3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords SusD homolog
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
5LX8A 3EHNA 4PUCA 3QNKA 5E76A 4F7AA 3JQ0A 3CK8A 3CK9A 3JQ1A 3OTNA 5J90A 3IV0A 3GZSA 3EJNA 5FQ4A 5E75A 3EHMA 3L22A 5FQ6A 3SNXA 3HDXA 3P1UA 3CGHA 5T3RA 5FQ7A 5FQ8A 3JYSA 3KEZA 4LERA 3MX3A 3CKCA 3MCXA 4L7TA 5T4YA 3NQPA 3CK7A 3CKBA 3I4GA 4MRUA 4F53A 3MYVA 3FDHA 4Q69A 3LEWA 3SGHA
chains in the Genus database with same CATH superfamily
2GROB 2MYOA 1IQRA 2Y69E 4PUCA 2J9VA 1QZXA 3UT4A 1Z3IX 5CCMA 5KJKA 4K1OA 1N1CA 3L0IA 1QPUA 3C62A 4LCTA 3CK9A 3NYMA 2XGOA 3MLGA 3KD7A 2XL8A 3LESA 1T01A 2OCCE 2EINC 1NI1A 1G4US 3K7DA 3F47A 3QARA 3TWUA 2BTDA 3I5QA 4FAPB 4GZ3A 3AQCA 1KT0A 3UKUG 3S7FA 3MZLB 2IO3C 3ASHA 5DS4A 4KNWA 3GYZA 1JRAA 3U5SA 2PQNA 3GEHA 4GZDA 2R5SA 3ZYMA 4CS9A 3LYAA 3JCKC 3EHRA 3LS8A 4FLHA 3PZ4A 4LLEA 3QWPA 3GWLA 1Z3XA 3RKOF 2F22A 3B7UX 2J46A 3OXGA 2ETBA 3G2VA 2X38A 2XS8A 2IBFA 1DCQA 1FFHA 1ORJA 2OJED 3MFNA 3SY2A 3VAYA 3BQOA 1Y8MA 3KKBA 2KK1A 4JE9A 3SF4A 4K5CA 1HO8A 2V5QC 2HFIA 1MMNA 5JUAA 2GRMA 2OQMA 2X6FA 4BJ1A 1W2WA 1T6UA 2PM6A 3CLJA 3LJBA 3PH0C 1Q0MA 2CDQA 3GM1A 3HXEA 3FEYA 2A5UA 4B8AA 3FUIA 5CCLA 1FMWA 4GZCA 3CVPA 3CEQA 3VLDA 1JPNA 4JIOA 2A0BA 4U9EA 1O1SA 3FEXA 1E86A 1OCOC 3IEEA 3V79K 1KPSB 2HS5A 3B9QA 3ABLE 3JYYA 3PZ2A 3S90A 2KW3C 2VSNA 4GQHA 2WXMA 3TXNA 2UWJG 1N52A 4JEHA 5KYYB 4URKA 1RKCA 3KL4A 1TEZA 3L1MA 3MA5A 1M2OA 4K0DA 4N39A 3CSTA 5D0QD 3KEZA 1B89A 4LG6A 1JOGA 3NYJA 4U04A 1E8YA 4Q69A 3DD7A 5F28E 1OWNA 3QW0A 3B7SA 4AL1A 3H2VA 4H7YA 3V5YA 3NMIA 3GWNA 2R05A 2VSXE 5FINA 3IBEA 5DQTA 2Y39A 5D92A 1E8XA 4MS2A 4BJTA 2IOQA 4UI9K 3ZYLA 4YDEA 4HRLA 1TR4A 4TRQA 2FO7A 4WJ0A 1WOLA 2P61A 1H2UA 3TOMA 2L81A 2NUTB 2R7RA 4E6HA 1OCRC 1WWPA 4NCQA 2HZ8A 3VTXA 2CNWA 4QDLA 1RXQA 5L0CA 3C3OA 3VLEA 5T3TA 2XXAB 1BD8A 2WZLA 5AN8A 3Q49B 4RD9A 4L23A 1MX4A 4AP2A 1YDIA 3RSEG 1FMVA 4CYMD 1N94A 1Z23A 2VGEA 1TFKB 5J90A 2AW6A 2FO1E 3L6AA 2H6HA 2EIJC 5BV0A 1TNUA 2J9UA 1MMDA 2NUPB 3DXJF 3PE4A 5AARA 5AC4A 3L34A 5JT4A 3GZ1A 2WL8A 2WQHA 1GGQA 5JMND 1PC2A 1ELRA 4XE0A 3SZRA 4IAOA 5KYXB 4EHPA 3FFLA 5LX8A 2KZTA 3GEIA 1H2VC 5LP0A 4PH4B 4Z9IA 256BA 4ILGA 1PY1A 1D1AA 1UG7A 3SXZA 4L6RA 4D4NA 1AUEA 3S84A 4J8FA 3WAQA 3UPVA 3D9IA 4YDWA 5H7PA 2Q7RA 1MYOA 4XPXA 4GTSA 1LS1A 1OW7A 4FESA 3A11A 5CI8A 2ZGGA 3SFYA 2J08A 4WNFA 3QDNA 2EPLX 4BX9A 3GM3A 3SGHA 5DS6A 1SR2A 4JC8A 3B13A 2KATA 4RSYA 1A0BA 2QC9A 3Q9UC 3DKAA 2LK4A 3PE3A 4A63B 1PV3A 3UM3A 4OIOF 3UT7A 2V8SE 3EDTB 3FVYA 3C7JA 2WMNA 4JTAB 4FJZA 3SNHA 3JT1A 3U8PA 3ULEG 3APFA 2WXGA 2ETCA 2XRHA 2VCCA 1H6OA 1Q0FA 1EF1C 4GCNA 4GTMA 3BUAA 4G24A 3OAWA 1ZHXA 1V54E 1P5QA 4BJ5C 4BSZB 5AC5A 1BDJB 1N9AA 4M7CA 4YNDA 1D1CA 2P9KG 4K5BA 4WWNA 3B0UX 1X5BA 5BNWA 1T5OA 4LSZE 2VYIA 5FQ8A 4WWPA 3OXLA 4APOA 3OWTA 2B0HA 3UMHA 4ANWA 3RYLA 1BI7B 4MVUA 1UW4B 2C2LA 5KCMA 4AVXA 3QMKA 3JRTA 4EKWA 3PEVB 1D0ZA 1NZNA 4J8DA 5BXUA 4X0RA 2XXAA 2CW0F 3BG0B 1NBBA 4OD5A 3J5PA 3Q73A 4G7ZF 5AQBA 4ANVA 1DC2A 2R03A 3DEPA 3FTVA 3TWWA 4LNGA 1O1RA 3N0TA 3E30A 2IM8A 4PFOA 2OEWA 3C63A 2R02A 4YL0A 3DPDA 3V5XA 1LI7A 1OCZC 3KSLA 1Y6DA 3K1IA 4MVOA 3Q47B 3TJ6A 3ZRHA 4KYOB 4JVSA 2WXFA 4I2ZA 3HNKA 3UQ3A 4NACA 2QTVA 3AG1C 4I1AA 2YL3A 3LEVA 1D8DA 2PFDA 3L22A 2WM9A 4Z9HA 4MW3A 2LAIA 1KZPA 4OAVB 5CMYA 4DX2A 2HJ3A 2XLOA 3TAXA 3LS1A 4CDNA 3Q7AA 5FZTA 4NTAA 2J7PA 2IU1A 4G8KA 5DBKA 4NY3A 1HMOA 5BQGA 1Z6TA 3TG5A 3ZVVA 4ME2A 1KLXA 2A68F 1A41A 1EYHA 5KJMA 4FP7A 4U7EB 4DX5D 5FWQA 2LO6A 3EGDA 4MVRA 3JYSA 4CIHA 3T4RA 2QLAA 2XLVA 5FT9A 2A1DD 2WMOA 2VGXB 4I1OB 2J07A 2EILE 3WHNA 4AIFA 1E7UA 1BR2A 3QWVA 4FHKA 2IYLD 3FHDA 3O4ZA 2WXLA 4DOZA 3EUVA 3RQFA 3ZW3A 3V2XA 4HEAJ 3DSVA 3DJNB 1OKKD 2FI7A 5FQ6A 3SFZA 4Q5SF 1OWPA 2Q4FA 3MYIA 3X2QE 1LIHA 4F4BA 4N4WA 2Y69C 1H19A 5JSLA 3ZEFA 4C3BA 2L0IA 4F6RD 3EG9B 3K66A 2MHRA 4CT0A 2ZPAA 2XRZA 1FT2A 3GM2A 2G62A 2FGYA 3C98A 2MWQA 2R25A 2PF4E 3HNIA 3SFXA 2RFMA 3Q9NC 4K03A 4PJMA 3EJNA 2A69F 2LP4A 5EKQD 4Q4ZF 5G05C 1FVFA 1D0XA 4KNVA 4XZ4A 2H6GA 2GRLA 1QQ3A 3MBGA 5ANRA 3UMVA 1Z3YA 2ASRA 1D0YA 5KJNA 3UINC 3MYVA 2DB4A 3LLIA 4O7GA 3HG0D 3L13A 2J9QA 4YT4A 2PNNA 3GW4A 1BR1A 4GEHA 5EX3A 2ZXRA 3UM1A 2R7TA 2P6VA 1E90A 1YARO 2C04A 3AJMA 1O3UA 4ER9A 1FT1A 1O5MA 2OVFA 2ZISA 4YL1A 4BWRA 4GZ5A 2XEHA 3Q79A 3FAJA 4J8SA 3L17A 4OD4A 2IFUA 2O9XA 3EG9A 1UFBA 3RQEA 4WAFA 1YLMA 1MMAA 1G3NB 3C3RA 3HLZA 5BQIA 1Q0DA 3JZ0A 4GYOA 3DXKG 4HOQA 4LNUD 4XTKA 1MQVA 2WXIA 2LD6A 4AE4B 3CSFA 3FP3A 5KNHD 2L6FA 2X0CA 4C3DA 1CGME 4F1PA 4EZJA 3W2VA 3D9MA 1IZMA 3MV2B 4UWFA 1TWGA 2R7QA 3BU8A 3D9KA 2TMVP 3JCUQ 4ULWA 2QE9A 3E9VA 4H54A 2Y4UA 2L7AA 5LOZA 2PM7A 2C0LA 3CVLA 5DS5A 4QFVA 4MTOA 4AY6A 4YT8A 2YVKA 1JCSA 4C48B 5J08A 4A1GA 5FTPA 4R7LA 3FUFA 4PACA 4BESA 3C8GB 3FUKA 1GW6A 5ENQD 3ABKE 1G5ZA 2DWZA 5B3SE 4EUKB 1L7CA 2CHXA 3MCXA 2H7OA 3CSKA 3RKVA 1OXJA 3IHUA 2NG1A 1MX2A 2OV8A 4AM9A 3D9NA 4M63A 2F8XK 4CDVA 2LFFA 4GYTA 4ILIA 5CHEE 2BC5A 4DVZA 1N4RA 1YYHA 3LY8A 3PNTB 1YJGA 3AGUA 2XEVA 3SXYA 2VTBA 3X2QC 4G2VA 4CDYA 2ETSA 1SA4A 3T5XA 3FU0A 1I5NA 1V4AA 4JD2G 2XENA 3IHYA 4LUNU 3T8MA 3CVVA 4AL0A 4IARA 2L6JA 1U3CA 5JJTA 4I6EA 3UGOA 1Z7Qc 5DQZA 3QVZA 2PBEA 2B0JA 1C17M 1R4TA 4N6CA 2AXZA 2HR2A 4HVBA 3A9CA 2HO1A 1D1BA 1TFOB 5JJ6A 3JSZA 4KVMA 4OAUC 3AG3C 3AAAC 3LKUA 4GTTA 3AG3E 3I3NA 1YVIA 3UKRG 3FXHA 2J0WA 2GRQB 1AVOB 3UNGC 3NZUA 4LEUA 4DRXE 5B3IA 1H6KA 4DLOA 5T8IA 4ATGA 3FUMA 3KYIA 1VYIA 3ZQVA 2YKZA 2QY9A 3ZSUA 4CCAA 5CIVA 2RSEB 3GANA 4MKTA 1ZHYA 4KVOA 1N11A 3POVA 3F46A 4TV3A 3R2PA 3N24A 1A7VA 4CX9A 5BT1A 3ZYQA 4U5GA 3I5PA 2V4HC 5G05J 2EIKE 2VGYA 1ZHTA 4TUMA 3FAPB 2J8SD 3AG1E 5T3RA 2GW1A 1BZ4A 1HS6A 4L7TA 4IAQA 3DSTA 1HF8A 2HYZA 3PUKA 4HOTA 3HXCA 2WB2A 3FMSA 4KMOA 4BETA 2P7VA 2KM4A 3PRZA 3TXMA 4EZKA 3DRAA 3T8KA 3EZIA 1OW6A 5G04J 3R7QA 3ABKC 3OTNA 3AG4C 3FTSA 2ONDA 3HDXA 2AJAA 3G2UA 3WG7C 1A7DA 5JA4D 4E18A 4A4AA 3FUJA 3V30A 2LSEA 3UM2A 2BUGA 4J32B 1ST6A 1B68A 4I44A 3NG1A 4W8PA 4P9FA 2X6KA 1BPOA 4BTBA 2VGXA 3DI5A 3EH2A 1VLSA 4N3CA 3CVUA 3ZC4A 2L6GA 1ZU2A 2F0YA 4B93B 3ASOE 4BFRA 4XEIG 4FULA 3S7JA 3SNXA 4JXTA 4O79A 3AGTA 3P2BA 1NFIE 1WY6A 4U8VD 3RRUA 2M64A 4LERA 3ONKA 4EBAG 1LTXA 1VK5A 2OEVA 3AS4A 3TJ5A 2WVIA 3RVYA 4I2WA 2ETAA 4WNGA 3EHNA 4C9BB 4WGYA 3Q78A 2ILRA 3I4RB 2CG3A 3LPZA 1SZ9A 1R5ID 2KCKA 5D0OD 4ATZD 2P9UG 2I1JA 5ENOD 2R7XA 2C03A 4LRZA 2MYSA 3LNRA 3PEUB 1E84A 2J49A 4UUCA 4G1TA 4ANJA 4O60A 2R7UA 1MZCA 2YLDA 5KWDA 3O6XA 1FR0A 3LLKA 2YL1A 1PD1A 1OQCA 3M15A 4DK5A 2KNHA 2GRPB 3QWWA 3IPMO 1DOVA 3JXJA 3GEEA 3CHPA 4O6MA 3DMDA 5F5FA 3CVYA 2BL2A 5D2MC 2VSYA 3AQBA 4JA7A 4TUUA 3JUIA 3LS0A 4DRJB 4CS8C 4I43A 2CYDA 5A69A 3EZHA 1QLEC 2DYRE 2X6HA 3PCVA 1WN0A 4E17A 3ZTMA 3LJ3A 3NKEA 3IQTA 3WXXA 4B89A 3ASOC 3CVXA 1K1BA 1OKKA 5A6AA 3UXGA 5C1DA 4IGGA 4XQ1A 2EPNA 4HRMB 3M4BA 2LUHA 2A4ZA 2OVBA 3U9WA 1K04A 3UUXA 3UIOC 4RBNA 1A17A 5A6BD 1LD7A 3L54A 3TL5A 5L3QA 5KYNA 3B71A 3MKQA 5COFA 4TXRA 3ASNC 4CS9C 3E32A 5T1DB 1OT8A 3ZXPA 4NRHB 4XIFA 3LAYA 3FH7A 3B7BA 3JSEO 2XPZA 5LCWJ 3PDMP 4XX5A 2CFUA 4WABA 1OCCE 3GORA 2XRYA 3DEOA 3GZSA 5HV9A 3VM6A 3O10A 1UOHA 2XLDA 3FWVA 5COGA 5EHHA 2I2OA 3CVNA 3DSUA 1ZBPA 1HH8A 2AWYA 2P9PG 3CHOA 2WXHA 2X51A 4Y6WA 2ZXWE 1GQAA 3NMKA 3U9MA 2ZU6B 2WXOA 2DIWA 3FOOA 2QFCA 3RJVA 1UN9A 1UJJA 2J9BA 3URZA 4MVQA 2VC9A 5L0IA 3E37A 5A6BA 1OCRE 4BT8A 5E3AA 5L0DA 3HNJA 5KBAA 2YINA 1U89A 1OCZE 3HIZA 3CIAA 3CK7A 2JEKA 2F8YA 3AG2E 4E0HA 2WXRA 5AAOA 5AJLA 2YHEA 3TGOA 4I6GA 3KH2A 3RW0A 4OIPF 1TYQG 2OOEA 4LLCA 3DAGA 4C3EA 2H6IA 3UT8A 2XCBA 1RCPA 4G8LA 4HI9A 4CJOA 1E83A 3HKKA 2V26A 1QZ2A 2XLWA 2IY0C 3BEEA 4GTQA 2J45A 1JCRA 1E8ZA 3B0PA 1M6TA 2EPMX 2R7OA 3DWWA 2A5EA 1HMDA 4NC3A 3HXFA 2VASA 2CFZA 2ZXWC 4H7XA 2YRFA 5KYXA 3O48A 1OCOE 4Q7CA 5CEAA 3D9PA 1QQEA 3AG2C 3ZNGA 5ENSD 2PX0A 5ARFA 3K9IA 4HFKB 3TWTA 2XSEA 1UJKA 5JP7A 3VYWA 1YZAA 5FZSA 1E2XA 2NSGA 4BY6A 1M56C 3Q7GA 4NQ0A 4HLEA 4PJJA 3U3BA 3ZHEB 3DJUB 4JW1A 1NLXA 4YWQA 1SW6A 5GPGB 2AXVA 3NYLA 5L0GA 1FPPA 4L2LA 2NYJA 3HNLA 1Y6IA 1E7VA 1HFAA 2KGOA 1XZPA 4CDMA 3PHF2 2YL0A 3QTHA 4I3MA 2HV7A 4XLNF 1TKNA 5L0FA 1K05A 5EDSA 3EHQA 3FU3A 2HSQA 5BUZA 4EBAA 5A6JA 1IYGA 4MTFA 4CDAA 3L9TA 1VMAA 5E2QA 4HOSA 1IXVA 4EBBA 3C72A 1OR3A 1TWCA 4DX1A 4BPMA 4XKBA 4AOFA 4B6IA 1KNYA 3D9OA 3LEOA 2DZOA 4Y6CA 1JUQA 2R7WA 2Y3AA 4AEZC 3ENEA 4WUYA 5KYYA 5ARGA 5CEDB 2R7VA 1WG0A 2HKVA 1RJ9B 5FZRA 3G4XA 4DBRA 3LVRE 3SO8A 2Q9CA 4IJJA 2J4DA 3QZCA 3UIPC 4GYWA 3UMKA 2X3MA 1TN6A 4F53A 2H7BA 2Q00A 2J4BA 3ULYA 3APDA 2FFHA 2V3CC 3JRMO 3E70C 2XM4A 2OOCA 2WQ7A 2DYSE 4YL3A 1T6IA 3JXIA 4HQDA 4AV7A 5DVWA 5AQ9A 4U96D 1Z5ZA 5FQ4A 5DIZA 4U0UA 1Z63A 2AP3A 3LNMB 2D4UA 4IRUA 4G23A 1OWMA 4AXHA 2XGSA 4UQXA 3O55A 4BEMJ 4GTOA 3RF3A 1TWAA 4I9EA 3CKBA 3SQVA 1L5JA 5D66A 4Z68A 5FCLA 4HOUA 4ZFHA 1BR4A 4FA6A 1YMPA 1MMGA 4J8EA 2D5RB 4UI9J 5A6CA 1A5EA 3ZIMA 3CZ6A 2EQXA 1BBHA 4U5HA 2L9JA 1FVHA 1BU9A 2AU5A 1EA8A 1YYJA 2DVWA 4RG9A 4U8YD 3PZ3A 3TWRA 2JPUA 5KYUB 4OYSA 4XEFA 3CKCA 4UWKA 3QJZA 4DVYP 1VLTA 3CR3A 3ZUVB 2I1KA 1OCCC 3J06A 2YEVA 4U5DE 3G2TA 3EH1A 5BXOA 1INZA 4U8HA 4RLYA 3V2OA 2WXNA 4FLBA 2WXJA 5E75A 2PQRA 1TJFA 4V3IA 3E34A 4A2NB 2XLMA 3FY4A 4GTRA 3TWQA 1NFOA 3HXBA 5FQ7A 2NSZA 1VYKA 3NZSA 4CRWA 1U2VG 2PNOA 2OU6A 1GS9A 3C3QA 2W9YA 4J8YA 4N06A 2VTBB 1YZCA 3Q6MA 4L9PA 1ORYA 1SF8A 2EPKX 1BI8B 3T9KA 4C0MA 3IXEA 3TULA 3CHRA 4DRHB 2G3KA 4NTFA 1EI7A 3EFOA 4G78A 1PD0A 3ASDA 3ZXSA 1FNTc 4BTAA 2KC7A 2Y3DA 3HVEA 4JC7A 1Q0KA 4AX2A 2AXUA 4O1PA 3NQPA 3Q7FA 3QOUA 3CAXA 3ZVRA 4ANUA 1ZB1A 1FFTC 2WQ6A 1YA7O 4MVMA 4X8QA 2XGMA 4GAAA 4JTCB 4EBKA 4A1SA 1V55E 4DBQA 1SA5A 1CPQA 5D91A 4CZ2D 5ENTD 2P9SG 3ZTZA 2A6EF 2EIKC 3ONLA 3P1UA 1L3PA 1E96B 3U2MA 3LCAA 5LFAA 1RW2A 1LVKA 1U0BB 2R2LA 2XQ0A 3SXMA 3W2WA 4JEBA 1N4PA 2LCHA 2DGJA 2XL4A 3QVYA 1WAO1 3NRHA 4DPRA 2P2CP 1M2VB 2QUPA 3J5QB 3ZYKA 5JHBA 4BJ5A 3KAEA 1ZW2A 3U2LA 4HE8D 3R7RA 4HNAD 4TXQA 4XKCA 4LNBA 4GA2A 3FH8A 1Z5SC 4P29A 3D3MA 4IYPA 3MYFA 1NU9C 3NOCD 5CMWA 2HJMA 3QNKA 3TQOA 3W9FA 1NSGB 3DAFA 1TQGA 2XCCA 4HFGA 4F3VA 2XZDG 3S29A 2FBNA 5B3SC 3NOGD 4C7OA 1KTMA 2J7PD 1LF8A 1WM5A 4GPKA 2Y4TA 5L0HA 5JJ7A 4QI0A 2XLHA 4G0HA 3D9JA 4XI0A 1CGNA 5B1BE 5A6KA 2KSFA 4GMJA 1ZW3A 3B7TA 3TJPA 1KU2A 1YA0A 5AENA 2LAHA 2JLBA 5E76A 1FTSA 3LDZA 1N0RA 1OXBA 1OW8A 4DX7D 1SVXA 1ORSC 3SEOA 2R7SA 3EIJA 4RVBA 1UG3A 5CERB 4O6FA 2VH3A 1MX6A 3Q7LA 4JJFA 4N3AA 3U0CA 1WASA 3T6BA 1AP7A 3MX3A 2CCYA 3DM5A 5EIBE 3SI5A 4EZLA 4KBLA 1H6GA 1TN8A 4ABNA 4YVOA 2NC9A 3D9LA 1NZEA 3C8ZA 4KBQA 3FTXA 1ELWA 1HG2A 2P1AA 2YL7A 3AJIA 5AGFA 1NP7A 1HW1A 3K6BA 3WODF 5L3VA 4JZYA 2RFAA 4MS6A 3RRNB 1YAUO 1N54A 1K3ZD 4C7OB 5K0IA 2OEXA 4OINF 2NUPA 4CBEA 4JPSA 4JB8P 1JWGA 3SXKA 4H4KC 3B0VC 1NU7D 3S28A 5FIOA 1JCQA 2YQ8A 4BJ6A 3E33A 2UUHA 4FX5A 5G2NA 1QVXA 4Q94A 3BEHA 3V5ZA 1MNEA 4ZLDA 1V74B 1FAPB 3IQ6A 3CK8A 5F5HA 2IQCA 1RJ9A 5HI7A 1C03A 3S7BA 3TWXA 1O1TA 4I17A 4KC9A 5T3WA 1LI5A 4DI4A 2WXPA 4P6IC 4O6NA 3L8JA 2P9LG 3K1IC 5CBOA 2XL6A 2YHCA 3EQLF 4FADA 1IQUA 2IEJA 4AK9A 1LM3B 5DLJA 3UGPA 4ACLA 3LEWA 4NTBA 2QZAA 4GA0A 3UTMA 1YA9A 3NAWA 4JCZA 5BUOA 4MW8A 3W8IA 4DJAA 3QKYA 3EFOB 3ASFA 2EIMC 2X6JA 1D8EA 2XPIA 2C0MA 3R7CA 4UWHA 5HS0A 3UR3C 3ZHEA 1HXIA 3KSQA 4D10C 4YT2A 4RDAA 1JPJA 5T4YA 4GMRA 3FUEA 2Q3TA 2M4EA 4UWGA 2NXPA 5HRYA 2EILC 4HI8A 3IQCA 3ISMC 3RQGA 5AIJA 1RKEA 1VOMA 2WVOA 4PJNA 2V0PA 1DVPA 1N0QA 2VQ2A 4APFA 3ASNE 1VB5A 3H2UA 1X81A 3F6QA 2WB7A 4GPMA 4GMLA 1TWHA 3AS8A 4JHRA 2KXPC 5HSWA 2BE5F 1W3BA 1NA3A 4MNDA 4E85A 3FULA 1LE4A 4JHJA 3CV0A 2LXLA 2IONA 2IOSA 1HX8A 2DYRC 1O5HA 4AY5A 3UI2A 3ABMC 1K8KG 4U9DA 3FH5A 3C8GA 4MVSA 2Q7FA 1QNFA 4A55A 1T9KA 1LPEA 4UWLA 1EKYA 2BKKB 3AG4E 3LXUX 3FTWA 1S7ZA 3RFYA 1QYMA 2MOWA 1AEPA 3UX4A 2YQYA 2FAPB 3ZQYA 2GRRB 1VDYA 3ZGQA 2KC3A 2ZD9A 3HHMA 4BX8A 1ELKA 2L0TB 2QYUA 3SBTB 1S63A 5EYPF 4TXPA 3PS6A 4BT9A 4A3VA 3ZIBA 1J8MF 2WVQA 2GAQA 3Q5MA 1WGWA 2JD3A 3VLFA 2OG2A 2XM0A 4NURA 2A0UA 2WPVA 3RIBA 3SHFA 2XEEA 5BQHA 2L9BA 2RD0A 4XPYA 5CI9A 3D9HA 2R9RB 4MLPA 3SD5A 5JLIA 3CHMA 4GU5A 1H9GA 5KYWA 4ILHB 2QYJA 3RAUA 5AYWD 2KZTB 2KBXA 2XLEA 4CS7A 4N3BA 3C18A 4XEVA 4DJ9A 4YDYA 2V4LA 3Q15A 5B1AE 5ENPD 4PK4A 3ZU7B 3T6JA 1VTMP 4NQFA 2GGFA 5KYUA 3X1OA 1H6PA 2IXNA 2KCVA 3RH3A 4N5QA 2IXOA 1ZYRF 2Q9BA 3G4ZA 5TJ5E 1XGWA 4UDVA 3U3FA 2CNWD 4F7AA 3MEKA 2Y3HA 4G7OF 3HJCA 3JQ1A 4B94A 3WG7E 4L1BA 1AWCB 2FEZA 2ZIRA 5G55A 3ZN3A 2L6HA 1YYXA 4XEKA 2P58C 2QNLA 4W8KA 4BERA 3VRCA 5BV1A 3EGXA 3SZ7A 2YZSA 5JHAA 4U0ZA 3JTLO 2PL2A 4CGVA 5CRVA 3EGDB 2F37A 3LY9A 1IHGA 1S70B 5EX0A 2V5FA 4XPWA 1OXKA 2WXQA 3L16A 1PCXA 3U4TA 2XPYA 3TWVA 1TNYA 3W8HA 1ZU4A 4G7HF 4OIQF 5B1BC 3LJNA 3PDNA 1E8WA 2E0IA 2XS1A 3MKRA 3T6GB 2VCAA 5BW8C 1HE8A 2OCCC 3ASGA 5EIDA 3IHVA 3NBNB 2G3VA 4IULA 3APCA 3ML9A 3QB2A 4CT4A 4EWCA 2GRNB 4I6JA 3BG1B 3C5RA 4HXIA 2J9WA 2Y1LE 5E33A 4E0IA 2I15A 4IB4A 3ITFA 4FU3A 2EIJE 3DZAA 2KCLA 2IJGX 4W9RA 4JCHA 1SZAA 4J7YA 3PREA 2ZXPA 1HG5A 3I4GA 1XZQA 5JVEA 2ICWG 1QKRA 4D4XA 2HM8A 3AU4A 1ZHZA 4FC8A 5AQ7A 3KMIA 2P9NG 3U66A 3CVQA 2KYHA 2CG2A 4HORA 3NKDA 3S27A 1SZIA 3CEXA 3SP1A 2MRIA 4PJLA 4WWOA 3DXMG 5B1AC 4M3OA 5ENNA 2WZGA 1HE9A 3Q4AB 4QQIA 5LCWC 1LD8A 2DCPA 2RD9A 1RKEB 2MHKA 5A23A 4Q96A 5EGYA 3S7DA 5M72A 4JHKA 2YHSA 3AU5A 2FULA 3FU5A 4MVZA 1F1MA 3G50A 5C2YA 1V54C 3UM0A 1LS4A 1T6QA 3FTYA 2Y0BG 3SBSA 4GTVA 4U07A 1U3DA 1UN8A 5CBNA 5JRAA 4K5AB 2HMZA 3RU0A 4PFPA 2VCBA 2LFDA 3ESKA 1JWFA 3ECSA 3ABME 3W4YA 4JURI 2KQ9A 3KPHA 1NL4A 2UY1B 4YT5A 2JX0A 5G04C 1Q0GA 2DYSC 4P9TA 4JA9A 2JABA 3TOLA 4PS7A 3EGXB 3M79A 2CGEA 4CDRA 2IXPA 3NDBB 3FU6A 3FHEA 3JYHA 3CQGB 2AWIA 5HQ8A 3ZFWA 4HRNA 3HXDA 3OA1A 2LQGA 2IOLA 4I1MA 4CS8A 1ZU5A 4N5CA 3M4CA 2YNQA 3UMIA 5KJLA 1LE2A 1JR8A 4ULVA 2XZTG 5CECB 4YK5A 3ABLC 2HSBA 3H65A 3OXFA 4J7WA 4DI3A 3ESLA 3DSXA 3PZ1A 4HB5A 1GM5A 2LSUA 4DRIB 2ZGDA 1PAQA 2DBAA 3CHSA 1LKXA 3W9GA 4UI9C 4JEUA 2I6HA 3PZDA 2YLIA 3TD7A 3NMJA 4E7SA 4EIYA 4FWVA 4QI2A 4KZCA 2Q9AA 2GWWA 5KYWB 4ONSA 1TNBA 4FJYA 1APCA 3L08A 3S2AA 2HE0A 2I8BA 4JRZA 4JEAA 4ACKA 1DCEA 4EPZA 2YLGA 3IV0A 1IKND 3HYMB 3DSWA 4LACB 2W4BA 3EHMA 4O1OA 4HS2A 2NPUA 2PZIA 1N4QA 2LIGA 3CGHA 3CVWA 2LSVA 2PX3A 3KYJA 2EIME 2J0XA 2NUTA 1H0AA 3S0XA 3IQ5A 4WNDA 4J6IA 1OWLA 4GB9A 4ANXA 1K40A 2GFHA 1QSPA 4JZAA 4JTDB 3KS2A 4G11A 1G8XA 4U5CE 1SMYF 3PMRA 4GCOA 4B0ZA 4J7TA 3FTUA 1C02A 4GA1A 3RO3A 2RG8A 3KEAA 5KNGA 3LVQE 2EINE 5FJYA 2W4MA 1EDUA 3GODA 3G2SA 4UQYA 4A3TA 4MQ9F 4RG6A 1G4WR 2HUJA 1EPUA 1YCSB 3ATPA 3ZPJA 2WZFA 4J0UA 4K7BA 1K1AA 4GZ6A 3EU5A 4PDXA 1QBQA 2NSFA 1MHQA 2XHEA 3RO2A 4DUIA 2E2EA 4RQIA 4G25A 4LDQA 4YN0B 3ULQA 1TNOA 2CHWA 1S64A 3NB2A 5COMA 1BLXB 2B0OE 2EPOA 1OUVA 4PR9A 4OIRF 1DNPA 2R59A 3R9MA 1JPLA 5L0JA 3OEOA 1H2TC 3TWSA 4CGWA 2Z15A 4HFFB 3N2ZB 2B6CA 1JMWA 4N2QA 1S05A 4EBJA 4U5EE 3ZDLA 2CHZA 5ENRD 4MBGA 4E7ZA 1H9TA 1XWJA 2HMQA 1HW2A 4LDKA 5EK0A 3US6A 4HBDA 5BPPA 1M57C 4UQZA 4B8CB 3EU9A 3QK0A 2IXMA 3DPYA 5AQAA 4N6HA 1Q2ZA 1ZVZA 3FDHA 4KZ0A 1MQSA 1XNFA 4AJWA 1NG1A 4JJGA 3Q75A 2OKUA 3U9JA 1ZHWA 3FUHA 5IY5C 2X6IA 5EN5D 1I4YA 2LXMA 3R9AB 3CQCB 3U3WA 3QW1A 4KXKB 1WDYA 2L6BA 4C0EA 1ZZPA 3L8IA 3K33A 2I9CA 2GA0A 4LDRA 5EYLA 3MJWA 1O87A 1D9SA 1NFNA 4EHMA 4XLPF 1E85A 1OR2A 2QY7A 2DZNA 2J09A 3SYNA 2AVPA 4IN3B 3CHQA 3HTKC 3DE8A 2H6FA 1S0PA 2VB6A 2BEDA 2IO2C 4CJGA 4Z9JA 3VTYA 1N95A 1SQMA 3FUDA 4YDOA 4BJ6C 3T9OA 4DX6D 2W45A 2HV6A 3T5VA 4WGZA 2A6HF 3DWLG 3Q6NA 5AJDA 5JS5A 4MRUA 3FOPA 1EQ1A 5EILA 4BEJA 4U5BE 4OVVA 1HU3A 2BKGA 2VSOE 1RZ4A 1KZOA 2UY1A 1Y4CA 4GYYA 3PUJA 4KI2A 4ZHBA 1WATA 3N71A 4DLQA 2FF4A 4BG0A 3DE9A 2ZXOA 4CSAC 3FUNA 4WNEA 4O6YA 1J8YF 3NF1A 3FDQA 2PP4A 3QAQA 1V55C 1IHBA 1H7IA 2OJQA 3LY7A 3MKQB 4PS3A 4K0RA 5ITZF 2LNIA 3B7RL 3B29A 1FCHA 4L2YA 5E3CA 4I9CA 2P9IG 2H7VC 4YJWA 1I4ZA 3E4BA 1U6HA 3IKOB 3V31A 2Y3GA 3EIQC 4IWBA 4F1SA 3O39A 2AVKA 4XI9A 1HZ4A 4XWJA 3TG4A 2GDCA 3LUTB 3PNLB 1M2VA 3MGBA 3U8VA 2VJ8A 1HY5A 3L82A 4KT6B 2DI3A 3B95A 2AWCA 4U0SA 4CEMA 3JQ0A 4MTGA 3IEGA 3RK6A 3EPVA 2P0NA 1CPRA 3I4UA 3AOUA 2UUIA 1TJCA 4U63A 4BSXA 5HKPA 3M1CB 2R17C 4U95D 1OWOA 3FTZA 2YWAA 1MJ0A 1MNDA 2IF4A 5CRUA 3RRMB 3V7OA 4N2SA 4U5FE 3TK0A 3GZ2A 3U64A 3MV3B 1CGOA 1TN7A 2RKKA 4JKVA 4CIPA 3PVLA 3ZKJA 5IY5E 4JL0A 2H8AA 1A7EA 4DXWA 3ZG1A 3G2WA 4YVQC 4BEPA 4PS8A 1TR2A 3S9OA 1NA0A 2Y3BA 3QC1A 1WTYA 3DSSA 2BF0X 1RMVA 3RVZA 1SYQA 5FZQA 1JAFA 3DM9B 2WXKA 3HRAA 1DOWA 3DBSA 3VF0A 4J30B 4FHJA 4AE4A 4R32A 1OY3D 3HVEB 1HE1A 2J8WA 3RIPA 3CQZA 3BRJA 4GTPA 3ZWIA 2E87A 1N4SA 1IW7F 1TNZA 4EECA 4CSAA 3JUEA 2M63A 2KJGA 3AS5A 5ANLA 2WVNA 3C8GD 5A7DB 4ZLCA 4OVUA 3ML8A 4G26A 1KT1A 4NIKA 1Z6AA 4HLLA 3K1HA 4EQFA
chains in the Genus database with same CATH topology
1IQRA 4PUCA 2J9VA 1QZXA 3UT4A 1Z3IX 5CCMA 5KJKA 1N1CA 3L0IA 4LCTA 3CK9A 3NYMA 2XGOA 3MLGA 3KD7A 3LESA 2EINC 3K7DA 3F47A 3QARA 2BTDA 3I5QA 4GZ3A 3AQCA 1KT0A 3S7FA 3MZLB 3ASHA 5DS4A 4KNWA 3GYZA 4GZDA 2PQNA 2R5SA 3ZYMA 4CS9A 3LYAA 3JCKC 3LS8A 4FLHA 4LLEA 3QWPA 1Z3XA 3RKOF 3B7UX 2J46A 3OXGA 3G2VA 2X38A 1FFHA 3VAYA 1Y8MA 3KKBA 3SF4A 1HO8A 1MMNA 2GRMA 2X6FA 4BJ1A 1W2WA 2PM6A 3CLJA 3LJBA 3PH0C 2CDQA 3FEYA 2A5UA 4B8AA 3FUIA 5CCLA 1FMWA 4GZCA 3CVPA 3CEQA 3VLDA 1JPNA 3FEXA 1OCOC 3IEEA 3B9QA 2KW3C 2VSNA 2WXMA 3TXNA 2UWJG 1N52A 4JEHA 5KYYB 4URKA 3KL4A 1TEZA 3MA5A 1M2OA 4K0DA 4N39A 3CSTA 5D0QD 3KEZA 1B89A 3NYJA 4U04A 1E8YA 4Q69A 3DD7A 1OWNA 3B7SA 4H7YA 2VSXE 3IBEA 5DQTA 2Y39A 5D92A 1E8XA 4BJTA 2IOQA 4UI9K 3ZYLA 4TRQA 2FO7A 4WJ0A 1H2UA 2L81A 2NUTB 2R7RA 4E6HA 1OCRC 3VTXA 2CNWA 4QDLA 3VLEA 5T3TA 2XXAB 2WZLA 4AP2A 3Q49B 4RD9A 4L23A 1FMVA 1Z23A 5J90A 2AW6A 3L6AA 2EIJC 5BV0A 2J9UA 1MMDA 2NUPB 3DXJF 3PE4A 3L34A 3GZ1A 2WL8A 2WQHA 1PC2A 1ELRA 4XE0A 3SZRA 4IAOA 5KYXB 5LX8A 3FFLA 2KZTA 1H2VC 5LP0A 4PH4B 4ILGA 1PY1A 1D1AA 4J8FA 3UPVA 3D9IA 1LS1A 4FESA 5CI8A 2J08A 4WNFA 3QDNA 4BX9A 3SGHA 5DS6A 4JC8A 3B13A 2KATA 4RSYA 3PE3A 4OIOF 3UT7A 2V8SE 3EDTB 3FVYA 2WMNA 4FJZA 3SNHA 3JT1A 3APFA 2WXGA 2XRHA 4GCNA 1EF1C 4G24A 3OAWA 1ZHXA 1P5QA 4BJ5C 4YNDA 1D1CA 4WWNA 3B0UX 1X5BA 5BNWA 2VYIA 5FQ8A 4WWPA 3OXLA 4APOA 3OWTA 3UMHA 4ANWA 3RYLA 1UW4B 2C2LA 5KCMA 4AVXA 3QMKA 3JRTA 3PEVB 1D0ZA 1NZNA 4J8DA 4X0RA 2XXAA 2CW0F 3BG0B 4OD5A 4G7ZF 4ANVA 3FTVA 3N0TA 4PFOA 3DPDA 1OCZC 3Q47B 3ZRHA 4KYOB 4JVSA 2WXFA 4I2ZA 3UQ3A 4NACA 2QTVA 3AG1C 4I1AA 3LEVA 3L22A 2PFDA 2WM9A 2LAIA 5CMYA 3TAXA 3LS1A 4CDNA 2J7PA 2IU1A 5DBKA 4NY3A 1Z6TA 3TG5A 3ZVVA 4ME2A 1KLXA 2A68F 1EYHA 5KJMA 4FP7A 5FWQA 2LO6A 3EGDA 3JYSA 4CIHA 3T4RA 5FT9A 2A1DD 2WMOA 2VGXB 4I1OB 2J07A 4AIFA 1E7UA 1BR2A 3QWVA 4FHKA 2IYLD 3FHDA 3O4ZA 2WXLA 4DOZA 3ZW3A 4HEAJ 3DJNB 1OKKD 2FI7A 5FQ6A 3SFZA 4Q5SF 1OWPA 4F4BA 2Y69C 1H19A 3ZEFA 4C3BA 2L0IA 3EG9B 3K66A 4CT0A 2ZPAA 2XRZA 2G62A 2FGYA 3C98A 2MWQA 2PF4E 4K03A 4PJMA 3EJNA 2A69F 5EKQD 5G05C 4Q4ZF 1FVFA 1D0XA 4KNVA 4XZ4A 2GRLA 5ANRA 3UMVA 1Z3YA 1D0YA 5KJNA 3MYVA 3LLIA 4O7GA 3L13A 2J9QA 4YT4A 3GW4A 1BR1A 4GEHA 5EX3A 2ZXRA 2R7TA 2P6VA 1E90A 2C04A 2OVFA 4BWRA 4GZ5A 3FAJA 4J8SA 3L17A 4OD4A 2IFUA 2O9XA 3EG9A 4WAFA 1MMAA 3HLZA 4GYOA 4HOQA 4XTKA 2WXIA 4AE4B 3CSFA 3FP3A 4C3DA 4EZJA 3W2VA 3D9MA 1IZMA 3MV2B 4UWFA 1TWGA 2R7QA 3D9KA 3JCUQ 4ULWA 3E9VA 2Y4UA 5LOZA 2PM7A 2C0LA 3CVLA 5DS5A 4QFVA 4AY6A 4YT8A 5J08A 4A1GA 5FTPA 4R7LA 3FUFA 3FUKA 1GW6A 2CHXA 3MCXA 2H7OA 3CSKA 3RKVA 2NG1A 2OV8A 4AM9A 3D9NA 4M63A 4GYTA 4ILIA 5CHEE 3LY8A 4DVZA 3PNTB 2XEVA 2VTBA 3X2QC 4G2VA 3T5XA 3FU0A 3T8MA 3IHYA 4LUNU 3CVVA 2L6JA 1U3CA 5JJTA 4I6EA 3UGOA 5DQZA 2B0JA 2AXZA 2HR2A 4HVBA 2HO1A 1D1BA 5JJ6A 3JSZA 4KVMA 3AG3C 3LKUA 3I3NA 2J0WA 3UNGC 3NZUA 4LEUA 1H6KA 4DLOA 5T8IA 4ATGA 3FUMA 1VYIA 2QY9A 3ZSUA 4CCAA 3GANA 4MKTA 1ZHYA 4KVOA 3POVA 3F46A 4TV3A 3N24A 5BT1A 3ZYQA 4U5GA 3I5PA 5G05J 2VGYA 1ZHTA 5T3RA 2GW1A 1HS6A 4L7TA 1HF8A 2HYZA 3PUKA 4HOTA 2WB2A 4KMOA 2P7VA 2KM4A 3PRZA 3TXMA 4EZKA 3EZIA 5G04J 3R7QA 3ABKC 3OTNA 3AG4C 3FTSA 2ONDA 3HDXA 3G2UA 3WG7C 3FUJA 2LSEA 2BUGA 4J32B 1ST6A 4I44A 2X6KA 3NG1A 1BPOA 4BTBA 2VGXA 3EH2A 4N3CA 3CVUA 3ZC4A 1ZU2A 4BFRA 4FULA 3S7JA 3SNXA 4JXTA 4O79A 3P2BA 1WY6A 3RRUA 4LERA 3ONKA 4EBAG 1VK5A 3AS4A 2WVIA 4I2WA 4WNGA 3EHNA 4C9BB 2ILRA 3I4RB 2CG3A 3LPZA 1SZ9A 2KCKA 5D0OD 2I1JA 2R7XA 2C03A 4LRZA 2MYSA 3LNRA 3PEUB 2J49A 4G1TA 4ANJA 2R7UA 3O6XA 3LLKA 1PD1A 4DK5A 2KNHA 3QWWA 3CHPA 4O6MA 3DMDA 5F5FA 3CVYA 2VSYA 3AQBA 4JA7A 4TUUA 3JUIA 3LS0A 4CS8C 4I43A 3EZHA 1QLEC 2X6HA 3LJ3A 3NKEA 3WXXA 4B89A 3ASOC 3CVXA 1OKKA 5C1DA 2A4ZA 2OVBA 3U9WA 3UUXA 4RBNA 1A17A 3L54A 3TL5A 5L3QA 5KYNA 3MKQA 3ASNC 4CS9C 5T1DB 4NRHB 4XIFA 3LAYA 3FH7A 2XPZA 5LCWJ 4XX5A 2CFUA 2XRYA 3GZSA 3FWVA 5EHHA 2I2OA 3CVNA 1ZBPA 1HH8A 3CHOA 2WXHA 2X51A 4Y6WA 2ZU6B 2WXOA 2DIWA 2QFCA 3RJVA 1UN9A 1UJJA 3URZA 4BT8A 5E3AA 2YINA 3HIZA 3CIAA 3CK7A 2JEKA 2WXRA 5AJLA 2YHEA 3TGOA 4I6GA 3KH2A 4OIPF 2OOEA 4LLCA 3DAGA 4C3EA 3UT8A 2XCBA 2V26A 1QZ2A 3BEEA 2J45A 1E8ZA 3B0PA 2R7OA 2VASA 2CFZA 2ZXWC 4H7XA 5KYXA 3O48A 4Q7CA 3D9PA 1QQEA 3AG2C 2PX0A 5ARFA 3K9IA 4HFKB 2XSEA 1UJKA 3VYWA 5FZSA 4BY6A 1M56C 3Q7GA 4NQ0A 4HLEA 4PJJA 3ZHEB 3DJUB 4JW1A 4YWQA 3NYLA 2AXVA 4L2LA 1Y6IA 1E7VA 1HFAA 2KGOA 4CDMA 3PHF2 4I3MA 2HV7A 4XLNF 1TKNA 5EDSA 3FU3A 5BUZA 4EBAA 1IYGA 1VMAA 5E2QA 4HOSA 4EBBA 1TWCA 4XKBA 4AOFA 4B6IA 3D9OA 4Y6CA 1JUQA 2R7WA 2Y3AA 4AEZC 3ENEA 4WUYA 5KYYA 5ARGA 2R7VA 1RJ9B 5FZRA 4DBRA 3LVRE 2Q9CA 4IJJA 2J4DA 3QZCA 4GYWA 3UMKA 2X3MA 4F53A 2H7BA 2J4BA 3APDA 2FFHA 2V3CC 3E70C 2WQ7A 4AV7A 5DVWA 1Z5ZA 5FQ4A 5DIZA 4U0UA 1Z63A 4IRUA 4G23A 1OWMA 4AXHA 2XGSA 4UQXA 1TWAA 4I9EA 3CKBA 1L5JA 5FCLA 4HOUA 1BR4A 4FA6A 4J8EA 1MMGA 2D5RB 4UI9J 5A6CA 3ZIMA 3CZ6A 2EQXA 4U5HA 2L9JA 1FVHA 4RG9A 5KYUB 4OYSA 3CKCA 4UWKA 3QJZA 4DVYP 3CR3A 2I1KA 1OCCC 2YEVA 4U5DE 3G2TA 3EH1A 1INZA 4U8HA 2WXNA 4FLBA 2WXJA 5E75A 2PQRA 1TJFA 4V3IA 4A2NB 3FY4A 5FQ7A 2NSZA 1VYKA 3NZSA 4CRWA 2W9YA 4N06A 2VTBB 3Q6MA 1SF8A 4C0MA 3CHRA 2G3KA 3EFOA 1PD0A 3ASDA 3ZXSA 4BTAA 2KC7A 2Y3DA 3HVEA 2AXUA 4AX2A 3NQPA 3QOUA 3ZVRA 4ANUA 1FFTC 2WQ6A 2XGMA 4GAAA 4A1SA 4DBQA 5D91A 2A6EF 2EIKC 3ONLA 3P1UA 1E96B 3LCAA 5LFAA 1LVKA 2XQ0A 3W2WA 2DGJA 2XL4A 1WAO1 3NRHA 4DPRA 1M2VB 3ZYKA 5JHBA 4BJ5A 3KAEA 4HE8D 3R7RA 4XKCA 4GA2A 3FH8A 4P29A 3D3MA 4IYPA 1NU9C 5CMWA 3QNKA 3DAFA 2XCCA 4HFGA 4F3VA 3S29A 2FBNA 5B3SC 4C7OA 2J7PD 1LF8A 1WM5A 4GPKA 2Y4TA 5JJ7A 4QI0A 4G0HA 3D9JA 4XI0A 4GMJA 3B7TA 3TJPA 1KU2A 1YA0A 5AENA 2LAHA 2JLBA 5E76A 1FTSA 3LDZA 3SEOA 2R7SA 3EIJA 4RVBA 1UG3A 4O6FA 2VH3A 3Q7LA 4JJFA 4N3AA 3T6BA 3MX3A 3DM5A 3SI5A 4EZLA 4KBLA 4ABNA 4YVOA 2NC9A 3D9LA 1NZEA 4KBQA 3FTXA 1ELWA 1HG2A 1NP7A 3K6BA 3WODF 5L3VA 4JZYA 3RRNB 4MS6A 1N54A 4C7OB 4OINF 4CBEA 2NUPA 4JPSA 1JWGA 4H4KC 3B0VC 1NU7D 3S28A 2YQ8A 4BJ6A 4FX5A 5G2NA 4Q94A 4ZLDA 1MNEA 3CK8A 5F5HA 2IQCA 1RJ9A 5HI7A 3S7BA 4I17A 4KC9A 5T3WA 4DI4A 2WXPA 4P6IC 4O6NA 3K1IC 2YHCA 3EQLF 4FADA 1IQUA 4AK9A 5DLJA 3UGPA 4ACLA 3LEWA 4GA0A 5BUOA 3W8IA 4DJAA 3QKYA 3EFOB 3ASFA 2EIMC 2X6JA 2XPIA 2C0MA 4UWHA 3UR3C 3ZHEA 1HXIA 4D10C 4YT2A 4RDAA 1JPJA 5T4YA 3FUEA 2Q3TA 2M4EA 4UWGA 2NXPA 2EILC 5AIJA 1VOMA 2WVOA 4PJNA 2V0PA 1DVPA 2VQ2A 4APFA 2WB7A 4GMLA 1TWHA 3AS8A 4JHRA 5HSWA 2BE5F 1W3BA 1NA3A 4MNDA 4E85A 3FULA 4JHJA 3CV0A 2IONA 2IOSA 1HX8A 2DYRC 1O5HA 4AY5A 3ABMC 3FH5A 2Q7FA 1QNFA 4A55A 4UWLA 3LXUX 3FTWA 1S7ZA 3RFYA 2MOWA 3UX4A 1VDYA 3ZGQA 3HHMA 4BX8A 1ELKA 2L0TB 3SBTB 4BT9A 3PS6A 4A3VA 3ZIBA 1J8MF 2WVQA 3Q5MA 1WGWA 2JD3A 3VLFA 2OG2A 4NURA 2WPVA 3RIBA 3SHFA 2L9BA 2RD0A 5CI9A 4MLPA 3SD5A 3CHMA 4GU5A 5KYWA 4ILHB 5AYWD 2KZTB 4CS7A 4N3BA 2V4LA 3Q15A 4PK4A 3T6JA 2GGFA 5KYUA 3X1OA 2IXNA 2KCVA 3RH3A 2IXOA 1ZYRF 2Q9BA 1XGWA 2CNWD 4F7AA 3MEKA 2Y3HA 4G7OF 3HJCA 3JQ1A 4B94A 4L1BA 2FEZA 5G55A 3ZN3A 2P58C 4W8KA 5BV1A 3EGXA 3SZ7A 2YZSA 5JHAA 4U0ZA 2PL2A 4CGVA 3EGDB 3LY9A 1IHGA 5EX0A 2V5FA 2WXQA 3L16A 1PCXA 3U4TA 2XPYA 3W8HA 1ZU4A 4G7HF 4OIQF 5B1BC 3PDNA 1E8WA 2E0IA 3MKRA 5BW8C 1HE8A 2OCCC 3ASGA 3IHVA 2G3VA 4IULA 3APCA 3ML9A 3QB2A 4CT4A 4EWCA 4I6JA 3BG1B 4HXIA 2J9WA 5E33A 3ITFA 4FU3A 3DZAA 2KCLA 2IJGX 4W9RA 4JCHA 1SZAA 3PREA 2ZXPA 1HG5A 3I4GA 3AU4A 2HM8A 4FC8A 1ZHZA 3KMIA 3U66A 3CVQA 2CG2A 4HORA 3NKDA 3S27A 1SZIA 3SP1A 2MRIA 4PJLA 4WWOA 5B1AC 4M3OA 5ENNA 2WZGA 3Q4AB 5LCWC 2DCPA 2MHKA 5A23A 4Q96A 5EGYA 3S7DA 5M72A 4JHKA 2YHSA 3AU5A 2FULA 3FU5A 5C2YA 1V54C 3FTYA 3SBSA 4U07A 1U3DA 1UN8A 3RU0A 4PFPA 3ESKA 1JWFA 3ECSA 4JURI 2KQ9A 2UY1B 4YT5A 5G04C 2DYSC 4JA9A 4PS7A 3EGXB 2CGEA 4CDRA 2IXPA 3NDBB 3FU6A 3FHEA 3JYHA 3CQGB 2AWIA 5HQ8A 3ZFWA 3OA1A 2IOLA 4I1MA 4CS8A 1ZU5A 4N5CA 2YNQA 3UMIA 5KJLA 3ABLC 3H65A 3OXFA 4DI3A 3ESLA 2LSUA 1PAQA 2DBAA 3CHSA 1LKXA 4UI9C 4JEUA 2I6HA 3PZDA 3TD7A 4E7SA 4FWVA 4QI2A 4KZCA 2Q9AA 5KYWB 4FJYA 3L08A 3S2AA 2I8BA 4ACKA 4EPZA 3IV0A 3HYMB 4LACB 2W4BA 3EHMA 4HS2A 2PZIA 3CGHA 3CVWA 2LSVA 2PX3A 2J0XA 2NUTA 1H0AA 3S0XA 4WNDA 4J6IA 1OWLA 4GB9A 4ANXA 2GFHA 4JZAA 3KS2A 4G11A 1G8XA 4U5CE 1SMYF 3PMRA 4GCOA 4B0ZA 3FTUA 3RO3A 4GA1A 2RG8A 3LVQE 5FJYA 2W4MA 1EDUA 3GODA 3G2SA 4UQYA 4A3TA 4MQ9F 4RG6A 1EPUA 3ZPJA 2WZFA 4J0UA 4K7BA 4GZ6A 4PDXA 1MHQA 2XHEA 3RO2A 2E2EA 4G25A 4YN0B 3ULQA 2CHWA 1OUVA 4OIRF 1DNPA 2R59A 1JPLA 3OEOA 1H2TC 4CGWA 2Z15A 4HFFB 3N2ZB 4N2QA 4U5EE 2CHZA 4E7ZA 5BPPA 1M57C 4UQZA 4B8CB 3QK0A 2IXMA 3FDHA 4KZ0A 1MQSA 4AJWA 1XNFA 1NG1A 4JJGA 1ZHWA 3FUHA 5IY5C 2X6IA 3R9AB 3CQCB 3U3WA 4KXKB 4C0EA 3K33A 2I9CA 3MJWA 1O87A 4XLPF 2QY7A 2J09A 3SYNA 2AVPA 4IN3B 3CHQA 3HTKC 1S0PA 2VB6A 3VTYA 1SQMA 3FUDA 4BJ6C 2W45A 2HV6A 3T5VA 2A6HF 3Q6NA 5AJDA 4MRUA 4BEJA 4U5BE 4OVVA 1HU3A 2VSOE 2UY1A 4GYYA 3PUJA 4KI2A 3N71A 4DLQA 2FF4A 4BG0A 2ZXOA 4CSAC 3FUNA 4WNEA 4O6YA 1J8YF 3NF1A 3FDQA 2PP4A 3QAQA 1V55C 3LY7A 3MKQB 4PS3A 4K0RA 2LNIA 3B7RL 1FCHA 4L2YA 5E3CA 4I9CA 2H7VC 4YJWA 3E4BA 3IKOB 2Y3GA 3EIQC 4IWBA 4F1SA 3O39A 4XI9A 1HZ4A 4XWJA 3TG4A 3PNLB 1M2VA 3MGBA 2VJ8A 4KT6B 4U0SA 4CEMA 3JQ0A 3IEGA 3RK6A 3EPVA 3I4UA 1TJCA 4U63A 4BSXA 3M1CB 2R17C 1OWOA 3FTZA 1MNDA 2IF4A 3RRMB 4N2SA 3V7OA 4U5FE 3GZ2A 3U64A 3MV3B 3PVLA 4JL0A 3ZG1A 3G2WA 4YVQC 4PS8A 1TR2A 1NA0A 2Y3BA 3QC1A 2BF0X 5FZQA 3DM9B 2WXKA 3DBSA 4J30B 4FHJA 4AE4A 3HVEB 3RIPA 3CQZA 2E87A 1IW7F 4EECA 4CSAA 2M63A 2KJGA 3AS5A 5ANLA 2WVNA 5A7DB 4ZLCA 4OVUA 3ML8A 4G26A 1KT1A 1Z6AA 3K1HA 4EQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LX8 A;  3EHN A;  4PUC A;  3QNK A;  5E76 A;  4F7A A;  3JQ0 A;  3CK8 A;  3CK9 A;  3JQ1 A;  3OTN A;  5J90 A;  3IV0 A;  3GZS A;  3EJN A;  5FQ4 A;  5E75 A;  3EHM A;  3L22 A;  5FQ6 A;  3SNX A;  3HDX A;  3P1U A;  3CGH A;  5T3R A;  5FQ7 A;  5FQ8 A;  3JYS A;  3KEZ A;  4LER A;  3MX3 A;  3CKC A;  3MCX A;  4L7T A;  5T4Y A;  3NQP A;  3CK7 A;  3CKB A;  3I4G A;  4MRU A;  4F53 A;  3MYV A;  3FDH A;  4Q69 A;  3LEW A;  3SGH A; 
#chains in the Genus database with same CATH topology
 2GRO B;  2MYO A;  1IQR A;  2Y69 E;  4PUC A;  2J9V A;  1QZX A;  3UT4 A;  1Z3I X;  5CCM A;  5KJK A;  4K1O A;  1N1C A;  3L0I A;  1QPU A;  3C62 A;  4LCT A;  3CK9 A;  3NYM A;  2XGO A;  3MLG A;  3KD7 A;  2XL8 A;  3LES A;  1T01 A;  2OCC E;  2EIN C;  1NI1 A;  1G4U S;  3K7D A;  3F47 A;  3QAR A;  3TWU A;  2BTD A;  3I5Q A;  4FAP B;  4GZ3 A;  3AQC A;  1KT0 A;  3UKU G;  3S7F A;  3MZL B;  2IO3 C;  3ASH A;  5DS4 A;  4KNW A;  3GYZ A;  1JRA A;  3U5S A;  2PQN A;  3GEH A;  4GZD A;  2R5S A;  3ZYM A;  4CS9 A;  3LYA A;  3JCK C;  3EHR A;  3LS8 A;  4FLH A;  3PZ4 A;  4LLE A;  3QWP A;  3GWL A;  1Z3X A;  3RKO F;  2F22 A;  3B7U X;  2J46 A;  3OXG A;  2ETB A;  3G2V A;  2X38 A;  2XS8 A;  2IBF A;  1DCQ A;  1FFH A;  1ORJ A;  2OJE D;  3MFN A;  3SY2 A;  3VAY A;  3BQO A;  1Y8M A;  3KKB A;  2KK1 A;  4JE9 A;  3SF4 A;  4K5C A;  1HO8 A;  2V5Q C;  2HFI A;  1MMN A;  5JUA A;  2GRM A;  2OQM A;  2X6F A;  4BJ1 A;  1W2W A;  1T6U A;  2PM6 A;  3CLJ A;  3LJB A;  3PH0 C;  1Q0M A;  2CDQ A;  3GM1 A;  3HXE A;  3FEY A;  2A5U A;  4B8A A;  3FUI A;  5CCL A;  1FMW A;  4GZC A;  3CVP A;  3CEQ A;  3VLD A;  1JPN A;  4JIO A;  2A0B A;  4U9E A;  1O1S A;  3FEX A;  1E86 A;  1OCO C;  3IEE A;  3V79 K;  1KPS B;  2HS5 A;  3B9Q A;  3ABL E;  3JYY A;  3PZ2 A;  3S90 A;  2KW3 C;  2VSN A;  4GQH A;  2WXM A;  3TXN A;  2UWJ G;  1N52 A;  4JEH A;  5KYY B;  4URK A;  1RKC A;  3KL4 A;  1TEZ A;  3L1M A;  3MA5 A;  1M2O A;  4K0D A;  4N39 A;  3CST A;  5D0Q D;  3KEZ A;  1B89 A;  4LG6 A;  1JOG A;  3NYJ A;  4U04 A;  1E8Y A;  4Q69 A;  3DD7 A;  5F28 E;  1OWN A;  3QW0 A;  3B7S A;  4AL1 A;  3H2V A;  4H7Y A;  3V5Y A;  3NMI A;  3GWN A;  2R05 A;  2VSX E;  5FIN A;  3IBE A;  5DQT A;  2Y39 A;  5D92 A;  1E8X A;  4MS2 A;  4BJT A;  2IOQ A;  4UI9 K;  3ZYL A;  4YDE A;  4HRL A;  1TR4 A;  4TRQ A;  2FO7 A;  4WJ0 A;  1WOL A;  2P61 A;  1H2U A;  3TOM A;  2L81 A;  2NUT B;  2R7R A;  4E6H A;  1OCR C;  1WWP A;  4NCQ A;  2HZ8 A;  3VTX A;  2CNW A;  4QDL A;  1RXQ A;  5L0C A;  3C3O A;  3VLE A;  5T3T A;  2XXA B;  1BD8 A;  2WZL A;  5AN8 A;  3Q49 B;  4RD9 A;  4L23 A;  1MX4 A;  4AP2 A;  1YDI A;  3RSE G;  1FMV A;  4CYM D;  1N94 A;  1Z23 A;  2VGE A;  1TFK B;  5J90 A;  2AW6 A;  2FO1 E;  3L6A A;  2H6H A;  2EIJ C;  5BV0 A;  1TNU A;  2J9U A;  1MMD A;  2NUP B;  3DXJ F;  3PE4 A;  5AAR A;  5AC4 A;  3L34 A;  5JT4 A;  3GZ1 A;  2WL8 A;  2WQH A;  1GGQ A;  5JMN D;  1PC2 A;  1ELR A;  4XE0 A;  3SZR A;  4IAO A;  5KYX B;  4EHP A;  3FFL A;  5LX8 A;  2KZT A;  3GEI A;  1H2V C;  5LP0 A;  4PH4 B;  4Z9I A;  256B A;  4ILG A;  1PY1 A;  1D1A A;  1UG7 A;  3SXZ A;  4L6R A;  4D4N A;  1AUE A;  3S84 A;  4J8F A;  3WAQ A;  3UPV A;  3D9I A;  4YDW A;  5H7P A;  2Q7R A;  1MYO A;  4XPX A;  4GTS A;  1LS1 A;  1OW7 A;  4FES A;  3A11 A;  5CI8 A;  2ZGG A;  3SFY A;  2J08 A;  4WNF A;  3QDN A;  2EPL X;  4BX9 A;  3GM3 A;  3SGH A;  5DS6 A;  1SR2 A;  4JC8 A;  3B13 A;  2KAT A;  4RSY A;  1A0B A;  2QC9 A;  3Q9U C;  3DKA A;  2LK4 A;  3PE3 A;  4A63 B;  1PV3 A;  3UM3 A;  4OIO F;  3UT7 A;  2V8S E;  3EDT B;  3FVY A;  3C7J A;  2WMN A;  4JTA B;  4FJZ A;  3SNH A;  3JT1 A;  3U8P A;  3ULE G;  3APF A;  2WXG A;  2ETC A;  2XRH A;  2VCC A;  1H6O A;  1Q0F A;  1EF1 C;  4GCN A;  4GTM A;  3BUA A;  4G24 A;  3OAW A;  1ZHX A;  1V54 E;  1P5Q A;  4BJ5 C;  4BSZ B;  5AC5 A;  1BDJ B;  1N9A A;  4M7C A;  4YND A;  1D1C A;  2P9K G;  4K5B A;  4WWN A;  3B0U X;  1X5B A;  5BNW A;  1T5O A;  4LSZ E;  2VYI A;  5FQ8 A;  4WWP A;  3OXL A;  4APO A;  3OWT A;  2B0H A;  3UMH A;  4ANW A;  3RYL A;  1BI7 B;  4MVU A;  1UW4 B;  2C2L A;  5KCM A;  4AVX A;  3QMK A;  3JRT A;  4EKW A;  3PEV B;  1D0Z A;  1NZN A;  4J8D A;  5BXU A;  4X0R A;  2XXA A;  2CW0 F;  3BG0 B;  1NBB A;  4OD5 A;  3J5P A;  3Q73 A;  4G7Z F;  5AQB A;  4ANV A;  1DC2 A;  2R03 A;  3DEP A;  3FTV A;  3TWW A;  4LNG A;  1O1R A;  3N0T A;  3E30 A;  2IM8 A;  4PFO A;  2OEW A;  3C63 A;  2R02 A;  4YL0 A;  3DPD A;  3V5X A;  1LI7 A;  1OCZ C;  3KSL A;  1Y6D A;  3K1I A;  4MVO A;  3Q47 B;  3TJ6 A;  3ZRH A;  4KYO B;  4JVS A;  2WXF A;  4I2Z A;  3HNK A;  3UQ3 A;  4NAC A;  2QTV A;  3AG1 C;  4I1A A;  2YL3 A;  3LEV A;  1D8D A;  2PFD A;  3L22 A;  2WM9 A;  4Z9H A;  4MW3 A;  2LAI A;  1KZP A;  4OAV B;  5CMY A;  4DX2 A;  2HJ3 A;  2XLO A;  3TAX A;  3LS1 A;  4CDN A;  3Q7A A;  5FZT A;  4NTA A;  2J7P A;  2IU1 A;  4G8K A;  5DBK A;  4NY3 A;  1HMO A;  5BQG A;  1Z6T A;  3TG5 A;  3ZVV A;  4ME2 A;  1KLX A;  2A68 F;  1A41 A;  1EYH A;  5KJM A;  4FP7 A;  4U7E B;  4DX5 D;  5FWQ A;  2LO6 A;  3EGD A;  4MVR A;  3JYS A;  4CIH A;  3T4R A;  2QLA A;  2XLV A;  5FT9 A;  2A1D D;  2WMO A;  2VGX B;  4I1O B;  2J07 A;  2EIL E;  3WHN A;  4AIF A;  1E7U A;  1BR2 A;  3QWV A;  4FHK A;  2IYL D;  3FHD A;  3O4Z A;  2WXL A;  4DOZ A;  3EUV A;  3RQF A;  3ZW3 A;  3V2X A;  4HEA J;  3DSV A;  3DJN B;  1OKK D;  2FI7 A;  5FQ6 A;  3SFZ A;  4Q5S F;  1OWP A;  2Q4F A;  3MYI A;  3X2Q E;  1LIH A;  4F4B A;  4N4W A;  2Y69 C;  1H19 A;  5JSL A;  3ZEF A;  4C3B A;  2L0I A;  4F6R D;  3EG9 B;  3K66 A;  2MHR A;  4CT0 A;  2ZPA A;  2XRZ A;  1FT2 A;  3GM2 A;  2G62 A;  2FGY A;  3C98 A;  2MWQ A;  2R25 A;  2PF4 E;  3HNI A;  3SFX A;  2RFM A;  3Q9N C;  4K03 A;  4PJM A;  3EJN A;  2A69 F;  2LP4 A;  5EKQ D;  4Q4Z F;  5G05 C;  1FVF A;  1D0X A;  4KNV A;  4XZ4 A;  2H6G A;  2GRL A;  1QQ3 A;  3MBG A;  5ANR A;  3UMV A;  1Z3Y A;  2ASR A;  1D0Y A;  5KJN A;  3UIN C;  3MYV A;  2DB4 A;  3LLI A;  4O7G A;  3HG0 D;  3L13 A;  2J9Q A;  4YT4 A;  2PNN A;  3GW4 A;  1BR1 A;  4GEH A;  5EX3 A;  2ZXR A;  3UM1 A;  2R7T A;  2P6V A;  1E90 A;  1YAR O;  2C04 A;  3AJM A;  1O3U A;  4ER9 A;  1FT1 A;  1O5M A;  2OVF A;  2ZIS A;  4YL1 A;  4BWR A;  4GZ5 A;  2XEH A;  3Q79 A;  3FAJ A;  4J8S A;  3L17 A;  4OD4 A;  2IFU A;  2O9X A;  3EG9 A;  1UFB A;  3RQE A;  4WAF A;  1YLM A;  1MMA A;  1G3N B;  3C3R A;  3HLZ A;  5BQI A;  1Q0D A;  3JZ0 A;  4GYO A;  3DXK G;  4HOQ A;  4LNU D;  4XTK A;  1MQV A;  2WXI A;  2LD6 A;  4AE4 B;  3CSF A;  3FP3 A;  5KNH D;  2L6F A;  2X0C A;  4C3D A;  1CGM E;  4F1P A;  4EZJ A;  3W2V A;  3D9M A;  1IZM A;  3MV2 B;  4UWF A;  1TWG A;  2R7Q A;  3BU8 A;  3D9K A;  2TMV P;  3JCU Q;  4ULW A;  2QE9 A;  3E9V A;  4H54 A;  2Y4U A;  2L7A A;  5LOZ A;  2PM7 A;  2C0L A;  3CVL A;  5DS5 A;  4QFV A;  4MTO A;  4AY6 A;  4YT8 A;  2YVK A;  1JCS A;  4C48 B;  5J08 A;  4A1G A;  5FTP A;  4R7L A;  3FUF A;  4PAC A;  4BES A;  3C8G B;  3FUK A;  1GW6 A;  5ENQ D;  3ABK E;  1G5Z A;  2DWZ A;  5B3S E;  4EUK B;  1L7C A;  2CHX A;  3MCX A;  2H7O A;  3CSK A;  3RKV A;  1OXJ A;  3IHU A;  2NG1 A;  1MX2 A;  2OV8 A;  4AM9 A;  3D9N A;  4M63 A;  2F8X K;  4CDV A;  2LFF A;  4GYT A;  4ILI A;  5CHE E;  2BC5 A;  4DVZ A;  1N4R A;  1YYH A;  3LY8 A;  3PNT B;  1YJG A;  3AGU A;  2XEV A;  3SXY A;  2VTB A;  3X2Q C;  4G2V A;  4CDY A;  2ETS A;  1SA4 A;  3T5X A;  3FU0 A;  1I5N A;  1V4A A;  4JD2 G;  2XEN A;  3IHY A;  4LUN U;  3T8M A;  3CVV A;  4AL0 A;  4IAR A;  2L6J A;  1U3C A;  5JJT A;  4I6E A;  3UGO A;  1Z7Q c;  5DQZ A;  3QVZ A;  2PBE A;  2B0J A;  1C17 M;  1R4T A;  4N6C A;  2AXZ A;  2HR2 A;  4HVB A;  3A9C A;  2HO1 A;  1D1B A;  1TFO B;  5JJ6 A;  3JSZ A;  4KVM A;  4OAU C;  3AG3 C;  3AAA C;  3LKU A;  4GTT A;  3AG3 E;  3I3N A;  1YVI A;  3UKR G;  3FXH A;  2J0W A;  2GRQ B;  1AVO B;  3UNG C;  3NZU A;  4LEU A;  4DRX E;  5B3I A;  1H6K A;  4DLO A;  5T8I A;  4ATG A;  3FUM A;  3KYI A;  1VYI A;  3ZQV A;  2YKZ A;  2QY9 A;  3ZSU A;  4CCA A;  5CIV A;  2RSE B;  3GAN A;  4MKT A;  1ZHY A;  4KVO A;  1N11 A;  3POV A;  3F46 A;  4TV3 A;  3R2P A;  3N24 A;  1A7V A;  4CX9 A;  5BT1 A;  3ZYQ A;  4U5G A;  3I5P A;  2V4H C;  5G05 J;  2EIK E;  2VGY A;  1ZHT A;  4TUM A;  3FAP B;  2J8S D;  3AG1 E;  5T3R A;  2GW1 A;  1BZ4 A;  1HS6 A;  4L7T A;  4IAQ A;  3DST A;  1HF8 A;  2HYZ A;  3PUK A;  4HOT A;  3HXC A;  2WB2 A;  3FMS A;  4KMO A;  4BET A;  2P7V A;  2KM4 A;  3PRZ A;  3TXM A;  4EZK A;  3DRA A;  3T8K A;  3EZI A;  1OW6 A;  5G04 J;  3R7Q A;  3ABK C;  3OTN A;  3AG4 C;  3FTS A;  2OND A;  3HDX A;  2AJA A;  3G2U A;  3WG7 C;  1A7D A;  5JA4 D;  4E18 A;  4A4A A;  3FUJ A;  3V30 A;  2LSE A;  3UM2 A;  2BUG A;  4J32 B;  1ST6 A;  1B68 A;  4I44 A;  3NG1 A;  4W8P A;  4P9F A;  2X6K A;  1BPO A;  4BTB A;  2VGX A;  3DI5 A;  3EH2 A;  1VLS A;  4N3C A;  3CVU A;  3ZC4 A;  2L6G A;  1ZU2 A;  2F0Y A;  4B93 B;  3ASO E;  4BFR A;  4XEI G;  4FUL A;  3S7J A;  3SNX A;  4JXT A;  4O79 A;  3AGT A;  3P2B A;  1NFI E;  1WY6 A;  4U8V D;  3RRU A;  2M64 A;  4LER A;  3ONK A;  4EBA G;  1LTX A;  1VK5 A;  2OEV A;  3AS4 A;  3TJ5 A;  2WVI A;  3RVY A;  4I2W A;  2ETA A;  4WNG A;  3EHN A;  4C9B B;  4WGY A;  3Q78 A;  2ILR A;  3I4R B;  2CG3 A;  3LPZ A;  1SZ9 A;  1R5I D;  2KCK A;  5D0O D;  4ATZ D;  2P9U G;  2I1J A;  5ENO D;  2R7X A;  2C03 A;  4LRZ A;  2MYS A;  3LNR A;  3PEU B;  1E84 A;  2J49 A;  4UUC A;  4G1T A;  4ANJ A;  4O60 A;  2R7U A;  1MZC A;  2YLD A;  5KWD A;  3O6X A;  1FR0 A;  3LLK A;  2YL1 A;  1PD1 A;  1OQC A;  3M15 A;  4DK5 A;  2KNH A;  2GRP B;  3QWW A;  3IPM O;  1DOV A;  3JXJ A;  3GEE A;  3CHP A;  4O6M A;  3DMD A;  5F5F A;  3CVY A;  2BL2 A;  5D2M C;  2VSY A;  3AQB A;  4JA7 A;  4TUU A;  3JUI A;  3LS0 A;  4DRJ B;  4CS8 C;  4I43 A;  2CYD A;  5A69 A;  3EZH A;  1QLE C;  2DYR E;  2X6H A;  3PCV A;  1WN0 A;  4E17 A;  3ZTM A;  3LJ3 A;  3NKE A;  3IQT A;  3WXX A;  4B89 A;  3ASO C;  3CVX A;  1K1B A;  1OKK A;  5A6A A;  3UXG A;  5C1D A;  4IGG A;  4XQ1 A;  2EPN A;  4HRM B;  3M4B A;  2LUH A;  2A4Z A;  2OVB A;  3U9W A;  1K04 A;  3UUX A;  3UIO C;  4RBN A;  1A17 A;  5A6B D;  1LD7 A;  3L54 A;  3TL5 A;  5L3Q A;  5KYN A;  3B71 A;  3MKQ A;  5COF A;  4TXR A;  3ASN C;  4CS9 C;  3E32 A;  5T1D B;  1OT8 A;  3ZXP A;  4NRH B;  4XIF A;  3LAY A;  3FH7 A;  3B7B A;  3JSE O;  2XPZ A;  5LCW J;  3PDM P;  4XX5 A;  2CFU A;  4WAB A;  1OCC E;  3GOR A;  2XRY A;  3DEO A;  3GZS A;  5HV9 A;  3VM6 A;  3O10 A;  1UOH A;  2XLD A;  3FWV A;  5COG A;  5EHH A;  2I2O A;  3CVN A;  3DSU A;  1ZBP A;  1HH8 A;  2AWY A;  2P9P G;  3CHO A;  2WXH A;  2X51 A;  4Y6W A;  2ZXW E;  1GQA A;  3NMK A;  3U9M A;  2ZU6 B;  2WXO A;  2DIW A;  3FOO A;  2QFC A;  3RJV A;  1UN9 A;  1UJJ A;  2J9B A;  3URZ A;  4MVQ A;  2VC9 A;  5L0I A;  3E37 A;  5A6B A;  1OCR E;  4BT8 A;  5E3A A;  5L0D A;  3HNJ A;  5KBA A;  2YIN A;  1U89 A;  1OCZ E;  3HIZ A;  3CIA A;  3CK7 A;  2JEK A;  2F8Y A;  3AG2 E;  4E0H A;  2WXR A;  5AAO A;  5AJL A;  2YHE A;  3TGO A;  4I6G A;  3KH2 A;  3RW0 A;  4OIP F;  1TYQ G;  2OOE A;  4LLC A;  3DAG A;  4C3E A;  2H6I A;  3UT8 A;  2XCB A;  1RCP A;  4G8L A;  4HI9 A;  4CJO A;  1E83 A;  3HKK A;  2V26 A;  1QZ2 A;  2XLW A;  2IY0 C;  3BEE A;  4GTQ A;  2J45 A;  1JCR A;  1E8Z A;  3B0P A;  1M6T A;  2EPM X;  2R7O A;  3DWW A;  2A5E A;  1HMD A;  4NC3 A;  3HXF A;  2VAS A;  2CFZ A;  2ZXW C;  4H7X A;  2YRF A;  5KYX A;  3O48 A;  1OCO E;  4Q7C A;  5CEA A;  3D9P A;  1QQE A;  3AG2 C;  3ZNG A;  5ENS D;  2PX0 A;  5ARF A;  3K9I A;  4HFK B;  3TWT A;  2XSE A;  1UJK A;  5JP7 A;  3VYW A;  1YZA A;  5FZS A;  1E2X A;  2NSG A;  4BY6 A;  1M56 C;  3Q7G A;  4NQ0 A;  4HLE A;  4PJJ A;  3U3B A;  3ZHE B;  3DJU B;  4JW1 A;  1NLX A;  4YWQ A;  1SW6 A;  5GPG B;  2AXV A;  3NYL A;  5L0G A;  1FPP A;  4L2L A;  2NYJ A;  3HNL A;  1Y6I A;  1E7V A;  1HFA A;  2KGO A;  1XZP A;  4CDM A;  3PHF 2;  2YL0 A;  3QTH A;  4I3M A;  2HV7 A;  4XLN F;  1TKN A;  5L0F A;  1K05 A;  5EDS A;  3EHQ A;  3FU3 A;  2HSQ A;  5BUZ A;  4EBA A;  5A6J A;  1IYG A;  4MTF A;  4CDA A;  3L9T A;  1VMA A;  5E2Q A;  4HOS A;  1IXV A;  4EBB A;  3C72 A;  1OR3 A;  1TWC A;  4DX1 A;  4BPM A;  4XKB A;  4AOF A;  4B6I A;  1KNY A;  3D9O A;  3LEO A;  2DZO A;  4Y6C A;  1JUQ A;  2R7W A;  2Y3A A;  4AEZ C;  3ENE A;  4WUY A;  5KYY A;  5ARG A;  5CED B;  2R7V A;  1WG0 A;  2HKV A;  1RJ9 B;  5FZR A;  3G4X A;  4DBR A;  3LVR E;  3SO8 A;  2Q9C A;  4IJJ A;  2J4D A;  3QZC A;  3UIP C;  4GYW A;  3UMK A;  2X3M A;  1TN6 A;  4F53 A;  2H7B A;  2Q00 A;  2J4B A;  3ULY A;  3APD A;  2FFH A;  2V3C C;  3JRM O;  3E70 C;  2XM4 A;  2OOC A;  2WQ7 A;  2DYS E;  4YL3 A;  1T6I A;  3JXI A;  4HQD A;  4AV7 A;  5DVW A;  5AQ9 A;  4U96 D;  1Z5Z A;  5FQ4 A;  5DIZ A;  4U0U A;  1Z63 A;  2AP3 A;  3LNM B;  2D4U A;  4IRU A;  4G23 A;  1OWM A;  4AXH A;  2XGS A;  4UQX A;  3O55 A;  4BEM J;  4GTO A;  3RF3 A;  1TWA A;  4I9E A;  3CKB A;  3SQV A;  1L5J A;  5D66 A;  4Z68 A;  5FCL A;  4HOU A;  4ZFH A;  1BR4 A;  4FA6 A;  1YMP A;  1MMG A;  4J8E A;  2D5R B;  4UI9 J;  5A6C A;  1A5E A;  3ZIM A;  3CZ6 A;  2EQX A;  1BBH A;  4U5H A;  2L9J A;  1FVH A;  1BU9 A;  2AU5 A;  1EA8 A;  1YYJ A;  2DVW A;  4RG9 A;  4U8Y D;  3PZ3 A;  3TWR A;  2JPU A;  5KYU B;  4OYS A;  4XEF A;  3CKC A;  4UWK A;  3QJZ A;  4DVY P;  1VLT A;  3CR3 A;  3ZUV B;  2I1K A;  1OCC C;  3J06 A;  2YEV A;  4U5D E;  3G2T A;  3EH1 A;  5BXO A;  1INZ A;  4U8H A;  4RLY A;  3V2O A;  2WXN A;  4FLB A;  2WXJ A;  5E75 A;  2PQR A;  1TJF A;  4V3I A;  3E34 A;  4A2N B;  2XLM A;  3FY4 A;  4GTR A;  3TWQ A;  1NFO A;  3HXB A;  5FQ7 A;  2NSZ A;  1VYK A;  3NZS A;  4CRW A;  1U2V G;  2PNO A;  2OU6 A;  1GS9 A;  3C3Q A;  2W9Y A;  4J8Y A;  4N06 A;  2VTB B;  1YZC A;  3Q6M A;  4L9P A;  1ORY A;  1SF8 A;  2EPK X;  1BI8 B;  3T9K A;  4C0M A;  3IXE A;  3TUL A;  3CHR A;  4DRH B;  2G3K A;  4NTF A;  1EI7 A;  3EFO A;  4G78 A;  1PD0 A;  3ASD A;  3ZXS A;  1FNT c;  4BTA A;  2KC7 A;  2Y3D A;  3HVE A;  4JC7 A;  1Q0K A;  4AX2 A;  2AXU A;  4O1P A;  3NQP A;  3Q7F A;  3QOU A;  3CAX A;  3ZVR A;  4ANU A;  1ZB1 A;  1FFT C;  2WQ6 A;  1YA7 O;  4MVM A;  4X8Q A;  2XGM A;  4GAA A;  4JTC B;  4EBK A;  4A1S A;  1V55 E;  4DBQ A;  1SA5 A;  1CPQ A;  5D91 A;  4CZ2 D;  5ENT D;  2P9S G;  3ZTZ A;  2A6E F;  2EIK C;  3ONL A;  3P1U A;  1L3P A;  1E96 B;  3U2M A;  3LCA A;  5LFA A;  1RW2 A;  1LVK A;  1U0B B;  2R2L A;  2XQ0 A;  3SXM A;  3W2W A;  4JEB A;  1N4P A;  2LCH A;  2DGJ A;  2XL4 A;  3QVY A;  1WAO 1;  3NRH A;  4DPR A;  2P2C P;  1M2V B;  2QUP A;  3J5Q B;  3ZYK A;  5JHB A;  4BJ5 A;  3KAE A;  1ZW2 A;  3U2L A;  4HE8 D;  3R7R A;  4HNA D;  4TXQ A;  4XKC A;  4LNB A;  4GA2 A;  3FH8 A;  1Z5S C;  4P29 A;  3D3M A;  4IYP A;  3MYF A;  1NU9 C;  3NOC D;  5CMW A;  2HJM A;  3QNK A;  3TQO A;  3W9F A;  1NSG B;  3DAF A;  1TQG A;  2XCC A;  4HFG A;  4F3V A;  2XZD G;  3S29 A;  2FBN A;  5B3S C;  3NOG D;  4C7O A;  1KTM A;  2J7P D;  1LF8 A;  1WM5 A;  4GPK A;  2Y4T A;  5L0H A;  5JJ7 A;  4QI0 A;  2XLH A;  4G0H A;  3D9J A;  4XI0 A;  1CGN A;  5B1B E;  5A6K A;  2KSF A;  4GMJ A;  1ZW3 A;  3B7T A;  3TJP A;  1KU2 A;  1YA0 A;  5AEN A;  2LAH A;  2JLB A;  5E76 A;  1FTS A;  3LDZ A;  1N0R A;  1OXB A;  1OW8 A;  4DX7 D;  1SVX A;  1ORS C;  3SEO A;  2R7S A;  3EIJ A;  4RVB A;  1UG3 A;  5CER B;  4O6F A;  2VH3 A;  1MX6 A;  3Q7L A;  4JJF A;  4N3A A;  3U0C A;  1WAS A;  3T6B A;  1AP7 A;  3MX3 A;  2CCY A;  3DM5 A;  5EIB E;  3SI5 A;  4EZL A;  4KBL A;  1H6G A;  1TN8 A;  4ABN A;  4YVO A;  2NC9 A;  3D9L A;  1NZE A;  3C8Z A;  4KBQ A;  3FTX A;  1ELW A;  1HG2 A;  2P1A A;  2YL7 A;  3AJI A;  5AGF A;  1NP7 A;  1HW1 A;  3K6B A;  3WOD F;  5L3V A;  4JZY A;  2RFA A;  4MS6 A;  3RRN B;  1YAU O;  1N54 A;  1K3Z D;  4C7O B;  5K0I A;  2OEX A;  4OIN F;  2NUP A;  4CBE A;  4JPS A;  4JB8 P;  1JWG A;  3SXK A;  4H4K C;  3B0V C;  1NU7 D;  3S28 A;  5FIO A;  1JCQ A;  2YQ8 A;  4BJ6 A;  3E33 A;  2UUH A;  4FX5 A;  5G2N A;  1QVX A;  4Q94 A;  3BEH A;  3V5Z A;  1MNE A;  4ZLD A;  1V74 B;  1FAP B;  3IQ6 A;  3CK8 A;  5F5H A;  2IQC A;  1RJ9 A;  5HI7 A;  1C03 A;  3S7B A;  3TWX A;  1O1T A;  4I17 A;  4KC9 A;  5T3W A;  1LI5 A;  4DI4 A;  2WXP A;  4P6I C;  4O6N A;  3L8J A;  2P9L G;  3K1I C;  5CBO A;  2XL6 A;  2YHC A;  3EQL F;  4FAD A;  1IQU A;  2IEJ A;  4AK9 A;  1LM3 B;  5DLJ A;  3UGP A;  4ACL A;  3LEW A;  4NTB A;  2QZA A;  4GA0 A;  3UTM A;  1YA9 A;  3NAW A;  4JCZ A;  5BUO A;  4MW8 A;  3W8I A;  4DJA A;  3QKY A;  3EFO B;  3ASF A;  2EIM C;  2X6J A;  1D8E A;  2XPI A;  2C0M A;  3R7C A;  4UWH A;  5HS0 A;  3UR3 C;  3ZHE A;  1HXI A;  3KSQ A;  4D10 C;  4YT2 A;  4RDA A;  1JPJ A;  5T4Y A;  4GMR A;  3FUE A;  2Q3T A;  2M4E A;  4UWG A;  2NXP A;  5HRY A;  2EIL C;  4HI8 A;  3IQC A;  3ISM C;  3RQG A;  5AIJ A;  1RKE A;  1VOM A;  2WVO A;  4PJN A;  2V0P A;  1DVP A;  1N0Q A;  2VQ2 A;  4APF A;  3ASN E;  1VB5 A;  3H2U A;  1X81 A;  3F6Q A;  2WB7 A;  4GPM A;  4GML A;  1TWH A;  3AS8 A;  4JHR A;  2KXP C;  5HSW A;  2BE5 F;  1W3B A;  1NA3 A;  4MND A;  4E85 A;  3FUL A;  1LE4 A;  4JHJ A;  3CV0 A;  2LXL A;  2ION A;  2IOS A;  1HX8 A;  2DYR C;  1O5H A;  4AY5 A;  3UI2 A;  3ABM C;  1K8K G;  4U9D A;  3FH5 A;  3C8G A;  4MVS A;  2Q7F A;  1QNF A;  4A55 A;  1T9K A;  1LPE A;  4UWL A;  1EKY A;  2BKK B;  3AG4 E;  3LXU X;  3FTW A;  1S7Z A;  3RFY A;  1QYM A;  2MOW A;  1AEP A;  3UX4 A;  2YQY A;  2FAP B;  3ZQY A;  2GRR B;  1VDY A;  3ZGQ A;  2KC3 A;  2ZD9 A;  3HHM A;  4BX8 A;  1ELK A;  2L0T B;  2QYU A;  3SBT B;  1S63 A;  5EYP F;  4TXP A;  3PS6 A;  4BT9 A;  4A3V A;  3ZIB A;  1J8M F;  2WVQ A;  2GAQ A;  3Q5M A;  1WGW A;  2JD3 A;  3VLF A;  2OG2 A;  2XM0 A;  4NUR A;  2A0U A;  2WPV A;  3RIB A;  3SHF A;  2XEE A;  5BQH A;  2L9B A;  2RD0 A;  4XPY A;  5CI9 A;  3D9H A;  2R9R B;  4MLP A;  3SD5 A;  5JLI A;  3CHM A;  4GU5 A;  1H9G A;  5KYW A;  4ILH B;  2QYJ A;  3RAU A;  5AYW D;  2KZT B;  2KBX A;  2XLE A;  4CS7 A;  4N3B A;  3C18 A;  4XEV A;  4DJ9 A;  4YDY A;  2V4L A;  3Q15 A;  5B1A E;  5ENP D;  4PK4 A;  3ZU7 B;  3T6J A;  1VTM P;  4NQF A;  2GGF A;  5KYU A;  3X1O A;  1H6P A;  2IXN A;  2KCV A;  3RH3 A;  4N5Q A;  2IXO A;  1ZYR F;  2Q9B A;  3G4Z A;  5TJ5 E;  1XGW A;  4UDV A;  3U3F A;  2CNW D;  4F7A A;  3MEK A;  2Y3H A;  4G7O F;  3HJC A;  3JQ1 A;  4B94 A;  3WG7 E;  4L1B A;  1AWC B;  2FEZ A;  2ZIR A;  5G55 A;  3ZN3 A;  2L6H A;  1YYX A;  4XEK A;  2P58 C;  2QNL A;  4W8K A;  4BER A;  3VRC A;  5BV1 A;  3EGX A;  3SZ7 A;  2YZS A;  5JHA A;  4U0Z A;  3JTL O;  2PL2 A;  4CGV A;  5CRV A;  3EGD B;  2F37 A;  3LY9 A;  1IHG A;  1S70 B;  5EX0 A;  2V5F A;  4XPW A;  1OXK A;  2WXQ A;  3L16 A;  1PCX A;  3U4T A;  2XPY A;  3TWV A;  1TNY A;  3W8H A;  1ZU4 A;  4G7H F;  4OIQ F;  5B1B C;  3LJN A;  3PDN A;  1E8W A;  2E0I A;  2XS1 A;  3MKR A;  3T6G B;  2VCA A;  5BW8 C;  1HE8 A;  2OCC C;  3ASG A;  5EID A;  3IHV A;  3NBN B;  2G3V A;  4IUL A;  3APC A;  3ML9 A;  3QB2 A;  4CT4 A;  4EWC A;  2GRN B;  4I6J A;  3BG1 B;  3C5R A;  4HXI A;  2J9W A;  2Y1L E;  5E33 A;  4E0I A;  2I15 A;  4IB4 A;  3ITF A;  4FU3 A;  2EIJ E;  3DZA A;  2KCL A;  2IJG X;  4W9R A;  4JCH A;  1SZA A;  4J7Y A;  3PRE A;  2ZXP A;  1HG5 A;  3I4G A;  1XZQ A;  5JVE A;  2ICW G;  1QKR A;  4D4X A;  2HM8 A;  3AU4 A;  1ZHZ A;  4FC8 A;  5AQ7 A;  3KMI A;  2P9N G;  3U66 A;  3CVQ A;  2KYH A;  2CG2 A;  4HOR A;  3NKD A;  3S27 A;  1SZI A;  3CEX A;  3SP1 A;  2MRI A;  4PJL A;  4WWO A;  3DXM G;  5B1A C;  4M3O A;  5ENN A;  2WZG A;  1HE9 A;  3Q4A B;  4QQI A;  5LCW C;  1LD8 A;  2DCP A;  2RD9 A;  1RKE B;  2MHK A;  5A23 A;  4Q96 A;  5EGY A;  3S7D A;  5M72 A;  4JHK A;  2YHS A;  3AU5 A;  2FUL A;  3FU5 A;  4MVZ A;  1F1M A;  3G50 A;  5C2Y A;  1V54 C;  3UM0 A;  1LS4 A;  1T6Q A;  3FTY A;  2Y0B G;  3SBS A;  4GTV A;  4U07 A;  1U3D A;  1UN8 A;  5CBN A;  5JRA A;  4K5A B;  2HMZ A;  3RU0 A;  4PFP A;  2VCB A;  2LFD A;  3ESK A;  1JWF A;  3ECS A;  3ABM E;  3W4Y A;  4JUR I;  2KQ9 A;  3KPH A;  1NL4 A;  2UY1 B;  4YT5 A;  2JX0 A;  5G04 C;  1Q0G A;  2DYS C;  4P9T A;  4JA9 A;  2JAB A;  3TOL A;  4PS7 A;  3EGX B;  3M79 A;  2CGE A;  4CDR A;  2IXP A;  3NDB B;  3FU6 A;  3FHE A;  3JYH A;  3CQG B;  2AWI A;  5HQ8 A;  3ZFW A;  4HRN A;  3HXD A;  3OA1 A;  2LQG A;  2IOL A;  4I1M A;  4CS8 A;  1ZU5 A;  4N5C A;  3M4C A;  2YNQ A;  3UMI A;  5KJL A;  1LE2 A;  1JR8 A;  4ULV A;  2XZT G;  5CEC B;  4YK5 A;  3ABL C;  2HSB A;  3H65 A;  3OXF A;  4J7W A;  4DI3 A;  3ESL A;  3DSX A;  3PZ1 A;  4HB5 A;  1GM5 A;  2LSU A;  4DRI B;  2ZGD A;  1PAQ A;  2DBA A;  3CHS A;  1LKX A;  3W9G A;  4UI9 C;  4JEU A;  2I6H A;  3PZD A;  2YLI A;  3TD7 A;  3NMJ A;  4E7S A;  4EIY A;  4FWV A;  4QI2 A;  4KZC A;  2Q9A A;  2GWW A;  5KYW B;  4ONS A;  1TNB A;  4FJY A;  1APC A;  3L08 A;  3S2A A;  2HE0 A;  2I8B A;  4JRZ A;  4JEA A;  4ACK A;  1DCE A;  4EPZ A;  2YLG A;  3IV0 A;  1IKN D;  3HYM B;  3DSW A;  4LAC B;  2W4B A;  3EHM A;  4O1O A;  4HS2 A;  2NPU A;  2PZI A;  1N4Q A;  2LIG A;  3CGH A;  3CVW A;  2LSV A;  2PX3 A;  3KYJ A;  2EIM E;  2J0X A;  2NUT A;  1H0A A;  3S0X A;  3IQ5 A;  4WND A;  4J6I A;  1OWL A;  4GB9 A;  4ANX A;  1K40 A;  2GFH A;  1QSP A;  4JZA A;  4JTD B;  3KS2 A;  4G11 A;  1G8X A;  4U5C E;  1SMY F;  3PMR A;  4GCO A;  4B0Z A;  4J7T A;  3FTU A;  1C02 A;  4GA1 A;  3RO3 A;  2RG8 A;  3KEA A;  5KNG A;  3LVQ E;  2EIN E;  5FJY A;  2W4M A;  1EDU A;  3GOD A;  3G2S A;  4UQY A;  4A3T A;  4MQ9 F;  4RG6 A;  1G4W R;  2HUJ A;  1EPU A;  1YCS B;  3ATP A;  3ZPJ A;  2WZF A;  4J0U A;  4K7B A;  1K1A A;  4GZ6 A;  3EU5 A;  4PDX A;  1QBQ A;  2NSF A;  1MHQ A;  2XHE A;  3RO2 A;  4DUI A;  2E2E A;  4RQI A;  4G25 A;  4LDQ A;  4YN0 B;  3ULQ A;  1TNO A;  2CHW A;  1S64 A;  3NB2 A;  5COM A;  1BLX B;  2B0O E;  2EPO A;  1OUV A;  4PR9 A;  4OIR F;  1DNP A;  2R59 A;  3R9M A;  1JPL A;  5L0J A;  3OEO A;  1H2T C;  3TWS A;  4CGW A;  2Z15 A;  4HFF B;  3N2Z B;  2B6C A;  1JMW A;  4N2Q A;  1S05 A;  4EBJ A;  4U5E E;  3ZDL A;  2CHZ A;  5ENR D;  4MBG A;  4E7Z A;  1H9T A;  1XWJ A;  2HMQ A;  1HW2 A;  4LDK A;  5EK0 A;  3US6 A;  4HBD A;  5BPP A;  1M57 C;  4UQZ A;  4B8C B;  3EU9 A;  3QK0 A;  2IXM A;  3DPY A;  5AQA A;  4N6H A;  1Q2Z A;  1ZVZ A;  3FDH A;  4KZ0 A;  1MQS A;  1XNF A;  4AJW A;  1NG1 A;  4JJG A;  3Q75 A;  2OKU A;  3U9J A;  1ZHW A;  3FUH A;  5IY5 C;  2X6I A;  5EN5 D;  1I4Y A;  2LXM A;  3R9A B;  3CQC B;  3U3W A;  3QW1 A;  4KXK B;  1WDY A;  2L6B A;  4C0E A;  1ZZP A;  3L8I A;  3K33 A;  2I9C A;  2GA0 A;  4LDR A;  5EYL A;  3MJW A;  1O87 A;  1D9S A;  1NFN A;  4EHM A;  4XLP F;  1E85 A;  1OR2 A;  2QY7 A;  2DZN A;  2J09 A;  3SYN A;  2AVP A;  4IN3 B;  3CHQ A;  3HTK C;  3DE8 A;  2H6F A;  1S0P A;  2VB6 A;  2BED A;  2IO2 C;  4CJG A;  4Z9J A;  3VTY A;  1N95 A;  1SQM A;  3FUD A;  4YDO A;  4BJ6 C;  3T9O A;  4DX6 D;  2W45 A;  2HV6 A;  3T5V A;  4WGZ A;  2A6H F;  3DWL G;  3Q6N A;  5AJD A;  5JS5 A;  4MRU A;  3FOP A;  1EQ1 A;  5EIL A;  4BEJ A;  4U5B E;  4OVV A;  1HU3 A;  2BKG A;  2VSO E;  1RZ4 A;  1KZO A;  2UY1 A;  1Y4C A;  4GYY A;  3PUJ A;  4KI2 A;  4ZHB A;  1WAT A;  3N71 A;  4DLQ A;  2FF4 A;  4BG0 A;  3DE9 A;  2ZXO A;  4CSA C;  3FUN A;  4WNE A;  4O6Y A;  1J8Y F;  3NF1 A;  3FDQ A;  2PP4 A;  3QAQ A;  1V55 C;  1IHB A;  1H7I A;  2OJQ A;  3LY7 A;  3MKQ B;  4PS3 A;  4K0R A;  5ITZ F;  2LNI A;  3B7R L;  3B29 A;  1FCH A;  4L2Y A;  5E3C A;  4I9C A;  2P9I G;  2H7V C;  4YJW A;  1I4Z A;  3E4B A;  1U6H A;  3IKO B;  3V31 A;  2Y3G A;  3EIQ C;  4IWB A;  4F1S A;  3O39 A;  2AVK A;  4XI9 A;  1HZ4 A;  4XWJ A;  3TG4 A;  2GDC A;  3LUT B;  3PNL B;  1M2V A;  3MGB A;  3U8V A;  2VJ8 A;  1HY5 A;  3L82 A;  4KT6 B;  2DI3 A;  3B95 A;  2AWC A;  4U0S A;  4CEM A;  3JQ0 A;  4MTG A;  3IEG A;  3RK6 A;  3EPV A;  2P0N A;  1CPR A;  3I4U A;  3AOU A;  2UUI A;  1TJC A;  4U63 A;  4BSX A;  5HKP A;  3M1C B;  2R17 C;  4U95 D;  1OWO A;  3FTZ A;  2YWA A;  1MJ0 A;  1MND A;  2IF4 A;  5CRU A;  3RRM B;  3V7O A;  4N2S A;  4U5F E;  3TK0 A;  3GZ2 A;  3U64 A;  3MV3 B;  1CGO A;  1TN7 A;  2RKK A;  4JKV A;  4CIP A;  3PVL A;  3ZKJ A;  5IY5 E;  4JL0 A;  2H8A A;  1A7E A;  4DXW A;  3ZG1 A;  3G2W A;  4YVQ C;  4BEP A;  4PS8 A;  1TR2 A;  3S9O A;  1NA0 A;  2Y3B A;  3QC1 A;  1WTY A;  3DSS A;  2BF0 X;  1RMV A;  3RVZ A;  1SYQ A;  5FZQ A;  1JAF A;  3DM9 B;  2WXK A;  3HRA A;  1DOW A;  3DBS A;  3VF0 A;  4J30 B;  4FHJ A;  4AE4 A;  4R32 A;  1OY3 D;  3HVE B;  1HE1 A;  2J8W A;  3RIP A;  3CQZ A;  3BRJ A;  4GTP A;  3ZWI A;  2E87 A;  1N4S A;  1IW7 F;  1TNZ A;  4EEC A;  4CSA A;  3JUE A;  2M63 A;  2KJG A;  3AS5 A;  5ANL A;  2WVN A;  3C8G D;  5A7D B;  4ZLC A;  4OVU A;  3ML8 A;  4G26 A;  1KT1 A;  4NIK A;  1Z6A A;  4HLL A;  3K1H A;  4EQF A; 
#chains in the Genus database with same CATH homology
 1IQR A;  4PUC A;  2J9V A;  1QZX A;  3UT4 A;  1Z3I X;  5CCM A;  5KJK A;  1N1C A;  3L0I A;  4LCT A;  3CK9 A;  3NYM A;  2XGO A;  3MLG A;  3KD7 A;  3LES A;  2EIN C;  3K7D A;  3F47 A;  3QAR A;  2BTD A;  3I5Q A;  4GZ3 A;  3AQC A;  1KT0 A;  3S7F A;  3MZL B;  3ASH A;  5DS4 A;  4KNW A;  3GYZ A;  4GZD A;  2PQN A;  2R5S A;  3ZYM A;  4CS9 A;  3LYA A;  3JCK C;  3LS8 A;  4FLH A;  4LLE A;  3QWP A;  1Z3X A;  3RKO F;  3B7U X;  2J46 A;  3OXG A;  3G2V A;  2X38 A;  1FFH A;  3VAY A;  1Y8M A;  3KKB A;  3SF4 A;  1HO8 A;  1MMN A;  2GRM A;  2X6F A;  4BJ1 A;  1W2W A;  2PM6 A;  3CLJ A;  3LJB A;  3PH0 C;  2CDQ A;  3FEY A;  2A5U A;  4B8A A;  3FUI A;  5CCL A;  1FMW A;  4GZC A;  3CVP A;  3CEQ A;  3VLD A;  1JPN A;  3FEX A;  1OCO C;  3IEE A;  3B9Q A;  2KW3 C;  2VSN A;  2WXM A;  3TXN A;  2UWJ G;  1N52 A;  4JEH A;  5KYY B;  4URK A;  3KL4 A;  1TEZ A;  3MA5 A;  1M2O A;  4K0D A;  4N39 A;  3CST A;  5D0Q D;  3KEZ A;  1B89 A;  3NYJ A;  4U04 A;  1E8Y A;  4Q69 A;  3DD7 A;  1OWN A;  3B7S A;  4H7Y A;  2VSX E;  3IBE A;  5DQT A;  2Y39 A;  5D92 A;  1E8X A;  4BJT A;  2IOQ A;  4UI9 K;  3ZYL A;  4TRQ A;  2FO7 A;  4WJ0 A;  1H2U A;  2L81 A;  2NUT B;  2R7R A;  4E6H A;  1OCR C;  3VTX A;  2CNW A;  4QDL A;  3VLE A;  5T3T A;  2XXA B;  2WZL A;  4AP2 A;  3Q49 B;  4RD9 A;  4L23 A;  1FMV A;  1Z23 A;  5J90 A;  2AW6 A;  3L6A A;  2EIJ C;  5BV0 A;  2J9U A;  1MMD A;  2NUP B;  3DXJ F;  3PE4 A;  3L34 A;  3GZ1 A;  2WL8 A;  2WQH A;  1PC2 A;  1ELR A;  4XE0 A;  3SZR A;  4IAO A;  5KYX B;  5LX8 A;  3FFL A;  2KZT A;  1H2V C;  5LP0 A;  4PH4 B;  4ILG A;  1PY1 A;  1D1A A;  4J8F A;  3UPV A;  3D9I A;  1LS1 A;  4FES A;  5CI8 A;  2J08 A;  4WNF A;  3QDN A;  4BX9 A;  3SGH A;  5DS6 A;  4JC8 A;  3B13 A;  2KAT A;  4RSY A;  3PE3 A;  4OIO F;  3UT7 A;  2V8S E;  3EDT B;  3FVY A;  2WMN A;  4FJZ A;  3SNH A;  3JT1 A;  3APF A;  2WXG A;  2XRH A;  4GCN A;  1EF1 C;  4G24 A;  3OAW A;  1ZHX A;  1P5Q A;  4BJ5 C;  4YND A;  1D1C A;  4WWN A;  3B0U X;  1X5B A;  5BNW A;  2VYI A;  5FQ8 A;  4WWP A;  3OXL A;  4APO A;  3OWT A;  3UMH A;  4ANW A;  3RYL A;  1UW4 B;  2C2L A;  5KCM A;  4AVX A;  3QMK A;  3JRT A;  3PEV B;  1D0Z A;  1NZN A;  4J8D A;  4X0R A;  2XXA A;  2CW0 F;  3BG0 B;  4OD5 A;  4G7Z F;  4ANV A;  3FTV A;  3N0T A;  4PFO A;  3DPD A;  1OCZ C;  3Q47 B;  3ZRH A;  4KYO B;  4JVS A;  2WXF A;  4I2Z A;  3UQ3 A;  4NAC A;  2QTV A;  3AG1 C;  4I1A A;  3LEV A;  3L22 A;  2PFD A;  2WM9 A;  2LAI A;  5CMY A;  3TAX A;  3LS1 A;  4CDN A;  2J7P A;  2IU1 A;  5DBK A;  4NY3 A;  1Z6T A;  3TG5 A;  3ZVV A;  4ME2 A;  1KLX A;  2A68 F;  1EYH A;  5KJM A;  4FP7 A;  5FWQ A;  2LO6 A;  3EGD A;  3JYS A;  4CIH A;  3T4R A;  5FT9 A;  2A1D D;  2WMO A;  2VGX B;  4I1O B;  2J07 A;  4AIF A;  1E7U A;  1BR2 A;  3QWV A;  4FHK A;  2IYL D;  3FHD A;  3O4Z A;  2WXL A;  4DOZ A;  3ZW3 A;  4HEA J;  3DJN B;  1OKK D;  2FI7 A;  5FQ6 A;  3SFZ A;  4Q5S F;  1OWP A;  4F4B A;  2Y69 C;  1H19 A;  3ZEF A;  4C3B A;  2L0I A;  3EG9 B;  3K66 A;  4CT0 A;  2ZPA A;  2XRZ A;  2G62 A;  2FGY A;  3C98 A;  2MWQ A;  2PF4 E;  4K03 A;  4PJM A;  3EJN A;  2A69 F;  5EKQ D;  5G05 C;  4Q4Z F;  1FVF A;  1D0X A;  4KNV A;  4XZ4 A;  2GRL A;  5ANR A;  3UMV A;  1Z3Y A;  1D0Y A;  5KJN A;  3MYV A;  3LLI A;  4O7G A;  3L13 A;  2J9Q A;  4YT4 A;  3GW4 A;  1BR1 A;  4GEH A;  5EX3 A;  2ZXR A;  2R7T A;  2P6V A;  1E90 A;  2C04 A;  2OVF A;  4BWR A;  4GZ5 A;  3FAJ A;  4J8S A;  3L17 A;  4OD4 A;  2IFU A;  2O9X A;  3EG9 A;  4WAF A;  1MMA A;  3HLZ A;  4GYO A;  4HOQ A;  4XTK A;  2WXI A;  4AE4 B;  3CSF A;  3FP3 A;  4C3D A;  4EZJ A;  3W2V A;  3D9M A;  1IZM A;  3MV2 B;  4UWF A;  1TWG A;  2R7Q A;  3D9K A;  3JCU Q;  4ULW A;  3E9V A;  2Y4U A;  5LOZ A;  2PM7 A;  2C0L A;  3CVL A;  5DS5 A;  4QFV A;  4AY6 A;  4YT8 A;  5J08 A;  4A1G A;  5FTP A;  4R7L A;  3FUF A;  3FUK A;  1GW6 A;  2CHX A;  3MCX A;  2H7O A;  3CSK A;  3RKV A;  2NG1 A;  2OV8 A;  4AM9 A;  3D9N A;  4M63 A;  4GYT A;  4ILI A;  5CHE E;  3LY8 A;  4DVZ A;  3PNT B;  2XEV A;  2VTB A;  3X2Q C;  4G2V A;  3T5X A;  3FU0 A;  3T8M A;  3IHY A;  4LUN U;  3CVV A;  2L6J A;  1U3C A;  5JJT A;  4I6E A;  3UGO A;  5DQZ A;  2B0J A;  2AXZ A;  2HR2 A;  4HVB A;  2HO1 A;  1D1B A;  5JJ6 A;  3JSZ A;  4KVM A;  3AG3 C;  3LKU A;  3I3N A;  2J0W A;  3UNG C;  3NZU A;  4LEU A;  1H6K A;  4DLO A;  5T8I A;  4ATG A;  3FUM A;  1VYI A;  2QY9 A;  3ZSU A;  4CCA A;  3GAN A;  4MKT A;  1ZHY A;  4KVO A;  3POV A;  3F46 A;  4TV3 A;  3N24 A;  5BT1 A;  3ZYQ A;  4U5G A;  3I5P A;  5G05 J;  2VGY A;  1ZHT A;  5T3R A;  2GW1 A;  1HS6 A;  4L7T A;  1HF8 A;  2HYZ A;  3PUK A;  4HOT A;  2WB2 A;  4KMO A;  2P7V A;  2KM4 A;  3PRZ A;  3TXM A;  4EZK A;  3EZI A;  5G04 J;  3R7Q A;  3ABK C;  3OTN A;  3AG4 C;  3FTS A;  2OND A;  3HDX A;  3G2U A;  3WG7 C;  3FUJ A;  2LSE A;  2BUG A;  4J32 B;  1ST6 A;  4I44 A;  2X6K A;  3NG1 A;  1BPO A;  4BTB A;  2VGX A;  3EH2 A;  4N3C A;  3CVU A;  3ZC4 A;  1ZU2 A;  4BFR A;  4FUL A;  3S7J A;  3SNX A;  4JXT A;  4O79 A;  3P2B A;  1WY6 A;  3RRU A;  4LER A;  3ONK A;  4EBA G;  1VK5 A;  3AS4 A;  2WVI A;  4I2W A;  4WNG A;  3EHN A;  4C9B B;  2ILR A;  3I4R B;  2CG3 A;  3LPZ A;  1SZ9 A;  2KCK A;  5D0O D;  2I1J A;  2R7X A;  2C03 A;  4LRZ A;  2MYS A;  3LNR A;  3PEU B;  2J49 A;  4G1T A;  4ANJ A;  2R7U A;  3O6X A;  3LLK A;  1PD1 A;  4DK5 A;  2KNH A;  3QWW A;  3CHP A;  4O6M A;  3DMD A;  5F5F A;  3CVY A;  2VSY A;  3AQB A;  4JA7 A;  4TUU A;  3JUI A;  3LS0 A;  4CS8 C;  4I43 A;  3EZH A;  1QLE C;  2X6H A;  3LJ3 A;  3NKE A;  3WXX A;  4B89 A;  3ASO C;  3CVX A;  1OKK A;  5C1D A;  2A4Z A;  2OVB A;  3U9W A;  3UUX A;  4RBN A;  1A17 A;  3L54 A;  3TL5 A;  5L3Q A;  5KYN A;  3MKQ A;  3ASN C;  4CS9 C;  5T1D B;  4NRH B;  4XIF A;  3LAY A;  3FH7 A;  2XPZ A;  5LCW J;  4XX5 A;  2CFU A;  2XRY A;  3GZS A;  3FWV A;  5EHH A;  2I2O A;  3CVN A;  1ZBP A;  1HH8 A;  3CHO A;  2WXH A;  2X51 A;  4Y6W A;  2ZU6 B;  2WXO A;  2DIW A;  2QFC A;  3RJV A;  1UN9 A;  1UJJ A;  3URZ A;  4BT8 A;  5E3A A;  2YIN A;  3HIZ A;  3CIA A;  3CK7 A;  2JEK A;  2WXR A;  5AJL A;  2YHE A;  3TGO A;  4I6G A;  3KH2 A;  4OIP F;  2OOE A;  4LLC A;  3DAG A;  4C3E A;  3UT8 A;  2XCB A;  2V26 A;  1QZ2 A;  3BEE A;  2J45 A;  1E8Z A;  3B0P A;  2R7O A;  2VAS A;  2CFZ A;  2ZXW C;  4H7X A;  5KYX A;  3O48 A;  4Q7C A;  3D9P A;  1QQE A;  3AG2 C;  2PX0 A;  5ARF A;  3K9I A;  4HFK B;  2XSE A;  1UJK A;  3VYW A;  5FZS A;  4BY6 A;  1M56 C;  3Q7G A;  4NQ0 A;  4HLE A;  4PJJ A;  3ZHE B;  3DJU B;  4JW1 A;  4YWQ A;  3NYL A;  2AXV A;  4L2L A;  1Y6I A;  1E7V A;  1HFA A;  2KGO A;  4CDM A;  3PHF 2;  4I3M A;  2HV7 A;  4XLN F;  1TKN A;  5EDS A;  3FU3 A;  5BUZ A;  4EBA A;  1IYG A;  1VMA A;  5E2Q A;  4HOS A;  4EBB A;  1TWC A;  4XKB A;  4AOF A;  4B6I A;  3D9O A;  4Y6C A;  1JUQ A;  2R7W A;  2Y3A A;  4AEZ C;  3ENE A;  4WUY A;  5KYY A;  5ARG A;  2R7V A;  1RJ9 B;  5FZR A;  4DBR A;  3LVR E;  2Q9C A;  4IJJ A;  2J4D A;  3QZC A;  4GYW A;  3UMK A;  2X3M A;  4F53 A;  2H7B A;  2J4B A;  3APD A;  2FFH A;  2V3C C;  3E70 C;  2WQ7 A;  4AV7 A;  5DVW A;  1Z5Z A;  5FQ4 A;  5DIZ A;  4U0U A;  1Z63 A;  4IRU A;  4G23 A;  1OWM A;  4AXH A;  2XGS A;  4UQX A;  1TWA A;  4I9E A;  3CKB A;  1L5J A;  5FCL A;  4HOU A;  1BR4 A;  4FA6 A;  4J8E A;  1MMG A;  2D5R B;  4UI9 J;  5A6C A;  3ZIM A;  3CZ6 A;  2EQX A;  4U5H A;  2L9J A;  1FVH A;  4RG9 A;  5KYU B;  4OYS A;  3CKC A;  4UWK A;  3QJZ A;  4DVY P;  3CR3 A;  2I1K A;  1OCC C;  2YEV A;  4U5D E;  3G2T A;  3EH1 A;  1INZ A;  4U8H A;  2WXN A;  4FLB A;  2WXJ A;  5E75 A;  2PQR A;  1TJF A;  4V3I A;  4A2N B;  3FY4 A;  5FQ7 A;  2NSZ A;  1VYK A;  3NZS A;  4CRW A;  2W9Y A;  4N06 A;  2VTB B;  3Q6M A;  1SF8 A;  4C0M A;  3CHR A;  2G3K A;  3EFO A;  1PD0 A;  3ASD A;  3ZXS A;  4BTA A;  2KC7 A;  2Y3D A;  3HVE A;  2AXU A;  4AX2 A;  3NQP A;  3QOU A;  3ZVR A;  4ANU A;  1FFT C;  2WQ6 A;  2XGM A;  4GAA A;  4A1S A;  4DBQ A;  5D91 A;  2A6E F;  2EIK C;  3ONL A;  3P1U A;  1E96 B;  3LCA A;  5LFA A;  1LVK A;  2XQ0 A;  3W2W A;  2DGJ A;  2XL4 A;  1WAO 1;  3NRH A;  4DPR A;  1M2V B;  3ZYK A;  5JHB A;  4BJ5 A;  3KAE A;  4HE8 D;  3R7R A;  4XKC A;  4GA2 A;  3FH8 A;  4P29 A;  3D3M A;  4IYP A;  1NU9 C;  5CMW A;  3QNK A;  3DAF A;  2XCC A;  4HFG A;  4F3V A;  3S29 A;  2FBN A;  5B3S C;  4C7O A;  2J7P D;  1LF8 A;  1WM5 A;  4GPK A;  2Y4T A;  5JJ7 A;  4QI0 A;  4G0H A;  3D9J A;  4XI0 A;  4GMJ A;  3B7T A;  3TJP A;  1KU2 A;  1YA0 A;  5AEN A;  2LAH A;  2JLB A;  5E76 A;  1FTS A;  3LDZ A;  3SEO A;  2R7S A;  3EIJ A;  4RVB A;  1UG3 A;  4O6F A;  2VH3 A;  3Q7L A;  4JJF A;  4N3A A;  3T6B A;  3MX3 A;  3DM5 A;  3SI5 A;  4EZL A;  4KBL A;  4ABN A;  4YVO A;  2NC9 A;  3D9L A;  1NZE A;  4KBQ A;  3FTX A;  1ELW A;  1HG2 A;  1NP7 A;  3K6B A;  3WOD F;  5L3V A;  4JZY A;  3RRN B;  4MS6 A;  1N54 A;  4C7O B;  4OIN F;  4CBE A;  2NUP A;  4JPS A;  1JWG A;  4H4K C;  3B0V C;  1NU7 D;  3S28 A;  2YQ8 A;  4BJ6 A;  4FX5 A;  5G2N A;  4Q94 A;  4ZLD A;  1MNE A;  3CK8 A;  5F5H A;  2IQC A;  1RJ9 A;  5HI7 A;  3S7B A;  4I17 A;  4KC9 A;  5T3W A;  4DI4 A;  2WXP A;  4P6I C;  4O6N A;  3K1I C;  2YHC A;  3EQL F;  4FAD A;  1IQU A;  4AK9 A;  5DLJ A;  3UGP A;  4ACL A;  3LEW A;  4GA0 A;  5BUO A;  3W8I A;  4DJA A;  3QKY A;  3EFO B;  3ASF A;  2EIM C;  2X6J A;  2XPI A;  2C0M A;  4UWH A;  3UR3 C;  3ZHE A;  1HXI A;  4D10 C;  4YT2 A;  4RDA A;  1JPJ A;  5T4Y A;  3FUE A;  2Q3T A;  2M4E A;  4UWG A;  2NXP A;  2EIL C;  5AIJ A;  1VOM A;  2WVO A;  4PJN A;  2V0P A;  1DVP A;  2VQ2 A;  4APF A;  2WB7 A;  4GML A;  1TWH A;  3AS8 A;  4JHR A;  5HSW A;  2BE5 F;  1W3B A;  1NA3 A;  4MND A;  4E85 A;  3FUL A;  4JHJ A;  3CV0 A;  2ION A;  2IOS A;  1HX8 A;  2DYR C;  1O5H A;  4AY5 A;  3ABM C;  3FH5 A;  2Q7F A;  1QNF A;  4A55 A;  4UWL A;  3LXU X;  3FTW A;  1S7Z A;  3RFY A;  2MOW A;  3UX4 A;  1VDY A;  3ZGQ A;  3HHM A;  4BX8 A;  1ELK A;  2L0T B;  3SBT B;  4BT9 A;  3PS6 A;  4A3V A;  3ZIB A;  1J8M F;  2WVQ A;  3Q5M A;  1WGW A;  2JD3 A;  3VLF A;  2OG2 A;  4NUR A;  2WPV A;  3RIB A;  3SHF A;  2L9B A;  2RD0 A;  5CI9 A;  4MLP A;  3SD5 A;  3CHM A;  4GU5 A;  5KYW A;  4ILH B;  5AYW D;  2KZT B;  4CS7 A;  4N3B A;  2V4L A;  3Q15 A;  4PK4 A;  3T6J A;  2GGF A;  5KYU A;  3X1O A;  2IXN A;  2KCV A;  3RH3 A;  2IXO A;  1ZYR F;  2Q9B A;  1XGW A;  2CNW D;  4F7A A;  3MEK A;  2Y3H A;  4G7O F;  3HJC A;  3JQ1 A;  4B94 A;  4L1B A;  2FEZ A;  5G55 A;  3ZN3 A;  2P58 C;  4W8K A;  5BV1 A;  3EGX A;  3SZ7 A;  2YZS A;  5JHA A;  4U0Z A;  2PL2 A;  4CGV A;  3EGD B;  3LY9 A;  1IHG A;  5EX0 A;  2V5F A;  2WXQ A;  3L16 A;  1PCX A;  3U4T A;  2XPY A;  3W8H A;  1ZU4 A;  4G7H F;  4OIQ F;  5B1B C;  3PDN A;  1E8W A;  2E0I A;  3MKR A;  5BW8 C;  1HE8 A;  2OCC C;  3ASG A;  3IHV A;  2G3V A;  4IUL A;  3APC A;  3ML9 A;  3QB2 A;  4CT4 A;  4EWC A;  4I6J A;  3BG1 B;  4HXI A;  2J9W A;  5E33 A;  3ITF A;  4FU3 A;  3DZA A;  2KCL A;  2IJG X;  4W9R A;  4JCH A;  1SZA A;  3PRE A;  2ZXP A;  1HG5 A;  3I4G A;  3AU4 A;  2HM8 A;  4FC8 A;  1ZHZ A;  3KMI A;  3U66 A;  3CVQ A;  2CG2 A;  4HOR A;  3NKD A;  3S27 A;  1SZI A;  3SP1 A;  2MRI A;  4PJL A;  4WWO A;  5B1A C;  4M3O A;  5ENN A;  2WZG A;  3Q4A B;  5LCW C;  2DCP A;  2MHK A;  5A23 A;  4Q96 A;  5EGY A;  3S7D A;  5M72 A;  4JHK A;  2YHS A;  3AU5 A;  2FUL A;  3FU5 A;  5C2Y A;  1V54 C;  3FTY A;  3SBS A;  4U07 A;  1U3D A;  1UN8 A;  3RU0 A;  4PFP A;  3ESK A;  1JWF A;  3ECS A;  4JUR I;  2KQ9 A;  2UY1 B;  4YT5 A;  5G04 C;  2DYS C;  4JA9 A;  4PS7 A;  3EGX B;  2CGE A;  4CDR A;  2IXP A;  3NDB B;  3FU6 A;  3FHE A;  3JYH A;  3CQG B;  2AWI A;  5HQ8 A;  3ZFW A;  3OA1 A;  2IOL A;  4I1M A;  4CS8 A;  1ZU5 A;  4N5C A;  2YNQ A;  3UMI A;  5KJL A;  3ABL C;  3H65 A;  3OXF A;  4DI3 A;  3ESL A;  2LSU A;  1PAQ A;  2DBA A;  3CHS A;  1LKX A;  4UI9 C;  4JEU A;  2I6H A;  3PZD A;  3TD7 A;  4E7S A;  4FWV A;  4QI2 A;  4KZC A;  2Q9A A;  5KYW B;  4FJY A;  3L08 A;  3S2A A;  2I8B A;  4ACK A;  4EPZ A;  3IV0 A;  3HYM B;  4LAC B;  2W4B A;  3EHM A;  4HS2 A;  2PZI A;  3CGH A;  3CVW A;  2LSV A;  2PX3 A;  2J0X A;  2NUT A;  1H0A A;  3S0X A;  4WND A;  4J6I A;  1OWL A;  4GB9 A;  4ANX A;  2GFH A;  4JZA A;  3KS2 A;  4G11 A;  1G8X A;  4U5C E;  1SMY F;  3PMR A;  4GCO A;  4B0Z A;  3FTU A;  3RO3 A;  4GA1 A;  2RG8 A;  3LVQ E;  5FJY A;  2W4M A;  1EDU A;  3GOD A;  3G2S A;  4UQY A;  4A3T A;  4MQ9 F;  4RG6 A;  1EPU A;  3ZPJ A;  2WZF A;  4J0U A;  4K7B A;  4GZ6 A;  4PDX A;  1MHQ A;  2XHE A;  3RO2 A;  2E2E A;  4G25 A;  4YN0 B;  3ULQ A;  2CHW A;  1OUV A;  4OIR F;  1DNP A;  2R59 A;  1JPL A;  3OEO A;  1H2T C;  4CGW A;  2Z15 A;  4HFF B;  3N2Z B;  4N2Q A;  4U5E E;  2CHZ A;  4E7Z A;  5BPP A;  1M57 C;  4UQZ A;  4B8C B;  3QK0 A;  2IXM A;  3FDH A;  4KZ0 A;  1MQS A;  4AJW A;  1XNF A;  1NG1 A;  4JJG A;  1ZHW A;  3FUH A;  5IY5 C;  2X6I A;  3R9A B;  3CQC B;  3U3W A;  4KXK B;  4C0E A;  3K33 A;  2I9C A;  3MJW A;  1O87 A;  4XLP F;  2QY7 A;  2J09 A;  3SYN A;  2AVP A;  4IN3 B;  3CHQ A;  3HTK C;  1S0P A;  2VB6 A;  3VTY A;  1SQM A;  3FUD A;  4BJ6 C;  2W45 A;  2HV6 A;  3T5V A;  2A6H F;  3Q6N A;  5AJD A;  4MRU A;  4BEJ A;  4U5B E;  4OVV A;  1HU3 A;  2VSO E;  2UY1 A;  4GYY A;  3PUJ A;  4KI2 A;  3N71 A;  4DLQ A;  2FF4 A;  4BG0 A;  2ZXO A;  4CSA C;  3FUN A;  4WNE A;  4O6Y A;  1J8Y F;  3NF1 A;  3FDQ A;  2PP4 A;  3QAQ A;  1V55 C;  3LY7 A;  3MKQ B;  4PS3 A;  4K0R A;  2LNI A;  3B7R L;  1FCH A;  4L2Y A;  5E3C A;  4I9C A;  2H7V C;  4YJW A;  3E4B A;  3IKO B;  2Y3G A;  3EIQ C;  4IWB A;  4F1S A;  3O39 A;  4XI9 A;  1HZ4 A;  4XWJ A;  3TG4 A;  3PNL B;  1M2V A;  3MGB A;  2VJ8 A;  4KT6 B;  4U0S A;  4CEM A;  3JQ0 A;  3IEG A;  3RK6 A;  3EPV A;  3I4U A;  1TJC A;  4U63 A;  4BSX A;  3M1C B;  2R17 C;  1OWO A;  3FTZ A;  1MND A;  2IF4 A;  3RRM B;  4N2S A;  3V7O A;  4U5F E;  3GZ2 A;  3U64 A;  3MV3 B;  3PVL A;  4JL0 A;  3ZG1 A;  3G2W A;  4YVQ C;  4PS8 A;  1TR2 A;  1NA0 A;  2Y3B A;  3QC1 A;  2BF0 X;  5FZQ A;  3DM9 B;  2WXK A;  3DBS A;  4J30 B;  4FHJ A;  4AE4 A;  3HVE B;  3RIP A;  3CQZ A;  2E87 A;  1IW7 F;  4EEC A;  4CSA A;  2M63 A;  2KJG A;  3AS5 A;  5ANL A;  2WVN A;  5A7D B;  4ZLC A;  4OVU A;  3ML8 A;  4G26 A;  1KT1 A;  1Z6A A;  3K1H A;  4EQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...