3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
3MYVA 3SNXA 3FDHA 3P1UA 3I4GA 3NQPA 4PUCA 3CKCA 3EHNA 3HDXA 5FQ4A 5E76A 4L7TA 5T4YA 4Q69A 3MCXA 4F53A 4LERA 5J90A 3CGHA 3EJNA 5FQ8A 3CK7A 3QNKA 3JQ1A 5T3RA 3EHMA 3JYSA 3LEWA 3IV0A 5FQ6A 5LX8A 3CK8A 3SGHA 3CK9A 3CKBA 3L22A 4MRUA 4F7AA 3MX3A 5FQ7A 5E75A 3GZSA 3OTNA 3JQ0A 3KEZA
chains in the Genus database with same CATH superfamily
1NFNA 4N06A 2J09A 3HG0D 3U8VA 2UUIA 2ETAA 4X8QA 1HE8A 5BPPA 3NBNB 2P9KG 3ZTZA 3B9QA 1UG3A 4OIRF 3ZC4A 4A55A 4N5QA 3ABLC 4U07A 3QB2A 2ZXRA 4AL0A 2QTVA 2DYSC 3GEHA 4ULVA 3QNKA 3TWTA 1MNDA 3UMKA 4F3VA 3ZGQA 2XM0A 3AU5A 3N2ZB 2XENA 1Z5SC 2V8SE 4N3CA 2QLAA 1MMAA 3G2SA 4EKWA 4EBJA 2DVWA 1ZYRF 5GPGB 1J8YF 5KYYB 1QQ3A 3O55A 3HRAA 4GTSA 1TR2A 1E90A 3DM5A 1H6OA 1BDJB 1FVHA 1K3ZD 1OXKA 3RO3A 2NSFA 2FGYA 3PRZA 3L34A 5F5HA 1BLXB 3S7JA 4AK9A 4O6FA 1HS6A 4FJZA 2QNLA 2JABA 4G78A 3UT4A 5KNGA 3IQCA 3FTWA 4D10C 3HNJA 5HS0A 4ZLDA 1NI1A 1FAPB 2GRMA 4J0UA 4B6IA 4EIYA 1HFAA 1HE9A 3RF3A 3PDMP 2VH3A 3V5XA 3TWWA 5EK0A 2P1AA 1ORSC 2BEDA 2HKVA 4CEMA 1L5JA 4YDOA 4B0ZA 3DSVA 4CDVA 4JXTA 4B94A 4O6MA 2LXMA 3GODA 5G05J 4YK5A 2EIJE 2OCCC 3KEAA 1CGME 3TXMA 3S7BA 1CPRA 3VYWA 5BXUA 3KSQA 2VGXB 3ZWIA 2BTDA 3LPZA 5KCMA 3GZ2A 3US6A 1SQMA 4AE4B 5LCWJ 2MOWA 3L08A 4FP7A 1OCZC 2J8SD 2M4EA 4GYOA 1D1BA 3LXUX 2KXPC 2YEVA 3VAYA 2YWAA 3O10A 4CIPA 5DS6A 1TWCA 3CEXA 3I4RB 2V3CC 2VTBB 2NUTB 2F0YA 2XLEA 4XWJA 4RSYA 5JHBA 5H7PA 2X6IA 1I4YA 5AGFA 5EDSA 3FHEA 1LVKA 1MYOA 2XRHA 4MQ9F 1OUVA 1MMDA 4ANVA 3DSTA 2X51A 3RQGA 3C8GD 4N6CA 3DPDA 2HV7A 3MGBA 1Z5ZA 3TAXA 3CVNA 5CMYA 4G24A 3CEQA 2GWWA 4C3DA 1TFKB 3UM1A 3SNXA 4KNWA 2KCKA 3LUTB 4XLPF 3H2UA 1BD8A 3T6BA 4WNFA 3K33A 5AJLA 3AG2E 4JHJA 4HI8A 3R2PA 1OXJA 4HVBA 2X38A 3JYSA 1LS1A 2X6KA 3DRAA 4IB4A 1SW6A 3I4UA 1E84A 2F8YA 1H2UA 3ASDA 3VTXA 3PUJA 1TEZA 2LNIA 2XQ0A 2V4LA 2J9QA 3OTNA 2LAHA 1HW2A 1TNYA 4F6RD 3RIBA 1YCSB 2F8XK 1X5BA 1NA0A 4BJ6C 1JCRA 4RLYA 4L7TA 2RFAA 4DK5A 4QI2A 1PD0A 1N52A 4U04A 2KZTA 2M63A 1G4WR 1I4ZA 2J46A 4G0HA 1N4SA 2KATA 3E9VA 2YHEA 1GS9A 3FUHA 5E3CA 2KCVA 2I6HA 4GEHA 3B0UX 3G2VA 4AX2A 4ATZD 4OVVA 3RSEG 4I9EA 4LDQA 2UWJG 1VB5A 1OR2A 4GMJA 1FMVA 4GQHA 3CQZA 1TWAA 3IQ5A 1MMNA 2IM8A 1N0RA 1M6TA 5G05C 4QDLA 3Q9NC 5JJ6A 3NZUA 1S63A 4XLNF 3CHRA 1ELKA 4XIFA 2MWQA 5KYUA 1FVFA 2WPVA 3CK8A 3PZ1A 2OU6A 4E17A 3FVYA 4PJJA 5LCWC 2Q9BA 1PAQA 4ANJA 1WATA 4JZYA 4AEZC 1R4TA 5HI7A 1SVXA 3CVYA 4K5BA 5JJTA 2L9JA 4EBAA 3D9NA 3HXBA 2OEXA 3G50A 4Q4ZF 2RG8A 5AAOA 1DOVA 5G2NA 4FESA 4H4KC 1DNPA 4LCTA 4PR9A 3L9TA 2IONA 4K0DA 2JD3A 5A69A 4WNDA 5CCLA 3Q5MA 4DJ9A 1ZHZA 3DEPA 4DLQA 3MKQA 4M3OA 3H2VA 4TRQA 2YZSA 1E83A 2YLGA 1MNEA 3K1IA 2PBEA 3TG4A 4E7SA 2PP4A 3UGPA 3F47A 3FUJA 3Q47B 4U5GA 1MQVA 1LF8A 3D9MA 3SZ7A 3B95A 3RRMB 3L1MA 2C0MA 2DZOA 2QYJA 2XCBA 2A0BA 3ZTMA 1KPSB 4ULWA 3L8IA 3DAFA 2AJAA 4PFOA 2V4HC 3MV2B 5L0JA 2J45A 3FUMA 4GZDA 4PJNA 1T01A 4NACA 1FT1A 5KYNA 3B71A 2XPYA 3TJ6A 3C72A 3Q7FA 3FU0A 1O1TA 4H7XA 3PHF2 4D4NA 2HUJA 4DXWA 1EA8A 4LERA 5E3AA 4BEPA 2DB4A 3AQCA 3FOPA 1YMPA 2IBFA 2LQGA 3ASFA 2NPUA 2Y1LE 2R2LA 4IULA 3V2OA 1OWNA 1NLXA 1NU9C 3D9PA 4YN0B 3X2QC 2GGFA 3LS1A 3E70C 1ZU4A 5DS4A 3AG4C 3VLDA 2VASA 1K05A 4U9DA 3GEEA 3DZAA 1LD8A 2LP4A 5FWQA 2EINC 3MYVA 1RKEA 3CVQA 4MVSA 1DCQA 3C98A 3HNIA 3V2XA 3FY4A 2VSYA 2XPZA 3TOMA 2FFHA 4Z9JA 5FZTA 4DRIB 4YT8A 2PQNA 2X6JA 3S84A 3C8GA 4JEAA 5L0FA 4L2YA 4KZCA 4CS9A 3U66A 4W8KA 2R5SA 2DI3A 2H6FA 4O1OA 4GZ5A 5EIDA 4J8EA 2J7PD 3ENEA 3Q49B 1YA7O 1NBBA 3LVQE 4HB5A 3RFYA 3FULA 2BE5F 2G3VA 3FFLA 3TULA 2AWIA 5JHAA 5BW8C 3TJPA 2G3KA 3Q7GA 4EPZA 2NC9A 4PJMA 1V54C 3J5PA 1XWJA 3TQOA 3LCAA 4PH4B 3KYIA 5ARFA 3U4TA 2GW1A 2R7WA 2XLMA 1OWOA 1R5ID 4KBQA 1JMWA 5KWDA 4F1PA 4C0MA 2XCCA 3UT7A 4NQ0A 1A7DA 2Y3DA 1M2VA 4C48B 3TK0A 5FZSA 4APOA 2ETBA 3AG1C 1TN8A 1VLSA 3JCUQ 1ZHYA 5AENA 4NURA 2OVFA 3FOOA 1BZ4A 1WDYA 1TNBA 3TWUA 4IAOA 1JR8A 1XZQA 3V30A 1GGQA 4HNAD 2IQCA 5BV1A 2I8BA 3Q6MA 5L3QA 3DXJF 4W8PA 4C3EA 5CI9A 4GPMA 4TUMA 3ZYKA 4HORA 2AWYA 1K8KG 4UI9J 1WM5A 4DPRA 4ACKA 3HXEA 3FWVA 2P9SG 4WUYA 3EPVA 2Q9CA 1NFOA 2MYSA 4GYYA 5CHEE 1H6GA 4U8YD 4RDAA 2R02A 3ZG1A 2OEVA 3HVEB 1K1BA 1N4QA 1TNZA 3UT8A 5CECB 3DSSA 3B29A 3ZU7B 3B13A 1ZW3A 3IQTA 3WAQA 4CDYA 4NY3A 3P1UA 3UTMA 2H6HA 4UDVA 3DAGA 1Q0MA 2ZXPA 5E76A 3LYAA 3RKOF 5JVEA 1QPUA 1OCOE 2OVBA 4TXPA 5J90A 1E96B 1B68A 4U95D 3AJMA 3C3RA 1OXBA 4YT2A 3G4ZA 4JCZA 1N11A 2Q00A 1KT0A 3Q9UC 2DYRE 1DC2A 4WNGA 1OQCA 3PMRA 2FO1E 1VLTA 1EYHA 2KZTB 3C8ZA 3LY8A 2BKKB 3KEZA 4G8KA 3CHMA 1K04A 1T6IA 1AEPA 3PUKA 4J8FA 3SEOA 5CEAA 3TWRA 3IHUA 2L6HA 3N0TA 4U0SA 3V7OA 4E85A 1N4PA 3VTYA 3QAQA 2R03A 5G55A 3NB2A 2YQYA 2BF0X 3QVYA 2W4MA 2CHXA 3SGHA 3AG2C 4MTFA 4Q7CA 2E0IA 3TWQA 3OXGA 3LY7A 3ZXPA 1E8XA 1KT1A 5BXOA 4BERA 5EYPF 3KH2A 2DIWA 1D0YA 2Y69E 4L2LA 2LK4A 3EQLF 5B3IA 5ANRA 4CSAC 3ZXSA 4U5BE 2XZDG 3EH1A 3B7UX 3ISMC 4OIPF 4KMOA 1H9TA 4GU5A 4BESA 4JJFA 1ZBPA 5IY5E 1Z3XA 1OW6A 1YZCA 4YL0A 3PVLA 3CKCA 3SXYA 3TWSA 2IO3C 3MYIA 2F22A 3O4ZA 2LSVA 1H6PA 1MZCA 2LO6A 2KYHA 4U5FE 4LNUD 5AIJA 4BJ5C 2YQ8A 3MKQB 1U89A 3CGHA 3N71A 2J7PA 4YNDA 2LFDA 1VK5A 1ZVZA 4UI9C 4AP2A 1Z6AA 1TJCA 2QFCA 1WG0A 3CK9A 4A63B 4ATGA 4YDEA 1N4RA 3LLIA 4X0RA 3SD5A 4R7LA 3HJCA 4JIOA 5FZRA 4HOUA 3UMVA 4C7OB 4FAPB 4BWRA 3T6JA 4J8DA 3GZ1A 2Y4TA 2P9LG 5D91A 2VSOE 4OD5A 4Y6WA 4ANUA 2XXAB 2D4UA 4UQZA 2Y3HA 3U64A 4NTAA 2AXZA 2WXKA 2I15A 3RQEA 3E4BA 3ZNGA 4DX6D 1X81A 4RBNA 5C2YA 3QDNA 5EKQD 2JX0A 2R7VA 3ITFA 3FDQA 3APCA 4DX2A 3EG9A 1LM3B 1U3DA 1D1CA 1RZ4A 3SXZA 2H7VC 1RKEB 5KYXB 4E7ZA 5F28E 3ASGA 3ABMC 3X1OA 3WXXA 3UINC 3LNRA 5BV0A 3T8MA 1Q0FA 3SBTB 4G8LA 3ONLA 1PCXA 1V4AA 3U8PA 1SA5A 3NOCD 4KNVA 2WXJA 3M79A 2YL0A 2WZGA 2BC5A 3PZ3A 1XZPA 1XGWA 2HM8A 4AL1A 3EZIA 4XI9A 4Q94A 2V5QC 3P2BA 4N6HA 1OW7A 4CBEA 2L0TB 5AQ7A 1HG2A 2XS1A 3RK6A 3PZ4A 3QWWA 4JHRA 3SFXA 2HE0A 3PREA 3I5PA 1Q2ZA 3W9FA 4N3AA 4WWNA 3ZW3A 5BUZA 3CAXA 3JYYA 3L22A 4A3TA 1YZAA 1M56C 1S0PA 5FTPA 1FT2A 2YHSA 1BI8B 5B1BE 3MBGA 3ZPJA 4ABNA 4JHKA 4JTAB 4DVZA 2KK1A 5BUOA 2RSEB 3RVYA 4DOZA 2EPLX 3F6QA 1NG1A 2XHEA 3LNMB 1Z3IX 1ZZPA 3CSKA 3EZHA 5T3TA 4P29A 3UM0A 1MX4A 4WNEA 3ULEG 4FA6A 2H7BA 3GM2A 3LJNA 1H7IA 3ML8A 3TGOA 4QQIA 4ILIA 3FP3A 1OW8A 3ASOC 3HTKC 3MX3A 3Q15A 3AG3C 4AM9A 3IPMO 1TN6A 3G2TA 4EWCA 3I4GA 4ILHB 1H2TC 1BR4A 4D4XA 3NYLA 1UG7A 1UOHA 2GDCA 4YT5A 3SP1A 2XM4A 3C18A 2VGYA 3CIAA 4G11A 2EIKC 1HU3A 2H7OA 3MFNA 4LG6A 1HMOA 5K0IA 1N1CA 5AN8A 3S28A 3RRUA 2WQ6A 4TUUA 1PD1A 5EX0A 3ZEFA 4N39A 3MKRA 4OIOF 4GA2A 4XEKA 4UWLA 3HXFA 2WVIA 2WXNA 1OCCC 3CKBA 4JRZA 2IOQA 3PZ2A 2LFFA 2ZISA 2MHRA 2XL6A 3FTYA 1JPJA 1QKRA 2XLVA 3RYLA 5KJKA 3IXEA 3CSFA 3NQPA 5ITZF 4H7YA 4PJLA 4V3IA 1D1AA 1TWHA 1Z23A 4ANXA 2OJQA 1T9KA 2J08A 2LAIA 2LXLA 2P9IG 4CCAA 3NG1A 1MX2A 2EIME 5EIBE 2V26A 4YWQA 2B6CA 1QQEA 3C62A 4MVRA 3GZSA 3EGDA 2F37A 4XE0A 4MW8A 4G1TA 1U0BB 1NA3A 4BSZB 3E32A 3NMJA 5LP0A 4GTPA 4WGYA 2CG2A 3MCXA 1TN7A 4IN3B 4U63A 4I1MA 2R7TA 3BUAA 5L0IA 1SZAA 3EHMA 4Z9HA 4I44A 3A11A 3DXKG 2P0NA 2B0OE 3K7DA 1YDIA 4DRXE 2J8WA 3ZRHA 1G5ZA 5LOZA 1NU7D 3G2WA 3AOUA 3Q78A 5KYWB 3DXMG 4GTQA 4UQXA 4BEMJ 5JMND 3E37A 2WQHA 2I1KA 3DWWA 1EKYA 3L54A 1AP7A 2ASRA 4EBBA 1QYMA 3UMHA 5T3WA 1YVIA 4G7ZF 1WY6A 3K66A 2X6FA 4N5CA 4AOFA 3LEWA 4NTBA 4DX5D 2LIGA 2RFMA 1V55E 1NZEA 2J9WA 3ZFWA 4HRMB 3J06A 2WM9A 2CFZA 4AJWA 4N2QA 1YYHA 4N2SA 3L8JA 1IW7F 2GFHA 3ABKC 3O48A 3QOUA 4GMRA 4TXQA 2PFDA 3VLFA 2EILC 3AS4A 4P9TA 2VQ2A 4J32B 3U3FA 5EYLA 4HI9A 2PZIA 4MVOA 3QW1A 3N24A 4CS8C 3TG5A 2IXMA 1GM5A 2HS5A 4W9RA 5AQ9A 3ZHEA 4UUCA 1Q0KA 1KLXA 2EPOA 1E8ZA 5E33A 3GYZA 2FO7A 3HYMB 2WZLA 4JZAA 3CHSA 4B8AA 2Q4FA 3EU5A 1CGNA 4MTOA 3UR3C 4C0EA 2P9NG 1TFOB 2FULA 2HFIA 3FTVA 2E87A 4DUIA 2J4BA 1LE4A 2JEKA 5CCMA 3C7JA 4E0HA 1APCA 3QC1A 4P6IC 3U3WA 4MVQA 1N95A 2PNNA 4GA1A 1LI7A 5LFAA 5AQBA 3C3OA 1RCPA 1ZW2A 2YKZA 2YRFA 1TNOA 4I1AA 3L0IA 1QZ2A 5DLJA 3LVRE 1A5EA 1LKXA 1AVOB 2V5FA 3L16A 3K1HA 1JWFA 1ELRA 3DPYA 3DSUA 2GRQB 5T4YA 4LDKA 2FF4A 5IY5C 3FXHA 3EU9A 3JZ0A 3JRTA 5HRYA 3CR3A 3HXCA 4K5AB 4RG9A 1ELWA 3FAPB 1WASA 5FINA 1GQAA 4XPWA 2BKGA 2ZXOA 1JRAA 3WG7E 2PF4E 3MA5A 3OAWA 4AY5A 1UN8A 3DI5A 1PC2A 4TXRA 2KW3C 4BG0A 1LD7A 3PE3A 5B3SC 3FH8A 4JPSA 2W4BA 2XLOA 3GM1A 4U7EB 2CHWA 1TJFA 2HSBA 3LS8A 2HJMA 4NQFA 2NSZA 4HLLA 1FNTc 4HQDA 4DBQA 2Y0BG 1E85A 4ME2A 1H9GA 5AARA 2KSFA 5AQAA 1AUEA 3U5SA 1OCRC 1L3PA 1LPEA 5T1DB 2OOCA 3JYHA 2VSXE 4KC9A 5CIVA 1TYQG 3JCKC 4FHKA 3MJWA 4HFKB 1S70B 3U2LA 1FMWA 4ZHBA 4GTOA 1LE2A 3UUXA 2ONDA 2PNOA 2WZFA 3UNGC 2HSQA 2L6JA 2CW0F 3SXKA 2DYSE 3C3QA 4LEUA 256BA 1W2WA 3HDXA 2J9VA 3TD7A 4ER9A 2RKKA 2MRIA 1RJ9A 4Q69A 1E2XA 3U0CA 5ENNA 1E8WA 4IRUA 2ZXWE 1OT8A 2DCPA 3JQ1A 3ASHA 3ZQVA 3AAAC 2VCCA 3KAEA 4EQFA 3BG1B 2KGOA 2L81A 2LCHA 4TV3A 2FI7A 3G2UA 3NAWA 2LSEA 4DRJB 3WODF 2VYIA 2R7QA 5FCLA 4N4WA 3ZIMA 4MS6A 3NRHA 2VJ8A 3ZYQA 4Z68A 1UFBA 4LACB 4JVSA 4B8CB 1JPLA 4MVUA 5KNHD 3W8HA 3QW0A 3SZRA 3LJ3A 2E2EA 1MMGA 1RXQA 4E6HA 3KSLA 2WVQA 2KJGA 2XEVA 1TWGA 2DGJA 1IXVA 4CRWA 1S05A 1VDYA 4FLBA 4JC8A 1UW4B 2P9UG 4HLEA 2PL2A 3FUKA 3Q75A 2AXVA 4I6EA 1HW1A 3UM3A 4IARA 2EPMX 5KYYA 2AU5A 2R05A 1D0ZA 4JKVA 2YNQA 3PS6A 4BX9A 5EGYA 3J5QB 1OCZE 2I1JA 3LKUA 1HO8A 4BJTA 2VGEA 4PUCA 2AVKA 1EI7A 4IWBA 1K40A 1HE1A 4BEJA 1Y6IA 5ENTD 2D5RB 3TJ5A 3D9JA 2EIJC 2X6HA 3PEUB 1VYKA 5FQ8A 2KNHA 1O3UA 3EH2A 3U9JA 5ENQD 4BX8A 1SR2A 4UWFA 2XPIA 5D0QD 1H19A 2GRPB 5DIZA 2Q9AA 4O6YA 2PX3A 2WMNA 3FUFA 4I6GA 2Z15A 3RU0A 3W4YA 2HO1A 1JAFA 4FHJA 3AQBA 5G04J 4A4AA 3B7SA 3DEOA 3DE8A 2I2OA 1IHGA 3T5VA 1Z63A 2A6HF 2Y4UA 3SF4A 5A23A 2VB6A 5FIOA 4PS8A 2A69F 4MS2A 1O5MA 4JL0A 4Z9IA 4JEBA 3UGOA 4ZFHA 2VGXA 4MBGA 2IYLD 1FPPA 1P5QA 4AE4A 1VTMP 2A5UA 3S2AA 3IHYA 3NOGD 3AS5A 3K1IC 3IEEA 5JP7A 4CZ2D 2AWCA 3S90A 2LSUA 1TQGA 3KS2A 3B0PA 5ENSD 2WXPA 3A9CA 3V5ZA 3EGXA 2QZAA 2R25A 2CDQA 3LS0A 4CDNA 4XKBA 3JSEO 4U5CE 3ZVRA 3ESLA 2AP3A 3SFZA 2ICWG 3GW4A 4KXKB 4BTAA 5KYUB 5JLIA 3RJVA 4JTDB 4UQYA 4CJOA 4OYSA 1NSGB 2QUPA 3BG0B 3MZLB 2P2CP 2WB2A 2Y3GA 3OXFA 4GYWA 3M1CB 2XRYA 2FAPB 1BBHA 4ACLA 3TWXA 3QKYA 3EHRA 3AJIA 4GAAA 4KVMA 1RKCA 5AC4A 5L0GA 5B1AE 3U3BA 3TWVA 5HQ8A 1IKND 2NSGA 4JJGA 1HH8A 4WAFA 4AY6A 3DJNB 4CS9C 3D9HA 3QARA 1K1AA 3UM2A 2YLDA 5EILA 4H54A 3FTXA 4HEAJ 3MLGA 4MRUA 1I5NA 1Q0GA 1N94A 5FQ7A 4DRHB 4KVOA 4I43A 2HR2A 5CBOA 2J07A 4XI0A 1F1MA 2C04A 1OWPA 1KZOA 1IZMA 1ZHWA 5A6CA 4AIFA 5ANLA 3GM3A 1Y8MA 3T8KA 3KPHA 3FU3A 1C02A 5ENOD 5HV9A 3OA1A 3UMIA 2R7SA 4JA9A 2RD0A 3D9OA 2MYOA 3ZSUA 5G04C 3ZYLA 2ZD9A 3QTHA 3CSTA 4U5HA 3ZDLA 1QLEC 3T9KA 3SHFA 1WAO1 3S29A 3U9MA 2XZTG 3ULYA 1NFIE 2HMQA 1L7CA 3CVLA 5ENRD 2L6GA 1E7VA 3LY9A 5EX3A 3EJNA 5JUAA 3CHOA 4DI3A 1INZA 4FJYA 2PM7A 1ZHTA 2AW6A 3ULQA 5DQTA 1CGOA 3UI2A 3RH3A 4F4BA 3C8GB 4CYMD 4MVZA 2WXRA 3HIZA 1HY5A 2HJ3A 2WMOA 5DQZA 4JD2G 2P7VA 3CVVA 4G23A 1G8XA 3KD7A 3X2QE 5A6BD 2AVPA 4O1PA 4BJ6A 3T9OA 3AG4E 4I3MA 4EHPA 2M64A 3Q6NA 3R7CA 4PS7A 2OOEA 5DVWA 1G3NB 2EINE 3Q4AB 5FJYA 1CPQA 1FCHA 3GORA 4CGVA 1OKKD 2QYUA 1NL4A 4JW1A 4U0UA 3IHVA 3UPVA 2WB7A 4APFA 3UQ3A 4XEVA 1ZHXA 3KKBA 3NF1A 4EECA 4R32A 3SI5A 2OKUA 2CGEA 4JCHA 2QY7A 4GZ6A 3ZIBA 2IU1A 1BPOA 4GYTA 1UJJA 1M2VB 4LLEA 3BU8A 3NMKA 2KCLA 4DVYP 4U5EE 4AVXA 2OJED 1NZNA 1Q0DA 4ILGA 2KC3A 4JA7A 2IXOA 3JUEA 3K6BA 2Y3AA 1V54E 3L82A 3B7TA 4BFRA 2ZXWC 3SXMA 3I5QA 4YL1A 4WWPA 1DOWA 3R7RA 1EQ1A 4KYOB 5D92A 3VM6A 3SO8A 4BTBA 3AG1E 3GWLA 2Q7FA 4YDYA 4CJGA 1HMDA 1D8EA 2XEEA 4MVMA 3CVUA 4YL3A 3BRJA 4JURI 3IBEA 3EDTB 2P9PG 5TJ5E 5CBNA 4BJ1A 3W2WA 4QI0A 3TXNA 2VCAA 3U2MA 1SZIA 3POVA 2WVNA 3E33A 4J7WA 3VRCA 4AXHA 3DKAA 2XRZA 2QC9A 3FMSA 5A6AA 3Q7LA 3S7DA 4J8SA 1YJGA 5L0DA 3B7RL 3E30A 5FQ6A 3QMKA 1Z7Qc 1D9SA 4RVBA 1SMYF 5ENPD 3DD7A 2L6BA 3S27A 4U5DE 4NCQA 3ATPA 1C17M 2Q3TA 1NP7A 4P9FA 1T5OA 3NMIA 1O87A 1VMAA 3FH5A 4O7GA 5COFA 5HSWA 1HX8A 5COMA 1S7ZA 1PV3A 2HMZA 3NYMA 5A6KA 4HXIA 1YYXA 1HZ4A 3VLEA 1N54A 5D2MC 1A7EA 2YINA 3Q79A 4I2ZA 3W2VA 4EBKA 3CLJA 3QWVA 4BT9A 3PNLB 1WGWA 3NKDA 3ASNE 5T8IA 2ZGDA 3HKKA 2YLIA 3EGXB 1E86A 5FT9A 3FEYA 2GAQA 5A6JA 4J6IA 1FFHA 4YVQC 3CVXA 4NTFA 3AGUA 1HF8A 4FLHA 4K0RA 4AV7A 3HXDA 2J0WA 3QJZA 2L6FA 4BT8A 4NIKA 4RG6A 3UKUG 5CRUA 1O1RA 1U2VG 4LDRA 4KT6B 1IQRA 2R7OA 4CT0A 2CG3A 1OCOC 3NZSA 4OINF 1D8DA 1IHBA 3FDHA 4PDXA 1JCQA 2J49A 3S7FA 3OXLA 4L6RA 2FEZA 4I1OB 3HVEA 4IYPA 5FQ4A 3EIQC 4CIHA 2BUGA 2DYRC 3SYNA 3GEIA 3AGTA 3HNLA 1MQSA 2NXPA 3CVWA 4HFFB 2WXFA 3T4RA 4XX5A 2W9YA 4HE8D 1E7UA 1IQUA 2WXHA 4OAVB 2YVKA 5DBKA 3LEOA 3S9OA 5CERB 3NYJA 5A6BA 4B93B 2YL3A 3PNTB 5A7DB 3PZDA 1YARO 2HZ8A 4CDRA 4HRLA 1FR0A 4WWOA 3WHNA 3EFOA 2P61A 3GANA 3O6XA 1OKKA 1SZ9A 3T6GB 1TKNA 3DBSA 1JOGA 4G7OF 4FX5A 2IEJA 2J0XA 4CDMA 3RW0A 3QVZA 3I3NA 1KU2A 2KC7A 4KBLA 5JRAA 2Y69C 2ZGGA 4J8YA 2P6VA 4FC8A 1C03A 3SQVA 3D9LA 4G2VA 3RIPA 1SF8A 1RMVA 3MV3B 4UWHA 2A5EA 2C0LA 2CYDA 3V31A 2XL8A 1KTMA 2WXIA 2CNWD 4DI4A 1ORYA 4MTGA 4L9PA 4LLCA 2X3MA 4FWVA 3JXJA 1AWCB 4WGZA 5B1AC 2WL8A 3DSWA 3EG9B 2PX0A 2BL2A 1N0QA 4GTMA 4C9BB 1QBQA 2WXOA 5JT4A 2UUHA 4EBAG 3T5XA 4ANWA 4GTTA 3DSXA 2B0HA 1QSPA 1EPUA 4B89A 1GW6A 3FUDA 3DMDA 4JEHA 4UWKA 4YDWA 1FFTC 2YL1A 2UY1A 4G26A 4PACA 2XGSA 4EZLA 2A0UA 1EDUA 4A3VA 1HXIA 3LLKA 1LS4A 2XL4A 3CHPA 2R7XA 3D9IA 3UIOC 4GTRA 1DVPA 3ABME 3M15A 4U96D 4CT4A 2WXMA 1OWMA 4A2NB 4GCNA 2H8AA 3H65A 4A1GA 2NUPA 1D0XA 2ILRA 1H6KA 4JE9A 2X0CA 4O60A 3M4CA 2LUHA 1QVXA 3R7QA 1YYJA 4O79A 2ETSA 2KM4A 4LNBA 1YLMA 1YAUO 3BEEA 3CHQA 5CI8A 3FTUA 4XKCA 2XEHA 1LTXA 4C7OA 3S0XA 5COGA 4E18A 2OEWA 5BNWA 2XLDA 3U9WA 3ABLE 1OY3D 2VCBA 1SA4A 2XXAA 5AYWD 1T6QA 3DM9B 2R17C 2DZNA 2XGMA 4G7HF 3RVZA 3ML9A 3ECSA 1M57C 2IXPA 1MHQA 1A41A 3M4BA 3OWTA 4FU3A 3ZKJA 3Q73A 4PK4A 2CHZA 2W45A 3D3MA 3CQGB 3JUIA 4N3BA 1A17A 1O1SA 5HKPA 4YT4A 5T3RA 2IJGX 2XGOA 4CSAA 3F46A 1ST6A 4MW3A 2IOSA 2L7AA 4JEUA 3IQ6A 4CX9A 1BI7B 3ONKA 4J7TA 5KYXA 2R7UA 4K7BA 3R9AB 4DLOA 5JA4D 3VF0A 2GRNB 2WVOA 3KYJA 2V0PA 3PCVA 3ASOE 5M72A 1JCSA 4K03A 3AG3E 4BJ5A 4GB9A 2A4ZA 3SFYA 5B1BC 5CMWA 4HOSA 3RKVA 2PM6A 1FTSA 4CS7A 1JWGA 2EIKE 4JB8P 3DE9A 3BEHA 4URKA 1H2VC 4IGGA 3ESKA 1WN0A 4RQIA 1KZPA 4GZCA 3FHDA 2OG2A 2IOLA 1OCCE 3EGDB 3W9GA 5C1DA 4DBRA 4FULA 3EHQA 4PFPA 2OCCE 3LJBA 3ZUVB 4K1OA 4I6JA 1E8YA 3W8IA 2Y3BA 3V5YA 3AS8A 2GRLA 2WXGA 2EPKX 4F7AA 3C63A 2YHCA 5KJNA 3G4XA 1O5HA 3UKRG 5JS5A 3JRMO 5EN5D 4OIQF 4YVOA 4LSZE 2TMVP 4J7YA 5AC5A 1ORJA 3FUIA 3NKEA 2C2LA 1OR3A 5F5FA 1TNUA 4XZ4A 4M7CA 2R59A 3TL5A 4GCOA 2RD9A 1VYIA 4OAUC 1J8MF 3B7BA 1ZB1A 5L3VA 4KI2A 1VOMA 4FADA 3PDNA 3PH0C 4MNDA 4GPKA 5LX8A 2WQ7A 3L13A 3JXIA 4U8HA 2G62A 2QE9A 2CNWA 5KJMA 2WXLA 2PQRA 4HFGA 4U0ZA 2QY9A 2R9RB 1QNFA 2EIMC 3HLZA 3K9IA 5KBAA 1A0BA 4OD4A 3FU6A 4O6NA 2LD6A 3FUEA 3CZ6A 3Q7AA 3SBSA 3DJUB 2B0JA 3CK7A 4XQ1A 4NRHB 4GA0A 2EPNA 3LESA 4LNGA 3UXGA 3UX4A 3C5RA 3APFA 3ZN3A 4DJAA 3HNKA 3KL4A 5J08A 4PS3A 5KJLA 1WWPA 4F1SA 3QWPA 3JQ0A 3R9MA 3CQCB 3KMIA 3LEVA 2ZIRA 2ZPAA 5D0OD 1B89A 4MLPA 4Y6CA 1BU9A 4BETA 2EQXA 5EHHA 3ZHEB 1A7VA 1Z3YA 3ASNC 2GROB 1H0AA 3JSZA 3HHMA 1OWLA 1W3BA 1ZU2A 2ZU6B 3EFOB 2NG1A 4L1BA 3AU4A 4Q96A 3IV0A 3ABKE 2NUTA 2VTBA 3QZCA 2EILE 3RAUA 2XSEA 2OV8A 1MJ0A 3LDZA 4GZ3A 5BQGA 2OQMA 2CFUA 4DX1A 4A1SA 2XLHA 3FEXA 4HBDA 2HYZA 4YJWA 3E34A 1N9AA 2IF4A 4I2WA 1V55C 3ZQYA 3FU5A 4NC3A 4M63A 5BQHA 2JPUA 5DS5A 2IFUA 4JC7A 3BQOA 4K5CA 4IAQA 4RD9A 4CDAA 3FH7A 4XTKA 5KYWA 1XNFA 3MEKA 4GTVA 2DWZA 4LUNU 1WOLA 4I9CA 4ONSA 1U3CA 2MHKA 2Y39A 4BSXA 3B0VC 2R7RA 3EUVA 3PEVB 4Q5SF 2GRRB 2KBXA 3APDA 1SYQA 2O9XA 4I17A 1KNYA 1U6HA 1PY1A 4BPMA 4QFVA 1BR2A 5D66A 3QK0A 3OEOA 4BY6A 2GA0A 4C3BA 2CCYA 3JT1A 1MX6A 3SY2A 4WABA 3IEGA 3UIPC 1JPNA 4U8VD 3NDBB 4EZJA 4EHMA 4KZ0A 3GWNA 2UY1B 3EIJA 1M2OA 4IJJA 5E75A 1S64A 2Q7RA 3IKOB 5JJ7A 3FTZA 5BQIA 2XLWA 3RQFA 2A68F 5JSLA 2I9CA 4HS2A 3L17A 2J9BA 1TR4A 4XEIG 1UJKA 5E2QA 5CRVA 2AXUA 1EF1C 4XPYA 2NUPB 3JTLO 4WJ0A 2DBAA 2HV6A 3FTSA 3CVPA 3RO2A 2H6IA 3DWLG 4OVUA 4HRNA 4J30B 5AJDA 5B3SE 4HOQA 4UI9K 3ZVVA 2IY0C 1Y4CA 3PE4A 2YL7A 2FBNA 3FAJA 2C03A 4ZLCA 4UWGA 1IYGA 2WXQA 3EHNA 2A6EF 4L23A 3RRNB 2IO2C 3SNHA 3LAYA 4JTCB 1YA0A 1LIHA 3WG7C 1V74B 1Z6TA 4XPXA 5FZQA 1RJ9B 1OCRE 1WTYA 1DCEA 4MKTA 5L0CA 3CV0A 1JUQA 2JLBA 5CEDB 3TOLA 1ZU5A 1YA9A 2A1DD 4GMLA 4XEFA 1BR1A 1QZXA 2J4DA 1RW2A 4E0IA 1T6UA 2P58C 5ARGA 4CGWA 4EZKA 5L0HA 3O39A 3URZA 4DX7D 2VSNA 2H6GA 2J9UA 2NYJA 4LRZA 2KQ9A 4F53A 3FUNA 3V79K 4G25A 1Y6DA 1UN9A 4U9EA 4CS8A 1HG5A 4EUKB 3ZYMA 1LI5A 2IXNA 1G4US 2XS8A 2ETCA 3L6AA 4HOTA 3MYFA 3D9KA 2L0IA 2VC9A 2L9BA 5BT1A
chains in the Genus database with same CATH topology
4N06A 2J09A 5BPPA 1HE8A 3B9QA 1UG3A 4OIRF 3ZC4A 4A55A 4U07A 3ABLC 3QB2A 2ZXRA 2QTVA 2DYSC 3QNKA 1MNDA 3UMKA 4F3VA 3ZGQA 3AU5A 3N2ZB 2V8SE 4N3CA 1MMAA 3G2SA 1ZYRF 5KYYB 1J8YF 1TR2A 1E90A 3DM5A 1FVHA 3RO3A 2FGYA 3PRZA 3L34A 5F5HA 3S7JA 4AK9A 4O6FA 1HS6A 4FJZA 3UT4A 3FTWA 4D10C 4ZLDA 2GRMA 4J0UA 4B6IA 1HFAA 2VH3A 4CEMA 1L5JA 4B0ZA 4JXTA 4B94A 4O6MA 3GODA 5G05J 2OCCC 3TXMA 3S7BA 3VYWA 2VGXB 3LPZA 2BTDA 5KCMA 3GZ2A 1SQMA 5LCWJ 4AE4B 2MOWA 3L08A 4FP7A 1OCZC 2M4EA 4GYOA 1D1BA 3LXUX 2YEVA 3VAYA 5DS6A 1TWCA 3I4RB 2V3CC 2VTBB 2NUTB 4XWJA 4RSYA 5JHBA 2X6IA 5EDSA 3FHEA 1LVKA 2XRHA 4MQ9F 1OUVA 1MMDA 4ANVA 2X51A 3DPDA 2HV7A 3MGBA 1Z5ZA 3TAXA 3CVNA 5CMYA 4G24A 3CEQA 4C3DA 3SNXA 4KNWA 2KCKA 4XLPF 3T6BA 4WNFA 3K33A 5AJLA 4JHJA 4HVBA 2X38A 3JYSA 1LS1A 2X6KA 3I4UA 3ASDA 1H2UA 3VTXA 3PUJA 1TEZA 2LNIA 2XQ0A 2V4LA 2J9QA 3OTNA 2LAHA 3RIBA 1X5BA 1NA0A 4BJ6C 4L7TA 4DK5A 4QI2A 1PD0A 1N52A 4U04A 2KZTA 2M63A 2J46A 4G0HA 2KATA 3E9VA 2YHEA 3FUHA 5E3CA 2KCVA 2I6HA 4GEHA 3B0UX 3G2VA 4AX2A 4OVVA 4I9EA 2UWJG 4GMJA 1FMVA 3CQZA 1TWAA 1MMNA 5G05C 4QDLA 5JJ6A 3NZUA 4XLNF 3CHRA 1ELKA 4XIFA 2MWQA 5KYUA 1FVFA 2WPVA 3CK8A 3FVYA 4PJJA 5LCWC 2Q9BA 1PAQA 4ANJA 4JZYA 4AEZC 5HI7A 3CVYA 5JJTA 2L9JA 4EBAA 3D9NA 4Q4ZF 2RG8A 5G2NA 4FESA 4H4KC 1DNPA 4LCTA 2IONA 4K0DA 2JD3A 4WNDA 5CCLA 3Q5MA 1ZHZA 4DLQA 3MKQA 4M3OA 4TRQA 2YZSA 1MNEA 3TG4A 4E7SA 2PP4A 3UGPA 3F47A 3FUJA 3Q47B 4U5GA 1LF8A 3D9MA 3SZ7A 3RRMB 2C0MA 2XCBA 4ULWA 3DAFA 4PFOA 3MV2B 2J45A 3FUMA 4GZDA 4PJNA 4NACA 5KYNA 2XPYA 3FU0A 4H7XA 3PHF2 4LERA 5E3AA 3AQCA 4IULA 4BWRA 3ASFA 1OWNA 1NU9C 3D9PA 4YN0B 3X2QC 2GGFA 3LS1A 3E70C 1ZU4A 5DS4A 3AG4C 3VLDA 2VASA 3DZAA 5FWQA 2EINC 3MYVA 3CVQA 3C98A 3FY4A 2VSYA 2XPZA 2FFHA 4YT8A 2PQNA 2X6JA 4L2YA 4KZCA 4CS9A 3U66A 4W8KA 2R5SA 4GZ5A 4J8EA 2J7PD 3ENEA 3Q49B 3LVQE 3RFYA 3FULA 2BE5F 2G3VA 3FFLA 2AWIA 5JHAA 5BW8C 3TJPA 2G3KA 3Q7GA 4EPZA 2NC9A 4PJMA 1V54C 3LCAA 4PH4B 5ARFA 3U4TA 2GW1A 2R7WA 1OWOA 4KBQA 4C0MA 2XCCA 3UT7A 4NQ0A 2Y3DA 1M2VA 5FZSA 4APOA 3AG1C 3JCUQ 1ZHYA 5AENA 4NURA 2OVFA 4IAOA 2IQCA 5BV1A 2I8BA 3Q6MA 5L3QA 3DXJF 4C3EA 5CI9A 3ZYKA 4HORA 4UI9J 1WM5A 4DPRA 4ACKA 3FWVA 4WUYA 3EPVA 2Q9CA 2MYSA 4GYYA 5CHEE 4RDAA 3ZG1A 3HVEB 3UT8A 3B13A 4NY3A 3P1UA 3DAGA 2ZXPA 5E76A 3LYAA 3RKOF 2OVBA 5J90A 1E96B 4YT2A 1KT0A 4WNGA 3PMRA 1EYHA 2KZTB 3LY8A 3KEZA 3CHMA 3PUKA 4J8FA 3SEOA 3N0TA 4U0SA 3V7OA 4E85A 3VTYA 3QAQA 5G55A 2BF0X 2W4MA 2CHXA 3SGHA 3AG2C 4Q7CA 2E0IA 3OXGA 3LY7A 1E8XA 1KT1A 3KH2A 2DIWA 1D0YA 4L2LA 3EQLF 5ANRA 4CSAC 3ZXSA 4U5BE 3EH1A 3B7UX 4OIPF 4KMOA 4GU5A 4JJFA 1ZBPA 1Z3XA 3PVLA 3CKCA 3O4ZA 2LSVA 2LO6A 4U5FE 5AIJA 4BJ5C 2YQ8A 3MKQB 3CGHA 3N71A 2J7PA 4YNDA 1VK5A 4UI9C 4AP2A 1Z6AA 1TJCA 2QFCA 3CK9A 4ATGA 3LLIA 4X0RA 3SD5A 4R7LA 3HJCA 5FZRA 4HOUA 3UMVA 4C7OB 3T6JA 4J8DA 3GZ1A 2Y4TA 5D91A 2VSOE 4OD5A 4Y6WA 4ANUA 2XXAB 4UQZA 2Y3HA 3U64A 2AXZA 2WXKA 3E4BA 4RBNA 5C2YA 3QDNA 5EKQD 2R7VA 3ITFA 3FDQA 3APCA 3EG9A 1U3DA 1D1CA 2H7VC 5KYXB 4E7ZA 3ASGA 3ABMC 3X1OA 3WXXA 3LNRA 5BV0A 3T8MA 3SBTB 3ONLA 1PCXA 4KNVA 2WXJA 2WZGA 1XGWA 2HM8A 3EZIA 4XI9A 4Q94A 3P2BA 2L0TB 4CBEA 1HG2A 3RK6A 3QWWA 4JHRA 3PREA 3I5PA 4N3AA 4WWNA 3ZW3A 5BUZA 4A3TA 3L22A 1M56C 1S0PA 5FTPA 2YHSA 4ABNA 3ZPJA 4JHKA 4DVZA 5BUOA 4DOZA 1NG1A 2XHEA 1Z3IX 5T3TA 3CSKA 3EZHA 4P29A 4WNEA 4FA6A 2H7BA 3ML8A 3TGOA 4ILIA 3FP3A 3ASOC 3HTKC 3MX3A 3Q15A 3AG3C 4AM9A 3G2TA 4EWCA 3I4GA 4ILHB 1H2TC 1BR4A 3NYLA 4YT5A 3SP1A 2VGYA 3CIAA 4G11A 2EIKC 1HU3A 2H7OA 1N1CA 3S28A 3RRUA 2WQ6A 4TUUA 1PD1A 5EX0A 3ZEFA 4N39A 3MKRA 4OIOF 4GA2A 4UWLA 2WVIA 2WXNA 1OCCC 3CKBA 2IOQA 3FTYA 1JPJA 3RYLA 5KJKA 3NQPA 3CSFA 4H7YA 4PJLA 4V3IA 1D1AA 1TWHA 1Z23A 4ANXA 2J08A 2LAIA 4CCAA 3NG1A 2V26A 4YWQA 1QQEA 3GZSA 3EGDA 4XE0A 4G1TA 1NA3A 5LP0A 2CG2A 4IN3B 3MCXA 4U63A 4I1MA 2R7TA 1SZAA 3EHMA 4I44A 3K7DA 3ZRHA 5LOZA 1NU7D 3G2WA 5KYWB 4UQXA 2WQHA 2I1KA 3L54A 4EBBA 3UMHA 5T3WA 4G7ZF 1WY6A 4N5CA 3K66A 2X6FA 4AOFA 3LEWA 1NZEA 2J9WA 3ZFWA 2WM9A 2CFZA 4AJWA 4N2QA 4N2SA 3QOUA 1IW7F 2GFHA 3O48A 3ABKC 2PFDA 3VLFA 2EILC 3AS4A 2VQ2A 4J32B 2PZIA 3N24A 4CS8C 3TG5A 2IXMA 4W9RA 3ZHEA 1KLXA 1E8ZA 5E33A 3GYZA 2FO7A 3HYMB 2WZLA 4JZAA 3CHSA 4B8AA 3UR3C 4C0EA 2FULA 3FTVA 2E87A 2J4BA 2JEKA 5CCMA 3QC1A 4P6IC 3U3WA 4GA1A 5LFAA 4I1AA 3L0IA 1QZ2A 5DLJA 3LVRE 1LKXA 2V5FA 3L16A 3K1HA 1JWFA 1ELRA 5T4YA 2FF4A 5IY5C 3JRTA 3CR3A 4RG9A 1ELWA 2ZXOA 2PF4E 3MA5A 3OAWA 4AY5A 1UN8A 1PC2A 2KW3C 4BG0A 3PE3A 5B3SC 3FH8A 4JPSA 2W4BA 2CHWA 1TJFA 3LS8A 2NSZA 4DBQA 4ME2A 1OCRC 5T1DB 3JYHA 2VSXE 4KC9A 3JCKC 4FHKA 3MJWA 4HFKB 1FMWA 3UUXA 2ONDA 2WZFA 3UNGC 2L6JA 2CW0F 4LEUA 1W2WA 3HDXA 2J9VA 3TD7A 2MRIA 1RJ9A 4Q69A 5ENNA 1E8WA 4IRUA 2DCPA 3JQ1A 3ASHA 3KAEA 4EQFA 3BG1B 2KGOA 2L81A 4TV3A 2FI7A 3G2UA 2LSEA 3WODF 2VYIA 2R7QA 5FCLA 3ZIMA 4MS6A 3NRHA 2VJ8A 3ZYQA 4LACB 4JVSA 4B8CB 1JPLA 3W8HA 3SZRA 3LJ3A 2E2EA 1MMGA 4E6HA 2WVQA 2KJGA 2XEVA 1TWGA 2DGJA 4CRWA 1VDYA 4FLBA 4JC8A 1UW4B 4HLEA 2PL2A 3FUKA 2AXVA 4I6EA 5KYYA 1D0ZA 2YNQA 3PS6A 4BX9A 5EGYA 2I1JA 3LKUA 1HO8A 4BJTA 4PUCA 4IWBA 4BEJA 1Y6IA 2D5RB 3D9JA 2EIJC 2X6HA 3PEUB 1VYKA 5FQ8A 2KNHA 3EH2A 4BX8A 4UWFA 2XPIA 5D0QD 1H19A 5DIZA 2Q9AA 4O6YA 2PX3A 2WMNA 3FUFA 4I6GA 2Z15A 3RU0A 2HO1A 4FHJA 3AQBA 5G04J 3B7SA 2I2OA 1IHGA 3T5VA 1Z63A 2A6HF 2Y4UA 3SF4A 5A23A 2VB6A 4PS8A 2A69F 4JL0A 3UGOA 2VGXA 2IYLD 1P5QA 4AE4A 2A5UA 3S2AA 3IHYA 3AS5A 3K1IC 3IEEA 2LSUA 3KS2A 3B0PA 2WXPA 3EGXA 2CDQA 3LS0A 4CDNA 4XKBA 4U5CE 3ZVRA 3ESLA 3SFZA 3GW4A 4KXKB 4BTAA 5KYUB 3RJVA 4UQYA 4OYSA 3MZLB 3BG0B 2WB2A 2Y3GA 3OXFA 4GYWA 3M1CB 2XRYA 4ACLA 3QKYA 4GAAA 4KVMA 5HQ8A 4JJGA 1HH8A 4WAFA 4AY6A 3DJNB 4CS9C 3QARA 3FTXA 4HEAJ 3MLGA 4MRUA 5FQ7A 4KVOA 4I43A 2HR2A 2J07A 4XI0A 2C04A 1OWPA 1IZMA 1ZHWA 5A6CA 4AIFA 5ANLA 1Y8MA 3FU3A 3OA1A 3UMIA 2R7SA 4JA9A 2RD0A 3D9OA 3ZSUA 5G04C 3ZYLA 3CSTA 4U5HA 1QLEC 3SHFA 1WAO1 3S29A 3CVLA 1E7VA 3LY9A 5EX3A 3EJNA 3CHOA 4DI3A 1INZA 4FJYA 2PM7A 1ZHTA 2AW6A 3ULQA 5DQTA 3RH3A 4F4BA 2WXRA 3HIZA 2WMOA 5DQZA 2P7VA 3CVVA 4G23A 1G8XA 3KD7A 2AVPA 4BJ6A 4I3MA 3Q6NA 4PS7A 2OOEA 5DVWA 3Q4AB 5FJYA 1FCHA 4CGVA 1OKKD 4JW1A 4U0UA 3IHVA 3UPVA 2WB7A 4APFA 3UQ3A 1ZHXA 3KKBA 3NF1A 4EECA 3SI5A 2CGEA 4JCHA 2QY7A 4GZ6A 3ZIBA 2IU1A 1BPOA 4GYTA 1UJJA 1M2VB 4LLEA 2KCLA 4DVYP 4U5EE 4AVXA 1NZNA 4ILGA 4JA7A 2IXOA 3K6BA 2Y3AA 3B7TA 4BFRA 2ZXWC 3I5QA 4WWPA 3R7RA 4KYOB 5D92A 4BTBA 2Q7FA 3CVUA 4JURI 3IBEA 3EDTB 4BJ1A 3W2WA 4QI0A 3TXNA 1SZIA 3POVA 2WVNA 4AXHA 2XRZA 3Q7LA 3S7DA 4J8SA 3B7RL 5FQ6A 3QMKA 4RVBA 1SMYF 3DD7A 3S27A 4U5DE 2Q3TA 1NP7A 1O87A 1VMAA 3FH5A 4O7GA 5HSWA 1HX8A 1S7ZA 3NYMA 4HXIA 3VLEA 1HZ4A 1N54A 2YINA 4I2ZA 3W2VA 3CLJA 3QWVA 4BT9A 3PNLB 1WGWA 3NKDA 5T8IA 3EGXB 5FT9A 3FEYA 4J6IA 1FFHA 4YVQC 3CVXA 1HF8A 4FLHA 4K0RA 4AV7A 2J0WA 3QJZA 4BT8A 4RG6A 4KT6B 1IQRA 2R7OA 4CT0A 2CG3A 1OCOC 3NZSA 4OINF 3FDHA 4PDXA 2J49A 3S7FA 3OXLA 2FEZA 4I1OB 3HVEA 4IYPA 5FQ4A 3EIQC 4CIHA 2BUGA 2DYRC 3SYNA 1MQSA 2NXPA 3CVWA 4HFFB 2WXFA 3T4RA 4XX5A 2W9YA 4HE8D 1E7UA 1IQUA 2WXHA 5DBKA 3NYJA 3PNTB 5A7DB 3PZDA 4CDRA 4WWOA 3EFOA 3GANA 3O6XA 1OKKA 1SZ9A 1TKNA 3DBSA 4G7OF 4FX5A 2J0XA 4CDMA 3I3NA 1KU2A 2KC7A 4KBLA 2Y69C 2P6VA 4FC8A 3D9LA 4G2VA 3RIPA 1SF8A 3MV3B 4UWHA 2C0LA 2WXIA 2CNWD 4DI4A 4LLCA 2X3MA 4FWVA 5B1AC 2WL8A 3EG9B 2PX0A 4C9BB 2WXOA 4EBAG 3T5XA 4ANWA 1EPUA 4B89A 1GW6A 3FUDA 3DMDA 4JEHA 4UWKA 1FFTC 2UY1A 4G26A 2XGSA 4EZLA 1EDUA 4A3VA 1HXIA 3LLKA 2XL4A 3CHPA 2R7XA 3D9IA 1DVPA 4CT4A 2WXMA 1OWMA 4A2NB 4GCNA 3H65A 4A1GA 2NUPA 1D0XA 2ILRA 1H6KA 3R7QA 4O79A 2KM4A 3CHQA 3BEEA 5CI8A 3FTUA 4XKCA 4C7OA 3S0XA 5BNWA 3U9WA 5AYWD 2XXAA 3DM9B 2R17C 2XGMA 4G7HF 3ML9A 3ECSA 1M57C 2IXPA 1MHQA 3OWTA 4FU3A 4PK4A 2CHZA 2W45A 3D3MA 3CQGB 3JUIA 4N3BA 1A17A 5T3RA 4YT4A 2IJGX 2XGOA 4CSAA 3F46A 1ST6A 2IOSA 4JEUA 3ONKA 5KYXA 2R7UA 4K7BA 3R9AB 4DLOA 2WVOA 2V0PA 5M72A 4K03A 4BJ5A 4GB9A 2A4ZA 5B1BC 5CMWA 4HOSA 3RKVA 2PM6A 1FTSA 4CS7A 1JWGA 4URKA 1H2VC 3ESKA 4GZCA 3FHDA 2OG2A 2IOLA 3EGDB 5C1DA 4DBRA 4FULA 4PFPA 3LJBA 4I6JA 1E8YA 3W8IA 2Y3BA 3AS8A 2GRLA 2WXGA 4F7AA 2YHCA 5KJNA 1O5HA 4OIQF 4YVOA 3FUIA 3NKEA 2C2LA 5F5FA 4XZ4A 2R59A 3TL5A 4GCOA 1VYIA 1J8MF 5L3VA 4KI2A 1VOMA 4FADA 3PDNA 3PH0C 4MNDA 4GPKA 5LX8A 2WQ7A 3L13A 4U8HA 2G62A 2CNWA 5KJMA 2WXLA 2PQRA 4HFGA 4U0ZA 2QY9A 1QNFA 2EIMC 3HLZA 3K9IA 4OD4A 3FU6A 4O6NA 3FUEA 3CZ6A 3SBSA 3DJUB 2B0JA 3CK7A 4NRHB 4GA0A 3LESA 3UX4A 3APFA 3ZN3A 4DJAA 3KL4A 5J08A 4PS3A 5KJLA 4F1SA 3QWPA 3JQ0A 3CQCB 3KMIA 3LEVA 5D0OD 2ZPAA 1B89A 4MLPA 4Y6CA 2EQXA 5EHHA 3ZHEB 1Z3YA 3ASNC 1H0AA 3JSZA 3HHMA 1OWLA 1W3BA 1ZU2A 2ZU6B 3EFOB 4L1BA 2NG1A 3AU4A 4Q96A 3IV0A 2VTBA 2NUTA 3QZCA 2XSEA 2OV8A 3LDZA 4GZ3A 2CFUA 4A1SA 3FEXA 2HYZA 4YJWA 2IF4A 4I2WA 1V55C 3FU5A 4M63A 5DS5A 2IFUA 4RD9A 3FH7A 4XTKA 5KYWA 1XNFA 3MEKA 4LUNU 4I9CA 1U3CA 2MHKA 2Y39A 4BSXA 3B0VC 2R7RA 3PEVB 4Q5SF 3APDA 2O9XA 4I17A 1PY1A 4QFVA 1BR2A 3QK0A 3OEOA 4BY6A 4C3BA 3JT1A 3IEGA 1JPNA 3NDBB 4EZJA 4KZ0A 2UY1B 3EIJA 1M2OA 4IJJA 5E75A 3IKOB 5JJ7A 3FTZA 2A68F 2I9CA 4HS2A 3L17A 1UJKA 5E2QA 2AXUA 1EF1C 2NUPB 4WJ0A 2DBAA 2HV6A 3FTSA 3CVPA 3RO2A 4OVUA 4J30B 5AJDA 4HOQA 4UI9K 3ZVVA 3PE4A 2FBNA 3FAJA 2C03A 4ZLCA 4UWGA 1IYGA 2WXQA 3EHNA 2A6EF 4L23A 3RRNB 3SNHA 3LAYA 1YA0A 3WG7C 1Z6TA 5FZQA 1RJ9B 4MKTA 3CV0A 1JUQA 2JLBA 1ZU5A 2A1DD 4GMLA 1BR1A 1QZXA 2J4DA 2P58C 5ARGA 4CGWA 4EZKA 3O39A 3URZA 2VSNA 2J9UA 4LRZA 2KQ9A 4F53A 3FUNA 4G25A 1UN9A 4CS8A 1HG5A 3ZYMA 2IXNA 3L6AA 4HOTA 3D9KA 2L0IA 2L9BA 5BT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYV A;  3SNX A;  3FDH A;  3P1U A;  3I4G A;  3NQP A;  4PUC A;  3CKC A;  3EHN A;  3HDX A;  5FQ4 A;  5E76 A;  4L7T A;  5T4Y A;  4Q69 A;  3MCX A;  4F53 A;  4LER A;  5J90 A;  3CGH A;  3EJN A;  5FQ8 A;  3CK7 A;  3QNK A;  3JQ1 A;  5T3R A;  3EHM A;  3JYS A;  3LEW A;  3IV0 A;  5FQ6 A;  5LX8 A;  3CK8 A;  3SGH A;  3CK9 A;  3CKB A;  3L22 A;  4MRU A;  4F7A A;  3MX3 A;  5FQ7 A;  5E75 A;  3GZS A;  3OTN A;  3JQ0 A;  3KEZ A; 
#chains in the Genus database with same CATH topology
 1NFN A;  4N06 A;  2J09 A;  3HG0 D;  3U8V A;  2UUI A;  2ETA A;  4X8Q A;  1HE8 A;  5BPP A;  3NBN B;  2P9K G;  3ZTZ A;  3B9Q A;  1UG3 A;  4OIR F;  3ZC4 A;  4A55 A;  4N5Q A;  3ABL C;  4U07 A;  3QB2 A;  2ZXR A;  4AL0 A;  2QTV A;  2DYS C;  3GEH A;  4ULV A;  3QNK A;  3TWT A;  1MND A;  3UMK A;  4F3V A;  3ZGQ A;  2XM0 A;  3AU5 A;  3N2Z B;  2XEN A;  1Z5S C;  2V8S E;  4N3C A;  2QLA A;  1MMA A;  3G2S A;  4EKW A;  4EBJ A;  2DVW A;  1ZYR F;  5GPG B;  1J8Y F;  5KYY B;  1QQ3 A;  3O55 A;  3HRA A;  4GTS A;  1TR2 A;  1E90 A;  3DM5 A;  1H6O A;  1BDJ B;  1FVH A;  1K3Z D;  1OXK A;  3RO3 A;  2NSF A;  2FGY A;  3PRZ A;  3L34 A;  5F5H A;  1BLX B;  3S7J A;  4AK9 A;  4O6F A;  1HS6 A;  4FJZ A;  2QNL A;  2JAB A;  4G78 A;  3UT4 A;  5KNG A;  3IQC A;  3FTW A;  4D10 C;  3HNJ A;  5HS0 A;  4ZLD A;  1NI1 A;  1FAP B;  2GRM A;  4J0U A;  4B6I A;  4EIY A;  1HFA A;  1HE9 A;  3RF3 A;  3PDM P;  2VH3 A;  3V5X A;  3TWW A;  5EK0 A;  2P1A A;  1ORS C;  2BED A;  2HKV A;  4CEM A;  1L5J A;  4YDO A;  4B0Z A;  3DSV A;  4CDV A;  4JXT A;  4B94 A;  4O6M A;  2LXM A;  3GOD A;  5G05 J;  4YK5 A;  2EIJ E;  2OCC C;  3KEA A;  1CGM E;  3TXM A;  3S7B A;  1CPR A;  3VYW A;  5BXU A;  3KSQ A;  2VGX B;  3ZWI A;  2BTD A;  3LPZ A;  5KCM A;  3GZ2 A;  3US6 A;  1SQM A;  4AE4 B;  5LCW J;  2MOW A;  3L08 A;  4FP7 A;  1OCZ C;  2J8S D;  2M4E A;  4GYO A;  1D1B A;  3LXU X;  2KXP C;  2YEV A;  3VAY A;  2YWA A;  3O10 A;  4CIP A;  5DS6 A;  1TWC A;  3CEX A;  3I4R B;  2V3C C;  2VTB B;  2NUT B;  2F0Y A;  2XLE A;  4XWJ A;  4RSY A;  5JHB A;  5H7P A;  2X6I A;  1I4Y A;  5AGF A;  5EDS A;  3FHE A;  1LVK A;  1MYO A;  2XRH A;  4MQ9 F;  1OUV A;  1MMD A;  4ANV A;  3DST A;  2X51 A;  3RQG A;  3C8G D;  4N6C A;  3DPD A;  2HV7 A;  3MGB A;  1Z5Z A;  3TAX A;  3CVN A;  5CMY A;  4G24 A;  3CEQ A;  2GWW A;  4C3D A;  1TFK B;  3UM1 A;  3SNX A;  4KNW A;  2KCK A;  3LUT B;  4XLP F;  3H2U A;  1BD8 A;  3T6B A;  4WNF A;  3K33 A;  5AJL A;  3AG2 E;  4JHJ A;  4HI8 A;  3R2P A;  1OXJ A;  4HVB A;  2X38 A;  3JYS A;  1LS1 A;  2X6K A;  3DRA A;  4IB4 A;  1SW6 A;  3I4U A;  1E84 A;  2F8Y A;  1H2U A;  3ASD A;  3VTX A;  3PUJ A;  1TEZ A;  2LNI A;  2XQ0 A;  2V4L A;  2J9Q A;  3OTN A;  2LAH A;  1HW2 A;  1TNY A;  4F6R D;  3RIB A;  1YCS B;  2F8X K;  1X5B A;  1NA0 A;  4BJ6 C;  1JCR A;  4RLY A;  4L7T A;  2RFA A;  4DK5 A;  4QI2 A;  1PD0 A;  1N52 A;  4U04 A;  2KZT A;  2M63 A;  1G4W R;  1I4Z A;  2J46 A;  4G0H A;  1N4S A;  2KAT A;  3E9V A;  2YHE A;  1GS9 A;  3FUH A;  5E3C A;  2KCV A;  2I6H A;  4GEH A;  3B0U X;  3G2V A;  4AX2 A;  4ATZ D;  4OVV A;  3RSE G;  4I9E A;  4LDQ A;  2UWJ G;  1VB5 A;  1OR2 A;  4GMJ A;  1FMV A;  4GQH A;  3CQZ A;  1TWA A;  3IQ5 A;  1MMN A;  2IM8 A;  1N0R A;  1M6T A;  5G05 C;  4QDL A;  3Q9N C;  5JJ6 A;  3NZU A;  1S63 A;  4XLN F;  3CHR A;  1ELK A;  4XIF A;  2MWQ A;  5KYU A;  1FVF A;  2WPV A;  3CK8 A;  3PZ1 A;  2OU6 A;  4E17 A;  3FVY A;  4PJJ A;  5LCW C;  2Q9B A;  1PAQ A;  4ANJ A;  1WAT A;  4JZY A;  4AEZ C;  1R4T A;  5HI7 A;  1SVX A;  3CVY A;  4K5B A;  5JJT A;  2L9J A;  4EBA A;  3D9N A;  3HXB A;  2OEX A;  3G50 A;  4Q4Z F;  2RG8 A;  5AAO A;  1DOV A;  5G2N A;  4FES A;  4H4K C;  1DNP A;  4LCT A;  4PR9 A;  3L9T A;  2ION A;  4K0D A;  2JD3 A;  5A69 A;  4WND A;  5CCL A;  3Q5M A;  4DJ9 A;  1ZHZ A;  3DEP A;  4DLQ A;  3MKQ A;  4M3O A;  3H2V A;  4TRQ A;  2YZS A;  1E83 A;  2YLG A;  1MNE A;  3K1I A;  2PBE A;  3TG4 A;  4E7S A;  2PP4 A;  3UGP A;  3F47 A;  3FUJ A;  3Q47 B;  4U5G A;  1MQV A;  1LF8 A;  3D9M A;  3SZ7 A;  3B95 A;  3RRM B;  3L1M A;  2C0M A;  2DZO A;  2QYJ A;  2XCB A;  2A0B A;  3ZTM A;  1KPS B;  4ULW A;  3L8I A;  3DAF A;  2AJA A;  4PFO A;  2V4H C;  3MV2 B;  5L0J A;  2J45 A;  3FUM A;  4GZD A;  4PJN A;  1T01 A;  4NAC A;  1FT1 A;  5KYN A;  3B71 A;  2XPY A;  3TJ6 A;  3C72 A;  3Q7F A;  3FU0 A;  1O1T A;  4H7X A;  3PHF 2;  4D4N A;  2HUJ A;  4DXW A;  1EA8 A;  4LER A;  5E3A A;  4BEP A;  2DB4 A;  3AQC A;  3FOP A;  1YMP A;  2IBF A;  2LQG A;  3ASF A;  2NPU A;  2Y1L E;  2R2L A;  4IUL A;  3V2O A;  1OWN A;  1NLX A;  1NU9 C;  3D9P A;  4YN0 B;  3X2Q C;  2GGF A;  3LS1 A;  3E70 C;  1ZU4 A;  5DS4 A;  3AG4 C;  3VLD A;  2VAS A;  1K05 A;  4U9D A;  3GEE A;  3DZA A;  1LD8 A;  2LP4 A;  5FWQ A;  2EIN C;  3MYV A;  1RKE A;  3CVQ A;  4MVS A;  1DCQ A;  3C98 A;  3HNI A;  3V2X A;  3FY4 A;  2VSY A;  2XPZ A;  3TOM A;  2FFH A;  4Z9J A;  5FZT A;  4DRI B;  4YT8 A;  2PQN A;  2X6J A;  3S84 A;  3C8G A;  4JEA A;  5L0F A;  4L2Y A;  4KZC A;  4CS9 A;  3U66 A;  4W8K A;  2R5S A;  2DI3 A;  2H6F A;  4O1O A;  4GZ5 A;  5EID A;  4J8E A;  2J7P D;  3ENE A;  3Q49 B;  1YA7 O;  1NBB A;  3LVQ E;  4HB5 A;  3RFY A;  3FUL A;  2BE5 F;  2G3V A;  3FFL A;  3TUL A;  2AWI A;  5JHA A;  5BW8 C;  3TJP A;  2G3K A;  3Q7G A;  4EPZ A;  2NC9 A;  4PJM A;  1V54 C;  3J5P A;  1XWJ A;  3TQO A;  3LCA A;  4PH4 B;  3KYI A;  5ARF A;  3U4T A;  2GW1 A;  2R7W A;  2XLM A;  1OWO A;  1R5I D;  4KBQ A;  1JMW A;  5KWD A;  4F1P A;  4C0M A;  2XCC A;  3UT7 A;  4NQ0 A;  1A7D A;  2Y3D A;  1M2V A;  4C48 B;  3TK0 A;  5FZS A;  4APO A;  2ETB A;  3AG1 C;  1TN8 A;  1VLS A;  3JCU Q;  1ZHY A;  5AEN A;  4NUR A;  2OVF A;  3FOO A;  1BZ4 A;  1WDY A;  1TNB A;  3TWU A;  4IAO A;  1JR8 A;  1XZQ A;  3V30 A;  1GGQ A;  4HNA D;  2IQC A;  5BV1 A;  2I8B A;  3Q6M A;  5L3Q A;  3DXJ F;  4W8P A;  4C3E A;  5CI9 A;  4GPM A;  4TUM A;  3ZYK A;  4HOR A;  2AWY A;  1K8K G;  4UI9 J;  1WM5 A;  4DPR A;  4ACK A;  3HXE A;  3FWV A;  2P9S G;  4WUY A;  3EPV A;  2Q9C A;  1NFO A;  2MYS A;  4GYY A;  5CHE E;  1H6G A;  4U8Y D;  4RDA A;  2R02 A;  3ZG1 A;  2OEV A;  3HVE B;  1K1B A;  1N4Q A;  1TNZ A;  3UT8 A;  5CEC B;  3DSS A;  3B29 A;  3ZU7 B;  3B13 A;  1ZW3 A;  3IQT A;  3WAQ A;  4CDY A;  4NY3 A;  3P1U A;  3UTM A;  2H6H A;  4UDV A;  3DAG A;  1Q0M A;  2ZXP A;  5E76 A;  3LYA A;  3RKO F;  5JVE A;  1QPU A;  1OCO E;  2OVB A;  4TXP A;  5J90 A;  1E96 B;  1B68 A;  4U95 D;  3AJM A;  3C3R A;  1OXB A;  4YT2 A;  3G4Z A;  4JCZ A;  1N11 A;  2Q00 A;  1KT0 A;  3Q9U C;  2DYR E;  1DC2 A;  4WNG A;  1OQC A;  3PMR A;  2FO1 E;  1VLT A;  1EYH A;  2KZT B;  3C8Z A;  3LY8 A;  2BKK B;  3KEZ A;  4G8K A;  3CHM A;  1K04 A;  1T6I A;  1AEP A;  3PUK A;  4J8F A;  3SEO A;  5CEA A;  3TWR A;  3IHU A;  2L6H A;  3N0T A;  4U0S A;  3V7O A;  4E85 A;  1N4P A;  3VTY A;  3QAQ A;  2R03 A;  5G55 A;  3NB2 A;  2YQY A;  2BF0 X;  3QVY A;  2W4M A;  2CHX A;  3SGH A;  3AG2 C;  4MTF A;  4Q7C A;  2E0I A;  3TWQ A;  3OXG A;  3LY7 A;  3ZXP A;  1E8X A;  1KT1 A;  5BXO A;  4BER A;  5EYP F;  3KH2 A;  2DIW A;  1D0Y A;  2Y69 E;  4L2L A;  2LK4 A;  3EQL F;  5B3I A;  5ANR A;  4CSA C;  3ZXS A;  4U5B E;  2XZD G;  3EH1 A;  3B7U X;  3ISM C;  4OIP F;  4KMO A;  1H9T A;  4GU5 A;  4BES A;  4JJF A;  1ZBP A;  5IY5 E;  1Z3X A;  1OW6 A;  1YZC A;  4YL0 A;  3PVL A;  3CKC A;  3SXY A;  3TWS A;  2IO3 C;  3MYI A;  2F22 A;  3O4Z A;  2LSV A;  1H6P A;  1MZC A;  2LO6 A;  2KYH A;  4U5F E;  4LNU D;  5AIJ A;  4BJ5 C;  2YQ8 A;  3MKQ B;  1U89 A;  3CGH A;  3N71 A;  2J7P A;  4YND A;  2LFD A;  1VK5 A;  1ZVZ A;  4UI9 C;  4AP2 A;  1Z6A A;  1TJC A;  2QFC A;  1WG0 A;  3CK9 A;  4A63 B;  4ATG A;  4YDE A;  1N4R A;  3LLI A;  4X0R A;  3SD5 A;  4R7L A;  3HJC A;  4JIO A;  5FZR A;  4HOU A;  3UMV A;  4C7O B;  4FAP B;  4BWR A;  3T6J A;  4J8D A;  3GZ1 A;  2Y4T A;  2P9L G;  5D91 A;  2VSO E;  4OD5 A;  4Y6W A;  4ANU A;  2XXA B;  2D4U A;  4UQZ A;  2Y3H A;  3U64 A;  4NTA A;  2AXZ A;  2WXK A;  2I15 A;  3RQE A;  3E4B A;  3ZNG A;  4DX6 D;  1X81 A;  4RBN A;  5C2Y A;  3QDN A;  5EKQ D;  2JX0 A;  2R7V A;  3ITF A;  3FDQ A;  3APC A;  4DX2 A;  3EG9 A;  1LM3 B;  1U3D A;  1D1C A;  1RZ4 A;  3SXZ A;  2H7V C;  1RKE B;  5KYX B;  4E7Z A;  5F28 E;  3ASG A;  3ABM C;  3X1O A;  3WXX A;  3UIN C;  3LNR A;  5BV0 A;  3T8M A;  1Q0F A;  3SBT B;  4G8L A;  3ONL A;  1PCX A;  1V4A A;  3U8P A;  1SA5 A;  3NOC D;  4KNV A;  2WXJ A;  3M79 A;  2YL0 A;  2WZG A;  2BC5 A;  3PZ3 A;  1XZP A;  1XGW A;  2HM8 A;  4AL1 A;  3EZI A;  4XI9 A;  4Q94 A;  2V5Q C;  3P2B A;  4N6H A;  1OW7 A;  4CBE A;  2L0T B;  5AQ7 A;  1HG2 A;  2XS1 A;  3RK6 A;  3PZ4 A;  3QWW A;  4JHR A;  3SFX A;  2HE0 A;  3PRE A;  3I5P A;  1Q2Z A;  3W9F A;  4N3A A;  4WWN A;  3ZW3 A;  5BUZ A;  3CAX A;  3JYY A;  3L22 A;  4A3T A;  1YZA A;  1M56 C;  1S0P A;  5FTP A;  1FT2 A;  2YHS A;  1BI8 B;  5B1B E;  3MBG A;  3ZPJ A;  4ABN A;  4JHK A;  4JTA B;  4DVZ A;  2KK1 A;  5BUO A;  2RSE B;  3RVY A;  4DOZ A;  2EPL X;  3F6Q A;  1NG1 A;  2XHE A;  3LNM B;  1Z3I X;  1ZZP A;  3CSK A;  3EZH A;  5T3T A;  4P29 A;  3UM0 A;  1MX4 A;  4WNE A;  3ULE G;  4FA6 A;  2H7B A;  3GM2 A;  3LJN A;  1H7I A;  3ML8 A;  3TGO A;  4QQI A;  4ILI A;  3FP3 A;  1OW8 A;  3ASO C;  3HTK C;  3MX3 A;  3Q15 A;  3AG3 C;  4AM9 A;  3IPM O;  1TN6 A;  3G2T A;  4EWC A;  3I4G A;  4ILH B;  1H2T C;  1BR4 A;  4D4X A;  3NYL A;  1UG7 A;  1UOH A;  2GDC A;  4YT5 A;  3SP1 A;  2XM4 A;  3C18 A;  2VGY A;  3CIA A;  4G11 A;  2EIK C;  1HU3 A;  2H7O A;  3MFN A;  4LG6 A;  1HMO A;  5K0I A;  1N1C A;  5AN8 A;  3S28 A;  3RRU A;  2WQ6 A;  4TUU A;  1PD1 A;  5EX0 A;  3ZEF A;  4N39 A;  3MKR A;  4OIO F;  4GA2 A;  4XEK A;  4UWL A;  3HXF A;  2WVI A;  2WXN A;  1OCC C;  3CKB A;  4JRZ A;  2IOQ A;  3PZ2 A;  2LFF A;  2ZIS A;  2MHR A;  2XL6 A;  3FTY A;  1JPJ A;  1QKR A;  2XLV A;  3RYL A;  5KJK A;  3IXE A;  3CSF A;  3NQP A;  5ITZ F;  4H7Y A;  4PJL A;  4V3I A;  1D1A A;  1TWH A;  1Z23 A;  4ANX A;  2OJQ A;  1T9K A;  2J08 A;  2LAI A;  2LXL A;  2P9I G;  4CCA A;  3NG1 A;  1MX2 A;  2EIM E;  5EIB E;  2V26 A;  4YWQ A;  2B6C A;  1QQE A;  3C62 A;  4MVR A;  3GZS A;  3EGD A;  2F37 A;  4XE0 A;  4MW8 A;  4G1T A;  1U0B B;  1NA3 A;  4BSZ B;  3E32 A;  3NMJ A;  5LP0 A;  4GTP A;  4WGY A;  2CG2 A;  3MCX A;  1TN7 A;  4IN3 B;  4U63 A;  4I1M A;  2R7T A;  3BUA A;  5L0I A;  1SZA A;  3EHM A;  4Z9H A;  4I44 A;  3A11 A;  3DXK G;  2P0N A;  2B0O E;  3K7D A;  1YDI A;  4DRX E;  2J8W A;  3ZRH A;  1G5Z A;  5LOZ A;  1NU7 D;  3G2W A;  3AOU A;  3Q78 A;  5KYW B;  3DXM G;  4GTQ A;  4UQX A;  4BEM J;  5JMN D;  3E37 A;  2WQH A;  2I1K A;  3DWW A;  1EKY A;  3L54 A;  1AP7 A;  2ASR A;  4EBB A;  1QYM A;  3UMH A;  5T3W A;  1YVI A;  4G7Z F;  1WY6 A;  3K66 A;  2X6F A;  4N5C A;  4AOF A;  3LEW A;  4NTB A;  4DX5 D;  2LIG A;  2RFM A;  1V55 E;  1NZE A;  2J9W A;  3ZFW A;  4HRM B;  3J06 A;  2WM9 A;  2CFZ A;  4AJW A;  4N2Q A;  1YYH A;  4N2S A;  3L8J A;  1IW7 F;  2GFH A;  3ABK C;  3O48 A;  3QOU A;  4GMR A;  4TXQ A;  2PFD A;  3VLF A;  2EIL C;  3AS4 A;  4P9T A;  2VQ2 A;  4J32 B;  3U3F A;  5EYL A;  4HI9 A;  2PZI A;  4MVO A;  3QW1 A;  3N24 A;  4CS8 C;  3TG5 A;  2IXM A;  1GM5 A;  2HS5 A;  4W9R A;  5AQ9 A;  3ZHE A;  4UUC A;  1Q0K A;  1KLX A;  2EPO A;  1E8Z A;  5E33 A;  3GYZ A;  2FO7 A;  3HYM B;  2WZL A;  4JZA A;  3CHS A;  4B8A A;  2Q4F A;  3EU5 A;  1CGN A;  4MTO A;  3UR3 C;  4C0E A;  2P9N G;  1TFO B;  2FUL A;  2HFI A;  3FTV A;  2E87 A;  4DUI A;  2J4B A;  1LE4 A;  2JEK A;  5CCM A;  3C7J A;  4E0H A;  1APC A;  3QC1 A;  4P6I C;  3U3W A;  4MVQ A;  1N95 A;  2PNN A;  4GA1 A;  1LI7 A;  5LFA A;  5AQB A;  3C3O A;  1RCP A;  1ZW2 A;  2YKZ A;  2YRF A;  1TNO A;  4I1A A;  3L0I A;  1QZ2 A;  5DLJ A;  3LVR E;  1A5E A;  1LKX A;  1AVO B;  2V5F A;  3L16 A;  3K1H A;  1JWF A;  1ELR A;  3DPY A;  3DSU A;  2GRQ B;  5T4Y A;  4LDK A;  2FF4 A;  5IY5 C;  3FXH A;  3EU9 A;  3JZ0 A;  3JRT A;  5HRY A;  3CR3 A;  3HXC A;  4K5A B;  4RG9 A;  1ELW A;  3FAP B;  1WAS A;  5FIN A;  1GQA A;  4XPW A;  2BKG A;  2ZXO A;  1JRA A;  3WG7 E;  2PF4 E;  3MA5 A;  3OAW A;  4AY5 A;  1UN8 A;  3DI5 A;  1PC2 A;  4TXR A;  2KW3 C;  4BG0 A;  1LD7 A;  3PE3 A;  5B3S C;  3FH8 A;  4JPS A;  2W4B A;  2XLO A;  3GM1 A;  4U7E B;  2CHW A;  1TJF A;  2HSB A;  3LS8 A;  2HJM A;  4NQF A;  2NSZ A;  4HLL A;  1FNT c;  4HQD A;  4DBQ A;  2Y0B G;  1E85 A;  4ME2 A;  1H9G A;  5AAR A;  2KSF A;  5AQA A;  1AUE A;  3U5S A;  1OCR C;  1L3P A;  1LPE A;  5T1D B;  2OOC A;  3JYH A;  2VSX E;  4KC9 A;  5CIV A;  1TYQ G;  3JCK C;  4FHK A;  3MJW A;  4HFK B;  1S70 B;  3U2L A;  1FMW A;  4ZHB A;  4GTO A;  1LE2 A;  3UUX A;  2OND A;  2PNO A;  2WZF A;  3UNG C;  2HSQ A;  2L6J A;  2CW0 F;  3SXK A;  2DYS E;  3C3Q A;  4LEU A;  256B A;  1W2W A;  3HDX A;  2J9V A;  3TD7 A;  4ER9 A;  2RKK A;  2MRI A;  1RJ9 A;  4Q69 A;  1E2X A;  3U0C A;  5ENN A;  1E8W A;  4IRU A;  2ZXW E;  1OT8 A;  2DCP A;  3JQ1 A;  3ASH A;  3ZQV A;  3AAA C;  2VCC A;  3KAE A;  4EQF A;  3BG1 B;  2KGO A;  2L81 A;  2LCH A;  4TV3 A;  2FI7 A;  3G2U A;  3NAW A;  2LSE A;  4DRJ B;  3WOD F;  2VYI A;  2R7Q A;  5FCL A;  4N4W A;  3ZIM A;  4MS6 A;  3NRH A;  2VJ8 A;  3ZYQ A;  4Z68 A;  1UFB A;  4LAC B;  4JVS A;  4B8C B;  1JPL A;  4MVU A;  5KNH D;  3W8H A;  3QW0 A;  3SZR A;  3LJ3 A;  2E2E A;  1MMG A;  1RXQ A;  4E6H A;  3KSL A;  2WVQ A;  2KJG A;  2XEV A;  1TWG A;  2DGJ A;  1IXV A;  4CRW A;  1S05 A;  1VDY A;  4FLB A;  4JC8 A;  1UW4 B;  2P9U G;  4HLE A;  2PL2 A;  3FUK A;  3Q75 A;  2AXV A;  4I6E A;  1HW1 A;  3UM3 A;  4IAR A;  2EPM X;  5KYY A;  2AU5 A;  2R05 A;  1D0Z A;  4JKV A;  2YNQ A;  3PS6 A;  4BX9 A;  5EGY A;  3J5Q B;  1OCZ E;  2I1J A;  3LKU A;  1HO8 A;  4BJT A;  2VGE A;  4PUC A;  2AVK A;  1EI7 A;  4IWB A;  1K40 A;  1HE1 A;  4BEJ A;  1Y6I A;  5ENT D;  2D5R B;  3TJ5 A;  3D9J A;  2EIJ C;  2X6H A;  3PEU B;  1VYK A;  5FQ8 A;  2KNH A;  1O3U A;  3EH2 A;  3U9J A;  5ENQ D;  4BX8 A;  1SR2 A;  4UWF A;  2XPI A;  5D0Q D;  1H19 A;  2GRP B;  5DIZ A;  2Q9A A;  4O6Y A;  2PX3 A;  2WMN A;  3FUF A;  4I6G A;  2Z15 A;  3RU0 A;  3W4Y A;  2HO1 A;  1JAF A;  4FHJ A;  3AQB A;  5G04 J;  4A4A A;  3B7S A;  3DEO A;  3DE8 A;  2I2O A;  1IHG A;  3T5V A;  1Z63 A;  2A6H F;  2Y4U A;  3SF4 A;  5A23 A;  2VB6 A;  5FIO A;  4PS8 A;  2A69 F;  4MS2 A;  1O5M A;  4JL0 A;  4Z9I A;  4JEB A;  3UGO A;  4ZFH A;  2VGX A;  4MBG A;  2IYL D;  1FPP A;  1P5Q A;  4AE4 A;  1VTM P;  2A5U A;  3S2A A;  3IHY A;  3NOG D;  3AS5 A;  3K1I C;  3IEE A;  5JP7 A;  4CZ2 D;  2AWC A;  3S90 A;  2LSU A;  1TQG A;  3KS2 A;  3B0P A;  5ENS D;  2WXP A;  3A9C A;  3V5Z A;  3EGX A;  2QZA A;  2R25 A;  2CDQ A;  3LS0 A;  4CDN A;  4XKB A;  3JSE O;  4U5C E;  3ZVR A;  3ESL A;  2AP3 A;  3SFZ A;  2ICW G;  3GW4 A;  4KXK B;  4BTA A;  5KYU B;  5JLI A;  3RJV A;  4JTD B;  4UQY A;  4CJO A;  4OYS A;  1NSG B;  2QUP A;  3BG0 B;  3MZL B;  2P2C P;  2WB2 A;  2Y3G A;  3OXF A;  4GYW A;  3M1C B;  2XRY A;  2FAP B;  1BBH A;  4ACL A;  3TWX A;  3QKY A;  3EHR A;  3AJI A;  4GAA A;  4KVM A;  1RKC A;  5AC4 A;  5L0G A;  5B1A E;  3U3B A;  3TWV A;  5HQ8 A;  1IKN D;  2NSG A;  4JJG A;  1HH8 A;  4WAF A;  4AY6 A;  3DJN B;  4CS9 C;  3D9H A;  3QAR A;  1K1A A;  3UM2 A;  2YLD A;  5EIL A;  4H54 A;  3FTX A;  4HEA J;  3MLG A;  4MRU A;  1I5N A;  1Q0G A;  1N94 A;  5FQ7 A;  4DRH B;  4KVO A;  4I43 A;  2HR2 A;  5CBO A;  2J07 A;  4XI0 A;  1F1M A;  2C04 A;  1OWP A;  1KZO A;  1IZM A;  1ZHW A;  5A6C A;  4AIF A;  5ANL A;  3GM3 A;  1Y8M A;  3T8K A;  3KPH A;  3FU3 A;  1C02 A;  5ENO D;  5HV9 A;  3OA1 A;  3UMI A;  2R7S A;  4JA9 A;  2RD0 A;  3D9O A;  2MYO A;  3ZSU A;  5G04 C;  3ZYL A;  2ZD9 A;  3QTH A;  3CST A;  4U5H A;  3ZDL A;  1QLE C;  3T9K A;  3SHF A;  1WAO 1;  3S29 A;  3U9M A;  2XZT G;  3ULY A;  1NFI E;  2HMQ A;  1L7C A;  3CVL A;  5ENR D;  2L6G A;  1E7V A;  3LY9 A;  5EX3 A;  3EJN A;  5JUA A;  3CHO A;  4DI3 A;  1INZ A;  4FJY A;  2PM7 A;  1ZHT A;  2AW6 A;  3ULQ A;  5DQT A;  1CGO A;  3UI2 A;  3RH3 A;  4F4B A;  3C8G B;  4CYM D;  4MVZ A;  2WXR A;  3HIZ A;  1HY5 A;  2HJ3 A;  2WMO A;  5DQZ A;  4JD2 G;  2P7V A;  3CVV A;  4G23 A;  1G8X A;  3KD7 A;  3X2Q E;  5A6B D;  2AVP A;  4O1P A;  4BJ6 A;  3T9O A;  3AG4 E;  4I3M A;  4EHP A;  2M64 A;  3Q6N A;  3R7C A;  4PS7 A;  2OOE A;  5DVW A;  1G3N B;  2EIN E;  3Q4A B;  5FJY A;  1CPQ A;  1FCH A;  3GOR A;  4CGV A;  1OKK D;  2QYU A;  1NL4 A;  4JW1 A;  4U0U A;  3IHV A;  3UPV A;  2WB7 A;  4APF A;  3UQ3 A;  4XEV A;  1ZHX A;  3KKB A;  3NF1 A;  4EEC A;  4R32 A;  3SI5 A;  2OKU A;  2CGE A;  4JCH A;  2QY7 A;  4GZ6 A;  3ZIB A;  2IU1 A;  1BPO A;  4GYT A;  1UJJ A;  1M2V B;  4LLE A;  3BU8 A;  3NMK A;  2KCL A;  4DVY P;  4U5E E;  4AVX A;  2OJE D;  1NZN A;  1Q0D A;  4ILG A;  2KC3 A;  4JA7 A;  2IXO A;  3JUE A;  3K6B A;  2Y3A A;  1V54 E;  3L82 A;  3B7T A;  4BFR A;  2ZXW C;  3SXM A;  3I5Q A;  4YL1 A;  4WWP A;  1DOW A;  3R7R A;  1EQ1 A;  4KYO B;  5D92 A;  3VM6 A;  3SO8 A;  4BTB A;  3AG1 E;  3GWL A;  2Q7F A;  4YDY A;  4CJG A;  1HMD A;  1D8E A;  2XEE A;  4MVM A;  3CVU A;  4YL3 A;  3BRJ A;  4JUR I;  3IBE A;  3EDT B;  2P9P G;  5TJ5 E;  5CBN A;  4BJ1 A;  3W2W A;  4QI0 A;  3TXN A;  2VCA A;  3U2M A;  1SZI A;  3POV A;  2WVN A;  3E33 A;  4J7W A;  3VRC A;  4AXH A;  3DKA A;  2XRZ A;  2QC9 A;  3FMS A;  5A6A A;  3Q7L A;  3S7D A;  4J8S A;  1YJG A;  5L0D A;  3B7R L;  3E30 A;  5FQ6 A;  3QMK A;  1Z7Q c;  1D9S A;  4RVB A;  1SMY F;  5ENP D;  3DD7 A;  2L6B A;  3S27 A;  4U5D E;  4NCQ A;  3ATP A;  1C17 M;  2Q3T A;  1NP7 A;  4P9F A;  1T5O A;  3NMI A;  1O87 A;  1VMA A;  3FH5 A;  4O7G A;  5COF A;  5HSW A;  1HX8 A;  5COM A;  1S7Z A;  1PV3 A;  2HMZ A;  3NYM A;  5A6K A;  4HXI A;  1YYX A;  1HZ4 A;  3VLE A;  1N54 A;  5D2M C;  1A7E A;  2YIN A;  3Q79 A;  4I2Z A;  3W2V A;  4EBK A;  3CLJ A;  3QWV A;  4BT9 A;  3PNL B;  1WGW A;  3NKD A;  3ASN E;  5T8I A;  2ZGD A;  3HKK A;  2YLI A;  3EGX B;  1E86 A;  5FT9 A;  3FEY A;  2GAQ A;  5A6J A;  4J6I A;  1FFH A;  4YVQ C;  3CVX A;  4NTF A;  3AGU A;  1HF8 A;  4FLH A;  4K0R A;  4AV7 A;  3HXD A;  2J0W A;  3QJZ A;  2L6F A;  4BT8 A;  4NIK A;  4RG6 A;  3UKU G;  5CRU A;  1O1R A;  1U2V G;  4LDR A;  4KT6 B;  1IQR A;  2R7O A;  4CT0 A;  2CG3 A;  1OCO C;  3NZS A;  4OIN F;  1D8D A;  1IHB A;  3FDH A;  4PDX A;  1JCQ A;  2J49 A;  3S7F A;  3OXL A;  4L6R A;  2FEZ A;  4I1O B;  3HVE A;  4IYP A;  5FQ4 A;  3EIQ C;  4CIH A;  2BUG A;  2DYR C;  3SYN A;  3GEI A;  3AGT A;  3HNL A;  1MQS A;  2NXP A;  3CVW A;  4HFF B;  2WXF A;  3T4R A;  4XX5 A;  2W9Y A;  4HE8 D;  1E7U A;  1IQU A;  2WXH A;  4OAV B;  2YVK A;  5DBK A;  3LEO A;  3S9O A;  5CER B;  3NYJ A;  5A6B A;  4B93 B;  2YL3 A;  3PNT B;  5A7D B;  3PZD A;  1YAR O;  2HZ8 A;  4CDR A;  4HRL A;  1FR0 A;  4WWO A;  3WHN A;  3EFO A;  2P61 A;  3GAN A;  3O6X A;  1OKK A;  1SZ9 A;  3T6G B;  1TKN A;  3DBS A;  1JOG A;  4G7O F;  4FX5 A;  2IEJ A;  2J0X A;  4CDM A;  3RW0 A;  3QVZ A;  3I3N A;  1KU2 A;  2KC7 A;  4KBL A;  5JRA A;  2Y69 C;  2ZGG A;  4J8Y A;  2P6V A;  4FC8 A;  1C03 A;  3SQV A;  3D9L A;  4G2V A;  3RIP A;  1SF8 A;  1RMV A;  3MV3 B;  4UWH A;  2A5E A;  2C0L A;  2CYD A;  3V31 A;  2XL8 A;  1KTM A;  2WXI A;  2CNW D;  4DI4 A;  1ORY A;  4MTG A;  4L9P A;  4LLC A;  2X3M A;  4FWV A;  3JXJ A;  1AWC B;  4WGZ A;  5B1A C;  2WL8 A;  3DSW A;  3EG9 B;  2PX0 A;  2BL2 A;  1N0Q A;  4GTM A;  4C9B B;  1QBQ A;  2WXO A;  5JT4 A;  2UUH A;  4EBA G;  3T5X A;  4ANW A;  4GTT A;  3DSX A;  2B0H A;  1QSP A;  1EPU A;  4B89 A;  1GW6 A;  3FUD A;  3DMD A;  4JEH A;  4UWK A;  4YDW A;  1FFT C;  2YL1 A;  2UY1 A;  4G26 A;  4PAC A;  2XGS A;  4EZL A;  2A0U A;  1EDU A;  4A3V A;  1HXI A;  3LLK A;  1LS4 A;  2XL4 A;  3CHP A;  2R7X A;  3D9I A;  3UIO C;  4GTR A;  1DVP A;  3ABM E;  3M15 A;  4U96 D;  4CT4 A;  2WXM A;  1OWM A;  4A2N B;  4GCN A;  2H8A A;  3H65 A;  4A1G A;  2NUP A;  1D0X A;  2ILR A;  1H6K A;  4JE9 A;  2X0C A;  4O60 A;  3M4C A;  2LUH A;  1QVX A;  3R7Q A;  1YYJ A;  4O79 A;  2ETS A;  2KM4 A;  4LNB A;  1YLM A;  1YAU O;  3BEE A;  3CHQ A;  5CI8 A;  3FTU A;  4XKC A;  2XEH A;  1LTX A;  4C7O A;  3S0X A;  5COG A;  4E18 A;  2OEW A;  5BNW A;  2XLD A;  3U9W A;  3ABL E;  1OY3 D;  2VCB A;  1SA4 A;  2XXA A;  5AYW D;  1T6Q A;  3DM9 B;  2R17 C;  2DZN A;  2XGM A;  4G7H F;  3RVZ A;  3ML9 A;  3ECS A;  1M57 C;  2IXP A;  1MHQ A;  1A41 A;  3M4B A;  3OWT A;  4FU3 A;  3ZKJ A;  3Q73 A;  4PK4 A;  2CHZ A;  2W45 A;  3D3M A;  3CQG B;  3JUI A;  4N3B A;  1A17 A;  1O1S A;  5HKP A;  4YT4 A;  5T3R A;  2IJG X;  2XGO A;  4CSA A;  3F46 A;  1ST6 A;  4MW3 A;  2IOS A;  2L7A A;  4JEU A;  3IQ6 A;  4CX9 A;  1BI7 B;  3ONK A;  4J7T A;  5KYX A;  2R7U A;  4K7B A;  3R9A B;  4DLO A;  5JA4 D;  3VF0 A;  2GRN B;  2WVO A;  3KYJ A;  2V0P A;  3PCV A;  3ASO E;  5M72 A;  1JCS A;  4K03 A;  3AG3 E;  4BJ5 A;  4GB9 A;  2A4Z A;  3SFY A;  5B1B C;  5CMW A;  4HOS A;  3RKV A;  2PM6 A;  1FTS A;  4CS7 A;  1JWG A;  2EIK E;  4JB8 P;  3DE9 A;  3BEH A;  4URK A;  1H2V C;  4IGG A;  3ESK A;  1WN0 A;  4RQI A;  1KZP A;  4GZC A;  3FHD A;  2OG2 A;  2IOL A;  1OCC E;  3EGD B;  3W9G A;  5C1D A;  4DBR A;  4FUL A;  3EHQ A;  4PFP A;  2OCC E;  3LJB A;  3ZUV B;  4K1O A;  4I6J A;  1E8Y A;  3W8I A;  2Y3B A;  3V5Y A;  3AS8 A;  2GRL A;  2WXG A;  2EPK X;  4F7A A;  3C63 A;  2YHC A;  5KJN A;  3G4X A;  1O5H A;  3UKR G;  5JS5 A;  3JRM O;  5EN5 D;  4OIQ F;  4YVO A;  4LSZ E;  2TMV P;  4J7Y A;  5AC5 A;  1ORJ A;  3FUI A;  3NKE A;  2C2L A;  1OR3 A;  5F5F A;  1TNU A;  4XZ4 A;  4M7C A;  2R59 A;  3TL5 A;  4GCO A;  2RD9 A;  1VYI A;  4OAU C;  1J8M F;  3B7B A;  1ZB1 A;  5L3V A;  4KI2 A;  1VOM A;  4FAD A;  3PDN A;  3PH0 C;  4MND A;  4GPK A;  5LX8 A;  2WQ7 A;  3L13 A;  3JXI A;  4U8H A;  2G62 A;  2QE9 A;  2CNW A;  5KJM A;  2WXL A;  2PQR A;  4HFG A;  4U0Z A;  2QY9 A;  2R9R B;  1QNF A;  2EIM C;  3HLZ A;  3K9I A;  5KBA A;  1A0B A;  4OD4 A;  3FU6 A;  4O6N A;  2LD6 A;  3FUE A;  3CZ6 A;  3Q7A A;  3SBS A;  3DJU B;  2B0J A;  3CK7 A;  4XQ1 A;  4NRH B;  4GA0 A;  2EPN A;  3LES A;  4LNG A;  3UXG A;  3UX4 A;  3C5R A;  3APF A;  3ZN3 A;  4DJA A;  3HNK A;  3KL4 A;  5J08 A;  4PS3 A;  5KJL A;  1WWP A;  4F1S A;  3QWP A;  3JQ0 A;  3R9M A;  3CQC B;  3KMI A;  3LEV A;  2ZIR A;  2ZPA A;  5D0O D;  1B89 A;  4MLP A;  4Y6C A;  1BU9 A;  4BET A;  2EQX A;  5EHH A;  3ZHE B;  1A7V A;  1Z3Y A;  3ASN C;  2GRO B;  1H0A A;  3JSZ A;  3HHM A;  1OWL A;  1W3B A;  1ZU2 A;  2ZU6 B;  3EFO B;  2NG1 A;  4L1B A;  3AU4 A;  4Q96 A;  3IV0 A;  3ABK E;  2NUT A;  2VTB A;  3QZC A;  2EIL E;  3RAU A;  2XSE A;  2OV8 A;  1MJ0 A;  3LDZ A;  4GZ3 A;  5BQG A;  2OQM A;  2CFU A;  4DX1 A;  4A1S A;  2XLH A;  3FEX A;  4HBD A;  2HYZ A;  4YJW A;  3E34 A;  1N9A A;  2IF4 A;  4I2W A;  1V55 C;  3ZQY A;  3FU5 A;  4NC3 A;  4M63 A;  5BQH A;  2JPU A;  5DS5 A;  2IFU A;  4JC7 A;  3BQO A;  4K5C A;  4IAQ A;  4RD9 A;  4CDA A;  3FH7 A;  4XTK A;  5KYW A;  1XNF A;  3MEK A;  4GTV A;  2DWZ A;  4LUN U;  1WOL A;  4I9C A;  4ONS A;  1U3C A;  2MHK A;  2Y39 A;  4BSX A;  3B0V C;  2R7R A;  3EUV A;  3PEV B;  4Q5S F;  2GRR B;  2KBX A;  3APD A;  1SYQ A;  2O9X A;  4I17 A;  1KNY A;  1U6H A;  1PY1 A;  4BPM A;  4QFV A;  1BR2 A;  5D66 A;  3QK0 A;  3OEO A;  4BY6 A;  2GA0 A;  4C3B A;  2CCY A;  3JT1 A;  1MX6 A;  3SY2 A;  4WAB A;  3IEG A;  3UIP C;  1JPN A;  4U8V D;  3NDB B;  4EZJ A;  4EHM A;  4KZ0 A;  3GWN A;  2UY1 B;  3EIJ A;  1M2O A;  4IJJ A;  5E75 A;  1S64 A;  2Q7R A;  3IKO B;  5JJ7 A;  3FTZ A;  5BQI A;  2XLW A;  3RQF A;  2A68 F;  5JSL A;  2I9C A;  4HS2 A;  3L17 A;  2J9B A;  1TR4 A;  4XEI G;  1UJK A;  5E2Q A;  5CRV A;  2AXU A;  1EF1 C;  4XPY A;  2NUP B;  3JTL O;  4WJ0 A;  2DBA A;  2HV6 A;  3FTS A;  3CVP A;  3RO2 A;  2H6I A;  3DWL G;  4OVU A;  4HRN A;  4J30 B;  5AJD A;  5B3S E;  4HOQ A;  4UI9 K;  3ZVV A;  2IY0 C;  1Y4C A;  3PE4 A;  2YL7 A;  2FBN A;  3FAJ A;  2C03 A;  4ZLC A;  4UWG A;  1IYG A;  2WXQ A;  3EHN A;  2A6E F;  4L23 A;  3RRN B;  2IO2 C;  3SNH A;  3LAY A;  4JTC B;  1YA0 A;  1LIH A;  3WG7 C;  1V74 B;  1Z6T A;  4XPX A;  5FZQ A;  1RJ9 B;  1OCR E;  1WTY A;  1DCE A;  4MKT A;  5L0C A;  3CV0 A;  1JUQ A;  2JLB A;  5CED B;  3TOL A;  1ZU5 A;  1YA9 A;  2A1D D;  4GML A;  4XEF A;  1BR1 A;  1QZX A;  2J4D A;  1RW2 A;  4E0I A;  1T6U A;  2P58 C;  5ARG A;  4CGW A;  4EZK A;  5L0H A;  3O39 A;  3URZ A;  4DX7 D;  2VSN A;  2H6G A;  2J9U A;  2NYJ A;  4LRZ A;  2KQ9 A;  4F53 A;  3FUN A;  3V79 K;  4G25 A;  1Y6D A;  1UN9 A;  4U9E A;  4CS8 A;  1HG5 A;  4EUK B;  3ZYM A;  1LI5 A;  2IXN A;  1G4U S;  2XS8 A;  2ETC A;  3L6A A;  4HOT A;  3MYF A;  3D9K A;  2L0I A;  2VC9 A;  2L9B A;  5BT1 A; 
#chains in the Genus database with same CATH homology
 4N06 A;  2J09 A;  5BPP A;  1HE8 A;  3B9Q A;  1UG3 A;  4OIR F;  3ZC4 A;  4A55 A;  4U07 A;  3ABL C;  3QB2 A;  2ZXR A;  2QTV A;  2DYS C;  3QNK A;  1MND A;  3UMK A;  4F3V A;  3ZGQ A;  3AU5 A;  3N2Z B;  2V8S E;  4N3C A;  1MMA A;  3G2S A;  1ZYR F;  5KYY B;  1J8Y F;  1TR2 A;  1E90 A;  3DM5 A;  1FVH A;  3RO3 A;  2FGY A;  3PRZ A;  3L34 A;  5F5H A;  3S7J A;  4AK9 A;  4O6F A;  1HS6 A;  4FJZ A;  3UT4 A;  3FTW A;  4D10 C;  4ZLD A;  2GRM A;  4J0U A;  4B6I A;  1HFA A;  2VH3 A;  4CEM A;  1L5J A;  4B0Z A;  4JXT A;  4B94 A;  4O6M A;  3GOD A;  5G05 J;  2OCC C;  3TXM A;  3S7B A;  3VYW A;  2VGX B;  3LPZ A;  2BTD A;  5KCM A;  3GZ2 A;  1SQM A;  5LCW J;  4AE4 B;  2MOW A;  3L08 A;  4FP7 A;  1OCZ C;  2M4E A;  4GYO A;  1D1B A;  3LXU X;  2YEV A;  3VAY A;  5DS6 A;  1TWC A;  3I4R B;  2V3C C;  2VTB B;  2NUT B;  4XWJ A;  4RSY A;  5JHB A;  2X6I A;  5EDS A;  3FHE A;  1LVK A;  2XRH A;  4MQ9 F;  1OUV A;  1MMD A;  4ANV A;  2X51 A;  3DPD A;  2HV7 A;  3MGB A;  1Z5Z A;  3TAX A;  3CVN A;  5CMY A;  4G24 A;  3CEQ A;  4C3D A;  3SNX A;  4KNW A;  2KCK A;  4XLP F;  3T6B A;  4WNF A;  3K33 A;  5AJL A;  4JHJ A;  4HVB A;  2X38 A;  3JYS A;  1LS1 A;  2X6K A;  3I4U A;  3ASD A;  1H2U A;  3VTX A;  3PUJ A;  1TEZ A;  2LNI A;  2XQ0 A;  2V4L A;  2J9Q A;  3OTN A;  2LAH A;  3RIB A;  1X5B A;  1NA0 A;  4BJ6 C;  4L7T A;  4DK5 A;  4QI2 A;  1PD0 A;  1N52 A;  4U04 A;  2KZT A;  2M63 A;  2J46 A;  4G0H A;  2KAT A;  3E9V A;  2YHE A;  3FUH A;  5E3C A;  2KCV A;  2I6H A;  4GEH A;  3B0U X;  3G2V A;  4AX2 A;  4OVV A;  4I9E A;  2UWJ G;  4GMJ A;  1FMV A;  3CQZ A;  1TWA A;  1MMN A;  5G05 C;  4QDL A;  5JJ6 A;  3NZU A;  4XLN F;  3CHR A;  1ELK A;  4XIF A;  2MWQ A;  5KYU A;  1FVF A;  2WPV A;  3CK8 A;  3FVY A;  4PJJ A;  5LCW C;  2Q9B A;  1PAQ A;  4ANJ A;  4JZY A;  4AEZ C;  5HI7 A;  3CVY A;  5JJT A;  2L9J A;  4EBA A;  3D9N A;  4Q4Z F;  2RG8 A;  5G2N A;  4FES A;  4H4K C;  1DNP A;  4LCT A;  2ION A;  4K0D A;  2JD3 A;  4WND A;  5CCL A;  3Q5M A;  1ZHZ A;  4DLQ A;  3MKQ A;  4M3O A;  4TRQ A;  2YZS A;  1MNE A;  3TG4 A;  4E7S A;  2PP4 A;  3UGP A;  3F47 A;  3FUJ A;  3Q47 B;  4U5G A;  1LF8 A;  3D9M A;  3SZ7 A;  3RRM B;  2C0M A;  2XCB A;  4ULW A;  3DAF A;  4PFO A;  3MV2 B;  2J45 A;  3FUM A;  4GZD A;  4PJN A;  4NAC A;  5KYN A;  2XPY A;  3FU0 A;  4H7X A;  3PHF 2;  4LER A;  5E3A A;  3AQC A;  4IUL A;  4BWR A;  3ASF A;  1OWN A;  1NU9 C;  3D9P A;  4YN0 B;  3X2Q C;  2GGF A;  3LS1 A;  3E70 C;  1ZU4 A;  5DS4 A;  3AG4 C;  3VLD A;  2VAS A;  3DZA A;  5FWQ A;  2EIN C;  3MYV A;  3CVQ A;  3C98 A;  3FY4 A;  2VSY A;  2XPZ A;  2FFH A;  4YT8 A;  2PQN A;  2X6J A;  4L2Y A;  4KZC A;  4CS9 A;  3U66 A;  4W8K A;  2R5S A;  4GZ5 A;  4J8E A;  2J7P D;  3ENE A;  3Q49 B;  3LVQ E;  3RFY A;  3FUL A;  2BE5 F;  2G3V A;  3FFL A;  2AWI A;  5JHA A;  5BW8 C;  3TJP A;  2G3K A;  3Q7G A;  4EPZ A;  2NC9 A;  4PJM A;  1V54 C;  3LCA A;  4PH4 B;  5ARF A;  3U4T A;  2GW1 A;  2R7W A;  1OWO A;  4KBQ A;  4C0M A;  2XCC A;  3UT7 A;  4NQ0 A;  2Y3D A;  1M2V A;  5FZS A;  4APO A;  3AG1 C;  3JCU Q;  1ZHY A;  5AEN A;  4NUR A;  2OVF A;  4IAO A;  2IQC A;  5BV1 A;  2I8B A;  3Q6M A;  5L3Q A;  3DXJ F;  4C3E A;  5CI9 A;  3ZYK A;  4HOR A;  4UI9 J;  1WM5 A;  4DPR A;  4ACK A;  3FWV A;  4WUY A;  3EPV A;  2Q9C A;  2MYS A;  4GYY A;  5CHE E;  4RDA A;  3ZG1 A;  3HVE B;  3UT8 A;  3B13 A;  4NY3 A;  3P1U A;  3DAG A;  2ZXP A;  5E76 A;  3LYA A;  3RKO F;  2OVB A;  5J90 A;  1E96 B;  4YT2 A;  1KT0 A;  4WNG A;  3PMR A;  1EYH A;  2KZT B;  3LY8 A;  3KEZ A;  3CHM A;  3PUK A;  4J8F A;  3SEO A;  3N0T A;  4U0S A;  3V7O A;  4E85 A;  3VTY A;  3QAQ A;  5G55 A;  2BF0 X;  2W4M A;  2CHX A;  3SGH A;  3AG2 C;  4Q7C A;  2E0I A;  3OXG A;  3LY7 A;  1E8X A;  1KT1 A;  3KH2 A;  2DIW A;  1D0Y A;  4L2L A;  3EQL F;  5ANR A;  4CSA C;  3ZXS A;  4U5B E;  3EH1 A;  3B7U X;  4OIP F;  4KMO A;  4GU5 A;  4JJF A;  1ZBP A;  1Z3X A;  3PVL A;  3CKC A;  3O4Z A;  2LSV A;  2LO6 A;  4U5F E;  5AIJ A;  4BJ5 C;  2YQ8 A;  3MKQ B;  3CGH A;  3N71 A;  2J7P A;  4YND A;  1VK5 A;  4UI9 C;  4AP2 A;  1Z6A A;  1TJC A;  2QFC A;  3CK9 A;  4ATG A;  3LLI A;  4X0R A;  3SD5 A;  4R7L A;  3HJC A;  5FZR A;  4HOU A;  3UMV A;  4C7O B;  3T6J A;  4J8D A;  3GZ1 A;  2Y4T A;  5D91 A;  2VSO E;  4OD5 A;  4Y6W A;  4ANU A;  2XXA B;  4UQZ A;  2Y3H A;  3U64 A;  2AXZ A;  2WXK A;  3E4B A;  4RBN A;  5C2Y A;  3QDN A;  5EKQ D;  2R7V A;  3ITF A;  3FDQ A;  3APC A;  3EG9 A;  1U3D A;  1D1C A;  2H7V C;  5KYX B;  4E7Z A;  3ASG A;  3ABM C;  3X1O A;  3WXX A;  3LNR A;  5BV0 A;  3T8M A;  3SBT B;  3ONL A;  1PCX A;  4KNV A;  2WXJ A;  2WZG A;  1XGW A;  2HM8 A;  3EZI A;  4XI9 A;  4Q94 A;  3P2B A;  2L0T B;  4CBE A;  1HG2 A;  3RK6 A;  3QWW A;  4JHR A;  3PRE A;  3I5P A;  4N3A A;  4WWN A;  3ZW3 A;  5BUZ A;  4A3T A;  3L22 A;  1M56 C;  1S0P A;  5FTP A;  2YHS A;  4ABN A;  3ZPJ A;  4JHK A;  4DVZ A;  5BUO A;  4DOZ A;  1NG1 A;  2XHE A;  1Z3I X;  5T3T A;  3CSK A;  3EZH A;  4P29 A;  4WNE A;  4FA6 A;  2H7B A;  3ML8 A;  3TGO A;  4ILI A;  3FP3 A;  3ASO C;  3HTK C;  3MX3 A;  3Q15 A;  3AG3 C;  4AM9 A;  3G2T A;  4EWC A;  3I4G A;  4ILH B;  1H2T C;  1BR4 A;  3NYL A;  4YT5 A;  3SP1 A;  2VGY A;  3CIA A;  4G11 A;  2EIK C;  1HU3 A;  2H7O A;  1N1C A;  3S28 A;  3RRU A;  2WQ6 A;  4TUU A;  1PD1 A;  5EX0 A;  3ZEF A;  4N39 A;  3MKR A;  4OIO F;  4GA2 A;  4UWL A;  2WVI A;  2WXN A;  1OCC C;  3CKB A;  2IOQ A;  3FTY A;  1JPJ A;  3RYL A;  5KJK A;  3NQP A;  3CSF A;  4H7Y A;  4PJL A;  4V3I A;  1D1A A;  1TWH A;  1Z23 A;  4ANX A;  2J08 A;  2LAI A;  4CCA A;  3NG1 A;  2V26 A;  4YWQ A;  1QQE A;  3GZS A;  3EGD A;  4XE0 A;  4G1T A;  1NA3 A;  5LP0 A;  2CG2 A;  4IN3 B;  3MCX A;  4U63 A;  4I1M A;  2R7T A;  1SZA A;  3EHM A;  4I44 A;  3K7D A;  3ZRH A;  5LOZ A;  1NU7 D;  3G2W A;  5KYW B;  4UQX A;  2WQH A;  2I1K A;  3L54 A;  4EBB A;  3UMH A;  5T3W A;  4G7Z F;  1WY6 A;  4N5C A;  3K66 A;  2X6F A;  4AOF A;  3LEW A;  1NZE A;  2J9W A;  3ZFW A;  2WM9 A;  2CFZ A;  4AJW A;  4N2Q A;  4N2S A;  3QOU A;  1IW7 F;  2GFH A;  3O48 A;  3ABK C;  2PFD A;  3VLF A;  2EIL C;  3AS4 A;  2VQ2 A;  4J32 B;  2PZI A;  3N24 A;  4CS8 C;  3TG5 A;  2IXM A;  4W9R A;  3ZHE A;  1KLX A;  1E8Z A;  5E33 A;  3GYZ A;  2FO7 A;  3HYM B;  2WZL A;  4JZA A;  3CHS A;  4B8A A;  3UR3 C;  4C0E A;  2FUL A;  3FTV A;  2E87 A;  2J4B A;  2JEK A;  5CCM A;  3QC1 A;  4P6I C;  3U3W A;  4GA1 A;  5LFA A;  4I1A A;  3L0I A;  1QZ2 A;  5DLJ A;  3LVR E;  1LKX A;  2V5F A;  3L16 A;  3K1H A;  1JWF A;  1ELR A;  5T4Y A;  2FF4 A;  5IY5 C;  3JRT A;  3CR3 A;  4RG9 A;  1ELW A;  2ZXO A;  2PF4 E;  3MA5 A;  3OAW A;  4AY5 A;  1UN8 A;  1PC2 A;  2KW3 C;  4BG0 A;  3PE3 A;  5B3S C;  3FH8 A;  4JPS A;  2W4B A;  2CHW A;  1TJF A;  3LS8 A;  2NSZ A;  4DBQ A;  4ME2 A;  1OCR C;  5T1D B;  3JYH A;  2VSX E;  4KC9 A;  3JCK C;  4FHK A;  3MJW A;  4HFK B;  1FMW A;  3UUX A;  2OND A;  2WZF A;  3UNG C;  2L6J A;  2CW0 F;  4LEU A;  1W2W A;  3HDX A;  2J9V A;  3TD7 A;  2MRI A;  1RJ9 A;  4Q69 A;  5ENN A;  1E8W A;  4IRU A;  2DCP A;  3JQ1 A;  3ASH A;  3KAE A;  4EQF A;  3BG1 B;  2KGO A;  2L81 A;  4TV3 A;  2FI7 A;  3G2U A;  2LSE A;  3WOD F;  2VYI A;  2R7Q A;  5FCL A;  3ZIM A;  4MS6 A;  3NRH A;  2VJ8 A;  3ZYQ A;  4LAC B;  4JVS A;  4B8C B;  1JPL A;  3W8H A;  3SZR A;  3LJ3 A;  2E2E A;  1MMG A;  4E6H A;  2WVQ A;  2KJG A;  2XEV A;  1TWG A;  2DGJ A;  4CRW A;  1VDY A;  4FLB A;  4JC8 A;  1UW4 B;  4HLE A;  2PL2 A;  3FUK A;  2AXV A;  4I6E A;  5KYY A;  1D0Z A;  2YNQ A;  3PS6 A;  4BX9 A;  5EGY A;  2I1J A;  3LKU A;  1HO8 A;  4BJT A;  4PUC A;  4IWB A;  4BEJ A;  1Y6I A;  2D5R B;  3D9J A;  2EIJ C;  2X6H A;  3PEU B;  1VYK A;  5FQ8 A;  2KNH A;  3EH2 A;  4BX8 A;  4UWF A;  2XPI A;  5D0Q D;  1H19 A;  5DIZ A;  2Q9A A;  4O6Y A;  2PX3 A;  2WMN A;  3FUF A;  4I6G A;  2Z15 A;  3RU0 A;  2HO1 A;  4FHJ A;  3AQB A;  5G04 J;  3B7S A;  2I2O A;  1IHG A;  3T5V A;  1Z63 A;  2A6H F;  2Y4U A;  3SF4 A;  5A23 A;  2VB6 A;  4PS8 A;  2A69 F;  4JL0 A;  3UGO A;  2VGX A;  2IYL D;  1P5Q A;  4AE4 A;  2A5U A;  3S2A A;  3IHY A;  3AS5 A;  3K1I C;  3IEE A;  2LSU A;  3KS2 A;  3B0P A;  2WXP A;  3EGX A;  2CDQ A;  3LS0 A;  4CDN A;  4XKB A;  4U5C E;  3ZVR A;  3ESL A;  3SFZ A;  3GW4 A;  4KXK B;  4BTA A;  5KYU B;  3RJV A;  4UQY A;  4OYS A;  3MZL B;  3BG0 B;  2WB2 A;  2Y3G A;  3OXF A;  4GYW A;  3M1C B;  2XRY A;  4ACL A;  3QKY A;  4GAA A;  4KVM A;  5HQ8 A;  4JJG A;  1HH8 A;  4WAF A;  4AY6 A;  3DJN B;  4CS9 C;  3QAR A;  3FTX A;  4HEA J;  3MLG A;  4MRU A;  5FQ7 A;  4KVO A;  4I43 A;  2HR2 A;  2J07 A;  4XI0 A;  2C04 A;  1OWP A;  1IZM A;  1ZHW A;  5A6C A;  4AIF A;  5ANL A;  1Y8M A;  3FU3 A;  3OA1 A;  3UMI A;  2R7S A;  4JA9 A;  2RD0 A;  3D9O A;  3ZSU A;  5G04 C;  3ZYL A;  3CST A;  4U5H A;  1QLE C;  3SHF A;  1WAO 1;  3S29 A;  3CVL A;  1E7V A;  3LY9 A;  5EX3 A;  3EJN A;  3CHO A;  4DI3 A;  1INZ A;  4FJY A;  2PM7 A;  1ZHT A;  2AW6 A;  3ULQ A;  5DQT A;  3RH3 A;  4F4B A;  2WXR A;  3HIZ A;  2WMO A;  5DQZ A;  2P7V A;  3CVV A;  4G23 A;  1G8X A;  3KD7 A;  2AVP A;  4BJ6 A;  4I3M A;  3Q6N A;  4PS7 A;  2OOE A;  5DVW A;  3Q4A B;  5FJY A;  1FCH A;  4CGV A;  1OKK D;  4JW1 A;  4U0U A;  3IHV A;  3UPV A;  2WB7 A;  4APF A;  3UQ3 A;  1ZHX A;  3KKB A;  3NF1 A;  4EEC A;  3SI5 A;  2CGE A;  4JCH A;  2QY7 A;  4GZ6 A;  3ZIB A;  2IU1 A;  1BPO A;  4GYT A;  1UJJ A;  1M2V B;  4LLE A;  2KCL A;  4DVY P;  4U5E E;  4AVX A;  1NZN A;  4ILG A;  4JA7 A;  2IXO A;  3K6B A;  2Y3A A;  3B7T A;  4BFR A;  2ZXW C;  3I5Q A;  4WWP A;  3R7R A;  4KYO B;  5D92 A;  4BTB A;  2Q7F A;  3CVU A;  4JUR I;  3IBE A;  3EDT B;  4BJ1 A;  3W2W A;  4QI0 A;  3TXN A;  1SZI A;  3POV A;  2WVN A;  4AXH A;  2XRZ A;  3Q7L A;  3S7D A;  4J8S A;  3B7R L;  5FQ6 A;  3QMK A;  4RVB A;  1SMY F;  3DD7 A;  3S27 A;  4U5D E;  2Q3T A;  1NP7 A;  1O87 A;  1VMA A;  3FH5 A;  4O7G A;  5HSW A;  1HX8 A;  1S7Z A;  3NYM A;  4HXI A;  3VLE A;  1HZ4 A;  1N54 A;  2YIN A;  4I2Z A;  3W2V A;  3CLJ A;  3QWV A;  4BT9 A;  3PNL B;  1WGW A;  3NKD A;  5T8I A;  3EGX B;  5FT9 A;  3FEY A;  4J6I A;  1FFH A;  4YVQ C;  3CVX A;  1HF8 A;  4FLH A;  4K0R A;  4AV7 A;  2J0W A;  3QJZ A;  4BT8 A;  4RG6 A;  4KT6 B;  1IQR A;  2R7O A;  4CT0 A;  2CG3 A;  1OCO C;  3NZS A;  4OIN F;  3FDH A;  4PDX A;  2J49 A;  3S7F A;  3OXL A;  2FEZ A;  4I1O B;  3HVE A;  4IYP A;  5FQ4 A;  3EIQ C;  4CIH A;  2BUG A;  2DYR C;  3SYN A;  1MQS A;  2NXP A;  3CVW A;  4HFF B;  2WXF A;  3T4R A;  4XX5 A;  2W9Y A;  4HE8 D;  1E7U A;  1IQU A;  2WXH A;  5DBK A;  3NYJ A;  3PNT B;  5A7D B;  3PZD A;  4CDR A;  4WWO A;  3EFO A;  3GAN A;  3O6X A;  1OKK A;  1SZ9 A;  1TKN A;  3DBS A;  4G7O F;  4FX5 A;  2J0X A;  4CDM A;  3I3N A;  1KU2 A;  2KC7 A;  4KBL A;  2Y69 C;  2P6V A;  4FC8 A;  3D9L A;  4G2V A;  3RIP A;  1SF8 A;  3MV3 B;  4UWH A;  2C0L A;  2WXI A;  2CNW D;  4DI4 A;  4LLC A;  2X3M A;  4FWV A;  5B1A C;  2WL8 A;  3EG9 B;  2PX0 A;  4C9B B;  2WXO A;  4EBA G;  3T5X A;  4ANW A;  1EPU A;  4B89 A;  1GW6 A;  3FUD A;  3DMD A;  4JEH A;  4UWK A;  1FFT C;  2UY1 A;  4G26 A;  2XGS A;  4EZL A;  1EDU A;  4A3V A;  1HXI A;  3LLK A;  2XL4 A;  3CHP A;  2R7X A;  3D9I A;  1DVP A;  4CT4 A;  2WXM A;  1OWM A;  4A2N B;  4GCN A;  3H65 A;  4A1G A;  2NUP A;  1D0X A;  2ILR A;  1H6K A;  3R7Q A;  4O79 A;  2KM4 A;  3CHQ A;  3BEE A;  5CI8 A;  3FTU A;  4XKC A;  4C7O A;  3S0X A;  5BNW A;  3U9W A;  5AYW D;  2XXA A;  3DM9 B;  2R17 C;  2XGM A;  4G7H F;  3ML9 A;  3ECS A;  1M57 C;  2IXP A;  1MHQ A;  3OWT A;  4FU3 A;  4PK4 A;  2CHZ A;  2W45 A;  3D3M A;  3CQG B;  3JUI A;  4N3B A;  1A17 A;  5T3R A;  4YT4 A;  2IJG X;  2XGO A;  4CSA A;  3F46 A;  1ST6 A;  2IOS A;  4JEU A;  3ONK A;  5KYX A;  2R7U A;  4K7B A;  3R9A B;  4DLO A;  2WVO A;  2V0P A;  5M72 A;  4K03 A;  4BJ5 A;  4GB9 A;  2A4Z A;  5B1B C;  5CMW A;  4HOS A;  3RKV A;  2PM6 A;  1FTS A;  4CS7 A;  1JWG A;  4URK A;  1H2V C;  3ESK A;  4GZC A;  3FHD A;  2OG2 A;  2IOL A;  3EGD B;  5C1D A;  4DBR A;  4FUL A;  4PFP A;  3LJB A;  4I6J A;  1E8Y A;  3W8I A;  2Y3B A;  3AS8 A;  2GRL A;  2WXG A;  4F7A A;  2YHC A;  5KJN A;  1O5H A;  4OIQ F;  4YVO A;  3FUI A;  3NKE A;  2C2L A;  5F5F A;  4XZ4 A;  2R59 A;  3TL5 A;  4GCO A;  1VYI A;  1J8M F;  5L3V A;  4KI2 A;  1VOM A;  4FAD A;  3PDN A;  3PH0 C;  4MND A;  4GPK A;  5LX8 A;  2WQ7 A;  3L13 A;  4U8H A;  2G62 A;  2CNW A;  5KJM A;  2WXL A;  2PQR A;  4HFG A;  4U0Z A;  2QY9 A;  1QNF A;  2EIM C;  3HLZ A;  3K9I A;  4OD4 A;  3FU6 A;  4O6N A;  3FUE A;  3CZ6 A;  3SBS A;  3DJU B;  2B0J A;  3CK7 A;  4NRH B;  4GA0 A;  3LES A;  3UX4 A;  3APF A;  3ZN3 A;  4DJA A;  3KL4 A;  5J08 A;  4PS3 A;  5KJL A;  4F1S A;  3QWP A;  3JQ0 A;  3CQC B;  3KMI A;  3LEV A;  5D0O D;  2ZPA A;  1B89 A;  4MLP A;  4Y6C A;  2EQX A;  5EHH A;  3ZHE B;  1Z3Y A;  3ASN C;  1H0A A;  3JSZ A;  3HHM A;  1OWL A;  1W3B A;  1ZU2 A;  2ZU6 B;  3EFO B;  4L1B A;  2NG1 A;  3AU4 A;  4Q96 A;  3IV0 A;  2VTB A;  2NUT A;  3QZC A;  2XSE A;  2OV8 A;  3LDZ A;  4GZ3 A;  2CFU A;  4A1S A;  3FEX A;  2HYZ A;  4YJW A;  2IF4 A;  4I2W A;  1V55 C;  3FU5 A;  4M63 A;  5DS5 A;  2IFU A;  4RD9 A;  3FH7 A;  4XTK A;  5KYW A;  1XNF A;  3MEK A;  4LUN U;  4I9C A;  1U3C A;  2MHK A;  2Y39 A;  4BSX A;  3B0V C;  2R7R A;  3PEV B;  4Q5S F;  3APD A;  2O9X A;  4I17 A;  1PY1 A;  4QFV A;  1BR2 A;  3QK0 A;  3OEO A;  4BY6 A;  4C3B A;  3JT1 A;  3IEG A;  1JPN A;  3NDB B;  4EZJ A;  4KZ0 A;  2UY1 B;  3EIJ A;  1M2O A;  4IJJ A;  5E75 A;  3IKO B;  5JJ7 A;  3FTZ A;  2A68 F;  2I9C A;  4HS2 A;  3L17 A;  1UJK A;  5E2Q A;  2AXU A;  1EF1 C;  2NUP B;  4WJ0 A;  2DBA A;  2HV6 A;  3FTS A;  3CVP A;  3RO2 A;  4OVU A;  4J30 B;  5AJD A;  4HOQ A;  4UI9 K;  3ZVV A;  3PE4 A;  2FBN A;  3FAJ A;  2C03 A;  4ZLC A;  4UWG A;  1IYG A;  2WXQ A;  3EHN A;  2A6E F;  4L23 A;  3RRN B;  3SNH A;  3LAY A;  1YA0 A;  3WG7 C;  1Z6T A;  5FZQ A;  1RJ9 B;  4MKT A;  3CV0 A;  1JUQ A;  2JLB A;  1ZU5 A;  2A1D D;  4GML A;  1BR1 A;  1QZX A;  2J4D A;  2P58 C;  5ARG A;  4CGW A;  4EZK A;  3O39 A;  3URZ A;  2VSN A;  2J9U A;  4LRZ A;  2KQ9 A;  4F53 A;  3FUN A;  4G25 A;  1UN9 A;  4CS8 A;  1HG5 A;  3ZYM A;  2IXN A;  3L6A A;  4HOT A;  3D9K A;  2L0I A;  2L9B A;  5BT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...