3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords SusD homolog
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
3CKCA 5E75A 4F7AA 3MYVA 3CK9A 3LEWA 3MCXA 3CK8A 3L22A 5FQ4A 5T4YA 5FQ7A 3CGHA 3JQ1A 4F53A 5FQ6A 5FQ8A 3QNKA 3EJNA 5J90A 4L7TA 3GZSA 3HDXA 5E76A 5LX8A 3FDHA 5T3RA 3KEZA 3CKBA 4PUCA 4Q69A 3JYSA 3EHMA 3SNXA 4LERA 3NQPA 3JQ0A 3SGHA 3I4GA 3CK7A 3OTNA 3MX3A 3P1UA 3IV0A 3EHNA 4MRUA
chains in the Genus database with same CATH superfamily
2QY9A 3LNMB 3B0PA 3FMSA 5LFAA 3SEOA 5A6AA 5C2YA 4FC8A 4TXQA 3KMIA 3MKRA 4N5CA 1E90A 2KM4A 3ABLC 2L6FA 4BY6A 2MHRA 3CR3A 3FP3A 4G7OF 4MW8A 4KXKB 1E86A 3B0VC 2PM7A 2HMQA 3AS4A 4X8QA 5AQ9A 2E0IA 3IQTA 4U5CE 1U2VG 4I2WA 5ENOD 4OIRF 2LXMA 2EIMC 5LP0A 2VSOE 1D1CA 4G24A 4K5AB 3B95A 4DX5D 2KSFA 4CS8C 1KZPA 3LLKA 1ELKA 1T5OA 3QW1A 1FPPA 4EECA 3U66A 1TWHA 3MYFA 4O7GA 2RD9A 4EUKB 2GWWA 4JCHA 3LVQE 4MTOA 3SXKA 3WAQA 4PK4A 3WHNA 5A6CA 3AOUA 1GGQA 5JT4A 5BXOA 3MFNA 4OINF 4A3TA 2PP4A 3CHOA 3ULEG 4ILGA 2CG2A 2PQRA 2P0NA 3FOPA 2VQ2A 3AU4A 3JQ0A 4GTQA 4J0UA 2YQYA 1LTXA 3Q9NC 1A41A 5AN8A 5D92A 4N3BA 1LD7A 4G7ZF 2WPVA 3TD7A 1OT8A 3S7BA 3TGOA 1OCRE 2Y3GA 3DEOA 1GW6A 1L7CA 1OUVA 3CV0A 3O4ZA 4HVBA 1SVXA 4XKBA 4CJOA 1SZ9A 3HYMB 1QZ2A 3BEEA 3RK6A 3Q73A 2EINE 4F3VA 3RVYA 5EX0A 4U8VD 4H54A 1HE8A 3ZPJA 3L16A 2V4HC 2FULA 2XGSA 2J7PA 5JP7A 1Q0MA 2OVFA 1MX2A 2J9BA 2V8SE 2ILRA 5JJTA 1WOLA 4ABNA 2EPLX 4LDKA 2V4LA 3JXJA 4JA9A 2R03A 3S7FA 3U9WA 3QAQA 2NSZA 2VB6A 1BLXB 2J49A 2XRZA 1H7IA 3P2BA 2KXPC 3SF4A 4DK5A 3IPMO 2B6CA 1TNYA 2V26A 1OXBA 1Z5ZA 3LAYA 2HFIA 5T3WA 4EPZA 4RD9A 2YHEA 3ZYKA 4FP7A 2P9NG 4E85A 3LEWA 4HS2A 3KKBA 3B29A 2HYZA 4JRZA 3KYIA 4DLQA 3HXEA 1B89A 3FXHA 4B8AA 2V0PA 2H6HA 2B0HA 4ME2A 4FULA 3DKAA 2NG1A 2Y1LE 2NSGA 4F1PA 5AARA 4NQ0A 1UN9A 1DOVA 4QDLA 3VTYA 3AGTA 1NA3A 3ZU7B 2P9IG 4UWKA 3DAGA 2R02A 1Q0GA 3JUIA 2C03A 4I9CA 3UKUG 2P9PG 2A0BA 4G8LA 1V55C 3K1IC 3RU0A 4DBQA 2J4BA 1Z6AA 2EINC 4EIYA 2LQGA 2MHKA 3LEVA 3ATPA 2ZXWE 3LDZA 5AQBA 3PEUB 3TWRA 2NPUA 1WTYA 2LSUA 3HTKC 3K1IA 4DPRA 4G2VA 1TNOA 4AIFA 3Q7AA 5EIDA 1GM5A 4JD2G 3WXXA 3DZAA 3Q4AB 4DVZA 3K7DA 3B7TA 2OEWA 3CHRA 2DYRE 2I1KA 3L9TA 2H6IA 4DX6D 4N2SA 5BV0A 3ZWIA 1SA4A 4MQ9F 2VTBA 2DZNA 3PZ2A 4RDAA 4P9TA 4R32A 2XS8A 3CVXA 1INZA 3WG7E 4JEUA 3ASFA 1SZAA 1NP7A 3CIAA 2VSYA 2LFDA 4GU5A 1LI5A 4FESA 3C3RA 1IKND 1WM5A 3SO8A 4EZJA 4MTGA 3N71A 3ZYLA 3ZQYA 1QSPA 1HW2A 3MV2B 3Q78A 2ZXOA 4RG6A 5A6JA 5ENPD 5L3QA 3I4RB 2RFMA 5ENQD 1OCOC 1KPSB 1O5HA 1S63A 2WXPA 5BV1A 5JHAA 3AG1C 2KK1A 4MRUA 4JEHA 2G62A 3NMJA 4CT0A 4AY6A 2YWAA 1LS1A 4Z9HA 1PD0A 5AQ7A 3ABMC 4A63B 3HJCA 3G50A 4G78A 1HG2A 4NRHB 4B0ZA 1O87A 3PE4A 2DI3A 1OCCE 1UJJA 3ITFA 2WXJA 1YA9A 3ABLE 5AC5A 3UX4A 4PJLA 2YL1A 2KZTB 3ML9A 4B94A 3VLEA 3NOGD 4ANXA 2MYOA 1HXIA 3ABKC 1GQAA 2P9UG 2E2EA 3EDTB 2IOLA 5TJ5E 3K6BA 5HSWA 2A4ZA 4UWLA 4XPYA 3DSUA 3DMDA 2GA0A 2XRHA 3DRAA 2OEVA 3CZ6A 3ESKA 4L7TA 3S7DA 3N0TA 4B93B 4ER9A 2X6HA 2WZLA 3VF0A 2QLAA 4PUCA 1E96B 4Q69A 3BUAA 3VYWA 2HJ3A 2Y69E 3M79A 2C0LA 2HMZA 1HMDA 2WXOA 4BTAA 3VLFA 2F0YA 1OWPA 3TOLA 4J7TA 1V55E 2C0MA 4LNUD 3LPZA 4W9RA 3L82A 3EU9A 4G0HA 1TWCA 4JCZA 1LF8A 5DS4A 1L5JA 1ZW2A 4G7HF 4J7WA 3RRNB 3DJUB 2DCPA 2FBNA 5D2MC 2CHXA 3QWVA 2OVBA 1QQEA 3SFYA 5JJ7A 1JMWA 3FH5A 3E9VA 4XX5A 2XHEA 3PZ4A 4NTAA 4N39A 4U0ZA 1EI7A 2CG3A 5B1AC 1BZ4A 1OWLA 1MQVA 2YNQA 5CBNA 3ZQVA 1R4TA 5M72A 3TAXA 1NU7D 4GTOA 2V5QC 4I44A 3M15A 3QW0A 4TXPA 1RKCA 4K1OA 2LCHA 3JRTA 5HRYA 4C9BB 1OCCC 5J90A 4NY3A 2HM8A 4FLBA 1FAPB 5JMND 3KEZA 3FUNA 4UI9J 4J30B 5HI7A 1JPJA 3DPYA 4HNAD 3DM9B 5F5FA 4HORA 2DYSE 1YZAA 5EYLA 2OCCC 2EIKE 4O1PA 3FEYA 3CEXA 1HH8A 1JWGA 3C8ZA 2XRYA 1YYHA 5CMWA 1LE4A 3X2QE 4YT4A 3CLJA 3VRCA 3FUDA 4WJ0A 3Q6MA 4HRNA 3HNJA 2L6BA 2EPOA 3BG1B 3KSLA 5DBKA 4CIHA 2KNHA 3EZHA 3SP1A 3Q15A 5L0JA 2WMNA 2IBFA 4JEAA 4YT2A 1JOGA 4UI9C 3QZCA 1D1BA 3ZXPA 1E8YA 1FTSA 1EQ1A 3EUVA 2KQ9A 3DE8A 4YL0A 5KYYA 3DXJF 4UQYA 1AVOB 3I5QA 5G05C 2F37A 5JVEA 5EGYA 3CEQA 3JUEA 4EHMA 3F46A 1OQCA 3RYLA 4XEFA 3BQOA 5LOZA 4QI2A 4F4BA 2GRLA 3GZSA 3ZKJA 3W9FA 3EG9A 2IY0C 2YLGA 2ETBA 3ZTMA 3UMHA 4I1OB 4O6NA 3MLGA 3FTZA 2RKKA 4I9EA 1EA8A 1PY1A 5FT9A 3IXEA 4IWBA 2LNIA 2L6JA 2PM6A 4KNVA 5A69A 2MWQA 1FCHA 3CSFA 4ATZD 4FJZA 3JT1A 4ANJA 4GZDA 1O1TA 3E30A 2XL4A 4HOQA 2WVQA 4I6GA 1Z6TA 4GMLA 2H7OA 1IZMA 3U8VA 2PF4E 5T3RA 5A7DB 2YHSA 5BQGA 3RAUA 2Y3DA 2NXPA 5FZSA 4GPKA 2UY1B 3JCKC 1H0AA 3OAWA 4CYMD 1ELWA 1Y4CA 1FNTc 2CFUA 2NC9A 4TUUA 4LCTA 4N5QA 2XLMA 2L0IA 2AVKA 2V5FA 4CEMA 1E8XA 5T4YA 5FTPA 3W2VA 1HW1A 3FTSA 3TQOA 4U95D 2AU5A 3PZ3A 1FFHA 4OYSA 3V31A 4YDYA 2DGJA 1TYQG 3S9OA 3FU3A 2A68F 2G3VA 2YZSA 4IULA 2BF0X 4O79A 1MNEA 2P1AA 3GODA 3QWPA 4AVXA 2H7VC 2MYSA 1K1BA 3HXCA 2Y3HA 2G3KA 2BUGA 1NSGB 1SQMA 4Y6CA 3MV3B 1O1RA 4KBQA 1U0BB 2KCKA 3M4BA 1PAQA 1VTMP 4DRXE 1ZHTA 1KLXA 3ABME 4GTPA 1BR1A 3D9OA 2J45A 1YCSB 5JHBA 2J09A 3PS6A 1S70B 3U5SA 5CEAA 2XQ0A 1LKXA 3SNHA 3Q7FA 2AP3A 3GORA 4EBKA 1SR2A 3GZ2A 1CPRA 4GZCA 2XXAA 1W3BA 3DSVA 3O10A 5BUOA 1TWAA 4XEIG 1K05A 1MMDA 2DVWA 4Z68A 5KJLA 4U5DE 3OXGA 3GWNA 1N11A 2ZISA 4OIQF 3FFLA 2L9BA 2J7PD 4L9PA 4FX5A 2W45A 3Q47B 4PS8A 5E2QA 2XLOA 5G55A 5COMA 4XLNF 3TWWA 3NYLA 5BQHA 1N52A 3TJPA 4OIOF 4OVVA 1KT1A 4LUNU 4DJAA 1KT0A 2A5EA 2KJGA 2M63A 4ZFHA 4GZ5A 1DCQA 2GRMA 4G1TA 2QUPA 3IHVA 4N2QA 2VCAA 3BRJA 4EQFA 3EH2A 2JEKA 4ZHBA 5KYWA 2PL2A 3D9LA 1UJKA 3L17A 3D9IA 4YT8A 3UR3C 5A6BA 3S29A 1K40A 4P29A 4MVOA 2IF4A 2BEDA 3ASHA 3MZLB 4U04A 3UM2A 2OKUA 2W4BA 4JIOA 5COGA 4BG0A 1JPNA 4E0IA 2WB2A 3TK0A 3U8PA 3EIQC 1MHQA 2OQMA 3FEXA 4KNWA 2FI7A 4GYYA 3LY9A 3DI5A 4LNGA 4M3OA 2X3MA 3E70C 5KNHD 1FT1A 5L3VA 5GPGB 4I3MA 4U5HA 4L2YA 2J8SD 5JSLA 3W4YA 3G2UA 3T8MA 4LERA 4DLOA 2A6HF 3SXZA 2IO3C 2OEXA 2M64A 3B13A 4G23A 1WGWA 4OVUA 2LXLA 2Y3BA 3QKYA 5B1BE 5B3SC 2VASA 1XWJA 3EZIA 1MX4A 3DPDA 4YT5A 2QE9A 4H4KC 4J8YA 3UKRG 4I1MA 3NMIA 2RFAA 4BJ5A 1A7EA 3ECSA 3F6QA 3K66A 1HFAA 4WNEA 3LY8A 3R7QA 3HXBA 3J5QB 3C63A 1HZ4A 5HV9A 4KVOA 1GS9A 2YINA 5COFA 4A3VA 3APDA 2Y69C 4HOTA 4HFFB 5JJ6A 1IYGA 4JZYA 3EU5A 2XLHA 3NDBB 1WN0A 3RVZA 2CYDA 2OU6A 3ONKA 4N3AA 3DBSA 3V30A 2IXPA 2C2LA 3JYSA 4TXRA 4EKWA 4JHKA 4UUCA 2XL8A 4CT4A 5AENA 2R9RB 1IQUA 2R7UA 3UIOC 3O39A 3FAJA 3RQEA 4HLEA 4DX1A 5A6KA 1TNUA 4FADA 1TFKB 3LESA 2BE5F 2H8AA 3E37A 2WXRA 3S0XA 4GTVA 3ZFWA 4E7SA 4FWVA 1ZU5A 3APFA 1M2VB 1U6HA 2CFZA 2XPYA 3EHRA 4N4WA 3DSTA 3FDQA 1WDYA 1DCEA 2H6FA 4BSXA 4JHRA 3ONLA 4XLPF 3MKQB 3L08A 3GWLA 2J0XA 1JAFA 5CCLA 4A1GA 3CVVA 3V7OA 5HS0A 3T5VA 4LRZA 2E87A 5ARGA 3S90A 2EQXA 5FWQA 5FQ4A 5CI8A 4LEUA 3TJ6A 2XCCA 1ZBPA 1G3NB 2GRQB 1EPUA 5EYPF 4CDVA 3KAEA 4K03A 3BG0B 1NFOA 3ISMC 4JA7A 4XIFA 3Q49B 1VMAA 4LSZE 3AG2C 2XM4A 4YNDA 1H2UA 2OJQA 2WL8A 3QTHA 3JTLO 3EHNA 3JZ0A 4LLEA 3IKOB 4AP2A 2HZ8A 3T6GB 2WQ6A 4J8FA 1WWPA 2ZIRA 4XEVA 4ANWA 3NBNB 2ASRA 4TRQA 2PNNA 3L54A 4G11A 4ATGA 3NKDA 3SYNA 4E17A 2EPNA 2EILC 4U0UA 4AX2A 2R7WA 2J07A 2R7QA 2ZXWC 5ENSD 4JXTA 3MYIA 5AC4A 1KU2A 3P1UA 4MLPA 1V54E 3DWWA 2VC9A 2PX3A 2DZOA 4C3EA 1J8MF 1NA0A 2KCLA 1W2WA 5FQ8A 3GM3A 3ZDLA 4L2LA 1V74B 5CECB 3HDXA 3U2LA 1RCPA 4B8CB 5KJMA 1ZW3A 2P9SG 5KBAA 3CVWA 2Q3TA 1LI7A 5G05J 3ZHEA 3EHMA 3IHUA 4UQXA 3I4GA 3TXMA 3BEHA 3FUKA 3X1OA 3DJNB 3JRMO 2XXAB 3OTNA 4XPXA 1UN8A 2KW3C 4OIPF 3ZG1A 1ST6A 3UT8A 4U8YD 4MVQA 3MJWA 1HO8A 2ETAA 3CQZA 3FTXA 3UT4A 2Q4FA 3K9IA 4WWPA 4JE9A 4DX7D 3HNIA 2BC5A 4CDRA 2P2CP 4KYOB 5L0IA 1OW6A 2WXNA 2QNLA 5KWDA 3C8GD 3AG1E 1TR4A 1T6UA 2GRPB 1NBBA 1Y6IA 3J06A 1H19A 1TEZA 3C62A 3CK9A 2O9XA 3L22A 1ORYA 2I1JA 2FO7A 4KC9A 5IY5C 3DXMG 1ELRA 4HLLA 3QNKA 4GEHA 1E8WA 4FU3A 4MS6A 3OWTA 2OOEA 1QZXA 1S64A 3CQCB 1VLTA 3FDHA 3UGPA 5EN5D 4MKTA 3FU6A 1VYKA 3TWSA 3ZSUA 1U3CA 3PHF2 3D9JA 3PCVA 3C3OA 3ZEFA 1YLMA 3H2UA 1NLXA 2XLEA 2ETCA 2LIGA 1DC2A 2R7RA 3ABKE 2GRNB 4EBJA 4E6HA 2CDQA 1ZVZA 2AWYA 3Q75A 3EHQA 3AG2E 3LY7A 3EPVA 3U9JA 3CGHA 5B3SE 4U5FE 2RSEB 3DSSA 1N0RA 1EYHA 1LVKA 2XS1A 4CS7A 4PACA 4O6MA 2QTVA 3SHFA 2JX0A 4BFRA 1K1AA 4KMOA 1ZYRF 1UG7A 4PJMA 2FO1E 1HF8A 3L1MA 3W9GA 3ZW3A 4DRIB 3L6AA 2CHZA 1F1MA 4IRUA 1OWNA 1HE1A 1LIHA 3DSXA 1JRAA 3LYAA 2DBAA 2VGXA 4MVZA 1YA7O 4GPMA 4P9FA 1K8KG 4BPMA 2QC9A 3MEKA 4YVOA 4CDAA 4HFKB 3DWLG 4GAAA 1MMNA 1BR2A 1O5MA 2HJMA 4WABA 1MZCA 4DJ9A 3MKQA 3R9AB 1KZOA 1QBQA 1C02A 2I9CA 1Y6DA 2NUTB 5H7PA 4IAOA 2HKVA 3RFYA 5B3IA 3EFOB 3TG4A 3NF1A 4CZ2D 3SBTB 2P6VA 2GW1A 2WXIA 2ZGGA 1TN6A 2XM0A 5KYNA 1OW7A 3NZUA 1G8XA 3UM0A 3AG4E 4H7XA 3UPVA 3LVRE 1TWGA 1SZIA 5ENTD 1RW2A 2D4UA 3ZN3A 2FF4A 5ENNA 1X81A 3AS8A 4EZLA 4PDXA 2XGMA 3QWWA 4GA2A 1A7DA 2IEJA 4JKVA 1SF8A 2LAIA 4EBAA 1RKEB 4B6IA 1B68A 4A4AA 3ZC4A 1NL4A 4H7YA 2YEVA 1YJGA 3QDNA 4GQHA 3RO3A 1NZNA 1TNZA 1Z5SC 4UQZA 1N4SA 4Q4ZF 1T9KA 3PUKA 4ACLA 4CJGA 2BKKB 3VTXA 3LNRA 2IXMA 4J6IA 3L8JA 5HKPA 2IONA 2NYJA 5G04J 4YL1A 3PDNA 3CHQA 2L9JA 3ZVRA 2DYRC 4CS8A 3TULA 3IEGA 4BEMJ 2Q7RA 1EKYA 3RF3A 3SD5A 1YYXA 5AQAA 4JW1A 5T8IA 5JA4D 5EILA 4XKCA 5EX3A 3HLZA 3N2ZB 1K3ZD 2RD0A 4O6FA 2I8BA 2PNOA 3WG7C 4HE8D 1ZB1A 3QARA 3POVA 4GYOA 4I2ZA 3ZHEB 4AK9A 2X51A 4IGGA 4BEJA 2EILE 4GCNA 4U5EE 4NCQA 4U96D 2JD3A 2I6HA 1RZ4A 4HXIA 4HEAJ 3RIPA 2IOQA 2X6KA 2JABA 4MW3A 2EPKX 3JYYA 4MVMA 2NSFA 2X6JA 1Q0FA 1UW4B 1H9GA 4JVSA 3C8GA 3AGUA 4CDYA 4U9DA 5KYWB 4HI9A 3C98A 4C48B 4AJWA 1QLEC 1CPQA 1Z7Qc 3GEEA 4JL0A 4PFPA 1R5ID 3F47A 1T01A 3V5ZA 3SXYA 4CDMA 3CHPA 2LP4A 3D9NA 1OR2A 4HRLA 4FHKA 3V2XA 4KI2A 2VYIA 256BA 2F8XK 2XL6A 2WXMA 2DYSC 1NZEA 1NG1A 5F28E 2JLBA 1SA5A 5ARFA 1BU9A 3FU0A 3H65A 3FU5A 3ZIBA 3QC1A 1G4WR 2MOWA 3CVUA 3QK0A 2EPMX 3ULYA 4C3DA 3BU8A 3ESLA 5D91A 1H2TC 4D4NA 5ANRA 4DI3A 2NUPA 4E18A 3M1CB 4NIKA 4YDOA 1OCZE 4I6EA 1K04A 3PNTB 2WB7A 1OKKA 3B9QA 1SYQA 2J8WA 4L23A 1E8ZA 2FFHA 2F22A 3NZSA 3MA5A 2YKZA 4RQIA 3TJ5A 4BESA 3B71A 5L0FA 3I3NA 2PBEA 2VGEA 3ZYQA 1RMVA 4ULVA 5CI9A 3RO2A 2WXLA 4WNFA 1BD8A 2LK4A 1TNBA 3KS2A 1D9SA 3GM2A 4CCAA 4K0DA 5B1AE 2WXKA 3U64A 3VAYA 5CEDB 1ZZPA 1U3DA 3NB2A 2MRIA 5JLIA 3C18A 4P6IC 4BERA 3EGDA 4DRJB 2ETSA 3LUTB 3UI2A 2YLDA 2DWZA 5AJLA 1J8YF 1CGME 5BNWA 1Q2ZA 2J08A 3CSTA 3FVYA 3TWUA 2X0CA 1CGNA 3TOMA 1FVHA 3CK7A 1VB5A 2OV8A 2AXZA 3CVYA 3UMKA 1D0YA 1G4US 3W8IA 3HHMA 1ZU4A 1YVIA 2L6HA 3AQBA 2AXUA 3ZVVA 3UXGA 2XLDA 2J0WA 3IHYA 1E7UA 3ASOE 5ITZF 3LCAA 1E84A 2VSXE 4PJJA 2HV7A 1ORSC 1PV3A 3Q9UC 5BUZA 1A5EA 4GTRA 1MMGA 4DRHB 3QOUA 5L0GA 4PH4B 2OOCA 4A2NB 1C17M 3NMKA 3W8HA 3T9KA 1XZPA 4AE4A 1BI7B 4HOSA 4IYPA 2PQNA 4JC7A 2AWIA 4ANVA 1H6OA 3MCXA 3PH0C 3LJ3A 5JUAA 3SZRA 2D5RB 4J8SA 4WAFA 1N4QA 3FULA 2CCYA 3AU5A 3KL4A 1H9TA 4LLCA 3FUIA 5E76A 4OD4A 2WMOA 2WXHA 3UM1A 3EQLF 4RG9A 2DB4A 3LS1A 4W8PA 3DSWA 2Q00A 4GA1A 2HUJA 3AJMA 4X0RA 1I4YA 3OXFA 4BT9A 4GYTA 1Q0KA 4AY5A 3EJNA 3DXKG 2XPZA 3DE9A 4F1SA 1OWMA 4OAVB 1WASA 3NG1A 1LS4A 5E33A 5FINA 1BBHA 1H6PA 4WNDA 2P58C 5KYXA 1N0QA 4HRMB 4TV3A 2A6EF 4YWQA 2P9LG 4APOA 3V79K 1XZQA 5CHEE 2M4EA 2XENA 4U7EB 1YARO 2A0UA 2XGOA 4UWHA 3C8GB 3HRAA 4KZCA 1Q0DA 4AOFA 3AG3E 1G5ZA 4MVUA 2R5SA 3FH8A 1S7ZA 4U07A 2WVOA 5KYUA 3B7UX 3PREA 2HS5A 4XWJA 2Y4TA 4CGVA 4GYWA 5DQTA 1MNDA 4DXWA 4XTKA 3T6BA 4YJWA 4KBLA 1Z23A 4BT8A 1HY5A 1M2VA 3UM3A 4CGWA 2I2OA 1BR4A 1XGWA 1YMPA 3UUXA 5CCMA 3DD7A 4W8KA 3LS8A 1ZHWA 2CNWA 2UWJG 2GROB 2ZGDA 1VYIA 5DS5A 3FUHA 2WXGA 1E2XA 2IXOA 1FMVA 3Q6NA 3C3QA 2R25A 2DIWA 2XZDG 4Z9IA 1EF1C 4GA0A 3MGBA 4WUYA 4EBAG 2PFDA 4CS9A 4AXHA 2J4DA 1LPEA 4CRWA 5KJNA 5A23A 2ZXPA 1Z3XA 3LS0A 3A9CA 2QYUA 2IYLD 3ULQA 3ENEA 3S27A 3JCUQ 2A69F 2QZAA 1AP7A 5EKQD 4MBGA 1OXJA 3QB2A 3CKCA 3ASGA 3UT7A 4AE4B 2PZIA 3FTUA 3TWVA 4K5CA 3NOCD 5F5HA 1IXVA 3KH2A 3TWQA 3HNKA 1OCZC 2YHCA 3UINC 1NU9C 3AG3C 1IHBA 5CIVA 3U3WA 1HMOA 1KTMA 4QI0A 1HE9A 2ZU6B 4G8KA 5G04C 4YN0B 3SFXA 2AVPA 1SMYF 3HXFA 5BPPA 2LSEA 4MTFA 3ZGQA 4TUMA 4RSYA 1TJFA 2R7OA 4I17A 3UMIA 1M56C 3PMRA 2OJED 3EGXA 1JCSA 3T6JA 3CVNA 2R59A 1HS6A 3SNXA 4BSZB 2Q9BA 2AW6A 1L3PA 1VOMA 4MVRA 2LUHA 4M63A 2IOSA 4A55A 2XSEA 4JJGA 4XQ1A 3G2WA 1N94A 3LJNA 3EIJA 1DVPA 5AGFA 4CBEA 2VSNA 3B7RL 4D4XA 1D8DA 4O1OA 2QY7A 4LDQA 5KNGA 3S84A 3FAPB 5LX8A 1OKKD 3JSZA 4PR9A 1ORJA 3NAWA 3CSKA 1IW7F 3US6A 1LE2A 4C7OA 3WODF 4URKA 3GEIA 3U4TA 3HKKA 5FJYA 5D66A 4JHJA 5KYYB 5E75A 4JPSA 3RH3A 1HG5A 2QYJA 3SFZA 3G4ZA 1JPLA 1M2OA 1N9AA 4GMJA 2J9VA 1EDUA 1QNFA 1HX8A 4JTDB 4LG6A 3FHEA 3RIBA 4ZLDA 4UWGA 3UGOA 4J32B 4N3CA 4U9EA 2IXNA 5FZRA 1TN8A 3EG9B 3K33A 4ONSA 5L0DA 1FR0A 1H2VC 4RLYA 4YDEA 5KYXB 3LEOA 1A17A 3HIZA 3SXMA 3VLDA 3U2MA 1XNFA 1TKNA 2W9YA 4MVSA 3FUMA 3TXNA 4I6JA 3MYVA 1BDJB 2GDCA 3JSEO 4CDNA 1Y8MA 4F6RD 4GTSA 3B7SA 1DOWA 5FQ6A 3EGXB 1E83A 2A1DD 1M6TA 3CHMA 5KYUB 3ZNGA 2Y0BG 4AV7A 2J46A 3PE3A 4U63A 2QFCA 2P9KG 4E0HA 3GZ1A 5EHHA 1JUQA 2BL2A 4N06A 4J8DA 4Q5SF 4N6CA 3SBSA 4XZ4A 5AAOA 3UMVA 2GFHA 2P61A 1JR8A 4GZ6A 4BX9A 5BQIA 2WZGA 3FTWA 2J9QA 4WWOA 5DVWA 4BJ6A 3OEOA 1TQGA 5T3TA 2F8YA 2IM8A 1NFIE 3KD7A 5T1DB 1MJ0A 4WNGA 3R9MA 3DAFA 3D9PA 4KVMA 2YL0A 5BT1A 2VH3A 3FTYA 3EH1A 4RVBA 3I4UA 3PEVB 1UOHA 2KC3A 4QFVA 5HQ8A 4Q96A 3Q7LA 1N1CA 1O3UA 1FT2A 5CRVA 2X6FA 4HI8A 3PZ1A 4IN3B 2LO6A 1FVFA 4UWFA 4LNBA 3PZDA 2X6IA 4BTBA 2WQ7A 1PCXA 3R7RA 4JJFA 2HE0A 2XCBA 1A0BA 2R2LA 1E7VA 3AJIA 4E7ZA 2FGYA 1YA0A 3CVQA 3PUJA 3D9HA 4M7CA 2PX0A 2WXQA 4IB4A 5KJKA 1APCA 3FY4A 4FJYA 4N6HA 4XEKA 2ZD9A 5CRUA 5EIBE 2VCCA 2XPIA 3DM5A 2WVIA 1X5BA 2WZFA 2R7XA 3E33A 3X2QC 1YYJA 3G2VA 3QMKA 4HBDA 3UIPC 2NUTA 1TFOB 3IV0A 4GTMA 5BXUA 3LKUA 2IO2C 3FWVA 3ZTZA 1TJCA 2JPUA 3ZIMA 1E85A 4JC8A 4K0RA 3SI5A 1MYOA 1C03A 4FAPB 4CSAC 2HV6A 1VK5A 1RXQA 3T5XA 2XLWA 2Y39A 2KCVA 5IY5E 1D8EA 3EGDB 1UG3A 2XZTG 2KZTA 2KBXA 4IARA 3RW0A 4JEBA 2IU1A 4JB8P 4PFOA 3CHSA 2C04A 2YL3A 2L6GA 4GCOA 4DOZA 4JTAB 2XEVA 2YQ8A 3TL5A 1RKEA 3L13A 3TG5A 2LD6A 1SW6A 1OW8A 4I1AA 5FQ7A 2V3CC 3FH7A 4HQDA 2IFUA 1I5NA 2LFFA 1M57C 2ICWG 1TN7A 3U0CA 2KC7A 1YZCA 5JRAA 3RRMB 3V5YA 1V4AA 3FHDA 3IBEA 4DI4A 2R7SA 3HNLA 2XLVA 4HB5A 4JTCB 5K0IA 4JURI 2I15A 4NC3A 3UNGC 1JCRA 1LM3B 3LLIA 3FOOA 3T8KA 2W4MA 5DIZA 3RQGA 2HSQA 4F7AA 4MNDA 4AL0A 1OY3D 2X38A 1ZHYA 4IAQA 2EIKC 2OCCE 5E3AA 3AS5A 3URZA 2XEEA 5JS5A 2L81A 2OG2A 3C7JA 5AJDA 3GEHA 3KPHA 4B89A 1TR2A 3DEPA 2R17C 3HVEA 3ML8A 4AEZC 3H2VA 5D0QD 1AWCB 4G25A 3IQ6A 2Y4UA 1T6IA 3QVZA 1P5QA 2NUPB 3O48A 3KSQA 4MS2A 3QJZA 4HOUA 4K7BA 2EIJE 4D10C 2UUHA 3C5RA 1N54A 3FUEA 4XPWA 3Q79A 3AG4C 2LAHA 1WATA 5ANLA 4L1BA 3JXIA 4V3IA 2H6GA 1D0XA 3CVLA 2YL7A 5DS6A 2WQHA 3TWTA 3PDMP 1T6QA 2J9WA 3NQPA 4CSAA 3I5PA 4C7OB 3APCA 4PS3A 3KYJA 5FIOA 4CX9A 5J08A 4NQFA 3G2TA 4C0MA 4KZ0A 3ZXSA 3G2SA 4C0EA 4BETA 3S28A 3K1HA 4BX8A 2AJAA 3GW4A 5EDSA 3IQ5A 3Q5MA 3GANA 3IEEA 2R7VA 1PC2A 4RBNA 4ULWA 3T4RA 4ILHB 4EZKA 3QVYA 2YRFA 4A1SA 3RQFA 5E3CA 3MX3A 2L0TB 1AEPA 4Z9JA 3R7CA 3S2AA 2AWCA 3NRHA 1ZHXA 4GZ3A 3GM1A 3CVPA 1UFBA 1MQSA 1D1AA 1YAUO 3VM6A 4XI9A 1MMAA 2LSVA 4PS7A 3HXDA 4OD5A 2AXVA 1MX6A 5BW8C 4U5GA 3ASDA 3PRZA 3L8IA 1RJ9A 3HG0D 5D0OD 4CIPA 4QQIA 2YLIA 1OR3A 4DUIA 2EIME 4U5BE 4AM9A 1H6KA 3S7JA 4LDRA 4UI9K 5DQZA 2VCBA 3PVLA 4J7YA 3ASNC 3CQGB 1BI8B 4EBBA 4APFA 4O60A 2B0JA 2CGEA 3OA1A 5LCWC 2EIJC 2FAPB 2H7BA 2Y3AA 4EWCA 1NI1A 4GTTA 4PJNA 3R2PA 3L0IA 3UQ3A 1S0PA 5L0HA 1JWFA 2CW0F 4FLHA 2YVKA 5LCWJ 4IJJA 4AL1A 3KEAA 2WVNA 4LACB 1QYMA 3W2WA 4WGYA 1FFTC 1N4PA 4R7LA 4BJTA 4YDWA 2Q9AA 2P7VA 3LJBA 4JZAA 1OXKA 3N24A 2J9UA 3Q7GA 1QQ3A 4GMRA 1WY6A 1S05A 2XEHA 5ENRD 3D9KA 3IQCA 4YL3A 2TMVP 4OAUC 3CKBA 4BJ6C 4ANUA 3O55A 2CNWD 5CMYA 1JCQA 1Z63A 4XE0A 4NTFA 4Y6WA 4O6YA 5CERB 3V5XA 2ZPAA 4GB9A 3SZ7A 5EK0A 3RKVA 3NYJA 2WM9A 4Q94A 4DBRA 3AAAC 3A11A 3V2OA 4G26A 3MBGA 2VGYA 1N95A 3SQVA 4WWNA 1AUEA 2R7TA 1VLSA 3SGHA 1A7VA 3U3FA 2Q9CA 5FZTA 2GGFA 2ZXRA 5L0CA 3D3MA 3E34A 3PNLB 1IHGA 5B1BC 3J5PA 3CAXA 3ASNE 2R05A 2HSBA 2GRRB 3M4CA 4XI0A 2CHWA 3GYZA 3ZYMA 4J8EA 1LD8A 4ZLCA 4BWRA 1D0ZA 1U89A 3NKEA 1FMWA 1OWOA 4EHPA 3TWXA 2HO1A 4YVQC 2IQCA 2IJGX 3ZRHA 2KGOA 5FCLA 2VJ8A 4NURA 4DVYP 3B0UX 2B0OE 4ACKA 1YDIA 3JYHA 4NTBA 1H6GA 3C72A 4ILIA 3T9OA 3G4XA 2KATA 4I43A 4KT6B 1IQRA 2RG8A 3JQ1A 2A5UA 2WXFA 3SY2A 3RKOF 4F53A 5CBOA 1O1SA 4NACA 5FZQA 2BKGA 3UTMA 3RJVA 1OCRC 1WAO1 4WGZA 3E32A 3NYMA 3FTVA 1CGOA 1QVXA 5DLJA 1HU3A 2Z15A 5AIJA 4FA6A 1KNYA 4YK5A 1PD1A 4Q7CA 4U8HA 3RSEG 2HR2A 1VDYA 3D9MA 1NFNA 1DNPA 3CK8A 5A6BD 3U9MA 1BPOA 1I4ZA 3LXUX 2VGXB 4BEPA 2L7AA 4BJ5C 5C1DA 4HFGA 3E4BA 1N4RA 3HVEB 3ASOC 4K5BA 3B7BA 4FHJA 5AYWD 2GAQA 1QKRA 3AQCA 3EFOA 4UDVA 4U0SA 3RRUA 2UUIA 3O6XA 2FEZA 3OXLA 1ZHZA 5KCMA 3ZUVB 5G2NA 2BTDA 4C3BA 1Z3YA 1RJ9B 1WG0A 3L34A 4L6RA 3FUJA 3FUFA 1ZU2A 1V54C 1OCOE 4DX2A 1Z3IX 4BJ1A 2KYHA 2VTBB 1QPUA 2UY1A 4CS9C 3U3BA 2Q7FA 2ONDA
chains in the Genus database with same CATH topology
2QY9A 3B0PA 5LFAA 3SEOA 5C2YA 4FC8A 3KMIA 3MKRA 4N5CA 1E90A 2KM4A 3ABLC 4BY6A 3CR3A 3FP3A 4G7OF 4KXKB 3B0VC 2PM7A 3AS4A 2E0IA 4U5CE 4I2WA 4OIRF 2EIMC 5LP0A 2VSOE 1D1CA 4G24A 4CS8C 3LLKA 1ELKA 4EECA 3U66A 1TWHA 4O7GA 4JCHA 3LVQE 4PK4A 5A6CA 4OINF 4A3TA 2PP4A 3CHOA 4ILGA 2CG2A 2PQRA 2VQ2A 3AU4A 3JQ0A 4J0UA 5D92A 4N3BA 4G7ZF 2WPVA 3TD7A 3S7BA 3TGOA 2Y3GA 1GW6A 1OUVA 3O4ZA 3CV0A 4HVBA 4XKBA 1SZ9A 3HYMB 1QZ2A 3BEEA 3RK6A 4F3VA 5EX0A 1HE8A 3ZPJA 3L16A 2FULA 2XGSA 2J7PA 2OVFA 2V8SE 2ILRA 5JJTA 4ABNA 2V4LA 4JA9A 3S7FA 3U9WA 3QAQA 2NSZA 2VB6A 2J49A 2XRZA 3P2BA 3SF4A 4DK5A 2V26A 1Z5ZA 3LAYA 5T3WA 4EPZA 4RD9A 2YHEA 3ZYKA 4FP7A 4E85A 3LEWA 4HS2A 3KKBA 2HYZA 4DLQA 1B89A 4B8AA 2V0PA 4ME2A 4FULA 2NG1A 4NQ0A 1UN9A 4QDLA 3VTYA 1NA3A 4UWKA 3DAGA 3JUIA 2C03A 4I9CA 1V55C 3K1IC 3RU0A 4DBQA 2J4BA 1Z6AA 2EINC 2MHKA 3LEVA 3LDZA 3PEUB 2LSUA 3HTKC 4DPRA 4AIFA 4G2VA 3WXXA 3DZAA 3Q4AB 4DVZA 3K7DA 3B7TA 3CHRA 2I1KA 4N2SA 5BV0A 4MQ9F 2VTBA 4RDAA 3CVXA 1INZA 4JEUA 3ASFA 1SZAA 1NP7A 3CIAA 2VSYA 4GU5A 4FESA 1WM5A 4EZJA 3N71A 3ZYLA 3MV2B 2ZXOA 4RG6A 5L3QA 3I4RB 1OCOC 1O5HA 2WXPA 5BV1A 5JHAA 3AG1C 4MRUA 4JEHA 2G62A 4CT0A 4AY6A 1LS1A 1PD0A 3ABMC 3HJCA 1HG2A 4NRHB 4B0ZA 1O87A 3PE4A 1UJJA 3ITFA 2WXJA 3UX4A 4PJLA 2KZTB 3ML9A 4B94A 3VLEA 4ANXA 1HXIA 3ABKC 2E2EA 3EDTB 2IOLA 3K6BA 5HSWA 2A4ZA 4UWLA 3DMDA 2XRHA 4L7TA 3CZ6A 3ESKA 3S7DA 3N0TA 2X6HA 2WZLA 4PUCA 4Q69A 1E96B 3VYWA 2C0LA 2WXOA 4BTAA 3VLFA 1OWPA 2C0MA 4W9RA 3LPZA 4G0HA 1TWCA 1LF8A 5DS4A 1L5JA 4G7HF 3RRNB 3DJUB 2DCPA 2FBNA 2CHXA 3QWVA 2OVBA 1QQEA 5JJ7A 3FH5A 3E9VA 4XX5A 2XHEA 4N39A 4U0ZA 2CG3A 5B1AC 1OWLA 2YNQA 5M72A 3TAXA 1NU7D 4I44A 3JRTA 4C9BB 1OCCC 5J90A 4NY3A 2HM8A 4FLBA 3KEZA 3FUNA 4UI9J 4J30B 5HI7A 1JPJA 3DM9B 5F5FA 4HORA 2OCCC 3FEYA 1HH8A 1JWGA 2XRYA 5CMWA 4YT4A 3CLJA 3FUDA 4WJ0A 3Q6MA 3BG1B 5DBKA 4CIHA 2KNHA 3EZHA 3SP1A 3Q15A 2WMNA 4YT2A 4UI9C 3QZCA 1D1BA 1E8YA 1FTSA 2KQ9A 5KYYA 3DXJF 4UQYA 3I5QA 5G05C 5EGYA 3CEQA 3F46A 3RYLA 5LOZA 4QI2A 4F4BA 2GRLA 3GZSA 3EG9A 3UMHA 4I1OB 4O6NA 3MLGA 3FTZA 4I9EA 5FT9A 1PY1A 4IWBA 2LNIA 2L6JA 2PM6A 4KNVA 2MWQA 1FCHA 3CSFA 4FJZA 3JT1A 4ANJA 4GZDA 2XL4A 4HOQA 2WVQA 4I6GA 1Z6TA 4GMLA 2H7OA 1IZMA 5T3RA 2PF4E 5A7DB 2YHSA 2Y3DA 2NXPA 5FZSA 4GPKA 2UY1B 3JCKC 1H0AA 3OAWA 1ELWA 2CFUA 2NC9A 4TUUA 4LCTA 2L0IA 2V5FA 4CEMA 1E8XA 5T4YA 5FTPA 3W2VA 3FTSA 1FFHA 4OYSA 2DGJA 3FU3A 4IULA 2A68F 2G3VA 2YZSA 2BF0X 4O79A 1MNEA 3GODA 3QWPA 4AVXA 2H7VC 2MYSA 2G3KA 2Y3HA 2BUGA 4Y6CA 1SQMA 3MV3B 4KBQA 2KCKA 1PAQA 1ZHTA 1KLXA 1BR1A 3D9OA 2J45A 5JHBA 2J09A 3PS6A 2XQ0A 1LKXA 3SNHA 3GZ2A 4GZCA 2XXAA 1W3BA 5BUOA 1TWAA 1MMDA 5KJLA 4U5DE 3OXGA 4OIQF 3FFLA 2L9BA 2J7PD 4FX5A 2W45A 3Q47B 4PS8A 5E2QA 5G55A 4XLNF 3NYLA 1N52A 3TJPA 4OIOF 4OVVA 1KT1A 4LUNU 4DJAA 1KT0A 2KJGA 2M63A 4GZ5A 2GRMA 4G1TA 3IHVA 4N2QA 4EQFA 3EH2A 2JEKA 5KYWA 2PL2A 3D9LA 1UJKA 3L17A 3D9IA 4YT8A 3UR3C 3S29A 4P29A 2IF4A 3MZLB 3ASHA 4U04A 2W4BA 4BG0A 1JPNA 2WB2A 3EIQC 1MHQA 3FEXA 4KNWA 2FI7A 4GYYA 3LY9A 4M3OA 2X3MA 3E70C 5L3VA 4L2YA 4I3MA 4U5HA 3G2UA 3T8MA 4LERA 4DLOA 2A6HF 3B13A 4G23A 1WGWA 4OVUA 2Y3BA 3QKYA 5B3SC 2VASA 3EZIA 3DPDA 4YT5A 4H4KC 4I1MA 4BJ5A 3ECSA 3K66A 1HFAA 4WNEA 3LY8A 3R7QA 1HZ4A 4KVOA 2YINA 4A3VA 3APDA 2Y69C 4HOTA 4HFFB 5JJ6A 1IYGA 4JZYA 3NDBB 4N3AA 3ONKA 3DBSA 2IXPA 2C2LA 3JYSA 4JHKA 4CT4A 5AENA 1IQUA 2R7UA 3O39A 3FAJA 4HLEA 4FADA 3LESA 2BE5F 2WXRA 3S0XA 3ZFWA 4E7SA 4FWVA 1ZU5A 3APFA 1M2VB 2CFZA 2XPYA 3FDQA 4BSXA 4JHRA 3ONLA 4XLPF 3MKQB 3L08A 2J0XA 5CCLA 4A1GA 3CVVA 3V7OA 3T5VA 4LRZA 2E87A 5ARGA 5FWQA 2EQXA 5FQ4A 5CI8A 4LEUA 2XCCA 1ZBPA 1EPUA 3KAEA 4K03A 3BG0B 4XIFA 4JA7A 3Q49B 1VMAA 3AG2C 4YNDA 1H2UA 2WL8A 3EHNA 4LLEA 3IKOB 4AP2A 2WQ6A 4J8FA 4ANWA 4TRQA 3L54A 4G11A 4ATGA 3NKDA 3SYNA 2EILC 4U0UA 4AX2A 2R7WA 2J07A 2R7QA 2ZXWC 4JXTA 1KU2A 3P1UA 4MLPA 2PX3A 4C3EA 1J8MF 1NA0A 2KCLA 1W2WA 5FQ8A 4L2LA 3HDXA 4B8CB 5KJMA 3CVWA 2Q3TA 5G05J 3ZHEA 3EHMA 4UQXA 3I4GA 3TXMA 3FUKA 3X1OA 3DJNB 2XXAB 3OTNA 1UN8A 2KW3C 4OIPF 3ZG1A 1ST6A 3UT8A 3MJWA 1HO8A 3CQZA 3FTXA 3UT4A 3K9IA 4WWPA 4CDRA 4KYOB 2WXNA 1Y6IA 1H19A 1TEZA 3CK9A 2O9XA 3L22A 2I1JA 2FO7A 4KC9A 5IY5C 1ELRA 4MS6A 3QNKA 4FU3A 4GEHA 1E8WA 3OWTA 2OOEA 1QZXA 3CQCB 3FDHA 3UGPA 4MKTA 3FU6A 1VYKA 3ZSUA 1U3CA 3PHF2 3D9JA 3ZEFA 2R7RA 4E6HA 2CDQA 3LY7A 3EPVA 3CGHA 4U5FE 1EYHA 1LVKA 4CS7A 4O6MA 2QTVA 3SHFA 4BFRA 4KMOA 1ZYRF 4PJMA 1HF8A 3ZW3A 3L6AA 2CHZA 4IRUA 1OWNA 3LYAA 2DBAA 2VGXA 3MEKA 4YVOA 4HFKB 4GAAA 1MMNA 1BR2A 3MKQA 3R9AB 2I9CA 2NUTB 4IAOA 3RFYA 3EFOB 3TG4A 3NF1A 3SBTB 2P6VA 2GW1A 2WXIA 5KYNA 3NZUA 1G8XA 4H7XA 3UPVA 3LVRE 1TWGA 1SZIA 3ZN3A 2FF4A 5ENNA 3AS8A 4EZLA 4PDXA 2XGMA 3QWWA 4GA2A 1SF8A 2LAIA 4EBAA 4B6IA 3ZC4A 4H7YA 2YEVA 3QDNA 3RO3A 1NZNA 4UQZA 4Q4ZF 3PUKA 4ACLA 3VTXA 3LNRA 2IXMA 4J6IA 2IONA 5G04J 3PDNA 3CHQA 2L9JA 3ZVRA 2DYRC 4CS8A 3IEGA 3SD5A 4JW1A 5T8IA 4XKCA 5EX3A 3HLZA 3N2ZB 2RD0A 4O6FA 2I8BA 3WG7C 4HE8D 3QARA 3POVA 4GYOA 4I2ZA 3ZHEB 4AK9A 2X51A 4BEJA 4GCNA 4U5EE 2JD3A 2I6HA 4HXIA 4HEAJ 3RIPA 2IOQA 2X6KA 2X6JA 1UW4B 4JVSA 5KYWB 3C98A 4AJWA 1QLEC 4JL0A 4PFPA 3F47A 4CDMA 3CHPA 3D9NA 4FHKA 4KI2A 2VYIA 2WXMA 2DYSC 1NZEA 1NG1A 2JLBA 5ARFA 3FU0A 3H65A 3FU5A 3ZIBA 3QC1A 2MOWA 3CVUA 3QK0A 4C3DA 3ESLA 5D91A 1H2TC 5ANRA 4DI3A 2NUPA 3M1CB 4I6EA 3PNTB 2WB7A 1OKKA 3B9QA 4L23A 1E8ZA 2FFHA 3NZSA 3MA5A 3I3NA 3ZYQA 5CI9A 3RO2A 2WXLA 4WNFA 3KS2A 4CCAA 4K0DA 2WXKA 3U64A 3VAYA 1U3DA 2MRIA 4P6IC 3EGDA 5AJLA 1J8YF 5BNWA 2J08A 3CSTA 3FVYA 1FVHA 3CK7A 2OV8A 2AXZA 3CVYA 3UMKA 1D0YA 3W8IA 3HHMA 1ZU4A 3AQBA 2AXUA 3ZVVA 2J0WA 3IHYA 1E7UA 3LCAA 2VSXE 4PJJA 2HV7A 5BUZA 1MMGA 3QOUA 4PH4B 4A2NB 3W8HA 4AE4A 4HOSA 4IYPA 2PQNA 2AWIA 4ANVA 3MCXA 3PH0C 3LJ3A 4J8SA 3SZRA 2D5RB 4WAFA 3FULA 3AU5A 3KL4A 5E76A 3FUIA 4LLCA 4OD4A 2WMOA 2WXHA 3EQLF 4RG9A 3LS1A 4GA1A 4X0RA 3OXFA 4BT9A 4GYTA 4AY5A 3EJNA 2XPZA 4F1SA 1OWMA 3NG1A 5E33A 4WNDA 2P58C 5KYXA 4TV3A 2A6EF 4YWQA 4APOA 5CHEE 2M4EA 2XGOA 4UWHA 4KZCA 4AOFA 2R5SA 3FH8A 1S7ZA 4U07A 2WVOA 5KYUA 3B7UX 3PREA 4XWJA 2Y4TA 4CGVA 4GYWA 5DQTA 1MNDA 4XTKA 3T6BA 4YJWA 4KBLA 1Z23A 4BT8A 1M2VA 4CGWA 2I2OA 1BR4A 1XGWA 3UUXA 5CCMA 3DD7A 4W8KA 3LS8A 1ZHWA 2CNWA 2UWJG 1VYIA 5DS5A 3FUHA 2WXGA 2IXOA 1FMVA 3Q6NA 2DIWA 1EF1C 4GA0A 3MGBA 4WUYA 4EBAG 2PFDA 4CS9A 4AXHA 2J4DA 4CRWA 5KJNA 5A23A 2ZXPA 1Z3XA 3LS0A 2IYLD 3ULQA 3ENEA 3S27A 3JCUQ 2A69F 5EKQD 3QB2A 3CKCA 3ASGA 3UT7A 4AE4B 2PZIA 3FTUA 5F5HA 3KH2A 1OCZC 2YHCA 1NU9C 3AG3C 3U3WA 4QI0A 2ZU6B 5G04C 4YN0B 2AVPA 1SMYF 5BPPA 2LSEA 3ZGQA 4RSYA 1TJFA 2R7OA 4I17A 3UMIA 1M56C 3PMRA 3EGXA 3T6JA 3CVNA 2R59A 1HS6A 3SNXA 2Q9BA 2AW6A 1VOMA 4M63A 2IOSA 4A55A 2XSEA 4JJGA 3G2WA 3EIJA 1DVPA 4CBEA 2VSNA 3B7RL 2QY7A 5LX8A 1OKKD 3JSZA 3CSKA 1IW7F 4C7OA 3WODF 4URKA 3U4TA 5FJYA 4JHJA 5KYYB 5E75A 4JPSA 3RH3A 1HG5A 3SFZA 1JPLA 1M2OA 4GMJA 2J9VA 1EDUA 1QNFA 1HX8A 3FHEA 3RIBA 4ZLDA 4UWGA 3UGOA 4J32B 4N3CA 2IXNA 5FZRA 3EG9B 3K33A 1H2VC 5KYXB 1A17A 3HIZA 3VLDA 1XNFA 1TKNA 2W9YA 3FUMA 3TXNA 4I6JA 3MYVA 4CDNA 1Y8MA 3B7SA 5FQ6A 3EGXB 2A1DD 3CHMA 5KYUB 4AV7A 2J46A 3PE3A 4U63A 2QFCA 3GZ1A 5EHHA 1JUQA 4N06A 4J8DA 4Q5SF 3SBSA 4XZ4A 3UMVA 2GFHA 4GZ6A 4BX9A 2WZGA 3FTWA 2J9QA 4WWOA 5DVWA 4BJ6A 3OEOA 5T3TA 4WNGA 3KD7A 5T1DB 3DAFA 3D9PA 4KVMA 5BT1A 2VH3A 3FTYA 3EH1A 4RVBA 3I4UA 3PEVB 4QFVA 5HQ8A 4Q96A 3Q7LA 1N1CA 2X6FA 4IN3B 2LO6A 1FVFA 4UWFA 3PZDA 2X6IA 4BTBA 2WQ7A 1PCXA 3R7RA 4JJFA 2XCBA 1E7VA 4E7ZA 2FGYA 1YA0A 3CVQA 3PUJA 2PX0A 2WXQA 5KJKA 3FY4A 4FJYA 2XPIA 3DM5A 2WVIA 1X5BA 2WZFA 2R7XA 3X2QC 3G2VA 3QMKA 2NUTA 3IV0A 3LKUA 3FWVA 1TJCA 3ZIMA 4JC8A 4K0RA 3SI5A 4CSAC 2HV6A 1VK5A 3T5XA 2Y39A 2KCVA 3EGDB 1UG3A 2KZTA 2IU1A 4PFOA 3CHSA 2C04A 4GCOA 4DOZA 2XEVA 2YQ8A 3TL5A 3L13A 3TG5A 4I1AA 5FQ7A 2V3CC 3FH7A 2IFUA 1M57C 2KC7A 3RRMB 3FHDA 3IBEA 4DI4A 2R7SA 4JURI 3UNGC 3LLIA 2W4MA 5DIZA 4F7AA 4MNDA 2X38A 1ZHYA 2EIKC 5E3AA 3AS5A 3URZA 2L81A 2OG2A 5AJDA 4B89A 1TR2A 2R17C 3HVEA 3ML8A 4AEZC 5D0QD 4G25A 2Y4UA 1P5QA 2NUPB 3O48A 3QJZA 4HOUA 4K7BA 4D10C 1N54A 3FUEA 3AG4C 2LAHA 5ANLA 4L1BA 4V3IA 1D0XA 3CVLA 5DS6A 2WQHA 2J9WA 3NQPA 4CSAA 3I5PA 4C7OB 3APCA 4PS3A 5J08A 3G2TA 4C0MA 4KZ0A 3ZXSA 3G2SA 4C0EA 3S28A 3K1HA 4BX8A 3GW4A 5EDSA 3Q5MA 3GANA 3IEEA 2R7VA 1PC2A 4RBNA 4ULWA 3T4RA 4ILHB 4EZKA 4A1SA 5E3CA 3MX3A 2L0TB 3S2AA 3NRHA 1ZHXA 4GZ3A 3CVPA 1MQSA 1D1AA 4XI9A 1MMAA 2LSVA 4PS7A 4OD5A 2AXVA 5BW8C 4U5GA 3ASDA 3PRZA 1RJ9A 5D0OD 4U5BE 4AM9A 1H6KA 3S7JA 4UI9K 5DQZA 3PVLA 3ASNC 3CQGB 4EBBA 4APFA 2B0JA 2CGEA 3OA1A 5LCWC 2EIJC 2H7BA 2Y3AA 4EWCA 4PJNA 3L0IA 3UQ3A 1S0PA 1JWFA 2CW0F 4FLHA 5LCWJ 4IJJA 2WVNA 4LACB 3W2WA 1FFTC 4R7LA 4BJTA 2Q9AA 2P7VA 3LJBA 4JZAA 3N24A 2J9UA 3Q7GA 1WY6A 3D9KA 3CKBA 4BJ6C 4ANUA 2CNWD 5CMYA 4XE0A 1Z63A 4Y6WA 4O6YA 2ZPAA 4GB9A 3SZ7A 3RKVA 3NYJA 2WM9A 4Q94A 4DBRA 4G26A 2VGYA 4WWNA 2R7TA 3SGHA 2Q9CA 2GGFA 2ZXRA 3D3MA 3PNLB 1IHGA 5B1BC 4XI0A 2CHWA 3GYZA 3ZYMA 4J8EA 4ZLCA 4BWRA 1D0ZA 3NKEA 1FMWA 1OWOA 2HO1A 4YVQC 2IQCA 2IJGX 3ZRHA 2KGOA 5FCLA 2VJ8A 4NURA 4DVYP 3B0UX 4ACKA 3JYHA 4ILIA 2KATA 4I43A 4KT6B 1IQRA 2RG8A 3JQ1A 2A5UA 2WXFA 3RKOF 4F53A 4NACA 5FZQA 3RJVA 1OCRC 1WAO1 3NYMA 3FTVA 5DLJA 1HU3A 2Z15A 5AIJA 4FA6A 1PD1A 4Q7CA 4U8HA 2HR2A 1VDYA 3D9MA 1DNPA 3CK8A 1BPOA 3LXUX 2VGXB 4BJ5C 5C1DA 4HFGA 3E4BA 3HVEB 3ASOC 4FHJA 5AYWD 3AQCA 3EFOA 4U0SA 3RRUA 3O6XA 2FEZA 3OXLA 1ZHZA 5KCMA 5G2NA 2BTDA 4C3BA 1Z3YA 1RJ9B 3FUJA 3FUFA 3L34A 1ZU2A 1V54C 1Z3IX 4BJ1A 2VTBB 2UY1A 4CS9C 2Q7FA 2ONDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKC A;  5E75 A;  4F7A A;  3MYV A;  3CK9 A;  3LEW A;  3MCX A;  3CK8 A;  3L22 A;  5FQ4 A;  5T4Y A;  5FQ7 A;  3CGH A;  3JQ1 A;  4F53 A;  5FQ6 A;  5FQ8 A;  3QNK A;  3EJN A;  5J90 A;  4L7T A;  3GZS A;  3HDX A;  5E76 A;  5LX8 A;  3FDH A;  5T3R A;  3KEZ A;  3CKB A;  4PUC A;  4Q69 A;  3JYS A;  3EHM A;  3SNX A;  4LER A;  3NQP A;  3JQ0 A;  3SGH A;  3I4G A;  3CK7 A;  3OTN A;  3MX3 A;  3P1U A;  3IV0 A;  3EHN A;  4MRU A; 
#chains in the Genus database with same CATH topology
 2QY9 A;  3LNM B;  3B0P A;  3FMS A;  5LFA A;  3SEO A;  5A6A A;  5C2Y A;  4FC8 A;  4TXQ A;  3KMI A;  3MKR A;  4N5C A;  1E90 A;  2KM4 A;  3ABL C;  2L6F A;  4BY6 A;  2MHR A;  3CR3 A;  3FP3 A;  4G7O F;  4MW8 A;  4KXK B;  1E86 A;  3B0V C;  2PM7 A;  2HMQ A;  3AS4 A;  4X8Q A;  5AQ9 A;  2E0I A;  3IQT A;  4U5C E;  1U2V G;  4I2W A;  5ENO D;  4OIR F;  2LXM A;  2EIM C;  5LP0 A;  2VSO E;  1D1C A;  4G24 A;  4K5A B;  3B95 A;  4DX5 D;  2KSF A;  4CS8 C;  1KZP A;  3LLK A;  1ELK A;  1T5O A;  3QW1 A;  1FPP A;  4EEC A;  3U66 A;  1TWH A;  3MYF A;  4O7G A;  2RD9 A;  4EUK B;  2GWW A;  4JCH A;  3LVQ E;  4MTO A;  3SXK A;  3WAQ A;  4PK4 A;  3WHN A;  5A6C A;  3AOU A;  1GGQ A;  5JT4 A;  5BXO A;  3MFN A;  4OIN F;  4A3T A;  2PP4 A;  3CHO A;  3ULE G;  4ILG A;  2CG2 A;  2PQR A;  2P0N A;  3FOP A;  2VQ2 A;  3AU4 A;  3JQ0 A;  4GTQ A;  4J0U A;  2YQY A;  1LTX A;  3Q9N C;  1A41 A;  5AN8 A;  5D92 A;  4N3B A;  1LD7 A;  4G7Z F;  2WPV A;  3TD7 A;  1OT8 A;  3S7B A;  3TGO A;  1OCR E;  2Y3G A;  3DEO A;  1GW6 A;  1L7C A;  1OUV A;  3CV0 A;  3O4Z A;  4HVB A;  1SVX A;  4XKB A;  4CJO A;  1SZ9 A;  3HYM B;  1QZ2 A;  3BEE A;  3RK6 A;  3Q73 A;  2EIN E;  4F3V A;  3RVY A;  5EX0 A;  4U8V D;  4H54 A;  1HE8 A;  3ZPJ A;  3L16 A;  2V4H C;  2FUL A;  2XGS A;  2J7P A;  5JP7 A;  1Q0M A;  2OVF A;  1MX2 A;  2J9B A;  2V8S E;  2ILR A;  5JJT A;  1WOL A;  4ABN A;  2EPL X;  4LDK A;  2V4L A;  3JXJ A;  4JA9 A;  2R03 A;  3S7F A;  3U9W A;  3QAQ A;  2NSZ A;  2VB6 A;  1BLX B;  2J49 A;  2XRZ A;  1H7I A;  3P2B A;  2KXP C;  3SF4 A;  4DK5 A;  3IPM O;  2B6C A;  1TNY A;  2V26 A;  1OXB A;  1Z5Z A;  3LAY A;  2HFI A;  5T3W A;  4EPZ A;  4RD9 A;  2YHE A;  3ZYK A;  4FP7 A;  2P9N G;  4E85 A;  3LEW A;  4HS2 A;  3KKB A;  3B29 A;  2HYZ A;  4JRZ A;  3KYI A;  4DLQ A;  3HXE A;  1B89 A;  3FXH A;  4B8A A;  2V0P A;  2H6H A;  2B0H A;  4ME2 A;  4FUL A;  3DKA A;  2NG1 A;  2Y1L E;  2NSG A;  4F1P A;  5AAR A;  4NQ0 A;  1UN9 A;  1DOV A;  4QDL A;  3VTY A;  3AGT A;  1NA3 A;  3ZU7 B;  2P9I G;  4UWK A;  3DAG A;  2R02 A;  1Q0G A;  3JUI A;  2C03 A;  4I9C A;  3UKU G;  2P9P G;  2A0B A;  4G8L A;  1V55 C;  3K1I C;  3RU0 A;  4DBQ A;  2J4B A;  1Z6A A;  2EIN C;  4EIY A;  2LQG A;  2MHK A;  3LEV A;  3ATP A;  2ZXW E;  3LDZ A;  5AQB A;  3PEU B;  3TWR A;  2NPU A;  1WTY A;  2LSU A;  3HTK C;  3K1I A;  4DPR A;  4G2V A;  1TNO A;  4AIF A;  3Q7A A;  5EID A;  1GM5 A;  4JD2 G;  3WXX A;  3DZA A;  3Q4A B;  4DVZ A;  3K7D A;  3B7T A;  2OEW A;  3CHR A;  2DYR E;  2I1K A;  3L9T A;  2H6I A;  4DX6 D;  4N2S A;  5BV0 A;  3ZWI A;  1SA4 A;  4MQ9 F;  2VTB A;  2DZN A;  3PZ2 A;  4RDA A;  4P9T A;  4R32 A;  2XS8 A;  3CVX A;  1INZ A;  3WG7 E;  4JEU A;  3ASF A;  1SZA A;  1NP7 A;  3CIA A;  2VSY A;  2LFD A;  4GU5 A;  1LI5 A;  4FES A;  3C3R A;  1IKN D;  1WM5 A;  3SO8 A;  4EZJ A;  4MTG A;  3N71 A;  3ZYL A;  3ZQY A;  1QSP A;  1HW2 A;  3MV2 B;  3Q78 A;  2ZXO A;  4RG6 A;  5A6J A;  5ENP D;  5L3Q A;  3I4R B;  2RFM A;  5ENQ D;  1OCO C;  1KPS B;  1O5H A;  1S63 A;  2WXP A;  5BV1 A;  5JHA A;  3AG1 C;  2KK1 A;  4MRU A;  4JEH A;  2G62 A;  3NMJ A;  4CT0 A;  4AY6 A;  2YWA A;  1LS1 A;  4Z9H A;  1PD0 A;  5AQ7 A;  3ABM C;  4A63 B;  3HJC A;  3G50 A;  4G78 A;  1HG2 A;  4NRH B;  4B0Z A;  1O87 A;  3PE4 A;  2DI3 A;  1OCC E;  1UJJ A;  3ITF A;  2WXJ A;  1YA9 A;  3ABL E;  5AC5 A;  3UX4 A;  4PJL A;  2YL1 A;  2KZT B;  3ML9 A;  4B94 A;  3VLE A;  3NOG D;  4ANX A;  2MYO A;  1HXI A;  3ABK C;  1GQA A;  2P9U G;  2E2E A;  3EDT B;  2IOL A;  5TJ5 E;  3K6B A;  5HSW A;  2A4Z A;  4UWL A;  4XPY A;  3DSU A;  3DMD A;  2GA0 A;  2XRH A;  3DRA A;  2OEV A;  3CZ6 A;  3ESK A;  4L7T A;  3S7D A;  3N0T A;  4B93 B;  4ER9 A;  2X6H A;  2WZL A;  3VF0 A;  2QLA A;  4PUC A;  1E96 B;  4Q69 A;  3BUA A;  3VYW A;  2HJ3 A;  2Y69 E;  3M79 A;  2C0L A;  2HMZ A;  1HMD A;  2WXO A;  4BTA A;  3VLF A;  2F0Y A;  1OWP A;  3TOL A;  4J7T A;  1V55 E;  2C0M A;  4LNU D;  3LPZ A;  4W9R A;  3L82 A;  3EU9 A;  4G0H A;  1TWC A;  4JCZ A;  1LF8 A;  5DS4 A;  1L5J A;  1ZW2 A;  4G7H F;  4J7W A;  3RRN B;  3DJU B;  2DCP A;  2FBN A;  5D2M C;  2CHX A;  3QWV A;  2OVB A;  1QQE A;  3SFY A;  5JJ7 A;  1JMW A;  3FH5 A;  3E9V A;  4XX5 A;  2XHE A;  3PZ4 A;  4NTA A;  4N39 A;  4U0Z A;  1EI7 A;  2CG3 A;  5B1A C;  1BZ4 A;  1OWL A;  1MQV A;  2YNQ A;  5CBN A;  3ZQV A;  1R4T A;  5M72 A;  3TAX A;  1NU7 D;  4GTO A;  2V5Q C;  4I44 A;  3M15 A;  3QW0 A;  4TXP A;  1RKC A;  4K1O A;  2LCH A;  3JRT A;  5HRY A;  4C9B B;  1OCC C;  5J90 A;  4NY3 A;  2HM8 A;  4FLB A;  1FAP B;  5JMN D;  3KEZ A;  3FUN A;  4UI9 J;  4J30 B;  5HI7 A;  1JPJ A;  3DPY A;  4HNA D;  3DM9 B;  5F5F A;  4HOR A;  2DYS E;  1YZA A;  5EYL A;  2OCC C;  2EIK E;  4O1P A;  3FEY A;  3CEX A;  1HH8 A;  1JWG A;  3C8Z A;  2XRY A;  1YYH A;  5CMW A;  1LE4 A;  3X2Q E;  4YT4 A;  3CLJ A;  3VRC A;  3FUD A;  4WJ0 A;  3Q6M A;  4HRN A;  3HNJ A;  2L6B A;  2EPO A;  3BG1 B;  3KSL A;  5DBK A;  4CIH A;  2KNH A;  3EZH A;  3SP1 A;  3Q15 A;  5L0J A;  2WMN A;  2IBF A;  4JEA A;  4YT2 A;  1JOG A;  4UI9 C;  3QZC A;  1D1B A;  3ZXP A;  1E8Y A;  1FTS A;  1EQ1 A;  3EUV A;  2KQ9 A;  3DE8 A;  4YL0 A;  5KYY A;  3DXJ F;  4UQY A;  1AVO B;  3I5Q A;  5G05 C;  2F37 A;  5JVE A;  5EGY A;  3CEQ A;  3JUE A;  4EHM A;  3F46 A;  1OQC A;  3RYL A;  4XEF A;  3BQO A;  5LOZ A;  4QI2 A;  4F4B A;  2GRL A;  3GZS A;  3ZKJ A;  3W9F A;  3EG9 A;  2IY0 C;  2YLG A;  2ETB A;  3ZTM A;  3UMH A;  4I1O B;  4O6N A;  3MLG A;  3FTZ A;  2RKK A;  4I9E A;  1EA8 A;  1PY1 A;  5FT9 A;  3IXE A;  4IWB A;  2LNI A;  2L6J A;  2PM6 A;  4KNV A;  5A69 A;  2MWQ A;  1FCH A;  3CSF A;  4ATZ D;  4FJZ A;  3JT1 A;  4ANJ A;  4GZD A;  1O1T A;  3E30 A;  2XL4 A;  4HOQ A;  2WVQ A;  4I6G A;  1Z6T A;  4GML A;  2H7O A;  1IZM A;  3U8V A;  2PF4 E;  5T3R A;  5A7D B;  2YHS A;  5BQG A;  3RAU A;  2Y3D A;  2NXP A;  5FZS A;  4GPK A;  2UY1 B;  3JCK C;  1H0A A;  3OAW A;  4CYM D;  1ELW A;  1Y4C A;  1FNT c;  2CFU A;  2NC9 A;  4TUU A;  4LCT A;  4N5Q A;  2XLM A;  2L0I A;  2AVK A;  2V5F A;  4CEM A;  1E8X A;  5T4Y A;  5FTP A;  3W2V A;  1HW1 A;  3FTS A;  3TQO A;  4U95 D;  2AU5 A;  3PZ3 A;  1FFH A;  4OYS A;  3V31 A;  4YDY A;  2DGJ A;  1TYQ G;  3S9O A;  3FU3 A;  2A68 F;  2G3V A;  2YZS A;  4IUL A;  2BF0 X;  4O79 A;  1MNE A;  2P1A A;  3GOD A;  3QWP A;  4AVX A;  2H7V C;  2MYS A;  1K1B A;  3HXC A;  2Y3H A;  2G3K A;  2BUG A;  1NSG B;  1SQM A;  4Y6C A;  3MV3 B;  1O1R A;  4KBQ A;  1U0B B;  2KCK A;  3M4B A;  1PAQ A;  1VTM P;  4DRX E;  1ZHT A;  1KLX A;  3ABM E;  4GTP A;  1BR1 A;  3D9O A;  2J45 A;  1YCS B;  5JHB A;  2J09 A;  3PS6 A;  1S70 B;  3U5S A;  5CEA A;  2XQ0 A;  1LKX A;  3SNH A;  3Q7F A;  2AP3 A;  3GOR A;  4EBK A;  1SR2 A;  3GZ2 A;  1CPR A;  4GZC A;  2XXA A;  1W3B A;  3DSV A;  3O10 A;  5BUO A;  1TWA A;  4XEI G;  1K05 A;  1MMD A;  2DVW A;  4Z68 A;  5KJL A;  4U5D E;  3OXG A;  3GWN A;  1N11 A;  2ZIS A;  4OIQ F;  3FFL A;  2L9B A;  2J7P D;  4L9P A;  4FX5 A;  2W45 A;  3Q47 B;  4PS8 A;  5E2Q A;  2XLO A;  5G55 A;  5COM A;  4XLN F;  3TWW A;  3NYL A;  5BQH A;  1N52 A;  3TJP A;  4OIO F;  4OVV A;  1KT1 A;  4LUN U;  4DJA A;  1KT0 A;  2A5E A;  2KJG A;  2M63 A;  4ZFH A;  4GZ5 A;  1DCQ A;  2GRM A;  4G1T A;  2QUP A;  3IHV A;  4N2Q A;  2VCA A;  3BRJ A;  4EQF A;  3EH2 A;  2JEK A;  4ZHB A;  5KYW A;  2PL2 A;  3D9L A;  1UJK A;  3L17 A;  3D9I A;  4YT8 A;  3UR3 C;  5A6B A;  3S29 A;  1K40 A;  4P29 A;  4MVO A;  2IF4 A;  2BED A;  3ASH A;  3MZL B;  4U04 A;  3UM2 A;  2OKU A;  2W4B A;  4JIO A;  5COG A;  4BG0 A;  1JPN A;  4E0I A;  2WB2 A;  3TK0 A;  3U8P A;  3EIQ C;  1MHQ A;  2OQM A;  3FEX A;  4KNW A;  2FI7 A;  4GYY A;  3LY9 A;  3DI5 A;  4LNG A;  4M3O A;  2X3M A;  3E70 C;  5KNH D;  1FT1 A;  5L3V A;  5GPG B;  4I3M A;  4U5H A;  4L2Y A;  2J8S D;  5JSL A;  3W4Y A;  3G2U A;  3T8M A;  4LER A;  4DLO A;  2A6H F;  3SXZ A;  2IO3 C;  2OEX A;  2M64 A;  3B13 A;  4G23 A;  1WGW A;  4OVU A;  2LXL A;  2Y3B A;  3QKY A;  5B1B E;  5B3S C;  2VAS A;  1XWJ A;  3EZI A;  1MX4 A;  3DPD A;  4YT5 A;  2QE9 A;  4H4K C;  4J8Y A;  3UKR G;  4I1M A;  3NMI A;  2RFA A;  4BJ5 A;  1A7E A;  3ECS A;  3F6Q A;  3K66 A;  1HFA A;  4WNE A;  3LY8 A;  3R7Q A;  3HXB A;  3J5Q B;  3C63 A;  1HZ4 A;  5HV9 A;  4KVO A;  1GS9 A;  2YIN A;  5COF A;  4A3V A;  3APD A;  2Y69 C;  4HOT A;  4HFF B;  5JJ6 A;  1IYG A;  4JZY A;  3EU5 A;  2XLH A;  3NDB B;  1WN0 A;  3RVZ A;  2CYD A;  2OU6 A;  3ONK A;  4N3A A;  3DBS A;  3V30 A;  2IXP A;  2C2L A;  3JYS A;  4TXR A;  4EKW A;  4JHK A;  4UUC A;  2XL8 A;  4CT4 A;  5AEN A;  2R9R B;  1IQU A;  2R7U A;  3UIO C;  3O39 A;  3FAJ A;  3RQE A;  4HLE A;  4DX1 A;  5A6K A;  1TNU A;  4FAD A;  1TFK B;  3LES A;  2BE5 F;  2H8A A;  3E37 A;  2WXR A;  3S0X A;  4GTV A;  3ZFW A;  4E7S A;  4FWV A;  1ZU5 A;  3APF A;  1M2V B;  1U6H A;  2CFZ A;  2XPY A;  3EHR A;  4N4W A;  3DST A;  3FDQ A;  1WDY A;  1DCE A;  2H6F A;  4BSX A;  4JHR A;  3ONL A;  4XLP F;  3MKQ B;  3L08 A;  3GWL A;  2J0X A;  1JAF A;  5CCL A;  4A1G A;  3CVV A;  3V7O A;  5HS0 A;  3T5V A;  4LRZ A;  2E87 A;  5ARG A;  3S90 A;  2EQX A;  5FWQ A;  5FQ4 A;  5CI8 A;  4LEU A;  3TJ6 A;  2XCC A;  1ZBP A;  1G3N B;  2GRQ B;  1EPU A;  5EYP F;  4CDV A;  3KAE A;  4K03 A;  3BG0 B;  1NFO A;  3ISM C;  4JA7 A;  4XIF A;  3Q49 B;  1VMA A;  4LSZ E;  3AG2 C;  2XM4 A;  4YND A;  1H2U A;  2OJQ A;  2WL8 A;  3QTH A;  3JTL O;  3EHN A;  3JZ0 A;  4LLE A;  3IKO B;  4AP2 A;  2HZ8 A;  3T6G B;  2WQ6 A;  4J8F A;  1WWP A;  2ZIR A;  4XEV A;  4ANW A;  3NBN B;  2ASR A;  4TRQ A;  2PNN A;  3L54 A;  4G11 A;  4ATG A;  3NKD A;  3SYN A;  4E17 A;  2EPN A;  2EIL C;  4U0U A;  4AX2 A;  2R7W A;  2J07 A;  2R7Q A;  2ZXW C;  5ENS D;  4JXT A;  3MYI A;  5AC4 A;  1KU2 A;  3P1U A;  4MLP A;  1V54 E;  3DWW A;  2VC9 A;  2PX3 A;  2DZO A;  4C3E A;  1J8M F;  1NA0 A;  2KCL A;  1W2W A;  5FQ8 A;  3GM3 A;  3ZDL A;  4L2L A;  1V74 B;  5CEC B;  3HDX A;  3U2L A;  1RCP A;  4B8C B;  5KJM A;  1ZW3 A;  2P9S G;  5KBA A;  3CVW A;  2Q3T A;  1LI7 A;  5G05 J;  3ZHE A;  3EHM A;  3IHU A;  4UQX A;  3I4G A;  3TXM A;  3BEH A;  3FUK A;  3X1O A;  3DJN B;  3JRM O;  2XXA B;  3OTN A;  4XPX A;  1UN8 A;  2KW3 C;  4OIP F;  3ZG1 A;  1ST6 A;  3UT8 A;  4U8Y D;  4MVQ A;  3MJW A;  1HO8 A;  2ETA A;  3CQZ A;  3FTX A;  3UT4 A;  2Q4F A;  3K9I A;  4WWP A;  4JE9 A;  4DX7 D;  3HNI A;  2BC5 A;  4CDR A;  2P2C P;  4KYO B;  5L0I A;  1OW6 A;  2WXN A;  2QNL A;  5KWD A;  3C8G D;  3AG1 E;  1TR4 A;  1T6U A;  2GRP B;  1NBB A;  1Y6I A;  3J06 A;  1H19 A;  1TEZ A;  3C62 A;  3CK9 A;  2O9X A;  3L22 A;  1ORY A;  2I1J A;  2FO7 A;  4KC9 A;  5IY5 C;  3DXM G;  1ELR A;  4HLL A;  3QNK A;  4GEH A;  1E8W A;  4FU3 A;  4MS6 A;  3OWT A;  2OOE A;  1QZX A;  1S64 A;  3CQC B;  1VLT A;  3FDH A;  3UGP A;  5EN5 D;  4MKT A;  3FU6 A;  1VYK A;  3TWS A;  3ZSU A;  1U3C A;  3PHF 2;  3D9J A;  3PCV A;  3C3O A;  3ZEF A;  1YLM A;  3H2U A;  1NLX A;  2XLE A;  2ETC A;  2LIG A;  1DC2 A;  2R7R A;  3ABK E;  2GRN B;  4EBJ A;  4E6H A;  2CDQ A;  1ZVZ A;  2AWY A;  3Q75 A;  3EHQ A;  3AG2 E;  3LY7 A;  3EPV A;  3U9J A;  3CGH A;  5B3S E;  4U5F E;  2RSE B;  3DSS A;  1N0R A;  1EYH A;  1LVK A;  2XS1 A;  4CS7 A;  4PAC A;  4O6M A;  2QTV A;  3SHF A;  2JX0 A;  4BFR A;  1K1A A;  4KMO A;  1ZYR F;  1UG7 A;  4PJM A;  2FO1 E;  1HF8 A;  3L1M A;  3W9G A;  3ZW3 A;  4DRI B;  3L6A A;  2CHZ A;  1F1M A;  4IRU A;  1OWN A;  1HE1 A;  1LIH A;  3DSX A;  1JRA A;  3LYA A;  2DBA A;  2VGX A;  4MVZ A;  1YA7 O;  4GPM A;  4P9F A;  1K8K G;  4BPM A;  2QC9 A;  3MEK A;  4YVO A;  4CDA A;  4HFK B;  3DWL G;  4GAA A;  1MMN A;  1BR2 A;  1O5M A;  2HJM A;  4WAB A;  1MZC A;  4DJ9 A;  3MKQ A;  3R9A B;  1KZO A;  1QBQ A;  1C02 A;  2I9C A;  1Y6D A;  2NUT B;  5H7P A;  4IAO A;  2HKV A;  3RFY A;  5B3I A;  3EFO B;  3TG4 A;  3NF1 A;  4CZ2 D;  3SBT B;  2P6V A;  2GW1 A;  2WXI A;  2ZGG A;  1TN6 A;  2XM0 A;  5KYN A;  1OW7 A;  3NZU A;  1G8X A;  3UM0 A;  3AG4 E;  4H7X A;  3UPV A;  3LVR E;  1TWG A;  1SZI A;  5ENT D;  1RW2 A;  2D4U A;  3ZN3 A;  2FF4 A;  5ENN A;  1X81 A;  3AS8 A;  4EZL A;  4PDX A;  2XGM A;  3QWW A;  4GA2 A;  1A7D A;  2IEJ A;  4JKV A;  1SF8 A;  2LAI A;  4EBA A;  1RKE B;  4B6I A;  1B68 A;  4A4A A;  3ZC4 A;  1NL4 A;  4H7Y A;  2YEV A;  1YJG A;  3QDN A;  4GQH A;  3RO3 A;  1NZN A;  1TNZ A;  1Z5S C;  4UQZ A;  1N4S A;  4Q4Z F;  1T9K A;  3PUK A;  4ACL A;  4CJG A;  2BKK B;  3VTX A;  3LNR A;  2IXM A;  4J6I A;  3L8J A;  5HKP A;  2ION A;  2NYJ A;  5G04 J;  4YL1 A;  3PDN A;  3CHQ A;  2L9J A;  3ZVR A;  2DYR C;  4CS8 A;  3TUL A;  3IEG A;  4BEM J;  2Q7R A;  1EKY A;  3RF3 A;  3SD5 A;  1YYX A;  5AQA A;  4JW1 A;  5T8I A;  5JA4 D;  5EIL A;  4XKC A;  5EX3 A;  3HLZ A;  3N2Z B;  1K3Z D;  2RD0 A;  4O6F A;  2I8B A;  2PNO A;  3WG7 C;  4HE8 D;  1ZB1 A;  3QAR A;  3POV A;  4GYO A;  4I2Z A;  3ZHE B;  4AK9 A;  2X51 A;  4IGG A;  4BEJ A;  2EIL E;  4GCN A;  4U5E E;  4NCQ A;  4U96 D;  2JD3 A;  2I6H A;  1RZ4 A;  4HXI A;  4HEA J;  3RIP A;  2IOQ A;  2X6K A;  2JAB A;  4MW3 A;  2EPK X;  3JYY A;  4MVM A;  2NSF A;  2X6J A;  1Q0F A;  1UW4 B;  1H9G A;  4JVS A;  3C8G A;  3AGU A;  4CDY A;  4U9D A;  5KYW B;  4HI9 A;  3C98 A;  4C48 B;  4AJW A;  1QLE C;  1CPQ A;  1Z7Q c;  3GEE A;  4JL0 A;  4PFP A;  1R5I D;  3F47 A;  1T01 A;  3V5Z A;  3SXY A;  4CDM A;  3CHP A;  2LP4 A;  3D9N A;  1OR2 A;  4HRL A;  4FHK A;  3V2X A;  4KI2 A;  2VYI A;  256B A;  2F8X K;  2XL6 A;  2WXM A;  2DYS C;  1NZE A;  1NG1 A;  5F28 E;  2JLB A;  1SA5 A;  5ARF A;  1BU9 A;  3FU0 A;  3H65 A;  3FU5 A;  3ZIB A;  3QC1 A;  1G4W R;  2MOW A;  3CVU A;  3QK0 A;  2EPM X;  3ULY A;  4C3D A;  3BU8 A;  3ESL A;  5D91 A;  1H2T C;  4D4N A;  5ANR A;  4DI3 A;  2NUP A;  4E18 A;  3M1C B;  4NIK A;  4YDO A;  1OCZ E;  4I6E A;  1K04 A;  3PNT B;  2WB7 A;  1OKK A;  3B9Q A;  1SYQ A;  2J8W A;  4L23 A;  1E8Z A;  2FFH A;  2F22 A;  3NZS A;  3MA5 A;  2YKZ A;  4RQI A;  3TJ5 A;  4BES A;  3B71 A;  5L0F A;  3I3N A;  2PBE A;  2VGE A;  3ZYQ A;  1RMV A;  4ULV A;  5CI9 A;  3RO2 A;  2WXL A;  4WNF A;  1BD8 A;  2LK4 A;  1TNB A;  3KS2 A;  1D9S A;  3GM2 A;  4CCA A;  4K0D A;  5B1A E;  2WXK A;  3U64 A;  3VAY A;  5CED B;  1ZZP A;  1U3D A;  3NB2 A;  2MRI A;  5JLI A;  3C18 A;  4P6I C;  4BER A;  3EGD A;  4DRJ B;  2ETS A;  3LUT B;  3UI2 A;  2YLD A;  2DWZ A;  5AJL A;  1J8Y F;  1CGM E;  5BNW A;  1Q2Z A;  2J08 A;  3CST A;  3FVY A;  3TWU A;  2X0C A;  1CGN A;  3TOM A;  1FVH A;  3CK7 A;  1VB5 A;  2OV8 A;  2AXZ A;  3CVY A;  3UMK A;  1D0Y A;  1G4U S;  3W8I A;  3HHM A;  1ZU4 A;  1YVI A;  2L6H A;  3AQB A;  2AXU A;  3ZVV A;  3UXG A;  2XLD A;  2J0W A;  3IHY A;  1E7U A;  3ASO E;  5ITZ F;  3LCA A;  1E84 A;  2VSX E;  4PJJ A;  2HV7 A;  1ORS C;  1PV3 A;  3Q9U C;  5BUZ A;  1A5E A;  4GTR A;  1MMG A;  4DRH B;  3QOU A;  5L0G A;  4PH4 B;  2OOC A;  4A2N B;  1C17 M;  3NMK A;  3W8H A;  3T9K A;  1XZP A;  4AE4 A;  1BI7 B;  4HOS A;  4IYP A;  2PQN A;  4JC7 A;  2AWI A;  4ANV A;  1H6O A;  3MCX A;  3PH0 C;  3LJ3 A;  5JUA A;  3SZR A;  2D5R B;  4J8S A;  4WAF A;  1N4Q A;  3FUL A;  2CCY A;  3AU5 A;  3KL4 A;  1H9T A;  4LLC A;  3FUI A;  5E76 A;  4OD4 A;  2WMO A;  2WXH A;  3UM1 A;  3EQL F;  4RG9 A;  2DB4 A;  3LS1 A;  4W8P A;  3DSW A;  2Q00 A;  4GA1 A;  2HUJ A;  3AJM A;  4X0R A;  1I4Y A;  3OXF A;  4BT9 A;  4GYT A;  1Q0K A;  4AY5 A;  3EJN A;  3DXK G;  2XPZ A;  3DE9 A;  4F1S A;  1OWM A;  4OAV B;  1WAS A;  3NG1 A;  1LS4 A;  5E33 A;  5FIN A;  1BBH A;  1H6P A;  4WND A;  2P58 C;  5KYX A;  1N0Q A;  4HRM B;  4TV3 A;  2A6E F;  4YWQ A;  2P9L G;  4APO A;  3V79 K;  1XZQ A;  5CHE E;  2M4E A;  2XEN A;  4U7E B;  1YAR O;  2A0U A;  2XGO A;  4UWH A;  3C8G B;  3HRA A;  4KZC A;  1Q0D A;  4AOF A;  3AG3 E;  1G5Z A;  4MVU A;  2R5S A;  3FH8 A;  1S7Z A;  4U07 A;  2WVO A;  5KYU A;  3B7U X;  3PRE A;  2HS5 A;  4XWJ A;  2Y4T A;  4CGV A;  4GYW A;  5DQT A;  1MND A;  4DXW A;  4XTK A;  3T6B A;  4YJW A;  4KBL A;  1Z23 A;  4BT8 A;  1HY5 A;  1M2V A;  3UM3 A;  4CGW A;  2I2O A;  1BR4 A;  1XGW A;  1YMP A;  3UUX A;  5CCM A;  3DD7 A;  4W8K A;  3LS8 A;  1ZHW A;  2CNW A;  2UWJ G;  2GRO B;  2ZGD A;  1VYI A;  5DS5 A;  3FUH A;  2WXG A;  1E2X A;  2IXO A;  1FMV A;  3Q6N A;  3C3Q A;  2R25 A;  2DIW A;  2XZD G;  4Z9I A;  1EF1 C;  4GA0 A;  3MGB A;  4WUY A;  4EBA G;  2PFD A;  4CS9 A;  4AXH A;  2J4D A;  1LPE A;  4CRW A;  5KJN A;  5A23 A;  2ZXP A;  1Z3X A;  3LS0 A;  3A9C A;  2QYU A;  2IYL D;  3ULQ A;  3ENE A;  3S27 A;  3JCU Q;  2A69 F;  2QZA A;  1AP7 A;  5EKQ D;  4MBG A;  1OXJ A;  3QB2 A;  3CKC A;  3ASG A;  3UT7 A;  4AE4 B;  2PZI A;  3FTU A;  3TWV A;  4K5C A;  3NOC D;  5F5H A;  1IXV A;  3KH2 A;  3TWQ A;  3HNK A;  1OCZ C;  2YHC A;  3UIN C;  1NU9 C;  3AG3 C;  1IHB A;  5CIV A;  3U3W A;  1HMO A;  1KTM A;  4QI0 A;  1HE9 A;  2ZU6 B;  4G8K A;  5G04 C;  4YN0 B;  3SFX A;  2AVP A;  1SMY F;  3HXF A;  5BPP A;  2LSE A;  4MTF A;  3ZGQ A;  4TUM A;  4RSY A;  1TJF A;  2R7O A;  4I17 A;  3UMI A;  1M56 C;  3PMR A;  2OJE D;  3EGX A;  1JCS A;  3T6J A;  3CVN A;  2R59 A;  1HS6 A;  3SNX A;  4BSZ B;  2Q9B A;  2AW6 A;  1L3P A;  1VOM A;  4MVR A;  2LUH A;  4M63 A;  2IOS A;  4A55 A;  2XSE A;  4JJG A;  4XQ1 A;  3G2W A;  1N94 A;  3LJN A;  3EIJ A;  1DVP A;  5AGF A;  4CBE A;  2VSN A;  3B7R L;  4D4X A;  1D8D A;  4O1O A;  2QY7 A;  4LDQ A;  5KNG A;  3S84 A;  3FAP B;  5LX8 A;  1OKK D;  3JSZ A;  4PR9 A;  1ORJ A;  3NAW A;  3CSK A;  1IW7 F;  3US6 A;  1LE2 A;  4C7O A;  3WOD F;  4URK A;  3GEI A;  3U4T A;  3HKK A;  5FJY A;  5D66 A;  4JHJ A;  5KYY B;  5E75 A;  4JPS A;  3RH3 A;  1HG5 A;  2QYJ A;  3SFZ A;  3G4Z A;  1JPL A;  1M2O A;  1N9A A;  4GMJ A;  2J9V A;  1EDU A;  1QNF A;  1HX8 A;  4JTD B;  4LG6 A;  3FHE A;  3RIB A;  4ZLD A;  4UWG A;  3UGO A;  4J32 B;  4N3C A;  4U9E A;  2IXN A;  5FZR A;  1TN8 A;  3EG9 B;  3K33 A;  4ONS A;  5L0D A;  1FR0 A;  1H2V C;  4RLY A;  4YDE A;  5KYX B;  3LEO A;  1A17 A;  3HIZ A;  3SXM A;  3VLD A;  3U2M A;  1XNF A;  1TKN A;  2W9Y A;  4MVS A;  3FUM A;  3TXN A;  4I6J A;  3MYV A;  1BDJ B;  2GDC A;  3JSE O;  4CDN A;  1Y8M A;  4F6R D;  4GTS A;  3B7S A;  1DOW A;  5FQ6 A;  3EGX B;  1E83 A;  2A1D D;  1M6T A;  3CHM A;  5KYU B;  3ZNG A;  2Y0B G;  4AV7 A;  2J46 A;  3PE3 A;  4U63 A;  2QFC A;  2P9K G;  4E0H A;  3GZ1 A;  5EHH A;  1JUQ A;  2BL2 A;  4N06 A;  4J8D A;  4Q5S F;  4N6C A;  3SBS A;  4XZ4 A;  5AAO A;  3UMV A;  2GFH A;  2P61 A;  1JR8 A;  4GZ6 A;  4BX9 A;  5BQI A;  2WZG A;  3FTW A;  2J9Q A;  4WWO A;  5DVW A;  4BJ6 A;  3OEO A;  1TQG A;  5T3T A;  2F8Y A;  2IM8 A;  1NFI E;  3KD7 A;  5T1D B;  1MJ0 A;  4WNG A;  3R9M A;  3DAF A;  3D9P A;  4KVM A;  2YL0 A;  5BT1 A;  2VH3 A;  3FTY A;  3EH1 A;  4RVB A;  3I4U A;  3PEV B;  1UOH A;  2KC3 A;  4QFV A;  5HQ8 A;  4Q96 A;  3Q7L A;  1N1C A;  1O3U A;  1FT2 A;  5CRV A;  2X6F A;  4HI8 A;  3PZ1 A;  4IN3 B;  2LO6 A;  1FVF A;  4UWF A;  4LNB A;  3PZD A;  2X6I A;  4BTB A;  2WQ7 A;  1PCX A;  3R7R A;  4JJF A;  2HE0 A;  2XCB A;  1A0B A;  2R2L A;  1E7V A;  3AJI A;  4E7Z A;  2FGY A;  1YA0 A;  3CVQ A;  3PUJ A;  3D9H A;  4M7C A;  2PX0 A;  2WXQ A;  4IB4 A;  5KJK A;  1APC A;  3FY4 A;  4FJY A;  4N6H A;  4XEK A;  2ZD9 A;  5CRU A;  5EIB E;  2VCC A;  2XPI A;  3DM5 A;  2WVI A;  1X5B A;  2WZF A;  2R7X A;  3E33 A;  3X2Q C;  1YYJ A;  3G2V A;  3QMK A;  4HBD A;  3UIP C;  2NUT A;  1TFO B;  3IV0 A;  4GTM A;  5BXU A;  3LKU A;  2IO2 C;  3FWV A;  3ZTZ A;  1TJC A;  2JPU A;  3ZIM A;  1E85 A;  4JC8 A;  4K0R A;  3SI5 A;  1MYO A;  1C03 A;  4FAP B;  4CSA C;  2HV6 A;  1VK5 A;  1RXQ A;  3T5X A;  2XLW A;  2Y39 A;  2KCV A;  5IY5 E;  1D8E A;  3EGD B;  1UG3 A;  2XZT G;  2KZT A;  2KBX A;  4IAR A;  3RW0 A;  4JEB A;  2IU1 A;  4JB8 P;  4PFO A;  3CHS A;  2C04 A;  2YL3 A;  2L6G A;  4GCO A;  4DOZ A;  4JTA B;  2XEV A;  2YQ8 A;  3TL5 A;  1RKE A;  3L13 A;  3TG5 A;  2LD6 A;  1SW6 A;  1OW8 A;  4I1A A;  5FQ7 A;  2V3C C;  3FH7 A;  4HQD A;  2IFU A;  1I5N A;  2LFF A;  1M57 C;  2ICW G;  1TN7 A;  3U0C A;  2KC7 A;  1YZC A;  5JRA A;  3RRM B;  3V5Y A;  1V4A A;  3FHD A;  3IBE A;  4DI4 A;  2R7S A;  3HNL A;  2XLV A;  4HB5 A;  4JTC B;  5K0I A;  4JUR I;  2I15 A;  4NC3 A;  3UNG C;  1JCR A;  1LM3 B;  3LLI A;  3FOO A;  3T8K A;  2W4M A;  5DIZ A;  3RQG A;  2HSQ A;  4F7A A;  4MND A;  4AL0 A;  1OY3 D;  2X38 A;  1ZHY A;  4IAQ A;  2EIK C;  2OCC E;  5E3A A;  3AS5 A;  3URZ A;  2XEE A;  5JS5 A;  2L81 A;  2OG2 A;  3C7J A;  5AJD A;  3GEH A;  3KPH A;  4B89 A;  1TR2 A;  3DEP A;  2R17 C;  3HVE A;  3ML8 A;  4AEZ C;  3H2V A;  5D0Q D;  1AWC B;  4G25 A;  3IQ6 A;  2Y4U A;  1T6I A;  3QVZ A;  1P5Q A;  2NUP B;  3O48 A;  3KSQ A;  4MS2 A;  3QJZ A;  4HOU A;  4K7B A;  2EIJ E;  4D10 C;  2UUH A;  3C5R A;  1N54 A;  3FUE A;  4XPW A;  3Q79 A;  3AG4 C;  2LAH A;  1WAT A;  5ANL A;  4L1B A;  3JXI A;  4V3I A;  2H6G A;  1D0X A;  3CVL A;  2YL7 A;  5DS6 A;  2WQH A;  3TWT A;  3PDM P;  1T6Q A;  2J9W A;  3NQP A;  4CSA A;  3I5P A;  4C7O B;  3APC A;  4PS3 A;  3KYJ A;  5FIO A;  4CX9 A;  5J08 A;  4NQF A;  3G2T A;  4C0M A;  4KZ0 A;  3ZXS A;  3G2S A;  4C0E A;  4BET A;  3S28 A;  3K1H A;  4BX8 A;  2AJA A;  3GW4 A;  5EDS A;  3IQ5 A;  3Q5M A;  3GAN A;  3IEE A;  2R7V A;  1PC2 A;  4RBN A;  4ULW A;  3T4R A;  4ILH B;  4EZK A;  3QVY A;  2YRF A;  4A1S A;  3RQF A;  5E3C A;  3MX3 A;  2L0T B;  1AEP A;  4Z9J A;  3R7C A;  3S2A A;  2AWC A;  3NRH A;  1ZHX A;  4GZ3 A;  3GM1 A;  3CVP A;  1UFB A;  1MQS A;  1D1A A;  1YAU O;  3VM6 A;  4XI9 A;  1MMA A;  2LSV A;  4PS7 A;  3HXD A;  4OD5 A;  2AXV A;  1MX6 A;  5BW8 C;  4U5G A;  3ASD A;  3PRZ A;  3L8I A;  1RJ9 A;  3HG0 D;  5D0O D;  4CIP A;  4QQI A;  2YLI A;  1OR3 A;  4DUI A;  2EIM E;  4U5B E;  4AM9 A;  1H6K A;  3S7J A;  4LDR A;  4UI9 K;  5DQZ A;  2VCB A;  3PVL A;  4J7Y A;  3ASN C;  3CQG B;  1BI8 B;  4EBB A;  4APF A;  4O60 A;  2B0J A;  2CGE A;  3OA1 A;  5LCW C;  2EIJ C;  2FAP B;  2H7B A;  2Y3A A;  4EWC A;  1NI1 A;  4GTT A;  4PJN A;  3R2P A;  3L0I A;  3UQ3 A;  1S0P A;  5L0H A;  1JWF A;  2CW0 F;  4FLH A;  2YVK A;  5LCW J;  4IJJ A;  4AL1 A;  3KEA A;  2WVN A;  4LAC B;  1QYM A;  3W2W A;  4WGY A;  1FFT C;  1N4P A;  4R7L A;  4BJT A;  4YDW A;  2Q9A A;  2P7V A;  3LJB A;  4JZA A;  1OXK A;  3N24 A;  2J9U A;  3Q7G A;  1QQ3 A;  4GMR A;  1WY6 A;  1S05 A;  2XEH A;  5ENR D;  3D9K A;  3IQC A;  4YL3 A;  2TMV P;  4OAU C;  3CKB A;  4BJ6 C;  4ANU A;  3O55 A;  2CNW D;  5CMY A;  1JCQ A;  1Z63 A;  4XE0 A;  4NTF A;  4Y6W A;  4O6Y A;  5CER B;  3V5X A;  2ZPA A;  4GB9 A;  3SZ7 A;  5EK0 A;  3RKV A;  3NYJ A;  2WM9 A;  4Q94 A;  4DBR A;  3AAA C;  3A11 A;  3V2O A;  4G26 A;  3MBG A;  2VGY A;  1N95 A;  3SQV A;  4WWN A;  1AUE A;  2R7T A;  1VLS A;  3SGH A;  1A7V A;  3U3F A;  2Q9C A;  5FZT A;  2GGF A;  2ZXR A;  5L0C A;  3D3M A;  3E34 A;  3PNL B;  1IHG A;  5B1B C;  3J5P A;  3CAX A;  3ASN E;  2R05 A;  2HSB A;  2GRR B;  3M4C A;  4XI0 A;  2CHW A;  3GYZ A;  3ZYM A;  4J8E A;  1LD8 A;  4ZLC A;  4BWR A;  1D0Z A;  1U89 A;  3NKE A;  1FMW A;  1OWO A;  4EHP A;  3TWX A;  2HO1 A;  4YVQ C;  2IQC A;  2IJG X;  3ZRH A;  2KGO A;  5FCL A;  2VJ8 A;  4NUR A;  4DVY P;  3B0U X;  2B0O E;  4ACK A;  1YDI A;  3JYH A;  4NTB A;  1H6G A;  3C72 A;  4ILI A;  3T9O A;  3G4X A;  2KAT A;  4I43 A;  4KT6 B;  1IQR A;  2RG8 A;  3JQ1 A;  2A5U A;  2WXF A;  3SY2 A;  3RKO F;  4F53 A;  5CBO A;  1O1S A;  4NAC A;  5FZQ A;  2BKG A;  3UTM A;  3RJV A;  1OCR C;  1WAO 1;  4WGZ A;  3E32 A;  3NYM A;  3FTV A;  1CGO A;  1QVX A;  5DLJ A;  1HU3 A;  2Z15 A;  5AIJ A;  4FA6 A;  1KNY A;  4YK5 A;  1PD1 A;  4Q7C A;  4U8H A;  3RSE G;  2HR2 A;  1VDY A;  3D9M A;  1NFN A;  1DNP A;  3CK8 A;  5A6B D;  3U9M A;  1BPO A;  1I4Z A;  3LXU X;  2VGX B;  4BEP A;  2L7A A;  4BJ5 C;  5C1D A;  4HFG A;  3E4B A;  1N4R A;  3HVE B;  3ASO C;  4K5B A;  3B7B A;  4FHJ A;  5AYW D;  2GAQ A;  1QKR A;  3AQC A;  3EFO A;  4UDV A;  4U0S A;  3RRU A;  2UUI A;  3O6X A;  2FEZ A;  3OXL A;  1ZHZ A;  5KCM A;  3ZUV B;  5G2N A;  2BTD A;  4C3B A;  1Z3Y A;  1RJ9 B;  1WG0 A;  3L34 A;  4L6R A;  3FUJ A;  3FUF A;  1ZU2 A;  1V54 C;  1OCO E;  4DX2 A;  1Z3I X;  4BJ1 A;  2KYH A;  2VTB B;  1QPU A;  2UY1 A;  4CS9 C;  3U3B A;  2Q7F A;  2OND A; 
#chains in the Genus database with same CATH homology
 2QY9 A;  3B0P A;  5LFA A;  3SEO A;  5C2Y A;  4FC8 A;  3KMI A;  3MKR A;  4N5C A;  1E90 A;  2KM4 A;  3ABL C;  4BY6 A;  3CR3 A;  3FP3 A;  4G7O F;  4KXK B;  3B0V C;  2PM7 A;  3AS4 A;  2E0I A;  4U5C E;  4I2W A;  4OIR F;  2EIM C;  5LP0 A;  2VSO E;  1D1C A;  4G24 A;  4CS8 C;  3LLK A;  1ELK A;  4EEC A;  3U66 A;  1TWH A;  4O7G A;  4JCH A;  3LVQ E;  4PK4 A;  5A6C A;  4OIN F;  4A3T A;  2PP4 A;  3CHO A;  4ILG A;  2CG2 A;  2PQR A;  2VQ2 A;  3AU4 A;  3JQ0 A;  4J0U A;  5D92 A;  4N3B A;  4G7Z F;  2WPV A;  3TD7 A;  3S7B A;  3TGO A;  2Y3G A;  1GW6 A;  1OUV A;  3O4Z A;  3CV0 A;  4HVB A;  4XKB A;  1SZ9 A;  3HYM B;  1QZ2 A;  3BEE A;  3RK6 A;  4F3V A;  5EX0 A;  1HE8 A;  3ZPJ A;  3L16 A;  2FUL A;  2XGS A;  2J7P A;  2OVF A;  2V8S E;  2ILR A;  5JJT A;  4ABN A;  2V4L A;  4JA9 A;  3S7F A;  3U9W A;  3QAQ A;  2NSZ A;  2VB6 A;  2J49 A;  2XRZ A;  3P2B A;  3SF4 A;  4DK5 A;  2V26 A;  1Z5Z A;  3LAY A;  5T3W A;  4EPZ A;  4RD9 A;  2YHE A;  3ZYK A;  4FP7 A;  4E85 A;  3LEW A;  4HS2 A;  3KKB A;  2HYZ A;  4DLQ A;  1B89 A;  4B8A A;  2V0P A;  4ME2 A;  4FUL A;  2NG1 A;  4NQ0 A;  1UN9 A;  4QDL A;  3VTY A;  1NA3 A;  4UWK A;  3DAG A;  3JUI A;  2C03 A;  4I9C A;  1V55 C;  3K1I C;  3RU0 A;  4DBQ A;  2J4B A;  1Z6A A;  2EIN C;  2MHK A;  3LEV A;  3LDZ A;  3PEU B;  2LSU A;  3HTK C;  4DPR A;  4AIF A;  4G2V A;  3WXX A;  3DZA A;  3Q4A B;  4DVZ A;  3K7D A;  3B7T A;  3CHR A;  2I1K A;  4N2S A;  5BV0 A;  4MQ9 F;  2VTB A;  4RDA A;  3CVX A;  1INZ A;  4JEU A;  3ASF A;  1SZA A;  1NP7 A;  3CIA A;  2VSY A;  4GU5 A;  4FES A;  1WM5 A;  4EZJ A;  3N71 A;  3ZYL A;  3MV2 B;  2ZXO A;  4RG6 A;  5L3Q A;  3I4R B;  1OCO C;  1O5H A;  2WXP A;  5BV1 A;  5JHA A;  3AG1 C;  4MRU A;  4JEH A;  2G62 A;  4CT0 A;  4AY6 A;  1LS1 A;  1PD0 A;  3ABM C;  3HJC A;  1HG2 A;  4NRH B;  4B0Z A;  1O87 A;  3PE4 A;  1UJJ A;  3ITF A;  2WXJ A;  3UX4 A;  4PJL A;  2KZT B;  3ML9 A;  4B94 A;  3VLE A;  4ANX A;  1HXI A;  3ABK C;  2E2E A;  3EDT B;  2IOL A;  3K6B A;  5HSW A;  2A4Z A;  4UWL A;  3DMD A;  2XRH A;  4L7T A;  3CZ6 A;  3ESK A;  3S7D A;  3N0T A;  2X6H A;  2WZL A;  4PUC A;  4Q69 A;  1E96 B;  3VYW A;  2C0L A;  2WXO A;  4BTA A;  3VLF A;  1OWP A;  2C0M A;  4W9R A;  3LPZ A;  4G0H A;  1TWC A;  1LF8 A;  5DS4 A;  1L5J A;  4G7H F;  3RRN B;  3DJU B;  2DCP A;  2FBN A;  2CHX A;  3QWV A;  2OVB A;  1QQE A;  5JJ7 A;  3FH5 A;  3E9V A;  4XX5 A;  2XHE A;  4N39 A;  4U0Z A;  2CG3 A;  5B1A C;  1OWL A;  2YNQ A;  5M72 A;  3TAX A;  1NU7 D;  4I44 A;  3JRT A;  4C9B B;  1OCC C;  5J90 A;  4NY3 A;  2HM8 A;  4FLB A;  3KEZ A;  3FUN A;  4UI9 J;  4J30 B;  5HI7 A;  1JPJ A;  3DM9 B;  5F5F A;  4HOR A;  2OCC C;  3FEY A;  1HH8 A;  1JWG A;  2XRY A;  5CMW A;  4YT4 A;  3CLJ A;  3FUD A;  4WJ0 A;  3Q6M A;  3BG1 B;  5DBK A;  4CIH A;  2KNH A;  3EZH A;  3SP1 A;  3Q15 A;  2WMN A;  4YT2 A;  4UI9 C;  3QZC A;  1D1B A;  1E8Y A;  1FTS A;  2KQ9 A;  5KYY A;  3DXJ F;  4UQY A;  3I5Q A;  5G05 C;  5EGY A;  3CEQ A;  3F46 A;  3RYL A;  5LOZ A;  4QI2 A;  4F4B A;  2GRL A;  3GZS A;  3EG9 A;  3UMH A;  4I1O B;  4O6N A;  3MLG A;  3FTZ A;  4I9E A;  5FT9 A;  1PY1 A;  4IWB A;  2LNI A;  2L6J A;  2PM6 A;  4KNV A;  2MWQ A;  1FCH A;  3CSF A;  4FJZ A;  3JT1 A;  4ANJ A;  4GZD A;  2XL4 A;  4HOQ A;  2WVQ A;  4I6G A;  1Z6T A;  4GML A;  2H7O A;  1IZM A;  5T3R A;  2PF4 E;  5A7D B;  2YHS A;  2Y3D A;  2NXP A;  5FZS A;  4GPK A;  2UY1 B;  3JCK C;  1H0A A;  3OAW A;  1ELW A;  2CFU A;  2NC9 A;  4TUU A;  4LCT A;  2L0I A;  2V5F A;  4CEM A;  1E8X A;  5T4Y A;  5FTP A;  3W2V A;  3FTS A;  1FFH A;  4OYS A;  2DGJ A;  3FU3 A;  4IUL A;  2A68 F;  2G3V A;  2YZS A;  2BF0 X;  4O79 A;  1MNE A;  3GOD A;  3QWP A;  4AVX A;  2H7V C;  2MYS A;  2G3K A;  2Y3H A;  2BUG A;  4Y6C A;  1SQM A;  3MV3 B;  4KBQ A;  2KCK A;  1PAQ A;  1ZHT A;  1KLX A;  1BR1 A;  3D9O A;  2J45 A;  5JHB A;  2J09 A;  3PS6 A;  2XQ0 A;  1LKX A;  3SNH A;  3GZ2 A;  4GZC A;  2XXA A;  1W3B A;  5BUO A;  1TWA A;  1MMD A;  5KJL A;  4U5D E;  3OXG A;  4OIQ F;  3FFL A;  2L9B A;  2J7P D;  4FX5 A;  2W45 A;  3Q47 B;  4PS8 A;  5E2Q A;  5G55 A;  4XLN F;  3NYL A;  1N52 A;  3TJP A;  4OIO F;  4OVV A;  1KT1 A;  4LUN U;  4DJA A;  1KT0 A;  2KJG A;  2M63 A;  4GZ5 A;  2GRM A;  4G1T A;  3IHV A;  4N2Q A;  4EQF A;  3EH2 A;  2JEK A;  5KYW A;  2PL2 A;  3D9L A;  1UJK A;  3L17 A;  3D9I A;  4YT8 A;  3UR3 C;  3S29 A;  4P29 A;  2IF4 A;  3MZL B;  3ASH A;  4U04 A;  2W4B A;  4BG0 A;  1JPN A;  2WB2 A;  3EIQ C;  1MHQ A;  3FEX A;  4KNW A;  2FI7 A;  4GYY A;  3LY9 A;  4M3O A;  2X3M A;  3E70 C;  5L3V A;  4L2Y A;  4I3M A;  4U5H A;  3G2U A;  3T8M A;  4LER A;  4DLO A;  2A6H F;  3B13 A;  4G23 A;  1WGW A;  4OVU A;  2Y3B A;  3QKY A;  5B3S C;  2VAS A;  3EZI A;  3DPD A;  4YT5 A;  4H4K C;  4I1M A;  4BJ5 A;  3ECS A;  3K66 A;  1HFA A;  4WNE A;  3LY8 A;  3R7Q A;  1HZ4 A;  4KVO A;  2YIN A;  4A3V A;  3APD A;  2Y69 C;  4HOT A;  4HFF B;  5JJ6 A;  1IYG A;  4JZY A;  3NDB B;  4N3A A;  3ONK A;  3DBS A;  2IXP A;  2C2L A;  3JYS A;  4JHK A;  4CT4 A;  5AEN A;  1IQU A;  2R7U A;  3O39 A;  3FAJ A;  4HLE A;  4FAD A;  3LES A;  2BE5 F;  2WXR A;  3S0X A;  3ZFW A;  4E7S A;  4FWV A;  1ZU5 A;  3APF A;  1M2V B;  2CFZ A;  2XPY A;  3FDQ A;  4BSX A;  4JHR A;  3ONL A;  4XLP F;  3MKQ B;  3L08 A;  2J0X A;  5CCL A;  4A1G A;  3CVV A;  3V7O A;  3T5V A;  4LRZ A;  2E87 A;  5ARG A;  5FWQ A;  2EQX A;  5FQ4 A;  5CI8 A;  4LEU A;  2XCC A;  1ZBP A;  1EPU A;  3KAE A;  4K03 A;  3BG0 B;  4XIF A;  4JA7 A;  3Q49 B;  1VMA A;  3AG2 C;  4YND A;  1H2U A;  2WL8 A;  3EHN A;  4LLE A;  3IKO B;  4AP2 A;  2WQ6 A;  4J8F A;  4ANW A;  4TRQ A;  3L54 A;  4G11 A;  4ATG A;  3NKD A;  3SYN A;  2EIL C;  4U0U A;  4AX2 A;  2R7W A;  2J07 A;  2R7Q A;  2ZXW C;  4JXT A;  1KU2 A;  3P1U A;  4MLP A;  2PX3 A;  4C3E A;  1J8M F;  1NA0 A;  2KCL A;  1W2W A;  5FQ8 A;  4L2L A;  3HDX A;  4B8C B;  5KJM A;  3CVW A;  2Q3T A;  5G05 J;  3ZHE A;  3EHM A;  4UQX A;  3I4G A;  3TXM A;  3FUK A;  3X1O A;  3DJN B;  2XXA B;  3OTN A;  1UN8 A;  2KW3 C;  4OIP F;  3ZG1 A;  1ST6 A;  3UT8 A;  3MJW A;  1HO8 A;  3CQZ A;  3FTX A;  3UT4 A;  3K9I A;  4WWP A;  4CDR A;  4KYO B;  2WXN A;  1Y6I A;  1H19 A;  1TEZ A;  3CK9 A;  2O9X A;  3L22 A;  2I1J A;  2FO7 A;  4KC9 A;  5IY5 C;  1ELR A;  4MS6 A;  3QNK A;  4FU3 A;  4GEH A;  1E8W A;  3OWT A;  2OOE A;  1QZX A;  3CQC B;  3FDH A;  3UGP A;  4MKT A;  3FU6 A;  1VYK A;  3ZSU A;  1U3C A;  3PHF 2;  3D9J A;  3ZEF A;  2R7R A;  4E6H A;  2CDQ A;  3LY7 A;  3EPV A;  3CGH A;  4U5F E;  1EYH A;  1LVK A;  4CS7 A;  4O6M A;  2QTV A;  3SHF A;  4BFR A;  4KMO A;  1ZYR F;  4PJM A;  1HF8 A;  3ZW3 A;  3L6A A;  2CHZ A;  4IRU A;  1OWN A;  3LYA A;  2DBA A;  2VGX A;  3MEK A;  4YVO A;  4HFK B;  4GAA A;  1MMN A;  1BR2 A;  3MKQ A;  3R9A B;  2I9C A;  2NUT B;  4IAO A;  3RFY A;  3EFO B;  3TG4 A;  3NF1 A;  3SBT B;  2P6V A;  2GW1 A;  2WXI A;  5KYN A;  3NZU A;  1G8X A;  4H7X A;  3UPV A;  3LVR E;  1TWG A;  1SZI A;  3ZN3 A;  2FF4 A;  5ENN A;  3AS8 A;  4EZL A;  4PDX A;  2XGM A;  3QWW A;  4GA2 A;  1SF8 A;  2LAI A;  4EBA A;  4B6I A;  3ZC4 A;  4H7Y A;  2YEV A;  3QDN A;  3RO3 A;  1NZN A;  4UQZ A;  4Q4Z F;  3PUK A;  4ACL A;  3VTX A;  3LNR A;  2IXM A;  4J6I A;  2ION A;  5G04 J;  3PDN A;  3CHQ A;  2L9J A;  3ZVR A;  2DYR C;  4CS8 A;  3IEG A;  3SD5 A;  4JW1 A;  5T8I A;  4XKC A;  5EX3 A;  3HLZ A;  3N2Z B;  2RD0 A;  4O6F A;  2I8B A;  3WG7 C;  4HE8 D;  3QAR A;  3POV A;  4GYO A;  4I2Z A;  3ZHE B;  4AK9 A;  2X51 A;  4BEJ A;  4GCN A;  4U5E E;  2JD3 A;  2I6H A;  4HXI A;  4HEA J;  3RIP A;  2IOQ A;  2X6K A;  2X6J A;  1UW4 B;  4JVS A;  5KYW B;  3C98 A;  4AJW A;  1QLE C;  4JL0 A;  4PFP A;  3F47 A;  4CDM A;  3CHP A;  3D9N A;  4FHK A;  4KI2 A;  2VYI A;  2WXM A;  2DYS C;  1NZE A;  1NG1 A;  2JLB A;  5ARF A;  3FU0 A;  3H65 A;  3FU5 A;  3ZIB A;  3QC1 A;  2MOW A;  3CVU A;  3QK0 A;  4C3D A;  3ESL A;  5D91 A;  1H2T C;  5ANR A;  4DI3 A;  2NUP A;  3M1C B;  4I6E A;  3PNT B;  2WB7 A;  1OKK A;  3B9Q A;  4L23 A;  1E8Z A;  2FFH A;  3NZS A;  3MA5 A;  3I3N A;  3ZYQ A;  5CI9 A;  3RO2 A;  2WXL A;  4WNF A;  3KS2 A;  4CCA A;  4K0D A;  2WXK A;  3U64 A;  3VAY A;  1U3D A;  2MRI A;  4P6I C;  3EGD A;  5AJL A;  1J8Y F;  5BNW A;  2J08 A;  3CST A;  3FVY A;  1FVH A;  3CK7 A;  2OV8 A;  2AXZ A;  3CVY A;  3UMK A;  1D0Y A;  3W8I A;  3HHM A;  1ZU4 A;  3AQB A;  2AXU A;  3ZVV A;  2J0W A;  3IHY A;  1E7U A;  3LCA A;  2VSX E;  4PJJ A;  2HV7 A;  5BUZ A;  1MMG A;  3QOU A;  4PH4 B;  4A2N B;  3W8H A;  4AE4 A;  4HOS A;  4IYP A;  2PQN A;  2AWI A;  4ANV A;  3MCX A;  3PH0 C;  3LJ3 A;  4J8S A;  3SZR A;  2D5R B;  4WAF A;  3FUL A;  3AU5 A;  3KL4 A;  5E76 A;  3FUI A;  4LLC A;  4OD4 A;  2WMO A;  2WXH A;  3EQL F;  4RG9 A;  3LS1 A;  4GA1 A;  4X0R A;  3OXF A;  4BT9 A;  4GYT A;  4AY5 A;  3EJN A;  2XPZ A;  4F1S A;  1OWM A;  3NG1 A;  5E33 A;  4WND A;  2P58 C;  5KYX A;  4TV3 A;  2A6E F;  4YWQ A;  4APO A;  5CHE E;  2M4E A;  2XGO A;  4UWH A;  4KZC A;  4AOF A;  2R5S A;  3FH8 A;  1S7Z A;  4U07 A;  2WVO A;  5KYU A;  3B7U X;  3PRE A;  4XWJ A;  2Y4T A;  4CGV A;  4GYW A;  5DQT A;  1MND A;  4XTK A;  3T6B A;  4YJW A;  4KBL A;  1Z23 A;  4BT8 A;  1M2V A;  4CGW A;  2I2O A;  1BR4 A;  1XGW A;  3UUX A;  5CCM A;  3DD7 A;  4W8K A;  3LS8 A;  1ZHW A;  2CNW A;  2UWJ G;  1VYI A;  5DS5 A;  3FUH A;  2WXG A;  2IXO A;  1FMV A;  3Q6N A;  2DIW A;  1EF1 C;  4GA0 A;  3MGB A;  4WUY A;  4EBA G;  2PFD A;  4CS9 A;  4AXH A;  2J4D A;  4CRW A;  5KJN A;  5A23 A;  2ZXP A;  1Z3X A;  3LS0 A;  2IYL D;  3ULQ A;  3ENE A;  3S27 A;  3JCU Q;  2A69 F;  5EKQ D;  3QB2 A;  3CKC A;  3ASG A;  3UT7 A;  4AE4 B;  2PZI A;  3FTU A;  5F5H A;  3KH2 A;  1OCZ C;  2YHC A;  1NU9 C;  3AG3 C;  3U3W A;  4QI0 A;  2ZU6 B;  5G04 C;  4YN0 B;  2AVP A;  1SMY F;  5BPP A;  2LSE A;  3ZGQ A;  4RSY A;  1TJF A;  2R7O A;  4I17 A;  3UMI A;  1M56 C;  3PMR A;  3EGX A;  3T6J A;  3CVN A;  2R59 A;  1HS6 A;  3SNX A;  2Q9B A;  2AW6 A;  1VOM A;  4M63 A;  2IOS A;  4A55 A;  2XSE A;  4JJG A;  3G2W A;  3EIJ A;  1DVP A;  4CBE A;  2VSN A;  3B7R L;  2QY7 A;  5LX8 A;  1OKK D;  3JSZ A;  3CSK A;  1IW7 F;  4C7O A;  3WOD F;  4URK A;  3U4T A;  5FJY A;  4JHJ A;  5KYY B;  5E75 A;  4JPS A;  3RH3 A;  1HG5 A;  3SFZ A;  1JPL A;  1M2O A;  4GMJ A;  2J9V A;  1EDU A;  1QNF A;  1HX8 A;  3FHE A;  3RIB A;  4ZLD A;  4UWG A;  3UGO A;  4J32 B;  4N3C A;  2IXN A;  5FZR A;  3EG9 B;  3K33 A;  1H2V C;  5KYX B;  1A17 A;  3HIZ A;  3VLD A;  1XNF A;  1TKN A;  2W9Y A;  3FUM A;  3TXN A;  4I6J A;  3MYV A;  4CDN A;  1Y8M A;  3B7S A;  5FQ6 A;  3EGX B;  2A1D D;  3CHM A;  5KYU B;  4AV7 A;  2J46 A;  3PE3 A;  4U63 A;  2QFC A;  3GZ1 A;  5EHH A;  1JUQ A;  4N06 A;  4J8D A;  4Q5S F;  3SBS A;  4XZ4 A;  3UMV A;  2GFH A;  4GZ6 A;  4BX9 A;  2WZG A;  3FTW A;  2J9Q A;  4WWO A;  5DVW A;  4BJ6 A;  3OEO A;  5T3T A;  4WNG A;  3KD7 A;  5T1D B;  3DAF A;  3D9P A;  4KVM A;  5BT1 A;  2VH3 A;  3FTY A;  3EH1 A;  4RVB A;  3I4U A;  3PEV B;  4QFV A;  5HQ8 A;  4Q96 A;  3Q7L A;  1N1C A;  2X6F A;  4IN3 B;  2LO6 A;  1FVF A;  4UWF A;  3PZD A;  2X6I A;  4BTB A;  2WQ7 A;  1PCX A;  3R7R A;  4JJF A;  2XCB A;  1E7V A;  4E7Z A;  2FGY A;  1YA0 A;  3CVQ A;  3PUJ A;  2PX0 A;  2WXQ A;  5KJK A;  3FY4 A;  4FJY A;  2XPI A;  3DM5 A;  2WVI A;  1X5B A;  2WZF A;  2R7X A;  3X2Q C;  3G2V A;  3QMK A;  2NUT A;  3IV0 A;  3LKU A;  3FWV A;  1TJC A;  3ZIM A;  4JC8 A;  4K0R A;  3SI5 A;  4CSA C;  2HV6 A;  1VK5 A;  3T5X A;  2Y39 A;  2KCV A;  3EGD B;  1UG3 A;  2KZT A;  2IU1 A;  4PFO A;  3CHS A;  2C04 A;  4GCO A;  4DOZ A;  2XEV A;  2YQ8 A;  3TL5 A;  3L13 A;  3TG5 A;  4I1A A;  5FQ7 A;  2V3C C;  3FH7 A;  2IFU A;  1M57 C;  2KC7 A;  3RRM B;  3FHD A;  3IBE A;  4DI4 A;  2R7S A;  4JUR I;  3UNG C;  3LLI A;  2W4M A;  5DIZ A;  4F7A A;  4MND A;  2X38 A;  1ZHY A;  2EIK C;  5E3A A;  3AS5 A;  3URZ A;  2L81 A;  2OG2 A;  5AJD A;  4B89 A;  1TR2 A;  2R17 C;  3HVE A;  3ML8 A;  4AEZ C;  5D0Q D;  4G25 A;  2Y4U A;  1P5Q A;  2NUP B;  3O48 A;  3QJZ A;  4HOU A;  4K7B A;  4D10 C;  1N54 A;  3FUE A;  3AG4 C;  2LAH A;  5ANL A;  4L1B A;  4V3I A;  1D0X A;  3CVL A;  5DS6 A;  2WQH A;  2J9W A;  3NQP A;  4CSA A;  3I5P A;  4C7O B;  3APC A;  4PS3 A;  5J08 A;  3G2T A;  4C0M A;  4KZ0 A;  3ZXS A;  3G2S A;  4C0E A;  3S28 A;  3K1H A;  4BX8 A;  3GW4 A;  5EDS A;  3Q5M A;  3GAN A;  3IEE A;  2R7V A;  1PC2 A;  4RBN A;  4ULW A;  3T4R A;  4ILH B;  4EZK A;  4A1S A;  5E3C A;  3MX3 A;  2L0T B;  3S2A A;  3NRH A;  1ZHX A;  4GZ3 A;  3CVP A;  1MQS A;  1D1A A;  4XI9 A;  1MMA A;  2LSV A;  4PS7 A;  4OD5 A;  2AXV A;  5BW8 C;  4U5G A;  3ASD A;  3PRZ A;  1RJ9 A;  5D0O D;  4U5B E;  4AM9 A;  1H6K A;  3S7J A;  4UI9 K;  5DQZ A;  3PVL A;  3ASN C;  3CQG B;  4EBB A;  4APF A;  2B0J A;  2CGE A;  3OA1 A;  5LCW C;  2EIJ C;  2H7B A;  2Y3A A;  4EWC A;  4PJN A;  3L0I A;  3UQ3 A;  1S0P A;  1JWF A;  2CW0 F;  4FLH A;  5LCW J;  4IJJ A;  2WVN A;  4LAC B;  3W2W A;  1FFT C;  4R7L A;  4BJT A;  2Q9A A;  2P7V A;  3LJB A;  4JZA A;  3N24 A;  2J9U A;  3Q7G A;  1WY6 A;  3D9K A;  3CKB A;  4BJ6 C;  4ANU A;  2CNW D;  5CMY A;  4XE0 A;  1Z63 A;  4Y6W A;  4O6Y A;  2ZPA A;  4GB9 A;  3SZ7 A;  3RKV A;  3NYJ A;  2WM9 A;  4Q94 A;  4DBR A;  4G26 A;  2VGY A;  4WWN A;  2R7T A;  3SGH A;  2Q9C A;  2GGF A;  2ZXR A;  3D3M A;  3PNL B;  1IHG A;  5B1B C;  4XI0 A;  2CHW A;  3GYZ A;  3ZYM A;  4J8E A;  4ZLC A;  4BWR A;  1D0Z A;  3NKE A;  1FMW A;  1OWO A;  2HO1 A;  4YVQ C;  2IQC A;  2IJG X;  3ZRH A;  2KGO A;  5FCL A;  2VJ8 A;  4NUR A;  4DVY P;  3B0U X;  4ACK A;  3JYH A;  4ILI A;  2KAT A;  4I43 A;  4KT6 B;  1IQR A;  2RG8 A;  3JQ1 A;  2A5U A;  2WXF A;  3RKO F;  4F53 A;  4NAC A;  5FZQ A;  3RJV A;  1OCR C;  1WAO 1;  3NYM A;  3FTV A;  5DLJ A;  1HU3 A;  2Z15 A;  5AIJ A;  4FA6 A;  1PD1 A;  4Q7C A;  4U8H A;  2HR2 A;  1VDY A;  3D9M A;  1DNP A;  3CK8 A;  1BPO A;  3LXU X;  2VGX B;  4BJ5 C;  5C1D A;  4HFG A;  3E4B A;  3HVE B;  3ASO C;  4FHJ A;  5AYW D;  3AQC A;  3EFO A;  4U0S A;  3RRU A;  3O6X A;  2FEZ A;  3OXL A;  1ZHZ A;  5KCM A;  5G2N A;  2BTD A;  4C3B A;  1Z3Y A;  1RJ9 B;  3FUJ A;  3FUF A;  3L34 A;  1ZU2 A;  1V54 C;  1Z3I X;  4BJ1 A;  2VTB B;  2UY1 A;  4CS9 C;  2Q7F A;  2OND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...