3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
b'ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
5J90A 3IV0A 4L7TA 3CK9A 3OTNA 3QNKA 3FDHA 4Q69A 4F7AA 3MX3A 3EHNA 3SNXA 3MYVA 3HDXA 3KEZA 5T3RA 3CGHA 4PUCA 3L22A 5FQ6A 3JQ1A 3P1UA 5FQ8A 4LERA 3NQPA 3I4GA 3GZSA 5E75A 3CKCA 4F53A 3LEWA 3CKBA 3EJNA 3EHMA 3CK8A 5LX8A 3JYSA 5E76A 4MRUA 3SGHA 5FQ4A 3MCXA 3CK7A 5T4YA 3JQ0A 5FQ7A
chains in the Genus database with same CATH superfamily
2WVOA 3CAXA 4JEBA 4O6YA 1H6OA 5T3TA 2AXUA 4GTPA 1E86A 1TWHA 2DGJA 4Q96A 5BV0A 1N4PA 3ENEA 4UUCA 3ASOC 3BG0B 2DYSC 4MLPA 4MTFA 5EK0A 4RG6A 2HJMA 2NG1A 4HOQA 1Z3XA 4DPRA 1KNYA 3DE8A 3LNRA 5A23A 4YJWA 2PFDA 1Z6AA 3CK9A 2YHCA 2WXMA 3UMKA 3ABME 2VH3A 4PS8A 3U3FA 4U7EB 1TWCA 2ICWG 4ACKA 4LLCA 4L23A 2YINA 3NAWA 3ZTZA 5ARGA 2P9NG 3T6GB 3DRAA 4F53A 4IARA 4FA6A 4QDLA 4ZHBA 3K33A 1JOGA 3QAQA 3GODA 2GW1A 3UINC 1BDJB 3NKEA 5H7PA 3TWWA 1U89A 1AWCB 1H2VC 3C5RA 4J8EA 2JD3A 5IY5C 4M63A 1N11A 2XS1A 1BBHA 4EIYA 4O6FA 3JQ1A 5A6CA 3ZTMA 1SMYF 3ZYKA 1G5ZA 2HUJA 4WNDA 4CS7A 3FUNA 2Q7FA 3PUKA 2MHRA 3DXMG 4JCZA 4OD4A 1HFAA 3TWTA 4K5AB 4HLLA 5B3SC 1WGWA 3EPVA 3OEOA 2J8SD 2ASRA 4XEFA 4GAAA 1JCQA 1LE4A 3NOGD 1O1TA 2WPVA 4B8AA 1JCRA 1MMGA 1JCSA 5G55A 4BT9A 2WM9A 3AG3C 4OYSA 2M63A 3HNLA 3HXBA 3I4GA 4JC8A 1RKEA 3D9JA 3KKBA 4HBDA 1S64A 3DPDA 1A7VA 3Q6MA 3C8GB 4GYYA 3TK0A 3T6JA 1RKEB 3PZDA 1OW7A 3HKKA 4U9DA 2RKKA 4PH4B 3IQCA 3NBNB 4YT8A 4CSAC 4KBQA 5LCWJ 3GWNA 1K40A 3HJCA 3FY4A 1LS4A 4AV7A 2B0HA 5CMWA 4XLPF 1WAO1 4YDOA 1HY5A 2L0IA 2P58C 1TQGA 2M4EA 1BZ4A 2VTBA 4NACA 3ABKE 3ASNC 2Q3TA 2YLDA 4XTKA 2X6HA 5AYWD 2ZGDA 4ILGA 1U3CA 2CHZA 4CCAA 3ZW3A 2CYDA 4TRQA 2VTBB 1E7UA 3DXJF 4UWKA 2IY0C 3LVQE 1PC2A 2I1KA 4HB5A 3SI5A 3ZIBA 4K1OA 4YDEA 3B71A 4L2LA 3SZ7A 2L0TB 4RBNA 4AXHA 1OR3A 3CEQA 3P1UA 2BEDA 4EPZA 1EI7A 4G78A 3TD7A 5JLIA 3DSTA 3TXNA 3NG1A 4TUMA 3M4BA 1R5ID 3H65A 2WZFA 1HU3A 4LG6A 5BW8C 2KZTA 4Y6CA 2XL4A 1DNPA 4I9EA 4JEHA 1C17M 4AX2A 3WG7C 3CGHA 3U9WA 3D9HA 1VLTA 2J46A 3GM1A 2VGXA 4PS3A 1MYOA 4F1PA 2QFCA 4CSAA 1Q0KA 5ANLA 4OIPF 2UWJG 3S9OA 4ANVA 1OCCE 1D0XA 1LM3B 4HFKB 1IHBA 4YDYA 4JD2G 1OXJA 3O55A 4QQIA 1CPRA 4GMLA 3FU0A 3TJ5A 4MS6A 3SP1A 4HRMB 4JIOA 2XRZA 4I9CA 4BFRA 3C8GD 5HRYA 4PJLA 1LI5A 4NRHB 3FU6A 1OCRC 1YA7O 4FU3A 4PFOA 4C9BB 3ZPJA 4D4XA 2WMOA 2GRMA 4KI2A 3FVYA 2P9IG 2Y3BA 2HZ8A 2DBAA 4AY6A 2PF4E 1O1RA 5M72A 1U0BB 4I6JA 1NL4A 4WNFA 2VGEA 3TL5A 1APCA 5CBOA 2KC3A 1N4QA 1YA9A 4MTOA 4C7OA 3MFNA 4HOSA 1H6GA 5L3QA 4BT8A 2EIMC 1E84A 4ATGA 2B0OE 4U04A 2C0LA 4C7OB 3L1MA 3J06A 5FQ7A 3JUEA 2GDCA 3DI5A 3ZQVA 4NQFA 4Z9JA 5B1BE 3FP3A 2LUHA 3UTMA 3NRHA 4KC9A 1HX8A 4BERA 4WGYA 1CGME 3UT4A 2A0UA 2L6BA 2CFUA 1QZXA 2AVKA 3C3RA 3F6QA 3FTYA 4CS9C 5FZRA 2WXLA 3V30A 3RIPA 2J9BA 1V55E 2WL8A 5A69A 1H2TC 3QVYA 2J0XA 3RSEG 3KMIA 4DJ9A 2KGOA 3D3MA 2YL1A 5G05J 2R9RB 4TXRA 3ZEFA 2OEWA 1MX4A 3GEIA 4YL0A 5HKPA 3FTUA 1BR1A 5EIBE 4G26A 2PQRA 1D1CA 5DQTA 3EHMA 4AP2A 3LDZA 1E90A 5BQHA 4GTVA 3V2OA 2WB7A 3WHNA 5A6KA 4PACA 2Y4UA 3RIBA 2P9UG 3FU3A 4U0SA 3UX4A 4EWCA 3LYAA 4YVOA 3MKQA 3EHRA 3APCA 2MHKA 3G2SA 4UWFA 2XL8A 1OWOA 4UQZA 1WY6A 1OCOE 2H6GA 5HS0A 2DI3A 3PEVB 4CDRA 3ESKA 4DI4A 5JJ7A 3DEPA 5F5HA 4I44A 2P9LG 3TWXA 1SVXA 4U8YD 3MKQB 2VB6A 1LPEA 1XGWA 4KXKB 4MNDA 3MKRA 4E0IA 3LJNA 1OY3D 2XLEA 4D10C 4I1AA 5ENQD 5CERB 2EILC 4C48B 2LQGA 1FT1A 2R17C 3ABLC 5KWDA 1D0ZA 4EBBA 1AEPA 1HG5A 4CS9A 3ABKC 4J8DA 3ZU7B 4ILIA 1H7IA 2NSFA 4JVSA 2C04A 5L0CA 3VTYA 3IEGA 2WXJA 2H6HA 3FH7A 1I4ZA 3U9MA 2E87A 5JUAA 4BY6A 5ENSD 3AGTA 2YEVA 2P2CP 3SF4A 1O87A 4GA1A 3Q73A 4B8CB 2GGFA 2J08A 3TWUA 1E8YA 4EQFA 2PP4A 3W2VA 4F7AA 3GZ1A 2EPKX 1HW2A 4CJOA 3JCUQ 4TXQA 3AOUA 4JTCB 4G7ZF 3KYJA 3LUTB 2BC5A 5L0FA 4N2SA 1WG0A 4N3AA 3TAXA 1Z7Qc 4MQ9F 1EYHA 4J6IA 5FT9A 3KEAA 1TEZA 4OAVB 3DXKG 2VSYA 1WDYA 3ZXSA 5J90A 4NTBA 1JRAA 4Q7CA 3MV2B 4N6CA 2UY1A 5CBNA 3LNMB 1FT2A 4GTTA 2HV6A 3T8KA 3AG4C 5E2QA 2E2EA 3GZSA 4CDYA 3TG5A 3K66A 3V7OA 4MW8A 3RQGA 1OCCC 3OXGA 3FHDA 2WVQA 5EKQD 3U8PA 3N24A 1TN6A 1N1CA 3R7QA 3B7RL 2Y3HA 4HI8A 3SYNA 2WXRA 3SGHA 1FR0A 4G25A 3MA5A 2R03A 2DB4A 4JRZA 2X51A 4NC3A 2LD6A 3D9NA 3T8MA 3PDMP 1ZZPA 1TWGA 1CGOA 2KK1A 3B9QA 4U5BE 3P2BA 2EIKE 3T5VA 1RCPA 1MZCA 3PMRA 4G23A 1TR2A 2Y0BG 2VCBA 3Q7GA 1QNFA 2CFZA 5AENA 3I5PA 2MOWA 4MRUA 3ECSA 3LCAA 1YAUO 3R2PA 4WJ0A 3RO3A 3CQGB 4XI9A 1X81A 5G2NA 2J7PA 1YARO 4DX2A 3QTHA 3Q7FA 2WVIA 1H9TA 3IKOB 5FZSA 2BF0X 2F37A 3AQBA 4JEUA 4GZ3A 3R7CA 2J09A 3JRMO 3PVLA 2XLHA 3IHUA 1GQAA 2DCPA 1PD1A 3F46A 3UM3A 4AIFA 2GRRB 1I5NA 3AG1C 1MX6A 3C72A 4I3MA 2YZSA 2VQ2A 3B95A 2ETAA 2ZXWC 1Q2ZA 4Z9IA 3RW0A 5B1BC 3M79A 1WTYA 3GWLA 2LSVA 3UQ3A 4LDKA 1XZQA 2XGMA 4FAPB 3CEXA 4G8KA 3CVNA 4N2QA 2I2OA 2NUPA 4PS7A 1LE2A 2OJED 4JCHA 1ZYRF 5AJDA 4P29A 1NBBA 3QC1A 3PDNA 4GPMA 4JHJA 3WAQA 2WQHA 2HMZA 4ANWA 1MMNA 4J7YA 1S05A 2Y69E 3PHF2 3TJPA 2NUPB 4XPXA 2VSXE 3VLDA 2D5RB 3RKOF 3Q49B 3M1CB 3M4CA 2IM8A 3ZC4A 2H7VC 1O5MA 1IQUA 3AS5A 3CKCA 2AW6A 1IQRA 4U0ZA 2HV7A 3B0VC 1LVKA 5G04C 3RQEA 2P7VA 4KNVA 4IGGA 5FIOA 3H2UA 3JT1A 3WODF 1D1BA 2XPIA 2XPYA 2GFHA 4HOUA 5CCMA 2VASA 4EHPA 4YL1A 4A1GA 5DQZA 4ABNA 1HMDA 3AQCA 3ZYQA 4PUCA 3CZ6A 4XLNF 5G05C 4D4NA 1T9KA 4QI0A 1TFKB 2IXMA 3IQ6A 3AU4A 4HORA 1HE1A 4JA7A 2WZLA 3RRNB 3CVWA 3CVYA 4IB4A 1G8XA 3EG9A 4ZFHA 5F5FA 3PCVA 3ZVVA 1VLSA 3EG9B 4FWVA 3QW0A 3GM2A 4UDVA 2A5EA 4HNAD 2YL3A 3U5SA 1N52A 4JC7A 2R59A 1G4US 4WNGA 4LRZA 1BR2A 4JZYA 3SFXA 1O3UA 4UQYA 2NXPA 4PDXA 4CIHA 3DE9A 4EZKA 4B0ZA 4L6RA 3U2LA 4CIPA 4YL3A 4LLEA 1UOHA 2VJ8A 4G1TA 3IQTA 3FTVA 2H7BA 3K9IA 1ELWA 3DM9B 4UI9K 2XXAA 2R2LA 4RSYA 3HRAA 3JRTA 1KZOA 2ZXRA 3CVQA 3UT8A 3GEEA 3U8VA 2V8SE 5LX8A 3FDQA 2XXAB 3RK6A 1PV3A 2KC7A 1EKYA 3ZUVB 4U95D 2ZU6B 1NA0A 1ZHTA 2RFMA 5FTPA 4BJ1A 3ML8A 2IF4A 3G2WA 1ELKA 1MMDA 3G50A 4JHKA 3W4YA 3NDBB 2MWQA 2KJGA 4AY5A 5ENNA 2A6HF 4MVRA 2J45A 2H7OA 4GMJA 4G7HF 4HEAJ 3PRZA 3B7UX 3VRCA 3Q79A 1GGQA 3O6XA 4MVMA 5DVWA 2XM4A 2LNIA 3GW4A 2EIKC 2IBFA 3EHNA 3UIOC 3U2MA 4KVOA 2A1DD 2L6GA 5E75A 1SZIA 2QTVA 5JA4D 1HO8A 4U5GA 3QDNA 3S7BA 3QZCA 5E76A 4F4BA 2AJAA 3FEXA 1HF8A 2HFIA 1WWPA 3ZVRA 3W8HA 4FX5A 3LLKA 3E4BA 2OV8A 3CV0A 1GW6A 4FULA 4J8YA 2XQ0A 5JMND 2FEZA 3D9PA 5ITZF 4KVMA 2R7XA 4Z68A 2OVFA 3FWVA 5LOZA 3T9KA 1N0QA 2YLIA 3NMKA 4BJ5A 3OA1A 2MYSA 5DS6A 3NF1A 2L7AA 1K3ZD 5CCLA 1O5HA 3JZ0A 2XEVA 4N5CA 3C98A 3FUEA 5D66A 2EPOA 3I5QA 4GPKA 3MEKA 4BJ6A 4MVQA 3HXFA 1YDIA 2XPZA 2PNOA 4YWQA 1Z3IX 1UG7A 1VTMP 4IYPA 2R7RA 2I1JA 3D9OA 4TXPA 2L9BA 2Y39A 4WUYA 3L34A 1K1AA 2Q9CA 3RH3A 3ESLA 2CNWA 2YQ8A 3ZN3A 3FUDA 3FXHA 3B7BA 2GRLA 3DAGA 1E8ZA 5KYWA 3ZDLA 4RLYA 1T01A 3E37A 2R7VA 4K0RA 3OXLA 2OG2A 4J0UA 1D8DA 1NI1A 4JEAA 2G3KA 3DD7A 3HIZA 3U3WA 1EA8A 4CS8C 5KYWB 3NMJA 5AQ7A 3LVRE 3LEOA 3EDTB 2J4DA 3QB2A 4XWJA 3CHQA 3C18A 2C2LA 3S28A 3ZHEA 2IYLD 1IYGA 4H7XA 2R02A 3VYWA 2G3VA 3S7JA 2A5UA 4LNUD 1HMOA 2F8XK 2ONDA 3QWWA 3LY7A 2VC9A 3ONLA 4CT0A 4XKCA 3ZHEB 1WATA 3CK7A 4JHRA 1SR2A 1V54C 2IOLA 3G4ZA 4LACB 3HNKA 1A5EA 2M64A 2HKVA 1MNDA 5T8IA 4EBJA 3EH1A 4UI9C 3N0TA 1OWMA 2KZTB 4WGZA 2XEHA 4A3TA 1UJKA 3TWQA 3UIPC 3UM0A 2X6KA 3SBTB 4E7SA 4QI2A 2ZISA 3KYIA 2J07A 5D91A 3O48A 5JSLA 3L54A 3BRJA 3IEEA 2VGXB 1TWAA 4L2YA 3LS0A 2A68F 2XLMA 1S0PA 2CGEA 2LXMA 5AQ9A 2AWYA 3MYFA 3C3QA 4U0UA 4V3IA 2RFAA 2ZGGA 4Q69A 4YDWA 5FWQA 2EIJE 2OOEA 4DRJB 1O1SA 1IW7F 3L22A 1NFIE 2RG8A 3S7DA 4FP7A 5AC5A 1B68A 3CSTA 5BUZA 1V74B 1VYIA 4CS8A 4B89A 3MV3B 2DYRE 4HXIA 3U64A 1ZVZA 3FOOA 1OWPA 4DI3A 2Q00A 2AVPA 1Y8MA 1INZA 1ZHZA 2V5FA 2J9WA 1RKCA 3S29A 5JP7A 4TUUA 5FCLA 3PE4A 4ZLDA 2FO1E 1GS9A 3ZXPA 3DSSA 1MHQA 3E34A 2QC9A 3TWRA 2CNWD 1HS6A 3EFOA 3FMSA 3O39A 4NTAA 5JS5A 2CG2A 1N95A 1QZ2A 4XPYA 4UWLA 3S2AA 4JE9A 2YNQA 4EECA 1YJGA 3UUXA 3UNGC 1MNEA 2KBXA 2CG3A 1OW8A 5T3WA 1PY1A 3E30A 4GTMA 1Y6DA 4I43A 4Y6WA 2PM6A 1RZ4A 2R25A 4HRLA 2DZNA 3GM3A 4B93B 4DXWA 3ABMC 2LP4A 1LD7A 4NIKA 4KT6B 3RQFA 4GA0A 4JTDB 5A6AA 1TNYA 2Y4TA 3SY2A 3I4RB 4AK9A 3R9MA 4C0MA 1JMWA 1QKRA 2B6CA 4R7LA 3F47A 3FH5A 1D8EA 2PQNA 3FUIA 5KCMA 3QK0A 2LCHA 2ETCA 5E3CA 1Q0FA 4IAQA 2LFFA 4GTOA 1LIHA 3EUVA 4C3DA 3JSZA 4W8PA 2AWIA 1KLXA 3EZHA 5BUOA 3GZ2A 1XWJA 5A6BA 3HXEA 5LP0A 4A55A 4G2VA 1YYHA 3C62A 4LEUA 4LERA 3MGBA 3V5ZA 3QOUA 1S7ZA 1JUQA 4M7CA 3RYLA 1IXVA 1E8XA 2XLWA 1ZHYA 2QE9A 4MVSA 1EQ1A 4E17A 5GPGB 3K1IA 4GEHA 4WWNA 1N9AA 1Z63A 1S70B 3DJUB 5J08A 2OKUA 3PH0C 1K8KG 3POVA 3T6BA 5EHHA 1H9GA 2OVBA 2OCCE 3TGOA 4FLBA 3BUAA 5L0JA 4AEZC 1XZPA 1UN8A 4LUNU 4ANUA 3S27A 4CX9A 4EZJA 5B1AE 2YRFA 1MX2A 2FF4A 3R9AB 4YT5A 5D0OD 4A1SA 2OQMA 5A6JA 4BX8A 3FULA 1OCZE 5C1DA 1FFTC 5EDSA 4N3CA 1MQVA 1QPUA 4DLOA 2Y3GA 5COGA 5FQ4A 1CGNA 3RFYA 1HH8A 3MJWA 4ULVA 2EINE 1T6QA 2V4LA 5KJNA 4AE4A 1Y6IA 4C3EA 3PNLB 3QWVA 4K7BA 4XI0A 4HVBA 1OW6A 3L08A 3EU5A 3NYJA 4BTAA 4CBEA 3SHFA 5EILA 4C0EA 4ANJA 3FU5A 4PJMA 3VM6A 2XM0A 4B94A 1R4TA 1KPSB 1YYXA 4OIRF 5A7DB 2XZDG 3CK8A 2XZTG 4E6HA 5DS5A 3FUKA 5JHAA 3X2QE 3DZAA 3KH2A 2BKKB 2P1AA 2KCKA 1OWNA 4EBAG 5BXUA 4L7TA 4IJJA 1TYQG 4N5QA 2IU1A 2FFHA 2ZPAA 4BSZB 2GAQA 1XNFA 1SW6A 2HO1A 3R7RA 5LCWC 1EPUA 2PNNA 1JAFA 1VB5A 3M15A 1I4YA 4DVYP 2LIGA 3U9JA 3W8IA 3ZYMA 1KU2A 4B6IA 1TN8A 2YKZA 3MBGA 3ML9A 1QLEC 1WOLA 4BETA 5CI9A 4PK4A 1D0YA 3T4RA 4P9FA 4J8SA 4O60A 4E85A 4I2ZA 3QJZA 2LO6A 2Y3AA 3LS8A 3SNXA 1JPLA 4P9TA 4WWOA 1AP7A 4GA2A 1FFHA 4GTRA 4LCTA 1DCQA 1L7CA 1L5JA 3CVLA 4X8QA 1OUVA 2UY1B 3ASOE 3E33A 2IO2C 3FH8A 5JHBA 3G2TA 4N4WA 5LFAA 2V4HC 3C63A 4MKTA 2V0PA 2B0JA 4R32A 2XRYA 4U5EE 3IV0A 4JJGA 4YVQC 2TMVP 4J8FA 3UGOA 4HQDA 2HE0A 3QARA 3URZA 2J4BA 3RKVA 5COFA 2EPLX 5KYNA 3W9GA 4ME2A 2KXPC 1JR8A 2CCYA 2A6EF 4CDVA 5BT1A 2EQXA 4F6RD 2P9SG 5CRUA 4G7OF 1UN9A 3ULQA 4AOFA 1DCEA 2KQ9A 4O6NA 1F1MA 3FTXA 3B29A 2R7WA 2F0YA 4ILHB 1U6HA 3EZIA 1OWLA 4XQ1A 1QYMA 4LNGA 2Y1LE 3GYZA 3Q75A 5AAOA 2J9QA 5IY5E 3I4UA 1VYKA 1WN0A 3NQPA 1VK5A 3VLEA 5ENOD 4XX5A 3G4XA 3CHMA 3JXJA 4U9EA 4I17A 4CEMA 1KTMA 2P6VA 3NB2A 5K0IA 5CI8A 5B3SE 4U8HA 1FTSA 2F22A 1QQ3A 1KT0A 1OKKA 4JKVA 1Y4CA 3B13A 3BEHA 4JJFA 3FTWA 3IBEA 3Q78A 3JSEO 3AS8A 3E32A 4KZCA 1HW1A 1DOVA 2Y3DA 3DM5A 2FBNA 2A0BA 2IONA 2I6HA 2I15A 3CHSA 1A17A 1A41A 4FHKA 3K7DA 1V55C 3QW1A 1S63A 3TWVA 1TKNA 2PX0A 4L9PA 2XENA 3C3OA 5L3VA 2IFUA 4NQ0A 2V5QC 5KJLA 5L0DA 1SZAA 2CHXA 4BWRA 2PL2A 2AXZA 2C0MA 3D9KA 3W9FA 2FAPB 2ILRA 3UMHA 1LI7A 3SXMA 2XCCA 4GU5A 4HE8D 5COMA 4KZ0A 2FGYA 1NFOA 4WABA 4PJNA 4JW1A 3ASNE 4CJGA 3ZKJA 3HG0D 4GB9A 1E2XA 5B1AC 3TOLA 1OCOC 4QFVA 2WZGA 3LAYA 4BEPA 5JJTA 2WXOA 1MMAA 2YL0A 5DBKA 3JUIA 1N4RA 2GWWA 4EBKA 4E18A 2R7QA 2EPNA 4CT4A 1E8WA 3SO8A 3EQLF 2DVWA 3FUFA 3OXFA 1NLXA 1E83A 4JA9A 2UUHA 3CHPA 3UM2A 4IAOA 3ZSUA 3HLZA 4ZLCA 4HOTA 1K1BA 1QVXA 1T6UA 2X6IA 2J7PD 3DSWA 5AQBA 4A3VA 2VCAA 3V2XA 2PBEA 1TNUA 3ISMC 4LDQA 1A7DA 1ZBPA 3BEEA 3O4ZA 2L6HA 3KS2A 4DX6D 3X1OA 1AVOB 1JPNA 5F28E 4K0DA 3HTKC 1BLXB 2QZAA 2J8WA 1HE8A 3FUHA 2XL6A 3ULEG 1FMVA 5E3AA 3HVEA 3PS6A 5AGFA 4FESA 5T4YA 1OKKD 3SNHA 3ASHA 3UGPA 1EDUA 3KAEA 1ZB1A 2R05A 2P9KG 1NG1A 5FJYA 3AGUA 3S84A 3HVEB 2OOCA 3RJVA 1X5BA 3KEZA 3ATPA 3EH2A 2GROB 2VYIA 4GTSA 1G4WR 4KNWA 5CMYA 3PZ1A 1H6KA 4FC8A 1NSGB 2P61A 4JPSA 2JEKA 4F3VA 1NFNA 2Q4FA 4XPWA 4JL0A 3FOPA 4JXTA 4G11A 5EX3A 4BJ5C 3VTXA 2BTDA 2R7TA 1SF8A 1LF8A 1BI8B 3LY9A 3DSXA 3PZ4A 4RG9A 2IOSA 3KSLA 3V5XA 4BJ6C 3UKRG 5FZQA 5CEAA 3VLFA 1T6IA 2YLGA 3CSFA 2ZXOA 3JYYA 4O6MA 4KYOB 2ZD9A 1SZ9A 4L1BA 4YN0B 1H6PA 3L6AA 3SZRA 2YL7A 2L9JA 4MW3A 2EIME 1BR4A 3US6A 1ST6A 1LTXA 2X0CA 5CRVA 1U2VG 3UT7A 3LEVA 4MS2A 3ASGA 4N3BA 1FVHA 4UWGA 1ZU5A 2HSBA 1RW2A 3AG2E 5KYUA 2QYUA 3UR3C 3Q7AA 2X6FA 5EX0A 1ZU4A 1ZW3A 3SXKA 3SXYA 3TOMA 4CGWA 2NUTA 5KYUB 3FEYA 2FULA 4UWHA 2WB2A 1IZMA 4O79A 3OWTA 3Q9NC 3DKAA 1JPJA 2AP3A 2NUTB 3DMDA 2XGOA 4JB8P 1NA3A 1YVIA 2IO3C 2HYZA 5L0HA 2P0NA 4BJTA 4CRWA 5JRAA 1JWFA 1TJCA 3D9MA 4JTAB 3ZWIA 4YNDA 4WWPA 4G0HA 3DJNB 2OU6A 4GYTA 1Q0GA 4HFFB 3E70C 2XHEA 3FUMA 3EJNA 5ENRD 1E96B 1QSPA 2QNLA 5KYYA 3J5QB 1FNTc 4A63B 2WQ7A 5CEDB 4PR9A 3BG1B 1ZHWA 4BTBA 1EF1C 4N39A 5KYYB 1M2VA 2XRHA 4ANXA 1FPPA 3C8GA 1AUEA 5E33A 1BPOA 1ELRA 3RVZA 4ER9A 4YK5A 4EUKB 2WQ6A 2NSGA 4GCOA 1M2VB 3AS4A 4LSZE 5EYLA 5EIDA 3MCXA 3LKUA 2QLAA 3UMIA 2Y69C 5ANRA 3E9VA 3S90A 1P5QA 1VOMA 1OXKA 2WMNA 5JJ6A 1M2OA 2EILE 5AC4A 1PD0A 3G2VA 4N6HA 3ZRHA 4I6EA 3I3NA 3EIQC 3ABLE 3HXDA 1T5OA 1YMPA 1W2WA 4NCQA 1DOWA 2VSNA 2KCLA 2J49A 4HI9A 3N71A 1HG2A 2NC9A 3V5YA 1TJFA 3CLJA 4IWBA 4DVZA 3ASFA 3RAUA 4XEIG 2WXPA 4DRXE 1ZU2A 4EBAA 3ITFA 3QNKA 4GYWA 4GCNA 1C03A 1Z23A 4GZDA 5L0IA 2NYJA 2RD9A 3AAAC 4K5CA 3CQZA 2UUIA 4DX5D 3L82A 5KNGA 3Q6NA 5DS4A 3K6BA 3SXZA 2WVNA 1TNBA 1NU7D 2L81A 2BE5F 1D1AA 3HXCA 1N0RA 4YT4A 4NURA 3IHYA 3N2ZB 2KM4A 4DX7D 4DBQA 2DWZA 3ASDA 4DBRA 3Q5MA 4O7GA 3CVUA 3GANA 1OXBA 4H54A 1WASA 4P6IC 2QY7A 2YVKA 2MRIA 3AG4E 1Z5SC 2YQYA 3ZG1A 4BPMA 3CVPA 1QBQA 4A2NB 3CQCB 4FLHA 3LLIA 2ETSA 2H8AA 3VF0A 1RMVA 4O1OA 4AVXA 4H7YA 1VMAA 3ZNGA 4JURI 4NY3A 3L8IA 5CECB 3FDHA 2JABA 3B7SA 5ENTD 3UPVA 4U5CE 1MJ0A 4AL0A 1M6TA 5C2YA 3LESA 4LDRA 5D0QD 3K1IC 3MZLB 5T1DB 3T5XA 3Q7LA 1DVPA 2A4ZA 5FINA 1Z6TA 2QYJA 5EYPF 4J30B 3EFOB 2HM8A 3CKBA 2VGYA 5HI7A 3PZ3A 1ZW2A 3TJ6A 4ULWA 4DOZA 4DJAA 2XLVA 5BV1A 2Q7RA 2XEEA 3JYSA 3LY8A 3UMVA 2KNHA 5BNWA 3C8ZA 4HRNA 1YYJA 3S7FA 3D9LA 3PNTB 3B0UX 2WXHA 4CDNA 1M57C 1KT1A 4M3OA 5AN8A 4AJWA 3S0XA 3DSVA 3TG4A 3RRUA 3J5PA 2CW0F 2J9UA 3LEWA 3K1HA 5JT4A 5ARFA 1N54A 5EN5D 4CDMA 1Z5ZA 4RVBA 2JPUA 1BI7B 3AG1E 2KCVA 3ZFWA 3AG2C 4U5HA 4U07A 1OQCA 2XLDA 4PFPA 4BEMJ 5AQAA 4MVOA 4E7ZA 2ZXWE 1BU9A 4MTGA 3UXGA 5EGYA 3ZQYA 2R7SA 4MBGA 4XZ4A 4I1MA 3FHEA 2IOQA 4NTFA 1K05A 1KZPA 3FAJA 4OD5A 2R7OA 3CVXA 5G04J 1HXIA 2L6JA 4GZ5A 3VAYA 2ZXPA 4I6GA 3ULYA 1VDYA 4DRHB 2LAHA 3L13A 2IJGX 2J0WA 3UKUG 4BG0A 3LPZA 1Q0DA 3KL4A 3SEOA 2YHSA 1NZNA 3LJBA 3UM1A 1Q0MA 4Q94A 1Z3YA 1M56C 3Q4AB 1A7EA 2XLOA 2MYOA 3IQ5A 3LS1A 3UI2A 4HLEA 2X38A 4DX1A 5AIJA 1PCXA 1ZHXA 3WXXA 1TFOB 3U4TA 4LNBA 3BQOA 3SD5A 3PUJA 4ACLA 2LAIA 2LXLA 4E0HA 2DIWA 2FI7A 3LJ3A 3T9OA 3SFZA 1L3PA 4FJZA 2EPMX 2HS5A 4IN3B 3TXMA 4HFGA 2IXOA 4ONSA 3QWPA 5DIZA 4H4KC 5FQ6A 3L16A 3FFLA 1H19A 3SBSA 5AJLA 1IKND 4FHJA 1CPQA 5D2MC 4AE4B 4WAFA 4JZAA 2PM7A 3DBSA 4EKWA 2IXPA 2PZIA 4GQHA 4MVUA 4K5BA 2G62A 5BXOA 1V4AA 3KD7A 5KJKA 4BSXA 1NZEA 3G2UA 4RQIA 4I2WA 1W3BA 3NMIA 1IHGA 2R5SA 3KPHA 2HJ3A 3CSKA 2NSZA 1U3DA 4WNEA 3V31A 1FVFA 4A4AA 3HNJA 2H6FA 4APFA 4BESA 3HYMB 3EIJA 4YT2A 2P9PG 3GORA 4AL1A 4I1OB 3O10A 1FCHA 1QQEA 2X3MA 2H6IA 4CDAA 2LSEA 3JTLO 3Q47B 1UFBA 3NYMA 3IXEA 2OEVA 3U3BA 2LSUA 3DAFA 3CVVA 3JXIA 3PZ2A 3MX3A 2KYHA 3ONKA 4BX9A 5A6BD 4DUIA 3NZSA 1UJJA 3B0PA 2HR2A 3EHQA 2VSOE 5KNHD 4KMOA 2ETBA 3ZIMA 2BKGA 3EU9A 3NKDA 3EGDA 3DWLG 1YZCA 2DYSE 2D4UA 2WXKA 3ZGQA 2V26A 3H2VA 2IEJA 1J8MF 2EIJC 3EGDB 3HNIA 1ORJA 2CDQA 1N94A 1FMWA 4G8LA 4Q4ZF 5T3RA 1BD8A 4OVUA 1UW4B 2J9VA 1WM5A 3L17A 2DYRC 2QUPA 2WXNA 3JCKC 1E7VA 2XCBA 3Q15A 1ORSC 5BQGA 1TNOA 2KSFA 5BQIA 1RXQA 2RSEB 3DWWA 3FTZA 1LD8A 3FTSA 2W4MA 3RRMB 1LS1A 4J32B 4RDAA 3IPMO 4U8VD 3W2WA 3MLGA 3BU8A 3QMKA 4J7TA 2WXFA 2O9XA 3NOCD 4N06A 256BA 2YHEA 1HZ4A 2AWCA 4J7WA 4KBLA 2PX3A 4ATZD 2AXVA 1SA4A 2R7UA 3OAWA 3DEOA 2JLBA 2OJQA 1HE9A 3TQOA 4DK5A 5D92A 5CHEE 4APOA 2XSEA 3EGXA 4X0RA 3ZYLA 1YA0A 3MYIA 1TN7A 2GRPB 2Q9AA 2GA0A 1H2UA 4IULA 2QY9A 2C03A 3GEHA 3A9CA 3EGXB 1N4SA 1OT8A 2V3CC 4Z9HA 4UQXA 3L8JA 1D9SA 3L0IA 2BL2A 1H0AA 1TNZA 1UG3A 3D9IA 1FAPB 5KJMA 1SQMA 3AG3E 4OIOF 2WXGA 3RVYA 2BUGA 4OAUC 1YZAA 2I9CA 5HSWA 3CHOA 3TWSA 3AU5A 2LK4A 2FO7A 4G24A 4GZCA 3C7JA 2LFDA 4RD9A 3NZUA 3CHRA 4MVZA 4XKBA 3QKYA 4GMRA 2WXIA 3MYVA 3FAPB 4EHMA 2X6JA 5FZTA 2W45A 4GTQA 3NYLA 2WXQA 2HSQA 4O1PA 2XS8A 4BEJA 3IHVA 2W4BA 1A0BA 3V79K 3QVZA 4U5DE 4OIQF 1GM5A 4U63A 3DSUA 2JX0A 4FJYA 2VCCA 2AU5A 3U66A 2OCCC 4GZ6A 3PE3A 2E0IA 4UI9J 1K04A 4CZ2D 1LKXA 1SYQA 1NP7A 2YWAA 4W8KA 1G3NB 3HDXA 2ZIRA 1B89A 2Q9BA 1JWGA 4W9RA 1MQSA 1OCZC 5L0GA 2Z15A 1YCSB 3KSQA 4U5FE 3RF3A 5BPPA 4DRIB 4GYOA 1DC2A 2DZOA 2CHWA 4FADA 5B3IA 4PJJA 4F1SA 1RJ9A 2EINC 4IRUA 2IXNA 3SQVA 1YLMA 4OVVA 1V54E 1E85A 1C02A 1J8YF 3OTNA 4XIFA 2XGSA 2GRQB 1RJ9B 4OINF 4DLQA 2OEXA 4XE0A 2W9YA 5HV9A 2L6FA 3WG7E 3A11A 3L9TA 2RD0A 4C3BA 3JYHA 5KBAA 1OR2A 1TR4A 3APFA 3PREA 3X2QC 1NU9C 3TULA 2GRNB 2IQCA 2NPUA 3RO2A 1PAQA 3DPYA 4TV3A 3LXUX 2HMQA 5JVEA 4HS2A 4CYMD 3PEUB 2F8YA 4XEVA 3APDA 3RU0A 3FUJA 2KATA 3B7TA 5KYXA 5FQ8A 3SFYA 3CIAA 5DLJA 5HQ8A 3CR3A 3AJMA 4K03A 5AARA 1ORYA 4CGVA 1OCRE 4Q5SF 5KYXB 2A69F 5CIVA 3AJIA 4EZLA 5TJ5E 4URKA 3U0CA 3Q9UC 4U96D 1SA5A 3HHMA 4AM9A 2KW3C 3JQ0A 5ENPD 4XEKA 2I8BA
chains in the Genus database with same CATH topology
2WVOA 4O6YA 5T3TA 2AXUA 4Q96A 1TWHA 2DGJA 5BV0A 3ENEA 3ASOC 3BG0B 2DYSC 4MLPA 4RG6A 2NG1A 4HOQA 1Z3XA 4DPRA 3LNRA 5A23A 4YJWA 2PFDA 1Z6AA 3CK9A 2YHCA 2WXMA 3UMKA 2VH3A 4PS8A 1TWCA 4ACKA 4LLCA 4L23A 2YINA 5ARGA 4F53A 4FA6A 4QDLA 3K33A 3QAQA 3GODA 2GW1A 3NKEA 1H2VC 4J8EA 2JD3A 5IY5C 4M63A 4O6FA 3JQ1A 5A6CA 1SMYF 3ZYKA 4WNDA 4CS7A 3FUNA 2Q7FA 3PUKA 4OD4A 1HFAA 5B3SC 1WGWA 3EPVA 3OEOA 4GAAA 2WPVA 4B8AA 1MMGA 5G55A 4BT9A 2WM9A 3AG3C 4OYSA 2M63A 3I4GA 4JC8A 3D9JA 3KKBA 3DPDA 3Q6MA 4GYYA 3PZDA 3T6JA 4PH4B 4YT8A 4CSAC 4KBQA 5LCWJ 3HJCA 3FY4A 4AV7A 5CMWA 4XLPF 1WAO1 2L0IA 2P58C 2M4EA 2VTBA 4NACA 3ASNC 2Q3TA 4XTKA 2X6HA 5AYWD 4ILGA 1U3CA 2CHZA 4CCAA 3ZW3A 4TRQA 2VTBB 1E7UA 3DXJF 4UWKA 3LVQE 1PC2A 2I1KA 3SI5A 3ZIBA 4L2LA 3SZ7A 2L0TB 4RBNA 4AXHA 3CEQA 3P1UA 4EPZA 3TD7A 3TXNA 3NG1A 3H65A 2WZFA 1HU3A 5BW8C 2KZTA 4Y6CA 2XL4A 1DNPA 4I9EA 4JEHA 4AX2A 3WG7C 3CGHA 3U9WA 2J46A 4PS3A 2VGXA 2QFCA 4CSAA 5ANLA 4OIPF 2UWJG 4ANVA 1D0XA 4HFKB 4GMLA 3FU0A 4MS6A 3SP1A 2XRZA 4I9CA 4BFRA 4PJLA 4NRHB 3FU6A 1OCRC 4FU3A 4PFOA 4C9BB 3ZPJA 2WMOA 2GRMA 4KI2A 3FVYA 2Y3BA 2DBAA 4AY6A 2PF4E 5M72A 4I6JA 4WNFA 3TL5A 4C7OA 4HOSA 5L3QA 4BT8A 2EIMC 4ATGA 4U04A 2C0LA 4C7OB 5FQ7A 3FP3A 3NRHA 4KC9A 1HX8A 3UT4A 2CFUA 1QZXA 3FTYA 4CS9C 5FZRA 2WXLA 3RIPA 2WL8A 1H2TC 2J0XA 3KMIA 2KGOA 3D3MA 5G05J 3ZEFA 3FTUA 1BR1A 4G26A 2PQRA 1D1CA 5DQTA 3EHMA 4AP2A 3LDZA 1E90A 2WB7A 2Y4UA 3RIBA 3FU3A 4U0SA 3UX4A 4EWCA 3LYAA 4YVOA 3MKQA 3APCA 2MHKA 3G2SA 4UWFA 1OWOA 4UQZA 1WY6A 4CDRA 4DI4A 3PEVB 5JJ7A 3ESKA 5F5HA 4I44A 3MKQB 2VB6A 1XGWA 4KXKB 4MNDA 3MKRA 4D10C 4I1AA 2EILC 2R17C 3ABLC 1D0ZA 4EBBA 1HG5A 4CS9A 3ABKC 4J8DA 4ILIA 3VTYA 4JVSA 2C04A 3IEGA 2WXJA 3FH7A 2E87A 4BY6A 2YEVA 3SF4A 1O87A 4GA1A 4B8CB 2GGFA 2J08A 1E8YA 4EQFA 2PP4A 3W2VA 4F7AA 3GZ1A 3JCUQ 4G7ZF 4N2SA 4N3AA 3TAXA 4MQ9F 1EYHA 4J6IA 5FT9A 1TEZA 2VSYA 3ZXSA 5J90A 4Q7CA 3MV2B 2UY1A 2HV6A 3AG4C 5E2QA 2E2EA 3GZSA 3TG5A 3K66A 3V7OA 1OCCC 3OXGA 3FHDA 2WVQA 5EKQD 3N24A 1N1CA 3R7QA 3B7RL 2Y3HA 3SYNA 2WXRA 3SGHA 4G25A 3MA5A 2X51A 3D9NA 3T8MA 3B9QA 1TWGA 4U5BE 3P2BA 3T5VA 3PMRA 4G23A 1TR2A 3Q7GA 1QNFA 2CFZA 5AENA 3I5PA 2MOWA 4MRUA 3ECSA 3LCAA 4WJ0A 3RO3A 3CQGB 4XI9A 5G2NA 2J7PA 2WVIA 3IKOB 5FZSA 2BF0X 3AQBA 4JEUA 4GZ3A 2J09A 3PVLA 2DCPA 1PD1A 3F46A 4AIFA 3AG1C 4I3MA 2YZSA 2VQ2A 2ZXWC 5B1BC 3UQ3A 2LSVA 2XGMA 3CVNA 4N2QA 2I2OA 2NUPA 4PS7A 4JCHA 1ZYRF 5AJDA 4P29A 3QC1A 3PDNA 4JHJA 2WQHA 4ANWA 1MMNA 3PHF2 3TJPA 2NUPB 2VSXE 3VLDA 2D5RB 3RKOF 3Q49B 3M1CB 3ZC4A 2H7VC 1IQUA 3AS5A 3CKCA 2AW6A 1IQRA 4U0ZA 2HV7A 3B0VC 1LVKA 5G04C 2P7VA 4KNVA 3JT1A 3WODF 1D1BA 2XPIA 2XPYA 2GFHA 4HOUA 5CCMA 2VASA 4A1GA 5DQZA 4ABNA 3AQCA 3ZYQA 4PUCA 3CZ6A 4XLNF 5G05C 4QI0A 2IXMA 3AU4A 4HORA 4JA7A 2WZLA 3RRNB 3CVWA 3CVYA 1G8XA 3EG9A 5F5FA 3ZVVA 4FWVA 3EG9B 1N52A 2R59A 4WNGA 4LRZA 1BR2A 4JZYA 4UQYA 2NXPA 4PDXA 4CIHA 4EZKA 4B0ZA 4LLEA 2VJ8A 4G1TA 3FTVA 2H7BA 3K9IA 1ELWA 3DM9B 4UI9K 2XXAA 4RSYA 3JRTA 2ZXRA 3CVQA 3UT8A 2V8SE 5LX8A 3FDQA 2XXAB 3RK6A 2KC7A 2ZU6B 1NA0A 1ZHTA 5FTPA 4BJ1A 3ML8A 2IF4A 3G2WA 1ELKA 1MMDA 4JHKA 3NDBB 2MWQA 2KJGA 4AY5A 5ENNA 2A6HF 2J45A 2H7OA 4GMJA 4G7HF 4HEAJ 3PRZA 3B7UX 3O6XA 5DVWA 2LNIA 3GW4A 2EIKC 3EHNA 4KVOA 2A1DD 5E75A 1SZIA 2QTVA 1HO8A 4U5GA 3QDNA 3S7BA 3QZCA 5E76A 4F4BA 3FEXA 1HF8A 3ZVRA 3W8HA 4FX5A 3LLKA 3E4BA 2OV8A 3CV0A 1GW6A 4FULA 2XQ0A 2FEZA 3D9PA 4KVMA 2R7XA 2OVFA 3FWVA 5LOZA 4BJ5A 3OA1A 2MYSA 5DS6A 3NF1A 5CCLA 1O5HA 2XEVA 4N5CA 3C98A 3FUEA 3I5QA 4GPKA 3MEKA 4BJ6A 2XPZA 4YWQA 1Z3IX 4IYPA 2R7RA 2I1JA 3D9OA 2L9BA 2Y39A 4WUYA 3L34A 2Q9CA 3RH3A 3ESLA 2CNWA 2YQ8A 3ZN3A 3FUDA 2GRLA 3DAGA 1E8ZA 5KYWA 2R7VA 4K0RA 3OXLA 2OG2A 4J0UA 2G3KA 3DD7A 3HIZA 3U3WA 4CS8C 5KYWB 3LVRE 3EDTB 2J4DA 3QB2A 4XWJA 3CHQA 2C2LA 3S28A 3ZHEA 2IYLD 1IYGA 4H7XA 3VYWA 2G3VA 3S7JA 2A5UA 2ONDA 3QWWA 3LY7A 3ONLA 4CT0A 4XKCA 3ZHEB 3CK7A 4JHRA 1V54C 2IOLA 4LACB 1MNDA 5T8IA 3EH1A 4UI9C 3N0TA 1OWMA 2KZTB 4A3TA 1UJKA 2X6KA 3SBTB 4E7SA 4QI2A 2J07A 5D91A 3O48A 3L54A 3IEEA 2VGXB 1TWAA 4L2YA 3LS0A 2A68F 1S0PA 2CGEA 4V3IA 4U0UA 4Q69A 5FWQA 2OOEA 1IW7F 3L22A 2RG8A 3S7DA 4FP7A 3CSTA 5BUZA 4CS8A 1VYIA 4B89A 3MV3B 4HXIA 3U64A 1OWPA 4DI3A 2AVPA 1Y8MA 1INZA 1ZHZA 2V5FA 2J9WA 3S29A 4TUUA 5FCLA 3PE4A 4ZLDA 1MHQA 2CNWD 3O39A 3EFOA 1HS6A 2CG2A 1QZ2A 4UWLA 3S2AA 2YNQA 4EECA 3UUXA 3UNGC 1MNEA 2CG3A 5T3WA 1PY1A 4I43A 4Y6WA 2PM6A 3ABMC 4KT6B 4GA0A 2Y4TA 3I4RB 4AK9A 4C0MA 4R7LA 3F47A 3FH5A 2PQNA 3FUIA 5KCMA 3QK0A 5E3CA 4C3DA 3JSZA 2AWIA 1KLXA 3EZHA 5BUOA 3GZ2A 5LP0A 4A55A 4G2VA 4LEUA 4LERA 3MGBA 3QOUA 1S7ZA 1JUQA 3RYLA 1E8XA 1ZHYA 4GEHA 4WWNA 1Z63A 3DJUB 5J08A 3PH0C 3POVA 3T6BA 5EHHA 2OVBA 3TGOA 4FLBA 4AEZC 1UN8A 4ANUA 4LUNU 3S27A 4EZJA 2FF4A 3R9AB 4YT5A 5D0OD 4A1SA 4BX8A 3FULA 5C1DA 1FFTC 5EDSA 4N3CA 4DLOA 2Y3GA 5FQ4A 3RFYA 1HH8A 3MJWA 2V4LA 5KJNA 4AE4A 1Y6IA 4C3EA 3PNLB 3QWVA 4K7BA 4XI0A 4HVBA 3L08A 4BTAA 3NYJA 4CBEA 3SHFA 4C0EA 4ANJA 3FU5A 4PJMA 4B94A 4OIRF 5A7DB 3CK8A 4E6HA 5DS5A 3FUKA 5JHAA 3DZAA 3KH2A 2KCKA 4EBAG 1OWNA 4L7TA 4IJJA 2IU1A 2FFHA 2ZPAA 1XNFA 2HO1A 3R7RA 5LCWC 1EPUA 4DVYP 3W8IA 3ZYMA 1KU2A 4B6IA 3ML9A 1QLEC 5CI9A 4PK4A 1D0YA 3T4RA 4J8SA 4E85A 4I2ZA 3QJZA 2LO6A 2Y3AA 3LS8A 3SNXA 1JPLA 4WWOA 4GA2A 1FFHA 4LCTA 1L5JA 3CVLA 1OUVA 2UY1B 3FH8A 5JHBA 3G2TA 5LFAA 4MKTA 2V0PA 2B0JA 2XRYA 4U5EE 3IV0A 4JJGA 4YVQC 4J8FA 3UGOA 3QARA 3URZA 2J4BA 3RKVA 5KYNA 4ME2A 2A6EF 5BT1A 2EQXA 4G7OF 1UN9A 3ULQA 4AOFA 2KQ9A 4O6NA 3FTXA 2R7WA 4ILHB 3EZIA 1OWLA 3GYZA 2J9QA 3I4UA 1VYKA 3NQPA 1VK5A 3VLEA 4XX5A 3CHMA 4I17A 4CEMA 2P6VA 5CI8A 4U8HA 1FTSA 1KT0A 1OKKA 3B13A 4JJFA 3FTWA 3IBEA 3AS8A 4KZCA 2Y3DA 3DM5A 2FBNA 2IONA 2I6HA 3CHSA 1A17A 4FHKA 3K7DA 1V55C 1TKNA 2PX0A 5L3VA 2IFUA 4NQ0A 5KJLA 1SZAA 2CHXA 4BWRA 2PL2A 2AXZA 2C0MA 3D9KA 2ILRA 3UMHA 2XCCA 4GU5A 4HE8D 4KZ0A 2FGYA 4PJNA 4JW1A 4GB9A 5B1AC 5JJTA 1OCOC 4QFVA 2WZGA 3LAYA 2WXOA 1MMAA 5DBKA 3JUIA 2R7QA 4CT4A 1E8WA 3EQLF 3FUFA 3OXFA 4JA9A 3CHPA 4IAOA 3ZSUA 3HLZA 4ZLCA 4HOTA 2X6IA 2J7PD 4A3VA 1ZBPA 3BEEA 3O4ZA 3KS2A 3X1OA 1JPNA 4K0DA 3HTKC 1HE8A 3FUHA 1FMVA 5E3AA 3HVEA 3PS6A 4FESA 5T4YA 1OKKD 3SNHA 3ASHA 3UGPA 1EDUA 3KAEA 1NG1A 5FJYA 3HVEB 3RJVA 1X5BA 3KEZA 3EH2A 2VYIA 4KNWA 5CMYA 1H6KA 4FC8A 4JPSA 2JEKA 4F3VA 4JL0A 4JXTA 4G11A 5EX3A 4BJ5C 3VTXA 2BTDA 2R7TA 1SF8A 1LF8A 3LY9A 4RG9A 2IOSA 4BJ6C 5FZQA 3VLFA 3CSFA 2ZXOA 4O6MA 4KYOB 1SZ9A 4L1BA 4YN0B 3L6AA 3SZRA 2L9JA 1BR4A 1ST6A 3UT7A 3LEVA 3ASGA 4N3BA 1FVHA 4UWGA 1ZU5A 5KYUA 3UR3C 2X6FA 5EX0A 1ZU4A 4CGWA 2NUTA 5KYUB 3FEYA 2FULA 4UWHA 2WB2A 1IZMA 4O79A 3OWTA 1JPJA 2NUTB 3DMDA 2XGOA 1NA3A 2HYZA 4BJTA 4CRWA 1JWFA 1TJCA 3D9MA 4YNDA 4WWPA 4G0HA 3DJNB 4GYTA 4HFFB 3E70C 2XHEA 3FUMA 3EJNA 1E96B 5KYYA 2WQ7A 3BG1B 1ZHWA 4BTBA 1EF1C 4N39A 5KYYB 1M2VA 2XRHA 4ANXA 5E33A 1BPOA 1ELRA 2WQ6A 4GCOA 1M2VB 3AS4A 3MCXA 3LKUA 3UMIA 2Y69C 5ANRA 3E9VA 1P5QA 1VOMA 2WMNA 5JJ6A 1M2OA 1PD0A 3G2VA 3ZRHA 4I6EA 3I3NA 3EIQC 1W2WA 2VSNA 2KCLA 2J49A 3N71A 1HG2A 2NC9A 1TJFA 3CLJA 4IWBA 4DVZA 3ASFA 2WXPA 1ZU2A 4EBAA 3ITFA 3QNKA 4GYWA 4GCNA 4GZDA 1Z23A 3CQZA 3Q6NA 5DS4A 3K6BA 2WVNA 1NU7D 2L81A 2BE5F 1D1AA 4YT4A 4NURA 3IHYA 3N2ZB 2KM4A 4DBQA 3ASDA 4DBRA 3Q5MA 4O7GA 3CVUA 3GANA 4P6IC 2QY7A 2MRIA 3ZG1A 3CVPA 4A2NB 3CQCB 4FLHA 3LLIA 4AVXA 4H7YA 1VMAA 4JURI 4NY3A 3FDHA 3B7SA 3UPVA 4U5CE 5C2YA 3LESA 5D0QD 3K1IC 3MZLB 5T1DB 3T5XA 3Q7LA 1DVPA 2A4ZA 1Z6TA 4J30B 3EFOB 2HM8A 3CKBA 2VGYA 5HI7A 4DJAA 4DOZA 5BV1A 4ULWA 3JYSA 3LY8A 3UMVA 2KNHA 5BNWA 3S7FA 3D9LA 3PNTB 3B0UX 2WXHA 4CDNA 1M57C 1KT1A 4M3OA 4AJWA 3S0XA 3TG4A 3RRUA 2CW0F 2J9UA 3LEWA 3K1HA 5ARFA 1N54A 4CDMA 1Z5ZA 4RVBA 2KCVA 3ZFWA 3AG2C 4U5HA 4U07A 4PFPA 4E7ZA 5EGYA 2R7SA 4XZ4A 4I1MA 3FHEA 2IOQA 3CVXA 3FAJA 4OD5A 2R7OA 5G04J 1HXIA 2L6JA 4GZ5A 3VAYA 2ZXPA 4I6GA 1VDYA 2LAHA 3L13A 2IJGX 2J0WA 4BG0A 3LPZA 3KL4A 3SEOA 2YHSA 1NZNA 3LJBA 4Q94A 1Z3YA 1M56C 3Q4AB 3LS1A 4HLEA 2X38A 5AIJA 1PCXA 1ZHXA 3WXXA 3U4TA 3SD5A 3PUJA 4ACLA 2LAIA 2DIWA 2FI7A 3LJ3A 3SFZA 4FJZA 4IN3B 3TXMA 4HFGA 2IXOA 3QWPA 5DIZA 4H4KC 5FQ6A 3L16A 3FFLA 1H19A 3SBSA 5AJLA 4FHJA 4AE4B 4WAFA 4JZAA 2PM7A 3DBSA 2IXPA 2PZIA 2G62A 5KJKA 3KD7A 4BSXA 1NZEA 3G2UA 4I2WA 1W3BA 1IHGA 2R5SA 3CSKA 2NSZA 1U3DA 4WNEA 1FVFA 4APFA 3HYMB 3EIJA 4YT2A 4I1OB 1FCHA 1QQEA 2X3MA 2LSEA 3Q47B 3NYMA 2LSUA 3DAFA 3CVVA 3MX3A 3ONKA 4BX9A 3NZSA 1UJJA 3B0PA 2HR2A 2VSOE 4KMOA 3ZIMA 3NKDA 3EGDA 2WXKA 3ZGQA 2V26A 1J8MF 2EIJC 3EGDB 2CDQA 1FMWA 4Q4ZF 5T3RA 4OVUA 1UW4B 2J9VA 1WM5A 3L17A 2DYRC 2WXNA 3JCKC 1E7VA 2XCBA 3Q15A 3FTZA 3FTSA 2W4MA 3RRMB 1LS1A 4J32B 4RDAA 3W2WA 3MLGA 3QMKA 2WXFA 2O9XA 4N06A 2YHEA 1HZ4A 4KBLA 2PX3A 2AXVA 2R7UA 3OAWA 2JLBA 4DK5A 5D92A 5CHEE 4APOA 2XSEA 3EGXA 4X0RA 3ZYLA 1YA0A 2Q9AA 1H2UA 4IULA 2QY9A 2C03A 3EGXB 2V3CC 4UQXA 3L0IA 1H0AA 1UG3A 3D9IA 5KJMA 1SQMA 4OIOF 2WXGA 2BUGA 2I9CA 5HSWA 3CHOA 3AU5A 2FO7A 4G24A 4GZCA 4RD9A 3NZUA 3CHRA 4XKBA 3QKYA 2WXIA 3MYVA 2X6JA 2W45A 3NYLA 2WXQA 4BEJA 3IHVA 2W4BA 4U5DE 4OIQF 4U63A 4FJYA 3U66A 2OCCC 4GZ6A 3PE3A 2E0IA 4UI9J 1LKXA 1NP7A 3HDXA 4W8KA 1B89A 2Q9BA 1JWGA 4W9RA 1MQSA 1OCZC 2Z15A 4U5FE 5BPPA 4GYOA 2CHWA 4FADA 4PJJA 4F1SA 1RJ9A 2EINC 4IRUA 2IXNA 4OVVA 1J8YF 3OTNA 4XIFA 2XGSA 1RJ9B 4OINF 4DLQA 4XE0A 2W9YA 2RD0A 4C3BA 3JYHA 3APFA 3PREA 3X2QC 1NU9C 2IQCA 3RO2A 1PAQA 4TV3A 3LXUX 4HS2A 3PEUB 3APDA 3RU0A 3FUJA 2KATA 3B7TA 5KYXA 5FQ8A 3CIAA 5DLJA 5HQ8A 3CR3A 4K03A 4CGVA 4Q5SF 5KYXB 2A69F 4EZLA 4URKA 3HHMA 4AM9A 2KW3C 3JQ0A 2I8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J90 A;  3IV0 A;  4L7T A;  3CK9 A;  3OTN A;  3QNK A;  3FDH A;  4Q69 A;  4F7A A;  3MX3 A;  3EHN A;  3SNX A;  3MYV A;  3HDX A;  3KEZ A;  5T3R A;  3CGH A;  4PUC A;  3L22 A;  5FQ6 A;  3JQ1 A;  3P1U A;  5FQ8 A;  4LER A;  3NQP A;  3I4G A;  3GZS A;  5E75 A;  3CKC A;  4F53 A;  3LEW A;  3CKB A;  3EJN A;  3EHM A;  3CK8 A;  5LX8 A;  3JYS A;  5E76 A;  4MRU A;  3SGH A;  5FQ4 A;  3MCX A;  3CK7 A;  5T4Y A;  3JQ0 A;  5FQ7 A; 
#chains in the Genus database with same CATH topology
 2WVO A;  3CAX A;  4JEB A;  4O6Y A;  1H6O A;  5T3T A;  2AXU A;  4GTP A;  1E86 A;  1TWH A;  2DGJ A;  4Q96 A;  5BV0 A;  1N4P A;  3ENE A;  4UUC A;  3ASO C;  3BG0 B;  2DYS C;  4MLP A;  4MTF A;  5EK0 A;  4RG6 A;  2HJM A;  2NG1 A;  4HOQ A;  1Z3X A;  4DPR A;  1KNY A;  3DE8 A;  3LNR A;  5A23 A;  4YJW A;  2PFD A;  1Z6A A;  3CK9 A;  2YHC A;  2WXM A;  3UMK A;  3ABM E;  2VH3 A;  4PS8 A;  3U3F A;  4U7E B;  1TWC A;  2ICW G;  4ACK A;  4LLC A;  4L23 A;  2YIN A;  3NAW A;  3ZTZ A;  5ARG A;  2P9N G;  3T6G B;  3DRA A;  4F53 A;  4IAR A;  4FA6 A;  4QDL A;  4ZHB A;  3K33 A;  1JOG A;  3QAQ A;  3GOD A;  2GW1 A;  3UIN C;  1BDJ B;  3NKE A;  5H7P A;  3TWW A;  1U89 A;  1AWC B;  1H2V C;  3C5R A;  4J8E A;  2JD3 A;  5IY5 C;  4M63 A;  1N11 A;  2XS1 A;  1BBH A;  4EIY A;  4O6F A;  3JQ1 A;  5A6C A;  3ZTM A;  1SMY F;  3ZYK A;  1G5Z A;  2HUJ A;  4WND A;  4CS7 A;  3FUN A;  2Q7F A;  3PUK A;  2MHR A;  3DXM G;  4JCZ A;  4OD4 A;  1HFA A;  3TWT A;  4K5A B;  4HLL A;  5B3S C;  1WGW A;  3EPV A;  3OEO A;  2J8S D;  2ASR A;  4XEF A;  4GAA A;  1JCQ A;  1LE4 A;  3NOG D;  1O1T A;  2WPV A;  4B8A A;  1JCR A;  1MMG A;  1JCS A;  5G55 A;  4BT9 A;  2WM9 A;  3AG3 C;  4OYS A;  2M63 A;  3HNL A;  3HXB A;  3I4G A;  4JC8 A;  1RKE A;  3D9J A;  3KKB A;  4HBD A;  1S64 A;  3DPD A;  1A7V A;  3Q6M A;  3C8G B;  4GYY A;  3TK0 A;  3T6J A;  1RKE B;  3PZD A;  1OW7 A;  3HKK A;  4U9D A;  2RKK A;  4PH4 B;  3IQC A;  3NBN B;  4YT8 A;  4CSA C;  4KBQ A;  5LCW J;  3GWN A;  1K40 A;  3HJC A;  3FY4 A;  1LS4 A;  4AV7 A;  2B0H A;  5CMW A;  4XLP F;  1WAO 1;  4YDO A;  1HY5 A;  2L0I A;  2P58 C;  1TQG A;  2M4E A;  1BZ4 A;  2VTB A;  4NAC A;  3ABK E;  3ASN C;  2Q3T A;  2YLD A;  4XTK A;  2X6H A;  5AYW D;  2ZGD A;  4ILG A;  1U3C A;  2CHZ A;  4CCA A;  3ZW3 A;  2CYD A;  4TRQ A;  2VTB B;  1E7U A;  3DXJ F;  4UWK A;  2IY0 C;  3LVQ E;  1PC2 A;  2I1K A;  4HB5 A;  3SI5 A;  3ZIB A;  4K1O A;  4YDE A;  3B71 A;  4L2L A;  3SZ7 A;  2L0T B;  4RBN A;  4AXH A;  1OR3 A;  3CEQ A;  3P1U A;  2BED A;  4EPZ A;  1EI7 A;  4G78 A;  3TD7 A;  5JLI A;  3DST A;  3TXN A;  3NG1 A;  4TUM A;  3M4B A;  1R5I D;  3H65 A;  2WZF A;  1HU3 A;  4LG6 A;  5BW8 C;  2KZT A;  4Y6C A;  2XL4 A;  1DNP A;  4I9E A;  4JEH A;  1C17 M;  4AX2 A;  3WG7 C;  3CGH A;  3U9W A;  3D9H A;  1VLT A;  2J46 A;  3GM1 A;  2VGX A;  4PS3 A;  1MYO A;  4F1P A;  2QFC A;  4CSA A;  1Q0K A;  5ANL A;  4OIP F;  2UWJ G;  3S9O A;  4ANV A;  1OCC E;  1D0X A;  1LM3 B;  4HFK B;  1IHB A;  4YDY A;  4JD2 G;  1OXJ A;  3O55 A;  4QQI A;  1CPR A;  4GML A;  3FU0 A;  3TJ5 A;  4MS6 A;  3SP1 A;  4HRM B;  4JIO A;  2XRZ A;  4I9C A;  4BFR A;  3C8G D;  5HRY A;  4PJL A;  1LI5 A;  4NRH B;  3FU6 A;  1OCR C;  1YA7 O;  4FU3 A;  4PFO A;  4C9B B;  3ZPJ A;  4D4X A;  2WMO A;  2GRM A;  4KI2 A;  3FVY A;  2P9I G;  2Y3B A;  2HZ8 A;  2DBA A;  4AY6 A;  2PF4 E;  1O1R A;  5M72 A;  1U0B B;  4I6J A;  1NL4 A;  4WNF A;  2VGE A;  3TL5 A;  1APC A;  5CBO A;  2KC3 A;  1N4Q A;  1YA9 A;  4MTO A;  4C7O A;  3MFN A;  4HOS A;  1H6G A;  5L3Q A;  4BT8 A;  2EIM C;  1E84 A;  4ATG A;  2B0O E;  4U04 A;  2C0L A;  4C7O B;  3L1M A;  3J06 A;  5FQ7 A;  3JUE A;  2GDC A;  3DI5 A;  3ZQV A;  4NQF A;  4Z9J A;  5B1B E;  3FP3 A;  2LUH A;  3UTM A;  3NRH A;  4KC9 A;  1HX8 A;  4BER A;  4WGY A;  1CGM E;  3UT4 A;  2A0U A;  2L6B A;  2CFU A;  1QZX A;  2AVK A;  3C3R A;  3F6Q A;  3FTY A;  4CS9 C;  5FZR A;  2WXL A;  3V30 A;  3RIP A;  2J9B A;  1V55 E;  2WL8 A;  5A69 A;  1H2T C;  3QVY A;  2J0X A;  3RSE G;  3KMI A;  4DJ9 A;  2KGO A;  3D3M A;  2YL1 A;  5G05 J;  2R9R B;  4TXR A;  3ZEF A;  2OEW A;  1MX4 A;  3GEI A;  4YL0 A;  5HKP A;  3FTU A;  1BR1 A;  5EIB E;  4G26 A;  2PQR A;  1D1C A;  5DQT A;  3EHM A;  4AP2 A;  3LDZ A;  1E90 A;  5BQH A;  4GTV A;  3V2O A;  2WB7 A;  3WHN A;  5A6K A;  4PAC A;  2Y4U A;  3RIB A;  2P9U G;  3FU3 A;  4U0S A;  3UX4 A;  4EWC A;  3LYA A;  4YVO A;  3MKQ A;  3EHR A;  3APC A;  2MHK A;  3G2S A;  4UWF A;  2XL8 A;  1OWO A;  4UQZ A;  1WY6 A;  1OCO E;  2H6G A;  5HS0 A;  2DI3 A;  3PEV B;  4CDR A;  3ESK A;  4DI4 A;  5JJ7 A;  3DEP A;  5F5H A;  4I44 A;  2P9L G;  3TWX A;  1SVX A;  4U8Y D;  3MKQ B;  2VB6 A;  1LPE A;  1XGW A;  4KXK B;  4MND A;  3MKR A;  4E0I A;  3LJN A;  1OY3 D;  2XLE A;  4D10 C;  4I1A A;  5ENQ D;  5CER B;  2EIL C;  4C48 B;  2LQG A;  1FT1 A;  2R17 C;  3ABL C;  5KWD A;  1D0Z A;  4EBB A;  1AEP A;  1HG5 A;  4CS9 A;  3ABK C;  4J8D A;  3ZU7 B;  4ILI A;  1H7I A;  2NSF A;  4JVS A;  2C04 A;  5L0C A;  3VTY A;  3IEG A;  2WXJ A;  2H6H A;  3FH7 A;  1I4Z A;  3U9M A;  2E87 A;  5JUA A;  4BY6 A;  5ENS D;  3AGT A;  2YEV A;  2P2C P;  3SF4 A;  1O87 A;  4GA1 A;  3Q73 A;  4B8C B;  2GGF A;  2J08 A;  3TWU A;  1E8Y A;  4EQF A;  2PP4 A;  3W2V A;  4F7A A;  3GZ1 A;  2EPK X;  1HW2 A;  4CJO A;  3JCU Q;  4TXQ A;  3AOU A;  4JTC B;  4G7Z F;  3KYJ A;  3LUT B;  2BC5 A;  5L0F A;  4N2S A;  1WG0 A;  4N3A A;  3TAX A;  1Z7Q c;  4MQ9 F;  1EYH A;  4J6I A;  5FT9 A;  3KEA A;  1TEZ A;  4OAV B;  3DXK G;  2VSY A;  1WDY A;  3ZXS A;  5J90 A;  4NTB A;  1JRA A;  4Q7C A;  3MV2 B;  4N6C A;  2UY1 A;  5CBN A;  3LNM B;  1FT2 A;  4GTT A;  2HV6 A;  3T8K A;  3AG4 C;  5E2Q A;  2E2E A;  3GZS A;  4CDY A;  3TG5 A;  3K66 A;  3V7O A;  4MW8 A;  3RQG A;  1OCC C;  3OXG A;  3FHD A;  2WVQ A;  5EKQ D;  3U8P A;  3N24 A;  1TN6 A;  1N1C A;  3R7Q A;  3B7R L;  2Y3H A;  4HI8 A;  3SYN A;  2WXR A;  3SGH A;  1FR0 A;  4G25 A;  3MA5 A;  2R03 A;  2DB4 A;  4JRZ A;  2X51 A;  4NC3 A;  2LD6 A;  3D9N A;  3T8M A;  3PDM P;  1ZZP A;  1TWG A;  1CGO A;  2KK1 A;  3B9Q A;  4U5B E;  3P2B A;  2EIK E;  3T5V A;  1RCP A;  1MZC A;  3PMR A;  4G23 A;  1TR2 A;  2Y0B G;  2VCB A;  3Q7G A;  1QNF A;  2CFZ A;  5AEN A;  3I5P A;  2MOW A;  4MRU A;  3ECS A;  3LCA A;  1YAU O;  3R2P A;  4WJ0 A;  3RO3 A;  3CQG B;  4XI9 A;  1X81 A;  5G2N A;  2J7P A;  1YAR O;  4DX2 A;  3QTH A;  3Q7F A;  2WVI A;  1H9T A;  3IKO B;  5FZS A;  2BF0 X;  2F37 A;  3AQB A;  4JEU A;  4GZ3 A;  3R7C A;  2J09 A;  3JRM O;  3PVL A;  2XLH A;  3IHU A;  1GQA A;  2DCP A;  1PD1 A;  3F46 A;  3UM3 A;  4AIF A;  2GRR B;  1I5N A;  3AG1 C;  1MX6 A;  3C72 A;  4I3M A;  2YZS A;  2VQ2 A;  3B95 A;  2ETA A;  2ZXW C;  1Q2Z A;  4Z9I A;  3RW0 A;  5B1B C;  3M79 A;  1WTY A;  3GWL A;  2LSV A;  3UQ3 A;  4LDK A;  1XZQ A;  2XGM A;  4FAP B;  3CEX A;  4G8K A;  3CVN A;  4N2Q A;  2I2O A;  2NUP A;  4PS7 A;  1LE2 A;  2OJE D;  4JCH A;  1ZYR F;  5AJD A;  4P29 A;  1NBB A;  3QC1 A;  3PDN A;  4GPM A;  4JHJ A;  3WAQ A;  2WQH A;  2HMZ A;  4ANW A;  1MMN A;  4J7Y A;  1S05 A;  2Y69 E;  3PHF 2;  3TJP A;  2NUP B;  4XPX A;  2VSX E;  3VLD A;  2D5R B;  3RKO F;  3Q49 B;  3M1C B;  3M4C A;  2IM8 A;  3ZC4 A;  2H7V C;  1O5M A;  1IQU A;  3AS5 A;  3CKC A;  2AW6 A;  1IQR A;  4U0Z A;  2HV7 A;  3B0V C;  1LVK A;  5G04 C;  3RQE A;  2P7V A;  4KNV A;  4IGG A;  5FIO A;  3H2U A;  3JT1 A;  3WOD F;  1D1B A;  2XPI A;  2XPY A;  2GFH A;  4HOU A;  5CCM A;  2VAS A;  4EHP A;  4YL1 A;  4A1G A;  5DQZ A;  4ABN A;  1HMD A;  3AQC A;  3ZYQ A;  4PUC A;  3CZ6 A;  4XLN F;  5G05 C;  4D4N A;  1T9K A;  4QI0 A;  1TFK B;  2IXM A;  3IQ6 A;  3AU4 A;  4HOR A;  1HE1 A;  4JA7 A;  2WZL A;  3RRN B;  3CVW A;  3CVY A;  4IB4 A;  1G8X A;  3EG9 A;  4ZFH A;  5F5F A;  3PCV A;  3ZVV A;  1VLS A;  3EG9 B;  4FWV A;  3QW0 A;  3GM2 A;  4UDV A;  2A5E A;  4HNA D;  2YL3 A;  3U5S A;  1N52 A;  4JC7 A;  2R59 A;  1G4U S;  4WNG A;  4LRZ A;  1BR2 A;  4JZY A;  3SFX A;  1O3U A;  4UQY A;  2NXP A;  4PDX A;  4CIH A;  3DE9 A;  4EZK A;  4B0Z A;  4L6R A;  3U2L A;  4CIP A;  4YL3 A;  4LLE A;  1UOH A;  2VJ8 A;  4G1T A;  3IQT A;  3FTV A;  2H7B A;  3K9I A;  1ELW A;  3DM9 B;  4UI9 K;  2XXA A;  2R2L A;  4RSY A;  3HRA A;  3JRT A;  1KZO A;  2ZXR A;  3CVQ A;  3UT8 A;  3GEE A;  3U8V A;  2V8S E;  5LX8 A;  3FDQ A;  2XXA B;  3RK6 A;  1PV3 A;  2KC7 A;  1EKY A;  3ZUV B;  4U95 D;  2ZU6 B;  1NA0 A;  1ZHT A;  2RFM A;  5FTP A;  4BJ1 A;  3ML8 A;  2IF4 A;  3G2W A;  1ELK A;  1MMD A;  3G50 A;  4JHK A;  3W4Y A;  3NDB B;  2MWQ A;  2KJG A;  4AY5 A;  5ENN A;  2A6H F;  4MVR A;  2J45 A;  2H7O A;  4GMJ A;  4G7H F;  4HEA J;  3PRZ A;  3B7U X;  3VRC A;  3Q79 A;  1GGQ A;  3O6X A;  4MVM A;  5DVW A;  2XM4 A;  2LNI A;  3GW4 A;  2EIK C;  2IBF A;  3EHN A;  3UIO C;  3U2M A;  4KVO A;  2A1D D;  2L6G A;  5E75 A;  1SZI A;  2QTV A;  5JA4 D;  1HO8 A;  4U5G A;  3QDN A;  3S7B A;  3QZC A;  5E76 A;  4F4B A;  2AJA A;  3FEX A;  1HF8 A;  2HFI A;  1WWP A;  3ZVR A;  3W8H A;  4FX5 A;  3LLK A;  3E4B A;  2OV8 A;  3CV0 A;  1GW6 A;  4FUL A;  4J8Y A;  2XQ0 A;  5JMN D;  2FEZ A;  3D9P A;  5ITZ F;  4KVM A;  2R7X A;  4Z68 A;  2OVF A;  3FWV A;  5LOZ A;  3T9K A;  1N0Q A;  2YLI A;  3NMK A;  4BJ5 A;  3OA1 A;  2MYS A;  5DS6 A;  3NF1 A;  2L7A A;  1K3Z D;  5CCL A;  1O5H A;  3JZ0 A;  2XEV A;  4N5C A;  3C98 A;  3FUE A;  5D66 A;  2EPO A;  3I5Q A;  4GPK A;  3MEK A;  4BJ6 A;  4MVQ A;  3HXF A;  1YDI A;  2XPZ A;  2PNO A;  4YWQ A;  1Z3I X;  1UG7 A;  1VTM P;  4IYP A;  2R7R A;  2I1J A;  3D9O A;  4TXP A;  2L9B A;  2Y39 A;  4WUY A;  3L34 A;  1K1A A;  2Q9C A;  3RH3 A;  3ESL A;  2CNW A;  2YQ8 A;  3ZN3 A;  3FUD A;  3FXH A;  3B7B A;  2GRL A;  3DAG A;  1E8Z A;  5KYW A;  3ZDL A;  4RLY A;  1T01 A;  3E37 A;  2R7V A;  4K0R A;  3OXL A;  2OG2 A;  4J0U A;  1D8D A;  1NI1 A;  4JEA A;  2G3K A;  3DD7 A;  3HIZ A;  3U3W A;  1EA8 A;  4CS8 C;  5KYW B;  3NMJ A;  5AQ7 A;  3LVR E;  3LEO A;  3EDT B;  2J4D A;  3QB2 A;  4XWJ A;  3CHQ A;  3C18 A;  2C2L A;  3S28 A;  3ZHE A;  2IYL D;  1IYG A;  4H7X A;  2R02 A;  3VYW A;  2G3V A;  3S7J A;  2A5U A;  4LNU D;  1HMO A;  2F8X K;  2OND A;  3QWW A;  3LY7 A;  2VC9 A;  3ONL A;  4CT0 A;  4XKC A;  3ZHE B;  1WAT A;  3CK7 A;  4JHR A;  1SR2 A;  1V54 C;  2IOL A;  3G4Z A;  4LAC B;  3HNK A;  1A5E A;  2M64 A;  2HKV A;  1MND A;  5T8I A;  4EBJ A;  3EH1 A;  4UI9 C;  3N0T A;  1OWM A;  2KZT B;  4WGZ A;  2XEH A;  4A3T A;  1UJK A;  3TWQ A;  3UIP C;  3UM0 A;  2X6K A;  3SBT B;  4E7S A;  4QI2 A;  2ZIS A;  3KYI A;  2J07 A;  5D91 A;  3O48 A;  5JSL A;  3L54 A;  3BRJ A;  3IEE A;  2VGX B;  1TWA A;  4L2Y A;  3LS0 A;  2A68 F;  2XLM A;  1S0P A;  2CGE A;  2LXM A;  5AQ9 A;  2AWY A;  3MYF A;  3C3Q A;  4U0U A;  4V3I A;  2RFA A;  2ZGG A;  4Q69 A;  4YDW A;  5FWQ A;  2EIJ E;  2OOE A;  4DRJ B;  1O1S A;  1IW7 F;  3L22 A;  1NFI E;  2RG8 A;  3S7D A;  4FP7 A;  5AC5 A;  1B68 A;  3CST A;  5BUZ A;  1V74 B;  1VYI A;  4CS8 A;  4B89 A;  3MV3 B;  2DYR E;  4HXI A;  3U64 A;  1ZVZ A;  3FOO A;  1OWP A;  4DI3 A;  2Q00 A;  2AVP A;  1Y8M A;  1INZ A;  1ZHZ A;  2V5F A;  2J9W A;  1RKC A;  3S29 A;  5JP7 A;  4TUU A;  5FCL A;  3PE4 A;  4ZLD A;  2FO1 E;  1GS9 A;  3ZXP A;  3DSS A;  1MHQ A;  3E34 A;  2QC9 A;  3TWR A;  2CNW D;  1HS6 A;  3EFO A;  3FMS A;  3O39 A;  4NTA A;  5JS5 A;  2CG2 A;  1N95 A;  1QZ2 A;  4XPY A;  4UWL A;  3S2A A;  4JE9 A;  2YNQ A;  4EEC A;  1YJG A;  3UUX A;  3UNG C;  1MNE A;  2KBX A;  2CG3 A;  1OW8 A;  5T3W A;  1PY1 A;  3E30 A;  4GTM A;  1Y6D A;  4I43 A;  4Y6W A;  2PM6 A;  1RZ4 A;  2R25 A;  4HRL A;  2DZN A;  3GM3 A;  4B93 B;  4DXW A;  3ABM C;  2LP4 A;  1LD7 A;  4NIK A;  4KT6 B;  3RQF A;  4GA0 A;  4JTD B;  5A6A A;  1TNY A;  2Y4T A;  3SY2 A;  3I4R B;  4AK9 A;  3R9M A;  4C0M A;  1JMW A;  1QKR A;  2B6C A;  4R7L A;  3F47 A;  3FH5 A;  1D8E A;  2PQN A;  3FUI A;  5KCM A;  3QK0 A;  2LCH A;  2ETC A;  5E3C A;  1Q0F A;  4IAQ A;  2LFF A;  4GTO A;  1LIH A;  3EUV A;  4C3D A;  3JSZ A;  4W8P A;  2AWI A;  1KLX A;  3EZH A;  5BUO A;  3GZ2 A;  1XWJ A;  5A6B A;  3HXE A;  5LP0 A;  4A55 A;  4G2V A;  1YYH A;  3C62 A;  4LEU A;  4LER A;  3MGB A;  3V5Z A;  3QOU A;  1S7Z A;  1JUQ A;  4M7C A;  3RYL A;  1IXV A;  1E8X A;  2XLW A;  1ZHY A;  2QE9 A;  4MVS A;  1EQ1 A;  4E17 A;  5GPG B;  3K1I A;  4GEH A;  4WWN A;  1N9A A;  1Z63 A;  1S70 B;  3DJU B;  5J08 A;  2OKU A;  3PH0 C;  1K8K G;  3POV A;  3T6B A;  5EHH A;  1H9G A;  2OVB A;  2OCC E;  3TGO A;  4FLB A;  3BUA A;  5L0J A;  4AEZ C;  1XZP A;  1UN8 A;  4LUN U;  4ANU A;  3S27 A;  4CX9 A;  4EZJ A;  5B1A E;  2YRF A;  1MX2 A;  2FF4 A;  3R9A B;  4YT5 A;  5D0O D;  4A1S A;  2OQM A;  5A6J A;  4BX8 A;  3FUL A;  1OCZ E;  5C1D A;  1FFT C;  5EDS A;  4N3C A;  1MQV A;  1QPU A;  4DLO A;  2Y3G A;  5COG A;  5FQ4 A;  1CGN A;  3RFY A;  1HH8 A;  3MJW A;  4ULV A;  2EIN E;  1T6Q A;  2V4L A;  5KJN A;  4AE4 A;  1Y6I A;  4C3E A;  3PNL B;  3QWV A;  4K7B A;  4XI0 A;  4HVB A;  1OW6 A;  3L08 A;  3EU5 A;  3NYJ A;  4BTA A;  4CBE A;  3SHF A;  5EIL A;  4C0E A;  4ANJ A;  3FU5 A;  4PJM A;  3VM6 A;  2XM0 A;  4B94 A;  1R4T A;  1KPS B;  1YYX A;  4OIR F;  5A7D B;  2XZD G;  3CK8 A;  2XZT G;  4E6H A;  5DS5 A;  3FUK A;  5JHA A;  3X2Q E;  3DZA A;  3KH2 A;  2BKK B;  2P1A A;  2KCK A;  1OWN A;  4EBA G;  5BXU A;  4L7T A;  4IJJ A;  1TYQ G;  4N5Q A;  2IU1 A;  2FFH A;  2ZPA A;  4BSZ B;  2GAQ A;  1XNF A;  1SW6 A;  2HO1 A;  3R7R A;  5LCW C;  1EPU A;  2PNN A;  1JAF A;  1VB5 A;  3M15 A;  1I4Y A;  4DVY P;  2LIG A;  3U9J A;  3W8I A;  3ZYM A;  1KU2 A;  4B6I A;  1TN8 A;  2YKZ A;  3MBG A;  3ML9 A;  1QLE C;  1WOL A;  4BET A;  5CI9 A;  4PK4 A;  1D0Y A;  3T4R A;  4P9F A;  4J8S A;  4O60 A;  4E85 A;  4I2Z A;  3QJZ A;  2LO6 A;  2Y3A A;  3LS8 A;  3SNX A;  1JPL A;  4P9T A;  4WWO A;  1AP7 A;  4GA2 A;  1FFH A;  4GTR A;  4LCT A;  1DCQ A;  1L7C A;  1L5J A;  3CVL A;  4X8Q A;  1OUV A;  2UY1 B;  3ASO E;  3E33 A;  2IO2 C;  3FH8 A;  5JHB A;  3G2T A;  4N4W A;  5LFA A;  2V4H C;  3C63 A;  4MKT A;  2V0P A;  2B0J A;  4R32 A;  2XRY A;  4U5E E;  3IV0 A;  4JJG A;  4YVQ C;  2TMV P;  4J8F A;  3UGO A;  4HQD A;  2HE0 A;  3QAR A;  3URZ A;  2J4B A;  3RKV A;  5COF A;  2EPL X;  5KYN A;  3W9G A;  4ME2 A;  2KXP C;  1JR8 A;  2CCY A;  2A6E F;  4CDV A;  5BT1 A;  2EQX A;  4F6R D;  2P9S G;  5CRU A;  4G7O F;  1UN9 A;  3ULQ A;  4AOF A;  1DCE A;  2KQ9 A;  4O6N A;  1F1M A;  3FTX A;  3B29 A;  2R7W A;  2F0Y A;  4ILH B;  1U6H A;  3EZI A;  1OWL A;  4XQ1 A;  1QYM A;  4LNG A;  2Y1L E;  3GYZ A;  3Q75 A;  5AAO A;  2J9Q A;  5IY5 E;  3I4U A;  1VYK A;  1WN0 A;  3NQP A;  1VK5 A;  3VLE A;  5ENO D;  4XX5 A;  3G4X A;  3CHM A;  3JXJ A;  4U9E A;  4I17 A;  4CEM A;  1KTM A;  2P6V A;  3NB2 A;  5K0I A;  5CI8 A;  5B3S E;  4U8H A;  1FTS A;  2F22 A;  1QQ3 A;  1KT0 A;  1OKK A;  4JKV A;  1Y4C A;  3B13 A;  3BEH A;  4JJF A;  3FTW A;  3IBE A;  3Q78 A;  3JSE O;  3AS8 A;  3E32 A;  4KZC A;  1HW1 A;  1DOV A;  2Y3D A;  3DM5 A;  2FBN A;  2A0B A;  2ION A;  2I6H A;  2I15 A;  3CHS A;  1A17 A;  1A41 A;  4FHK A;  3K7D A;  1V55 C;  3QW1 A;  1S63 A;  3TWV A;  1TKN A;  2PX0 A;  4L9P A;  2XEN A;  3C3O A;  5L3V A;  2IFU A;  4NQ0 A;  2V5Q C;  5KJL A;  5L0D A;  1SZA A;  2CHX A;  4BWR A;  2PL2 A;  2AXZ A;  2C0M A;  3D9K A;  3W9F A;  2FAP B;  2ILR A;  3UMH A;  1LI7 A;  3SXM A;  2XCC A;  4GU5 A;  4HE8 D;  5COM A;  4KZ0 A;  2FGY A;  1NFO A;  4WAB A;  4PJN A;  4JW1 A;  3ASN E;  4CJG A;  3ZKJ A;  3HG0 D;  4GB9 A;  1E2X A;  5B1A C;  3TOL A;  1OCO C;  4QFV A;  2WZG A;  3LAY A;  4BEP A;  5JJT A;  2WXO A;  1MMA A;  2YL0 A;  5DBK A;  3JUI A;  1N4R A;  2GWW A;  4EBK A;  4E18 A;  2R7Q A;  2EPN A;  4CT4 A;  1E8W A;  3SO8 A;  3EQL F;  2DVW A;  3FUF A;  3OXF A;  1NLX A;  1E83 A;  4JA9 A;  2UUH A;  3CHP A;  3UM2 A;  4IAO A;  3ZSU A;  3HLZ A;  4ZLC A;  4HOT A;  1K1B A;  1QVX A;  1T6U A;  2X6I A;  2J7P D;  3DSW A;  5AQB A;  4A3V A;  2VCA A;  3V2X A;  2PBE A;  1TNU A;  3ISM C;  4LDQ A;  1A7D A;  1ZBP A;  3BEE A;  3O4Z A;  2L6H A;  3KS2 A;  4DX6 D;  3X1O A;  1AVO B;  1JPN A;  5F28 E;  4K0D A;  3HTK C;  1BLX B;  2QZA A;  2J8W A;  1HE8 A;  3FUH A;  2XL6 A;  3ULE G;  1FMV A;  5E3A A;  3HVE A;  3PS6 A;  5AGF A;  4FES A;  5T4Y A;  1OKK D;  3SNH A;  3ASH A;  3UGP A;  1EDU A;  3KAE A;  1ZB1 A;  2R05 A;  2P9K G;  1NG1 A;  5FJY A;  3AGU A;  3S84 A;  3HVE B;  2OOC A;  3RJV A;  1X5B A;  3KEZ A;  3ATP A;  3EH2 A;  2GRO B;  2VYI A;  4GTS A;  1G4W R;  4KNW A;  5CMY A;  3PZ1 A;  1H6K A;  4FC8 A;  1NSG B;  2P61 A;  4JPS A;  2JEK A;  4F3V A;  1NFN A;  2Q4F A;  4XPW A;  4JL0 A;  3FOP A;  4JXT A;  4G11 A;  5EX3 A;  4BJ5 C;  3VTX A;  2BTD A;  2R7T A;  1SF8 A;  1LF8 A;  1BI8 B;  3LY9 A;  3DSX A;  3PZ4 A;  4RG9 A;  2IOS A;  3KSL A;  3V5X A;  4BJ6 C;  3UKR G;  5FZQ A;  5CEA A;  3VLF A;  1T6I A;  2YLG A;  3CSF A;  2ZXO A;  3JYY A;  4O6M A;  4KYO B;  2ZD9 A;  1SZ9 A;  4L1B A;  4YN0 B;  1H6P A;  3L6A A;  3SZR A;  2YL7 A;  2L9J A;  4MW3 A;  2EIM E;  1BR4 A;  3US6 A;  1ST6 A;  1LTX A;  2X0C A;  5CRV A;  1U2V G;  3UT7 A;  3LEV A;  4MS2 A;  3ASG A;  4N3B A;  1FVH A;  4UWG A;  1ZU5 A;  2HSB A;  1RW2 A;  3AG2 E;  5KYU A;  2QYU A;  3UR3 C;  3Q7A A;  2X6F A;  5EX0 A;  1ZU4 A;  1ZW3 A;  3SXK A;  3SXY A;  3TOM A;  4CGW A;  2NUT A;  5KYU B;  3FEY A;  2FUL A;  4UWH A;  2WB2 A;  1IZM A;  4O79 A;  3OWT A;  3Q9N C;  3DKA A;  1JPJ A;  2AP3 A;  2NUT B;  3DMD A;  2XGO A;  4JB8 P;  1NA3 A;  1YVI A;  2IO3 C;  2HYZ A;  5L0H A;  2P0N A;  4BJT A;  4CRW A;  5JRA A;  1JWF A;  1TJC A;  3D9M A;  4JTA B;  3ZWI A;  4YND A;  4WWP A;  4G0H A;  3DJN B;  2OU6 A;  4GYT A;  1Q0G A;  4HFF B;  3E70 C;  2XHE A;  3FUM A;  3EJN A;  5ENR D;  1E96 B;  1QSP A;  2QNL A;  5KYY A;  3J5Q B;  1FNT c;  4A63 B;  2WQ7 A;  5CED B;  4PR9 A;  3BG1 B;  1ZHW A;  4BTB A;  1EF1 C;  4N39 A;  5KYY B;  1M2V A;  2XRH A;  4ANX A;  1FPP A;  3C8G A;  1AUE A;  5E33 A;  1BPO A;  1ELR A;  3RVZ A;  4ER9 A;  4YK5 A;  4EUK B;  2WQ6 A;  2NSG A;  4GCO A;  1M2V B;  3AS4 A;  4LSZ E;  5EYL A;  5EID A;  3MCX A;  3LKU A;  2QLA A;  3UMI A;  2Y69 C;  5ANR A;  3E9V A;  3S90 A;  1P5Q A;  1VOM A;  1OXK A;  2WMN A;  5JJ6 A;  1M2O A;  2EIL E;  5AC4 A;  1PD0 A;  3G2V A;  4N6H A;  3ZRH A;  4I6E A;  3I3N A;  3EIQ C;  3ABL E;  3HXD A;  1T5O A;  1YMP A;  1W2W A;  4NCQ A;  1DOW A;  2VSN A;  2KCL A;  2J49 A;  4HI9 A;  3N71 A;  1HG2 A;  2NC9 A;  3V5Y A;  1TJF A;  3CLJ A;  4IWB A;  4DVZ A;  3ASF A;  3RAU A;  4XEI G;  2WXP A;  4DRX E;  1ZU2 A;  4EBA A;  3ITF A;  3QNK A;  4GYW A;  4GCN A;  1C03 A;  1Z23 A;  4GZD A;  5L0I A;  2NYJ A;  2RD9 A;  3AAA C;  4K5C A;  3CQZ A;  2UUI A;  4DX5 D;  3L82 A;  5KNG A;  3Q6N A;  5DS4 A;  3K6B A;  3SXZ A;  2WVN A;  1TNB A;  1NU7 D;  2L81 A;  2BE5 F;  1D1A A;  3HXC A;  1N0R A;  4YT4 A;  4NUR A;  3IHY A;  3N2Z B;  2KM4 A;  4DX7 D;  4DBQ A;  2DWZ A;  3ASD A;  4DBR A;  3Q5M A;  4O7G A;  3CVU A;  3GAN A;  1OXB A;  4H54 A;  1WAS A;  4P6I C;  2QY7 A;  2YVK A;  2MRI A;  3AG4 E;  1Z5S C;  2YQY A;  3ZG1 A;  4BPM A;  3CVP A;  1QBQ A;  4A2N B;  3CQC B;  4FLH A;  3LLI A;  2ETS A;  2H8A A;  3VF0 A;  1RMV A;  4O1O A;  4AVX A;  4H7Y A;  1VMA A;  3ZNG A;  4JUR I;  4NY3 A;  3L8I A;  5CEC B;  3FDH A;  2JAB A;  3B7S A;  5ENT D;  3UPV A;  4U5C E;  1MJ0 A;  4AL0 A;  1M6T A;  5C2Y A;  3LES A;  4LDR A;  5D0Q D;  3K1I C;  3MZL B;  5T1D B;  3T5X A;  3Q7L A;  1DVP A;  2A4Z A;  5FIN A;  1Z6T A;  2QYJ A;  5EYP F;  4J30 B;  3EFO B;  2HM8 A;  3CKB A;  2VGY A;  5HI7 A;  3PZ3 A;  1ZW2 A;  3TJ6 A;  4ULW A;  4DOZ A;  4DJA A;  2XLV A;  5BV1 A;  2Q7R A;  2XEE A;  3JYS A;  3LY8 A;  3UMV A;  2KNH A;  5BNW A;  3C8Z A;  4HRN A;  1YYJ A;  3S7F A;  3D9L A;  3PNT B;  3B0U X;  2WXH A;  4CDN A;  1M57 C;  1KT1 A;  4M3O A;  5AN8 A;  4AJW A;  3S0X A;  3DSV A;  3TG4 A;  3RRU A;  3J5P A;  2CW0 F;  2J9U A;  3LEW A;  3K1H A;  5JT4 A;  5ARF A;  1N54 A;  5EN5 D;  4CDM A;  1Z5Z A;  4RVB A;  2JPU A;  1BI7 B;  3AG1 E;  2KCV A;  3ZFW A;  3AG2 C;  4U5H A;  4U07 A;  1OQC A;  2XLD A;  4PFP A;  4BEM J;  5AQA A;  4MVO A;  4E7Z A;  2ZXW E;  1BU9 A;  4MTG A;  3UXG A;  5EGY A;  3ZQY A;  2R7S A;  4MBG A;  4XZ4 A;  4I1M A;  3FHE A;  2IOQ A;  4NTF A;  1K05 A;  1KZP A;  3FAJ A;  4OD5 A;  2R7O A;  3CVX A;  5G04 J;  1HXI A;  2L6J A;  4GZ5 A;  3VAY A;  2ZXP A;  4I6G A;  3ULY A;  1VDY A;  4DRH B;  2LAH A;  3L13 A;  2IJG X;  2J0W A;  3UKU G;  4BG0 A;  3LPZ A;  1Q0D A;  3KL4 A;  3SEO A;  2YHS A;  1NZN A;  3LJB A;  3UM1 A;  1Q0M A;  4Q94 A;  1Z3Y A;  1M56 C;  3Q4A B;  1A7E A;  2XLO A;  2MYO A;  3IQ5 A;  3LS1 A;  3UI2 A;  4HLE A;  2X38 A;  4DX1 A;  5AIJ A;  1PCX A;  1ZHX A;  3WXX A;  1TFO B;  3U4T A;  4LNB A;  3BQO A;  3SD5 A;  3PUJ A;  4ACL A;  2LAI A;  2LXL A;  4E0H A;  2DIW A;  2FI7 A;  3LJ3 A;  3T9O A;  3SFZ A;  1L3P A;  4FJZ A;  2EPM X;  2HS5 A;  4IN3 B;  3TXM A;  4HFG A;  2IXO A;  4ONS A;  3QWP A;  5DIZ A;  4H4K C;  5FQ6 A;  3L16 A;  3FFL A;  1H19 A;  3SBS A;  5AJL A;  1IKN D;  4FHJ A;  1CPQ A;  5D2M C;  4AE4 B;  4WAF A;  4JZA A;  2PM7 A;  3DBS A;  4EKW A;  2IXP A;  2PZI A;  4GQH A;  4MVU A;  4K5B A;  2G62 A;  5BXO A;  1V4A A;  3KD7 A;  5KJK A;  4BSX A;  1NZE A;  3G2U A;  4RQI A;  4I2W A;  1W3B A;  3NMI A;  1IHG A;  2R5S A;  3KPH A;  2HJ3 A;  3CSK A;  2NSZ A;  1U3D A;  4WNE A;  3V31 A;  1FVF A;  4A4A A;  3HNJ A;  2H6F A;  4APF A;  4BES A;  3HYM B;  3EIJ A;  4YT2 A;  2P9P G;  3GOR A;  4AL1 A;  4I1O B;  3O10 A;  1FCH A;  1QQE A;  2X3M A;  2H6I A;  4CDA A;  2LSE A;  3JTL O;  3Q47 B;  1UFB A;  3NYM A;  3IXE A;  2OEV A;  3U3B A;  2LSU A;  3DAF A;  3CVV A;  3JXI A;  3PZ2 A;  3MX3 A;  2KYH A;  3ONK A;  4BX9 A;  5A6B D;  4DUI A;  3NZS A;  1UJJ A;  3B0P A;  2HR2 A;  3EHQ A;  2VSO E;  5KNH D;  4KMO A;  2ETB A;  3ZIM A;  2BKG A;  3EU9 A;  3NKD A;  3EGD A;  3DWL G;  1YZC A;  2DYS E;  2D4U A;  2WXK A;  3ZGQ A;  2V26 A;  3H2V A;  2IEJ A;  1J8M F;  2EIJ C;  3EGD B;  3HNI A;  1ORJ A;  2CDQ A;  1N94 A;  1FMW A;  4G8L A;  4Q4Z F;  5T3R A;  1BD8 A;  4OVU A;  1UW4 B;  2J9V A;  1WM5 A;  3L17 A;  2DYR C;  2QUP A;  2WXN A;  3JCK C;  1E7V A;  2XCB A;  3Q15 A;  1ORS C;  5BQG A;  1TNO A;  2KSF A;  5BQI A;  1RXQ A;  2RSE B;  3DWW A;  3FTZ A;  1LD8 A;  3FTS A;  2W4M A;  3RRM B;  1LS1 A;  4J32 B;  4RDA A;  3IPM O;  4U8V D;  3W2W A;  3MLG A;  3BU8 A;  3QMK A;  4J7T A;  2WXF A;  2O9X A;  3NOC D;  4N06 A;  256B A;  2YHE A;  1HZ4 A;  2AWC A;  4J7W A;  4KBL A;  2PX3 A;  4ATZ D;  2AXV A;  1SA4 A;  2R7U A;  3OAW A;  3DEO A;  2JLB A;  2OJQ A;  1HE9 A;  3TQO A;  4DK5 A;  5D92 A;  5CHE E;  4APO A;  2XSE A;  3EGX A;  4X0R A;  3ZYL A;  1YA0 A;  3MYI A;  1TN7 A;  2GRP B;  2Q9A A;  2GA0 A;  1H2U A;  4IUL A;  2QY9 A;  2C03 A;  3GEH A;  3A9C A;  3EGX B;  1N4S A;  1OT8 A;  2V3C C;  4Z9H A;  4UQX A;  3L8J A;  1D9S A;  3L0I A;  2BL2 A;  1H0A A;  1TNZ A;  1UG3 A;  3D9I A;  1FAP B;  5KJM A;  1SQM A;  3AG3 E;  4OIO F;  2WXG A;  3RVY A;  2BUG A;  4OAU C;  1YZA A;  2I9C A;  5HSW A;  3CHO A;  3TWS A;  3AU5 A;  2LK4 A;  2FO7 A;  4G24 A;  4GZC A;  3C7J A;  2LFD A;  4RD9 A;  3NZU A;  3CHR A;  4MVZ A;  4XKB A;  3QKY A;  4GMR A;  2WXI A;  3MYV A;  3FAP B;  4EHM A;  2X6J A;  5FZT A;  2W45 A;  4GTQ A;  3NYL A;  2WXQ A;  2HSQ A;  4O1P A;  2XS8 A;  4BEJ A;  3IHV A;  2W4B A;  1A0B A;  3V79 K;  3QVZ A;  4U5D E;  4OIQ F;  1GM5 A;  4U63 A;  3DSU A;  2JX0 A;  4FJY A;  2VCC A;  2AU5 A;  3U66 A;  2OCC C;  4GZ6 A;  3PE3 A;  2E0I A;  4UI9 J;  1K04 A;  4CZ2 D;  1LKX A;  1SYQ A;  1NP7 A;  2YWA A;  4W8K A;  1G3N B;  3HDX A;  2ZIR A;  1B89 A;  2Q9B A;  1JWG A;  4W9R A;  1MQS A;  1OCZ C;  5L0G A;  2Z15 A;  1YCS B;  3KSQ A;  4U5F E;  3RF3 A;  5BPP A;  4DRI B;  4GYO A;  1DC2 A;  2DZO A;  2CHW A;  4FAD A;  5B3I A;  4PJJ A;  4F1S A;  1RJ9 A;  2EIN C;  4IRU A;  2IXN A;  3SQV A;  1YLM A;  4OVV A;  1V54 E;  1E85 A;  1C02 A;  1J8Y F;  3OTN A;  4XIF A;  2XGS A;  2GRQ B;  1RJ9 B;  4OIN F;  4DLQ A;  2OEX A;  4XE0 A;  2W9Y A;  5HV9 A;  2L6F A;  3WG7 E;  3A11 A;  3L9T A;  2RD0 A;  4C3B A;  3JYH A;  5KBA A;  1OR2 A;  1TR4 A;  3APF A;  3PRE A;  3X2Q C;  1NU9 C;  3TUL A;  2GRN B;  2IQC A;  2NPU A;  3RO2 A;  1PAQ A;  3DPY A;  4TV3 A;  3LXU X;  2HMQ A;  5JVE A;  4HS2 A;  4CYM D;  3PEU B;  2F8Y A;  4XEV A;  3APD A;  3RU0 A;  3FUJ A;  2KAT A;  3B7T A;  5KYX A;  5FQ8 A;  3SFY A;  3CIA A;  5DLJ A;  5HQ8 A;  3CR3 A;  3AJM A;  4K03 A;  5AAR A;  1ORY A;  4CGV A;  1OCR E;  4Q5S F;  5KYX B;  2A69 F;  5CIV A;  3AJI A;  4EZL A;  5TJ5 E;  4URK A;  3U0C A;  3Q9U C;  4U96 D;  1SA5 A;  3HHM A;  4AM9 A;  2KW3 C;  3JQ0 A;  5ENP D;  4XEK A;  2I8B A; 
#chains in the Genus database with same CATH homology
 2WVO A;  4O6Y A;  5T3T A;  2AXU A;  4Q96 A;  1TWH A;  2DGJ A;  5BV0 A;  3ENE A;  3ASO C;  3BG0 B;  2DYS C;  4MLP A;  4RG6 A;  2NG1 A;  4HOQ A;  1Z3X A;  4DPR A;  3LNR A;  5A23 A;  4YJW A;  2PFD A;  1Z6A A;  3CK9 A;  2YHC A;  2WXM A;  3UMK A;  2VH3 A;  4PS8 A;  1TWC A;  4ACK A;  4LLC A;  4L23 A;  2YIN A;  5ARG A;  4F53 A;  4FA6 A;  4QDL A;  3K33 A;  3QAQ A;  3GOD A;  2GW1 A;  3NKE A;  1H2V C;  4J8E A;  2JD3 A;  5IY5 C;  4M63 A;  4O6F A;  3JQ1 A;  5A6C A;  1SMY F;  3ZYK A;  4WND A;  4CS7 A;  3FUN A;  2Q7F A;  3PUK A;  4OD4 A;  1HFA A;  5B3S C;  1WGW A;  3EPV A;  3OEO A;  4GAA A;  2WPV A;  4B8A A;  1MMG A;  5G55 A;  4BT9 A;  2WM9 A;  3AG3 C;  4OYS A;  2M63 A;  3I4G A;  4JC8 A;  3D9J A;  3KKB A;  3DPD A;  3Q6M A;  4GYY A;  3PZD A;  3T6J A;  4PH4 B;  4YT8 A;  4CSA C;  4KBQ A;  5LCW J;  3HJC A;  3FY4 A;  4AV7 A;  5CMW A;  4XLP F;  1WAO 1;  2L0I A;  2P58 C;  2M4E A;  2VTB A;  4NAC A;  3ASN C;  2Q3T A;  4XTK A;  2X6H A;  5AYW D;  4ILG A;  1U3C A;  2CHZ A;  4CCA A;  3ZW3 A;  4TRQ A;  2VTB B;  1E7U A;  3DXJ F;  4UWK A;  3LVQ E;  1PC2 A;  2I1K A;  3SI5 A;  3ZIB A;  4L2L A;  3SZ7 A;  2L0T B;  4RBN A;  4AXH A;  3CEQ A;  3P1U A;  4EPZ A;  3TD7 A;  3TXN A;  3NG1 A;  3H65 A;  2WZF A;  1HU3 A;  5BW8 C;  2KZT A;  4Y6C A;  2XL4 A;  1DNP A;  4I9E A;  4JEH A;  4AX2 A;  3WG7 C;  3CGH A;  3U9W A;  2J46 A;  4PS3 A;  2VGX A;  2QFC A;  4CSA A;  5ANL A;  4OIP F;  2UWJ G;  4ANV A;  1D0X A;  4HFK B;  4GML A;  3FU0 A;  4MS6 A;  3SP1 A;  2XRZ A;  4I9C A;  4BFR A;  4PJL A;  4NRH B;  3FU6 A;  1OCR C;  4FU3 A;  4PFO A;  4C9B B;  3ZPJ A;  2WMO A;  2GRM A;  4KI2 A;  3FVY A;  2Y3B A;  2DBA A;  4AY6 A;  2PF4 E;  5M72 A;  4I6J A;  4WNF A;  3TL5 A;  4C7O A;  4HOS A;  5L3Q A;  4BT8 A;  2EIM C;  4ATG A;  4U04 A;  2C0L A;  4C7O B;  5FQ7 A;  3FP3 A;  3NRH A;  4KC9 A;  1HX8 A;  3UT4 A;  2CFU A;  1QZX A;  3FTY A;  4CS9 C;  5FZR A;  2WXL A;  3RIP A;  2WL8 A;  1H2T C;  2J0X A;  3KMI A;  2KGO A;  3D3M A;  5G05 J;  3ZEF A;  3FTU A;  1BR1 A;  4G26 A;  2PQR A;  1D1C A;  5DQT A;  3EHM A;  4AP2 A;  3LDZ A;  1E90 A;  2WB7 A;  2Y4U A;  3RIB A;  3FU3 A;  4U0S A;  3UX4 A;  4EWC A;  3LYA A;  4YVO A;  3MKQ A;  3APC A;  2MHK A;  3G2S A;  4UWF A;  1OWO A;  4UQZ A;  1WY6 A;  4CDR A;  4DI4 A;  3PEV B;  5JJ7 A;  3ESK A;  5F5H A;  4I44 A;  3MKQ B;  2VB6 A;  1XGW A;  4KXK B;  4MND A;  3MKR A;  4D10 C;  4I1A A;  2EIL C;  2R17 C;  3ABL C;  1D0Z A;  4EBB A;  1HG5 A;  4CS9 A;  3ABK C;  4J8D A;  4ILI A;  3VTY A;  4JVS A;  2C04 A;  3IEG A;  2WXJ A;  3FH7 A;  2E87 A;  4BY6 A;  2YEV A;  3SF4 A;  1O87 A;  4GA1 A;  4B8C B;  2GGF A;  2J08 A;  1E8Y A;  4EQF A;  2PP4 A;  3W2V A;  4F7A A;  3GZ1 A;  3JCU Q;  4G7Z F;  4N2S A;  4N3A A;  3TAX A;  4MQ9 F;  1EYH A;  4J6I A;  5FT9 A;  1TEZ A;  2VSY A;  3ZXS A;  5J90 A;  4Q7C A;  3MV2 B;  2UY1 A;  2HV6 A;  3AG4 C;  5E2Q A;  2E2E A;  3GZS A;  3TG5 A;  3K66 A;  3V7O A;  1OCC C;  3OXG A;  3FHD A;  2WVQ A;  5EKQ D;  3N24 A;  1N1C A;  3R7Q A;  3B7R L;  2Y3H A;  3SYN A;  2WXR A;  3SGH A;  4G25 A;  3MA5 A;  2X51 A;  3D9N A;  3T8M A;  3B9Q A;  1TWG A;  4U5B E;  3P2B A;  3T5V A;  3PMR A;  4G23 A;  1TR2 A;  3Q7G A;  1QNF A;  2CFZ A;  5AEN A;  3I5P A;  2MOW A;  4MRU A;  3ECS A;  3LCA A;  4WJ0 A;  3RO3 A;  3CQG B;  4XI9 A;  5G2N A;  2J7P A;  2WVI A;  3IKO B;  5FZS A;  2BF0 X;  3AQB A;  4JEU A;  4GZ3 A;  2J09 A;  3PVL A;  2DCP A;  1PD1 A;  3F46 A;  4AIF A;  3AG1 C;  4I3M A;  2YZS A;  2VQ2 A;  2ZXW C;  5B1B C;  3UQ3 A;  2LSV A;  2XGM A;  3CVN A;  4N2Q A;  2I2O A;  2NUP A;  4PS7 A;  4JCH A;  1ZYR F;  5AJD A;  4P29 A;  3QC1 A;  3PDN A;  4JHJ A;  2WQH A;  4ANW A;  1MMN A;  3PHF 2;  3TJP A;  2NUP B;  2VSX E;  3VLD A;  2D5R B;  3RKO F;  3Q49 B;  3M1C B;  3ZC4 A;  2H7V C;  1IQU A;  3AS5 A;  3CKC A;  2AW6 A;  1IQR A;  4U0Z A;  2HV7 A;  3B0V C;  1LVK A;  5G04 C;  2P7V A;  4KNV A;  3JT1 A;  3WOD F;  1D1B A;  2XPI A;  2XPY A;  2GFH A;  4HOU A;  5CCM A;  2VAS A;  4A1G A;  5DQZ A;  4ABN A;  3AQC A;  3ZYQ A;  4PUC A;  3CZ6 A;  4XLN F;  5G05 C;  4QI0 A;  2IXM A;  3AU4 A;  4HOR A;  4JA7 A;  2WZL A;  3RRN B;  3CVW A;  3CVY A;  1G8X A;  3EG9 A;  5F5F A;  3ZVV A;  4FWV A;  3EG9 B;  1N52 A;  2R59 A;  4WNG A;  4LRZ A;  1BR2 A;  4JZY A;  4UQY A;  2NXP A;  4PDX A;  4CIH A;  4EZK A;  4B0Z A;  4LLE A;  2VJ8 A;  4G1T A;  3FTV A;  2H7B A;  3K9I A;  1ELW A;  3DM9 B;  4UI9 K;  2XXA A;  4RSY A;  3JRT A;  2ZXR A;  3CVQ A;  3UT8 A;  2V8S E;  5LX8 A;  3FDQ A;  2XXA B;  3RK6 A;  2KC7 A;  2ZU6 B;  1NA0 A;  1ZHT A;  5FTP A;  4BJ1 A;  3ML8 A;  2IF4 A;  3G2W A;  1ELK A;  1MMD A;  4JHK A;  3NDB B;  2MWQ A;  2KJG A;  4AY5 A;  5ENN A;  2A6H F;  2J45 A;  2H7O A;  4GMJ A;  4G7H F;  4HEA J;  3PRZ A;  3B7U X;  3O6X A;  5DVW A;  2LNI A;  3GW4 A;  2EIK C;  3EHN A;  4KVO A;  2A1D D;  5E75 A;  1SZI A;  2QTV A;  1HO8 A;  4U5G A;  3QDN A;  3S7B A;  3QZC A;  5E76 A;  4F4B A;  3FEX A;  1HF8 A;  3ZVR A;  3W8H A;  4FX5 A;  3LLK A;  3E4B A;  2OV8 A;  3CV0 A;  1GW6 A;  4FUL A;  2XQ0 A;  2FEZ A;  3D9P A;  4KVM A;  2R7X A;  2OVF A;  3FWV A;  5LOZ A;  4BJ5 A;  3OA1 A;  2MYS A;  5DS6 A;  3NF1 A;  5CCL A;  1O5H A;  2XEV A;  4N5C A;  3C98 A;  3FUE A;  3I5Q A;  4GPK A;  3MEK A;  4BJ6 A;  2XPZ A;  4YWQ A;  1Z3I X;  4IYP A;  2R7R A;  2I1J A;  3D9O A;  2L9B A;  2Y39 A;  4WUY A;  3L34 A;  2Q9C A;  3RH3 A;  3ESL A;  2CNW A;  2YQ8 A;  3ZN3 A;  3FUD A;  2GRL A;  3DAG A;  1E8Z A;  5KYW A;  2R7V A;  4K0R A;  3OXL A;  2OG2 A;  4J0U A;  2G3K A;  3DD7 A;  3HIZ A;  3U3W A;  4CS8 C;  5KYW B;  3LVR E;  3EDT B;  2J4D A;  3QB2 A;  4XWJ A;  3CHQ A;  2C2L A;  3S28 A;  3ZHE A;  2IYL D;  1IYG A;  4H7X A;  3VYW A;  2G3V A;  3S7J A;  2A5U A;  2OND A;  3QWW A;  3LY7 A;  3ONL A;  4CT0 A;  4XKC A;  3ZHE B;  3CK7 A;  4JHR A;  1V54 C;  2IOL A;  4LAC B;  1MND A;  5T8I A;  3EH1 A;  4UI9 C;  3N0T A;  1OWM A;  2KZT B;  4A3T A;  1UJK A;  2X6K A;  3SBT B;  4E7S A;  4QI2 A;  2J07 A;  5D91 A;  3O48 A;  3L54 A;  3IEE A;  2VGX B;  1TWA A;  4L2Y A;  3LS0 A;  2A68 F;  1S0P A;  2CGE A;  4V3I A;  4U0U A;  4Q69 A;  5FWQ A;  2OOE A;  1IW7 F;  3L22 A;  2RG8 A;  3S7D A;  4FP7 A;  3CST A;  5BUZ A;  4CS8 A;  1VYI A;  4B89 A;  3MV3 B;  4HXI A;  3U64 A;  1OWP A;  4DI3 A;  2AVP A;  1Y8M A;  1INZ A;  1ZHZ A;  2V5F A;  2J9W A;  3S29 A;  4TUU A;  5FCL A;  3PE4 A;  4ZLD A;  1MHQ A;  2CNW D;  3O39 A;  3EFO A;  1HS6 A;  2CG2 A;  1QZ2 A;  4UWL A;  3S2A A;  2YNQ A;  4EEC A;  3UUX A;  3UNG C;  1MNE A;  2CG3 A;  5T3W A;  1PY1 A;  4I43 A;  4Y6W A;  2PM6 A;  3ABM C;  4KT6 B;  4GA0 A;  2Y4T A;  3I4R B;  4AK9 A;  4C0M A;  4R7L A;  3F47 A;  3FH5 A;  2PQN A;  3FUI A;  5KCM A;  3QK0 A;  5E3C A;  4C3D A;  3JSZ A;  2AWI A;  1KLX A;  3EZH A;  5BUO A;  3GZ2 A;  5LP0 A;  4A55 A;  4G2V A;  4LEU A;  4LER A;  3MGB A;  3QOU A;  1S7Z A;  1JUQ A;  3RYL A;  1E8X A;  1ZHY A;  4GEH A;  4WWN A;  1Z63 A;  3DJU B;  5J08 A;  3PH0 C;  3POV A;  3T6B A;  5EHH A;  2OVB A;  3TGO A;  4FLB A;  4AEZ C;  1UN8 A;  4ANU A;  4LUN U;  3S27 A;  4EZJ A;  2FF4 A;  3R9A B;  4YT5 A;  5D0O D;  4A1S A;  4BX8 A;  3FUL A;  5C1D A;  1FFT C;  5EDS A;  4N3C A;  4DLO A;  2Y3G A;  5FQ4 A;  3RFY A;  1HH8 A;  3MJW A;  2V4L A;  5KJN A;  4AE4 A;  1Y6I A;  4C3E A;  3PNL B;  3QWV A;  4K7B A;  4XI0 A;  4HVB A;  3L08 A;  4BTA A;  3NYJ A;  4CBE A;  3SHF A;  4C0E A;  4ANJ A;  3FU5 A;  4PJM A;  4B94 A;  4OIR F;  5A7D B;  3CK8 A;  4E6H A;  5DS5 A;  3FUK A;  5JHA A;  3DZA A;  3KH2 A;  2KCK A;  4EBA G;  1OWN A;  4L7T A;  4IJJ A;  2IU1 A;  2FFH A;  2ZPA A;  1XNF A;  2HO1 A;  3R7R A;  5LCW C;  1EPU A;  4DVY P;  3W8I A;  3ZYM A;  1KU2 A;  4B6I A;  3ML9 A;  1QLE C;  5CI9 A;  4PK4 A;  1D0Y A;  3T4R A;  4J8S A;  4E85 A;  4I2Z A;  3QJZ A;  2LO6 A;  2Y3A A;  3LS8 A;  3SNX A;  1JPL A;  4WWO A;  4GA2 A;  1FFH A;  4LCT A;  1L5J A;  3CVL A;  1OUV A;  2UY1 B;  3FH8 A;  5JHB A;  3G2T A;  5LFA A;  4MKT A;  2V0P A;  2B0J A;  2XRY A;  4U5E E;  3IV0 A;  4JJG A;  4YVQ C;  4J8F A;  3UGO A;  3QAR A;  3URZ A;  2J4B A;  3RKV A;  5KYN A;  4ME2 A;  2A6E F;  5BT1 A;  2EQX A;  4G7O F;  1UN9 A;  3ULQ A;  4AOF A;  2KQ9 A;  4O6N A;  3FTX A;  2R7W A;  4ILH B;  3EZI A;  1OWL A;  3GYZ A;  2J9Q A;  3I4U A;  1VYK A;  3NQP A;  1VK5 A;  3VLE A;  4XX5 A;  3CHM A;  4I17 A;  4CEM A;  2P6V A;  5CI8 A;  4U8H A;  1FTS A;  1KT0 A;  1OKK A;  3B13 A;  4JJF A;  3FTW A;  3IBE A;  3AS8 A;  4KZC A;  2Y3D A;  3DM5 A;  2FBN A;  2ION A;  2I6H A;  3CHS A;  1A17 A;  4FHK A;  3K7D A;  1V55 C;  1TKN A;  2PX0 A;  5L3V A;  2IFU A;  4NQ0 A;  5KJL A;  1SZA A;  2CHX A;  4BWR A;  2PL2 A;  2AXZ A;  2C0M A;  3D9K A;  2ILR A;  3UMH A;  2XCC A;  4GU5 A;  4HE8 D;  4KZ0 A;  2FGY A;  4PJN A;  4JW1 A;  4GB9 A;  5B1A C;  5JJT A;  1OCO C;  4QFV A;  2WZG A;  3LAY A;  2WXO A;  1MMA A;  5DBK A;  3JUI A;  2R7Q A;  4CT4 A;  1E8W A;  3EQL F;  3FUF A;  3OXF A;  4JA9 A;  3CHP A;  4IAO A;  3ZSU A;  3HLZ A;  4ZLC A;  4HOT A;  2X6I A;  2J7P D;  4A3V A;  1ZBP A;  3BEE A;  3O4Z A;  3KS2 A;  3X1O A;  1JPN A;  4K0D A;  3HTK C;  1HE8 A;  3FUH A;  1FMV A;  5E3A A;  3HVE A;  3PS6 A;  4FES A;  5T4Y A;  1OKK D;  3SNH A;  3ASH A;  3UGP A;  1EDU A;  3KAE A;  1NG1 A;  5FJY A;  3HVE B;  3RJV A;  1X5B A;  3KEZ A;  3EH2 A;  2VYI A;  4KNW A;  5CMY A;  1H6K A;  4FC8 A;  4JPS A;  2JEK A;  4F3V A;  4JL0 A;  4JXT A;  4G11 A;  5EX3 A;  4BJ5 C;  3VTX A;  2BTD A;  2R7T A;  1SF8 A;  1LF8 A;  3LY9 A;  4RG9 A;  2IOS A;  4BJ6 C;  5FZQ A;  3VLF A;  3CSF A;  2ZXO A;  4O6M A;  4KYO B;  1SZ9 A;  4L1B A;  4YN0 B;  3L6A A;  3SZR A;  2L9J A;  1BR4 A;  1ST6 A;  3UT7 A;  3LEV A;  3ASG A;  4N3B A;  1FVH A;  4UWG A;  1ZU5 A;  5KYU A;  3UR3 C;  2X6F A;  5EX0 A;  1ZU4 A;  4CGW A;  2NUT A;  5KYU B;  3FEY A;  2FUL A;  4UWH A;  2WB2 A;  1IZM A;  4O79 A;  3OWT A;  1JPJ A;  2NUT B;  3DMD A;  2XGO A;  1NA3 A;  2HYZ A;  4BJT A;  4CRW A;  1JWF A;  1TJC A;  3D9M A;  4YND A;  4WWP A;  4G0H A;  3DJN B;  4GYT A;  4HFF B;  3E70 C;  2XHE A;  3FUM A;  3EJN A;  1E96 B;  5KYY A;  2WQ7 A;  3BG1 B;  1ZHW A;  4BTB A;  1EF1 C;  4N39 A;  5KYY B;  1M2V A;  2XRH A;  4ANX A;  5E33 A;  1BPO A;  1ELR A;  2WQ6 A;  4GCO A;  1M2V B;  3AS4 A;  3MCX A;  3LKU A;  3UMI A;  2Y69 C;  5ANR A;  3E9V A;  1P5Q A;  1VOM A;  2WMN A;  5JJ6 A;  1M2O A;  1PD0 A;  3G2V A;  3ZRH A;  4I6E A;  3I3N A;  3EIQ C;  1W2W A;  2VSN A;  2KCL A;  2J49 A;  3N71 A;  1HG2 A;  2NC9 A;  1TJF A;  3CLJ A;  4IWB A;  4DVZ A;  3ASF A;  2WXP A;  1ZU2 A;  4EBA A;  3ITF A;  3QNK A;  4GYW A;  4GCN A;  4GZD A;  1Z23 A;  3CQZ A;  3Q6N A;  5DS4 A;  3K6B A;  2WVN A;  1NU7 D;  2L81 A;  2BE5 F;  1D1A A;  4YT4 A;  4NUR A;  3IHY A;  3N2Z B;  2KM4 A;  4DBQ A;  3ASD A;  4DBR A;  3Q5M A;  4O7G A;  3CVU A;  3GAN A;  4P6I C;  2QY7 A;  2MRI A;  3ZG1 A;  3CVP A;  4A2N B;  3CQC B;  4FLH A;  3LLI A;  4AVX A;  4H7Y A;  1VMA A;  4JUR I;  4NY3 A;  3FDH A;  3B7S A;  3UPV A;  4U5C E;  5C2Y A;  3LES A;  5D0Q D;  3K1I C;  3MZL B;  5T1D B;  3T5X A;  3Q7L A;  1DVP A;  2A4Z A;  1Z6T A;  4J30 B;  3EFO B;  2HM8 A;  3CKB A;  2VGY A;  5HI7 A;  4DJA A;  4DOZ A;  5BV1 A;  4ULW A;  3JYS A;  3LY8 A;  3UMV A;  2KNH A;  5BNW A;  3S7F A;  3D9L A;  3PNT B;  3B0U X;  2WXH A;  4CDN A;  1M57 C;  1KT1 A;  4M3O A;  4AJW A;  3S0X A;  3TG4 A;  3RRU A;  2CW0 F;  2J9U A;  3LEW A;  3K1H A;  5ARF A;  1N54 A;  4CDM A;  1Z5Z A;  4RVB A;  2KCV A;  3ZFW A;  3AG2 C;  4U5H A;  4U07 A;  4PFP A;  4E7Z A;  5EGY A;  2R7S A;  4XZ4 A;  4I1M A;  3FHE A;  2IOQ A;  3CVX A;  3FAJ A;  4OD5 A;  2R7O A;  5G04 J;  1HXI A;  2L6J A;  4GZ5 A;  3VAY A;  2ZXP A;  4I6G A;  1VDY A;  2LAH A;  3L13 A;  2IJG X;  2J0W A;  4BG0 A;  3LPZ A;  3KL4 A;  3SEO A;  2YHS A;  1NZN A;  3LJB A;  4Q94 A;  1Z3Y A;  1M56 C;  3Q4A B;  3LS1 A;  4HLE A;  2X38 A;  5AIJ A;  1PCX A;  1ZHX A;  3WXX A;  3U4T A;  3SD5 A;  3PUJ A;  4ACL A;  2LAI A;  2DIW A;  2FI7 A;  3LJ3 A;  3SFZ A;  4FJZ A;  4IN3 B;  3TXM A;  4HFG A;  2IXO A;  3QWP A;  5DIZ A;  4H4K C;  5FQ6 A;  3L16 A;  3FFL A;  1H19 A;  3SBS A;  5AJL A;  4FHJ A;  4AE4 B;  4WAF A;  4JZA A;  2PM7 A;  3DBS A;  2IXP A;  2PZI A;  2G62 A;  5KJK A;  3KD7 A;  4BSX A;  1NZE A;  3G2U A;  4I2W A;  1W3B A;  1IHG A;  2R5S A;  3CSK A;  2NSZ A;  1U3D A;  4WNE A;  1FVF A;  4APF A;  3HYM B;  3EIJ A;  4YT2 A;  4I1O B;  1FCH A;  1QQE A;  2X3M A;  2LSE A;  3Q47 B;  3NYM A;  2LSU A;  3DAF A;  3CVV A;  3MX3 A;  3ONK A;  4BX9 A;  3NZS A;  1UJJ A;  3B0P A;  2HR2 A;  2VSO E;  4KMO A;  3ZIM A;  3NKD A;  3EGD A;  2WXK A;  3ZGQ A;  2V26 A;  1J8M F;  2EIJ C;  3EGD B;  2CDQ A;  1FMW A;  4Q4Z F;  5T3R A;  4OVU A;  1UW4 B;  2J9V A;  1WM5 A;  3L17 A;  2DYR C;  2WXN A;  3JCK C;  1E7V A;  2XCB A;  3Q15 A;  3FTZ A;  3FTS A;  2W4M A;  3RRM B;  1LS1 A;  4J32 B;  4RDA A;  3W2W A;  3MLG A;  3QMK A;  2WXF A;  2O9X A;  4N06 A;  2YHE A;  1HZ4 A;  4KBL A;  2PX3 A;  2AXV A;  2R7U A;  3OAW A;  2JLB A;  4DK5 A;  5D92 A;  5CHE E;  4APO A;  2XSE A;  3EGX A;  4X0R A;  3ZYL A;  1YA0 A;  2Q9A A;  1H2U A;  4IUL A;  2QY9 A;  2C03 A;  3EGX B;  2V3C C;  4UQX A;  3L0I A;  1H0A A;  1UG3 A;  3D9I A;  5KJM A;  1SQM A;  4OIO F;  2WXG A;  2BUG A;  2I9C A;  5HSW A;  3CHO A;  3AU5 A;  2FO7 A;  4G24 A;  4GZC A;  4RD9 A;  3NZU A;  3CHR A;  4XKB A;  3QKY A;  2WXI A;  3MYV A;  2X6J A;  2W45 A;  3NYL A;  2WXQ A;  4BEJ A;  3IHV A;  2W4B A;  4U5D E;  4OIQ F;  4U63 A;  4FJY A;  3U66 A;  2OCC C;  4GZ6 A;  3PE3 A;  2E0I A;  4UI9 J;  1LKX A;  1NP7 A;  3HDX A;  4W8K A;  1B89 A;  2Q9B A;  1JWG A;  4W9R A;  1MQS A;  1OCZ C;  2Z15 A;  4U5F E;  5BPP A;  4GYO A;  2CHW A;  4FAD A;  4PJJ A;  4F1S A;  1RJ9 A;  2EIN C;  4IRU A;  2IXN A;  4OVV A;  1J8Y F;  3OTN A;  4XIF A;  2XGS A;  1RJ9 B;  4OIN F;  4DLQ A;  4XE0 A;  2W9Y A;  2RD0 A;  4C3B A;  3JYH A;  3APF A;  3PRE A;  3X2Q C;  1NU9 C;  2IQC A;  3RO2 A;  1PAQ A;  4TV3 A;  3LXU X;  4HS2 A;  3PEU B;  3APD A;  3RU0 A;  3FUJ A;  2KAT A;  3B7T A;  5KYX A;  5FQ8 A;  3CIA A;  5DLJ A;  5HQ8 A;  3CR3 A;  4K03 A;  4CGV A;  4Q5S F;  5KYX B;  2A69 F;  4EZL A;  4URK A;  3HHM A;  4AM9 A;  2KW3 C;  3JQ0 A;  2I8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...