3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
3HDXA 3JQ0A 3KEZA 3CGHA 4Q69A 5FQ6A 3MX3A 3SGHA 3EHNA 3NQPA 3CK9A 3EJNA 5T4YA 5LX8A 3JQ1A 5E76A 4F7AA 5FQ8A 3OTNA 3JYSA 3EHMA 3SNXA 5FQ7A 3CK8A 4LERA 5T3RA 3P1UA 4L7TA 3MYVA 3IV0A 5FQ4A 3QNKA 4PUCA 5E75A 3LEWA 3GZSA 3CKCA 3FDHA 3L22A 3MCXA 3CK7A 4F53A 3CKBA 5J90A 4MRUA 3I4GA
chains in the Genus database with same CATH superfamily
3LYAA 3L08A 3MV2B 4HQDA 2FEZA 3B7BA 3U2LA 1M57C 2XLVA 1TN7A 5E2QA 1CPQA 4EECA 2XLWA 3S9OA 4TUMA 3R7QA 3TWQA 4FADA 5L0HA 1VK5A 4MVUA 1A7DA 4N2SA 2RFAA 1D1AA 3ABLE 5DQTA 2IBFA 4MS2A 3C7JA 4DXWA 4EHPA 2EPLX 4GZ3A 4WWNA 3B0UX 1OKKD 4I1OB 4JPSA 1PAQA 4ANUA 3RJVA 4UQXA 3Q5MA 4YJWA 2WQ6A 1BZ4A 3AS8A 4J7TA 2KSFA 2BKKB 2LFFA 5E76A 2ZIRA 4YDEA 3AS5A 4ZFHA 1TWAA 4NIKA 5D0OD 2KCKA 4BY6A 3LEVA 2Y3HA 3M15A 2ZISA 3V2XA 3FUDA 1A7VA 1IYGA 1JWFA 4DLOA 3FFLA 3UT7A 3ML9A 3JSEO 4ER9A 4G2VA 4JTCB 5J90A 4ACKA 3DE9A 3U64A 2EINE 1Y8MA 3DWWA 2HO1A 3D9IA 4A3TA 2IXOA 3ITFA 1D8DA 3K1IC 4U9EA 4GZCA 5ANLA 1OCZC 2P9IG 3NMJA 2ICWG 4WNEA 5KYXB 4XZ4A 1LM3B 4RVBA 2BKGA 5E3AA 5KBAA 5T3WA 2IM8A 3LY9A 1I4YA 3D9NA 5COMA 4KC9A 3GM3A 3JTLO 2HV7A 2EIME 3FY4A 4O60A 4LERA 2ZXRA 5F5FA 3GEEA 1WN0A 2WXPA 3NAWA 2IXNA 2LSEA 1KZOA 1WOLA 3T6BA 3FU3A 5AAOA 1H6GA 4AL1A 3G4XA 1OWNA 2KNHA 1OXBA 2Q9CA 3WAQA 1HXIA 4EZJA 3I5PA 4WNDA 2UY1A 4PS7A 3QWVA 4X0RA 1EKYA 1TFKB 3CEQA 3LNMB 2DYRE 2XEHA 3V5YA 1N94A 5E3CA 2XLDA 1X81A 1ZW3A 5BUZA 4JEHA 4CDRA 3HXEA 3X1OA 5DVWA 4Z9IA 4HB5A 2ETBA 4CDAA 1Z63A 3MLGA 4U0SA 2P2CP 1V55C 2L9BA 4HLEA 1MQVA 1FVHA 3NMKA 4XTKA 3HYMB 3QTHA 1HF8A 3AU4A 2EPOA 4KZ0A 4U07A 2UWJG 4APOA 1A41A 1MX4A 1YYHA 3CHSA 3DSSA 2LP4A 3DJNB 2Q00A 5AENA 4J8FA 1PY1A 3SXMA 5ENTD 4JD2G 1Q0DA 3GW4A 3BRJA 5ENRD 4J6IA 3DI5A 1UOHA 1NP7A 3LS0A 3VAYA 3JCKC 1RJ9A 2HJ3A 3MKQA 3DZAA 2CDQA 2M64A 3EGXA 3DSVA 1QQEA 3L13A 2E2EA 2XPYA 2AP3A 3I3NA 2AXUA 5EIBE 4QI0A 5ANRA 1JCQA 5JLIA 2ZXPA 4FP7A 1NG1A 1GM5A 2R02A 3APDA 4JEBA 4MNDA 1PCXA 4GB9A 4PFPA 1HE9A 1NA0A 2ZPAA 3Q7GA 3NZSA 2AWCA 4URKA 2AW6A 4XX5A 1JCSA 3U8VA 1IQRA 2KJGA 3VF0A 2C03A 4XEFA 1QBQA 1Z3YA 2CHXA 2XRZA 3QWPA 2JD3A 3L8JA 3Q7LA 1KPSB 3ASNE 3T6GB 5AQ9A 1KZPA 4RBNA 1T6UA 3EUVA 2JPUA 4C3EA 3PZ2A 3ZEFA 3B13A 1TN6A 3D9OA 4CJGA 2HSQA 3S28A 4GZDA 1D0ZA 2WM9A 2YL3A 2NG1A 5B1AC 2G62A 4GTSA 3O39A 1D9SA 1OWLA 1QZXA 4HRLA 2IFUA 1XZQA 4HXIA 2MYOA 5DS5A 2QYUA 1RKEB 1TNUA 5JT4A 2KQ9A 4N6CA 2PNOA 2Q9BA 1EPUA 1XWJA 2KZTB 3LPZA 5D2MC 4G7OF 3D9HA 1GGQA 3UT8A 3CAXA 4C7OB 4MS6A 4NTAA 2I9CA 3S90A 3BG0B 3RAUA 3KEZA 2AWYA 2QYJA 5EYLA 2XGSA 5ENSD 1H19A 2QLAA 3RSEG 1OR2A 4YL3A 3TWRA 3RO2A 1OWMA 5COFA 2LD6A 4XEKA 4EIYA 1EYHA 1DCEA 3ASOC 4C0EA 3U2MA 1KT0A 1VYKA 1MMDA 4LDRA 3TJ5A 1E83A 4EHMA 3SFXA 1C03A 1FR0A 1JPJA 5EIDA 1N4RA 2Q3TA 1Y6IA 2X3MA 2J8WA 3US6A 4ILGA 5CRVA 2NC9A 3CK9A 1XNFA 3J5PA 1QYMA 2E0IA 2B0JA 2YLDA 3ZUVB 4J7YA 3QC1A 3UIOC 4I17A 2IU1A 3L54A 3GANA 1G4WR 2X0CA 2JABA 3GEHA 1L7CA 3CIAA 4XI0A 2F37A 3AQBA 2Y3GA 3CV0A 4BX9A 2ETSA 1TKNA 5FQ6A 1W3BA 2R7VA 3CVLA 3JSZA 4CX9A 3FH8A 2GAQA 3CEXA 3F6QA 4AOFA 3ZW3A 2Y4TA 1O5MA 4YWQA 3TULA 5JSLA 1TFOB 2XHEA 5FZSA 1JOGA 2YEVA 2CNWA 1O5HA 2QZAA 3RH3A 2LAHA 1YMPA 3CHOA 5KYWB 4LLEA 2OCCE 5CRUA 3G2WA 3S29A 4UDVA 3AG1C 4ZLDA 3ZTMA 2XS8A 4GU5A 3U66A 5CBOA 3BG1B 4PDXA 5CMWA 4K7BA 3OTNA 3NYMA 3V7OA 4Q5SF 1LTXA 2YINA 1G5ZA 4CS8A 4ULWA 1SA4A 2LSUA 4ONSA 2XPIA 1ZU5A 4U63A 3L6AA 3IPMO 2YNQA 2NPUA 3IXEA 4LNUD 1OWOA 3ONLA 4AX2A 4O6NA 2L6FA 2DVWA 4Q69A 1FCHA 4GYWA 3ZC4A 2FGYA 1ZU2A 2GRRB 3RKOF 4UUCA 4J7WA 2L0IA 3OAWA 4D4XA 2CCYA 3FMSA 4GCOA 3CHRA 4YVQC 3B7SA 3LUTB 4DBQA 3PDMP 3DMDA 3KMIA 3EH2A 5HV9A 1DC2A 2V8SE 1FMVA 2OEXA 1BU9A 4HEAJ 2WL8A 1H6KA 1TR4A 2P1AA 3ZNGA 5IY5C 2BEDA 3SGHA 3WG7E 1MYOA 3EFOA 4AP2A 2YWAA 4UQYA 4E85A 3FUIA 3RQFA 1RKCA 1TJFA 2AU5A 2D5RB 1FFHA 5BQGA 3RF3A 5A6BA 4GPMA 5FJYA 4CJOA 2Q4FA 4ANJA 4W8KA 4RG6A 4J30B 5L0JA 1O87A 4DRXE 1OXJA 3BEHA 3C8GB 3FHEA 3OXFA 1SA5A 2J07A 1ZHYA 3S84A 2R59A 1OQCA 2XSEA 1EQ1A 3RQEA 2OEWA 1O1SA 3KSQA 4HOQA 3I4UA 5CI8A 1D1CA 1YZAA 4FC8A 3SY2A 4XQ1A 3EHQA 2DYSC 3LLKA 1DVPA 4U7EB 2GDCA 4XE0A 3L0IA 1HO8A 1U0BB 2AJAA 3UPVA 1OCOC 4HFKB 3GEIA 3FUEA 2CHWA 3PUJA 3SFYA 4L6RA 2KM4A 3K7DA 3IKOB 4JIOA 2FF4A 2OKUA 3Q9UC 2VCCA 5BNWA 4N4WA 4UWKA 3RO3A 2R7XA 3FU6A 5KWDA 2P7VA 1BI7B 3S7DA 5LFAA 1LE4A 1Q0KA 3DD7A 3SI5A 4QDLA 2HUJA 3H65A 2VGEA 3E34A 3NRHA 1J8YF 5AARA 2VTBB 2R7UA 3IEGA 5BW8C 1C17M 4DOZA 2B6CA 2EPKX 1N0QA 1N9AA 5E75A 4B94A 3T8MA 4HOUA 2GRLA 4ANXA 1N0RA 5ENOD 3C18A 1M6TA 4J32B 1P5QA 4PR9A 3C63A 3HIZA 4TUUA 1WATA 3W8IA 1OKKA 1B68A 3O6XA 4Y6WA 3TG4A 2YZSA 2LO6A 3EGDB 1ZBPA 1HS6A 3QDNA 4BJ1A 4MVRA 2J9WA 1M56C 4N3CA 3ZIMA 1VMAA 4BJ6C 4BEMJ 1UN8A 3P1UA 1OCRC 2OQMA 2WXKA 3PRZA 2R7SA 3SD5A 2CG3A 3DPDA 5G04C 2YLGA 4DVYP 1H2TC 3DSUA 4GA0A 4I44A 3E4BA 2E87A 4DX5D 3ZGQA 3CLJA 4RQIA 3SQVA 4K0RA 1FFTC 1R4TA 5E33A 2RSEB 1HMOA 4GZ5A 4AXHA 3DSXA 5J08A 4UWHA 2J49A 1PD0A 2WVIA 3FOPA 1FAPB 2HZ8A 4JJFA 4GZ6A 5C2YA 2AWIA 3DAFA 3AG3E 3QWWA 1MZCA 3KD7A 4ILIA 3SF4A 2F22A 4M63A 3JYYA 4PFOA 4BPMA 1U6HA 2CGEA 4C3DA 3POVA 3Q78A 3EH1A 3JXJA 2L0TB 1SZAA 5HS0A 1JAFA 1G8XA 4CS9A 3R9AB 3JZ0A 2VSNA 4U04A 5LX8A 3HRAA 2VGXB 1YVIA 4PH4B 3VRCA 4JW1A 4O6YA 2WXMA 3ZWIA 1D0YA 3FUFA 3UMHA 5EX0A 4AK9A 2NUTA 4Z9HA 1Q0GA 3I4RB 5T8IA 2J9BA 4RDAA 4LRZA 4GYTA 2DBAA 3TWUA 1A0BA 4DI3A 2H6FA 2RD0A 1ELKA 4F6RD 5FZRA 3HJCA 2VB6A 2MWQA 4CEMA 3B0PA 2VC9A 4BT9A 4EKWA 1E7UA 4GMRA 4KZCA 5FWQA 4G0HA 4NURA 2P6VA 3ZRHA 4GEHA 2RFMA 2LCHA 3ESLA 3RK6A 1CGNA 1OUVA 1VOMA 1YA0A 1CGME 4WAFA 1MHQA 2R7WA 5HI7A 4BT8A 4N39A 4AIFA 2IXPA 2DI3A 4DJ9A 1YZCA 5L0IA 1GS9A 5JUAA 3CSKA 2R05A 1SR2A 3QVYA 2EILC 3MEKA 2L6BA 1TWCA 4JE9A 3T4RA 3UR3C 4OVVA 4Q96A 2NSZA 4U5BE 2R7OA 3MKQB 2I1JA 5A69A 5CHEE 2FBNA 3DJUB 3CVXA 2LSVA 4IULA 3MV3B 1H9GA 2BL2A 1RXQA 3VM6A 2I8BA 3GZ2A 3FEXA 4NACA 4FHJA 1D1BA 3LY7A 1BI8B 4DBRA 4A63B 3W2WA 3Q7FA 1NZEA 3B7UX 2H7OA 4XPXA 5L0CA 4ATGA 3QAQA 4MKTA 3GYZA 3LKUA 4NCQA 2O9XA 4LDQA 4DRJB 4AE4A 2P9PG 4X8QA 5TJ5E 3QNKA 5D91A 2Q7RA 2IXMA 1HW2A 2NUPA 1PD1A 2XM4A 2M63A 4GAAA 1MNEA 2NXPA 2GRMA 4AJWA 2A4ZA 2R7QA 3JCUQ 2WVOA 3ZQVA 4N5CA 3C3RA 2FAPB 3LDZA 3W8HA 4U5DE 5KJKA 2L9JA 3KSLA 2DZNA 1KLXA 3ASHA 2H6GA 4N3AA 3JXIA 1MNDA 1SMYF 4KNWA 4LEUA 1MMNA 2CW0F 1YCSB 4I9CA 3PZ3A 5FCLA 3BUAA 4A55A 1S64A 4EBAA 3TOLA 2V5FA 2KATA 3K6BA 3MKRA 5KYUA 2J9UA 3ONKA 4B8AA 4HI9A 4W8PA 5GPGB 1E84A 2WB2A 4CDYA 2QE9A 1VB5A 2W9YA 4HRMB 1BBHA 4YL0A 2A6EF 3FOOA 3JRMO 4MVOA 4L2YA 3PMRA 1MX6A 3L82A 5G04J 2LFDA 4HORA 1KU2A 1RZ4A 4IRUA 4MRUA 1WG0A 1NBBA 3FTZA 3HLZA 4KVOA 2KW3C 3BEEA 2RG8A 3N0TA 3UMIA 3PZ1A 2C04A 1HY5A 1ZYRF 1JRAA 3NYJA 3EZHA 2X6KA 3ASFA 4XEVA 3S7JA 4XWJA 2CG2A 1FT1A 2HR2A 5AQAA 2EIJC 4BSXA 5FTPA 4GTPA 3D3MA 1SZIA 1V54E 3NDBB 4I6GA 1TN8A 3ASGA 4BWRA 4IYPA 3CK7A 3SXKA 5JVEA 2VQ2A 2OU6A 3HVEB 4KBQA 2KGOA 1N52A 1JWGA 1AUEA 4GMJA 3ECSA 3ZYQA 4MBGA 1SZ9A 3EHNA 3SFZA 4RD9A 4FX5A 5JJTA 1A5EA 1UJKA 3DSWA 1N4SA 1HE1A 4OINF 5B3IA 5G55A 1E86A 4A4AA 2OEVA 3UI2A 3CSTA 3HNIA 3C8GD 5B1AE 3T8KA 1M2OA 1LD7A 2I15A 3SBSA 1KNYA 3ENEA 1LI5A 2GRPB 4GTRA 3UKUG 4G25A 3G2SA 2PQRA 4IB4A 3PUKA 1TEZA 4AV7A 3ZKJA 1IQUA 1D0XA 3Q4AB 5KYNA 3UNGC 3QZCA 1NFNA 4HE8D 3MBGA 2OOEA 3G2VA 3TWTA 3ATPA 5L0GA 2KXPC 5BV0A 2C0MA 4TXPA 4JCZA 4K03A 5CEAA 2X38A 4AY5A 3K1HA 1Q2ZA 1K8KG 3PEVB 2L7AA 2PX3A 4EBAG 3DXKG 3ASOE 1U89A 3T9KA 5DS6A 2P9UG 2CYDA 3ABKC 4XEIG 4DPRA 4EBJA 2B0OE 3CK8A 4FLBA 3PREA 2OVBA 1KT1A 1TQGA 1D8EA 1ZU4A 3E70C 4IWBA 4J0UA 4E0HA 3N71A 2OJED 4B8CB 1V74B 2J45A 3N2ZB 3NF1A 4AY6A 1OW7A 1ORSC 2EPMX 3CSFA 4BJTA 2L81A 2XEEA 1XZPA 2JLBA 4TV3A 1Z5SC 4ME2A 4J8DA 1JMWA 1NFOA 3W4YA 4IARA 4CSAC 4LLCA 5AJDA 5ARGA 4LDKA 3V2OA 1SYQA 2EIKE 3Q73A 1OCCC 3G2UA 3SNXA 2ZXOA 4MTFA 4FESA 2VSYA 3Q7AA 3LNRA 3E33A 4PS8A 2WVNA 4QI2A 2KCVA 1GW6A 1SVXA 2WXJA 3TQOA 5CIVA 3LJNA 4HBDA 5BXOA 5AJLA 3PEUB 2Y3DA 3KYIA 1NLXA 4TXQA 4CIPA 3EIQC 2I6HA 2IJGX 2I2OA 2Y3AA 5KYXA 3AJIA 3WXXA 4I3MA 3H2VA 2KBXA 3R9MA 3ZYKA 4KI2A 3G50A 1ORJA 3AG4C 2AXZA 2BTDA 1A7EA 5BXUA 4MLPA 3AG1E 1M2VB 1B89A 3QB2A 4G8KA 2AVKA 4C3BA 2WB7A 3UIPC 5F5HA 2P9SG 2QC9A 2PZIA 2L6GA 2BE5F 2VYIA 2WXNA 3E30A 4CT4A 1YDIA 1FVFA 4P29A 2BF0X 3Q15A 1AP7A 2R9RB 4R32A 4CDVA 1FPPA 2LQGA 4MVZA 3IEEA 2XXAB 4B6IA 2QTVA 4CGWA 3DSTA 5KNHD 3EU9A 3P2BA 2DIWA 3QARA 2YRFA 1YA7O 3ISMC 3D9JA 2A69F 4GTVA 3I4GA 3ASNC 1TWGA 2KC7A 3CVPA 3AS4A 3C3QA 4YNDA 3ZVVA 1R5ID 2PP4A 1AWCB 3NG1A 3S0XA 4KMOA 3VLDA 4FJYA 2MOWA 3FUKA 3TJ6A 4WABA 5ENPD 2X6IA 2LNIA 2NSGA 3DBSA 3CKCA 1YA9A 2DCPA 1VDYA 4EBKA 4DLQA 2V26A 3O55A 2J8SD 3EG9A 5JRAA 2FFHA 3WHNA 3DPYA 4V3IA 3U3FA 3EZIA 1J8MF 3SHFA 3CHMA 3J06A 4I2WA 5DLJA 3IHYA 4OD4A 5LP0A 4F7AA 5L0DA 5DBKA 4JXTA 4HOTA 1RW2A 3EPVA 3IQ6A 3AG2E 4CIHA 4OYSA 2CFUA 1VYIA 3SEOA 4DUIA 4NQFA 3RVYA 3LXUX 4FJZA 4CGVA 3U9JA 1BR1A 3U3WA 3LY8A 3MX3A 2DYSE 1QZ2A 3CVUA 1H0AA 2ILRA 4O1OA 4JB8P 1HG5A 3LEOA 3RFYA 1OCOE 1WDYA 1K1AA 3RRNB 4OIRF 1L3PA 1LF8A 1C02A 2GFHA 3ZIBA 2WXIA 3CHQA 4DI4A 5KJNA 2J9VA 4MTGA 2FI7A 4BG0A 1IHGA 3VLFA 4NTFA 4UWFA 4L23A 3FTSA 1N1CA 5EGYA 4YT4A 3NKDA 1KTMA 3SO8A 3ZG1A 1JPNA 5L0FA 4CS9C 5K0IA 3DM5A 2XCBA 4E7SA 4CRWA 4CCAA 4WGYA 4G1TA 4Q94A 1N11A 3FUNA 3AGUA 3EU5A 4GTTA 4ILHB 4H7XA 2XGMA 1UG3A 2MRIA 3TWVA 1ZZPA 1IZMA 5EN5D 2GGFA 4JCHA 1YARO 1RCPA 2QFCA 3FTUA 3LS8A 3PZ4A 2LUHA 4O6FA 1CGOA 1TWHA 2HMQA 3PE4A 4RLYA 5ENQD 3PHF2 1OCRE 2Y39A 2WZGA 1RKEA 1ZHTA 3ABMC 3TWWA 3V79K 4KVMA 1Z6AA 4HI8A 4H7YA 1X5BA 5KJLA 3FVYA 2A0UA 3LJBA 4DRHB 2LXMA 2J0WA 1ELRA 4C7OA 1UJJA 2PM6A 2WXHA 3CVVA 3APFA 4RSYA 1K1BA 4HRNA 1S70B 4I1MA 1IXVA 2V4LA 2J0XA 3UGPA 4PACA 3CZ6A 5A23A 2P9NG 1NZNA 2IO3C 2X6JA 2TMVP 4DX7D 3MGBA 4I2ZA 2DGJA 5D66A 1DNPA 3FH7A 3EHMA 1QSPA 5D0QD 4Z68A 4Y6CA 3KPHA 3UM2A 3L34A 3ZYMA 3UXGA 3ZU7B 4EWCA 4U9DA 1MX2A 3OA1A 3QK0A 4KXKB 4LNBA 3L8IA 4CDNA 2YKZA 4PK4A 3URZA 3L22A 2XL6A 3G4ZA 1YYJA 2WXFA 4C0MA 5BQHA 3M1CB 3KS2A 4U8VD 2KK1A 2DWZA 4KT6B 5JA4D 1L5JA 3HXBA 3X2QC 3TAXA 2RKKA 3Q9NC 1O1TA 2ZU6B 4KBLA 2H6IA 4GA1A 1EF1C 5C1DA 2WXQA 5CECB 3PVLA 4HVBA 1F1MA 4JTDB 4U0UA 3FTXA 1UG7A 4MVMA 4L7TA 3ZYLA 4H54A 3IHVA 3IV0A 4BX8A 1JCRA 2MHRA 2XRYA 1YYXA 4IGGA 3F47A 3MZLB 3V31A 4E17A 2WXRA 4J8YA 4EUKB 3HTKC 2Y0BG 2KC3A 4CYMD 3L16A 4K1OA 4MVSA 3RIPA 3AU5A 4XLPF 3VLEA 3A9CA 1DOVA 1T6QA 1LD8A 4JL0A 3TD7A 4GYYA 4EQFA 1SQMA 5LOZA 3BQOA 4Q4ZF 4BTBA 4O7GA 1ZVZA 3FAPB 3PCVA 4IAQA 2J09A 4AVXA 5KYWA 3CQGB 2GRQB 3LEWA 5JS5A 3LS1A 3TGOA 1H2UA 3S27A 3LESA 2ZXWC 1FMWA 2WMNA 1BR2A 4NTBA 5JHAA 2WZLA 5EILA 1QVXA 4K0DA 1HFAA 2IO2C 2VASA 3MYIA 2WXLA 3G2TA 3JQ1A 2PF4E 2VJ8A 1ZW2A 4U5CE 256BA 2YQYA 4G7ZF 3FTYA 3PH0C 2UY1B 2ASRA 4NC3A 3TL5A 2FO1E 2P9LG 3QJZA 3RYLA 1Q0FA 4LNGA 3K9IA 4MW3A 3GWLA 3OXGA 4DX6D 3C3OA 3TWSA 2ETCA 2ETAA 4HS2A 4J8EA 4UWLA 2XPZA 1NL4A 2Q7FA 3VTYA 3NMIA 2WMOA 1BD8A 4QFVA 1I5NA 1N54A 2YHCA 4AEZC 5A7DB 1NA3A 2YVKA 2IOLA 2IEJA 3NB2A 3HNLA 4BEJA 2WXGA 1IW7F 2Q9AA 1OCZE 4WWOA 3AGTA 4UQZA 3FDQA 3S7BA 4JZYA 4U96D 1QKRA 1S05A 4I43A 3FH5A 2C0LA 1E8XA 2KYHA 4MQ9F 3T5VA 4OIPF 1LVKA 2A6HF 3EHRA 1NU9C 4N5QA 2LAIA 1RJ9B 1NFIE 2UUIA 1HW1A 2XL8A 2C2LA 4GCNA 4PUCA 3EGXB 4L9PA 2GROB 2R2LA 5BT1A 4R7LA 5B3SC 2A5EA 2FULA 1H2VC 3MA5A 3UQ3A 5B1BC 5EDSA 3H2UA 3U0CA 3AG3C 3ULEG 3UM3A 4ABNA 4G11A 4XKBA 1ST6A 3JUIA 4RG9A 4U5GA 5JMND 5JJ7A 4YDOA 4YK5A 4FA6A 1E8WA 4WUYA 1Z3IX 4JVSA 3ZHEA 3OXLA 2VH3A 3FTWA 1N4PA 3DEOA 4GA2A 4O1PA 4L1BA 3JT1A 3JQ0A 2EIJE 3IQTA 1DCQA 4YT2A 3D9PA 4DK5A 1WY6A 2G3VA 2IOQA 3T6JA 3B7TA 2VTBA 3Q6MA 2R7TA 3U3BA 5HQ8A 2QUPA 3WODF 4PS3A 4MVQA 3QKYA 4GMLA 5HRYA 3M4BA 4BJ6A 3UMKA 2XLHA 2R03A 1ORYA 4W9RA 5ENNA 4ANVA 1V55E 5AC4A 3E37A 4GPKA 3EGDA 3PNLB 3IHUA 2Y69C 3V5XA 3SZ7A 2VSXE 4BESA 3ZDLA 4HFFB 1E2XA 5F28E 3LJ3A 2J4BA 3FUHA 5HSWA 1K04A 3GORA 3AJMA 4C48B 2NYJA 3Q79A 3HG0D 2HMZA 2QY7A 4YDWA 4PJJA 4FULA 3PS6A 2RD9A 4WNGA 5LCWC 2XLEA 4N06A 4NY3A 2DB4A 3RRUA 2VCBA 3HKKA 4ANWA 2XCCA 5BUOA 2WQHA 5CCMA 1WWPA 4ZLCA 3FU0A 2HSBA 3KAEA 5JJ6A 3HNKA 1OXKA 5CI9A 4JC7A 3ABLC 3RVZA 1QPUA 3ZVRA 3NQPA 4YVOA 1HMDA 3Q6NA 4LG6A 4C9BB 1S0PA 3AAAC 3ZN3A 4K5AB 3MYVA 4BJ5A 3ABKE 3CHPA 3D9LA 1JR8A 2PBEA 3DWLG 2VGXA 3SP1A 5CEDB 3PDNA 4U95D 2A1DD 5COGA 1ELWA 3FEYA 3B29A 2WVQA 2J7PD 3EJNA 4JZAA 1Y4CA 4G24A 2F8YA 3EDTB 4YT5A 4YT8A 2YL7A 4E0IA 4GTOA 4LSZE 2HFIA 2EINC 2M4EA 4WWPA 1W2WA 3NZUA 4P9FA 1BLXB 3DEPA 4JHJA 1EA8A 4GYOA 1G4US 4JJGA 2XZDG 1XGWA 1ZHWA 2PM7A 1IKND 1OCCE 3MFNA 5KYYA 3EQLF 3FWVA 4QQIA 1Z23A 3FTVA 1APCA 1ZHZA 2HS5A 2W4BA 2R5SA 5A6AA 3D9KA 3M79A 4JC8A 2XS1A 3EG9B 5EK0A 5G2NA 1NI1A 1UN9A 1ZHXA 5FQ8A 2PQNA 1V4AA 4KYOB 2BC5A 1MMGA 4FHKA 3PNTB 4WGZA 3QW0A 3O4ZA 1JUQA 2L6JA 3LVQE 4U5FE 2QNLA 3T9OA 3KEAA 1EDUA 5JHBA 3AQCA 4WNFA 3FAJA 1LS4A 3J5QB 5AC5A 3F46A 4OD5A 2EIMC 1TJCA 3SYNA 3CR3A 3AG4E 3O48A 3FU5A 4TXRA 4F3VA 2HM8A 2F0YA 2EQXA 3ZQYA 4D10C 4GTQA 2J9QA 1Z5ZA 1AVOB 2OV8A 2W45A 4HNAD 4XI9A 3LLIA 3B7RL 4ATZD 4F1PA 4CS8C 2A5UA 5AYWD 3U8PA 2IYLD 4E6HA 2PX0A 3FDHA 4MTOA 1WM5A 3C62A 4B93B 2XL4A 3CKBA 2DYRC 4E7ZA 4N6HA 2X51A 2GRNB 2A0BA 2OVFA 3UT4A 3SXYA 3TXNA 1V54C 3LAYA 1E90A 2P9KG 3VYWA 2G3KA 2W4MA 5ARFA 5FINA 3KKBA 3K1IA 4EZLA 1E96B 4BEPA 2XENA 1TR2A 5FIOA 3W9GA 1HU3A 4DVZA 2YHSA 3EFOB 4H4KC 2CHZA 1H9TA 1E8YA 4IN3B 3GM2A 4APFA 3TOMA 3ULQA 4K5CA 1LKXA 3ESKA 4BETA 4P6IC 2LIGA 3TK0A 1S7ZA 4AL0A 1HH8A 1FT2A 4JEAA 1U3CA 2DZOA 2XZTG 3L17A 3JYHA 3T5XA 3S2AA 1E85A 4CZ2D 3B95A 3S7FA 3M4CA 4U8YD 4DX2A 4HFGA 5FQ4A 4WJ0A 4JHKA 4M7CA 4OAUC 4F4BA 3NKEA 4O6MA 5G05C 4U8HA 4MW8A 4TRQA 4I1AA 3QMKA 2HV6A 2B0HA 4G78A 1PC2A 3IQCA 5AQ7A 5DQZA 2IONA 4F1SA 3EIJA 2H7BA 4OAVB 4G7HF 3VTXA 3DXJF 1LS1A 3ZTZA 5LCWJ 2Y4UA 5L3QA 3FUJA 5BPPA 2VGYA 3MCXA 1MMAA 2LK4A 3BU8A 4Z9JA 4HOSA 1LPEA 1T9KA 3UINC 3NOCD 4XPWA 2PL2A 1T5OA 1INZA 4ACLA 5H7PA 4DJAA 1OW6A 3KYJA 2R7RA 2NSFA 4EPZA 2YLIA 2BUGA 3GWNA 3JRTA 3O10A 2UUHA 1MQSA 3CQCB 3HVEA 1WAO1 3DXMG 1N95A 2XM0A 5IY5E 2YL1A 2EIKC 4F53A 4YDYA 4BERA 1A17A 2PNNA 2X6HA 3RU0A 1T6IA 1O3UA 1K40A 2XLMA 3E9VA 3FP3A 4JURI 3HNJA 3LCAA 3Q49B 3C5RA 2IQCA 2YHEA 3R7CA 3TG5A 4XLNF 1FNTc 4EBBA 5A6CA 1AEPA 2X6FA 2JX0A 3ML8A 3ABME 1RMVA 1DOWA 3UM1A 3KL4A 1NU7D 1LE2A 2XLOA 2KCLA 3HHMA 5BV1A 2OG2A 5L3VA 3MYFA 1BPOA 2XEVA 2WQ7A 3QOUA 4DRIB 4EZKA 4I6EA 4PJMA 1H6PA 4ULVA 4UWGA 3ZXSA 3U4TA 2D4UA 3RKVA 1U2VG 4O79A 2YL0A 1UW4B 1U3DA 2GA0A 3W9FA 4JKVA 3I5QA 1I4ZA 4OIOF 1YLMA 3PE3A 3ULYA 3UUXA 1WGWA 1VTMP 1QNFA 3GZSA 5EYPF 4L2LA 4G23A 1TYQG 4UI9C 3RQGA 2XGOA 4XKCA 2H7VC 5ITZF 2Z15A 3W2VA 1K05A 2V5QC 2NUTB 3FXHA 3HDXA 3D9MA 5M72A 3R2PA 3A11A 5T3TA 5CMYA 5JP7A 4CSAA 3NBNB 2LXLA 5AIJA 2A68F 3IBEA 1WASA 3CVQA 5KJMA 3UX4A 4B0ZA 1TNZA 1SW6A 3KH2A 1OT8A 2YQ8A 4JHRA 5EX3A 4BTAA 2HE0A 4A1GA 3X2QE 2PFDA 4HLLA 1N4QA 1ZB1A 3DAGA 1GQAA 5D92A 5AN8A 3GM1A 4FLHA 4A3VA 5AGFA 2HKVA 4NQ0A 3IQ5A 4XPYA 1JPLA 1HZ4A 2AXVA 2Y1LE 1T01A 4U5HA 4G26A 4YL1A 3TJPA 1OY3D 2FO7A 4G8LA 3JUEA 5T4YA 3GZ1A 3SXZA 5A6KA 3Q75A 1HG2A 2KZTA 5KCMA 2GWWA 2OCCC 3QVZA 4A1SA 2HJMA 1PV3A 1OWPA 4LACB 4FAPB 2H8AA 4JRZA 2J4DA 2XRHA 3SNHA 3AG2C 3RIBA 3CGHA 3HXDA 3B71A 2QY9A 3E32A 4OVUA 1H7IA 3OEOA 4GQHA 1NSGB 1HE8A 1E8ZA 1FTSA 4NRHB 3HXCA 2EPNA 4GTMA 2ZXWE 3L9TA 1M2VA 4CS7A 4CT0A 3ASDA 3SZRA 3B0VC 3K33A 3OWTA 3C72A 3UGOA 3TXMA 2J08A 3SBTB 3ZFWA 2J46A 4E18A 3UTMA 3U9WA 5KNGA 4LUNU 2MHKA 4AE4B 5DS4A 2WXOA 5G05J 3ZHEB 3APCA 3U9MA 5FT9A 4JEUA 2XXAA 2NUPB 4PJNA 4OIQF 3L1MA 1TNOA 2WPVA 3RW0A 3MJWA 5CBNA 1LI7A 1YAUO 1E7VA 5DIZA 2ZD9A 4XIFA 3WG7C 1TNYA 2IOSA 3UM0A 1EI7A 3DRAA 4JTAB 1G3NB 1UFBA 4IAOA 1Z3XA 5T1DB 1H6OA 3V5ZA 3C8ZA 3RRMB 2CNWD 4ZHBA 4FWVA 2I1KA 2XQ0A 1BR4A 2ONDA 4N2QA 1CPRA 3C98A 4PJLA 1S63A 5FZTA 5BQIA 2GW1A 5KYUB 3K66A 3ZXPA 2H6HA 5AQBA 2F8XK 1TNBA 3CVNA 4U5EE 2EILE 1HX8A 3Q47B 3GODA 4LCTA 4J8SA 5HKPA 1MJ0A 3DKAA 3FHDA 2WZFA 4AM9A 1Z7Qc 3N24A 4B89A 1WTYA 5B3SE 2P0NA 4KNVA 3JYSA 3HXFA 5FQ7A 3CVYA 1BDJB 4D4NA 5B1BE 3PZDA 5T3RA 4IJJA 2V3CC 3UMVA 3DE8A 5CERB 4P9TA 4Q7CA 1YJGA 4U0ZA 3CVWA 3LVRE 3UKRG 3V30A 3NYLA 4BFRA 1Z6TA 4K5BA 5CCLA 2P58C 1QLEC 1Q0MA 2ZGDA 2IY0C 2VCAA 2Y3BA 4DX1A 2OJQA 1QQ3A 4JA7A 3CQZA 2V0PA 5EKQD 1VLTA 4BJ5C 3B9QA 5FZQA 5A6BD 1LIHA 3ZSUA 2R25A 4N3BA 3R7RA 4UI9J 2OOCA 1IHBA 1K3ZD 4FU3A 2HYZA 3QW1A 3DM9B 2JEKA 3TWXA 4UI9K 2J7PA 1Y6DA 3AOUA 5KYYB 4I9EA 2V4HC 2L6HA 4A2NB 4CDMA 2CFZA 3NOGD 3FUMA 4JA9A 3ZPJA 2Y69E 3FULA 2IF4A 5A6JA 1OW8A 3U5SA 5EHHA 1O1RA 4BSZB 1VLSA 2P61A 2AVPA 3C8GA 1SF8A 4M3OA 2MYSA 4CBEA 4I6JA 2VSOE 2R17C 2ZGGA 4YN0B 1OR3A
chains in the Genus database with same CATH topology
3LYAA 3L08A 3MV2B 2FEZA 1M57C 5E2QA 4EECA 3R7QA 4FADA 1VK5A 4N2SA 1D1AA 5DQTA 4GZ3A 4WWNA 3B0UX 1OKKD 4I1OB 4JPSA 1PAQA 4ANUA 3RJVA 4UQXA 3Q5MA 4YJWA 2WQ6A 3AS8A 5E76A 3AS5A 1TWAA 5D0OD 2KCKA 4BY6A 3LEVA 2Y3HA 3FUDA 1IYGA 1JWFA 4DLOA 3FFLA 3UT7A 3ML9A 4G2VA 5J90A 4ACKA 3U64A 1Y8MA 2HO1A 3D9IA 4A3TA 2IXOA 3ITFA 3K1IC 4GZCA 5ANLA 1OCZC 4WNEA 5KYXB 4XZ4A 4RVBA 5E3AA 5T3WA 3LY9A 3D9NA 4KC9A 2HV7A 3FY4A 4LERA 2ZXRA 5F5FA 2WXPA 2IXNA 2LSEA 3T6BA 3FU3A 1OWNA 2KNHA 2Q9CA 1HXIA 4EZJA 3I5PA 4WNDA 2UY1A 4PS7A 3QWVA 4X0RA 3CEQA 5E3CA 5BUZA 4JEHA 4CDRA 3X1OA 5DVWA 1Z63A 3MLGA 4U0SA 1V55C 2L9BA 4HLEA 1FVHA 4XTKA 3HYMB 1HF8A 3AU4A 4KZ0A 4U07A 2UWJG 4APOA 3CHSA 3DJNB 5AENA 4J8FA 1PY1A 3GW4A 4J6IA 1NP7A 3LS0A 3VAYA 3JCKC 1RJ9A 3MKQA 3DZAA 2CDQA 3EGXA 3L13A 1QQEA 2E2EA 2XPYA 3I3NA 2AXUA 4QI0A 5ANRA 2ZXPA 4FP7A 1NG1A 3APDA 4MNDA 1PCXA 4GB9A 4PFPA 1NA0A 2ZPAA 3Q7GA 3NZSA 4URKA 2AW6A 4XX5A 1IQRA 2KJGA 2C03A 1Z3YA 2CHXA 2XRZA 3QWPA 2JD3A 3Q7LA 4RBNA 4C3EA 3ZEFA 3B13A 3D9OA 3S28A 4GZDA 1D0ZA 2WM9A 2NG1A 5B1AC 2G62A 3O39A 1OWLA 1QZXA 2IFUA 4HXIA 5DS5A 2KQ9A 2Q9BA 1EPUA 2KZTB 3LPZA 4G7OF 3UT8A 4C7OB 4MS6A 2I9CA 3BG0B 3KEZA 2XGSA 1H19A 3RO2A 1OWMA 1EYHA 3ASOC 4C0EA 1KT0A 1VYKA 1MMDA 1JPJA 2Q3TA 1Y6IA 2X3MA 4ILGA 2NC9A 3CK9A 1XNFA 2E0IA 2B0JA 3QC1A 4I17A 2IU1A 3L54A 3GANA 3CIAA 4XI0A 3CV0A 3AQBA 2Y3GA 4BX9A 1TKNA 5FQ6A 1W3BA 2R7VA 3CVLA 3JSZA 3FH8A 4AOFA 3ZW3A 2Y4TA 4YWQA 2XHEA 5FZSA 2YEVA 2CNWA 1O5HA 3RH3A 2LAHA 3CHOA 5KYWB 4LLEA 3G2WA 3S29A 3AG1C 4ZLDA 4GU5A 3U66A 3BG1B 4PDXA 5CMWA 4K7BA 3OTNA 3NYMA 3V7OA 4Q5SF 2YINA 4CS8A 4ULWA 2LSUA 2XPIA 1ZU5A 4U63A 3L6AA 2YNQA 1OWOA 3ONLA 4AX2A 4O6NA 4Q69A 1FCHA 4GYWA 3ZC4A 2FGYA 1ZU2A 3RKOF 2L0IA 3OAWA 4GCOA 3CHRA 4YVQC 3B7SA 4DBQA 3DMDA 3KMIA 3EH2A 2V8SE 1FMVA 4HEAJ 2WL8A 1H6KA 5IY5C 3SGHA 3EFOA 4AP2A 4UQYA 4E85A 3FUIA 1TJFA 2D5RB 1FFHA 5FJYA 4ANJA 4RG6A 4W8KA 4J30B 1O87A 3FHEA 3OXFA 2J07A 1ZHYA 2R59A 2XSEA 4HOQA 3I4UA 5CI8A 1D1CA 4FC8A 2DYSC 3LLKA 1DVPA 4XE0A 3L0IA 1HO8A 3UPVA 1OCOC 4HFKB 3FUEA 2CHWA 3PUJA 2KM4A 3K7DA 3IKOB 2FF4A 5BNWA 4UWKA 3RO3A 2R7XA 3FU6A 2P7VA 3S7DA 5LFAA 3DD7A 3SI5A 4QDLA 3H65A 3NRHA 1J8YF 2VTBB 2R7UA 3IEGA 5BW8C 4DOZA 4B94A 5E75A 3T8MA 4HOUA 2GRLA 4ANXA 4J32B 1P5QA 3HIZA 4TUUA 3W8IA 1OKKA 3O6XA 4Y6WA 3TG4A 2YZSA 2LO6A 3EGDB 1ZBPA 1HS6A 3QDNA 4BJ1A 2J9WA 1M56C 4N3CA 3ZIMA 1VMAA 4BJ6C 1UN8A 3P1UA 1OCRC 2WXKA 3PRZA 2R7SA 3SD5A 2CG3A 3DPDA 5G04C 4DVYP 1H2TC 4GA0A 4I44A 3E4BA 2E87A 3ZGQA 3CLJA 4K0RA 1FFTC 5E33A 4GZ5A 4AXHA 5J08A 4UWHA 2J49A 1PD0A 2WVIA 5C2YA 4JJFA 4GZ6A 2AWIA 3DAFA 3QWWA 3KD7A 4ILIA 3SF4A 4M63A 4PFOA 2CGEA 4C3DA 3POVA 3EH1A 2L0TB 1SZAA 1G8XA 4CS9A 3R9AB 2VSNA 4U04A 5LX8A 2VGXB 4PH4B 4JW1A 4O6YA 2WXMA 1D0YA 3FUFA 3UMHA 5EX0A 4AK9A 2NUTA 3I4RB 5T8IA 4RDAA 4LRZA 4GYTA 2DBAA 4DI3A 2RD0A 1ELKA 5FZRA 3HJCA 2VB6A 2MWQA 4CEMA 3B0PA 4BT9A 1E7UA 4KZCA 5FWQA 4G0HA 4NURA 2P6VA 3ZRHA 4GEHA 3ESLA 3RK6A 1OUVA 1VOMA 1YA0A 4WAFA 1MHQA 2R7WA 5HI7A 4BT8A 4N39A 4AIFA 2IXPA 3CSKA 2EILC 3MEKA 1TWCA 3T4RA 3UR3C 4OVVA 4Q96A 2NSZA 4U5BE 2R7OA 3MKQB 2I1JA 5CHEE 2FBNA 3DJUB 3CVXA 2LSVA 4IULA 3MV3B 2I8BA 3GZ2A 3FEXA 4NACA 4FHJA 1D1BA 3LY7A 4DBRA 3W2WA 1NZEA 3B7UX 2H7OA 4ATGA 3QAQA 4MKTA 3GYZA 3LKUA 2O9XA 4AE4A 3QNKA 5D91A 2IXMA 2NUPA 1PD1A 2M63A 4GAAA 1MNEA 2NXPA 2GRMA 4AJWA 2A4ZA 2R7QA 3JCUQ 2WVOA 4N5CA 3LDZA 3W8HA 4U5DE 5KJKA 2L9JA 1KLXA 3ASHA 4N3AA 1MNDA 1SMYF 4KNWA 4LEUA 1MMNA 2CW0F 4I9CA 5FCLA 4A55A 4EBAA 2V5FA 2KATA 3K6BA 3MKRA 5KYUA 2J9UA 3ONKA 4B8AA 2WB2A 2W9YA 2A6EF 4L2YA 3PMRA 5G04J 4HORA 1KU2A 4IRUA 4MRUA 3FTZA 3HLZA 4KVOA 2KW3C 3BEEA 2RG8A 3N0TA 3UMIA 2C04A 1ZYRF 3NYJA 3EZHA 2X6KA 3ASFA 3S7JA 4XWJA 2CG2A 2HR2A 2EIJC 4BSXA 5FTPA 3D3MA 1SZIA 3NDBB 4I6GA 3ASGA 4BWRA 4IYPA 3CK7A 2VQ2A 3HVEB 4KBQA 2KGOA 1N52A 1JWGA 4GMJA 3ECSA 3ZYQA 1SZ9A 3EHNA 3SFZA 4RD9A 4FX5A 5JJTA 1UJKA 4OINF 5G55A 3CSTA 1M2OA 3SBSA 3ENEA 4G25A 3G2SA 2PQRA 3PUKA 1TEZA 4AV7A 1IQUA 1D0XA 3Q4AB 5KYNA 3UNGC 3QZCA 4HE8D 2OOEA 3G2VA 5BV0A 2C0MA 4K03A 2X38A 4AY5A 3K1HA 3PEVB 2PX3A 4EBAG 5DS6A 3ABKC 4DPRA 3CK8A 4FLBA 3PREA 2OVBA 1KT1A 1ZU4A 3E70C 4IWBA 4J0UA 3N71A 4B8CB 2J45A 3N2ZB 3NF1A 4AY6A 3CSFA 4BJTA 2L81A 2JLBA 4TV3A 4ME2A 4J8DA 4CSAC 4LLCA 5AJDA 5ARGA 1OCCC 3G2UA 3SNXA 2ZXOA 4FESA 2VSYA 3LNRA 4PS8A 2WVNA 4QI2A 2KCVA 1GW6A 2WXJA 5AJLA 3PEUB 2Y3DA 3EIQC 2I6HA 2IJGX 2I2OA 2Y3AA 5KYXA 3WXXA 4I3MA 3ZYKA 4KI2A 3AG4C 2AXZA 2BTDA 4MLPA 1M2VB 1B89A 4C3BA 2WB7A 5F5HA 2PZIA 2BE5F 2VYIA 2WXNA 4CT4A 1FVFA 4P29A 2BF0X 3Q15A 3IEEA 2XXAB 4B6IA 2QTVA 4CGWA 3P2BA 2DIWA 3QARA 3D9JA 2A69F 3I4GA 1TWGA 3ASNC 2KC7A 3CVPA 3AS4A 4YNDA 3ZVVA 2PP4A 3NG1A 3S0XA 4KMOA 3VLDA 4FJYA 2MOWA 3FUKA 2X6IA 2LNIA 3DBSA 3CKCA 2DCPA 1VDYA 4DLQA 2V26A 3EG9A 2FFHA 4V3IA 3EZIA 1J8MF 3SHFA 3CHMA 4I2WA 5DLJA 3IHYA 4OD4A 5LP0A 4F7AA 5DBKA 4JXTA 4HOTA 3EPVA 4CIHA 4OYSA 2CFUA 1VYIA 3SEOA 3LXUX 4FJZA 4CGVA 1BR1A 3U3WA 3LY8A 3MX3A 1QZ2A 3CVUA 1H0AA 2ILRA 1HG5A 3RFYA 3RRNB 4OIRF 1LF8A 2GFHA 3ZIBA 2WXIA 3CHQA 4DI4A 5KJNA 2J9VA 2FI7A 4BG0A 1IHGA 3VLFA 4UWFA 4L23A 3FTSA 1N1CA 5EGYA 4YT4A 3NKDA 3ZG1A 1JPNA 4CS9C 3DM5A 2XCBA 4E7SA 4CRWA 4CCAA 4G1TA 4Q94A 3FUNA 4ILHB 4H7XA 2XGMA 1UG3A 2MRIA 1IZMA 2GGFA 4JCHA 2QFCA 3FTUA 3LS8A 4O6FA 1TWHA 3PE4A 3PHF2 2Y39A 2WZGA 1ZHTA 3ABMC 4KVMA 1Z6AA 4H7YA 1X5BA 5KJLA 3FVYA 3LJBA 2J0WA 1ELRA 4C7OA 1UJJA 2PM6A 2WXHA 3CVVA 3APFA 4RSYA 4I1MA 2V4LA 2J0XA 3UGPA 3CZ6A 5A23A 1NZNA 2X6JA 3MGBA 4I2ZA 2DGJA 1DNPA 3FH7A 3EHMA 5D0QD 4Y6CA 3ZYMA 3L34A 4EWCA 3OA1A 3QK0A 4KXKB 4CDNA 4PK4A 3URZA 3L22A 2WXFA 4C0MA 3M1CB 3KS2A 4KT6B 1L5JA 3X2QC 3TAXA 2ZU6B 4KBLA 4GA1A 1EF1C 5C1DA 2WXQA 3PVLA 4HVBA 4U0UA 3FTXA 4L7TA 3ZYLA 3IHVA 3IV0A 4BX8A 2XRYA 3F47A 3MZLB 2WXRA 3HTKC 3L16A 3RIPA 3AU5A 4XLPF 3VLEA 4JL0A 3TD7A 4GYYA 4EQFA 1SQMA 5LOZA 4Q4ZF 4BTBA 4O7GA 2J09A 4AVXA 5KYWA 3CQGB 3LEWA 3LS1A 3TGOA 1H2UA 3S27A 3LESA 2ZXWC 1FMWA 2WMNA 1BR2A 5JHAA 2WZLA 4K0DA 1HFAA 2VASA 2WXLA 3G2TA 3JQ1A 2PF4E 2VJ8A 4U5CE 4G7ZF 3FTYA 3PH0C 2UY1B 3TL5A 3QJZA 3RYLA 3K9IA 3OXGA 4HS2A 4J8EA 4UWLA 2XPZA 2Q7FA 3VTYA 2WMOA 4QFVA 1N54A 2YHCA 4AEZC 5A7DB 1NA3A 2IOLA 4BEJA 2WXGA 1IW7F 2Q9AA 4WWOA 4UQZA 3FDQA 3S7BA 4JZYA 4I43A 3FH5A 2C0LA 1E8XA 4MQ9F 3T5VA 4OIPF 1LVKA 2A6HF 1NU9C 2LAIA 1RJ9B 2C2LA 4PUCA 4GCNA 3EGXB 5BT1A 4R7LA 5B3SC 2FULA 1H2VC 3MA5A 3UQ3A 5B1BC 5EDSA 3AG3C 4ABNA 4G11A 4XKBA 1ST6A 3JUIA 4RG9A 4U5GA 5JJ7A 4FA6A 1E8WA 4WUYA 1Z3IX 4JVSA 3ZHEA 3OXLA 2VH3A 3FTWA 4GA2A 4L1BA 3JT1A 3JQ0A 4YT2A 3D9PA 4DK5A 1WY6A 2G3VA 2IOQA 3T6JA 3B7TA 2VTBA 3Q6MA 2R7TA 5HQ8A 3WODF 4PS3A 3QKYA 4GMLA 4BJ6A 3UMKA 4W9RA 5ENNA 4ANVA 4GPKA 3EGDA 3PNLB 2Y69C 3SZ7A 2VSXE 4HFFB 3LJ3A 2J4BA 3FUHA 5HSWA 2QY7A 4PJJA 4FULA 3PS6A 4WNGA 5LCWC 4N06A 4NY3A 3RRUA 4ANWA 2XCCA 5BUOA 2WQHA 5CCMA 4ZLCA 3FU0A 3KAEA 5JJ6A 5CI9A 3NQPA 3ABLC 3ZVRA 4YVOA 3Q6NA 4C9BB 1S0PA 3ZN3A 3MYVA 4BJ5A 3CHPA 3D9LA 2VGXA 3SP1A 3PDNA 2A1DD 3FEYA 1ELWA 2WVQA 2J7PD 3EJNA 4JZAA 4G24A 3EDTB 4YT5A 4YT8A 2EINC 2M4EA 4WWPA 1W2WA 3NZUA 4JHJA 4GYOA 4JJGA 1XGWA 1ZHWA 2PM7A 5KYYA 3EQLF 3FWVA 1Z23A 3FTVA 1ZHZA 2R5SA 2W4BA 3D9KA 4JC8A 3EG9B 5G2NA 1UN9A 1ZHXA 5FQ8A 2PQNA 4KYOB 1MMGA 4FHKA 3PNTB 3O4ZA 1JUQA 2L6JA 3LVQE 4U5FE 1EDUA 5JHBA 3AQCA 4WNFA 3FAJA 3F46A 4OD5A 2EIMC 1TJCA 3SYNA 3CR3A 3O48A 3FU5A 4F3VA 2HM8A 2EQXA 4D10C 2J9QA 1Z5ZA 2OV8A 2W45A 4XI9A 3LLIA 3B7RL 4CS8C 2A5UA 5AYWD 2IYLD 4E6HA 2PX0A 3FDHA 1WM5A 2XL4A 3CKBA 2DYRC 4E7ZA 2X51A 3UT4A 2OVFA 3TXNA 1V54C 3LAYA 1E90A 3VYWA 2G3KA 2W4MA 5ARFA 3KKBA 4EZLA 1E96B 1TR2A 1HU3A 4DVZA 2YHSA 3EFOB 4H4KC 2CHZA 1E8YA 4IN3B 4APFA 3ULQA 1LKXA 3ESKA 4P6IC 3QB2A 1S7ZA 1HH8A 3L17A 1U3CA 3JYHA 3T5XA 3S2AA 3S7FA 4HFGA 5FQ4A 4WJ0A 4JHKA 4F4BA 3NKEA 4O6MA 5G05C 4U8HA 4TRQA 4I1AA 3QMKA 2HV6A 1PC2A 5DQZA 2IONA 4F1SA 3EIJA 2H7BA 4G7HF 3VTXA 3DXJF 1LS1A 5LCWJ 2Y4UA 5L3QA 3FUJA 5BPPA 2VGYA 3MCXA 1MMAA 4HOSA 2PL2A 1INZA 4ACLA 4DJAA 2R7RA 4EPZA 2BUGA 3JRTA 1MQSA 3CQCB 3HVEA 1WAO1 2EIKC 4F53A 1A17A 3RU0A 2X6HA 3FP3A 3E9VA 3Q49B 4JURI 3LCAA 2IQCA 2YHEA 3TG5A 4XLNF 4EBBA 5A6CA 2X6FA 3ML8A 3KL4A 1NU7D 2KCLA 3HHMA 5BV1A 2OG2A 5L3VA 1BPOA 2XEVA 2WQ7A 3QOUA 4EZKA 4I6EA 4PJMA 4UWGA 3ZXSA 3U4TA 3RKVA 4O79A 1UW4B 1U3DA 3I5QA 4OIOF 3PE3A 3UUXA 1WGWA 1QNFA 3GZSA 4L2LA 4G23A 4UI9C 2XGOA 4XKCA 2H7VC 2Z15A 3W2VA 2NUTB 3HDXA 3D9MA 5M72A 5T3TA 5CMYA 4CSAA 5AIJA 2A68F 3IBEA 3CVQA 5KJMA 3UX4A 4B0ZA 3KH2A 2YQ8A 4JHRA 5EX3A 4BTAA 4A1GA 2PFDA 3DAGA 5D92A 4FLHA 4A3VA 4NQ0A 1JPLA 1HZ4A 2AXVA 4U5HA 4G26A 3TJPA 2FO7A 5T4YA 3GZ1A 1HG2A 2KZTA 5KCMA 2OCCC 4A1SA 1OWPA 4LACB 2J4DA 2XRHA 3SNHA 3AG2C 3RIBA 3CGHA 4OVUA 2QY9A 3OEOA 1HE8A 1E8ZA 1FTSA 4NRHB 1M2VA 4CS7A 4CT0A 3ASDA 3SZRA 3B0VC 3K33A 3OWTA 3UGOA 3TXMA 2J08A 3SBTB 3ZFWA 2J46A 3U9WA 4LUNU 2MHKA 4AE4B 5DS4A 2WXOA 5G05J 3ZHEB 3APCA 5FT9A 4JEUA 2XXAA 2NUPB 4PJNA 4OIQF 2WPVA 3MJWA 1E7VA 5DIZA 4XIFA 3WG7C 2IOSA 4IAOA 1Z3XA 5T1DB 3RRMB 2CNWD 4FWVA 2I1KA 2XQ0A 1BR4A 2ONDA 4N2QA 3C98A 4PJLA 2GW1A 5KYUB 3K66A 3CVNA 4U5EE 1HX8A 3Q47B 3GODA 4LCTA 4J8SA 3FHDA 2WZFA 4AM9A 3N24A 4B89A 4KNVA 3JYSA 5FQ7A 3CVYA 3PZDA 5T3RA 4IJJA 2V3CC 3UMVA 4Q7CA 4U0ZA 3CVWA 3LVRE 3NYLA 4BFRA 1Z6TA 5CCLA 2P58C 1QLEC 2Y3BA 4JA7A 3CQZA 2V0PA 5EKQD 5FZQA 4BJ5C 3B9QA 3ZSUA 4N3BA 3R7RA 4UI9J 4FU3A 2HYZA 3DM9B 2JEKA 4UI9K 2J7PA 5KYYB 4I9EA 4A2NB 4CDMA 2CFZA 3FUMA 4JA9A 3ZPJA 3FULA 2IF4A 5EHHA 2AVPA 1SF8A 4M3OA 2MYSA 4CBEA 4I6JA 2VSOE 2R17C 4YN0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HDX A;  3JQ0 A;  3KEZ A;  3CGH A;  4Q69 A;  5FQ6 A;  3MX3 A;  3SGH A;  3EHN A;  3NQP A;  3CK9 A;  3EJN A;  5T4Y A;  5LX8 A;  3JQ1 A;  5E76 A;  4F7A A;  5FQ8 A;  3OTN A;  3JYS A;  3EHM A;  3SNX A;  5FQ7 A;  3CK8 A;  4LER A;  5T3R A;  3P1U A;  4L7T A;  3MYV A;  3IV0 A;  5FQ4 A;  3QNK A;  4PUC A;  5E75 A;  3LEW A;  3GZS A;  3CKC A;  3FDH A;  3L22 A;  3MCX A;  3CK7 A;  4F53 A;  3CKB A;  5J90 A;  4MRU A;  3I4G A; 
#chains in the Genus database with same CATH topology
 3LYA A;  3L08 A;  3MV2 B;  4HQD A;  2FEZ A;  3B7B A;  3U2L A;  1M57 C;  2XLV A;  1TN7 A;  5E2Q A;  1CPQ A;  4EEC A;  2XLW A;  3S9O A;  4TUM A;  3R7Q A;  3TWQ A;  4FAD A;  5L0H A;  1VK5 A;  4MVU A;  1A7D A;  4N2S A;  2RFA A;  1D1A A;  3ABL E;  5DQT A;  2IBF A;  4MS2 A;  3C7J A;  4DXW A;  4EHP A;  2EPL X;  4GZ3 A;  4WWN A;  3B0U X;  1OKK D;  4I1O B;  4JPS A;  1PAQ A;  4ANU A;  3RJV A;  4UQX A;  3Q5M A;  4YJW A;  2WQ6 A;  1BZ4 A;  3AS8 A;  4J7T A;  2KSF A;  2BKK B;  2LFF A;  5E76 A;  2ZIR A;  4YDE A;  3AS5 A;  4ZFH A;  1TWA A;  4NIK A;  5D0O D;  2KCK A;  4BY6 A;  3LEV A;  2Y3H A;  3M15 A;  2ZIS A;  3V2X A;  3FUD A;  1A7V A;  1IYG A;  1JWF A;  4DLO A;  3FFL A;  3UT7 A;  3ML9 A;  3JSE O;  4ER9 A;  4G2V A;  4JTC B;  5J90 A;  4ACK A;  3DE9 A;  3U64 A;  2EIN E;  1Y8M A;  3DWW A;  2HO1 A;  3D9I A;  4A3T A;  2IXO A;  3ITF A;  1D8D A;  3K1I C;  4U9E A;  4GZC A;  5ANL A;  1OCZ C;  2P9I G;  3NMJ A;  2ICW G;  4WNE A;  5KYX B;  4XZ4 A;  1LM3 B;  4RVB A;  2BKG A;  5E3A A;  5KBA A;  5T3W A;  2IM8 A;  3LY9 A;  1I4Y A;  3D9N A;  5COM A;  4KC9 A;  3GM3 A;  3JTL O;  2HV7 A;  2EIM E;  3FY4 A;  4O60 A;  4LER A;  2ZXR A;  5F5F A;  3GEE A;  1WN0 A;  2WXP A;  3NAW A;  2IXN A;  2LSE A;  1KZO A;  1WOL A;  3T6B A;  3FU3 A;  5AAO A;  1H6G A;  4AL1 A;  3G4X A;  1OWN A;  2KNH A;  1OXB A;  2Q9C A;  3WAQ A;  1HXI A;  4EZJ A;  3I5P A;  4WND A;  2UY1 A;  4PS7 A;  3QWV A;  4X0R A;  1EKY A;  1TFK B;  3CEQ A;  3LNM B;  2DYR E;  2XEH A;  3V5Y A;  1N94 A;  5E3C A;  2XLD A;  1X81 A;  1ZW3 A;  5BUZ A;  4JEH A;  4CDR A;  3HXE A;  3X1O A;  5DVW A;  4Z9I A;  4HB5 A;  2ETB A;  4CDA A;  1Z63 A;  3MLG A;  4U0S A;  2P2C P;  1V55 C;  2L9B A;  4HLE A;  1MQV A;  1FVH A;  3NMK A;  4XTK A;  3HYM B;  3QTH A;  1HF8 A;  3AU4 A;  2EPO A;  4KZ0 A;  4U07 A;  2UWJ G;  4APO A;  1A41 A;  1MX4 A;  1YYH A;  3CHS A;  3DSS A;  2LP4 A;  3DJN B;  2Q00 A;  5AEN A;  4J8F A;  1PY1 A;  3SXM A;  5ENT D;  4JD2 G;  1Q0D A;  3GW4 A;  3BRJ A;  5ENR D;  4J6I A;  3DI5 A;  1UOH A;  1NP7 A;  3LS0 A;  3VAY A;  3JCK C;  1RJ9 A;  2HJ3 A;  3MKQ A;  3DZA A;  2CDQ A;  2M64 A;  3EGX A;  3DSV A;  1QQE A;  3L13 A;  2E2E A;  2XPY A;  2AP3 A;  3I3N A;  2AXU A;  5EIB E;  4QI0 A;  5ANR A;  1JCQ A;  5JLI A;  2ZXP A;  4FP7 A;  1NG1 A;  1GM5 A;  2R02 A;  3APD A;  4JEB A;  4MND A;  1PCX A;  4GB9 A;  4PFP A;  1HE9 A;  1NA0 A;  2ZPA A;  3Q7G A;  3NZS A;  2AWC A;  4URK A;  2AW6 A;  4XX5 A;  1JCS A;  3U8V A;  1IQR A;  2KJG A;  3VF0 A;  2C03 A;  4XEF A;  1QBQ A;  1Z3Y A;  2CHX A;  2XRZ A;  3QWP A;  2JD3 A;  3L8J A;  3Q7L A;  1KPS B;  3ASN E;  3T6G B;  5AQ9 A;  1KZP A;  4RBN A;  1T6U A;  3EUV A;  2JPU A;  4C3E A;  3PZ2 A;  3ZEF A;  3B13 A;  1TN6 A;  3D9O A;  4CJG A;  2HSQ A;  3S28 A;  4GZD A;  1D0Z A;  2WM9 A;  2YL3 A;  2NG1 A;  5B1A C;  2G62 A;  4GTS A;  3O39 A;  1D9S A;  1OWL A;  1QZX A;  4HRL A;  2IFU A;  1XZQ A;  4HXI A;  2MYO A;  5DS5 A;  2QYU A;  1RKE B;  1TNU A;  5JT4 A;  2KQ9 A;  4N6C A;  2PNO A;  2Q9B A;  1EPU A;  1XWJ A;  2KZT B;  3LPZ A;  5D2M C;  4G7O F;  3D9H A;  1GGQ A;  3UT8 A;  3CAX A;  4C7O B;  4MS6 A;  4NTA A;  2I9C A;  3S90 A;  3BG0 B;  3RAU A;  3KEZ A;  2AWY A;  2QYJ A;  5EYL A;  2XGS A;  5ENS D;  1H19 A;  2QLA A;  3RSE G;  1OR2 A;  4YL3 A;  3TWR A;  3RO2 A;  1OWM A;  5COF A;  2LD6 A;  4XEK A;  4EIY A;  1EYH A;  1DCE A;  3ASO C;  4C0E A;  3U2M A;  1KT0 A;  1VYK A;  1MMD A;  4LDR A;  3TJ5 A;  1E83 A;  4EHM A;  3SFX A;  1C03 A;  1FR0 A;  1JPJ A;  5EID A;  1N4R A;  2Q3T A;  1Y6I A;  2X3M A;  2J8W A;  3US6 A;  4ILG A;  5CRV A;  2NC9 A;  3CK9 A;  1XNF A;  3J5P A;  1QYM A;  2E0I A;  2B0J A;  2YLD A;  3ZUV B;  4J7Y A;  3QC1 A;  3UIO C;  4I17 A;  2IU1 A;  3L54 A;  3GAN A;  1G4W R;  2X0C A;  2JAB A;  3GEH A;  1L7C A;  3CIA A;  4XI0 A;  2F37 A;  3AQB A;  2Y3G A;  3CV0 A;  4BX9 A;  2ETS A;  1TKN A;  5FQ6 A;  1W3B A;  2R7V A;  3CVL A;  3JSZ A;  4CX9 A;  3FH8 A;  2GAQ A;  3CEX A;  3F6Q A;  4AOF A;  3ZW3 A;  2Y4T A;  1O5M A;  4YWQ A;  3TUL A;  5JSL A;  1TFO B;  2XHE A;  5FZS A;  1JOG A;  2YEV A;  2CNW A;  1O5H A;  2QZA A;  3RH3 A;  2LAH A;  1YMP A;  3CHO A;  5KYW B;  4LLE A;  2OCC E;  5CRU A;  3G2W A;  3S29 A;  4UDV A;  3AG1 C;  4ZLD A;  3ZTM A;  2XS8 A;  4GU5 A;  3U66 A;  5CBO A;  3BG1 B;  4PDX A;  5CMW A;  4K7B A;  3OTN A;  3NYM A;  3V7O A;  4Q5S F;  1LTX A;  2YIN A;  1G5Z A;  4CS8 A;  4ULW A;  1SA4 A;  2LSU A;  4ONS A;  2XPI A;  1ZU5 A;  4U63 A;  3L6A A;  3IPM O;  2YNQ A;  2NPU A;  3IXE A;  4LNU D;  1OWO A;  3ONL A;  4AX2 A;  4O6N A;  2L6F A;  2DVW A;  4Q69 A;  1FCH A;  4GYW A;  3ZC4 A;  2FGY A;  1ZU2 A;  2GRR B;  3RKO F;  4UUC A;  4J7W A;  2L0I A;  3OAW A;  4D4X A;  2CCY A;  3FMS A;  4GCO A;  3CHR A;  4YVQ C;  3B7S A;  3LUT B;  4DBQ A;  3PDM P;  3DMD A;  3KMI A;  3EH2 A;  5HV9 A;  1DC2 A;  2V8S E;  1FMV A;  2OEX A;  1BU9 A;  4HEA J;  2WL8 A;  1H6K A;  1TR4 A;  2P1A A;  3ZNG A;  5IY5 C;  2BED A;  3SGH A;  3WG7 E;  1MYO A;  3EFO A;  4AP2 A;  2YWA A;  4UQY A;  4E85 A;  3FUI A;  3RQF A;  1RKC A;  1TJF A;  2AU5 A;  2D5R B;  1FFH A;  5BQG A;  3RF3 A;  5A6B A;  4GPM A;  5FJY A;  4CJO A;  2Q4F A;  4ANJ A;  4W8K A;  4RG6 A;  4J30 B;  5L0J A;  1O87 A;  4DRX E;  1OXJ A;  3BEH A;  3C8G B;  3FHE A;  3OXF A;  1SA5 A;  2J07 A;  1ZHY A;  3S84 A;  2R59 A;  1OQC A;  2XSE A;  1EQ1 A;  3RQE A;  2OEW A;  1O1S A;  3KSQ A;  4HOQ A;  3I4U A;  5CI8 A;  1D1C A;  1YZA A;  4FC8 A;  3SY2 A;  4XQ1 A;  3EHQ A;  2DYS C;  3LLK A;  1DVP A;  4U7E B;  2GDC A;  4XE0 A;  3L0I A;  1HO8 A;  1U0B B;  2AJA A;  3UPV A;  1OCO C;  4HFK B;  3GEI A;  3FUE A;  2CHW A;  3PUJ A;  3SFY A;  4L6R A;  2KM4 A;  3K7D A;  3IKO B;  4JIO A;  2FF4 A;  2OKU A;  3Q9U C;  2VCC A;  5BNW A;  4N4W A;  4UWK A;  3RO3 A;  2R7X A;  3FU6 A;  5KWD A;  2P7V A;  1BI7 B;  3S7D A;  5LFA A;  1LE4 A;  1Q0K A;  3DD7 A;  3SI5 A;  4QDL A;  2HUJ A;  3H65 A;  2VGE A;  3E34 A;  3NRH A;  1J8Y F;  5AAR A;  2VTB B;  2R7U A;  3IEG A;  5BW8 C;  1C17 M;  4DOZ A;  2B6C A;  2EPK X;  1N0Q A;  1N9A A;  5E75 A;  4B94 A;  3T8M A;  4HOU A;  2GRL A;  4ANX A;  1N0R A;  5ENO D;  3C18 A;  1M6T A;  4J32 B;  1P5Q A;  4PR9 A;  3C63 A;  3HIZ A;  4TUU A;  1WAT A;  3W8I A;  1OKK A;  1B68 A;  3O6X A;  4Y6W A;  3TG4 A;  2YZS A;  2LO6 A;  3EGD B;  1ZBP A;  1HS6 A;  3QDN A;  4BJ1 A;  4MVR A;  2J9W A;  1M56 C;  4N3C A;  3ZIM A;  1VMA A;  4BJ6 C;  4BEM J;  1UN8 A;  3P1U A;  1OCR C;  2OQM A;  2WXK A;  3PRZ A;  2R7S A;  3SD5 A;  2CG3 A;  3DPD A;  5G04 C;  2YLG A;  4DVY P;  1H2T C;  3DSU A;  4GA0 A;  4I44 A;  3E4B A;  2E87 A;  4DX5 D;  3ZGQ A;  3CLJ A;  4RQI A;  3SQV A;  4K0R A;  1FFT C;  1R4T A;  5E33 A;  2RSE B;  1HMO A;  4GZ5 A;  4AXH A;  3DSX A;  5J08 A;  4UWH A;  2J49 A;  1PD0 A;  2WVI A;  3FOP A;  1FAP B;  2HZ8 A;  4JJF A;  4GZ6 A;  5C2Y A;  2AWI A;  3DAF A;  3AG3 E;  3QWW A;  1MZC A;  3KD7 A;  4ILI A;  3SF4 A;  2F22 A;  4M63 A;  3JYY A;  4PFO A;  4BPM A;  1U6H A;  2CGE A;  4C3D A;  3POV A;  3Q78 A;  3EH1 A;  3JXJ A;  2L0T B;  1SZA A;  5HS0 A;  1JAF A;  1G8X A;  4CS9 A;  3R9A B;  3JZ0 A;  2VSN A;  4U04 A;  5LX8 A;  3HRA A;  2VGX B;  1YVI A;  4PH4 B;  3VRC A;  4JW1 A;  4O6Y A;  2WXM A;  3ZWI A;  1D0Y A;  3FUF A;  3UMH A;  5EX0 A;  4AK9 A;  2NUT A;  4Z9H A;  1Q0G A;  3I4R B;  5T8I A;  2J9B A;  4RDA A;  4LRZ A;  4GYT A;  2DBA A;  3TWU A;  1A0B A;  4DI3 A;  2H6F A;  2RD0 A;  1ELK A;  4F6R D;  5FZR A;  3HJC A;  2VB6 A;  2MWQ A;  4CEM A;  3B0P A;  2VC9 A;  4BT9 A;  4EKW A;  1E7U A;  4GMR A;  4KZC A;  5FWQ A;  4G0H A;  4NUR A;  2P6V A;  3ZRH A;  4GEH A;  2RFM A;  2LCH A;  3ESL A;  3RK6 A;  1CGN A;  1OUV A;  1VOM A;  1YA0 A;  1CGM E;  4WAF A;  1MHQ A;  2R7W A;  5HI7 A;  4BT8 A;  4N39 A;  4AIF A;  2IXP A;  2DI3 A;  4DJ9 A;  1YZC A;  5L0I A;  1GS9 A;  5JUA A;  3CSK A;  2R05 A;  1SR2 A;  3QVY A;  2EIL C;  3MEK A;  2L6B A;  1TWC A;  4JE9 A;  3T4R A;  3UR3 C;  4OVV A;  4Q96 A;  2NSZ A;  4U5B E;  2R7O A;  3MKQ B;  2I1J A;  5A69 A;  5CHE E;  2FBN A;  3DJU B;  3CVX A;  2LSV A;  4IUL A;  3MV3 B;  1H9G A;  2BL2 A;  1RXQ A;  3VM6 A;  2I8B A;  3GZ2 A;  3FEX A;  4NAC A;  4FHJ A;  1D1B A;  3LY7 A;  1BI8 B;  4DBR A;  4A63 B;  3W2W A;  3Q7F A;  1NZE A;  3B7U X;  2H7O A;  4XPX A;  5L0C A;  4ATG A;  3QAQ A;  4MKT A;  3GYZ A;  3LKU A;  4NCQ A;  2O9X A;  4LDQ A;  4DRJ B;  4AE4 A;  2P9P G;  4X8Q A;  5TJ5 E;  3QNK A;  5D91 A;  2Q7R A;  2IXM A;  1HW2 A;  2NUP A;  1PD1 A;  2XM4 A;  2M63 A;  4GAA A;  1MNE A;  2NXP A;  2GRM A;  4AJW A;  2A4Z A;  2R7Q A;  3JCU Q;  2WVO A;  3ZQV A;  4N5C A;  3C3R A;  2FAP B;  3LDZ A;  3W8H A;  4U5D E;  5KJK A;  2L9J A;  3KSL A;  2DZN A;  1KLX A;  3ASH A;  2H6G A;  4N3A A;  3JXI A;  1MND A;  1SMY F;  4KNW A;  4LEU A;  1MMN A;  2CW0 F;  1YCS B;  4I9C A;  3PZ3 A;  5FCL A;  3BUA A;  4A55 A;  1S64 A;  4EBA A;  3TOL A;  2V5F A;  2KAT A;  3K6B A;  3MKR A;  5KYU A;  2J9U A;  3ONK A;  4B8A A;  4HI9 A;  4W8P A;  5GPG B;  1E84 A;  2WB2 A;  4CDY A;  2QE9 A;  1VB5 A;  2W9Y A;  4HRM B;  1BBH A;  4YL0 A;  2A6E F;  3FOO A;  3JRM O;  4MVO A;  4L2Y A;  3PMR A;  1MX6 A;  3L82 A;  5G04 J;  2LFD A;  4HOR A;  1KU2 A;  1RZ4 A;  4IRU A;  4MRU A;  1WG0 A;  1NBB A;  3FTZ A;  3HLZ A;  4KVO A;  2KW3 C;  3BEE A;  2RG8 A;  3N0T A;  3UMI A;  3PZ1 A;  2C04 A;  1HY5 A;  1ZYR F;  1JRA A;  3NYJ A;  3EZH A;  2X6K A;  3ASF A;  4XEV A;  3S7J A;  4XWJ A;  2CG2 A;  1FT1 A;  2HR2 A;  5AQA A;  2EIJ C;  4BSX A;  5FTP A;  4GTP A;  3D3M A;  1SZI A;  1V54 E;  3NDB B;  4I6G A;  1TN8 A;  3ASG A;  4BWR A;  4IYP A;  3CK7 A;  3SXK A;  5JVE A;  2VQ2 A;  2OU6 A;  3HVE B;  4KBQ A;  2KGO A;  1N52 A;  1JWG A;  1AUE A;  4GMJ A;  3ECS A;  3ZYQ A;  4MBG A;  1SZ9 A;  3EHN A;  3SFZ A;  4RD9 A;  4FX5 A;  5JJT A;  1A5E A;  1UJK A;  3DSW A;  1N4S A;  1HE1 A;  4OIN F;  5B3I A;  5G55 A;  1E86 A;  4A4A A;  2OEV A;  3UI2 A;  3CST A;  3HNI A;  3C8G D;  5B1A E;  3T8K A;  1M2O A;  1LD7 A;  2I15 A;  3SBS A;  1KNY A;  3ENE A;  1LI5 A;  2GRP B;  4GTR A;  3UKU G;  4G25 A;  3G2S A;  2PQR A;  4IB4 A;  3PUK A;  1TEZ A;  4AV7 A;  3ZKJ A;  1IQU A;  1D0X A;  3Q4A B;  5KYN A;  3UNG C;  3QZC A;  1NFN A;  4HE8 D;  3MBG A;  2OOE A;  3G2V A;  3TWT A;  3ATP A;  5L0G A;  2KXP C;  5BV0 A;  2C0M A;  4TXP A;  4JCZ A;  4K03 A;  5CEA A;  2X38 A;  4AY5 A;  3K1H A;  1Q2Z A;  1K8K G;  3PEV B;  2L7A A;  2PX3 A;  4EBA G;  3DXK G;  3ASO E;  1U89 A;  3T9K A;  5DS6 A;  2P9U G;  2CYD A;  3ABK C;  4XEI G;  4DPR A;  4EBJ A;  2B0O E;  3CK8 A;  4FLB A;  3PRE A;  2OVB A;  1KT1 A;  1TQG A;  1D8E A;  1ZU4 A;  3E70 C;  4IWB A;  4J0U A;  4E0H A;  3N71 A;  2OJE D;  4B8C B;  1V74 B;  2J45 A;  3N2Z B;  3NF1 A;  4AY6 A;  1OW7 A;  1ORS C;  2EPM X;  3CSF A;  4BJT A;  2L81 A;  2XEE A;  1XZP A;  2JLB A;  4TV3 A;  1Z5S C;  4ME2 A;  4J8D A;  1JMW A;  1NFO A;  3W4Y A;  4IAR A;  4CSA C;  4LLC A;  5AJD A;  5ARG A;  4LDK A;  3V2O A;  1SYQ A;  2EIK E;  3Q73 A;  1OCC C;  3G2U A;  3SNX A;  2ZXO A;  4MTF A;  4FES A;  2VSY A;  3Q7A A;  3LNR A;  3E33 A;  4PS8 A;  2WVN A;  4QI2 A;  2KCV A;  1GW6 A;  1SVX A;  2WXJ A;  3TQO A;  5CIV A;  3LJN A;  4HBD A;  5BXO A;  5AJL A;  3PEU B;  2Y3D A;  3KYI A;  1NLX A;  4TXQ A;  4CIP A;  3EIQ C;  2I6H A;  2IJG X;  2I2O A;  2Y3A A;  5KYX A;  3AJI A;  3WXX A;  4I3M A;  3H2V A;  2KBX A;  3R9M A;  3ZYK A;  4KI2 A;  3G50 A;  1ORJ A;  3AG4 C;  2AXZ A;  2BTD A;  1A7E A;  5BXU A;  4MLP A;  3AG1 E;  1M2V B;  1B89 A;  3QB2 A;  4G8K A;  2AVK A;  4C3B A;  2WB7 A;  3UIP C;  5F5H A;  2P9S G;  2QC9 A;  2PZI A;  2L6G A;  2BE5 F;  2VYI A;  2WXN A;  3E30 A;  4CT4 A;  1YDI A;  1FVF A;  4P29 A;  2BF0 X;  3Q15 A;  1AP7 A;  2R9R B;  4R32 A;  4CDV A;  1FPP A;  2LQG A;  4MVZ A;  3IEE A;  2XXA B;  4B6I A;  2QTV A;  4CGW A;  3DST A;  5KNH D;  3EU9 A;  3P2B A;  2DIW A;  3QAR A;  2YRF A;  1YA7 O;  3ISM C;  3D9J A;  2A69 F;  4GTV A;  3I4G A;  3ASN C;  1TWG A;  2KC7 A;  3CVP A;  3AS4 A;  3C3Q A;  4YND A;  3ZVV A;  1R5I D;  2PP4 A;  1AWC B;  3NG1 A;  3S0X A;  4KMO A;  3VLD A;  4FJY A;  2MOW A;  3FUK A;  3TJ6 A;  4WAB A;  5ENP D;  2X6I A;  2LNI A;  2NSG A;  3DBS A;  3CKC A;  1YA9 A;  2DCP A;  1VDY A;  4EBK A;  4DLQ A;  2V26 A;  3O55 A;  2J8S D;  3EG9 A;  5JRA A;  2FFH A;  3WHN A;  3DPY A;  4V3I A;  3U3F A;  3EZI A;  1J8M F;  3SHF A;  3CHM A;  3J06 A;  4I2W A;  5DLJ A;  3IHY A;  4OD4 A;  5LP0 A;  4F7A A;  5L0D A;  5DBK A;  4JXT A;  4HOT A;  1RW2 A;  3EPV A;  3IQ6 A;  3AG2 E;  4CIH A;  4OYS A;  2CFU A;  1VYI A;  3SEO A;  4DUI A;  4NQF A;  3RVY A;  3LXU X;  4FJZ A;  4CGV A;  3U9J A;  1BR1 A;  3U3W A;  3LY8 A;  3MX3 A;  2DYS E;  1QZ2 A;  3CVU A;  1H0A A;  2ILR A;  4O1O A;  4JB8 P;  1HG5 A;  3LEO A;  3RFY A;  1OCO E;  1WDY A;  1K1A A;  3RRN B;  4OIR F;  1L3P A;  1LF8 A;  1C02 A;  2GFH A;  3ZIB A;  2WXI A;  3CHQ A;  4DI4 A;  5KJN A;  2J9V A;  4MTG A;  2FI7 A;  4BG0 A;  1IHG A;  3VLF A;  4NTF A;  4UWF A;  4L23 A;  3FTS A;  1N1C A;  5EGY A;  4YT4 A;  3NKD A;  1KTM A;  3SO8 A;  3ZG1 A;  1JPN A;  5L0F A;  4CS9 C;  5K0I A;  3DM5 A;  2XCB A;  4E7S A;  4CRW A;  4CCA A;  4WGY A;  4G1T A;  4Q94 A;  1N11 A;  3FUN A;  3AGU A;  3EU5 A;  4GTT A;  4ILH B;  4H7X A;  2XGM A;  1UG3 A;  2MRI A;  3TWV A;  1ZZP A;  1IZM A;  5EN5 D;  2GGF A;  4JCH A;  1YAR O;  1RCP A;  2QFC A;  3FTU A;  3LS8 A;  3PZ4 A;  2LUH A;  4O6F A;  1CGO A;  1TWH A;  2HMQ A;  3PE4 A;  4RLY A;  5ENQ D;  3PHF 2;  1OCR E;  2Y39 A;  2WZG A;  1RKE A;  1ZHT A;  3ABM C;  3TWW A;  3V79 K;  4KVM A;  1Z6A A;  4HI8 A;  4H7Y A;  1X5B A;  5KJL A;  3FVY A;  2A0U A;  3LJB A;  4DRH B;  2LXM A;  2J0W A;  1ELR A;  4C7O A;  1UJJ A;  2PM6 A;  2WXH A;  3CVV A;  3APF A;  4RSY A;  1K1B A;  4HRN A;  1S70 B;  4I1M A;  1IXV A;  2V4L A;  2J0X A;  3UGP A;  4PAC A;  3CZ6 A;  5A23 A;  2P9N G;  1NZN A;  2IO3 C;  2X6J A;  2TMV P;  4DX7 D;  3MGB A;  4I2Z A;  2DGJ A;  5D66 A;  1DNP A;  3FH7 A;  3EHM A;  1QSP A;  5D0Q D;  4Z68 A;  4Y6C A;  3KPH A;  3UM2 A;  3L34 A;  3ZYM A;  3UXG A;  3ZU7 B;  4EWC A;  4U9D A;  1MX2 A;  3OA1 A;  3QK0 A;  4KXK B;  4LNB A;  3L8I A;  4CDN A;  2YKZ A;  4PK4 A;  3URZ A;  3L22 A;  2XL6 A;  3G4Z A;  1YYJ A;  2WXF A;  4C0M A;  5BQH A;  3M1C B;  3KS2 A;  4U8V D;  2KK1 A;  2DWZ A;  4KT6 B;  5JA4 D;  1L5J A;  3HXB A;  3X2Q C;  3TAX A;  2RKK A;  3Q9N C;  1O1T A;  2ZU6 B;  4KBL A;  2H6I A;  4GA1 A;  1EF1 C;  5C1D A;  2WXQ A;  5CEC B;  3PVL A;  4HVB A;  1F1M A;  4JTD B;  4U0U A;  3FTX A;  1UG7 A;  4MVM A;  4L7T A;  3ZYL A;  4H54 A;  3IHV A;  3IV0 A;  4BX8 A;  1JCR A;  2MHR A;  2XRY A;  1YYX A;  4IGG A;  3F47 A;  3MZL B;  3V31 A;  4E17 A;  2WXR A;  4J8Y A;  4EUK B;  3HTK C;  2Y0B G;  2KC3 A;  4CYM D;  3L16 A;  4K1O A;  4MVS A;  3RIP A;  3AU5 A;  4XLP F;  3VLE A;  3A9C A;  1DOV A;  1T6Q A;  1LD8 A;  4JL0 A;  3TD7 A;  4GYY A;  4EQF A;  1SQM A;  5LOZ A;  3BQO A;  4Q4Z F;  4BTB A;  4O7G A;  1ZVZ A;  3FAP B;  3PCV A;  4IAQ A;  2J09 A;  4AVX A;  5KYW A;  3CQG B;  2GRQ B;  3LEW A;  5JS5 A;  3LS1 A;  3TGO A;  1H2U A;  3S27 A;  3LES A;  2ZXW C;  1FMW A;  2WMN A;  1BR2 A;  4NTB A;  5JHA A;  2WZL A;  5EIL A;  1QVX A;  4K0D A;  1HFA A;  2IO2 C;  2VAS A;  3MYI A;  2WXL A;  3G2T A;  3JQ1 A;  2PF4 E;  2VJ8 A;  1ZW2 A;  4U5C E;  256B A;  2YQY A;  4G7Z F;  3FTY A;  3PH0 C;  2UY1 B;  2ASR A;  4NC3 A;  3TL5 A;  2FO1 E;  2P9L G;  3QJZ A;  3RYL A;  1Q0F A;  4LNG A;  3K9I A;  4MW3 A;  3GWL A;  3OXG A;  4DX6 D;  3C3O A;  3TWS A;  2ETC A;  2ETA A;  4HS2 A;  4J8E A;  4UWL A;  2XPZ A;  1NL4 A;  2Q7F A;  3VTY A;  3NMI A;  2WMO A;  1BD8 A;  4QFV A;  1I5N A;  1N54 A;  2YHC A;  4AEZ C;  5A7D B;  1NA3 A;  2YVK A;  2IOL A;  2IEJ A;  3NB2 A;  3HNL A;  4BEJ A;  2WXG A;  1IW7 F;  2Q9A A;  1OCZ E;  4WWO A;  3AGT A;  4UQZ A;  3FDQ A;  3S7B A;  4JZY A;  4U96 D;  1QKR A;  1S05 A;  4I43 A;  3FH5 A;  2C0L A;  1E8X A;  2KYH A;  4MQ9 F;  3T5V A;  4OIP F;  1LVK A;  2A6H F;  3EHR A;  1NU9 C;  4N5Q A;  2LAI A;  1RJ9 B;  1NFI E;  2UUI A;  1HW1 A;  2XL8 A;  2C2L A;  4GCN A;  4PUC A;  3EGX B;  4L9P A;  2GRO B;  2R2L A;  5BT1 A;  4R7L A;  5B3S C;  2A5E A;  2FUL A;  1H2V C;  3MA5 A;  3UQ3 A;  5B1B C;  5EDS A;  3H2U A;  3U0C A;  3AG3 C;  3ULE G;  3UM3 A;  4ABN A;  4G11 A;  4XKB A;  1ST6 A;  3JUI A;  4RG9 A;  4U5G A;  5JMN D;  5JJ7 A;  4YDO A;  4YK5 A;  4FA6 A;  1E8W A;  4WUY A;  1Z3I X;  4JVS A;  3ZHE A;  3OXL A;  2VH3 A;  3FTW A;  1N4P A;  3DEO A;  4GA2 A;  4O1P A;  4L1B A;  3JT1 A;  3JQ0 A;  2EIJ E;  3IQT A;  1DCQ A;  4YT2 A;  3D9P A;  4DK5 A;  1WY6 A;  2G3V A;  2IOQ A;  3T6J A;  3B7T A;  2VTB A;  3Q6M A;  2R7T A;  3U3B A;  5HQ8 A;  2QUP A;  3WOD F;  4PS3 A;  4MVQ A;  3QKY A;  4GML A;  5HRY A;  3M4B A;  4BJ6 A;  3UMK A;  2XLH A;  2R03 A;  1ORY A;  4W9R A;  5ENN A;  4ANV A;  1V55 E;  5AC4 A;  3E37 A;  4GPK A;  3EGD A;  3PNL B;  3IHU A;  2Y69 C;  3V5X A;  3SZ7 A;  2VSX E;  4BES A;  3ZDL A;  4HFF B;  1E2X A;  5F28 E;  3LJ3 A;  2J4B A;  3FUH A;  5HSW A;  1K04 A;  3GOR A;  3AJM A;  4C48 B;  2NYJ A;  3Q79 A;  3HG0 D;  2HMZ A;  2QY7 A;  4YDW A;  4PJJ A;  4FUL A;  3PS6 A;  2RD9 A;  4WNG A;  5LCW C;  2XLE A;  4N06 A;  4NY3 A;  2DB4 A;  3RRU A;  2VCB A;  3HKK A;  4ANW A;  2XCC A;  5BUO A;  2WQH A;  5CCM A;  1WWP A;  4ZLC A;  3FU0 A;  2HSB A;  3KAE A;  5JJ6 A;  3HNK A;  1OXK A;  5CI9 A;  4JC7 A;  3ABL C;  3RVZ A;  1QPU A;  3ZVR A;  3NQP A;  4YVO A;  1HMD A;  3Q6N A;  4LG6 A;  4C9B B;  1S0P A;  3AAA C;  3ZN3 A;  4K5A B;  3MYV A;  4BJ5 A;  3ABK E;  3CHP A;  3D9L A;  1JR8 A;  2PBE A;  3DWL G;  2VGX A;  3SP1 A;  5CED B;  3PDN A;  4U95 D;  2A1D D;  5COG A;  1ELW A;  3FEY A;  3B29 A;  2WVQ A;  2J7P D;  3EJN A;  4JZA A;  1Y4C A;  4G24 A;  2F8Y A;  3EDT B;  4YT5 A;  4YT8 A;  2YL7 A;  4E0I A;  4GTO A;  4LSZ E;  2HFI A;  2EIN C;  2M4E A;  4WWP A;  1W2W A;  3NZU A;  4P9F A;  1BLX B;  3DEP A;  4JHJ A;  1EA8 A;  4GYO A;  1G4U S;  4JJG A;  2XZD G;  1XGW A;  1ZHW A;  2PM7 A;  1IKN D;  1OCC E;  3MFN A;  5KYY A;  3EQL F;  3FWV A;  4QQI A;  1Z23 A;  3FTV A;  1APC A;  1ZHZ A;  2HS5 A;  2W4B A;  2R5S A;  5A6A A;  3D9K A;  3M79 A;  4JC8 A;  2XS1 A;  3EG9 B;  5EK0 A;  5G2N A;  1NI1 A;  1UN9 A;  1ZHX A;  5FQ8 A;  2PQN A;  1V4A A;  4KYO B;  2BC5 A;  1MMG A;  4FHK A;  3PNT B;  4WGZ A;  3QW0 A;  3O4Z A;  1JUQ A;  2L6J A;  3LVQ E;  4U5F E;  2QNL A;  3T9O A;  3KEA A;  1EDU A;  5JHB A;  3AQC A;  4WNF A;  3FAJ A;  1LS4 A;  3J5Q B;  5AC5 A;  3F46 A;  4OD5 A;  2EIM C;  1TJC A;  3SYN A;  3CR3 A;  3AG4 E;  3O48 A;  3FU5 A;  4TXR A;  4F3V A;  2HM8 A;  2F0Y A;  2EQX A;  3ZQY A;  4D10 C;  4GTQ A;  2J9Q A;  1Z5Z A;  1AVO B;  2OV8 A;  2W45 A;  4HNA D;  4XI9 A;  3LLI A;  3B7R L;  4ATZ D;  4F1P A;  4CS8 C;  2A5U A;  5AYW D;  3U8P A;  2IYL D;  4E6H A;  2PX0 A;  3FDH A;  4MTO A;  1WM5 A;  3C62 A;  4B93 B;  2XL4 A;  3CKB A;  2DYR C;  4E7Z A;  4N6H A;  2X51 A;  2GRN B;  2A0B A;  2OVF A;  3UT4 A;  3SXY A;  3TXN A;  1V54 C;  3LAY A;  1E90 A;  2P9K G;  3VYW A;  2G3K A;  2W4M A;  5ARF A;  5FIN A;  3KKB A;  3K1I A;  4EZL A;  1E96 B;  4BEP A;  2XEN A;  1TR2 A;  5FIO A;  3W9G A;  1HU3 A;  4DVZ A;  2YHS A;  3EFO B;  4H4K C;  2CHZ A;  1H9T A;  1E8Y A;  4IN3 B;  3GM2 A;  4APF A;  3TOM A;  3ULQ A;  4K5C A;  1LKX A;  3ESK A;  4BET A;  4P6I C;  2LIG A;  3TK0 A;  1S7Z A;  4AL0 A;  1HH8 A;  1FT2 A;  4JEA A;  1U3C A;  2DZO A;  2XZT G;  3L17 A;  3JYH A;  3T5X A;  3S2A A;  1E85 A;  4CZ2 D;  3B95 A;  3S7F A;  3M4C A;  4U8Y D;  4DX2 A;  4HFG A;  5FQ4 A;  4WJ0 A;  4JHK A;  4M7C A;  4OAU C;  4F4B A;  3NKE A;  4O6M A;  5G05 C;  4U8H A;  4MW8 A;  4TRQ A;  4I1A A;  3QMK A;  2HV6 A;  2B0H A;  4G78 A;  1PC2 A;  3IQC A;  5AQ7 A;  5DQZ A;  2ION A;  4F1S A;  3EIJ A;  2H7B A;  4OAV B;  4G7H F;  3VTX A;  3DXJ F;  1LS1 A;  3ZTZ A;  5LCW J;  2Y4U A;  5L3Q A;  3FUJ A;  5BPP A;  2VGY A;  3MCX A;  1MMA A;  2LK4 A;  3BU8 A;  4Z9J A;  4HOS A;  1LPE A;  1T9K A;  3UIN C;  3NOC D;  4XPW A;  2PL2 A;  1T5O A;  1INZ A;  4ACL A;  5H7P A;  4DJA A;  1OW6 A;  3KYJ A;  2R7R A;  2NSF A;  4EPZ A;  2YLI A;  2BUG A;  3GWN A;  3JRT A;  3O10 A;  2UUH A;  1MQS A;  3CQC B;  3HVE A;  1WAO 1;  3DXM G;  1N95 A;  2XM0 A;  5IY5 E;  2YL1 A;  2EIK C;  4F53 A;  4YDY A;  4BER A;  1A17 A;  2PNN A;  2X6H A;  3RU0 A;  1T6I A;  1O3U A;  1K40 A;  2XLM A;  3E9V A;  3FP3 A;  4JUR I;  3HNJ A;  3LCA A;  3Q49 B;  3C5R A;  2IQC A;  2YHE A;  3R7C A;  3TG5 A;  4XLN F;  1FNT c;  4EBB A;  5A6C A;  1AEP A;  2X6F A;  2JX0 A;  3ML8 A;  3ABM E;  1RMV A;  1DOW A;  3UM1 A;  3KL4 A;  1NU7 D;  1LE2 A;  2XLO A;  2KCL A;  3HHM A;  5BV1 A;  2OG2 A;  5L3V A;  3MYF A;  1BPO A;  2XEV A;  2WQ7 A;  3QOU A;  4DRI B;  4EZK A;  4I6E A;  4PJM A;  1H6P A;  4ULV A;  4UWG A;  3ZXS A;  3U4T A;  2D4U A;  3RKV A;  1U2V G;  4O79 A;  2YL0 A;  1UW4 B;  1U3D A;  2GA0 A;  3W9F A;  4JKV A;  3I5Q A;  1I4Z A;  4OIO F;  1YLM A;  3PE3 A;  3ULY A;  3UUX A;  1WGW A;  1VTM P;  1QNF A;  3GZS A;  5EYP F;  4L2L A;  4G23 A;  1TYQ G;  4UI9 C;  3RQG A;  2XGO A;  4XKC A;  2H7V C;  5ITZ F;  2Z15 A;  3W2V A;  1K05 A;  2V5Q C;  2NUT B;  3FXH A;  3HDX A;  3D9M A;  5M72 A;  3R2P A;  3A11 A;  5T3T A;  5CMY A;  5JP7 A;  4CSA A;  3NBN B;  2LXL A;  5AIJ A;  2A68 F;  3IBE A;  1WAS A;  3CVQ A;  5KJM A;  3UX4 A;  4B0Z A;  1TNZ A;  1SW6 A;  3KH2 A;  1OT8 A;  2YQ8 A;  4JHR A;  5EX3 A;  4BTA A;  2HE0 A;  4A1G A;  3X2Q E;  2PFD A;  4HLL A;  1N4Q A;  1ZB1 A;  3DAG A;  1GQA A;  5D92 A;  5AN8 A;  3GM1 A;  4FLH A;  4A3V A;  5AGF A;  2HKV A;  4NQ0 A;  3IQ5 A;  4XPY A;  1JPL A;  1HZ4 A;  2AXV A;  2Y1L E;  1T01 A;  4U5H A;  4G26 A;  4YL1 A;  3TJP A;  1OY3 D;  2FO7 A;  4G8L A;  3JUE A;  5T4Y A;  3GZ1 A;  3SXZ A;  5A6K A;  3Q75 A;  1HG2 A;  2KZT A;  5KCM A;  2GWW A;  2OCC C;  3QVZ A;  4A1S A;  2HJM A;  1PV3 A;  1OWP A;  4LAC B;  4FAP B;  2H8A A;  4JRZ A;  2J4D A;  2XRH A;  3SNH A;  3AG2 C;  3RIB A;  3CGH A;  3HXD A;  3B71 A;  2QY9 A;  3E32 A;  4OVU A;  1H7I A;  3OEO A;  4GQH A;  1NSG B;  1HE8 A;  1E8Z A;  1FTS A;  4NRH B;  3HXC A;  2EPN A;  4GTM A;  2ZXW E;  3L9T A;  1M2V A;  4CS7 A;  4CT0 A;  3ASD A;  3SZR A;  3B0V C;  3K33 A;  3OWT A;  3C72 A;  3UGO A;  3TXM A;  2J08 A;  3SBT B;  3ZFW A;  2J46 A;  4E18 A;  3UTM A;  3U9W A;  5KNG A;  4LUN U;  2MHK A;  4AE4 B;  5DS4 A;  2WXO A;  5G05 J;  3ZHE B;  3APC A;  3U9M A;  5FT9 A;  4JEU A;  2XXA A;  2NUP B;  4PJN A;  4OIQ F;  3L1M A;  1TNO A;  2WPV A;  3RW0 A;  3MJW A;  5CBN A;  1LI7 A;  1YAU O;  1E7V A;  5DIZ A;  2ZD9 A;  4XIF A;  3WG7 C;  1TNY A;  2IOS A;  3UM0 A;  1EI7 A;  3DRA A;  4JTA B;  1G3N B;  1UFB A;  4IAO A;  1Z3X A;  5T1D B;  1H6O A;  3V5Z A;  3C8Z A;  3RRM B;  2CNW D;  4ZHB A;  4FWV A;  2I1K A;  2XQ0 A;  1BR4 A;  2OND A;  4N2Q A;  1CPR A;  3C98 A;  4PJL A;  1S63 A;  5FZT A;  5BQI A;  2GW1 A;  5KYU B;  3K66 A;  3ZXP A;  2H6H A;  5AQB A;  2F8X K;  1TNB A;  3CVN A;  4U5E E;  2EIL E;  1HX8 A;  3Q47 B;  3GOD A;  4LCT A;  4J8S A;  5HKP A;  1MJ0 A;  3DKA A;  3FHD A;  2WZF A;  4AM9 A;  1Z7Q c;  3N24 A;  4B89 A;  1WTY A;  5B3S E;  2P0N A;  4KNV A;  3JYS A;  3HXF A;  5FQ7 A;  3CVY A;  1BDJ B;  4D4N A;  5B1B E;  3PZD A;  5T3R A;  4IJJ A;  2V3C C;  3UMV A;  3DE8 A;  5CER B;  4P9T A;  4Q7C A;  1YJG A;  4U0Z A;  3CVW A;  3LVR E;  3UKR G;  3V30 A;  3NYL A;  4BFR A;  1Z6T A;  4K5B A;  5CCL A;  2P58 C;  1QLE C;  1Q0M A;  2ZGD A;  2IY0 C;  2VCA A;  2Y3B A;  4DX1 A;  2OJQ A;  1QQ3 A;  4JA7 A;  3CQZ A;  2V0P A;  5EKQ D;  1VLT A;  4BJ5 C;  3B9Q A;  5FZQ A;  5A6B D;  1LIH A;  3ZSU A;  2R25 A;  4N3B A;  3R7R A;  4UI9 J;  2OOC A;  1IHB A;  1K3Z D;  4FU3 A;  2HYZ A;  3QW1 A;  3DM9 B;  2JEK A;  3TWX A;  4UI9 K;  2J7P A;  1Y6D A;  3AOU A;  5KYY B;  4I9E A;  2V4H C;  2L6H A;  4A2N B;  4CDM A;  2CFZ A;  3NOG D;  3FUM A;  4JA9 A;  3ZPJ A;  2Y69 E;  3FUL A;  2IF4 A;  5A6J A;  1OW8 A;  3U5S A;  5EHH A;  1O1R A;  4BSZ B;  1VLS A;  2P61 A;  2AVP A;  3C8G A;  1SF8 A;  4M3O A;  2MYS A;  4CBE A;  4I6J A;  2VSO E;  2R17 C;  2ZGG A;  4YN0 B;  1OR3 A; 
#chains in the Genus database with same CATH homology
 3LYA A;  3L08 A;  3MV2 B;  2FEZ A;  1M57 C;  5E2Q A;  4EEC A;  3R7Q A;  4FAD A;  1VK5 A;  4N2S A;  1D1A A;  5DQT A;  4GZ3 A;  4WWN A;  3B0U X;  1OKK D;  4I1O B;  4JPS A;  1PAQ A;  4ANU A;  3RJV A;  4UQX A;  3Q5M A;  4YJW A;  2WQ6 A;  3AS8 A;  5E76 A;  3AS5 A;  1TWA A;  5D0O D;  2KCK A;  4BY6 A;  3LEV A;  2Y3H A;  3FUD A;  1IYG A;  1JWF A;  4DLO A;  3FFL A;  3UT7 A;  3ML9 A;  4G2V A;  5J90 A;  4ACK A;  3U64 A;  1Y8M A;  2HO1 A;  3D9I A;  4A3T A;  2IXO A;  3ITF A;  3K1I C;  4GZC A;  5ANL A;  1OCZ C;  4WNE A;  5KYX B;  4XZ4 A;  4RVB A;  5E3A A;  5T3W A;  3LY9 A;  3D9N A;  4KC9 A;  2HV7 A;  3FY4 A;  4LER A;  2ZXR A;  5F5F A;  2WXP A;  2IXN A;  2LSE A;  3T6B A;  3FU3 A;  1OWN A;  2KNH A;  2Q9C A;  1HXI A;  4EZJ A;  3I5P A;  4WND A;  2UY1 A;  4PS7 A;  3QWV A;  4X0R A;  3CEQ A;  5E3C A;  5BUZ A;  4JEH A;  4CDR A;  3X1O A;  5DVW A;  1Z63 A;  3MLG A;  4U0S A;  1V55 C;  2L9B A;  4HLE A;  1FVH A;  4XTK A;  3HYM B;  1HF8 A;  3AU4 A;  4KZ0 A;  4U07 A;  2UWJ G;  4APO A;  3CHS A;  3DJN B;  5AEN A;  4J8F A;  1PY1 A;  3GW4 A;  4J6I A;  1NP7 A;  3LS0 A;  3VAY A;  3JCK C;  1RJ9 A;  3MKQ A;  3DZA A;  2CDQ A;  3EGX A;  3L13 A;  1QQE A;  2E2E A;  2XPY A;  3I3N A;  2AXU A;  4QI0 A;  5ANR A;  2ZXP A;  4FP7 A;  1NG1 A;  3APD A;  4MND A;  1PCX A;  4GB9 A;  4PFP A;  1NA0 A;  2ZPA A;  3Q7G A;  3NZS A;  4URK A;  2AW6 A;  4XX5 A;  1IQR A;  2KJG A;  2C03 A;  1Z3Y A;  2CHX A;  2XRZ A;  3QWP A;  2JD3 A;  3Q7L A;  4RBN A;  4C3E A;  3ZEF A;  3B13 A;  3D9O A;  3S28 A;  4GZD A;  1D0Z A;  2WM9 A;  2NG1 A;  5B1A C;  2G62 A;  3O39 A;  1OWL A;  1QZX A;  2IFU A;  4HXI A;  5DS5 A;  2KQ9 A;  2Q9B A;  1EPU A;  2KZT B;  3LPZ A;  4G7O F;  3UT8 A;  4C7O B;  4MS6 A;  2I9C A;  3BG0 B;  3KEZ A;  2XGS A;  1H19 A;  3RO2 A;  1OWM A;  1EYH A;  3ASO C;  4C0E A;  1KT0 A;  1VYK A;  1MMD A;  1JPJ A;  2Q3T A;  1Y6I A;  2X3M A;  4ILG A;  2NC9 A;  3CK9 A;  1XNF A;  2E0I A;  2B0J A;  3QC1 A;  4I17 A;  2IU1 A;  3L54 A;  3GAN A;  3CIA A;  4XI0 A;  3CV0 A;  3AQB A;  2Y3G A;  4BX9 A;  1TKN A;  5FQ6 A;  1W3B A;  2R7V A;  3CVL A;  3JSZ A;  3FH8 A;  4AOF A;  3ZW3 A;  2Y4T A;  4YWQ A;  2XHE A;  5FZS A;  2YEV A;  2CNW A;  1O5H A;  3RH3 A;  2LAH A;  3CHO A;  5KYW B;  4LLE A;  3G2W A;  3S29 A;  3AG1 C;  4ZLD A;  4GU5 A;  3U66 A;  3BG1 B;  4PDX A;  5CMW A;  4K7B A;  3OTN A;  3NYM A;  3V7O A;  4Q5S F;  2YIN A;  4CS8 A;  4ULW A;  2LSU A;  2XPI A;  1ZU5 A;  4U63 A;  3L6A A;  2YNQ A;  1OWO A;  3ONL A;  4AX2 A;  4O6N A;  4Q69 A;  1FCH A;  4GYW A;  3ZC4 A;  2FGY A;  1ZU2 A;  3RKO F;  2L0I A;  3OAW A;  4GCO A;  3CHR A;  4YVQ C;  3B7S A;  4DBQ A;  3DMD A;  3KMI A;  3EH2 A;  2V8S E;  1FMV A;  4HEA J;  2WL8 A;  1H6K A;  5IY5 C;  3SGH A;  3EFO A;  4AP2 A;  4UQY A;  4E85 A;  3FUI A;  1TJF A;  2D5R B;  1FFH A;  5FJY A;  4ANJ A;  4RG6 A;  4W8K A;  4J30 B;  1O87 A;  3FHE A;  3OXF A;  2J07 A;  1ZHY A;  2R59 A;  2XSE A;  4HOQ A;  3I4U A;  5CI8 A;  1D1C A;  4FC8 A;  2DYS C;  3LLK A;  1DVP A;  4XE0 A;  3L0I A;  1HO8 A;  3UPV A;  1OCO C;  4HFK B;  3FUE A;  2CHW A;  3PUJ A;  2KM4 A;  3K7D A;  3IKO B;  2FF4 A;  5BNW A;  4UWK A;  3RO3 A;  2R7X A;  3FU6 A;  2P7V A;  3S7D A;  5LFA A;  3DD7 A;  3SI5 A;  4QDL A;  3H65 A;  3NRH A;  1J8Y F;  2VTB B;  2R7U A;  3IEG A;  5BW8 C;  4DOZ A;  4B94 A;  5E75 A;  3T8M A;  4HOU A;  2GRL A;  4ANX A;  4J32 B;  1P5Q A;  3HIZ A;  4TUU A;  3W8I A;  1OKK A;  3O6X A;  4Y6W A;  3TG4 A;  2YZS A;  2LO6 A;  3EGD B;  1ZBP A;  1HS6 A;  3QDN A;  4BJ1 A;  2J9W A;  1M56 C;  4N3C A;  3ZIM A;  1VMA A;  4BJ6 C;  1UN8 A;  3P1U A;  1OCR C;  2WXK A;  3PRZ A;  2R7S A;  3SD5 A;  2CG3 A;  3DPD A;  5G04 C;  4DVY P;  1H2T C;  4GA0 A;  4I44 A;  3E4B A;  2E87 A;  3ZGQ A;  3CLJ A;  4K0R A;  1FFT C;  5E33 A;  4GZ5 A;  4AXH A;  5J08 A;  4UWH A;  2J49 A;  1PD0 A;  2WVI A;  5C2Y A;  4JJF A;  4GZ6 A;  2AWI A;  3DAF A;  3QWW A;  3KD7 A;  4ILI A;  3SF4 A;  4M63 A;  4PFO A;  2CGE A;  4C3D A;  3POV A;  3EH1 A;  2L0T B;  1SZA A;  1G8X A;  4CS9 A;  3R9A B;  2VSN A;  4U04 A;  5LX8 A;  2VGX B;  4PH4 B;  4JW1 A;  4O6Y A;  2WXM A;  1D0Y A;  3FUF A;  3UMH A;  5EX0 A;  4AK9 A;  2NUT A;  3I4R B;  5T8I A;  4RDA A;  4LRZ A;  4GYT A;  2DBA A;  4DI3 A;  2RD0 A;  1ELK A;  5FZR A;  3HJC A;  2VB6 A;  2MWQ A;  4CEM A;  3B0P A;  4BT9 A;  1E7U A;  4KZC A;  5FWQ A;  4G0H A;  4NUR A;  2P6V A;  3ZRH A;  4GEH A;  3ESL A;  3RK6 A;  1OUV A;  1VOM A;  1YA0 A;  4WAF A;  1MHQ A;  2R7W A;  5HI7 A;  4BT8 A;  4N39 A;  4AIF A;  2IXP A;  3CSK A;  2EIL C;  3MEK A;  1TWC A;  3T4R A;  3UR3 C;  4OVV A;  4Q96 A;  2NSZ A;  4U5B E;  2R7O A;  3MKQ B;  2I1J A;  5CHE E;  2FBN A;  3DJU B;  3CVX A;  2LSV A;  4IUL A;  3MV3 B;  2I8B A;  3GZ2 A;  3FEX A;  4NAC A;  4FHJ A;  1D1B A;  3LY7 A;  4DBR A;  3W2W A;  1NZE A;  3B7U X;  2H7O A;  4ATG A;  3QAQ A;  4MKT A;  3GYZ A;  3LKU A;  2O9X A;  4AE4 A;  3QNK A;  5D91 A;  2IXM A;  2NUP A;  1PD1 A;  2M63 A;  4GAA A;  1MNE A;  2NXP A;  2GRM A;  4AJW A;  2A4Z A;  2R7Q A;  3JCU Q;  2WVO A;  4N5C A;  3LDZ A;  3W8H A;  4U5D E;  5KJK A;  2L9J A;  1KLX A;  3ASH A;  4N3A A;  1MND A;  1SMY F;  4KNW A;  4LEU A;  1MMN A;  2CW0 F;  4I9C A;  5FCL A;  4A55 A;  4EBA A;  2V5F A;  2KAT A;  3K6B A;  3MKR A;  5KYU A;  2J9U A;  3ONK A;  4B8A A;  2WB2 A;  2W9Y A;  2A6E F;  4L2Y A;  3PMR A;  5G04 J;  4HOR A;  1KU2 A;  4IRU A;  4MRU A;  3FTZ A;  3HLZ A;  4KVO A;  2KW3 C;  3BEE A;  2RG8 A;  3N0T A;  3UMI A;  2C04 A;  1ZYR F;  3NYJ A;  3EZH A;  2X6K A;  3ASF A;  3S7J A;  4XWJ A;  2CG2 A;  2HR2 A;  2EIJ C;  4BSX A;  5FTP A;  3D3M A;  1SZI A;  3NDB B;  4I6G A;  3ASG A;  4BWR A;  4IYP A;  3CK7 A;  2VQ2 A;  3HVE B;  4KBQ A;  2KGO A;  1N52 A;  1JWG A;  4GMJ A;  3ECS A;  3ZYQ A;  1SZ9 A;  3EHN A;  3SFZ A;  4RD9 A;  4FX5 A;  5JJT A;  1UJK A;  4OIN F;  5G55 A;  3CST A;  1M2O A;  3SBS A;  3ENE A;  4G25 A;  3G2S A;  2PQR A;  3PUK A;  1TEZ A;  4AV7 A;  1IQU A;  1D0X A;  3Q4A B;  5KYN A;  3UNG C;  3QZC A;  4HE8 D;  2OOE A;  3G2V A;  5BV0 A;  2C0M A;  4K03 A;  2X38 A;  4AY5 A;  3K1H A;  3PEV B;  2PX3 A;  4EBA G;  5DS6 A;  3ABK C;  4DPR A;  3CK8 A;  4FLB A;  3PRE A;  2OVB A;  1KT1 A;  1ZU4 A;  3E70 C;  4IWB A;  4J0U A;  3N71 A;  4B8C B;  2J45 A;  3N2Z B;  3NF1 A;  4AY6 A;  3CSF A;  4BJT A;  2L81 A;  2JLB A;  4TV3 A;  4ME2 A;  4J8D A;  4CSA C;  4LLC A;  5AJD A;  5ARG A;  1OCC C;  3G2U A;  3SNX A;  2ZXO A;  4FES A;  2VSY A;  3LNR A;  4PS8 A;  2WVN A;  4QI2 A;  2KCV A;  1GW6 A;  2WXJ A;  5AJL A;  3PEU B;  2Y3D A;  3EIQ C;  2I6H A;  2IJG X;  2I2O A;  2Y3A A;  5KYX A;  3WXX A;  4I3M A;  3ZYK A;  4KI2 A;  3AG4 C;  2AXZ A;  2BTD A;  4MLP A;  1M2V B;  1B89 A;  4C3B A;  2WB7 A;  5F5H A;  2PZI A;  2BE5 F;  2VYI A;  2WXN A;  4CT4 A;  1FVF A;  4P29 A;  2BF0 X;  3Q15 A;  3IEE A;  2XXA B;  4B6I A;  2QTV A;  4CGW A;  3P2B A;  2DIW A;  3QAR A;  3D9J A;  2A69 F;  3I4G A;  1TWG A;  3ASN C;  2KC7 A;  3CVP A;  3AS4 A;  4YND A;  3ZVV A;  2PP4 A;  3NG1 A;  3S0X A;  4KMO A;  3VLD A;  4FJY A;  2MOW A;  3FUK A;  2X6I A;  2LNI A;  3DBS A;  3CKC A;  2DCP A;  1VDY A;  4DLQ A;  2V26 A;  3EG9 A;  2FFH A;  4V3I A;  3EZI A;  1J8M F;  3SHF A;  3CHM A;  4I2W A;  5DLJ A;  3IHY A;  4OD4 A;  5LP0 A;  4F7A A;  5DBK A;  4JXT A;  4HOT A;  3EPV A;  4CIH A;  4OYS A;  2CFU A;  1VYI A;  3SEO A;  3LXU X;  4FJZ A;  4CGV A;  1BR1 A;  3U3W A;  3LY8 A;  3MX3 A;  1QZ2 A;  3CVU A;  1H0A A;  2ILR A;  1HG5 A;  3RFY A;  3RRN B;  4OIR F;  1LF8 A;  2GFH A;  3ZIB A;  2WXI A;  3CHQ A;  4DI4 A;  5KJN A;  2J9V A;  2FI7 A;  4BG0 A;  1IHG A;  3VLF A;  4UWF A;  4L23 A;  3FTS A;  1N1C A;  5EGY A;  4YT4 A;  3NKD A;  3ZG1 A;  1JPN A;  4CS9 C;  3DM5 A;  2XCB A;  4E7S A;  4CRW A;  4CCA A;  4G1T A;  4Q94 A;  3FUN A;  4ILH B;  4H7X A;  2XGM A;  1UG3 A;  2MRI A;  1IZM A;  2GGF A;  4JCH A;  2QFC A;  3FTU A;  3LS8 A;  4O6F A;  1TWH A;  3PE4 A;  3PHF 2;  2Y39 A;  2WZG A;  1ZHT A;  3ABM C;  4KVM A;  1Z6A A;  4H7Y A;  1X5B A;  5KJL A;  3FVY A;  3LJB A;  2J0W A;  1ELR A;  4C7O A;  1UJJ A;  2PM6 A;  2WXH A;  3CVV A;  3APF A;  4RSY A;  4I1M A;  2V4L A;  2J0X A;  3UGP A;  3CZ6 A;  5A23 A;  1NZN A;  2X6J A;  3MGB A;  4I2Z A;  2DGJ A;  1DNP A;  3FH7 A;  3EHM A;  5D0Q D;  4Y6C A;  3ZYM A;  3L34 A;  4EWC A;  3OA1 A;  3QK0 A;  4KXK B;  4CDN A;  4PK4 A;  3URZ A;  3L22 A;  2WXF A;  4C0M A;  3M1C B;  3KS2 A;  4KT6 B;  1L5J A;  3X2Q C;  3TAX A;  2ZU6 B;  4KBL A;  4GA1 A;  1EF1 C;  5C1D A;  2WXQ A;  3PVL A;  4HVB A;  4U0U A;  3FTX A;  4L7T A;  3ZYL A;  3IHV A;  3IV0 A;  4BX8 A;  2XRY A;  3F47 A;  3MZL B;  2WXR A;  3HTK C;  3L16 A;  3RIP A;  3AU5 A;  4XLP F;  3VLE A;  4JL0 A;  3TD7 A;  4GYY A;  4EQF A;  1SQM A;  5LOZ A;  4Q4Z F;  4BTB A;  4O7G A;  2J09 A;  4AVX A;  5KYW A;  3CQG B;  3LEW A;  3LS1 A;  3TGO A;  1H2U A;  3S27 A;  3LES A;  2ZXW C;  1FMW A;  2WMN A;  1BR2 A;  5JHA A;  2WZL A;  4K0D A;  1HFA A;  2VAS A;  2WXL A;  3G2T A;  3JQ1 A;  2PF4 E;  2VJ8 A;  4U5C E;  4G7Z F;  3FTY A;  3PH0 C;  2UY1 B;  3TL5 A;  3QJZ A;  3RYL A;  3K9I A;  3OXG A;  4HS2 A;  4J8E A;  4UWL A;  2XPZ A;  2Q7F A;  3VTY A;  2WMO A;  4QFV A;  1N54 A;  2YHC A;  4AEZ C;  5A7D B;  1NA3 A;  2IOL A;  4BEJ A;  2WXG A;  1IW7 F;  2Q9A A;  4WWO A;  4UQZ A;  3FDQ A;  3S7B A;  4JZY A;  4I43 A;  3FH5 A;  2C0L A;  1E8X A;  4MQ9 F;  3T5V A;  4OIP F;  1LVK A;  2A6H F;  1NU9 C;  2LAI A;  1RJ9 B;  2C2L A;  4PUC A;  4GCN A;  3EGX B;  5BT1 A;  4R7L A;  5B3S C;  2FUL A;  1H2V C;  3MA5 A;  3UQ3 A;  5B1B C;  5EDS A;  3AG3 C;  4ABN A;  4G11 A;  4XKB A;  1ST6 A;  3JUI A;  4RG9 A;  4U5G A;  5JJ7 A;  4FA6 A;  1E8W A;  4WUY A;  1Z3I X;  4JVS A;  3ZHE A;  3OXL A;  2VH3 A;  3FTW A;  4GA2 A;  4L1B A;  3JT1 A;  3JQ0 A;  4YT2 A;  3D9P A;  4DK5 A;  1WY6 A;  2G3V A;  2IOQ A;  3T6J A;  3B7T A;  2VTB A;  3Q6M A;  2R7T A;  5HQ8 A;  3WOD F;  4PS3 A;  3QKY A;  4GML A;  4BJ6 A;  3UMK A;  4W9R A;  5ENN A;  4ANV A;  4GPK A;  3EGD A;  3PNL B;  2Y69 C;  3SZ7 A;  2VSX E;  4HFF B;  3LJ3 A;  2J4B A;  3FUH A;  5HSW A;  2QY7 A;  4PJJ A;  4FUL A;  3PS6 A;  4WNG A;  5LCW C;  4N06 A;  4NY3 A;  3RRU A;  4ANW A;  2XCC A;  5BUO A;  2WQH A;  5CCM A;  4ZLC A;  3FU0 A;  3KAE A;  5JJ6 A;  5CI9 A;  3NQP A;  3ABL C;  3ZVR A;  4YVO A;  3Q6N A;  4C9B B;  1S0P A;  3ZN3 A;  3MYV A;  4BJ5 A;  3CHP A;  3D9L A;  2VGX A;  3SP1 A;  3PDN A;  2A1D D;  3FEY A;  1ELW A;  2WVQ A;  2J7P D;  3EJN A;  4JZA A;  4G24 A;  3EDT B;  4YT5 A;  4YT8 A;  2EIN C;  2M4E A;  4WWP A;  1W2W A;  3NZU A;  4JHJ A;  4GYO A;  4JJG A;  1XGW A;  1ZHW A;  2PM7 A;  5KYY A;  3EQL F;  3FWV A;  1Z23 A;  3FTV A;  1ZHZ A;  2R5S A;  2W4B A;  3D9K A;  4JC8 A;  3EG9 B;  5G2N A;  1UN9 A;  1ZHX A;  5FQ8 A;  2PQN A;  4KYO B;  1MMG A;  4FHK A;  3PNT B;  3O4Z A;  1JUQ A;  2L6J A;  3LVQ E;  4U5F E;  1EDU A;  5JHB A;  3AQC A;  4WNF A;  3FAJ A;  3F46 A;  4OD5 A;  2EIM C;  1TJC A;  3SYN A;  3CR3 A;  3O48 A;  3FU5 A;  4F3V A;  2HM8 A;  2EQX A;  4D10 C;  2J9Q A;  1Z5Z A;  2OV8 A;  2W45 A;  4XI9 A;  3LLI A;  3B7R L;  4CS8 C;  2A5U A;  5AYW D;  2IYL D;  4E6H A;  2PX0 A;  3FDH A;  1WM5 A;  2XL4 A;  3CKB A;  2DYR C;  4E7Z A;  2X51 A;  3UT4 A;  2OVF A;  3TXN A;  1V54 C;  3LAY A;  1E90 A;  3VYW A;  2G3K A;  2W4M A;  5ARF A;  3KKB A;  4EZL A;  1E96 B;  1TR2 A;  1HU3 A;  4DVZ A;  2YHS A;  3EFO B;  4H4K C;  2CHZ A;  1E8Y A;  4IN3 B;  4APF A;  3ULQ A;  1LKX A;  3ESK A;  4P6I C;  3QB2 A;  1S7Z A;  1HH8 A;  3L17 A;  1U3C A;  3JYH A;  3T5X A;  3S2A A;  3S7F A;  4HFG A;  5FQ4 A;  4WJ0 A;  4JHK A;  4F4B A;  3NKE A;  4O6M A;  5G05 C;  4U8H A;  4TRQ A;  4I1A A;  3QMK A;  2HV6 A;  1PC2 A;  5DQZ A;  2ION A;  4F1S A;  3EIJ A;  2H7B A;  4G7H F;  3VTX A;  3DXJ F;  1LS1 A;  5LCW J;  2Y4U A;  5L3Q A;  3FUJ A;  5BPP A;  2VGY A;  3MCX A;  1MMA A;  4HOS A;  2PL2 A;  1INZ A;  4ACL A;  4DJA A;  2R7R A;  4EPZ A;  2BUG A;  3JRT A;  1MQS A;  3CQC B;  3HVE A;  1WAO 1;  2EIK C;  4F53 A;  1A17 A;  3RU0 A;  2X6H A;  3FP3 A;  3E9V A;  3Q49 B;  4JUR I;  3LCA A;  2IQC A;  2YHE A;  3TG5 A;  4XLN F;  4EBB A;  5A6C A;  2X6F A;  3ML8 A;  3KL4 A;  1NU7 D;  2KCL A;  3HHM A;  5BV1 A;  2OG2 A;  5L3V A;  1BPO A;  2XEV A;  2WQ7 A;  3QOU A;  4EZK A;  4I6E A;  4PJM A;  4UWG A;  3ZXS A;  3U4T A;  3RKV A;  4O79 A;  1UW4 B;  1U3D A;  3I5Q A;  4OIO F;  3PE3 A;  3UUX A;  1WGW A;  1QNF A;  3GZS A;  4L2L A;  4G23 A;  4UI9 C;  2XGO A;  4XKC A;  2H7V C;  2Z15 A;  3W2V A;  2NUT B;  3HDX A;  3D9M A;  5M72 A;  5T3T A;  5CMY A;  4CSA A;  5AIJ A;  2A68 F;  3IBE A;  3CVQ A;  5KJM A;  3UX4 A;  4B0Z A;  3KH2 A;  2YQ8 A;  4JHR A;  5EX3 A;  4BTA A;  4A1G A;  2PFD A;  3DAG A;  5D92 A;  4FLH A;  4A3V A;  4NQ0 A;  1JPL A;  1HZ4 A;  2AXV A;  4U5H A;  4G26 A;  3TJP A;  2FO7 A;  5T4Y A;  3GZ1 A;  1HG2 A;  2KZT A;  5KCM A;  2OCC C;  4A1S A;  1OWP A;  4LAC B;  2J4D A;  2XRH A;  3SNH A;  3AG2 C;  3RIB A;  3CGH A;  4OVU A;  2QY9 A;  3OEO A;  1HE8 A;  1E8Z A;  1FTS A;  4NRH B;  1M2V A;  4CS7 A;  4CT0 A;  3ASD A;  3SZR A;  3B0V C;  3K33 A;  3OWT A;  3UGO A;  3TXM A;  2J08 A;  3SBT B;  3ZFW A;  2J46 A;  3U9W A;  4LUN U;  2MHK A;  4AE4 B;  5DS4 A;  2WXO A;  5G05 J;  3ZHE B;  3APC A;  5FT9 A;  4JEU A;  2XXA A;  2NUP B;  4PJN A;  4OIQ F;  2WPV A;  3MJW A;  1E7V A;  5DIZ A;  4XIF A;  3WG7 C;  2IOS A;  4IAO A;  1Z3X A;  5T1D B;  3RRM B;  2CNW D;  4FWV A;  2I1K A;  2XQ0 A;  1BR4 A;  2OND A;  4N2Q A;  3C98 A;  4PJL A;  2GW1 A;  5KYU B;  3K66 A;  3CVN A;  4U5E E;  1HX8 A;  3Q47 B;  3GOD A;  4LCT A;  4J8S A;  3FHD A;  2WZF A;  4AM9 A;  3N24 A;  4B89 A;  4KNV A;  3JYS A;  5FQ7 A;  3CVY A;  3PZD A;  5T3R A;  4IJJ A;  2V3C C;  3UMV A;  4Q7C A;  4U0Z A;  3CVW A;  3LVR E;  3NYL A;  4BFR A;  1Z6T A;  5CCL A;  2P58 C;  1QLE C;  2Y3B A;  4JA7 A;  3CQZ A;  2V0P A;  5EKQ D;  5FZQ A;  4BJ5 C;  3B9Q A;  3ZSU A;  4N3B A;  3R7R A;  4UI9 J;  4FU3 A;  2HYZ A;  3DM9 B;  2JEK A;  4UI9 K;  2J7P A;  5KYY B;  4I9E A;  4A2N B;  4CDM A;  2CFZ A;  3FUM A;  4JA9 A;  3ZPJ A;  3FUL A;  2IF4 A;  5EHH A;  2AVP A;  1SF8 A;  4M3O A;  2MYS A;  4CBE A;  4I6J A;  2VSO E;  2R17 C;  4YN0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...