3O10A

Crystal structure of the hepn domain from human sacsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
GSVGNPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKLENFMQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sacsin
publication title Structural basis of defects in the sacsin HEPN domain responsible for autosomal recessive spastic ataxia of Charlevoix-Saguenay (ARSACS).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 53
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3o10A00
1UFBA 3AJMA 2LK4A 3K7DA 4EBKA 2KK1A 1KTMA 4R32A 1K05A 1ZZPA 2JX0A 3U3FA 1WOLA 2YWAA 3GM2A 3U0CA 2L6FA 1QVXA 2HSBA 3JYYA 4NQFA 4XEFA 3RQGA 3BRJA 1OW6A 3L8IA 2JPUA 5F28E 2L6HA 3C8GD 1OW7A 1V4AA 2PBEA 3GM3A 1WWPA 1PV3A 3JZ0A 1WTYA 3L8JA 1O3UA 2Q00A 3C8GA 1JOGA 3MFNA 3O10A 1K04A 1K40A 4XEKA 3RQFA 3RQEA 3S9OA 4EBJA 2L6GA 4XEVA 3GM1A 1OW8A 1KNYA 3C8GB 3TULA 3C18A 3B71A
chains in the Genus database with same CATH superfamily
4NTBA 4YT5A 4R32A 2X0CA 3FMSA 2KYHA 2W9YA 4YT8A 3EG9A 2W4MA 1H6GA 2FAPB 2ZXOA 2X51A 4Z9HA 5DQZA 1FFHA 1VLSA 1NU9C 2KC3A 2WVQA 4XLNF 1VYKA 1HW1A 2D4UA 3AGTA 3JRTA 4EIYA 3CZ6A 2A69F 3QTHA 2J46A 2YQYA 4C3BA 4AK9A 2EIKC 3JZ0A 4XWJA 1YYJA 2BL2A 4JTDB 5E3AA 2YL0A 3G4XA 5EHHA 2R7TA 1M6TA 3EH1A 1LM3B 4U5FE 1ZVZA 1Z5ZA 4KBLA 3PMRA 1I4YA 2XS8A 2WVOA 1WGWA 4NTAA 3T6BA 4EBBA 3B0VC 3RKOF 4MTOA 3X2QC 5KYYA 4O6YA 4J32B 3ZG1A 4GYTA 2VASA 2XLWA 3B71A 3UNGC 1FR0A 2Y69C 1GS9A 1W2WA 3RFYA 3US6A 5CIVA 4NC3A 2KK1A 2PF4E 4JCZA 1Q0KA 1K05A 4D4NA 4YL1A 1ZHXA 3HNIA 1T6QA 3AOUA 3GM2A 4O79A 3ZC4A 1F1MA 2J9VA 4BEJA 2QTVA 4AX2A 3LAYA 1M57C 2QLAA 3K33A 4QI0A 3HNLA 4U9EA 5KYUB 3IQCA 3G50A 3GM3A 2AWCA 1TWHA 3N2ZB 2W4BA 2EPOA 3Q6MA 4HEAJ 5E3CA 3ZDLA 3FAPB 1WTYA 4C3DA 4JE9A 1BDJB 2DI3A 3DJNB 4CDAA 2ZXWC 4U5EE 2H7VC 2NPUA 3OEOA 2LQGA 3ZTZA 3V5YA 2DB4A 1G4WR 2J9BA 3J06A 3EH2A 2OJED 4IGGA 1MMDA 3CSKA 2Q4FA 3R7CA 1HE1A 5COFA 4AL1A 4KI2A 4B6IA 1LPEA 1D1BA 2XL8A 4ULVA 4MS2A 2GFHA 1CGNA 5B1BC 2PP4A 1WATA 1OKKD 3NYMA 2WL8A 3A11A 4XPXA 1NZEA 5DLJA 1OCOC 1T6UA 3IHUA 1N1CA 2C03A 2HSQA 3LNRA 1TFOB 2CDQA 2AVKA 2R7QA 3DM9B 4XEFA 3CEXA 1MNDA 3ABKC 3GWLA 5COGA 4D4XA 2VH3A 4WGYA 4OD5A 3S84A 3OA1A 4JTCB 3EGXB 4IAQA 1IZMA 5L0DA 4ER9A 2O9XA 3RW0A 5DVWA 3SNHA 3K6BA 3TK0A 2EIJC 5L0GA 2J0WA 2Q00A 5L0IA 2A1DD 3AG1C 1T9KA 2DGJA 2NUPA 3EZHA 3FXHA 4N6HA 3DXJF 4YT4A 4KNWA 3NKDA 4XEVA 3GM1A 1ZHYA 1YYXA 3EJNA 4I3MA 4G7HF 3AQCA 3EHMA 1UFBA 4FESA 2I15A 4JEAA 1Z6AA 4L6RA 4W8PA 3TQOA 1A7VA 3LLIA 5FZTA 1KTMA 1A7EA 1AVOB 2J9WA 1ZU4A 2OKUA 4MVQA 2JX0A 2LFFA 1UG7A 4WGZA 4PJMA 5D92A 4CDVA 1Z63A 1MQVA 5A6AA 2WVNA 3KMIA 3M79A 3JYHA 3TOLA 3SYNA 1SF8A 4QDLA 3JSEO 1XZQA 2KGOA 4YK5A 2L6HA 2R25A 3NRHA 4A2NB 4ZLCA 1YARO 2Y3HA 3EG9B 1D1CA 2YL7A 3GEEA 3PCVA 4DBQA 1DOWA 3O55A 3SXYA 4BEMJ 4RBNA 5K0IA 4PK4A 4DXWA 1U6HA 1O3UA 1RJ9A 3K1IA 1JOGA 3FHDA 4K1OA 1EA8A 3DM5A 1JPNA 3DMDA 3MFNA 4IRUA 2ETSA 4XEKA 2J8WA 2EPNA 2P7VA 1V55C 1LI7A 1Q0FA 3UMIA 3U8VA 3MYIA 2JD3A 3LNMB 4JC7A 3AJMA 5BUOA 3TOMA 4OIRF 1MMNA 3V5ZA 4DVZA 5DS6A 1TWGA 2YL3A 3SXZA 5KYYB 2IOQA 2C04A 2VB6A 2HS5A 3NG1A 4XQ1A 4LLCA 5B1AC 5FCLA 4JEBA 5JT4A 2LP4A 3IQ5A 4P9FA 1H9GA 5A6BD 5JUAA 3IPMO 3L1MA 4LDKA 3ZQYA 1A7DA 4HE8D 2YZSA 3NYJA 4LLEA 5COMA 4DRJB 3HNKA 2KW3C 5AC5A 5EGYA 1QSPA 3DKAA 5A6BA 4C3EA 5L3QA 2LIGA 2VC9A 3KYJA 2YVKA 3LEVA 3MX3A 4A4AA 2CGEA 3SEOA 3SXMA 1NFOA 3W2VA 1K40A 2XLVA 3AQBA 4J7TA 3GORA 3IQ6A 2P1AA 3C7JA 4CJOA 1VLTA 3UGPA 4P6IC 1VTMP 2Q3TA 1JRAA 4BJ5A 4DRIB 4JW1A 4IB4A 1M2VA 1FTSA 3U8PA 3ASNC 2EIMC 4CIHA 1YAUO 3QW0A 5CI8A 3V5XA 1LS1A 4PR9A 1APCA 2MHRA 2XLEA 3NMIA 1U89A 5KYWA 3ZQVA 1OCZC 1Z23A 3BRJA 2G62A 5T1DB 1EQ1A 4NCQA 4G7ZF 4MVZA 4PACA 1A0BA 2L81A 3F46A 1ORJA 5L0JA 3PDMP 3FOOA 2OG2A 1VK5A 1J8YF 3ZWIA 1ZYRF 4C7OA 3LJBA 3DE9A 1D1AA 4U5HA 4AL0A 2OEVA 4GQHA 3GANA 3HLZA 2NSGA 2QY9A 1NU7D 2WB7A 3MBGA 1O5HA 2BE5F 3TJ5A 4ZLDA 2YHSA 4OD4A 4YJWA 5JP7A 3RF3A 2XXAA 1TQGA 2NUPB 2LK4A 4EBKA 1Q0DA 1SMYF 3A9CA 4PFPA 1ZW2A 5GPGB 1MNEA 2PX0A 1NBBA 1VOMA 4JZAA 1NLXA 4O7GA 1ST6A 2XL6A 3DAFA 4XPWA 3AGUA 3FOPA 3L8IA 4O6MA 1QQ3A 2OQMA 1CPRA 1BR4A 3C8GD 1OW7A 1BZ4A 2H7OA 3W4YA 2FGYA 4CS8A 1YA9A 3LUTB 1V74B 2V3CC 3FDQA 4CBEA 4CS9C 1VB5A 1L3PA 1G8XA 2PX3A 2Y39A 2A68F 3C8GA 2Y3DA 4PJJA 3K1IC 3EZIA 3GEHA 4XLPF 2G3KA 3G4ZA 3T6JA 2FFHA 1LVKA 2A0BA 2P61A 2XLMA 5E33A 3QW1A 3SP1A 4IJJA 3ZSUA 5HV9A 1RJ9B 5DS4A 1TFKB 1VYIA 2HMZA 2M64A 3S29A 1C03A 5JVEA 5KYXA 1HW2A 3KKBA 1G5ZA 256BA 3C8ZA 4CJGA 1D0XA 2P6VA 3ITFA 4MVMA 4E7ZA 1I4ZA 2ZPAA 2IYLD 3EGDA 5BQGA 3M1CB 2HFIA 4CSAA 3LESA 1FFTC 1FMWA 4CIPA 5IY5C 1Z7Qc 1QKRA 1SZIA 3U3BA 4H4KC 1RKEB 3RYLA 4DJ9A 5L0HA 4OINF 5TJ5E 1GM5A 2AP3A 3L8JA 2R05A 3ABLC 2ICWG 2VCAA 4DVYP 1CGOA 2G3VA 1SYQA 3DD7A 1E84A 4EBJA 3WHNA 1S7ZA 4J7YA 1D0ZA 2M4EA 2RSEB 3B29A 4W8KA 3JCUQ 4BJ5C 2F22A 3K7DA 1I5NA 2R7SA 3IEEA 4EUKB 2IM8A 1T6IA 1OCRC 5L3VA 2CYDA 1WOLA 2YL1A 4BG0A 2AWYA 1M2VB 1VMAA 3C63A 4KNVA 3NKEA 5L0CA 3K1HA 1Y6DA 4I1MA 3RQGA 3Q6NA 3W8IA 4ULWA 3W8HA 2MWQA 4Q4ZF 5CI9A 1QLEC 3AG3C 1AUEA 1WWPA 3GODA 3V7OA 5BQHA 1L7CA 5KYWB 3RH3A 3QZCA 1JAFA 2ASRA 3VYWA 4RD9A 2EINC 4Z9JA 4U5GA 3UMHA 1E85A 3BEHA 3M4CA 5AGFA 4GEHA 4JVSA 2A0UA 1FNTc 3B0PA 3VAYA 1LIHA 5A6KA 2J9UA 5KYUA 1ZZPA 2MYSA 3UGOA 3U3FA 2YLDA 4CDYA 1NG1A 1GGQA 2HMQA 1CGME 2XXAB 2EPLX 1ORYA 2HV7A 2DYRC 3LS0A 2YLIA 3E70C 1HMOA 1ZHTA 4Q7CA 4MW8A 4NTFA 1OQCA 2KQ9A 4JJGA 1PV3A 4CS8C 3I4UA 3AG2C 2OJQA 4HFKB 2CW0F 2R7RA 4MVRA 1Y4CA 1H9TA 2XS1A 1BR1A 3DJUB 3WAQA 4ANJA 1YLMA 3K66A 2OU6A 2YLGA 4U5BE 4QI2A 5BQIA 2HJ3A 1KNYA 1PD0A 3C8GB 3MYFA 3C18A 4BJ1A 1NFNA 2Q9AA 4HFFB 3VM6A 2NSFA 5JLIA 1YJGA 2BC5A 3EFOA 4WABA 3U2LA 1M56C 1Q0GA 4FWVA 4YL3A 4NY3A 1LI5A 1G4US 3QMKA 4BJ6A 3W2WA 4CSAC 2LD6A 2Q7RA 2B0HA 3OWTA 4Z9IA 1OW6A 1YVIA 1E86A 1NSGB 1YZAA 4MTGA 2YRFA 5JSLA 5JRAA 4CX9A 1XZPA 1TWAA 2EPMX 2P0NA 3EGDB 2XRHA 4MNDA 1EKYA 2QNLA 4PJLA 4JCHA 4EHPA 5AC4A 3ABMC 3QVZA 5E2QA 1OCCC 4MVSA 3E9VA 4LDRA 3Q7LA 3ZIBA 5T3TA 1OR2A 4J30B 3QVYA 4PJNA 2XM0A 4N6CA 1OW8A 3CAXA 4O6NA 4AE4A 3B9QA 5EK0A 3R2PA 4U9DA 3SXKA 1IW7F 3FAJA 1T5OA 1WASA 3HJCA 4JRZA 4WJ0A 3JT1A 3ZTMA 4OIQF 3X1OA 3LEOA 1A41A 2QUPA 4JKVA 4U5CE 3AG4C 1TKNA 3DZAA 3U0CA 2EILC 3JYYA 3TD7A 3VRCA 2R7XA 3N0TA 3UR3C 1V4AA 1YDIA 2R03A 2YKZA 3PHF2 1OXKA 1KU2A 2HV6A 2NG1A 2H7BA 3RIPA 3TJ6A 2Y3BA 4F4BA 2XL4A 3KPHA 1K04A 1FAPB 2YEVA 2DYSC 4JTAB 2VCBA 2L6GA 3EHNA 3EQLF 1LE2A 3L34A 2R7VA 5F5FA 2Y3GA 1HE9A 3H2UA 3HTKC 1XWJA 4DOZA 5A69A 5L0FA 1LE4A 2IXMA 4E0HA 1E83A 2R7OA 2Z15A 1V54C 2KSFA 2PNOA 2J7PD 2D5RB 3SZRA 3M15A 2LSEA 4E18A 3ASOC 4YN0B 4BPMA 3NDBB 1BBHA 2XSEA 2L7AA 3JSZA 2J7PA 4OIPF 3EPVA 2NUTA 1R5ID 1M2OA 3HNJA 3O6XA 4CS7A 1H7IA 3O10A 3U5SA 1OXBA 4I1OB 4P9TA 5DQTA 3I5PA 3RQEA 3S9OA 3POVA 2XLHA 2I8BA 4EWCA 2R7WA 4KC9A 3LS1A 5D91A 3S90A 1DOVA 1J8MF 4YWQA 3RVZA 4FX5A 1T01A 4LACB 4M63A 3HKKA 3DI5A 3DE8A 3N24A 2KJGA 4JURI 2L9JA 4U5DE 5F5HA 4K0DA 2LFDA 3O39A 1AEPA 1CPQA 4PFOA 5B3SC 2EPKX 2YWAA 1RCPA 2WZLA 3Q7GA 4IARA 3U2MA 1TR2A 2OEXA 4X0RA 4NQFA 2QE9A 4BJ6C 1GQAA 1OKKA 3ECSA 2A6HF 2JPUA 3EFOB 3DAGA 3KYIA 4G7OF 4MQ9F 4BJTA 2E87A 1JPJA 2VCCA 2ZD9A 1OR3A 2R02A 1SR2A 3CQZA 4G78A 1ZHZA 4YL0A 4IWBA 4MW3A 3T6GB 3UMKA 3NMKA 5HSWA 2ZXRA 4ONSA 1Q0MA 1C17M 1JMWA 4LDQA 1PD1A 2R9RB 1QZXA 1Z3IX 1B68A 4C7OB 2A6EF 2IXPA 4Q5SF 1YZCA 2KNHA 1ORSC 1ZHWA 4I44A 3ZVRA 3H2VA 5JS5A 2Q9CA 1O87A 3FVYA 3U9MA 4AE4B 4RDAA 4DRHB 3ATPA 5DS5A 1RMVA 2UUIA 1U0BB 3F47A 3MLGA 2WZGA 1JR8A 4E17A 5A6JA 2HUJA 4N06A 1QPUA 4K7BA 1FMVA 4MTFA 2XM4A 4UDVA 3U9JA 2HKVA 4CS9A 3H65A 3S27A 1WN0A 3WG7C 4XTKA 3S0XA 2IXOA 3KL4A 1MMAA 2GAQA 3KH2A 3S28A 3T4RA 1E2XA 5KYNA 2XLOA 3LLKA 4JIOA 1LKXA 2CNWD 1BR2A 1C02A 2GDCA 1ZU5A 2IXNA 2V26A 2GWWA 1D0YA 2WZFA 3JRMO 3M4BA 2Q9BA 3NYLA 1RXQA 4MVUA 4EKWA 4IAOA 4H54A 3B0UX 2CNWA 3GEIA 2IBFA 3IQTA 4YT2A 1RKEA 3EGXA 3GWNA 2J0XA 1PCXA 3WODF 2L6FA 1QVXA 2HSBA 2RD9A 5KYXB 2TMVP 2PFDA 2J45A 2R7UA 4G0HA 1TWCA 5F28E 3C62A 1RKCA 2GA0A 1HMDA 2W45A 2PBEA 1YA7O 1ZW3A 2LCHA 4JJFA 4LERA 1S05A 4N4WA 3T9OA 4E0IA 2CCYA 2OCCC 3I5QA 4E7SA 4DBRA 4OIOF 2B0JA 2OOCA 2UUHA 3DWWA 1HY5A 3L0IA 3JTLO 4MVOA 2HJMA 1LS4A 4XPYA 2AU5A 3RVYA 3RQFA 4FAPB 1EI7A 2HZ8A 5B3IA 2H8AA 1MMGA 3NMJA 2ZXPA 2NUTB 2XLDA 3TULA 5T3WA 3VF0A 1R4TA
chains in the Genus database with same CATH topology
1UFBA 3AJMA 2LK4A 3K7DA 4EBKA 2KK1A 1KTMA 4R32A 1K05A 1ZZPA 2JX0A 3U3FA 1WOLA 2YWAA 3GM2A 3U0CA 2L6FA 1QVXA 2HSBA 3JYYA 4NQFA 4XEFA 3RQGA 3BRJA 1OW6A 3L8IA 2JPUA 5F28E 2L6HA 3C8GD 1OW7A 1V4AA 2PBEA 3GM3A 1WWPA 1PV3A 3JZ0A 1WTYA 3L8JA 1O3UA 2Q00A 3C8GA 1JOGA 3MFNA 3O10A 1K04A 1K40A 4XEKA 3RQFA 3RQEA 3S9OA 4EBJA 2L6GA 4XEVA 3GM1A 1OW8A 1KNYA 3C8GB 3TULA 3C18A 3B71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFB A;  3AJM A;  2LK4 A;  3K7D A;  4EBK A;  2KK1 A;  1KTM A;  4R32 A;  1K05 A;  1ZZP A;  2JX0 A;  3U3F A;  1WOL A;  2YWA A;  3GM2 A;  3U0C A;  2L6F A;  1QVX A;  2HSB A;  3JYY A;  4NQF A;  4XEF A;  3RQG A;  3BRJ A;  1OW6 A;  3L8I A;  2JPU A;  5F28 E;  2L6H A;  3C8G D;  1OW7 A;  1V4A A;  2PBE A;  3GM3 A;  1WWP A;  1PV3 A;  3JZ0 A;  1WTY A;  3L8J A;  1O3U A;  2Q00 A;  3C8G A;  1JOG A;  3MFN A;  3O10 A;  1K04 A;  1K40 A;  4XEK A;  3RQF A;  3RQE A;  3S9O A;  4EBJ A;  2L6G A;  4XEV A;  3GM1 A;  1OW8 A;  1KNY A;  3C8G B;  3TUL A;  3C18 A;  3B71 A; 
#chains in the Genus database with same CATH topology
 4NTB A;  4YT5 A;  4R32 A;  2X0C A;  3FMS A;  2KYH A;  2W9Y A;  4YT8 A;  3EG9 A;  2W4M A;  1H6G A;  2FAP B;  2ZXO A;  2X51 A;  4Z9H A;  5DQZ A;  1FFH A;  1VLS A;  1NU9 C;  2KC3 A;  2WVQ A;  4XLN F;  1VYK A;  1HW1 A;  2D4U A;  3AGT A;  3JRT A;  4EIY A;  3CZ6 A;  2A69 F;  3QTH A;  2J46 A;  2YQY A;  4C3B A;  4AK9 A;  2EIK C;  3JZ0 A;  4XWJ A;  1YYJ A;  2BL2 A;  4JTD B;  5E3A A;  2YL0 A;  3G4X A;  5EHH A;  2R7T A;  1M6T A;  3EH1 A;  1LM3 B;  4U5F E;  1ZVZ A;  1Z5Z A;  4KBL A;  3PMR A;  1I4Y A;  2XS8 A;  2WVO A;  1WGW A;  4NTA A;  3T6B A;  4EBB A;  3B0V C;  3RKO F;  4MTO A;  3X2Q C;  5KYY A;  4O6Y A;  4J32 B;  3ZG1 A;  4GYT A;  2VAS A;  2XLW A;  3B71 A;  3UNG C;  1FR0 A;  2Y69 C;  1GS9 A;  1W2W A;  3RFY A;  3US6 A;  5CIV A;  4NC3 A;  2KK1 A;  2PF4 E;  4JCZ A;  1Q0K A;  1K05 A;  4D4N A;  4YL1 A;  1ZHX A;  3HNI A;  1T6Q A;  3AOU A;  3GM2 A;  4O79 A;  3ZC4 A;  1F1M A;  2J9V A;  4BEJ A;  2QTV A;  4AX2 A;  3LAY A;  1M57 C;  2QLA A;  3K33 A;  4QI0 A;  3HNL A;  4U9E A;  5KYU B;  3IQC A;  3G50 A;  3GM3 A;  2AWC A;  1TWH A;  3N2Z B;  2W4B A;  2EPO A;  3Q6M A;  4HEA J;  5E3C A;  3ZDL A;  3FAP B;  1WTY A;  4C3D A;  4JE9 A;  1BDJ B;  2DI3 A;  3DJN B;  4CDA A;  2ZXW C;  4U5E E;  2H7V C;  2NPU A;  3OEO A;  2LQG A;  3ZTZ A;  3V5Y A;  2DB4 A;  1G4W R;  2J9B A;  3J06 A;  3EH2 A;  2OJE D;  4IGG A;  1MMD A;  3CSK A;  2Q4F A;  3R7C A;  1HE1 A;  5COF A;  4AL1 A;  4KI2 A;  4B6I A;  1LPE A;  1D1B A;  2XL8 A;  4ULV A;  4MS2 A;  2GFH A;  1CGN A;  5B1B C;  2PP4 A;  1WAT A;  1OKK D;  3NYM A;  2WL8 A;  3A11 A;  4XPX A;  1NZE A;  5DLJ A;  1OCO C;  1T6U A;  3IHU A;  1N1C A;  2C03 A;  2HSQ A;  3LNR A;  1TFO B;  2CDQ A;  2AVK A;  2R7Q A;  3DM9 B;  4XEF A;  3CEX A;  1MND A;  3ABK C;  3GWL A;  5COG A;  4D4X A;  2VH3 A;  4WGY A;  4OD5 A;  3S84 A;  3OA1 A;  4JTC B;  3EGX B;  4IAQ A;  1IZM A;  5L0D A;  4ER9 A;  2O9X A;  3RW0 A;  5DVW A;  3SNH A;  3K6B A;  3TK0 A;  2EIJ C;  5L0G A;  2J0W A;  2Q00 A;  5L0I A;  2A1D D;  3AG1 C;  1T9K A;  2DGJ A;  2NUP A;  3EZH A;  3FXH A;  4N6H A;  3DXJ F;  4YT4 A;  4KNW A;  3NKD A;  4XEV A;  3GM1 A;  1ZHY A;  1YYX A;  3EJN A;  4I3M A;  4G7H F;  3AQC A;  3EHM A;  1UFB A;  4FES A;  2I15 A;  4JEA A;  1Z6A A;  4L6R A;  4W8P A;  3TQO A;  1A7V A;  3LLI A;  5FZT A;  1KTM A;  1A7E A;  1AVO B;  2J9W A;  1ZU4 A;  2OKU A;  4MVQ A;  2JX0 A;  2LFF A;  1UG7 A;  4WGZ A;  4PJM A;  5D92 A;  4CDV A;  1Z63 A;  1MQV A;  5A6A A;  2WVN A;  3KMI A;  3M79 A;  3JYH A;  3TOL A;  3SYN A;  1SF8 A;  4QDL A;  3JSE O;  1XZQ A;  2KGO A;  4YK5 A;  2L6H A;  2R25 A;  3NRH A;  4A2N B;  4ZLC A;  1YAR O;  2Y3H A;  3EG9 B;  1D1C A;  2YL7 A;  3GEE A;  3PCV A;  4DBQ A;  1DOW A;  3O55 A;  3SXY A;  4BEM J;  4RBN A;  5K0I A;  4PK4 A;  4DXW A;  1U6H A;  1O3U A;  1RJ9 A;  3K1I A;  1JOG A;  3FHD A;  4K1O A;  1EA8 A;  3DM5 A;  1JPN A;  3DMD A;  3MFN A;  4IRU A;  2ETS A;  4XEK A;  2J8W A;  2EPN A;  2P7V A;  1V55 C;  1LI7 A;  1Q0F A;  3UMI A;  3U8V A;  3MYI A;  2JD3 A;  3LNM B;  4JC7 A;  3AJM A;  5BUO A;  3TOM A;  4OIR F;  1MMN A;  3V5Z A;  4DVZ A;  5DS6 A;  1TWG A;  2YL3 A;  3SXZ A;  5KYY B;  2IOQ A;  2C04 A;  2VB6 A;  2HS5 A;  3NG1 A;  4XQ1 A;  4LLC A;  5B1A C;  5FCL A;  4JEB A;  5JT4 A;  2LP4 A;  3IQ5 A;  4P9F A;  1H9G A;  5A6B D;  5JUA A;  3IPM O;  3L1M A;  4LDK A;  3ZQY A;  1A7D A;  4HE8 D;  2YZS A;  3NYJ A;  4LLE A;  5COM A;  4DRJ B;  3HNK A;  2KW3 C;  5AC5 A;  5EGY A;  1QSP A;  3DKA A;  5A6B A;  4C3E A;  5L3Q A;  2LIG A;  2VC9 A;  3KYJ A;  2YVK A;  3LEV A;  3MX3 A;  4A4A A;  2CGE A;  3SEO A;  3SXM A;  1NFO A;  3W2V A;  1K40 A;  2XLV A;  3AQB A;  4J7T A;  3GOR A;  3IQ6 A;  2P1A A;  3C7J A;  4CJO A;  1VLT A;  3UGP A;  4P6I C;  1VTM P;  2Q3T A;  1JRA A;  4BJ5 A;  4DRI B;  4JW1 A;  4IB4 A;  1M2V A;  1FTS A;  3U8P A;  3ASN C;  2EIM C;  4CIH A;  1YAU O;  3QW0 A;  5CI8 A;  3V5X A;  1LS1 A;  4PR9 A;  1APC A;  2MHR A;  2XLE A;  3NMI A;  1U89 A;  5KYW A;  3ZQV A;  1OCZ C;  1Z23 A;  3BRJ A;  2G62 A;  5T1D B;  1EQ1 A;  4NCQ A;  4G7Z F;  4MVZ A;  4PAC A;  1A0B A;  2L81 A;  3F46 A;  1ORJ A;  5L0J A;  3PDM P;  3FOO A;  2OG2 A;  1VK5 A;  1J8Y F;  3ZWI A;  1ZYR F;  4C7O A;  3LJB A;  3DE9 A;  1D1A A;  4U5H A;  4AL0 A;  2OEV A;  4GQH A;  3GAN A;  3HLZ A;  2NSG A;  2QY9 A;  1NU7 D;  2WB7 A;  3MBG A;  1O5H A;  2BE5 F;  3TJ5 A;  4ZLD A;  2YHS A;  4OD4 A;  4YJW A;  5JP7 A;  3RF3 A;  2XXA A;  1TQG A;  2NUP B;  2LK4 A;  4EBK A;  1Q0D A;  1SMY F;  3A9C A;  4PFP A;  1ZW2 A;  5GPG B;  1MNE A;  2PX0 A;  1NBB A;  1VOM A;  4JZA A;  1NLX A;  4O7G A;  1ST6 A;  2XL6 A;  3DAF A;  4XPW A;  3AGU A;  3FOP A;  3L8I A;  4O6M A;  1QQ3 A;  2OQM A;  1CPR A;  1BR4 A;  3C8G D;  1OW7 A;  1BZ4 A;  2H7O A;  3W4Y A;  2FGY A;  4CS8 A;  1YA9 A;  3LUT B;  1V74 B;  2V3C C;  3FDQ A;  4CBE A;  4CS9 C;  1VB5 A;  1L3P A;  1G8X A;  2PX3 A;  2Y39 A;  2A68 F;  3C8G A;  2Y3D A;  4PJJ A;  3K1I C;  3EZI A;  3GEH A;  4XLP F;  2G3K A;  3G4Z A;  3T6J A;  2FFH A;  1LVK A;  2A0B A;  2P61 A;  2XLM A;  5E33 A;  3QW1 A;  3SP1 A;  4IJJ A;  3ZSU A;  5HV9 A;  1RJ9 B;  5DS4 A;  1TFK B;  1VYI A;  2HMZ A;  2M64 A;  3S29 A;  1C03 A;  5JVE A;  5KYX A;  1HW2 A;  3KKB A;  1G5Z A;  256B A;  3C8Z A;  4CJG A;  1D0X A;  2P6V A;  3ITF A;  4MVM A;  4E7Z A;  1I4Z A;  2ZPA A;  2IYL D;  3EGD A;  5BQG A;  3M1C B;  2HFI A;  4CSA A;  3LES A;  1FFT C;  1FMW A;  4CIP A;  5IY5 C;  1Z7Q c;  1QKR A;  1SZI A;  3U3B A;  4H4K C;  1RKE B;  3RYL A;  4DJ9 A;  5L0H A;  4OIN F;  5TJ5 E;  1GM5 A;  2AP3 A;  3L8J A;  2R05 A;  3ABL C;  2ICW G;  2VCA A;  4DVY P;  1CGO A;  2G3V A;  1SYQ A;  3DD7 A;  1E84 A;  4EBJ A;  3WHN A;  1S7Z A;  4J7Y A;  1D0Z A;  2M4E A;  2RSE B;  3B29 A;  4W8K A;  3JCU Q;  4BJ5 C;  2F22 A;  3K7D A;  1I5N A;  2R7S A;  3IEE A;  4EUK B;  2IM8 A;  1T6I A;  1OCR C;  5L3V A;  2CYD A;  1WOL A;  2YL1 A;  4BG0 A;  2AWY A;  1M2V B;  1VMA A;  3C63 A;  4KNV A;  3NKE A;  5L0C A;  3K1H A;  1Y6D A;  4I1M A;  3RQG A;  3Q6N A;  3W8I A;  4ULW A;  3W8H A;  2MWQ A;  4Q4Z F;  5CI9 A;  1QLE C;  3AG3 C;  1AUE A;  1WWP A;  3GOD A;  3V7O A;  5BQH A;  1L7C A;  5KYW B;  3RH3 A;  3QZC A;  1JAF A;  2ASR A;  3VYW A;  4RD9 A;  2EIN C;  4Z9J A;  4U5G A;  3UMH A;  1E85 A;  3BEH A;  3M4C A;  5AGF A;  4GEH A;  4JVS A;  2A0U A;  1FNT c;  3B0P A;  3VAY A;  1LIH A;  5A6K A;  2J9U A;  5KYU A;  1ZZP A;  2MYS A;  3UGO A;  3U3F A;  2YLD A;  4CDY A;  1NG1 A;  1GGQ A;  2HMQ A;  1CGM E;  2XXA B;  2EPL X;  1ORY A;  2HV7 A;  2DYR C;  3LS0 A;  2YLI A;  3E70 C;  1HMO A;  1ZHT A;  4Q7C A;  4MW8 A;  4NTF A;  1OQC A;  2KQ9 A;  4JJG A;  1PV3 A;  4CS8 C;  3I4U A;  3AG2 C;  2OJQ A;  4HFK B;  2CW0 F;  2R7R A;  4MVR A;  1Y4C A;  1H9T A;  2XS1 A;  1BR1 A;  3DJU B;  3WAQ A;  4ANJ A;  1YLM A;  3K66 A;  2OU6 A;  2YLG A;  4U5B E;  4QI2 A;  5BQI A;  2HJ3 A;  1KNY A;  1PD0 A;  3C8G B;  3MYF A;  3C18 A;  4BJ1 A;  1NFN A;  2Q9A A;  4HFF B;  3VM6 A;  2NSF A;  5JLI A;  1YJG A;  2BC5 A;  3EFO A;  4WAB A;  3U2L A;  1M56 C;  1Q0G A;  4FWV A;  4YL3 A;  4NY3 A;  1LI5 A;  1G4U S;  3QMK A;  4BJ6 A;  3W2W A;  4CSA C;  2LD6 A;  2Q7R A;  2B0H A;  3OWT A;  4Z9I A;  1OW6 A;  1YVI A;  1E86 A;  1NSG B;  1YZA A;  4MTG A;  2YRF A;  5JSL A;  5JRA A;  4CX9 A;  1XZP A;  1TWA A;  2EPM X;  2P0N A;  3EGD B;  2XRH A;  4MND A;  1EKY A;  2QNL A;  4PJL A;  4JCH A;  4EHP A;  5AC4 A;  3ABM C;  3QVZ A;  5E2Q A;  1OCC C;  4MVS A;  3E9V A;  4LDR A;  3Q7L A;  3ZIB A;  5T3T A;  1OR2 A;  4J30 B;  3QVY A;  4PJN A;  2XM0 A;  4N6C A;  1OW8 A;  3CAX A;  4O6N A;  4AE4 A;  3B9Q A;  5EK0 A;  3R2P A;  4U9D A;  3SXK A;  1IW7 F;  3FAJ A;  1T5O A;  1WAS A;  3HJC A;  4JRZ A;  4WJ0 A;  3JT1 A;  3ZTM A;  4OIQ F;  3X1O A;  3LEO A;  1A41 A;  2QUP A;  4JKV A;  4U5C E;  3AG4 C;  1TKN A;  3DZA A;  3U0C A;  2EIL C;  3JYY A;  3TD7 A;  3VRC A;  2R7X A;  3N0T A;  3UR3 C;  1V4A A;  1YDI A;  2R03 A;  2YKZ A;  3PHF 2;  1OXK A;  1KU2 A;  2HV6 A;  2NG1 A;  2H7B A;  3RIP A;  3TJ6 A;  2Y3B A;  4F4B A;  2XL4 A;  3KPH A;  1K04 A;  1FAP B;  2YEV A;  2DYS C;  4JTA B;  2VCB A;  2L6G A;  3EHN A;  3EQL F;  1LE2 A;  3L34 A;  2R7V A;  5F5F A;  2Y3G A;  1HE9 A;  3H2U A;  3HTK C;  1XWJ A;  4DOZ A;  5A69 A;  5L0F A;  1LE4 A;  2IXM A;  4E0H A;  1E83 A;  2R7O A;  2Z15 A;  1V54 C;  2KSF A;  2PNO A;  2J7P D;  2D5R B;  3SZR A;  3M15 A;  2LSE A;  4E18 A;  3ASO C;  4YN0 B;  4BPM A;  3NDB B;  1BBH A;  2XSE A;  2L7A A;  3JSZ A;  2J7P A;  4OIP F;  3EPV A;  2NUT A;  1R5I D;  1M2O A;  3HNJ A;  3O6X A;  4CS7 A;  1H7I A;  3O10 A;  3U5S A;  1OXB A;  4I1O B;  4P9T A;  5DQT A;  3I5P A;  3RQE A;  3S9O A;  3POV A;  2XLH A;  2I8B A;  4EWC A;  2R7W A;  4KC9 A;  3LS1 A;  5D91 A;  3S90 A;  1DOV A;  1J8M F;  4YWQ A;  3RVZ A;  4FX5 A;  1T01 A;  4LAC B;  4M63 A;  3HKK A;  3DI5 A;  3DE8 A;  3N24 A;  2KJG A;  4JUR I;  2L9J A;  4U5D E;  5F5H A;  4K0D A;  2LFD A;  3O39 A;  1AEP A;  1CPQ A;  4PFO A;  5B3S C;  2EPK X;  2YWA A;  1RCP A;  2WZL A;  3Q7G A;  4IAR A;  3U2M A;  1TR2 A;  2OEX A;  4X0R A;  4NQF A;  2QE9 A;  4BJ6 C;  1GQA A;  1OKK A;  3ECS A;  2A6H F;  2JPU A;  3EFO B;  3DAG A;  3KYI A;  4G7O F;  4MQ9 F;  4BJT A;  2E87 A;  1JPJ A;  2VCC A;  2ZD9 A;  1OR3 A;  2R02 A;  1SR2 A;  3CQZ A;  4G78 A;  1ZHZ A;  4YL0 A;  4IWB A;  4MW3 A;  3T6G B;  3UMK A;  3NMK A;  5HSW A;  2ZXR A;  4ONS A;  1Q0M A;  1C17 M;  1JMW A;  4LDQ A;  1PD1 A;  2R9R B;  1QZX A;  1Z3I X;  1B68 A;  4C7O B;  2A6E F;  2IXP A;  4Q5S F;  1YZC A;  2KNH A;  1ORS C;  1ZHW A;  4I44 A;  3ZVR A;  3H2V A;  5JS5 A;  2Q9C A;  1O87 A;  3FVY A;  3U9M A;  4AE4 B;  4RDA A;  4DRH B;  3ATP A;  5DS5 A;  1RMV A;  2UUI A;  1U0B B;  3F47 A;  3MLG A;  2WZG A;  1JR8 A;  4E17 A;  5A6J A;  2HUJ A;  4N06 A;  1QPU A;  4K7B A;  1FMV A;  4MTF A;  2XM4 A;  4UDV A;  3U9J A;  2HKV A;  4CS9 A;  3H65 A;  3S27 A;  1WN0 A;  3WG7 C;  4XTK A;  3S0X A;  2IXO A;  3KL4 A;  1MMA A;  2GAQ A;  3KH2 A;  3S28 A;  3T4R A;  1E2X A;  5KYN A;  2XLO A;  3LLK A;  4JIO A;  1LKX A;  2CNW D;  1BR2 A;  1C02 A;  2GDC A;  1ZU5 A;  2IXN A;  2V26 A;  2GWW A;  1D0Y A;  2WZF A;  3JRM O;  3M4B A;  2Q9B A;  3NYL A;  1RXQ A;  4MVU A;  4EKW A;  4IAO A;  4H54 A;  3B0U X;  2CNW A;  3GEI A;  2IBF A;  3IQT A;  4YT2 A;  1RKE A;  3EGX A;  3GWN A;  2J0X A;  1PCX A;  3WOD F;  2L6F A;  1QVX A;  2HSB A;  2RD9 A;  5KYX B;  2TMV P;  2PFD A;  2J45 A;  2R7U A;  4G0H A;  1TWC A;  5F28 E;  3C62 A;  1RKC A;  2GA0 A;  1HMD A;  2W45 A;  2PBE A;  1YA7 O;  1ZW3 A;  2LCH A;  4JJF A;  4LER A;  1S05 A;  4N4W A;  3T9O A;  4E0I A;  2CCY A;  2OCC C;  3I5Q A;  4E7S A;  4DBR A;  4OIO F;  2B0J A;  2OOC A;  2UUH A;  3DWW A;  1HY5 A;  3L0I A;  3JTL O;  4MVO A;  2HJM A;  1LS4 A;  4XPY A;  2AU5 A;  3RVY A;  3RQF A;  4FAP B;  1EI7 A;  2HZ8 A;  5B3I A;  2H8A A;  1MMG A;  3NMJ A;  2ZXP A;  2NUT B;  2XLD A;  3TUL A;  5T3W A;  3VF0 A;  1R4T A; 
#chains in the Genus database with same CATH homology
 1UFB A;  3AJM A;  2LK4 A;  3K7D A;  4EBK A;  2KK1 A;  1KTM A;  4R32 A;  1K05 A;  1ZZP A;  2JX0 A;  3U3F A;  1WOL A;  2YWA A;  3GM2 A;  3U0C A;  2L6F A;  1QVX A;  2HSB A;  3JYY A;  4NQF A;  4XEF A;  3RQG A;  3BRJ A;  1OW6 A;  3L8I A;  2JPU A;  5F28 E;  2L6H A;  3C8G D;  1OW7 A;  1V4A A;  2PBE A;  3GM3 A;  1WWP A;  1PV3 A;  3JZ0 A;  1WTY A;  3L8J A;  1O3U A;  2Q00 A;  3C8G A;  1JOG A;  3MFN A;  3O10 A;  1K04 A;  1K40 A;  4XEK A;  3RQF A;  3RQE A;  3S9O A;  4EBJ A;  2L6G A;  4XEV A;  3GM1 A;  1OW8 A;  1KNY A;  3C8G B;  3TUL A;  3C18 A;  3B71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...