3O10A

Crystal structure of the hepn domain from human sacsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
b'GSVGNPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKLENFMQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sacsin
publication title Structural basis of defects in the sacsin HEPN domain responsible for autosomal recessive spastic ataxia of Charlevoix-Saguenay (ARSACS).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 53
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3o10A00
4XEVA 1PV3A 3JYYA 2L6FA 3U0CA 1K05A 4EBJA 3K7DA 2L6GA 3B71A 3C8GB 3C8GA 4NQFA 3RQGA 3RQFA 2LK4A 3S9OA 4R32A 1K40A 1WTYA 2YWAA 3U3FA 5F28E 3AJMA 3C18A 3GM3A 3O10A 4XEKA 2JPUA 1ZZPA 3GM2A 1JOGA 1O3UA 2HSBA 3GM1A 3L8IA 1KNYA 3TULA 1KTMA 2Q00A 2KK1A 2L6HA 1OW6A 1WOLA 4XEFA 1OW7A 1V4AA 2PBEA 3C8GD 1K04A 1OW8A 1UFBA 3JZ0A 3MFNA 1WWPA 3BRJA 4EBKA 3L8JA 3RQEA 2JX0A 1QVXA
chains in the Genus database with same CATH superfamily
1A7VA 3B0UX 3EGXB 1MMAA 2GDCA 1IZMA 1MMGA 3U5SA 3DE8A 3KMIA 4P6IC 4PK4A 4ULWA 3AGUA 3JSZA 2YLIA 2DB4A 1YLMA 2XS1A 4YJWA 4EIYA 2H7BA 4DRIB 3K6BA 1YVIA 2P1AA 1OCCC 4FWVA 3U3FA 3MYIA 5AC5A 3GM2A 2YZSA 4X0RA 1TWGA 4H54A 4O6YA 3TOMA 5A6BA 3C8ZA 4RD9A 2ZXWC 2A68F 4IJJA 4U5GA 1EA8A 3HNIA 3UMKA 2YL0A 4K0DA 2WL8A 2LFFA 1L3PA 2FAPB 3EG9A 1NFOA 2EILC 1A7DA 1BZ4A 1LS4A 2J0WA 2KGOA 2OQMA 3LEOA 5F5HA 3AG4C 3S84A 4BEJA 3A11A 1QVXA 5KYWA 4D4NA 5L0FA 2L6FA 4U5BE 3VRCA 4B6IA 3TK0A 1LKXA 2B0JA 3IHUA 3JT1A 1Y6DA 3S0XA 3FAPB 4OIPF 1WATA 3LLKA 4IGGA 1T6IA 4U9DA 3UR3C 2A69F 2YL3A 5F28E 5KYUA 3V5YA 2QE9A 3IQ5A 3RIPA 1A7EA 2YL7A 3TJ5A 2YL1A 4FX5A 2RD9A 4U5EE 5A6AA 2MHRA 2L7AA 4AX2A 2NUTB 2P0NA 2R7UA 4NCQA 4CDVA 1EKYA 4OIRF 5BQIA 1V4AA 4L6RA 1OW8A 2WB7A 3BRJA 4JZAA 2IM8A 2IXNA 3SXYA 4YT8A 5A6KA 1ZU5A 1ZVZA 3ITFA 1FMWA 2R02A 1Q0DA 2XL6A 3MX3A 2AU5A 4CJGA 2CGEA 1CGNA 3ASOC 1O5HA 1NU7D 2ZXPA 3CSKA 4I1MA 1Z5ZA 4XPXA 3M1CB 3CEXA 3UMHA 3GEIA 4OD5A 2LSEA 1WASA 1Q0GA 1OXBA 4XWJA 4FAPB 5A69A 2ZD9A 4N4WA 4UDVA 5DS4A 4PJLA 1K40A 2XSEA 2YKZA 4O79A 1YZCA 5DQTA 3ASNC 3EGDA 1OKKD 1YA9A 4KI2A 2R7TA 3T4RA 3V5ZA 2Y3DA 3UMIA 4IARA 2RSEB 3HNJA 1YARO 2E87A 2ZXRA 2HS5A 2LP4A 1OR3A 3UGPA 3G4ZA 4JC7A 1JPJA 2I15A 2PNOA 4FESA 3DJUB 3M15A 3X1OA 4LACB 2KSFA 4U9EA 1OCZC 3NMIA 4U5HA 3IPMO 4XEVA 2YEVA 3NYJA 3JRTA 3V7OA 4XLPF 3NMJA 2Y3HA 3EHMA 2C04A 4I1OB 3I5QA 4RBNA 3M4CA 4EBBA 4XPWA 1YZAA 1J8YF 4R32A 2C03A 2V3CC 1CPRA 2WVOA 2Q9BA 2OJQA 2H8AA 4JVSA 1HY5A 1Z23A 1NU9C 1NZEA 1RJ9A 2A6EF 3N24A 2Q7RA 3TJ6A 5JVEA 4XPYA 4MNDA 3LLIA 5TJ5E 5DS5A 1HMOA 1ZHWA 3LS0A 5B1AC 4AL0A 3BEHA 1C02A 4Z9HA 3OEOA 5JP7A 5DS6A 4PJJA 2YLDA 3JCUQ 4EHPA 5HV9A 2F22A 3EG9B 1Z63A 4YL3A 1UFBA 4DBRA 3AQBA 3W8IA 1EQ1A 3S90A 1VB5A 1DOWA 3PDMP 2FFHA 3B0VC 1WN0A 2HV6A 2R9RB 3JYYA 1D1CA 4QI2A 1A41A 3FAJA 1E83A 5JUAA 3QVYA 1JPNA 2PFDA 2R25A 3AG2C 3JTLO 4GEHA 3ABKC 4NTBA 3RQGA 5EHHA 2EINC 2KC3A 2LK4A 4C3BA 4CS7A 4CX9A 5BQGA 2J7PA 5L0GA 2VCAA 4BJ1A 3VF0A 4JCHA 1H7IA 3IEEA 4JIOA 3NDBB 1YAUO 4Z9IA 3RFYA 1V74B 5COGA 3S28A 5JLIA 4ANJA 1NBBA 1TWAA 2HSBA 2J9BA 3ZWIA 3UGOA 5L0HA 3HTKC 2AWYA 3B0PA 3VM6A 5T3TA 1TQGA 2L81A 5L0CA 1FFHA 4LERA 3DE9A 3RQEA 1ST6A 2R7RA 1QQ3A 1Q0KA 3FMSA 1UG7A 3GORA 3GANA 4JE9A 4AK9A 4ULVA 2GFHA 2CNWA 3FOPA 4J32B 5AGFA 2CW0F 3OA1A 4CDAA 5JT4A 2Z15A 3RQFA 2QNLA 3N2ZB 1SMYF 1D0ZA 3I5PA 3UNGC 2P6VA 1BBHA 3GEEA 2WZLA 2XS8A 1G8XA 2LD6A 4XTKA 3F47A 3G50A 3U8PA 4O7GA 5AC4A 3U2MA 1LE4A 5IY5C 1JMWA 2QTVA 2WZGA 2Y69C 3RH3A 1HW1A 1NLXA 3KYIA 4MW8A 2XM0A 5T3WA 3L8JA 2G62A 1LE2A 4GQHA 5CI9A 2H7OA 2OU6A 1LVKA 1SF8A 2Q4FA 1RKEA 1YJGA 1W2WA 2XLMA 3L0IA 1H9GA 1APCA 1ZHZA 3EHNA 4YT4A 3C8GB 3WHNA 3DWWA 2A0BA 2B0HA 2XL4A 5COMA 4JEAA 4BJ5C 2WZFA 1PCXA 4MTFA 4BJ6A 3PHF2 2TMVP 4G0HA 2GAQA 3X2QC 4JW1A 3O39A 4MVUA 1NG1A 2ZXOA 2EIKC 2UUIA 3O6XA 1KU2A 3FXHA 3GEHA 1N1CA 1D0XA 3LEVA 3FDQA 1IW7F 2EPMX 3LNMB 3ZSUA 3B29A 3RW0A 3K1HA 2CDQA 2JX0A 4P9FA 5JS5A 3H2UA 4OD4A 1C17M 2WVNA 2J0XA 2A6HF 2XM4A 3K1IC 4K7BA 1GM5A 1WGWA 4CJOA 1M2VB 2R03A 3U2LA 3L34A 3ZVRA 4JEBA 4HE8D 3E9VA 4KNVA 3ZTMA 1U6HA 1H9TA 4DBQA 3O55A 4JURI 3OWTA 5FZTA 3LUTB 4E17A 4OIQF 2BC5A 1BR4A 5DVWA 3B9QA 3ZC4A 1I4ZA 2HJMA 3F46A 3PCVA 5HSWA 1TFKB 1JR8A 2J9UA 2KW3C 3QTHA 1OW6A 2AP3A 2Q9AA 1DOVA 3DI5A 4E18A 3C8GD 2R05A 2LQGA 4JJFA 1V54C 1R4TA 4WGYA 4CS8A 2J9WA 4D4XA 2IXOA 4CIPA 2IOQA 2LFDA 4JTCB 2YRFA 5E3CA 4P9TA 5L0JA 4JCZA 2YHSA 1OCRC 2YLGA 2W9YA 3JRMO 1GQAA 4BJ5A 2BL2A 3DM9B 3B71A 4E7SA 5FCLA 2NSGA 1M6TA 1QSPA 1T6QA 3W2VA 2EPKX 3RYLA 3H2VA 4MTOA 1YYJA 3SNHA 1G4US 5B3IA 3TQOA 5BQHA 1WTYA 2YWAA 1FR0A 4J7YA 1Q0MA 2HFIA 3C18A 4ONSA 3LNRA 2OCCC 1GS9A 2BE5F 2IBFA 1RCPA 4YT2A 4PFPA 3GM1A 3W2WA 3MYFA 3T6JA 1JAFA 3AOUA 1MMDA 1RMVA 1WOLA 4IB4A 2EIJC 1QZXA 2Y3GA 3ATPA 3E70C 3SEOA 1WWPA 4E0HA 1VK5A 3AG3C 3K1IA 1OKKA 4J7TA 4MTGA 1T9KA 1E86A 1Q0FA 2J45A 4G78A 4MVQA 5E33A 3ECSA 5B1BC 5KYWB 1YDIA 4CSAC 4JJGA 2X51A 4CS9C 3Q7LA 3VYWA 4MVZA 2Y3BA 4DVYP 2CYDA 2LIGA 1YYXA 3EZIA 3HNKA 3LS1A 1BR2A 3N0TA 2FGYA 3M79A 4KBLA 3R2PA 4NY3A 4W8PA 3TOLA 3U9MA 4MW3A 3DMDA 2R7WA 2JD3A 3GODA 5KYUB 3DKAA 1B68A 2HJ3A 4IAOA 3U8VA 3ZIBA 4G7HF 2M4EA 1JOGA 3DJNB 5L3VA 3C63A 4BJ6C 4C7OA 3RVYA 1RXQA 2W4BA 4U5DE 4N6CA 4W8KA 5EK0A 2L6HA 3TD7A 1HMDA 256BA 4DOZA 1Z6AA 5KYNA 2HV7A 1LI5A 5K0IA 2ICWG 4CDYA 4NC3A 4JKVA 4ER9A 1QPUA 5D92A 3WODF 2VCBA 1MMNA 2W45A 3U0CA 1E85A 2EPOA 4E7ZA 3K7DA 1AVOB 3KL4A 2L6GA 3T9OA 2CCYA 1E84A 2GA0A 4NQFA 3NRHA 5A6BD 1ZW2A 5L0IA 3KYJA 3S9OA 2OEXA 2HSQA 1XZQA 3VAYA 2VC9A 1XZPA 3LAYA 4Q7CA 3EGDB 4LDKA 4DVZA 3DAFA 3GM3A 4ZLDA 3ZTZA 4I3MA 4KNWA 5EGYA 1NSGB 3I4UA 1KTMA 1HE1A 5KYXA 4MVSA 4CIHA 4H4KC 3HNLA 4WGZA 4N06A 4YN0B 4NTAA 1L7CA 2VH3A 4U5FE 4YL1A 3AGTA 4BJTA 5L0DA 4CSAA 1TFOB 3NG1A 4PR9A 4K1OA 4CS9A 4F4BA 5KYYA 1TWHA 2PX0A 2YQYA 3PMRA 4MVOA 1ORJA 1MNEA 3Q6NA 3EFOA 3KH2A 4LLEA 4O6NA 3SXKA 3SXMA 2O9XA 4Q5SF 4CS8C 3W8HA 4C3DA 1M2OA 1AEPA 1SR2A 1LIHA 3SP1A 4AE4A 2VCCA 2J9VA 4BG0A 4EWCA 2IYLD 1CGME 1ZHTA 3IQCA 3DXJF 1JRAA 1TR2A 1GGQA 2HZ8A 2VASA 2DI3A 3QMKA 4QI0A 1D1BA 4ZLCA 3O10A 1RJ9B 1V55C 1RKCA 4XLNF 1ZZPA 4GYTA 1ZU4A 2DGJA 5JSLA 3NMKA 3TULA 3IQTA 3LESA 4LLCA 5L3QA 2XL8A 3AQCA 1SYQA 1PD1A 3JYHA 4LDRA 1Z3IX 3US6A 4XEFA 2IXPA 1FMVA 3ZDLA 4Q4ZF 1U0BB 1PD0A 1ORYA 3K66A 1ZW3A 2J46A 4EBKA 1Z7Qc 3CZ6A 2L9JA 3GWLA 3QZCA 4IWBA 4BEMJ 3POVA 2R7XA 3C62A 4XQ1A 4DRJB 3U9JA 4WABA 2XXAA 3LJBA 3FVYA 2WVQA 4DJ9A 3HKKA 1F1MA 4EBJA 1H6GA 1ZYRF 4DXWA 2XLVA 3EH1A 3RF3A 2R7OA 2M64A 2NUPA 3AG1C 3CAXA 2ZPAA 3RVZA 4OIOF 3J06A 1E2XA 1VYIA 4XEKA 2JPUA 3QW0A 1ZHYA 4A2NB 4AL1A 4C7OB 5JRAA 3FOOA 2HUJA 4M63A 4YWQA 2P7VA 4G7ZF 2Q00A 1FTSA 2EIMC 3EZHA 3JSEO 2KYHA 4PFOA 2OJED 1OXKA 2NPUA 1K04A 4DRHB 3MFNA 3ABLC 2HMQA 3SXZA 1FNTc 3SZRA 2IXMA 2AVKA 2R7QA 1XWJA 1O87A 4YL0A 2OOCA 1MQVA 1AUEA 2QLAA 3L1MA 2ETSA 1K05A 2QUPA 3T6GB 3ZQYA 1S7ZA 2AWCA 3EPVA 3EGXA 2YVKA 2D4UA 2H7VC 2P61A 2EPNA 3U3BA 2I8BA 3QVZA 3T6BA 5DQZA 5CIVA 1LS1A 2G3KA 2KNHA 3KKBA 4MQ9F 4QDLA 5COFA 4YT5A 1VTMP 2OKUA 1FFTC 3MBGA 1I4YA 1R5ID 4YK5A 5KYXB 3EH2A 4PJNA 2LCHA 2V26A 1VMAA 1YA7O 2MWQA 3KPHA 1BDJB 3GWNA 3NKDA 1Y4CA 4O6MA 2PBEA 5T1DB 2PP4A 5KYYB 2A1DD 2KJGA 4I44A 3W4YA 3EJNA 3ZQVA 3EFOB 3H65A 2J7PD 2PX3A 3FHDA 3DAGA 4LDQA 1RKEB 3S29A 1VLSA 1PV3A 2EPLX 3G4XA 3Q6MA 4AE4B 4NTFA 1G5ZA 1VOMA 3ZG1A 3C8GA 5E3AA 2ASRA 1CGOA 5A6JA 1EI7A 1TWCA 2Q9CA 1T01A 2Q3TA 4JTAB 4KC9A 3NYMA 1ORSC 2J8WA 4J30B 4HFFB 3SYNA 2A0UA 2QY9A 3AJMA 4HFKB 5DLJA 2NG1A 5F5FA 2W4MA 1I5NA 1VYKA 3R7CA 1SZIA 1U89A 1O3UA 1BR1A 2HKVA 2MYSA 2UUHA 3C7JA 2KQ9A 4MS2A 5E2QA 4OINF 1OCOC 2OEVA 2CNWD 3ABMC 2KK1A 1G4WR 3S27A 4WJ0A 2NUTA 4EKWA 4MVRA 1OW7A 3WG7C 1TKNA 1CPQA 3JZ0A 1FAPB 1T6UA 1HE9A 2DYRC 1OR2A 3WAQA 4G7OF 2R7SA 3DD7A 3DM5A 4BPMA 2XXAB 3A9CA 4EUKB 1D1AA 1LPEA 2R7VA 4Z9JA 1NFNA 2X0CA 3DZAA 3Q7GA 5CI8A 1M2VA 2D5RB 1LM3B 3CQZA 1OQCA 2NUPB 2XLHA 3MLGA 3NYLA 4N6HA 4C3EA 3HJCA 5B3SC 4JRZA 2XLEA 4CBEA 1VLTA 1J8MF 5D91A 1D0YA 4RDAA 4A4AA 4IAQA 4IRUA 2HMZA 3RKOF 2DYSC 1LI7A 2XLDA 4HEAJ 1M57C 4PACA 1A0BA 2XLWA 1KNYA 1MNDA 2XRHA 2PF4E 2VB6A 3EQLF 2XLOA 3L8IA 1T5OA 2Y39A 4MVMA 4U5CE 4E0IA 5GPGB 4PJMA 1QLEC 2OG2A 2G3VA 3HLZA 2NSFA 3IQ6A 3K33A 1C03A 1ZHXA 3NKEA 3M4BA 1M56C 3QW1A 3V5XA 1HW2A 4JTDB 1QKRA 2GWWA 5BUOA 1S05A
chains in the Genus database with same CATH topology
4XEVA 1PV3A 3JYYA 2L6FA 3U0CA 1K05A 4EBJA 3K7DA 2L6GA 3B71A 3C8GB 3C8GA 4NQFA 3RQGA 3RQFA 2LK4A 3S9OA 4R32A 1K40A 1WTYA 2YWAA 3U3FA 5F28E 3AJMA 3C18A 3GM3A 3O10A 4XEKA 2JPUA 1ZZPA 3GM2A 1JOGA 1O3UA 2HSBA 3GM1A 3L8IA 1KNYA 3TULA 1KTMA 2Q00A 2KK1A 2L6HA 1OW6A 1WOLA 4XEFA 1OW7A 1V4AA 2PBEA 3C8GD 1K04A 1OW8A 1UFBA 3JZ0A 3MFNA 1WWPA 3BRJA 4EBKA 3L8JA 3RQEA 2JX0A 1QVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEV A;  1PV3 A;  3JYY A;  2L6F A;  3U0C A;  1K05 A;  4EBJ A;  3K7D A;  2L6G A;  3B71 A;  3C8G B;  3C8G A;  4NQF A;  3RQG A;  3RQF A;  2LK4 A;  3S9O A;  4R32 A;  1K40 A;  1WTY A;  2YWA A;  3U3F A;  5F28 E;  3AJM A;  3C18 A;  3GM3 A;  3O10 A;  4XEK A;  2JPU A;  1ZZP A;  3GM2 A;  1JOG A;  1O3U A;  2HSB A;  3GM1 A;  3L8I A;  1KNY A;  3TUL A;  1KTM A;  2Q00 A;  2KK1 A;  2L6H A;  1OW6 A;  1WOL A;  4XEF A;  1OW7 A;  1V4A A;  2PBE A;  3C8G D;  1K04 A;  1OW8 A;  1UFB A;  3JZ0 A;  3MFN A;  1WWP A;  3BRJ A;  4EBK A;  3L8J A;  3RQE A;  2JX0 A;  1QVX A; 
#chains in the Genus database with same CATH topology
 1A7V A;  3B0U X;  3EGX B;  1MMA A;  2GDC A;  1IZM A;  1MMG A;  3U5S A;  3DE8 A;  3KMI A;  4P6I C;  4PK4 A;  4ULW A;  3AGU A;  3JSZ A;  2YLI A;  2DB4 A;  1YLM A;  2XS1 A;  4YJW A;  4EIY A;  2H7B A;  4DRI B;  3K6B A;  1YVI A;  2P1A A;  1OCC C;  4FWV A;  3U3F A;  3MYI A;  5AC5 A;  3GM2 A;  2YZS A;  4X0R A;  1TWG A;  4H54 A;  4O6Y A;  3TOM A;  5A6B A;  3C8Z A;  4RD9 A;  2ZXW C;  2A68 F;  4IJJ A;  4U5G A;  1EA8 A;  3HNI A;  3UMK A;  2YL0 A;  4K0D A;  2WL8 A;  2LFF A;  1L3P A;  2FAP B;  3EG9 A;  1NFO A;  2EIL C;  1A7D A;  1BZ4 A;  1LS4 A;  2J0W A;  2KGO A;  2OQM A;  3LEO A;  5F5H A;  3AG4 C;  3S84 A;  4BEJ A;  3A11 A;  1QVX A;  5KYW A;  4D4N A;  5L0F A;  2L6F A;  4U5B E;  3VRC A;  4B6I A;  3TK0 A;  1LKX A;  2B0J A;  3IHU A;  3JT1 A;  1Y6D A;  3S0X A;  3FAP B;  4OIP F;  1WAT A;  3LLK A;  4IGG A;  1T6I A;  4U9D A;  3UR3 C;  2A69 F;  2YL3 A;  5F28 E;  5KYU A;  3V5Y A;  2QE9 A;  3IQ5 A;  3RIP A;  1A7E A;  2YL7 A;  3TJ5 A;  2YL1 A;  4FX5 A;  2RD9 A;  4U5E E;  5A6A A;  2MHR A;  2L7A A;  4AX2 A;  2NUT B;  2P0N A;  2R7U A;  4NCQ A;  4CDV A;  1EKY A;  4OIR F;  5BQI A;  1V4A A;  4L6R A;  1OW8 A;  2WB7 A;  3BRJ A;  4JZA A;  2IM8 A;  2IXN A;  3SXY A;  4YT8 A;  5A6K A;  1ZU5 A;  1ZVZ A;  3ITF A;  1FMW A;  2R02 A;  1Q0D A;  2XL6 A;  3MX3 A;  2AU5 A;  4CJG A;  2CGE A;  1CGN A;  3ASO C;  1O5H A;  1NU7 D;  2ZXP A;  3CSK A;  4I1M A;  1Z5Z A;  4XPX A;  3M1C B;  3CEX A;  3UMH A;  3GEI A;  4OD5 A;  2LSE A;  1WAS A;  1Q0G A;  1OXB A;  4XWJ A;  4FAP B;  5A69 A;  2ZD9 A;  4N4W A;  4UDV A;  5DS4 A;  4PJL A;  1K40 A;  2XSE A;  2YKZ A;  4O79 A;  1YZC A;  5DQT A;  3ASN C;  3EGD A;  1OKK D;  1YA9 A;  4KI2 A;  2R7T A;  3T4R A;  3V5Z A;  2Y3D A;  3UMI A;  4IAR A;  2RSE B;  3HNJ A;  1YAR O;  2E87 A;  2ZXR A;  2HS5 A;  2LP4 A;  1OR3 A;  3UGP A;  3G4Z A;  4JC7 A;  1JPJ A;  2I15 A;  2PNO A;  4FES A;  3DJU B;  3M15 A;  3X1O A;  4LAC B;  2KSF A;  4U9E A;  1OCZ C;  3NMI A;  4U5H A;  3IPM O;  4XEV A;  2YEV A;  3NYJ A;  3JRT A;  3V7O A;  4XLP F;  3NMJ A;  2Y3H A;  3EHM A;  2C04 A;  4I1O B;  3I5Q A;  4RBN A;  3M4C A;  4EBB A;  4XPW A;  1YZA A;  1J8Y F;  4R32 A;  2C03 A;  2V3C C;  1CPR A;  2WVO A;  2Q9B A;  2OJQ A;  2H8A A;  4JVS A;  1HY5 A;  1Z23 A;  1NU9 C;  1NZE A;  1RJ9 A;  2A6E F;  3N24 A;  2Q7R A;  3TJ6 A;  5JVE A;  4XPY A;  4MND A;  3LLI A;  5TJ5 E;  5DS5 A;  1HMO A;  1ZHW A;  3LS0 A;  5B1A C;  4AL0 A;  3BEH A;  1C02 A;  4Z9H A;  3OEO A;  5JP7 A;  5DS6 A;  4PJJ A;  2YLD A;  3JCU Q;  4EHP A;  5HV9 A;  2F22 A;  3EG9 B;  1Z63 A;  4YL3 A;  1UFB A;  4DBR A;  3AQB A;  3W8I A;  1EQ1 A;  3S90 A;  1VB5 A;  1DOW A;  3PDM P;  2FFH A;  3B0V C;  1WN0 A;  2HV6 A;  2R9R B;  3JYY A;  1D1C A;  4QI2 A;  1A41 A;  3FAJ A;  1E83 A;  5JUA A;  3QVY A;  1JPN A;  2PFD A;  2R25 A;  3AG2 C;  3JTL O;  4GEH A;  3ABK C;  4NTB A;  3RQG A;  5EHH A;  2EIN C;  2KC3 A;  2LK4 A;  4C3B A;  4CS7 A;  4CX9 A;  5BQG A;  2J7P A;  5L0G A;  2VCA A;  4BJ1 A;  3VF0 A;  4JCH A;  1H7I A;  3IEE A;  4JIO A;  3NDB B;  1YAU O;  4Z9I A;  3RFY A;  1V74 B;  5COG A;  3S28 A;  5JLI A;  4ANJ A;  1NBB A;  1TWA A;  2HSB A;  2J9B A;  3ZWI A;  3UGO A;  5L0H A;  3HTK C;  2AWY A;  3B0P A;  3VM6 A;  5T3T A;  1TQG A;  2L81 A;  5L0C A;  1FFH A;  4LER A;  3DE9 A;  3RQE A;  1ST6 A;  2R7R A;  1QQ3 A;  1Q0K A;  3FMS A;  1UG7 A;  3GOR A;  3GAN A;  4JE9 A;  4AK9 A;  4ULV A;  2GFH A;  2CNW A;  3FOP A;  4J32 B;  5AGF A;  2CW0 F;  3OA1 A;  4CDA A;  5JT4 A;  2Z15 A;  3RQF A;  2QNL A;  3N2Z B;  1SMY F;  1D0Z A;  3I5P A;  3UNG C;  2P6V A;  1BBH A;  3GEE A;  2WZL A;  2XS8 A;  1G8X A;  2LD6 A;  4XTK A;  3F47 A;  3G50 A;  3U8P A;  4O7G A;  5AC4 A;  3U2M A;  1LE4 A;  5IY5 C;  1JMW A;  2QTV A;  2WZG A;  2Y69 C;  3RH3 A;  1HW1 A;  1NLX A;  3KYI A;  4MW8 A;  2XM0 A;  5T3W A;  3L8J A;  2G62 A;  1LE2 A;  4GQH A;  5CI9 A;  2H7O A;  2OU6 A;  1LVK A;  1SF8 A;  2Q4F A;  1RKE A;  1YJG A;  1W2W A;  2XLM A;  3L0I A;  1H9G A;  1APC A;  1ZHZ A;  3EHN A;  4YT4 A;  3C8G B;  3WHN A;  3DWW A;  2A0B A;  2B0H A;  2XL4 A;  5COM A;  4JEA A;  4BJ5 C;  2WZF A;  1PCX A;  4MTF A;  4BJ6 A;  3PHF 2;  2TMV P;  4G0H A;  2GAQ A;  3X2Q C;  4JW1 A;  3O39 A;  4MVU A;  1NG1 A;  2ZXO A;  2EIK C;  2UUI A;  3O6X A;  1KU2 A;  3FXH A;  3GEH A;  1N1C A;  1D0X A;  3LEV A;  3FDQ A;  1IW7 F;  2EPM X;  3LNM B;  3ZSU A;  3B29 A;  3RW0 A;  3K1H A;  2CDQ A;  2JX0 A;  4P9F A;  5JS5 A;  3H2U A;  4OD4 A;  1C17 M;  2WVN A;  2J0X A;  2A6H F;  2XM4 A;  3K1I C;  4K7B A;  1GM5 A;  1WGW A;  4CJO A;  1M2V B;  2R03 A;  3U2L A;  3L34 A;  3ZVR A;  4JEB A;  4HE8 D;  3E9V A;  4KNV A;  3ZTM A;  1U6H A;  1H9T A;  4DBQ A;  3O55 A;  4JUR I;  3OWT A;  5FZT A;  3LUT B;  4E17 A;  4OIQ F;  2BC5 A;  1BR4 A;  5DVW A;  3B9Q A;  3ZC4 A;  1I4Z A;  2HJM A;  3F46 A;  3PCV A;  5HSW A;  1TFK B;  1JR8 A;  2J9U A;  2KW3 C;  3QTH A;  1OW6 A;  2AP3 A;  2Q9A A;  1DOV A;  3DI5 A;  4E18 A;  3C8G D;  2R05 A;  2LQG A;  4JJF A;  1V54 C;  1R4T A;  4WGY A;  4CS8 A;  2J9W A;  4D4X A;  2IXO A;  4CIP A;  2IOQ A;  2LFD A;  4JTC B;  2YRF A;  5E3C A;  4P9T A;  5L0J A;  4JCZ A;  2YHS A;  1OCR C;  2YLG A;  2W9Y A;  3JRM O;  1GQA A;  4BJ5 A;  2BL2 A;  3DM9 B;  3B71 A;  4E7S A;  5FCL A;  2NSG A;  1M6T A;  1QSP A;  1T6Q A;  3W2V A;  2EPK X;  3RYL A;  3H2V A;  4MTO A;  1YYJ A;  3SNH A;  1G4U S;  5B3I A;  3TQO A;  5BQH A;  1WTY A;  2YWA A;  1FR0 A;  4J7Y A;  1Q0M A;  2HFI A;  3C18 A;  4ONS A;  3LNR A;  2OCC C;  1GS9 A;  2BE5 F;  2IBF A;  1RCP A;  4YT2 A;  4PFP A;  3GM1 A;  3W2W A;  3MYF A;  3T6J A;  1JAF A;  3AOU A;  1MMD A;  1RMV A;  1WOL A;  4IB4 A;  2EIJ C;  1QZX A;  2Y3G A;  3ATP A;  3E70 C;  3SEO A;  1WWP A;  4E0H A;  1VK5 A;  3AG3 C;  3K1I A;  1OKK A;  4J7T A;  4MTG A;  1T9K A;  1E86 A;  1Q0F A;  2J45 A;  4G78 A;  4MVQ A;  5E33 A;  3ECS A;  5B1B C;  5KYW B;  1YDI A;  4CSA C;  4JJG A;  2X51 A;  4CS9 C;  3Q7L A;  3VYW A;  4MVZ A;  2Y3B A;  4DVY P;  2CYD A;  2LIG A;  1YYX A;  3EZI A;  3HNK A;  3LS1 A;  1BR2 A;  3N0T A;  2FGY A;  3M79 A;  4KBL A;  3R2P A;  4NY3 A;  4W8P A;  3TOL A;  3U9M A;  4MW3 A;  3DMD A;  2R7W A;  2JD3 A;  3GOD A;  5KYU B;  3DKA A;  1B68 A;  2HJ3 A;  4IAO A;  3U8V A;  3ZIB A;  4G7H F;  2M4E A;  1JOG A;  3DJN B;  5L3V A;  3C63 A;  4BJ6 C;  4C7O A;  3RVY A;  1RXQ A;  2W4B A;  4U5D E;  4N6C A;  4W8K A;  5EK0 A;  2L6H A;  3TD7 A;  1HMD A;  256B A;  4DOZ A;  1Z6A A;  5KYN A;  2HV7 A;  1LI5 A;  5K0I A;  2ICW G;  4CDY A;  4NC3 A;  4JKV A;  4ER9 A;  1QPU A;  5D92 A;  3WOD F;  2VCB A;  1MMN A;  2W45 A;  3U0C A;  1E85 A;  2EPO A;  4E7Z A;  3K7D A;  1AVO B;  3KL4 A;  2L6G A;  3T9O A;  2CCY A;  1E84 A;  2GA0 A;  4NQF A;  3NRH A;  5A6B D;  1ZW2 A;  5L0I A;  3KYJ A;  3S9O A;  2OEX A;  2HSQ A;  1XZQ A;  3VAY A;  2VC9 A;  1XZP A;  3LAY A;  4Q7C A;  3EGD B;  4LDK A;  4DVZ A;  3DAF A;  3GM3 A;  4ZLD A;  3ZTZ A;  4I3M A;  4KNW A;  5EGY A;  1NSG B;  3I4U A;  1KTM A;  1HE1 A;  5KYX A;  4MVS A;  4CIH A;  4H4K C;  3HNL A;  4WGZ A;  4N06 A;  4YN0 B;  4NTA A;  1L7C A;  2VH3 A;  4U5F E;  4YL1 A;  3AGT A;  4BJT A;  5L0D A;  4CSA A;  1TFO B;  3NG1 A;  4PR9 A;  4K1O A;  4CS9 A;  4F4B A;  5KYY A;  1TWH A;  2PX0 A;  2YQY A;  3PMR A;  4MVO A;  1ORJ A;  1MNE A;  3Q6N A;  3EFO A;  3KH2 A;  4LLE A;  4O6N A;  3SXK A;  3SXM A;  2O9X A;  4Q5S F;  4CS8 C;  3W8H A;  4C3D A;  1M2O A;  1AEP A;  1SR2 A;  1LIH A;  3SP1 A;  4AE4 A;  2VCC A;  2J9V A;  4BG0 A;  4EWC A;  2IYL D;  1CGM E;  1ZHT A;  3IQC A;  3DXJ F;  1JRA A;  1TR2 A;  1GGQ A;  2HZ8 A;  2VAS A;  2DI3 A;  3QMK A;  4QI0 A;  1D1B A;  4ZLC A;  3O10 A;  1RJ9 B;  1V55 C;  1RKC A;  4XLN F;  1ZZP A;  4GYT A;  1ZU4 A;  2DGJ A;  5JSL A;  3NMK A;  3TUL A;  3IQT A;  3LES A;  4LLC A;  5L3Q A;  2XL8 A;  3AQC A;  1SYQ A;  1PD1 A;  3JYH A;  4LDR A;  1Z3I X;  3US6 A;  4XEF A;  2IXP A;  1FMV A;  3ZDL A;  4Q4Z F;  1U0B B;  1PD0 A;  1ORY A;  3K66 A;  1ZW3 A;  2J46 A;  4EBK A;  1Z7Q c;  3CZ6 A;  2L9J A;  3GWL A;  3QZC A;  4IWB A;  4BEM J;  3POV A;  2R7X A;  3C62 A;  4XQ1 A;  4DRJ B;  3U9J A;  4WAB A;  2XXA A;  3LJB A;  3FVY A;  2WVQ A;  4DJ9 A;  3HKK A;  1F1M A;  4EBJ A;  1H6G A;  1ZYR F;  4DXW A;  2XLV A;  3EH1 A;  3RF3 A;  2R7O A;  2M64 A;  2NUP A;  3AG1 C;  3CAX A;  2ZPA A;  3RVZ A;  4OIO F;  3J06 A;  1E2X A;  1VYI A;  4XEK A;  2JPU A;  3QW0 A;  1ZHY A;  4A2N B;  4AL1 A;  4C7O B;  5JRA A;  3FOO A;  2HUJ A;  4M63 A;  4YWQ A;  2P7V A;  4G7Z F;  2Q00 A;  1FTS A;  2EIM C;  3EZH A;  3JSE O;  2KYH A;  4PFO A;  2OJE D;  1OXK A;  2NPU A;  1K04 A;  4DRH B;  3MFN A;  3ABL C;  2HMQ A;  3SXZ A;  1FNT c;  3SZR A;  2IXM A;  2AVK A;  2R7Q A;  1XWJ A;  1O87 A;  4YL0 A;  2OOC A;  1MQV A;  1AUE A;  2QLA A;  3L1M A;  2ETS A;  1K05 A;  2QUP A;  3T6G B;  3ZQY A;  1S7Z A;  2AWC A;  3EPV A;  3EGX A;  2YVK A;  2D4U A;  2H7V C;  2P61 A;  2EPN A;  3U3B A;  2I8B A;  3QVZ A;  3T6B A;  5DQZ A;  5CIV A;  1LS1 A;  2G3K A;  2KNH A;  3KKB A;  4MQ9 F;  4QDL A;  5COF A;  4YT5 A;  1VTM P;  2OKU A;  1FFT C;  3MBG A;  1I4Y A;  1R5I D;  4YK5 A;  5KYX B;  3EH2 A;  4PJN A;  2LCH A;  2V26 A;  1VMA A;  1YA7 O;  2MWQ A;  3KPH A;  1BDJ B;  3GWN A;  3NKD A;  1Y4C A;  4O6M A;  2PBE A;  5T1D B;  2PP4 A;  5KYY B;  2A1D D;  2KJG A;  4I44 A;  3W4Y A;  3EJN A;  3ZQV A;  3EFO B;  3H65 A;  2J7P D;  2PX3 A;  3FHD A;  3DAG A;  4LDQ A;  1RKE B;  3S29 A;  1VLS A;  1PV3 A;  2EPL X;  3G4X A;  3Q6M A;  4AE4 B;  4NTF A;  1G5Z A;  1VOM A;  3ZG1 A;  3C8G A;  5E3A A;  2ASR A;  1CGO A;  5A6J A;  1EI7 A;  1TWC A;  2Q9C A;  1T01 A;  2Q3T A;  4JTA B;  4KC9 A;  3NYM A;  1ORS C;  2J8W A;  4J30 B;  4HFF B;  3SYN A;  2A0U A;  2QY9 A;  3AJM A;  4HFK B;  5DLJ A;  2NG1 A;  5F5F A;  2W4M A;  1I5N A;  1VYK A;  3R7C A;  1SZI A;  1U89 A;  1O3U A;  1BR1 A;  2HKV A;  2MYS A;  2UUH A;  3C7J A;  2KQ9 A;  4MS2 A;  5E2Q A;  4OIN F;  1OCO C;  2OEV A;  2CNW D;  3ABM C;  2KK1 A;  1G4W R;  3S27 A;  4WJ0 A;  2NUT A;  4EKW A;  4MVR A;  1OW7 A;  3WG7 C;  1TKN A;  1CPQ A;  3JZ0 A;  1FAP B;  1T6U A;  1HE9 A;  2DYR C;  1OR2 A;  3WAQ A;  4G7O F;  2R7S A;  3DD7 A;  3DM5 A;  4BPM A;  2XXA B;  3A9C A;  4EUK B;  1D1A A;  1LPE A;  2R7V A;  4Z9J A;  1NFN A;  2X0C A;  3DZA A;  3Q7G A;  5CI8 A;  1M2V A;  2D5R B;  1LM3 B;  3CQZ A;  1OQC A;  2NUP B;  2XLH A;  3MLG A;  3NYL A;  4N6H A;  4C3E A;  3HJC A;  5B3S C;  4JRZ A;  2XLE A;  4CBE A;  1VLT A;  1J8M F;  5D91 A;  1D0Y A;  4RDA A;  4A4A A;  4IAQ A;  4IRU A;  2HMZ A;  3RKO F;  2DYS C;  1LI7 A;  2XLD A;  4HEA J;  1M57 C;  4PAC A;  1A0B A;  2XLW A;  1KNY A;  1MND A;  2XRH A;  2PF4 E;  2VB6 A;  3EQL F;  2XLO A;  3L8I A;  1T5O A;  2Y39 A;  4MVM A;  4U5C E;  4E0I A;  5GPG B;  4PJM A;  1QLE C;  2OG2 A;  2G3V A;  3HLZ A;  2NSF A;  3IQ6 A;  3K33 A;  1C03 A;  1ZHX A;  3NKE A;  3M4B A;  1M56 C;  3QW1 A;  3V5X A;  1HW2 A;  4JTD B;  1QKR A;  2GWW A;  5BUO A;  1S05 A; 
#chains in the Genus database with same CATH homology
 4XEV A;  1PV3 A;  3JYY A;  2L6F A;  3U0C A;  1K05 A;  4EBJ A;  3K7D A;  2L6G A;  3B71 A;  3C8G B;  3C8G A;  4NQF A;  3RQG A;  3RQF A;  2LK4 A;  3S9O A;  4R32 A;  1K40 A;  1WTY A;  2YWA A;  3U3F A;  5F28 E;  3AJM A;  3C18 A;  3GM3 A;  3O10 A;  4XEK A;  2JPU A;  1ZZP A;  3GM2 A;  1JOG A;  1O3U A;  2HSB A;  3GM1 A;  3L8I A;  1KNY A;  3TUL A;  1KTM A;  2Q00 A;  2KK1 A;  2L6H A;  1OW6 A;  1WOL A;  4XEF A;  1OW7 A;  1V4A A;  2PBE A;  3C8G D;  1K04 A;  1OW8 A;  1UFB A;  3JZ0 A;  3MFN A;  1WWP A;  3BRJ A;  4EBK A;  3L8J A;  3RQE A;  2JX0 A;  1QVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...