3O10A

Crystal structure of the hepn domain from human sacsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
139
structure length
139
Chain Sequence
GSVGNPVEARRWLRQARANFSAARNDLHKNANEWVCFKCYLSTKLALIAADYAVRGKSDKDVKPTALAQKIEEYSQQLEGLTNDVHTLEAYGVDSLKTRYPDLLPFPQIPNDRFTSEVAMRVMECTACIIIKLENFMQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Sacsin
publication title Structural basis of defects in the sacsin HEPN domain responsible for autosomal recessive spastic ataxia of Charlevoix-Saguenay (ARSACS).
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05168 HEPN HEPN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3o10A00
2LK4A 4EBKA 3U0CA 1KNYA 1QVXA 4XEKA 4R32A 3AJMA 3K7DA 1O3UA 3GM1A 4NQFA 1OW6A 1V4AA 4EBJA 4XEFA 1K40A 5F28E 1JOGA 3S9OA 3BRJA 3C8GD 1WOLA 3JYYA 3RQEA 2L6HA 2KK1A 1ZZPA 3RQGA 3U3FA 1UFBA 3GM2A 1OW7A 1PV3A 2JX0A 2PBEA 3C18A 2YWAA 1WWPA 3L8JA 4XEVA 3JZ0A 1WTYA 3MFNA 3TULA 1KTMA 3B71A 1K04A 2L6FA 1K05A 3L8IA 1OW8A 3C8GA 3C8GB 2Q00A 2HSBA 2JPUA 3RQFA 3O10A 3GM3A 2L6GA
chains in the Genus database with same CATH superfamily
1QSPA 5JT4A 2LIGA 2AP3A 4J32B 5JSLA 2HV7A 3EG9B 3UMKA 5DQZA 2W4MA 3C8ZA 4ULVA 2R7QA 4KI2A 1J8YF 3QVYA 4OIQF 3GM1A 3I5QA 4BJTA 4C3DA 5F5FA 2W4BA 2EIJC 3JTLO 1OCZC 2HFIA 1OKKA 2ASRA 2Y3GA 4HEAJ 3VYWA 1G4US 2FFHA 1MNDA 1VLTA 4OD4A 4XLNF 1EA8A 2A1DD 3C8GD 1WOLA 1OCRC 2JD3A 3ITFA 3Q7LA 4U5EE 2GA0A 2R02A 2A69F 4QI0A 1L3PA 4IJJA 2WVNA 1WGWA 1YLMA 3A9CA 4CS9A 2EPOA 4YT2A 4XEVA 2ZXOA 3UGPA 5L0IA 1JR8A 1U6HA 2LQGA 2Q9AA 3C8GA 3RVYA 4DRIB 5KYYB 1HE1A 2YLDA 2C04A 3EGXB 4BJ5C 4MQ9F 3NRHA 4CJOA 1O87A 3I4UA 4GEHA 4CJGA 3Q6MA 5JUAA 3GM3A 2OEVA 5K0IA 3POVA 3NYMA 4ZLDA 2G62A 3EG9A 4D4NA 4R32A 2HJMA 2GFHA 3EQLF 4LLEA 2R05A 2P6VA 3G4XA 4E0IA 2XRHA 1GM5A 1VYIA 1NFNA 1FAPB 2QLAA 3F46A 2BC5A 3HJCA 2OEXA 4YL3A 1T6UA 2FAPB 2YVKA 3HNIA 5DS4A 5KYXA 1SYQA 3O6XA 3GM2A 1MMDA 3KH2A 1PV3A 4CDAA 5JS5A 2PBEA 3AQCA 3US6A 1BR1A 3TJ5A 1WWPA 2EPMX 3DE9A 1U89A 4E7SA 2UUIA 1ORJA 3ZWIA 2IM8A 1BR4A 3IHUA 2RSEB 4I3MA 3PCVA 3LEVA 1EKYA 2XLVA 4J7YA 3W8HA 1VB5A 2J9VA 3U0CA 4AE4B 2W45A 3KMIA 1VYKA 2KC3A 3NMIA 4DVZA 5KYNA 5TJ5E 2J0XA 3AG3C 3AG2C 2A6EF 3K1HA 3T4RA 3G50A 1MMNA 4OINF 3SXZA 5F28E 4JVSA 4J7TA 4O7GA 1SF8A 1I4ZA 2LD6A 3FAJA 4MVRA 1QKRA 1IW7F 2NSFA 2P7VA 2EILC 1GS9A 3DJNB 4J30B 2O9XA 4P9FA 3WAQA 1YDIA 2R7SA 1OCCC 2NUTB 3LAYA 1Z3IX 3DZAA 3C62A 1OW8A 3ATPA 3RF3A 1C03A 1LS4A 2YL1A 3ZQVA 4JTAB 5BQHA 1AVOB 1APCA 1R4TA 2AU5A 2D4UA 2L6GA 3EH2A 3SZRA 3K33A 2Q9BA 4KC9A 2UUHA 2XLEA 3DM9B 2LP4A 3LLIA 4QDLA 4AE4A 4C3EA 2ZPAA 1FMWA 3OA1A 4YN0B 2L81A 2PNOA 3N2ZB 2P61A 2XLMA 2WZGA 1LPEA 1Y4CA 3IEEA 3ABMC 2OKUA 4U5BE 5L0FA 2DB4A 3GEIA 3DM5A 4ER9A 2R7TA 2YKZA 3JT1A 3RQGA 1YVIA 2XL4A 1AUEA 3Q7GA 4CDYA 2KGOA 4CS8C 2OG2A 2YEVA 5E3AA 3C18A 4JCZA 3U8PA 2NUTA 4NC3A 1NFOA 2XLDA 3DWWA 4MW3A 5L0CA 1E84A 3R7CA 2CDQA 3W2WA 2Q4FA 3CQZA 2EINC 2J7PD 5FCLA 2OOCA 5BQIA 1E86A 4O6NA 3G4ZA 5B3IA 4EBBA 1YZCA 5FZTA 1B68A 3DI5A 2AWCA 3AOUA 3NG1A 4BJ5A 4X0RA 4EBKA 5A6BD 3LESA 5T3TA 2R7XA 1L7CA 1A7VA 1Q0GA 1GQAA 3JSZA 2J7PA 3LEOA 4AX2A 4BG0A 3NDBB 1EQ1A 4G0HA 4JEAA 4K0DA 4H54A 4G7ZF 1CPQA 2A68F 1AEPA 1JPNA 2OJED 4MVZA 4B6IA 2DYSC 1YA7O 4H4KC 4YK5A 3UGOA 1A0BA 1TWGA 2YLIA 3EGDB 4MS2A 5EGYA 1KTMA 2J0WA 2V26A 4JIOA 3DE8A 5L3QA 3U9MA 2HV6A 2HSBA 3RKOF 1IZMA 4C3BA 3Q6NA 4P9TA 3HNKA 4EUKB 3I5PA 2IBFA 4NY3A 1A7DA 3KYJA 2XS1A 2L7AA 1D0XA 3R2PA 1E2XA 1OR2A 1RKCA 4K1OA 3J06A 4RD9A 4PJMA 1Q0FA 3W2VA 1NU7D 2P0NA 3LNRA 1A7EA 1Q0MA 1SR2A 2PX3A 4N4WA 4O6MA 3KKBA 4MNDA 4N06A 5B1BC 1C02A 3ZQYA 3AG4C 3LJBA 2YZSA 1I5NA 4JE9A 2Z15A 1TR2A 3AQBA 4ANJA 4GYTA 2HKVA 2XM4A 3TOMA 3V5ZA 3FMSA 4M63A 1M57C 1Z7Qc 3SEOA 3U2LA 2IOQA 1FNTc 1M2VB 4U5HA 4WGYA 2XM0A 1JMWA 2HS5A 1TWHA 5D92A 4CSAA 1LE4A 2Q3TA 1QQ3A 2LK4A 1LKXA 3MLGA 1YZAA 2XS8A 2H8AA 1LI7A 2XL8A 5CI8A 1RMVA 4A4AA 1S7ZA 2XL6A 3H65A 3VAYA 4Z9HA 3JRTA 4W8PA 1Q0DA 2ZXPA 3GODA 1FMVA 3BRJA 4DBRA 1PCXA 2CYDA 3K1IA 5BUOA 5A69A 1Z63A 3UMIA 2I15A 2ETSA 4MTFA 2R9RB 4CDVA 3GANA 4MTGA 4JJFA 4KNVA 2B0HA 2W9YA 2J8WA 3SXYA 4LLCA 4DOZA 5AC5A 4FESA 5A6JA 1M2VA 4WGZA 3MYIA 2LCHA 1JRAA 4MVUA 5KYYA 2M64A 3EGXA 5E3CA 1M6TA 2NG1A 3NYLA 4XEKA 4F4BA 2R7UA 1OXKA 2QE9A 1V74B 1GGQA 2VASA 3CAXA 2WB7A 3JCUQ 2M4EA 2R7RA 4XPXA 3OEOA 5CIVA 3IQ5A 1BBHA 5A6KA 4IGGA 5T3WA 3WHNA 5L0JA 3FAPB 3QW1A 3ASOC 4E18A 3M15A 3QW0A 2HMQA 5KYWB 1ZYRF 4BJ6C 3S9OA 2J9WA 1QLEC 3EZHA 3TK0A 2GAQA 2L6HA 2Y3DA 1ZZPA 2I8BA 2LSEA 1YAUO 4A2NB 4GQHA 3ZDLA 3V7OA 1NG1A 3RVZA 4JKVA 4E7ZA 4CS7A 2X51A 2Y39A 3B71A 1K04A 3ABLC 4U9DA 5L0GA 2KYHA 4JTCB 2HZ8A 3GORA 2A6HF 2Q7RA 2J9UA 2YHSA 3GWNA 4XPWA 2IXOA 3DAFA 3NMJA 5AGFA 3S29A 4G78A 1NU9C 2CCYA 3S28A 5B3SC 4O79A 3PDMP 1UG7A 1O5HA 5L3VA 1OW6A 2VCAA 2YL3A 1JPJA 3HNLA 3FOPA 4L6RA 1N1CA 2EIMC 3TQOA 5KYWA 5DLJA 2XSEA 4U5GA 1HY5A 4CS9C 1NZEA 1SMYF 3NMKA 4LERA 3S84A 2E87A 4EIYA 2R7OA 4HFKB 3NKEA 3T6GB 3DXJF 2Q9CA 5DS5A 4PACA 3U9JA 3L8JA 1U0BB 3TULA 1LI5A 1I4YA 1RCPA 1Q0KA 1A41A 4JZAA 2XXAB 5E2QA 3X2QC 1XZPA 1T01A 2JPUA 3H2UA 4CBEA 2KW3C 4CIPA 5HSWA 3A11A 2PP4A 4YT4A 4G7OF 1CGME 3N0TA 1KNYA 5CI9A 1D1CA 2G3KA 2LFDA 3FVYA 3K7DA 3M4BA 1HMDA 4BEMJ 2H7BA 2HUJA 2QY9A 4U5FE 1RKEB 4OIRF 3TJ6A 3RFYA 3ASNC 4Z9IA 2IXPA 3E70C 4IAOA 5L0DA 1XWJA 4P6IC 5L0HA 2KQ9A 1T9KA 2KSFA 2NPUA 4EKWA 4HFFB 2EPLX 5AC4A 1JAFA 2BL2A 2OJQA 1SZIA 2PFDA 3DKAA 4ULWA 3SYNA 2OU6A 3TOLA 2XXAA 2R7VA 3ZC4A 4NTFA 3SP1A 2ICWG 2Y69C 3JRMO 1YA9A 3GWLA 4LDRA 3VF0A 3RW0A 3DAGA 3ZSUA 5EHHA 2PF4E 1MNEA 3T9OA 4XWJA 1QVXA 2YRFA 4YWQA 3M79A 3ZIBA 4PJJA 2WVQA 4PJNA 1TQGA 1VK5A 3DMDA 4PJLA 4CX9A 1TFOB 1E83A 3DJUB 4QI2A 2OCCC 4FX5A 1OQCA 4IRUA 1Y6DA 2EPKX 2XLOA 3JYHA 3F47A 2CW0F 3PMRA 3UNGC 4YT8A 1ZHYA 1LVKA 3N24A 5JLIA 3FXHA 1UFBA 3DD7A 1M2OA 2R03A 3IPMO 1LIHA 4LDKA 3V5XA 3U3BA 3W4YA 4DBQA 1MMGA 1H6GA 3M4CA 3ZTMA 4ZLCA 3S0XA 1ZHXA 3EGDA 4MVMA 3B0UX 1T5OA 5JRAA 1HW1A 3C63A 1OXBA 2BE5F 3C8GB 5EK0A 2EIKC 2KJGA 3MYFA 4PFPA 3SXMA 3WODF 1S05A 1OR3A 1WASA 1TWCA 2OQMA 4BPMA 2PX0A 3H2VA 3S90A 1ZHTA 3B0VC 5T1DB 3VM6A 2WZFA 3KYIA 1RJ9B 2P1AA 3K66A 4JCHA 3RYLA 4AL1A 4WABA 1BR2A 1OCOC 2AVKA 1MQVA 3RIPA 4DXWA 2VCCA 1XZQA 5COMA 1RXQA 3L1MA 4NCQA 1NLXA 4N6HA 4PK4A 4AK9A 4IB4A 1Z6AA 4FWVA 3W8IA 2KNHA 1TWAA 3GEHA 2FGYA 4NTAA 1D1AA 3L34A 4PR9A 4W8KA 4BEJA 4MVOA 4Q5SF 2ZD9A 4O6YA 5KYXB 1EI7A 2B0JA 4JJGA 4I1MA 3NYJA 1LM3B 1Z5ZA 1T6QA 2DGJA 3EHMA 1WTYA 3JZ0A 4IARA 4RBNA 4AL0A 3TD7A 4CIHA 4EHPA 3U2MA 4CS8A 1H7IA 2MWQA 4MVQA 1LE2A 2IXNA 4N6CA 3UMHA 1RJ9A 1D0YA 2F22A 1HE9A 2J9BA 1T6IA 2MHRA 1QZXA 3HNJA 1ZHWA 4Z9JA 3QMKA 1F1MA 1E85A 2VH3A 5COGA 3EZIA 1VTMP 2QUPA 3LS1A 4IWBA 4XEFA 1Z23A 1G5ZA 3CZ6A 2R7WA 4MTOA 4YL0A 3SXKA 1H9TA 4JRZA 3EPVA 3PHF2 1MMAA 3ZTZA 2Y3BA 4C7OB 2HJ3A 1H9GA 3U3FA 3ABKC 1CGOA 3B29A 1OW7A 3LUTB 2QTVA 3K6BA 5DQTA 5KYUB 1V55C 5COFA 5DS6A 3HTKC 2VCBA 3CEXA 3QZCA 4OIOF 2L6FA 2H7VC 2TMVP 2LFFA 1FR0A 1NSGB 2NUPB 4U5CE 4FAPB 4XLPF 1PD1A 3EHNA 3QVZA 4G7HF 1M56C 1ORYA 5DVWA 4DVYP 1D1BA 2L9JA 1W2WA 3AJMA 2DI3A 2H7OA 1O3UA 3HKKA 3KPHA 4YJWA 2WL8A 3T6JA 1VMAA 4I44A 4U5DE 2IYLD 1K40A 3CSKA 2NSGA 3U5SA 1ST6A 2AWYA 4C7OA 4JTDB 2G3VA 4YL1A 5BQGA 2YL7A 4PFOA 2R25A 2VB6A 1FFTC 3M1CB 3EFOB 2JX0A 3L0IA 1R5ID 5KYUA 5GPGB 3E9VA 4CSAC 2VC9A 1DOVA 1D0ZA 4HE8D 3S27A 3ECSA 4E0HA 4K7BA 2NUPA 3AGTA 3IQTA 4LDQA 4RDAA 4EWCA 1G8XA 2A0BA 3LS0A 2D5RB 2YLGA 1V54C 3O10A 4Q7CA 3IQCA 3O39A 4E17A 1WATA 1G4WR 5D91A 2J46A 4XQ1A 2QNLA 4YT5A 5IY5C 2J45A 2Y3HA 2EPNA 3K1IC 3U8VA 3SNHA 4NQFA 4DJ9A 3EH1A 4EBJA 4KNWA 4JW1A 1VLSA 2A0UA 3B9QA 2HMZA 4WJ0A 1ZU4A 2ZXWC 1CGNA 3KL4A 1JOGA 1TFKB 1VOMA 5E33A 3UR3C 4NTBA 2DYRC 2X0CA 4DRHB 2XLWA 3HLZA 2CNWD 1DOWA 3NKDA 1BZ4A 3EFOA 4IAQA 2WZLA 4XPYA 1ZHZA 3LLKA 2GDCA 4D4XA 5F5HA 1HW2A 1TKNA 1ZW2A 2WVOA 5JP7A 1K05A 4OIPF 4XTKA 3ZG1A 3X1OA 2CNWA 3FOOA 2MYSA 4JEBA 3WG7C 3VRCA 5JVEA 1J8MF 1FTSA 3FDQA 3BEHA 1YYXA 2YL0A 3V5YA 1FFHA 1KU2A 1YARO 2YQYA 3AG1C 3T6BA 4I1OB 1CPRA 4JURI 3C7JA 2CGEA 2IXMA 1V4AA 2RD9A 1ZW3A 3JSEO 4JC7A 4ONSA 1HMOA 1RKEA 4MVSA 5A6BA 1QPUA 1YYJA 2XLHA 4BJ1A 3EJNA 3JYYA 3RQEA 3MX3A 3AGUA 2KK1A 5A6AA 3GEEA 3ZVRA 3OWTA 4Q4ZF 4BJ6A 4UDVA 1PD0A 3RH3A 2HSQA 4KBLA 2YWAA 4U9EA 2V3CC 5HV9A 2C03A 3B0PA 1ZVZA 3QTHA 1NBBA 3MFNA 4OD5A 5B1AC 1ORSC 1ZU5A 3FHDA 3L8IA 3LNMB 2Q00A 1LS1A 4MW8A 1BDJB 3IQ6A 3MBGA 256BA 4DRJB 1YJGA 2GWWA 1WN0A 2ZXRA 4LACB 1OKKD 3RQFA 3O55A 1C17M
chains in the Genus database with same CATH topology
2LK4A 4EBKA 3U0CA 1KNYA 1QVXA 4XEKA 4R32A 3AJMA 3K7DA 1O3UA 3GM1A 4NQFA 1OW6A 1V4AA 4EBJA 4XEFA 1K40A 5F28E 1JOGA 3S9OA 3BRJA 3C8GD 1WOLA 3JYYA 3RQEA 2L6HA 2KK1A 1ZZPA 3RQGA 3U3FA 1UFBA 3GM2A 1OW7A 1PV3A 2JX0A 2PBEA 3C18A 2YWAA 1WWPA 3L8JA 4XEVA 3JZ0A 1WTYA 3MFNA 3TULA 1KTMA 3B71A 1K04A 2L6FA 1K05A 3L8IA 1OW8A 3C8GA 3C8GB 2Q00A 2HSBA 2JPUA 3RQFA 3O10A 3GM3A 2L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LK4 A;  4EBK A;  3U0C A;  1KNY A;  1QVX A;  4XEK A;  4R32 A;  3AJM A;  3K7D A;  1O3U A;  3GM1 A;  4NQF A;  1OW6 A;  1V4A A;  4EBJ A;  4XEF A;  1K40 A;  5F28 E;  1JOG A;  3S9O A;  3BRJ A;  3C8G D;  1WOL A;  3JYY A;  3RQE A;  2L6H A;  2KK1 A;  1ZZP A;  3RQG A;  3U3F A;  1UFB A;  3GM2 A;  1OW7 A;  1PV3 A;  2JX0 A;  2PBE A;  3C18 A;  2YWA A;  1WWP A;  3L8J A;  4XEV A;  3JZ0 A;  1WTY A;  3MFN A;  3TUL A;  1KTM A;  3B71 A;  1K04 A;  2L6F A;  1K05 A;  3L8I A;  1OW8 A;  3C8G A;  3C8G B;  2Q00 A;  2HSB A;  2JPU A;  3RQF A;  3O10 A;  3GM3 A;  2L6G A; 
#chains in the Genus database with same CATH topology
 1QSP A;  5JT4 A;  2LIG A;  2AP3 A;  4J32 B;  5JSL A;  2HV7 A;  3EG9 B;  3UMK A;  5DQZ A;  2W4M A;  3C8Z A;  4ULV A;  2R7Q A;  4KI2 A;  1J8Y F;  3QVY A;  4OIQ F;  3GM1 A;  3I5Q A;  4BJT A;  4C3D A;  5F5F A;  2W4B A;  2EIJ C;  3JTL O;  1OCZ C;  2HFI A;  1OKK A;  2ASR A;  2Y3G A;  4HEA J;  3VYW A;  1G4U S;  2FFH A;  1MND A;  1VLT A;  4OD4 A;  4XLN F;  1EA8 A;  2A1D D;  3C8G D;  1WOL A;  1OCR C;  2JD3 A;  3ITF A;  3Q7L A;  4U5E E;  2GA0 A;  2R02 A;  2A69 F;  4QI0 A;  1L3P A;  4IJJ A;  2WVN A;  1WGW A;  1YLM A;  3A9C A;  4CS9 A;  2EPO A;  4YT2 A;  4XEV A;  2ZXO A;  3UGP A;  5L0I A;  1JR8 A;  1U6H A;  2LQG A;  2Q9A A;  3C8G A;  3RVY A;  4DRI B;  5KYY B;  1HE1 A;  2YLD A;  2C04 A;  3EGX B;  4BJ5 C;  4MQ9 F;  3NRH A;  4CJO A;  1O87 A;  3I4U A;  4GEH A;  4CJG A;  3Q6M A;  5JUA A;  3GM3 A;  2OEV A;  5K0I A;  3POV A;  3NYM A;  4ZLD A;  2G62 A;  3EG9 A;  4D4N A;  4R32 A;  2HJM A;  2GFH A;  3EQL F;  4LLE A;  2R05 A;  2P6V A;  3G4X A;  4E0I A;  2XRH A;  1GM5 A;  1VYI A;  1NFN A;  1FAP B;  2QLA A;  3F46 A;  2BC5 A;  3HJC A;  2OEX A;  4YL3 A;  1T6U A;  2FAP B;  2YVK A;  3HNI A;  5DS4 A;  5KYX A;  1SYQ A;  3O6X A;  3GM2 A;  1MMD A;  3KH2 A;  1PV3 A;  4CDA A;  5JS5 A;  2PBE A;  3AQC A;  3US6 A;  1BR1 A;  3TJ5 A;  1WWP A;  2EPM X;  3DE9 A;  1U89 A;  4E7S A;  2UUI A;  1ORJ A;  3ZWI A;  2IM8 A;  1BR4 A;  3IHU A;  2RSE B;  4I3M A;  3PCV A;  3LEV A;  1EKY A;  2XLV A;  4J7Y A;  3W8H A;  1VB5 A;  2J9V A;  3U0C A;  4AE4 B;  2W45 A;  3KMI A;  1VYK A;  2KC3 A;  3NMI A;  4DVZ A;  5KYN A;  5TJ5 E;  2J0X A;  3AG3 C;  3AG2 C;  2A6E F;  3K1H A;  3T4R A;  3G50 A;  1MMN A;  4OIN F;  3SXZ A;  5F28 E;  4JVS A;  4J7T A;  4O7G A;  1SF8 A;  1I4Z A;  2LD6 A;  3FAJ A;  4MVR A;  1QKR A;  1IW7 F;  2NSF A;  2P7V A;  2EIL C;  1GS9 A;  3DJN B;  4J30 B;  2O9X A;  4P9F A;  3WAQ A;  1YDI A;  2R7S A;  1OCC C;  2NUT B;  3LAY A;  1Z3I X;  3DZA A;  3C62 A;  1OW8 A;  3ATP A;  3RF3 A;  1C03 A;  1LS4 A;  2YL1 A;  3ZQV A;  4JTA B;  5BQH A;  1AVO B;  1APC A;  1R4T A;  2AU5 A;  2D4U A;  2L6G A;  3EH2 A;  3SZR A;  3K33 A;  2Q9B A;  4KC9 A;  2UUH A;  2XLE A;  3DM9 B;  2LP4 A;  3LLI A;  4QDL A;  4AE4 A;  4C3E A;  2ZPA A;  1FMW A;  3OA1 A;  4YN0 B;  2L81 A;  2PNO A;  3N2Z B;  2P61 A;  2XLM A;  2WZG A;  1LPE A;  1Y4C A;  3IEE A;  3ABM C;  2OKU A;  4U5B E;  5L0F A;  2DB4 A;  3GEI A;  3DM5 A;  4ER9 A;  2R7T A;  2YKZ A;  3JT1 A;  3RQG A;  1YVI A;  2XL4 A;  1AUE A;  3Q7G A;  4CDY A;  2KGO A;  4CS8 C;  2OG2 A;  2YEV A;  5E3A A;  3C18 A;  4JCZ A;  3U8P A;  2NUT A;  4NC3 A;  1NFO A;  2XLD A;  3DWW A;  4MW3 A;  5L0C A;  1E84 A;  3R7C A;  2CDQ A;  3W2W A;  2Q4F A;  3CQZ A;  2EIN C;  2J7P D;  5FCL A;  2OOC A;  5BQI A;  1E86 A;  4O6N A;  3G4Z A;  5B3I A;  4EBB A;  1YZC A;  5FZT A;  1B68 A;  3DI5 A;  2AWC A;  3AOU A;  3NG1 A;  4BJ5 A;  4X0R A;  4EBK A;  5A6B D;  3LES A;  5T3T A;  2R7X A;  1L7C A;  1A7V A;  1Q0G A;  1GQA A;  3JSZ A;  2J7P A;  3LEO A;  4AX2 A;  4BG0 A;  3NDB B;  1EQ1 A;  4G0H A;  4JEA A;  4K0D A;  4H54 A;  4G7Z F;  1CPQ A;  2A68 F;  1AEP A;  1JPN A;  2OJE D;  4MVZ A;  4B6I A;  2DYS C;  1YA7 O;  4H4K C;  4YK5 A;  3UGO A;  1A0B A;  1TWG A;  2YLI A;  3EGD B;  4MS2 A;  5EGY A;  1KTM A;  2J0W A;  2V26 A;  4JIO A;  3DE8 A;  5L3Q A;  3U9M A;  2HV6 A;  2HSB A;  3RKO F;  1IZM A;  4C3B A;  3Q6N A;  4P9T A;  3HNK A;  4EUK B;  3I5P A;  2IBF A;  4NY3 A;  1A7D A;  3KYJ A;  2XS1 A;  2L7A A;  1D0X A;  3R2P A;  1E2X A;  1OR2 A;  1RKC A;  4K1O A;  3J06 A;  4RD9 A;  4PJM A;  1Q0F A;  3W2V A;  1NU7 D;  2P0N A;  3LNR A;  1A7E A;  1Q0M A;  1SR2 A;  2PX3 A;  4N4W A;  4O6M A;  3KKB A;  4MND A;  4N06 A;  5B1B C;  1C02 A;  3ZQY A;  3AG4 C;  3LJB A;  2YZS A;  1I5N A;  4JE9 A;  2Z15 A;  1TR2 A;  3AQB A;  4ANJ A;  4GYT A;  2HKV A;  2XM4 A;  3TOM A;  3V5Z A;  3FMS A;  4M63 A;  1M57 C;  1Z7Q c;  3SEO A;  3U2L A;  2IOQ A;  1FNT c;  1M2V B;  4U5H A;  4WGY A;  2XM0 A;  1JMW A;  2HS5 A;  1TWH A;  5D92 A;  4CSA A;  1LE4 A;  2Q3T A;  1QQ3 A;  2LK4 A;  1LKX A;  3MLG A;  1YZA A;  2XS8 A;  2H8A A;  1LI7 A;  2XL8 A;  5CI8 A;  1RMV A;  4A4A A;  1S7Z A;  2XL6 A;  3H65 A;  3VAY A;  4Z9H A;  3JRT A;  4W8P A;  1Q0D A;  2ZXP A;  3GOD A;  1FMV A;  3BRJ A;  4DBR A;  1PCX A;  2CYD A;  3K1I A;  5BUO A;  5A69 A;  1Z63 A;  3UMI A;  2I15 A;  2ETS A;  4MTF A;  2R9R B;  4CDV A;  3GAN A;  4MTG A;  4JJF A;  4KNV A;  2B0H A;  2W9Y A;  2J8W A;  3SXY A;  4LLC A;  4DOZ A;  5AC5 A;  4FES A;  5A6J A;  1M2V A;  4WGZ A;  3MYI A;  2LCH A;  1JRA A;  4MVU A;  5KYY A;  2M64 A;  3EGX A;  5E3C A;  1M6T A;  2NG1 A;  3NYL A;  4XEK A;  4F4B A;  2R7U A;  1OXK A;  2QE9 A;  1V74 B;  1GGQ A;  2VAS A;  3CAX A;  2WB7 A;  3JCU Q;  2M4E A;  2R7R A;  4XPX A;  3OEO A;  5CIV A;  3IQ5 A;  1BBH A;  5A6K A;  4IGG A;  5T3W A;  3WHN A;  5L0J A;  3FAP B;  3QW1 A;  3ASO C;  4E18 A;  3M15 A;  3QW0 A;  2HMQ A;  5KYW B;  1ZYR F;  4BJ6 C;  3S9O A;  2J9W A;  1QLE C;  3EZH A;  3TK0 A;  2GAQ A;  2L6H A;  2Y3D A;  1ZZP A;  2I8B A;  2LSE A;  1YAU O;  4A2N B;  4GQH A;  3ZDL A;  3V7O A;  1NG1 A;  3RVZ A;  4JKV A;  4E7Z A;  4CS7 A;  2X51 A;  2Y39 A;  3B71 A;  1K04 A;  3ABL C;  4U9D A;  5L0G A;  2KYH A;  4JTC B;  2HZ8 A;  3GOR A;  2A6H F;  2Q7R A;  2J9U A;  2YHS A;  3GWN A;  4XPW A;  2IXO A;  3DAF A;  3NMJ A;  5AGF A;  3S29 A;  4G78 A;  1NU9 C;  2CCY A;  3S28 A;  5B3S C;  4O79 A;  3PDM P;  1UG7 A;  1O5H A;  5L3V A;  1OW6 A;  2VCA A;  2YL3 A;  1JPJ A;  3HNL A;  3FOP A;  4L6R A;  1N1C A;  2EIM C;  3TQO A;  5KYW A;  5DLJ A;  2XSE A;  4U5G A;  1HY5 A;  4CS9 C;  1NZE A;  1SMY F;  3NMK A;  4LER A;  3S84 A;  2E87 A;  4EIY A;  2R7O A;  4HFK B;  3NKE A;  3T6G B;  3DXJ F;  2Q9C A;  5DS5 A;  4PAC A;  3U9J A;  3L8J A;  1U0B B;  3TUL A;  1LI5 A;  1I4Y A;  1RCP A;  1Q0K A;  1A41 A;  4JZA A;  2XXA B;  5E2Q A;  3X2Q C;  1XZP A;  1T01 A;  2JPU A;  3H2U A;  4CBE A;  2KW3 C;  4CIP A;  5HSW A;  3A11 A;  2PP4 A;  4YT4 A;  4G7O F;  1CGM E;  3N0T A;  1KNY A;  5CI9 A;  1D1C A;  2G3K A;  2LFD A;  3FVY A;  3K7D A;  3M4B A;  1HMD A;  4BEM J;  2H7B A;  2HUJ A;  2QY9 A;  4U5F E;  1RKE B;  4OIR F;  3TJ6 A;  3RFY A;  3ASN C;  4Z9I A;  2IXP A;  3E70 C;  4IAO A;  5L0D A;  1XWJ A;  4P6I C;  5L0H A;  2KQ9 A;  1T9K A;  2KSF A;  2NPU A;  4EKW A;  4HFF B;  2EPL X;  5AC4 A;  1JAF A;  2BL2 A;  2OJQ A;  1SZI A;  2PFD A;  3DKA A;  4ULW A;  3SYN A;  2OU6 A;  3TOL A;  2XXA A;  2R7V A;  3ZC4 A;  4NTF A;  3SP1 A;  2ICW G;  2Y69 C;  3JRM O;  1YA9 A;  3GWL A;  4LDR A;  3VF0 A;  3RW0 A;  3DAG A;  3ZSU A;  5EHH A;  2PF4 E;  1MNE A;  3T9O A;  4XWJ A;  1QVX A;  2YRF A;  4YWQ A;  3M79 A;  3ZIB A;  4PJJ A;  2WVQ A;  4PJN A;  1TQG A;  1VK5 A;  3DMD A;  4PJL A;  4CX9 A;  1TFO B;  1E83 A;  3DJU B;  4QI2 A;  2OCC C;  4FX5 A;  1OQC A;  4IRU A;  1Y6D A;  2EPK X;  2XLO A;  3JYH A;  3F47 A;  2CW0 F;  3PMR A;  3UNG C;  4YT8 A;  1ZHY A;  1LVK A;  3N24 A;  5JLI A;  3FXH A;  1UFB A;  3DD7 A;  1M2O A;  2R03 A;  3IPM O;  1LIH A;  4LDK A;  3V5X A;  3U3B A;  3W4Y A;  4DBQ A;  1MMG A;  1H6G A;  3M4C A;  3ZTM A;  4ZLC A;  3S0X A;  1ZHX A;  3EGD A;  4MVM A;  3B0U X;  1T5O A;  5JRA A;  1HW1 A;  3C63 A;  1OXB A;  2BE5 F;  3C8G B;  5EK0 A;  2EIK C;  2KJG A;  3MYF A;  4PFP A;  3SXM A;  3WOD F;  1S05 A;  1OR3 A;  1WAS A;  1TWC A;  2OQM A;  4BPM A;  2PX0 A;  3H2V A;  3S90 A;  1ZHT A;  3B0V C;  5T1D B;  3VM6 A;  2WZF A;  3KYI A;  1RJ9 B;  2P1A A;  3K66 A;  4JCH A;  3RYL A;  4AL1 A;  4WAB A;  1BR2 A;  1OCO C;  2AVK A;  1MQV A;  3RIP A;  4DXW A;  2VCC A;  1XZQ A;  5COM A;  1RXQ A;  3L1M A;  4NCQ A;  1NLX A;  4N6H A;  4PK4 A;  4AK9 A;  4IB4 A;  1Z6A A;  4FWV A;  3W8I A;  2KNH A;  1TWA A;  3GEH A;  2FGY A;  4NTA A;  1D1A A;  3L34 A;  4PR9 A;  4W8K A;  4BEJ A;  4MVO A;  4Q5S F;  2ZD9 A;  4O6Y A;  5KYX B;  1EI7 A;  2B0J A;  4JJG A;  4I1M A;  3NYJ A;  1LM3 B;  1Z5Z A;  1T6Q A;  2DGJ A;  3EHM A;  1WTY A;  3JZ0 A;  4IAR A;  4RBN A;  4AL0 A;  3TD7 A;  4CIH A;  4EHP A;  3U2M A;  4CS8 A;  1H7I A;  2MWQ A;  4MVQ A;  1LE2 A;  2IXN A;  4N6C A;  3UMH A;  1RJ9 A;  1D0Y A;  2F22 A;  1HE9 A;  2J9B A;  1T6I A;  2MHR A;  1QZX A;  3HNJ A;  1ZHW A;  4Z9J A;  3QMK A;  1F1M A;  1E85 A;  2VH3 A;  5COG A;  3EZI A;  1VTM P;  2QUP A;  3LS1 A;  4IWB A;  4XEF A;  1Z23 A;  1G5Z A;  3CZ6 A;  2R7W A;  4MTO A;  4YL0 A;  3SXK A;  1H9T A;  4JRZ A;  3EPV A;  3PHF 2;  1MMA A;  3ZTZ A;  2Y3B A;  4C7O B;  2HJ3 A;  1H9G A;  3U3F A;  3ABK C;  1CGO A;  3B29 A;  1OW7 A;  3LUT B;  2QTV A;  3K6B A;  5DQT A;  5KYU B;  1V55 C;  5COF A;  5DS6 A;  3HTK C;  2VCB A;  3CEX A;  3QZC A;  4OIO F;  2L6F A;  2H7V C;  2TMV P;  2LFF A;  1FR0 A;  1NSG B;  2NUP B;  4U5C E;  4FAP B;  4XLP F;  1PD1 A;  3EHN A;  3QVZ A;  4G7H F;  1M56 C;  1ORY A;  5DVW A;  4DVY P;  1D1B A;  2L9J A;  1W2W A;  3AJM A;  2DI3 A;  2H7O A;  1O3U A;  3HKK A;  3KPH A;  4YJW A;  2WL8 A;  3T6J A;  1VMA A;  4I44 A;  4U5D E;  2IYL D;  1K40 A;  3CSK A;  2NSG A;  3U5S A;  1ST6 A;  2AWY A;  4C7O A;  4JTD B;  2G3V A;  4YL1 A;  5BQG A;  2YL7 A;  4PFO A;  2R25 A;  2VB6 A;  1FFT C;  3M1C B;  3EFO B;  2JX0 A;  3L0I A;  1R5I D;  5KYU A;  5GPG B;  3E9V A;  4CSA C;  2VC9 A;  1DOV A;  1D0Z A;  4HE8 D;  3S27 A;  3ECS A;  4E0H A;  4K7B A;  2NUP A;  3AGT A;  3IQT A;  4LDQ A;  4RDA A;  4EWC A;  1G8X A;  2A0B A;  3LS0 A;  2D5R B;  2YLG A;  1V54 C;  3O10 A;  4Q7C A;  3IQC A;  3O39 A;  4E17 A;  1WAT A;  1G4W R;  5D91 A;  2J46 A;  4XQ1 A;  2QNL A;  4YT5 A;  5IY5 C;  2J45 A;  2Y3H A;  2EPN A;  3K1I C;  3U8V A;  3SNH A;  4NQF A;  4DJ9 A;  3EH1 A;  4EBJ A;  4KNW A;  4JW1 A;  1VLS A;  2A0U A;  3B9Q A;  2HMZ A;  4WJ0 A;  1ZU4 A;  2ZXW C;  1CGN A;  3KL4 A;  1JOG A;  1TFK B;  1VOM A;  5E33 A;  3UR3 C;  4NTB A;  2DYR C;  2X0C A;  4DRH B;  2XLW A;  3HLZ A;  2CNW D;  1DOW A;  3NKD A;  1BZ4 A;  3EFO A;  4IAQ A;  2WZL A;  4XPY A;  1ZHZ A;  3LLK A;  2GDC A;  4D4X A;  5F5H A;  1HW2 A;  1TKN A;  1ZW2 A;  2WVO A;  5JP7 A;  1K05 A;  4OIP F;  4XTK A;  3ZG1 A;  3X1O A;  2CNW A;  3FOO A;  2MYS A;  4JEB A;  3WG7 C;  3VRC A;  5JVE A;  1J8M F;  1FTS A;  3FDQ A;  3BEH A;  1YYX A;  2YL0 A;  3V5Y A;  1FFH A;  1KU2 A;  1YAR O;  2YQY A;  3AG1 C;  3T6B A;  4I1O B;  1CPR A;  4JUR I;  3C7J A;  2CGE A;  2IXM A;  1V4A A;  2RD9 A;  1ZW3 A;  3JSE O;  4JC7 A;  4ONS A;  1HMO A;  1RKE A;  4MVS A;  5A6B A;  1QPU A;  1YYJ A;  2XLH A;  4BJ1 A;  3EJN A;  3JYY A;  3RQE A;  3MX3 A;  3AGU A;  2KK1 A;  5A6A A;  3GEE A;  3ZVR A;  3OWT A;  4Q4Z F;  4BJ6 A;  4UDV A;  1PD0 A;  3RH3 A;  2HSQ A;  4KBL A;  2YWA A;  4U9E A;  2V3C C;  5HV9 A;  2C03 A;  3B0P A;  1ZVZ A;  3QTH A;  1NBB A;  3MFN A;  4OD5 A;  5B1A C;  1ORS C;  1ZU5 A;  3FHD A;  3L8I A;  3LNM B;  2Q00 A;  1LS1 A;  4MW8 A;  1BDJ B;  3IQ6 A;  3MBG A;  256B A;  4DRJ B;  1YJG A;  2GWW A;  1WN0 A;  2ZXR A;  4LAC B;  1OKK D;  3RQF A;  3O55 A;  1C17 M; 
#chains in the Genus database with same CATH homology
 2LK4 A;  4EBK A;  3U0C A;  1KNY A;  1QVX A;  4XEK A;  4R32 A;  3AJM A;  3K7D A;  1O3U A;  3GM1 A;  4NQF A;  1OW6 A;  1V4A A;  4EBJ A;  4XEF A;  1K40 A;  5F28 E;  1JOG A;  3S9O A;  3BRJ A;  3C8G D;  1WOL A;  3JYY A;  3RQE A;  2L6H A;  2KK1 A;  1ZZP A;  3RQG A;  3U3F A;  1UFB A;  3GM2 A;  1OW7 A;  1PV3 A;  2JX0 A;  2PBE A;  3C18 A;  2YWA A;  1WWP A;  3L8J A;  4XEV A;  3JZ0 A;  1WTY A;  3MFN A;  3TUL A;  1KTM A;  3B71 A;  1K04 A;  2L6F A;  1K05 A;  3L8I A;  1OW8 A;  3C8G A;  3C8G B;  2Q00 A;  2HSB A;  2JPU A;  3RQF A;  3O10 A;  3GM3 A;  2L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...