G B;  2YVK A;  3TD7 A;  1DOV A;  2J9B A;  3ZC4 A;  5KYX A;  4J7Y A;  1D1C A;  3EJN A;  1M56 C;  1OKK A;  4MND A;  2LQG A;  3DJN B;  2KYH A;  2R05 A;  2IYL D;  3ABM C;  4XPY A;  1NFO A;  3PHF 2;  5KYU B;  1UG7 A;  3DM9 B;  1NG1 A;  3EGX B;  4IAQ A;  3UMI A;  5A6J A;  2DB4 A;  2EPK X;  3B29 A;  2VCC A;  4ULV A;  4IRU A;  3Q7G A;  4MVS A;  1XZQ A;  1OQC A;  1Z63 A;  2YLG A;  4Q7C A;  4KC9 A;  1JRA A;  1OW7 A;  2XM0 A;  2P0N A;  2TMV P;  2LCH A;  3S9O A;  1D0Z A;  2XLV A;  1NLX A;  3ECS A;  4XPW A;  3UNG C;  1SYQ A;  3JZ0 A;  2A6H F;  4X0R A;  4BG0 A;  1F1M A;  4YL1 A;  5T3W A;  4XTK A;  3MBG A;  1IZM A;  4XLN F;  1FMW A;  4XQ1 A;  2PP4 A;  3ITF A;  4HFF B;  4XEK A;  2PF4 E;  3FMS A;  1TWA A;  1CGN A;  4MTF A;  3M79 A;  2R7W A;  1A7E A;  4JVS A;  1W2W A;  1OR3 A;  2R02 A;  4MTO A;  1CGM E;  2CNW A;  2VAS A;  2ZXR A;  3LNM B;  4G0H A;  4I3M A;  1Z6A A;  2L81 A;  2A0B A;  3DI5 A;  4JIO A;  4DRH B;  2Q4F A;  1Q0K A;  2JPU A;  4CS7 A;  3AQB A;  3MYI A;  2I15 A;  1OXB A;  2LP4 A;  2MWQ A;  1V4A A;  2Y39 A;  3JT1 A;  4U9E A;  3S28 A;  4WGY A;  4CS8 A;  5L0D A;  4AE4 A;  1OXK A;  3K6B A;  4BPM A;  3E9V A;  2J0X A;  1A7V A;  1D1A A;  2EIK C;  3QVZ A;  4EKW A;  1QKR A;  1TWC A;  2KW3 C;  4C3E A;  1FNT c;  3AJM A;  4O6M A;  3EFO A;  4JW1 A;  2XSE A;  1FFH A;  3SNH A;  1S7Z A;  1PD1 A;  4MVQ A;  2WZG A;  1E83 A;  4JJG A;  3OA1 A;  1CPR A;  1RKE A;  4O79 A;  4B6I A;  1JOG A;  2DYS C;  4XEF A;  5DQZ A;  4CS9 C;  3RFY A;  1MNE A;  2H8A A;  1RCP A;  1HY5 A;  3C62 A;  4J30 B;  1YYX A;  4LDQ A;  3ZG1 A;  3LJB A;  1EQ1 A;  2Q3T A;  1G8X A;  3SP1 A;  4YN0 B;  3B71 A;  3RQG A;  1R5I D;  1SZI A;  1C17 M;  1TR2 A;  4CS8 C;  2J0W A;  1LE4 A;  2AU5 A;  3R2P A;  4MQ9 F;  4N6H A;  3LAY A;  3W8I A;  3TJ5 A;  3QZC A;  256B A;  3T9O A;  3O39 A;  1LS4 A;  4ONS A;  3ABL C;  3U9J A;  4MVR A;  2HMZ A;  5A6B D;  1TFK B;  2WVN A;  3I5P A;  4EIY A;  2OG2 A;  3NKD A;  3NKE A;  3U5S A;  2YLI A;  3EZH A;  3N2Z B;  2XS1 A;  4LDK A;  2D5R B;  3B9Q A;  2XL6 A;  3DZA A;  4N06 A;  3RVY A;  5DQT A;  4YT8 A;  1O5H A;  3S29 A;  4YT2 A;  2HV6 A;  4FES A;  2HSQ A;  3DXJ F;  1T6U A;  1K40 A;  4U5H A;  4XPX A;  1SF8 A;  2EIN C;  4JE9 A;  1JAF A;  2AWC A;  4CX9 A;  1I4Z A;  4DRI B;  5HSW A;  3PMR A;  2R7O A;  2IM8 A;  3LEV A;  2CNW D;  4CJG A;  5DS4 A;  3ZTZ A;  1LKX A;  3C8G D;  4JUR I;  2WVQ A;  4DBR A;  1E85 A;  2RSE B;  1U0B B;  2XS8 A;  3K33 A;  3S27 A;  4CDV A;  3U9M A;  2EIM C;  5A6A A;  1QSP A;  1CPQ A;  3QVY A;  5COF A;  3ZVR A;  3W4Y A;  4GQH A;  4EHP A;  1FR0 A;  1YJG A;  2KNH A;  3LS0 A;  2Y69 C;  3EGD A;  3UGO A;  5L0C A;  4MW3 A;  1MMD A;  3OWT A;  5KYW B;  4HEA J;  1M6T A;  5EHH A;  4YL3 A;  2DYR C;  3U2L A;  3AGT A;  2GAQ A;  2KQ9 A;  1OCZ C;  2FGY A;  4WAB A;  4Q5S F;  2NSF A;  4AL1 A;  1FFT C;  1T6Q A;  2CCY A;  4EUK B;  2X0C A;  5AGF A;  1RJ9 A;  1ST6 A;  4GYT A;  1O3U A;  2PFD A;  2YZS A;  4JEA A;  4OIR F;  3AGU A;  1HMO A;  1A41 A;  1BR2 A;  4BJ6 A;  3GM2 A;  4OIN F;  2M4E A;  1Q0M A;  1H9G A;  3JSZ A;  4LLC A;  1FMV A;  1OR2 A;  2R25 A;  3O10 A;  4JTC B;  2QTV A;  2C04 A;  2YQY A;  2XLD A;  2HZ8 A;  3PDM P;  1Y4C A;  4XWJ A;  4LER A;  4YL0 A;  3DD7 A;  3V7O A;  1BBH A;  3DAF A;  4NTF A;  3FXH A;  3I4U A;  4ER9 A;  2Q9B A;  3RIP A;  2KC3 A;  1ZU4 A;  3RQE A;  1PCX A;  3LES A;  1KU2 A;  2J8W A;  3M1C B;  4M63 A;  2NUP B;  3SEO A;  3F46 A;  3G4Z A;  1OCO C;  2RD9 A;  2YHS A;  1K05 A;  1J8Y F;  3NYJ A;  3FOP A;  3W8H A;  3JYH A;  1BR4 A;  5L0F A;  3LNR A;  4L6R A;  4P9F A;  2WL8 A;  3ATP A;  5B1A C;  3KYJ A;  4NQF A;  3TQO A;  2HJM A;  3LLK A;  2XXA B;  3JCU Q;  3ZDL A;  1Z23 A;  4EBK A;  4FX5 A;  1ZHZ A;  3TK0 A;  4LLE A;  5A69 A;  3ASN C;  2PNO A;  2HFI A;  2HSB A;  4PJN A;  1XWJ A;  4MVZ A;  1VYK A;  2ICW G;  4JTD B;  2XL8 A;  2EPM X;  3RVZ A;  4BEM J;  3GWN A;  4C3D A;  2HS5 A;  3JSE O;  2JX0 A;  4OD5 A;  2R7U A;  1YZC A;  1M2V B;  2XLH A;  2YKZ A;  1E86 A;  3KL4 A;  4E0I A;  1QZX A;  3KYI A;  4WJ0 A;  5BQG A;  3HTK C;  4U5E E;  3RH3 A;  3ZSU A;  1APC A;  4QI0 A;  1NU9 C;  3G4X A;  3BRJ A;  3GM3 A;  4PJL A;  4PFO A;  4K1O A;  4IGG A;  1WN0 A;  3UMK A;  4FAP B;  2QLA A;  3WG7 C;  4CS9 A;  1Z5Z A;  1YYJ A;  3CQZ A;  2MHR A;  1E84 A;  3B0U X;  4GEH A;  1EI7 A;  1DOW A;  1LVK A;  1VTM P;  4DJ9 A;  1NU7 D;  1VMA A;  3EHM A;  3TJ6 A;  4ZLC A;  1NSG B;  1FAP B;  3UMH A;  3O55 A;  4CJO A;  4R32 A;  4Z9J A;  4IAR A;  1AUE A;  1H6G A;  3IQ5 A;  2A1D D;  2IXN A;  3AG3 C;  3K7D A;  3R7C A;  1M57 C;  3SXK A;  4NTB A;  4JRZ A;  1G5Z A;  3H65 A;  3NYM A;  3HNK A;  4O7G A;  5KYW A;  5KYN A;  4JKV A;  4JJF A;  2OCC C;  2XL4 A;  5AC5 A;  5JP7 A;  3NMK A;  5E3A A;  1OW8 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 3B71 A;  3JYY A;  1WWP A;  1O3U A;  2L6G A;  3L8J A;  3RQG A;  1KNY A;  4NQF A;  3GM2 A;  3C8G D;  4EBK A;  4XEK A;  3C8G B;  2L6H A;  3O10 A;  2JPU A;  4XEV A;  3TUL A;  3C8G A;  1V4A A;  1QVX A;  2HSB A;  3U3F A;  1PV3 A;  1WTY A;  4R32 A;  3U0C A;  1KTM A;  1WOL A;  2KK1 A;  3L8I A;  1OW6 A;  2L6F A;  3K7D A;  1OW7 A;  2JX0 A;  3MFN A;  1UFB A;  3C18 A;  3RQF A;  3AJM A;  3RQE A;  3GM1 A;  3S9O A;  5F28 E;  3JZ0 A;  1K04 A;  3BRJ A;  1JOG A;  3GM3 A;  1K40 A;  4XEF A;  4EBJ A;  1ZZP A;  2LK4 A;  2YWA A;  2Q00 A;  1K05 A;  2PBE A;  1OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...