3EHNA

Bt1043 with n-acetyllactosamine
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
514
structure length
514
Chain Sequence
ELGPLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 190
structure length 514
sequence length 514
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehnA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehnA01
3MCXA 5LX8A 3I4GA 3KEZA 4PUCA 3OTNA 4F53A 3JQ0A 3MYVA 3CGHA 3QNKA 5T3RA 3CKCA 3CK8A 3IV0A 3P1UA 3L22A 5FQ7A 3LEWA 3EJNA 4MRUA 3MX3A 3FDHA 3NQPA 5FQ8A 4L7TA 3SNXA 5J90A 3EHNA 4Q69A 3HDXA 3GZSA 3CKBA 3EHMA 5FQ4A 3JQ1A 3JYSA 5E76A 3CK9A 3CK7A 4LERA 5T4YA 4F7AA 5E75A 5FQ6A 3SGHA
chains in the Genus database with same CATH superfamily
2CG3A 3PZ2A 1S63A 2GGFA 5LX8A 3U3FA 1YAUO 2A6HF 5AIJA 3HXFA 2I8BA 3CKCA 3C5RA 4AV7A 4G7OF 3NZSA 1ZYRF 4BJ6A 3NQPA 5D66A 1HMDA 1Q0KA 3Q9NC 1R4TA 3ZC4A 4Y6WA 4C3BA 1V54E 4YT5A 4ATZD 2VGXB 5L3VA 2VSOE 3Q7LA 5DQZA 2WVNA 3SP1A 2EINC 3HVEB 4CSAA 3JT1A 3QB2A 3ULEG 3QNKA 2OOEA 1JPJA 3NOGD 3PZ1A 3ZG1A 4DVZA 1TJCA 1O87A 2NXPA 4JXTA 3T9OA 3E37A 5G05C 4FHKA 2ETAA 4BJTA 4Z68A 4A4AA 2X6FA 4XTKA 2PQRA 3K66A 4HS2A 1TNUA 3ABKE 3U9JA 3JQ1A 2M64A 3DAGA 5COGA 1E8WA 1OWMA 3M15A 1OWPA 1WWPA 1XZPA 3UM0A 3ZU7B 2OEWA 1NG1A 3E34A 4YK5A 3Q78A 3R2PA 1IQUA 2Y1LE 4YDWA 3LEWA 3AS5A 2YL7A 4B0ZA 1V55E 1QQ3A 5JUAA 1S05A 1EYHA 4MVZA 2QLAA 3HXBA 2I9CA 3KS2A 2IQCA 4TXQA 3GEHA 5BT1A 2PNOA 1S64A 3L16A 2EPMX 4NACA 3AJMA 4ANJA 2PP4A 3Q7FA 1Z5SC 5EK0A 1F1MA 2XL6A 3ZPJA 5LCWJ 3FOPA 3WAQA 1S0PA 4LDRA 3AG3C 1EQ1A 2D5RB 4HE8D 2QYUA 4BEMJ 4H7XA 4O6YA 3FHEA 3PNTB 1Z6AA 4EBAA 3Q49B 3NMKA 3GM2A 2L0IA 4YVQC 1HZ4A 3LY8A 4GPMA 3O4ZA 3L6AA 4F1SA 3D9KA 1TR2A 4CEMA 4XI0A 3UM2A 1UN9A 1BZ4A 2EPKX 4MVOA 4IB4A 5FIOA 1BD8A 2DYRE 3NZUA 3HG0D 5KYUB 3D9HA 5ANLA 3HYMB 3UPVA 4PS7A 3AGTA 4IWBA 1ZVZA 3ABLC 4Q4ZF 1TNYA 3EDTB 4LDQA 3JXIA 1AWCB 2Q9BA 5JA4D 5DS6A 1E8XA 3PZ4A 5F5FA 1B68A 1Y6IA 4KVMA 3I5QA 2GA0A 3DPDA 4HNAD 2LXMA 3ABMC 1C02A 4UWGA 3ASOE 3F47A 2VSNA 1TEZA 3TWQA 4XWJA 1JUQA 5A69A 3V31A 3ZYMA 2EIKC 4QI0A 4J8SA 1DNPA 2DYSE 3RQFA 1VB5A 2FFHA 4UWLA 4Z9JA 5EYPF 5LOZA 2I6HA 4DBQA 4EWCA 3RSEG 3FUDA 4N06A 4HB5A 3NYLA 1UN8A 5B3SC 3IV0A 3CHSA 1LIHA 2DVWA 3QKYA 3UT8A 2HV7A 3N24A 4UWFA 2XS8A 3C8GA 3CZ6A 4FLHA 1VYIA 5ENSD 1H7IA 4JVSA 3V5XA 2XEVA 2NC9A 1UFBA 4XI9A 4OINF 5M72A 1YJGA 2LSEA 4IGGA 4PACA 2UY1A 3EFOB 2P7VA 3AG4E 4N2SA 4FAPB 2ZPAA 3DM9B 3Q4AB 3FWVA 3CHOA 2L6BA 3C3RA 2BC5A 4HFKB 4NCQA 4YT2A 2IONA 3MKQA 1WTYA 1MZCA 3UIOC 2DGJA 2AWYA 3RRMB 2G3KA 2BTDA 5AQ9A 2H6IA 4LG6A 4A55A 1S7ZA 4C7OA 3VAYA 3N0TA 2VQ2A 3IQCA 3NF1A 5HQ8A 2VH3A 3HNLA 2M63A 4LNBA 3S28A 1M57C 1FR0A 3ZSUA 2R7UA 3WXXA 4I3MA 2IOQA 3AG1C 3E4BA 1MNDA 1LE4A 3DSVA 3ZNGA 1NFNA 4UQZA 3QDNA 4JRZA 4BT9A 1HF8A 1LM3B 3S7BA 3HNIA 2Q9AA 3GWNA 3SY2A 4C0MA 2RSEB 4ONSA 4CS8A 1RW2A 3ZHEA 3HNJA 4V3IA 3DWLG 3U2MA 5JLIA 1C17M 2J7PA 4G25A 5G04J 3UINC 4CJGA 2WB2A 2HS5A 3CHMA 5FQ4A 3U0CA 3UGPA 2LFFA 2J7PD 1O1TA 4Z9HA 3PS6A 1ZZPA 3E33A 3VTYA 1KZOA 3CR3A 3FTZA 1DCQA 2Q4FA 2HSQA 2P58C 3D9MA 4O1OA 1A5EA 4IJJA 3GEIA 4N3AA 4BERA 2L9JA 4FU3A 3FUHA 2ETCA 5FQ8A 1ZW3A 2H6GA 1H19A 2PQNA 1GS9A 4O6MA 4X8QA 2KM4A 4B93B 3UMIA 3PHF2 3QWPA 3SHFA 4YT4A 3SZRA 4K5CA 4C48B 3I3NA 2R2LA 4B6IA 4AOFA 1WATA 3RIPA 4LRZA 3ULQA 4JCHA 2A1DD 1AP7A 2LIGA 3SNHA 4J7TA 2AP3A 4E7ZA 5L0JA 3DPYA 4DK5A 4OD5A 2WXLA 5CEDB 1YZCA 3MX3A 3C8GB 3URZA 4U96D 3AQBA 1IKND 4AK9A 4OAVB 4C0EA 3U4TA 5JVEA 2MOWA 1RJ9B 1P5QA 2Y3GA 4FWVA 1NL4A 4AM9A 2KBXA 4YWQA 1TKNA 2CCYA 5AAOA 3G4ZA 2OV8A 1D8EA 3RH3A 5T3WA 3CEXA 4ME2A 5DIZA 5T8IA 2WZFA 3Q6NA 3OWTA 1SZ9A 3V5ZA 4OIQF 1U3DA 2MHRA 2NSGA 4GTTA 3FU0A 1Q0DA 3D9IA 3MKQB 2XHEA 2GRRB 4UWHA 1G4US 4E0HA 2MYSA 4ZHBA 4EBKA 4D4XA 2XPIA 4XEKA 3LXUX 3JRMO 3VF0A 1DCEA 1HFAA 2KGOA 1LI7A 2GW1A 5BPPA 5L0DA 4WAFA 2WB7A 4CS9A 2YRFA 4C7OB 2XRZA 1EKYA 2CG2A 2WXPA 4KYOB 1HXIA 4HOTA 1OT8A 4TXPA 4IYPA 4MVUA 2R7WA 3NRHA 3KH2A 1Z63A 5BW8C 2R7RA 4LACB 2QYJA 4BSXA 2GFHA 4RD9A 2Y3AA 5L0FA 1X5BA 2JABA 4G23A 1TNBA 4CDMA 5DQTA 3ASOC 4RLYA 3EGXA 4ANXA 1ZB1A 1OW7A 3PREA 3D9JA 4HORA 3ZHEB 4EECA 3JYYA 3S7DA 3IHVA 3FAJA 2FBNA 3LLIA 3AJIA 3ZWIA 1CGME 4AIFA 3IKOB 1OWOA 1NA3A 2A5UA 2R03A 2WQ6A 1FT1A 4ABNA 4G26A 3DSUA 2KZTA 3Q79A 5BQHA 4L2LA 2QTVA 1TNZA 4QFVA 5JJTA 2XXAA 4NQ0A 1NP7A 3CHQA 5G55A 3FXHA 3VYWA 4EZKA 4GA0A 1KT0A 1PC2A 2YNQA 1NZEA 5ARGA 1D8DA 2Z15A 4RG9A 1RKEB 3ML8A 3SD5A 1OCOE 3IQTA 2B6CA 1OCCE 2J9QA 5AN8A 1AEPA 1H6KA 3HXCA 5TJ5E 4MW8A 1H9TA 4J0UA 1VMAA 3KAEA 5BV1A 1N0QA 4C3EA 2V26A 2VC9A 5EIBE 4U9DA 4DI3A 2P9IG 3DSXA 3CVXA 2V4HC 3RO2A 2PX0A 1Z3YA 3B7SA 3C72A 4E17A 3SBTB 1IHGA 1ZHYA 3RVYA 2Y69C 1FFTC 2IYLD 2IO2C 2ZXWE 3MZLB 1T9KA 4JJGA 3ZVVA 2HJ3A 4EQFA 2UUHA 2HE0A 4AX2A 4F7AA 3FUIA 3KD7A 3J5QB 2F0YA 4B94A 3L08A 5JRAA 3FP3A 2GRLA 3S7FA 4CIHA 3RIBA 1NU9C 3QVYA 2I15A 4WGYA 5EHHA 3ASFA 1ZU4A 3FUEA 3PUJA 3U64A 3FTXA 2EIMC 4DBRA 4N3BA 4OYSA 5A6BD 4BSZB 1MQSA 5B3IA 2XGMA 2NUPA 4Q96A 4GTQA 3ONLA 4U8HA 3K1HA 4X0RA 1N9AA 3AGUA 3T6GB 3EHQA 1N54A 4ILGA 3CSTA 4GAAA 1M56C 1YMPA 4GA1A 3QK0A 3WG7C 4HOSA 1L3PA 3T5XA 1SQMA 1V4AA 3E30A 4KMOA 2P9KG 1ZHWA 4I6EA 3OA1A 4JKVA 4FULA 3M4BA 3LESA 1Z6TA 5AGFA 5GPGB 2P1AA 4HOUA 3TWTA 1QYMA 4EUKB 3CHPA 2E2EA 3CHRA 1OCZE 4YL1A 4IRUA 3SFYA 4EZLA 4JEUA 3DE8A 3EGXB 3Q5MA 3RQEA 3MGBA 2YL0A 3ASNE 4GTVA 3FUNA 4JA7A 3L8JA 4GZDA 2J8WA 2VCCA 4U04A 3O48A 3LNMB 4KZ0A 4B8AA 5CRVA 3DSWA 2R7OA 4XKCA 1QQEA 5EKQD 2WXQA 2ZGGA 4K5AB 5KWDA 4TRQA 3RK6A 5BQGA 2XXAB 3DE9A 1FFHA 1FAPB 3NOCD 4CZ2D 4W8PA 1LS4A 3KEAA 5FJYA 5L0CA 3CK8A 2XS1A 3AG2E 2WQHA 1MJ0A 1OY3D 5H7PA 3NAWA 4FADA 1J8YF 4UI9J 4CYMD 2ILRA 4L2YA 3RJVA 3QOUA 1L7CA 1ZHZA 5KNGA 2ASRA 4E0IA 5LP0A 5EX3A 2Y39A 4N6CA 2XPZA 3GW4A 3LEVA 4GZCA 4KBQA 4PJNA 5T3RA 3PE4A 1SZIA 5HSWA 2IXOA 3UMKA 2OVFA 3LVRE 1K04A 4JPSA 3S84A 2HKVA 4I43A 1A7EA 4M7CA 1Q0GA 2P9UG 3QWVA 1XZQA 2QUPA 4CDAA 3W8IA 5CBNA 2KJGA 3G2UA 3DEOA 3EU9A 2AU5A 2J45A 3PH0C 4JZAA 4FJZA 3JCUQ 4OD4A 4CGVA 3BG1B 5ANRA 5EX0A 1E7UA 3DSSA 3SFXA 4GQHA 1A7DA 3BEEA 1T6UA 2Y3DA 2LCHA 3JQ0A 3QVZA 5G05J 1BU9A 4GTPA 2NPUA 3AU4A 4KXKB 4DRHB 3BRJA 4NC3A 2HV6A 5KYWA 1JRAA 2L0TB 2NUPB 1LD7A 3C98A 4AY5A 2YHEA 4U0ZA 2WVQA 1ORSC 4LSZE 5CCMA 3B0PA 3CKBA 1TN6A 4G7ZF 2DB4A 3ENEA 5IY5E 1CPQA 2VTBA 3TAXA 3ZXSA 1NA0A 2LQGA 3N2ZB 4EHPA 5L0IA 3B95A 1OXJA 4O79A 1TWHA 4WWOA 5HKPA 4H7YA 2XM0A 2F8YA 5KCMA 3BUAA 3FU3A 1LE2A 3H65A 1Z23A 1Z7Qc 2LAIA 1ELRA 2F8XK 1OUVA 2L9BA 1MMGA 3E70C 2R7VA 2Q9CA 4J30B 2XLVA 4F1PA 4JW1A 4CBEA 1N4PA 2A0BA 3FEXA 3IEGA 1YA9A 1IZMA 2P9SG 4CDNA 2HUJA 1JR8A 2LD6A 2J9UA 3DEPA 1SF8A 1DOWA 4L9PA 3UIPC 3OAWA 1MX2A 2YZSA 1GM5A 2GAQA 2NYJA 4HFFB 3FH8A 1E7VA 4HEAJ 1JCQA 3RKVA 3W2VA 3CSKA 2OQMA 3P2BA 5CI9A 2IXNA 3J06A 3LPZA 1G8XA 3S7JA 2HMQA 2UWJG 2IF4A 4OIRF 4PK4A 1H2TC 3L17A 1T01A 4N4WA 5T3TA 3HRAA 2WVOA 3VRCA 1NI1A 2A68F 3UI2A 4AEZC 1NSGB 2ZISA 1PAQA 3T5VA 5EGYA 2YINA 4NRHB 5ENRD 2C03A 3TGOA 3JYHA 5FCLA 3SFZA 3QW0A 4EBBA 1UG3A 1YCSB 2DZNA 3TJ6A 4MVMA 4CIPA 3FTSA 1YYXA 3JZ0A 2FO1E 1K1AA 5BUZA 5K0IA 4IN3B 4CCAA 4MVSA 4I1AA 4DXWA 5B1BC 5DLJA 2YLDA 4P9FA 3B7RL 1K8KG 1OCZC 4K0DA 2IO3C 4AE4B 2NUTB 1RZ4A 3QJZA 5HRYA 1TYQG 3ASNC 2WVIA 3FTYA 4BJ5A 1MMNA 1WDYA 1Z3IX 4ANUA 3CVVA 2ZIRA 4U8YD 5JP7A 5KYWB 3U3WA 4DLOA 3EHRA 5ENPD 1RMVA 3NKEA 5J90A 1AVOB 2J4BA 2IOLA 2JLBA 4Q94A 2MRIA 2QE9A 2EIJE 2X6IA 2Y0BG 1FVHA 4JA9A 4N39A 3F6QA 3ZN3A 2XRHA 1YDIA 4GZ3A 4XZ4A 3ATPA 1WM5A 3UUXA 1FMWA 2X38A 1T6IA 5JSLA 2IXPA 1MX4A 4RSYA 1NFOA 4MKTA 1HE1A 3C63A 1D0XA 3AG2C 3RW0A 4UQYA 4J7WA 3IHYA 4DX2A 3DM5A 4KVOA 3FH5A 2ZXOA 2P9LG 4BTBA 3ZVRA 2QY7A 4NURA 3IEEA 4G2VA 1OXBA 1OCRE 4F4BA 3DBSA 2WZLA 2BUGA 3WHNA 5DBKA 4FA6A 3EUVA 2VYIA 5ENOD 3RAUA 5KYYA 2VGEA 2XRYA 3UXGA 2YL1A 4PFOA 3LAYA 1JCSA 5AENA 3FHDA 4ANWA 4AP2A 3LCAA 4K0RA 4FX5A 2RKKA 4G8KA 2FAPB 1BI7B 4GCOA 4WWPA 3LDZA 3PDNA 1W3BA 1D0ZA 1OWNA 4CDRA 2WMNA 3B0UX 4K5BA 5AQAA 5ARFA 1A7VA 3U9MA 3VM6A 3DJNB 4HLLA 1KZPA 1Y6DA 4G7HF 5ENNA 2GRNB 2WPVA 5CCLA 4UQXA 2H7VC 4LNGA 2YWAA 2PM7A 4I44A 5D92A 4FESA 4BJ5C 2ZXRA 3RVZA 3Q75A 4U5HA 5KNHD 2OCCE 3ZRHA 3SYNA 2Q7FA 2WXOA 5IY5C 2XENA 4QI2A 1V54C 5F28E 3G2SA 2RFAA 2XLWA 3S9OA 3FUKA 2KYHA 4I6JA 4JZYA 4U5BE 2AXUA 4XKBA 2YQ8A 5HI7A 5BXOA 2IEJA 4N6HA 4JEAA 4WJ0A 1RKCA 4CT4A 1FMVA 2EPNA 2HZ8A 4N2QA 1U89A 1QKRA 4B8CB 2RD9A 4NY3A 4YL0A 2WZGA 1HY5A 2YHSA 1E90A 1E8YA 3VLFA 5EILA 5E76A 3ABKC 4NTFA 5COFA 3O10A 3MFNA 2VSXE 3C62A 1E83A 2FO7A 2KCLA 3W9FA 3V30A 1OQCA 3HHMA 1WAO1 3K7DA 2KNHA 5CHEE 2X6KA 3UM1A 3EG9A 3CVNA 3GZ2A 1UW4B 1NFIE 4U0UA 3VTXA 3EGDA 2L7AA 1BI8B 3C7JA 2YLIA 4XIFA 2HSBA 2OKUA 1FPPA 2A4ZA 3OXFA 2XM4A 4MRUA 2E0IA 5D2MC 1V55C 3ONKA 3TWRA 2JD3A 2XLMA 3OXGA 2J9WA 3G2WA 1WOLA 1PCXA 1D1AA 1M2VA 2V0PA 3ZIMA 2ZXPA 4A1SA 3D9PA 3ITFA 4LLCA 2UY1B 2HJMA 5FZRA 4A63B 4K7BA 3FFLA 3LNRA 4IAQA 4GYOA 1ORYA 4CS7A 4I1OB 4EBJA 3CVPA 1TN8A 1UJJA 3SXMA 4DJAA 5CMYA 3RKOF 1QLEC 2W9YA 2KC3A 4GZ6A 4DUIA 1TJFA 4FC8A 2CGEA 5AC5A 2DIWA 5B1AE 2J9BA 1LF8A 1TQGA 4G24A 3CVLA 3UQ3A 3R9AB 5DS4A 1H2VC 3GYZA 2DYRC 5KYYB 2OEXA 4AL1A 4KZCA 2GWWA 3FTVA 5L0HA 2ZD9A 4MS6A 3EIQC 3R7QA 3EPVA 4P9TA 1E84A 4DX7D 2LUHA 2Y4UA 3L22A 4BX8A 3JUIA 1WGWA 2TMVP 3SBSA 5AYWD 4MTGA 4UWKA 4H54A 4BY6A 1YARO 3L34A 4I2WA 3R7RA 4EZJA 2OG2A 2DYSC 3UR3C 3GODA 3MYFA 4U63A 4J7YA 5FTPA 5KBAA 3TWWA 1M2OA 5A6KA 2EPLX 1N94A 3C3OA 4EKWA 1OR3A 3CVYA 3LEOA 1KPSB 2OVBA 3T6JA 4CDVA 4TXRA 3TJ5A 4LUNU 4BT8A 3UNGC 2HM8A 3Q7GA 1K40A 2CHXA 4LEUA 2V3CC 2J49A 4BETA 4HRMB 4K1OA 4F53A 2GRPB 1FNTc 3MKRA 3JSEO 3ASHA 1JMWA 3AG4C 4OVUA 1PY1A 2HFIA 4Z9IA 3ZYKA 4QDLA 4O7GA 5KJNA 5DS5A 3JCKC 3MYIA 2XGSA 2CFZA 1VK5A 2WXNA 4GTMA 1SW6A 4Q7CA 4MQ9F 1TR4A 5HV9A 1UJKA 2R05A 2J8SD 1MHQA 2Y4TA 4GTRA 1KU2A 2LFDA 4E18A 2AVPA 2EINE 3ML9A 3LS0A 3UGOA 4GCNA 1JPLA 3D9NA 3DXMG 1LI5A 3EGDB 3FUFA 2DI3A 4ANVA 2WXFA 4PJLA 1OKKA 4JC8A 4NQFA 5JHAA 1LS1A 2E87A 5DVWA 1I4YA 4PR9A 4FLBA 4DRXE 2R59A 2OJED 2WQ7A 4JURI 2GROB 1OKKD 4WNDA 1B89A 5EIDA 2XPYA 4YDOA 2JEKA 4CJOA 1M2VB 3Q15A 2R7SA 1E8ZA 3V7OA 3KSLA 4HVBA 5CEAA 4ULVA 5CERB 4HLEA 3W9GA 5L0GA 2CYDA 5FINA 1XGWA 5A6BA 4PS8A 4APOA 5KJMA 3I5PA 4L23A 4K03A 2C2LA 1ELWA 4JEBA 3ZYLA 3EJNA 3FDHA 4PH4B 2L6JA 1MYOA 3AAAC 4GMRA 3V2OA 4E85A 3KYJA 3U8VA 4EBAG 3ZTZA 3L13A 3SF4A 1TFOB 1YA0A 4HI9A 5FQ6A 4GTSA 3T9KA 1UOHA 3AG3E 1XNFA 2X6JA 1RCPA 3E32A 3QC1A 4GMLA 3PMRA 2KC7A 2LSVA 4J6IA 4IAOA 4DVYP 4Q5SF 4BEJA 2GRQB 3PUKA 3ZTMA 1EDUA 1G3NB 1AUEA 5C2YA 3CAXA 4PJMA 4JC7A 5CI8A 3QARA 3GZ1A 1U2VG 2XL4A 2L6GA 2CHWA 2PFDA 4ATGA 2VGXA 4UI9K 4BTAA 4MNDA 2V5QC 3HNKA 1D1BA 2ZGDA 2R17C 4IULA 4PUCA 1N4RA 4RBNA 4XLPF 1O1SA 3ABLE 1QNFA 1OW8A 2XEHA 3U2LA 1T6QA 3KPHA 4W9RA 1QVXA 1GW6A 2XZDG 3DSTA 1N4QA 4LDKA 3ABME 3FEYA 4M3OA 1TNOA 3TWSA 3HDXA 4GU5A 2PF4E 2FEZA 2EIKE 2KZTB 1PD0A 4LERA 4QQIA 1FTSA 4F3VA 3L0IA 4J32B 3PZ3A 5B3SE 3RO3A 2L81A 2KATA 4JIOA 1EF1C 1MQVA 2OJQA 3RRUA 3QTHA 2X0CA 3PRZA 4BX9A 2MHKA 4MTFA 2BF0X 3VLDA 3B7TA 3K6BA 4DJ9A 1EPUA 3AS4A 5B1AC 3RRNB 1O5HA 3V2XA 4GB9A 3VLEA 1ZBPA 3JXJA 3FH7A 4CT0A 2P2CP 3PDMP 1INZA 1BR1A 2FI7A 2WXHA 3T6BA 1APCA 2WM9A 3OTNA 1ST6A 2YEVA 4YT8A 2YHCA 3MJWA 3Q6MA 3NMJA 2BL2A 2AJAA 2G62A 2Q7RA 4NTBA 1HO8A 1N0RA 1SR2A 3LLKA 3K9IA 2KCVA 2MWQA 2XLDA 3SZ7A 3AU5A 3TWUA 3HJCA 5CECB 2KQ9A 1IXVA 2WXIA 2R02A 2WXKA 3APCA 2QFCA 4XEFA 4DRJB 2NG1A 2V4LA 4J8DA 4LLEA 5AJDA 2CW0F 4BJ1A 5AC4A 2RG8A 5KYUA 3TOMA 3SXKA 1K05A 2R7QA 5E2QA 2R5SA 2BEDA 2XCBA 2UUIA 1NZNA 4PFPA 2CFUA 3UMVA 1ZU5A 2RD0A 1JAFA 1M6TA 3H2VA 2HMZA 3W8HA 2HR2A 2LO6A 2PX3A 1BDJB 3FY4A 2DBAA 3N71A 4JTDB 3FUJA 2IBFA 4URKA 3EZIA 4UI9C 4GYTA 5E75A 1HE9A 1DOVA 4A1GA 2P61A 4YN0B 1Z3XA 4AY6A 4MS2A 3F46A 1N52A 3ESKA 4I9CA 4U9EA 4ACLA 1ELKA 4D10C 3H2UA 1H0AA 2XSEA 4U5GA 5FQ7A 2GDCA 4JCZA 4WNGA 1QBQA 4P29A 1RXQA 2DWZA 3EZHA 1OCOC 2KCKA 3CV0A 1OCCC 4YJWA 1WY6A 3WODF 3RQGA 4MTOA 3CK9A 3E9VA 4HRNA 3POVA 2VCAA 4ZFHA 2HO1A 3EFOA 5A6CA 4AVXA 2QC9A 2A6EF 3NBNB 5A6AA 4TUMA 2AVKA 1SYQA 3UM3A 3CQZA 1N1CA 2P6VA 3G4XA 5COMA 2ZXWC 3L9TA 3B7UX 3TWVA 2YLGA 1LPEA 2B0HA 1H9GA 3DWWA 4KNWA 4U5EE 2C0MA 4HFGA 2AXZA 3MBGA 1YVIA 4JEHA 4YDYA 1Q0MA 3G2TA 1X81A 3B29A 4HRLA 3S0XA 4U07A 2JX0A 3CEQA 2BKKB 3EH2A 1Z5ZA 1WASA 5JMND 3NYJA 3A11A 3L82A 1NLXA 4CX9A 3B7BA 3Q9UC 3SGHA 2J0XA 1JOGA 1TWGA 2IY0C 3DZAA 2WXJA 4MBGA 1JWGA 1G4WR 3JTLO 3DD7A 1VDYA 3BQOA 4XLNF 3JUEA 1O5MA 3KL4A 2YQYA 3NYMA 2LAHA 3APDA 3HKKA 5KJLA 2R9RB 1MX6A 2G3VA 3T8MA 4BJ6C 3AS8A 4PDXA 4H4KC 3SO8A 1DVPA 3X2QE 4W8KA 3CVUA 4YVOA 1D1CA 3K33A 5CBOA 5JHBA 4OAUC 2WL8A 5LCWC 4DOZA 3UKUG 3KSQA 2QY9A 4CSAC 1S70B 3T4RA 4L7TA 1VTMP 3APFA 3CQGB 2ETSA 2H6FA 3PE3A 2VTBB 3CSFA 2GRMA 4XPWA 2VSYA 4G8LA 3PCVA 3RU0A 2XLOA 1CGNA 4EPZA 4J8FA 4YDEA 4N5CA 4RVBA 3KMIA 3FTUA 4GZ5A 3LUTB 2VGYA 2EPOA 4L6RA 2XL8A 5BQIA 1YZAA 3CIAA 3NKDA 1UG7A 3ZDLA 4WNFA 2F37A 4HOQA 1QZ2A 1SVXA 3HXEA 4OVVA 4GTOA 3C8GD 3FU6A 1RJ9A 4RG6A 2H7OA 5BV0A 3MCXA 4Y6CA 3J5PA 2O9XA 2IM8A 2IOSA 1LTXA 3FTWA 2WXGA 4F6RD 2HYZA 5J08A 4N5QA 5FZQA 1H6OA 3R7CA 4APFA 3NB2A 1HE8A 3KYIA 4HQDA 5FT9A 1I5NA 5FZTA 1IHBA 3EHNA 3GZSA 3CQCB 4U5DE 4JD2G 5T4YA 3MV2B 2P0NA 1VYKA 3ZUVB 3DMDA 3ZQYA 1SMYF 1MNEA 2Y3BA 3GORA 4JTCB 1A0BA 2J0WA 2P9PG 1E85A 4JL0A 2Y69E 4E7SA 3IPMO 1NBBA 3FMSA 1N95A 1GGQA 3I4UA 2PZIA 3CLJA 3TWXA 4C9BB 1G5ZA 4U5CE 4O6NA 3ASGA 2ICWG 4LNUD 2VASA 3U3BA 4ZLDA 5CMWA 3LYAA 4JHJA 3C18A 1ZHXA 3RFYA 3LVQE 3CVWA 2C0LA 4G0HA 2J9VA 2VJ8A 3IHUA 4CGWA 1W2WA 1E2XA 4WGZA 2XQ0A 1H6PA 2PNNA 4E6HA 2H6HA 3O6XA 4MVRA 3S27A 2EIME 3PVLA 3LS8A 1OWLA 4U0SA 1EA8A 2XCCA 4NIKA 3TG5A 2CDQA 5D0OD 3IQ5A 5A23A 4KI2A 4BFRA 4JHKA 3NG1A 2V5FA 4ILIA 3LJNA 3Q7AA 2LP4A 5KJKA 3WG7E 2KK1A 4DRIB 4ILHB 3ZW3A 3B13A 4AJWA 4ER9A 5D0QD 1J8MF 3L8IA 1N11A 2EQXA 1O3UA 4I17A 3BEHA 3D3MA 4UDVA 1FVFA 2Q00A 3TD7A 3EU5A 5A7DB 4O6FA 1TWAA 2OOCA 1RKEA 2V8SE 4GYYA 4YL3A 5HS0A 3MLGA 2FF4A 2Y3HA 4O60A 5ITZF 3G2VA 5CRUA 3SQVA 5E3CA 4UUCA 1E86A 4XE0A 5G04C 5FWQA 5C1DA 3IBEA 2WXMA 1BR4A 2OEVA 1KNYA 1HS6A 5FZSA 5KYNA 3B71A 4HI8A 3QW1A 2I1KA 1HH8A 2LSUA 3D9LA 1BBHA 2YKZA 4N3CA 3ZGQA 2AW6A 1I4ZA 1YA7O 3DXKG 3QMKA 3JYSA 3LY7A 5E33A 2VCBA 3IQ6A 3TJPA 3FDQA 1VLTA 5EN5D 4EIYA 3GM1A 3MYVA 3MA5A 2H8AA 5BUOA 3B9QA 2EILE 4KT6B 3TXNA 4EHMA 3C3QA 4ULWA 2R7XA 3OXLA 4G78A 2VB6A 4U7EB 1N4SA 1LVKA 4CS8C 2AWIA 4J8YA 4CRWA 4U5FE 3C8ZA 3L1MA 2R7TA 3GANA 4BEPA 5T1DB 1K3ZD 1D0YA 1L5JA 1JCRA 1SA4A 1ZHTA 1XWJA 3A9CA 3X2QC 3ESLA 3ULYA 4R7LA 2FULA 4YNDA 4GPKA 2L6FA 3AOUA 2XZTG 4GYWA 4AL0A 4TUUA 1ORJA 1WN0A 1U6HA 2W45A 4OIOF 2WXRA 5JT4A 3HLZA 2DZOA 1C03A 5EYLA 3GEEA 4I1MA 2I2OA 3FU5A 1D9SA 2EIJC 3BU8A 4DX5D 2YVKA 3DI5A 4A2NB 3EIJA 1JPNA 3KEZA 3ISMC 3M79A 3SXZA 1SA5A 2XGOA 3NDBB 2R25A 2IJGX 4R32A 2KSFA 4CDYA 2PM6A 2WMOA 4KBLA 1KLXA 2B0OE 4I9EA 2LNIA 1BLXB 2ETBA 3SEOA 3LJ3A 3NMIA 1HMOA 4WWNA 3EHMA 1IQRA 1LD8A 2OU6A 3O39A 2Q3TA 2YL3A 4AXHA 1OCRC 2J08A 3HXDA 3QWWA 3QAQA 4BWRA 3PEVB 3G50A 2J09A 3EG9B 4KC9A 2J46A 4U95D 3R9MA 1IW7F 5EDSA 3US6A 3PEUB 1YLMA 3ZQVA 4G1TA 3CVQA 1LKXA 4JE9A 3TK0A 2LK4A 4G11A 4BESA 2J07A 5BXUA 3X1OA 3EQLF 4OIPF 4GA2A 1KTMA 4MLPA 4BPMA 4IARA 4FP7A 1WG0A 1BR2A 3S2AA 3UT4A 1R5ID 3CGHA 3K1IA 2A69F 1U0BB 1HW1A 4GMJA 3OEOA 4CS9C 3Q47B 2NSFA 5KYXA 2IXMA 5CIVA 3DXJF 4I6GA 4TV3A 2AWCA 3HIZA 3ECSA 1BPOA 5AQBA 1NU7D 3W2WA 2OCCC 2A5EA 3M1CB 2IU1A 1Y4CA 2XLEA 3EH1A 3LKUA 3S29A 3TQOA 4NTAA 4DI4A 2LXLA 4XPXA 1QSPA 3FAPB 3ZEFA 1H6GA 2J4DA 3I4RB 4HXIA 1ZW2A 3HTKC 5BNWA 1K1BA 5A6JA 4HBDA 2XLHA 3UTMA 2H7BA 1Y8MA 4ACKA 1OW6A 2CNWA 2BKGA 3FUMA 3SNXA 3DRAA 3T8KA 5E3AA 3JRTA 1DC2A 5G2NA 2CNWD 4JJFA 256BA 2RFMA 1OXKA 1HG5A 3JSZA 3LY9A 5ENTD 3ZKJA 4PJJA 2MYOA 4O1PA 1QPUA 3LJBA 3QZCA 3GWLA 1TN7A 2L6HA 4P6IC 3FULA 4JTAB 3HVEA 4XX5A 4DX1A 1CPRA 4MVQA 5L3QA 1A17A 1IYGA 4FJYA 5B1BE 3V5YA 1H2UA 1YYJA 4JHRA 1CGOA 1V74B 3TULA 1A41A 1ZU2A 3SI5A 4Q69A 3UKRG 1KT1A 4BG0A 1GQAA 5AQ7A 4DX6D 4DPRA 2KXPC 2FGYA 3FOOA 1YYHA 1FCHA 5AARA 2F22A 4RDAA 1OR2A 3TG4A 3U5SA 3UMHA 4I2ZA 4DLQA 1Q2ZA 1E96B 2ONDA 1TWCA 3O55A 3V79K 3P1UA 1MMAA 3UT7A 5LFAA 3PNLB 4XPYA 2X6HA 1Q0FA 2NSZA 3U9WA 2BE5F 1SZAA 3K1IC 3TL5A 3ZIBA 3RF3A 4ZLCA 3D9OA 1HU3A 3LS1A 4LCTA 3DKAA 3DJUB 1VLSA 4XQ1A 1QZXA 2ZU6B 4KNVA 1TFKB 3CK7A 3ZXPA 2QNLA 4D4NA 3UX4A 1EI7A 5JS5A 2X51A 2PL2A 3MV3B 3S90A 3M4CA 3I4GA 4A3TA 3W4YA 3RYLA 3TXMA 2PBEA 3ZFWA 2W4MA 4MW3A 3ASDA 5F5HA 2QZAA 5JJ7A 2JPUA 4WUYA 2EILC 1O1RA 4WNEA 3IXEA 4PS3A 3U8PA 2C04A 2AXVA 4JB8P 4L1BA 3MEKA 3B0VC 2XEEA 5JJ6A 4B89A 4U8VD 3ZYQA 4FHJA 1HW2A 1VOMA 2I1JA 1PD1A 5D91A 2W4BA 1PV3A 3FVYA 4J8EA 2DCPA 2IFUA 5AJLA 2X3MA 1U3CA 3Q73A 2M4EA 3TOLA 1T5OA 1FT2A 5KYXB 3SXYA 3U66A 3BG0B 4RQIA 2P9NG 1HG2A 2D4UA 3AQCA 4GEHA 5ENQD 3AG1E 4WABA 4M63A 2A0UA 2B0JA 4A3VA 3PZDA 4XEIG 3DAFA 3GM3A 3L54A 1JWFA 1MMDA 4AE4A 4XEVA 3KKBA 2NUTA 4C3DA 2CHZA 1HX8A 2KW3C
chains in the Genus database with same CATH topology
2CG3A 5LX8A 2GGFA 2A6HF 5AIJA 2I8BA 3CKCA 4AV7A 4G7OF 3NZSA 1ZYRF 4BJ6A 3NQPA 3ZC4A 4Y6WA 4C3BA 4YT5A 2VGXB 5L3VA 2VSOE 3Q7LA 5DQZA 2WVNA 3SP1A 2EINC 3HVEB 4CSAA 3JT1A 3QB2A 3QNKA 2OOEA 1JPJA 3ZG1A 4DVZA 1TJCA 1O87A 2NXPA 4JXTA 5G05C 4FHKA 4BJTA 2X6FA 4XTKA 2PQRA 3K66A 4HS2A 3JQ1A 3DAGA 1E8WA 1OWMA 1OWPA 1NG1A 1IQUA 3LEWA 3AS5A 4B0ZA 1EYHA 2I9CA 3KS2A 2IQCA 5BT1A 3L16A 4NACA 4ANJA 2PP4A 3ZPJA 5LCWJ 1S0PA 3AG3C 4H7XA 2D5RB 4HE8D 4O6YA 3FHEA 3PNTB 1Z6AA 4EBAA 3Q49B 2L0IA 4YVQC 1HZ4A 3LY8A 3O4ZA 3L6AA 4F1SA 3D9KA 1TR2A 4CEMA 4XI0A 1UN9A 3NZUA 5KYUB 5ANLA 3HYMB 3UPVA 4PS7A 4IWBA 3ABLC 4Q4ZF 3EDTB 2Q9BA 5DS6A 1E8XA 5F5FA 1Y6IA 4KVMA 3I5QA 3DPDA 3ABMC 4UWGA 3F47A 2VSNA 1TEZA 4XWJA 1JUQA 3ZYMA 2EIKC 4QI0A 4J8SA 1DNPA 2FFHA 4UWLA 5LOZA 2I6HA 4DBQA 4EWCA 3FUDA 4N06A 3NYLA 1UN8A 5B3SC 3IV0A 3CHSA 3QKYA 3UT8A 2HV7A 3N24A 4UWFA 3CZ6A 4FLHA 1VYIA 1HX8A 2XEVA 4JVSA 2NC9A 4XI9A 4OINF 5M72A 2LSEA 2UY1A 3EFOB 2P7VA 4N2SA 2ZPAA 3DM9B 3Q4AB 3FWVA 3CHOA 4HFKB 3MKQA 4YT2A 2IONA 2DGJA 3RRMB 2G3KA 2BTDA 4A55A 1S7ZA 4C7OA 3VAYA 3N0TA 2VQ2A 3NF1A 5HQ8A 2VH3A 2M63A 3S28A 1M57C 3ZSUA 2R7UA 3WXXA 4I3MA 2IOQA 3AG1C 3E4BA 1MNDA 4UQZA 3QDNA 4BT9A 1HF8A 3S7BA 2Q9AA 4C0MA 4CS8A 3ZHEA 4V3IA 2J7PA 4G25A 5G04J 2WB2A 3CHMA 5FQ4A 3UGPA 2J7PD 3PS6A 3VTYA 3CR3A 3FTZA 3D9MA 2P58C 4IJJA 4N3AA 2L9JA 4FU3A 3FUHA 5FQ8A 1H19A 2PQNA 4O6MA 2KM4A 3UMIA 3PHF2 3QWPA 3SHFA 4YT4A 3SZRA 3I3NA 4B6IA 4AOFA 3RIPA 4LRZA 3ULQA 4JCHA 2A1DD 3SNHA 4E7ZA 4DK5A 4OD5A 2WXLA 3MX3A 3URZA 3AQBA 4AK9A 4C0EA 3U4TA 2MOWA 1RJ9B 1P5QA 2Y3GA 4FWVA 4AM9A 4YWQA 1TKNA 2OV8A 3RH3A 5T3WA 4ME2A 5DIZA 5T8IA 2WZFA 3Q6NA 3OWTA 1SZ9A 4OIQF 1U3DA 3FU0A 3D9IA 3MKQB 2XHEA 4UWHA 2MYSA 2XPIA 3LXUX 1HFAA 2KGOA 2GW1A 5BPPA 4WAFA 2WB7A 4CS9A 4C7OB 2XRZA 2CG2A 2WXPA 4KYOB 1HXIA 4HOTA 4IYPA 2R7WA 3NRHA 3KH2A 1Z63A 5BW8C 2R7RA 4LACB 4BSXA 2GFHA 4RD9A 2Y3AA 1X5BA 4G23A 4CDMA 5DQTA 3ASOC 3EGXA 4ANXA 3PREA 3D9JA 4HORA 3ZHEB 4EECA 3S7DA 3IHVA 3FAJA 2FBNA 3LLIA 4AIFA 3IKOB 1OWOA 1NA3A 2A5UA 2WQ6A 4ABNA 4G26A 2KZTA 4L2LA 2QTVA 4QFVA 5JJTA 2XXAA 4NQ0A 1NP7A 3CHQA 5G55A 3VYWA 4EZKA 4GA0A 1KT0A 1PC2A 2YNQA 1NZEA 5ARGA 2Z15A 4RG9A 3ML8A 3SD5A 2J9QA 1H6KA 4J0UA 1VMAA 3KAEA 5BV1A 4C3EA 2V26A 4DI3A 3CVXA 3RO2A 2PX0A 1Z3YA 3B7SA 3SBTB 1IHGA 1ZHYA 2Y69C 1FFTC 2IYLD 3MZLB 4JJGA 3ZVVA 4EQFA 4AX2A 4F7AA 3FUIA 3KD7A 4B94A 3L08A 3FP3A 2GRLA 3S7FA 4CIHA 3RIBA 1NU9C 5EHHA 3ASFA 1ZU4A 3FUEA 3PUJA 3U64A 3FTXA 2EIMC 4DBRA 4N3BA 4OYSA 1MQSA 2XGMA 2NUPA 4Q96A 4U8HA 3ONLA 3K1HA 4X0RA 1N54A 4ILGA 3CSTA 4GAAA 1M56C 4GA1A 3QK0A 3WG7C 4HOSA 3T5XA 1SQMA 4KMOA 1ZHWA 4I6EA 3OA1A 4FULA 3LESA 1Z6TA 4HOUA 3CHPA 2E2EA 3CHRA 4IRUA 4EZLA 4JEUA 3EGXB 3Q5MA 3MGBA 3FUNA 4JA7A 4GZDA 4U04A 3O48A 4KZ0A 4B8AA 2R7OA 4XKCA 1QQEA 5EKQD 2WXQA 4TRQA 3RK6A 2XXAB 1FFHA 5FJYA 3CK8A 2WQHA 4FADA 1J8YF 4UI9J 2ILRA 4L2YA 3RJVA 3QOUA 1ZHZA 5LP0A 5EX3A 2Y39A 3GW4A 2XPZA 4KBQA 3LEVA 4GZCA 4PJNA 5T3RA 3PE4A 1SZIA 5HSWA 2IXOA 3UMKA 2OVFA 3LVRE 4JPSA 4I43A 3QWVA 3W8IA 2KJGA 3G2UA 2J45A 3PH0C 4JZAA 4FJZA 3JCUQ 4OD4A 4CGVA 3BG1B 5ANRA 5EX0A 1E7UA 3BEEA 2Y3DA 3JQ0A 5G05J 3AU4A 4KXKB 2HV6A 5KYWA 2L0TB 2NUPB 3C98A 4AY5A 2YHEA 4U0ZA 2WVQA 5CCMA 3B0PA 3CKBA 4G7ZF 3ENEA 2VTBA 3TAXA 3ZXSA 1NA0A 3N2ZB 4O79A 1TWHA 4WWOA 4H7YA 5KCMA 3FU3A 3H65A 1Z23A 2LAIA 1ELRA 1OUVA 2L9BA 1MMGA 3E70C 2R7VA 2Q9CA 4J30B 4JW1A 4CBEA 3FEXA 3IEGA 1IZMA 4CDNA 2J9UA 1SF8A 3OAWA 2YZSA 4HFFB 3FH8A 1E7VA 4HEAJ 3RKVA 3W2VA 3CSKA 3P2BA 5CI9A 2IXNA 3LPZA 1G8XA 3S7JA 2UWJG 2IF4A 4OIRF 4PK4A 1H2TC 3L17A 5T3TA 2WVOA 2A68F 4AEZC 1PAQA 3T5VA 5EGYA 2YINA 4NRHB 2C03A 3TGOA 3JYHA 5FCLA 3SFZA 4EBBA 1UG3A 3FTSA 5BUZA 4IN3B 4CCAA 4I1AA 5B1BC 5DLJA 3B7RL 1OCZC 4K0DA 4AE4B 2NUTB 3QJZA 3ASNC 2WVIA 3FTYA 4BJ5A 1MMNA 4ANUA 1Z3IX 3CVVA 5KYWB 3U3WA 4DLOA 3NKEA 5J90A 2J4BA 2IOLA 2JLBA 4Q94A 2MRIA 2X6IA 1FVHA 4JA9A 4N39A 3ZN3A 2XRHA 4GZ3A 4XZ4A 1WM5A 3UUXA 1FMWA 2X38A 2IXPA 4RSYA 4MKTA 1D0XA 3AG2C 4UQYA 3IHYA 3DM5A 4KVOA 3FH5A 2ZXOA 4BTBA 3ZVRA 2QY7A 4NURA 3IEEA 4G2VA 4F4BA 3DBSA 2WZLA 2BUGA 5DBKA 4FA6A 2VYIA 5KYYA 2XRYA 4PFOA 3LAYA 5AENA 3FHDA 4ANWA 4AP2A 3LCAA 4K0RA 4FX5A 4GCOA 4WWPA 3LDZA 3PDNA 1W3BA 1D0ZA 1OWNA 4CDRA 2WMNA 3B0UX 5ARFA 3DJNB 4G7HF 5ENNA 2WPVA 5CCLA 4UQXA 2H7VC 2PM7A 4I44A 5D92A 4FESA 4BJ5C 2ZXRA 4U5HA 3ZRHA 3SYNA 2Q7FA 2WXOA 5IY5C 4QI2A 1V54C 3G2SA 3FUKA 4I6JA 4JZYA 4U5BE 2AXUA 4XKBA 2YQ8A 5HI7A 4WJ0A 4CT4A 1FMVA 4N2QA 4B8CB 4NY3A 2WZGA 2YHSA 1E90A 1E8YA 3VLFA 5E76A 3ABKC 2VSXE 2KCLA 2FO7A 3HHMA 1WAO1 3K7DA 2KNHA 5CHEE 2X6KA 3EG9A 3CVNA 3GZ2A 1UW4B 4U0UA 3VTXA 3EGDA 4XIFA 2A4ZA 3OXFA 4MRUA 2E0IA 1V55C 3ONKA 2JD3A 3OXGA 2J9WA 3G2WA 1PCXA 1D1AA 1M2VA 2V0PA 3ZIMA 2ZXPA 4A1SA 3D9PA 3ITFA 4LLCA 2UY1B 5FZRA 4K7BA 3FFLA 3LNRA 4GYOA 4CS7A 4I1OB 3CVPA 1UJJA 4DJAA 5CMYA 3RKOF 1QLEC 2W9YA 4GZ6A 1TJFA 4FC8A 2CGEA 2DIWA 1LF8A 4G24A 3UQ3A 3CVLA 3R9AB 5DS4A 1H2VC 3GYZA 2DYRC 5KYYB 4KZCA 3FTVA 4MS6A 3EIQC 3R7QA 3EPVA 2Y4UA 3L22A 4BX8A 3JUIA 1WGWA 3SBSA 5AYWD 4UWKA 4BY6A 4I2WA 3L34A 3R7RA 4EZJA 2OG2A 2DYSC 3UR3C 3GODA 4U63A 5FTPA 1M2OA 3CVYA 2OVBA 3T6JA 4LUNU 4BT8A 3UNGC 2HM8A 3Q7GA 2CHXA 4LEUA 2V3CC 2J49A 4F53A 3MKRA 3ASHA 3AG4C 4OVUA 1PY1A 3ZYKA 4QDLA 4O7GA 5KJNA 5DS5A 3JCKC 2XGSA 2CFZA 1VK5A 2WXNA 4Q7CA 4MQ9F 1UJKA 1MHQA 2Y4TA 1KU2A 2AVPA 3ML9A 3LS0A 3UGOA 4GCNA 1JPLA 3D9NA 3EGDB 3FUFA 4ANVA 2WXFA 4PJLA 1OKKA 4JC8A 5JHAA 1LS1A 2E87A 5DVWA 4FLBA 2R59A 2WQ7A 4JURI 1OKKD 4WNDA 1B89A 2XPYA 2JEKA 1M2VB 3Q15A 2R7SA 1E8ZA 3V7OA 4HVBA 4HLEA 1XGWA 4PS8A 4APOA 5KJMA 3I5PA 4L23A 4K03A 2C2LA 1ELWA 3ZYLA 3EJNA 3FDHA 4PH4B 2L6JA 4E85A 4EBAG 3L13A 3SF4A 1YA0A 5FQ6A 1XNFA 2X6JA 3QC1A 4GMLA 3PMRA 2KC7A 2LSVA 4J6IA 4IAOA 4DVYP 4Q5SF 4BEJA 3PUKA 1EDUA 5C2YA 4PJMA 5CI8A 3QARA 3GZ1A 2XL4A 4ATGA 2CHWA 2PFDA 2VGXA 4UI9K 4BTAA 4MNDA 1D1BA 2R17C 4IULA 4PUCA 4RBNA 4XLPF 1QNFA 4W9RA 1GW6A 3FEYA 4M3OA 3HDXA 4GU5A 2PF4E 2FEZA 2KZTB 1PD0A 4LERA 1FTSA 4F3VA 3L0IA 4J32B 3RO3A 2L81A 2KATA 1EF1C 3RRUA 3PRZA 4BX9A 2MHKA 2BF0X 3VLDA 3B7TA 3K6BA 1EPUA 3AS4A 5B1AC 3RRNB 1O5HA 4GB9A 3VLEA 1ZBPA 3FH7A 4CT0A 1INZA 1BR1A 2FI7A 2WXHA 2WM9A 3T6BA 3OTNA 1ST6A 2YHCA 2YEVA 4YT8A 3MJWA 3Q6MA 2G62A 1HO8A 3LLKA 3K9IA 2KCVA 2MWQA 3SZ7A 3AU5A 3HJCA 2KQ9A 2WXIA 2WXKA 3APCA 2QFCA 2NG1A 2V4LA 4J8DA 4LLEA 5AJDA 2CW0F 4BJ1A 2RG8A 5KYUA 2R7QA 5E2QA 2R5SA 2XCBA 1NZNA 4PFPA 2CFUA 3UMVA 1ZU5A 2RD0A 3W8HA 2HR2A 2LO6A 2PX3A 3FY4A 2DBAA 3N71A 3FUJA 4URKA 3EZIA 4UI9C 4GYTA 5E75A 4A1GA 4YN0B 1Z3XA 4AY6A 3F46A 1N52A 3ESKA 4I9CA 4ACLA 4D10C 1ELKA 1H0AA 2XSEA 4U5GA 5FQ7A 4WNGA 4P29A 3EZHA 1OCOC 2KCKA 3CV0A 1OCCC 4YJWA 1WY6A 3WODF 3CK9A 3E9VA 3POVA 2HO1A 3EFOA 5A6CA 4AVXA 2A6EF 3CQZA 1N1CA 2P6VA 2ZXWC 3B7UX 4KNWA 4U5EE 2C0MA 4HFGA 2AXZA 4JEHA 3G2TA 3S0XA 4U07A 3CEQA 3EH2A 1Z5ZA 3NYJA 3SGHA 2J0XA 1TWGA 3DZAA 2WXJA 1JWGA 3DD7A 1VDYA 4XLNF 3KL4A 3NYMA 2LAHA 3APDA 5KJLA 2G3VA 3T8MA 4BJ6C 3AS8A 4PDXA 4H4KC 1DVPA 4W8KA 3CVUA 4YVOA 1D1CA 3K33A 5JHBA 2WL8A 5LCWC 4DOZA 2QY9A 4CSAC 3T4RA 4L7TA 3APFA 3CQGB 3PE3A 2VTBB 3CSFA 2GRMA 2VSYA 3RU0A 4EPZA 4J8FA 4N5CA 4RVBA 3KMIA 3FTUA 4GZ5A 2VGYA 3CIAA 3NKDA 4WNFA 4HOQA 1QZ2A 4OVVA 3FU6A 1RJ9A 4RG6A 2H7OA 5BV0A 3MCXA 4Y6CA 2O9XA 2IOSA 3FTWA 2WXGA 2HYZA 5J08A 5FZQA 4APFA 1HE8A 5FT9A 3EHNA 3GZSA 3CQCB 4U5DE 5T4YA 3MV2B 1VYKA 3DMDA 1SMYF 1MNEA 2Y3BA 2J0WA 4JL0A 4E7SA 4C9BB 3I4UA 2PZIA 3CLJA 4U5CE 4O6NA 3ASGA 2VASA 4ZLDA 5CMWA 3LYAA 4JHJA 1ZHXA 3RFYA 3LVQE 3CVWA 2C0LA 4G0HA 2J9VA 2VJ8A 4CGWA 1W2WA 2XQ0A 4E6HA 3O6XA 3S27A 3PVLA 3LS8A 1OWLA 4U0SA 2XCCA 3TG5A 2CDQA 5D0OD 5A23A 4KI2A 4BFRA 4JHKA 3NG1A 2V5FA 4ILIA 5KJKA 4ILHB 3ZW3A 3B13A 4AJWA 5D0QD 1J8MF 2EQXA 4I17A 3D3MA 1FVFA 3TD7A 5A7DB 4O6FA 1TWAA 2V8SE 4GYYA 3MLGA 2FF4A 2Y3HA 3G2VA 5E3CA 4XE0A 5G04C 5FWQA 5C1DA 3IBEA 2WXMA 1BR4A 1HS6A 5FZSA 5KYNA 2I1KA 1HH8A 2LSUA 3D9LA 4N3CA 3ZGQA 2AW6A 3QMKA 3JYSA 3LY7A 5E33A 3TJPA 3FDQA 3MYVA 3MA5A 5BUOA 3B9QA 4KT6B 3TXNA 4ULWA 2R7XA 3OXLA 2VB6A 1LVKA 4CS8C 2AWIA 4CRWA 4U5FE 2R7TA 3GANA 5T1DB 1D0YA 1L5JA 1ZHTA 3X2QC 3ESLA 4R7LA 2FULA 4YNDA 4GPKA 4GYWA 4TUUA 2W45A 4OIOF 2WXRA 3HLZA 4I1MA 2I2OA 3FU5A 2EIJC 3EIJA 4A2NB 1JPNA 3KEZA 2XGOA 3NDBB 2IJGX 2PM6A 2WMOA 4KBLA 1KLXA 4I9EA 2LNIA 3SEOA 3LJ3A 4WWNA 3EHMA 1IQRA 3O39A 2Q3TA 4AXHA 1OCRC 2J08A 3QWWA 3QAQA 4BWRA 3PEVB 2J09A 3EG9B 4KC9A 2J46A 1IW7F 5EDSA 3PEUB 4G1TA 3CVQA 1LKXA 4G11A 2J07A 3X1OA 3EQLF 4OIPF 4MLPA 4FP7A 1BR2A 3S2AA 3UT4A 3CGHA 2A69F 4GMJA 3OEOA 4CS9C 3Q47B 5KYXA 2IXMA 3DXJF 4I6GA 4TV3A 3HIZA 3ECSA 1BPOA 1NU7D 3W2WA 2OCCC 3M1CB 2IU1A 3EH1A 3LKUA 3S29A 4DI4A 3ZEFA 2J4DA 3I4RB 4HXIA 3HTKC 5BNWA 2H7BA 1Y8MA 4ACKA 2CNWA 3FUMA 3SNXA 5E3AA 3JRTA 5G2NA 2CNWD 4JJFA 1HG5A 3JSZA 3LY9A 4PJJA 3LJBA 3QZCA 4P6IC 3FULA 3HVEA 4XX5A 5L3QA 1A17A 1IYGA 4FJYA 1H2UA 4JHRA 3SI5A 4Q69A 1ZU2A 1KT1A 4BG0A 4DPRA 2FGYA 1FCHA 4RDAA 3TG4A 3UMHA 4I2ZA 4DLQA 2ONDA 1E96B 1TWCA 3P1UA 1MMAA 3UT7A 5LFAA 3PNLB 2X6HA 2NSZA 3U9WA 2BE5F 1SZAA 3K1IC 3TL5A 3ZIBA 3D9OA 4ZLCA 1HU3A 3LS1A 4LCTA 3DJUB 2ZU6B 1QZXA 4KNVA 3CK7A 3UX4A 2X51A 2PL2A 3MV3B 3I4GA 4A3TA 3RYLA 3TXMA 3ZFWA 2W4MA 3ASDA 5F5HA 5JJ7A 4WUYA 2EILC 4WNEA 4PS3A 2C04A 2AXVA 4L1BA 3MEKA 3B0VC 5JJ6A 4B89A 3ZYQA 4FHJA 1VOMA 2I1JA 1PD1A 5D91A 2W4BA 3FVYA 4J8EA 2DCPA 2IFUA 5AJLA 2X3MA 1U3CA 2M4EA 5KYXB 3U66A 3BG0B 1HG2A 3AQCA 4GEHA 4M63A 2B0JA 4A3VA 3PZDA 3DAFA 3L54A 1MMDA 1JWFA 4AE4A 2NUTA 3KKBA 4C3DA 2CHZA 4GA2A 2KW3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MCX A;  5LX8 A;  3I4G A;  3KEZ A;  4PUC A;  3OTN A;  4F53 A;  3JQ0 A;  3MYV A;  3CGH A;  3QNK A;  5T3R A;  3CKC A;  3CK8 A;  3IV0 A;  3P1U A;  3L22 A;  5FQ7 A;  3LEW A;  3EJN A;  4MRU A;  3MX3 A;  3FDH A;  3NQP A;  5FQ8 A;  4L7T A;  3SNX A;  5J90 A;  3EHN A;  4Q69 A;  3HDX A;  3GZS A;  3CKB A;  3EHM A;  5FQ4 A;  3JQ1 A;  3JYS A;  5E76 A;  3CK9 A;  3CK7 A;  4LER A;  5T4Y A;  4F7A A;  5E75 A;  5FQ6 A;  3SGH A; 
#chains in the Genus database with same CATH topology
 2CG3 A;  3PZ2 A;  1S63 A;  2GGF A;  5LX8 A;  3U3F A;  1YAU O;  2A6H F;  5AIJ A;  3HXF A;  2I8B A;  3CKC A;  3C5R A;  4AV7 A;  4G7O F;  3NZS A;  1ZYR F;  4BJ6 A;  3NQP A;  5D66 A;  1HMD A;  1Q0K A;  3Q9N C;  1R4T A;  3ZC4 A;  4Y6W A;  4C3B A;  1V54 E;  4YT5 A;  4ATZ D;  2VGX B;  5L3V A;  2VSO E;  3Q7L A;  5DQZ A;  2WVN A;  3SP1 A;  2EIN C;  3HVE B;  4CSA A;  3JT1 A;  3QB2 A;  3ULE G;  3QNK A;  2OOE A;  1JPJ A;  3NOG D;  3PZ1 A;  3ZG1 A;  4DVZ A;  1TJC A;  1O87 A;  2NXP A;  4JXT A;  3T9O A;  3E37 A;  5G05 C;  4FHK A;  2ETA A;  4BJT A;  4Z68 A;  4A4A A;  2X6F A;  4XTK A;  2PQR A;  3K66 A;  4HS2 A;  1TNU A;  3ABK E;  3U9J A;  3JQ1 A;  2M64 A;  3DAG A;  5COG A;  1E8W A;  1OWM A;  3M15 A;  1OWP A;  1WWP A;  1XZP A;  3UM0 A;  3ZU7 B;  2OEW A;  1NG1 A;  3E34 A;  4YK5 A;  3Q78 A;  3R2P A;  1IQU A;  2Y1L E;  4YDW A;  3LEW A;  3AS5 A;  2YL7 A;  4B0Z A;  1V55 E;  1QQ3 A;  5JUA A;  1S05 A;  1EYH A;  4MVZ A;  2QLA A;  3HXB A;  2I9C A;  3KS2 A;  2IQC A;  4TXQ A;  3GEH A;  5BT1 A;  2PNO A;  1S64 A;  3L16 A;  2EPM X;  4NAC A;  3AJM A;  4ANJ A;  2PP4 A;  3Q7F A;  1Z5S C;  5EK0 A;  1F1M A;  2XL6 A;  3ZPJ A;  5LCW J;  3FOP A;  3WAQ A;  1S0P A;  4LDR A;  3AG3 C;  1EQ1 A;  2D5R B;  4HE8 D;  2QYU A;  4BEM J;  4H7X A;  4O6Y A;  3FHE A;  3PNT B;  1Z6A A;  4EBA A;  3Q49 B;  3NMK A;  3GM2 A;  2L0I A;  4YVQ C;  1HZ4 A;  3LY8 A;  4GPM A;  3O4Z A;  3L6A A;  4F1S A;  3D9K A;  1TR2 A;  4CEM A;  4XI0 A;  3UM2 A;  1UN9 A;  1BZ4 A;  2EPK X;  4MVO A;  4IB4 A;  5FIO A;  1BD8 A;  2DYR E;  3NZU A;  3HG0 D;  5KYU B;  3D9H A;  5ANL A;  3HYM B;  3UPV A;  4PS7 A;  3AGT A;  4IWB A;  1ZVZ A;  3ABL C;  4Q4Z F;  1TNY A;  3EDT B;  4LDQ A;  3JXI A;  1AWC B;  2Q9B A;  5JA4 D;  5DS6 A;  1E8X A;  3PZ4 A;  5F5F A;  1B68 A;  1Y6I A;  4KVM A;  3I5Q A;  2GA0 A;  3DPD A;  4HNA D;  2LXM A;  3ABM C;  1C02 A;  4UWG A;  3ASO E;  3F47 A;  2VSN A;  1TEZ A;  3TWQ A;  4XWJ A;  1JUQ A;  5A69 A;  3V31 A;  3ZYM A;  2EIK C;  4QI0 A;  4J8S A;  1DNP A;  2DYS E;  3RQF A;  1VB5 A;  2FFH A;  4UWL A;  4Z9J A;  5EYP F;  5LOZ A;  2I6H A;  4DBQ A;  4EWC A;  3RSE G;  3FUD A;  4N06 A;  4HB5 A;  3NYL A;  1UN8 A;  5B3S C;  3IV0 A;  3CHS A;  1LIH A;  2DVW A;  3QKY A;  3UT8 A;  2HV7 A;  3N24 A;  4UWF A;  2XS8 A;  3C8G A;  3CZ6 A;  4FLH A;  1VYI A;  5ENS D;  1H7I A;  4JVS A;  3V5X A;  2XEV A;  2NC9 A;  1UFB A;  4XI9 A;  4OIN F;  5M72 A;  1YJG A;  2LSE A;  4IGG A;  4PAC A;  2UY1 A;  3EFO B;  2P7V A;  3AG4 E;  4N2S A;  4FAP B;  2ZPA A;  3DM9 B;  3Q4A B;  3FWV A;  3CHO A;  2L6B A;  3C3R A;  2BC5 A;  4HFK B;  4NCQ A;  4YT2 A;  2ION A;  3MKQ A;  1WTY A;  1MZC A;  3UIO C;  2DGJ A;  2AWY A;  3RRM B;  2G3K A;  2BTD A;  5AQ9 A;  2H6I A;  4LG6 A;  4A55 A;  1S7Z A;  4C7O A;  3VAY A;  3N0T A;  2VQ2 A;  3IQC A;  3NF1 A;  5HQ8 A;  2VH3 A;  3HNL A;  2M63 A;  4LNB A;  3S28 A;  1M57 C;  1FR0 A;  3ZSU A;  2R7U A;  3WXX A;  4I3M A;  2IOQ A;  3AG1 C;  3E4B A;  1MND A;  1LE4 A;  3DSV A;  3ZNG A;  1NFN A;  4UQZ A;  3QDN A;  4JRZ A;  4BT9 A;  1HF8 A;  1LM3 B;  3S7B A;  3HNI A;  2Q9A A;  3GWN A;  3SY2 A;  4C0M A;  2RSE B;  4ONS A;  4CS8 A;  1RW2 A;  3ZHE A;  3HNJ A;  4V3I A;  3DWL G;  3U2M A;  5JLI A;  1C17 M;  2J7P A;  4G25 A;  5G04 J;  3UIN C;  4CJG A;  2WB2 A;  2HS5 A;  3CHM A;  5FQ4 A;  3U0C A;  3UGP A;  2LFF A;  2J7P D;  1O1T A;  4Z9H A;  3PS6 A;  1ZZP A;  3E33 A;  3VTY A;  1KZO A;  3CR3 A;  3FTZ A;  1DCQ A;  2Q4F A;  2HSQ A;  2P58 C;  3D9M A;  4O1O A;  1A5E A;  4IJJ A;  3GEI A;  4N3A A;  4BER A;  2L9J A;  4FU3 A;  3FUH A;  2ETC A;  5FQ8 A;  1ZW3 A;  2H6G A;  1H19 A;  2PQN A;  1GS9 A;  4O6M A;  4X8Q A;  2KM4 A;  4B93 B;  3UMI A;  3PHF 2;  3QWP A;  3SHF A;  4YT4 A;  3SZR A;  4K5C A;  4C48 B;  3I3N A;  2R2L A;  4B6I A;  4AOF A;  1WAT A;  3RIP A;  4LRZ A;  3ULQ A;  4JCH A;  2A1D D;  1AP7 A;  2LIG A;  3SNH A;  4J7T A;  2AP3 A;  4E7Z A;  5L0J A;  3DPY A;  4DK5 A;  4OD5 A;  2WXL A;  5CED B;  1YZC A;  3MX3 A;  3C8G B;  3URZ A;  4U96 D;  3AQB A;  1IKN D;  4AK9 A;  4OAV B;  4C0E A;  3U4T A;  5JVE A;  2MOW A;  1RJ9 B;  1P5Q A;  2Y3G A;  4FWV A;  1NL4 A;  4AM9 A;  2KBX A;  4YWQ A;  1TKN A;  2CCY A;  5AAO A;  3G4Z A;  2OV8 A;  1D8E A;  3RH3 A;  5T3W A;  3CEX A;  4ME2 A;  5DIZ A;  5T8I A;  2WZF A;  3Q6N A;  3OWT A;  1SZ9 A;  3V5Z A;  4OIQ F;  1U3D A;  2MHR A;  2NSG A;  4GTT A;  3FU0 A;  1Q0D A;  3D9I A;  3MKQ B;  2XHE A;  2GRR B;  4UWH A;  1G4U S;  4E0H A;  2MYS A;  4ZHB A;  4EBK A;  4D4X A;  2XPI A;  4XEK A;  3LXU X;  3JRM O;  3VF0 A;  1DCE A;  1HFA A;  2KGO A;  1LI7 A;  2GW1 A;  5BPP A;  5L0D A;  4WAF A;  2WB7 A;  4CS9 A;  2YRF A;  4C7O B;  2XRZ A;  1EKY A;  2CG2 A;  2WXP A;  4KYO B;  1HXI A;  4HOT A;  1OT8 A;  4TXP A;  4IYP A;  4MVU A;  2R7W A;  3NRH A;  3KH2 A;  1Z63 A;  5BW8 C;  2R7R A;  4LAC B;  2QYJ A;  4BSX A;  2GFH A;  4RD9 A;  2Y3A A;  5L0F A;  1X5B A;  2JAB A;  4G23 A;  1TNB A;  4CDM A;  5DQT A;  3ASO C;  4RLY A;  3EGX A;  4ANX A;  1ZB1 A;  1OW7 A;  3PRE A;  3D9J A;  4HOR A;  3ZHE B;  4EEC A;  3JYY A;  3S7D A;  3IHV A;  3FAJ A;  2FBN A;  3LLI A;  3AJI A;  3ZWI A;  1CGM E;  4AIF A;  3IKO B;  1OWO A;  1NA3 A;  2A5U A;  2R03 A;  2WQ6 A;  1FT1 A;  4ABN A;  4G26 A;  3DSU A;  2KZT A;  3Q79 A;  5BQH A;  4L2L A;  2QTV A;  1TNZ A;  4QFV A;  5JJT A;  2XXA A;  4NQ0 A;  1NP7 A;  3CHQ A;  5G55 A;  3FXH A;  3VYW A;  4EZK A;  4GA0 A;  1KT0 A;  1PC2 A;  2YNQ A;  1NZE A;  5ARG A;  1D8D A;  2Z15 A;  4RG9 A;  1RKE B;  3ML8 A;  3SD5 A;  1OCO E;  3IQT A;  2B6C A;  1OCC E;  2J9Q A;  5AN8 A;  1AEP A;  1H6K A;  3HXC A;  5TJ5 E;  4MW8 A;  1H9T A;  4J0U A;  1VMA A;  3KAE A;  5BV1 A;  1N0Q A;  4C3E A;  2V26 A;  2VC9 A;  5EIB E;  4U9D A;  4DI3 A;  2P9I G;  3DSX A;  3CVX A;  2V4H C;  3RO2 A;  2PX0 A;  1Z3Y A;  3B7S A;  3C72 A;  4E17 A;  3SBT B;  1IHG A;  1ZHY A;  3RVY A;  2Y69 C;  1FFT C;  2IYL D;  2IO2 C;  2ZXW E;  3MZL B;  1T9K A;  4JJG A;  3ZVV A;  2HJ3 A;  4EQF A;  2UUH A;  2HE0 A;  4AX2 A;  4F7A A;  3FUI A;  3KD7 A;  3J5Q B;  2F0Y A;  4B94 A;  3L08 A;  5JRA A;  3FP3 A;  2GRL A;  3S7F A;  4CIH A;  3RIB A;  1NU9 C;  3QVY A;  2I15 A;  4WGY A;  5EHH A;  3ASF A;  1ZU4 A;  3FUE A;  3PUJ A;  3U64 A;  3FTX A;  2EIM C;  4DBR A;  4N3B A;  4OYS A;  5A6B D;  4BSZ B;  1MQS A;  5B3I A;  2XGM A;  2NUP A;  4Q96 A;  4GTQ A;  3ONL A;  4U8H A;  3K1H A;  4X0R A;  1N9A A;  3AGU A;  3T6G B;  3EHQ A;  1N54 A;  4ILG A;  3CST A;  4GAA A;  1M56 C;  1YMP A;  4GA1 A;  3QK0 A;  3WG7 C;  4HOS A;  1L3P A;  3T5X A;  1SQM A;  1V4A A;  3E30 A;  4KMO A;  2P9K G;  1ZHW A;  4I6E A;  3OA1 A;  4JKV A;  4FUL A;  3M4B A;  3LES A;  1Z6T A;  5AGF A;  5GPG B;  2P1A A;  4HOU A;  3TWT A;  1QYM A;  4EUK B;  3CHP A;  2E2E A;  3CHR A;  1OCZ E;  4YL1 A;  4IRU A;  3SFY A;  4EZL A;  4JEU A;  3DE8 A;  3EGX B;  3Q5M A;  3RQE A;  3MGB A;  2YL0 A;  3ASN E;  4GTV A;  3FUN A;  4JA7 A;  3L8J A;  4GZD A;  2J8W A;  2VCC A;  4U04 A;  3O48 A;  3LNM B;  4KZ0 A;  4B8A A;  5CRV A;  3DSW A;  2R7O A;  4XKC A;  1QQE A;  5EKQ D;  2WXQ A;  2ZGG A;  4K5A B;  5KWD A;  4TRQ A;  3RK6 A;  5BQG A;  2XXA B;  3DE9 A;  1FFH A;  1FAP B;  3NOC D;  4CZ2 D;  4W8P A;  1LS4 A;  3KEA A;  5FJY A;  5L0C A;  3CK8 A;  2XS1 A;  3AG2 E;  2WQH A;  1MJ0 A;  1OY3 D;  5H7P A;  3NAW A;  4FAD A;  1J8Y F;  4UI9 J;  4CYM D;  2ILR A;  4L2Y A;  3RJV A;  3QOU A;  1L7C A;  1ZHZ A;  5KNG A;  2ASR A;  4E0I A;  5LP0 A;  5EX3 A;  2Y39 A;  4N6C A;  2XPZ A;  3GW4 A;  3LEV A;  4GZC A;  4KBQ A;  4PJN A;  5T3R A;  3PE4 A;  1SZI A;  5HSW A;  2IXO A;  3UMK A;  2OVF A;  3LVR E;  1K04 A;  4JPS A;  3S84 A;  2HKV A;  4I43 A;  1A7E A;  4M7C A;  1Q0G A;  2P9U G;  3QWV A;  1XZQ A;  2QUP A;  4CDA A;  3W8I A;  5CBN A;  2KJG A;  3G2U A;  3DEO A;  3EU9 A;  2AU5 A;  2J45 A;  3PH0 C;  4JZA A;  4FJZ A;  3JCU Q;  4OD4 A;  4CGV A;  3BG1 B;  5ANR A;  5EX0 A;  1E7U A;  3DSS A;  3SFX A;  4GQH A;  1A7D A;  3BEE A;  1T6U A;  2Y3D A;  2LCH A;  3JQ0 A;  3QVZ A;  5G05 J;  1BU9 A;  4GTP A;  2NPU A;  3AU4 A;  4KXK B;  4DRH B;  3BRJ A;  4NC3 A;  2HV6 A;  5KYW A;  1JRA A;  2L0T B;  2NUP B;  1LD7 A;  3C98 A;  4AY5 A;  2YHE A;  4U0Z A;  2WVQ A;  1ORS C;  4LSZ E;  5CCM A;  3B0P A;  3CKB A;  1TN6 A;  4G7Z F;  2DB4 A;  3ENE A;  5IY5 E;  1CPQ A;  2VTB A;  3TAX A;  3ZXS A;  1NA0 A;  2LQG A;  3N2Z B;  4EHP A;  5L0I A;  3B95 A;  1OXJ A;  4O79 A;  1TWH A;  4WWO A;  5HKP A;  4H7Y A;  2XM0 A;  2F8Y A;  5KCM A;  3BUA A;  3FU3 A;  1LE2 A;  3H65 A;  1Z23 A;  1Z7Q c;  2LAI A;  1ELR A;  2F8X K;  1OUV A;  2L9B A;  1MMG A;  3E70 C;  2R7V A;  2Q9C A;  4J30 B;  2XLV A;  4F1P A;  4JW1 A;  4CBE A;  1N4P A;  2A0B A;  3FEX A;  3IEG A;  1YA9 A;  1IZM A;  2P9S G;  4CDN A;  2HUJ A;  1JR8 A;  2LD6 A;  2J9U A;  3DEP A;  1SF8 A;  1DOW A;  4L9P A;  3UIP C;  3OAW A;  1MX2 A;  2YZS A;  1GM5 A;  2GAQ A;  2NYJ A;  4HFF B;  3FH8 A;  1E7V A;  4HEA J;  1JCQ A;  3RKV A;  3W2V A;  3CSK A;  2OQM A;  3P2B A;  5CI9 A;  2IXN A;  3J06 A;  3LPZ A;  1G8X A;  3S7J A;  2HMQ A;  2UWJ G;  2IF4 A;  4OIR F;  4PK4 A;  1H2T C;  3L17 A;  1T01 A;  4N4W A;  5T3T A;  3HRA A;  2WVO A;  3VRC A;  1NI1 A;  2A68 F;  3UI2 A;  4AEZ C;  1NSG B;  2ZIS A;  1PAQ A;  3T5V A;  5EGY A;  2YIN A;  4NRH B;  5ENR D;  2C03 A;  3TGO A;  3JYH A;  5FCL A;  3SFZ A;  3QW0 A;  4EBB A;  1UG3 A;  1YCS B;  2DZN A;  3TJ6 A;  4MVM A;  4CIP A;  3FTS A;  1YYX A;  3JZ0 A;  2FO1 E;  1K1A A;  5BUZ A;  5K0I A;  4IN3 B;  4CCA A;  4MVS A;  4I1A A;  4DXW A;  5B1B C;  5DLJ A;  2YLD A;  4P9F A;  3B7R L;  1K8K G;  1OCZ C;  4K0D A;  2IO3 C;  4AE4 B;  2NUT B;  1RZ4 A;  3QJZ A;  5HRY A;  1TYQ G;  3ASN C;  2WVI A;  3FTY A;  4BJ5 A;  1MMN A;  1WDY A;  1Z3I X;  4ANU A;  3CVV A;  2ZIR A;  4U8Y D;  5JP7 A;  5KYW B;  3U3W A;  4DLO A;  3EHR A;  5ENP D;  1RMV A;  3NKE A;  5J90 A;  1AVO B;  2J4B A;  2IOL A;  2JLB A;  4Q94 A;  2MRI A;  2QE9 A;  2EIJ E;  2X6I A;  2Y0B G;  1FVH A;  4JA9 A;  4N39 A;  3F6Q A;  3ZN3 A;  2XRH A;  1YDI A;  4GZ3 A;  4XZ4 A;  3ATP A;  1WM5 A;  3UUX A;  1FMW A;  2X38 A;  1T6I A;  5JSL A;  2IXP A;  1MX4 A;  4RSY A;  1NFO A;  4MKT A;  1HE1 A;  3C63 A;  1D0X A;  3AG2 C;  3RW0 A;  4UQY A;  4J7W A;  3IHY A;  4DX2 A;  3DM5 A;  4KVO A;  3FH5 A;  2ZXO A;  2P9L G;  4BTB A;  3ZVR A;  2QY7 A;  4NUR A;  3IEE A;  4G2V A;  1OXB A;  1OCR E;  4F4B A;  3DBS A;  2WZL A;  2BUG A;  3WHN A;  5DBK A;  4FA6 A;  3EUV A;  2VYI A;  5ENO D;  3RAU A;  5KYY A;  2VGE A;  2XRY A;  3UXG A;  2YL1 A;  4PFO A;  3LAY A;  1JCS A;  5AEN A;  3FHD A;  4ANW A;  4AP2 A;  3LCA A;  4K0R A;  4FX5 A;  2RKK A;  4G8K A;  2FAP B;  1BI7 B;  4GCO A;  4WWP A;  3LDZ A;  3PDN A;  1W3B A;  1D0Z A;  1OWN A;  4CDR A;  2WMN A;  3B0U X;  4K5B A;  5AQA A;  5ARF A;  1A7V A;  3U9M A;  3VM6 A;  3DJN B;  4HLL A;  1KZP A;  1Y6D A;  4G7H F;  5ENN A;  2GRN B;  2WPV A;  5CCL A;  4UQX A;  2H7V C;  4LNG A;  2YWA A;  2PM7 A;  4I44 A;  5D92 A;  4FES A;  4BJ5 C;  2ZXR A;  3RVZ A;  3Q75 A;  4U5H A;  5KNH D;  2OCC E;  3ZRH A;  3SYN A;  2Q7F A;  2WXO A;  5IY5 C;  2XEN A;  4QI2 A;  1V54 C;  5F28 E;  3G2S A;  2RFA A;  2XLW A;  3S9O A;  3FUK A;  2KYH A;  4I6J A;  4JZY A;  4U5B E;  2AXU A;  4XKB A;  2YQ8 A;  5HI7 A;  5BXO A;  2IEJ A;  4N6H A;  4JEA A;  4WJ0 A;  1RKC A;  4CT4 A;  1FMV A;  2EPN A;  2HZ8 A;  4N2Q A;  1U89 A;  1QKR A;  4B8C B;  2RD9 A;  4NY3 A;  4YL0 A;  2WZG A;  1HY5 A;  2YHS A;  1E90 A;  1E8Y A;  3VLF A;  5EIL A;  5E76 A;  3ABK C;  4NTF A;  5COF A;  3O10 A;  3MFN A;  2VSX E;  3C62 A;  1E83 A;  2FO7 A;  2KCL A;  3W9F A;  3V30 A;  1OQC A;  3HHM A;  1WAO 1;  3K7D A;  2KNH A;  5CHE E;  2X6K A;  3UM1 A;  3EG9 A;  3CVN A;  3GZ2 A;  1UW4 B;  1NFI E;  4U0U A;  3VTX A;  3EGD A;  2L7A A;  1BI8 B;  3C7J A;  2YLI A;  4XIF A;  2HSB A;  2OKU A;  1FPP A;  2A4Z A;  3OXF A;  2XM4 A;  4MRU A;  2E0I A;  5D2M C;  1V55 C;  3ONK A;  3TWR A;  2JD3 A;  2XLM A;  3OXG A;  2J9W A;  3G2W A;  1WOL A;  1PCX A;  1D1A A;  1M2V A;  2V0P A;  3ZIM A;  2ZXP A;  4A1S A;  3D9P A;  3ITF A;  4LLC A;  2UY1 B;  2HJM A;  5FZR A;  4A63 B;  4K7B A;  3FFL A;  3LNR A;  4IAQ A;  4GYO A;  1ORY A;  4CS7 A;  4I1O B;  4EBJ A;  3CVP A;  1TN8 A;  1UJJ A;  3SXM A;  4DJA A;  5CMY A;  3RKO F;  1QLE C;  2W9Y A;  2KC3 A;  4GZ6 A;  4DUI A;  1TJF A;  4FC8 A;  2CGE A;  5AC5 A;  2DIW A;  5B1A E;  2J9B A;  1LF8 A;  1TQG A;  4G24 A;  3CVL A;  3UQ3 A;  3R9A B;  5DS4 A;  1H2V C;  3GYZ A;  2DYR C;  5KYY B;  2OEX A;  4AL1 A;  4KZC A;  2GWW A;  3FTV A;  5L0H A;  2ZD9 A;  4MS6 A;  3EIQ C;  3R7Q A;  3EPV A;  4P9T A;  1E84 A;  4DX7 D;  2LUH A;  2Y4U A;  3L22 A;  4BX8 A;  3JUI A;  1WGW A;  2TMV P;  3SBS A;  5AYW D;  4MTG A;  4UWK A;  4H54 A;  4BY6 A;  1YAR O;  3L34 A;  4I2W A;  3R7R A;  4EZJ A;  2OG2 A;  2DYS C;  3UR3 C;  3GOD A;  3MYF A;  4U63 A;  4J7Y A;  5FTP A;  5KBA A;  3TWW A;  1M2O A;  5A6K A;  2EPL X;  1N94 A;  3C3O A;  4EKW A;  1OR3 A;  3CVY A;  3LEO A;  1KPS B;  2OVB A;  3T6J A;  4CDV A;  4TXR A;  3TJ5 A;  4LUN U;  4BT8 A;  3UNG C;  2HM8 A;  3Q7G A;  1K40 A;  2CHX A;  4LEU A;  2V3C C;  2J49 A;  4BET A;  4HRM B;  4K1O A;  4F53 A;  2GRP B;  1FNT c;  3MKR A;  3JSE O;  3ASH A;  1JMW A;  3AG4 C;  4OVU A;  1PY1 A;  2HFI A;  4Z9I A;  3ZYK A;  4QDL A;  4O7G A;  5KJN A;  5DS5 A;  3JCK C;  3MYI A;  2XGS A;  2CFZ A;  1VK5 A;  2WXN A;  4GTM A;  1SW6 A;  4Q7C A;  4MQ9 F;  1TR4 A;  5HV9 A;  1UJK A;  2R05 A;  2J8S D;  1MHQ A;  2Y4T A;  4GTR A;  1KU2 A;  2LFD A;  4E18 A;  2AVP A;  2EIN E;  3ML9 A;  3LS0 A;  3UGO A;  4GCN A;  1JPL A;  3D9N A;  3DXM G;  1LI5 A;  3EGD B;  3FUF A;  2DI3 A;  4ANV A;  2WXF A;  4PJL A;  1OKK A;  4JC8 A;  4NQF A;  5JHA A;  1LS1 A;  2E87 A;  5DVW A;  1I4Y A;  4PR9 A;  4FLB A;  4DRX E;  2R59 A;  2OJE D;  2WQ7 A;  4JUR I;  2GRO B;  1OKK D;  4WND A;  1B89 A;  5EID A;  2XPY A;  4YDO A;  2JEK A;  4CJO A;  1M2V B;  3Q15 A;  2R7S A;  1E8Z A;  3V7O A;  3KSL A;  4HVB A;  5CEA A;  4ULV A;  5CER B;  4HLE A;  3W9G A;  5L0G A;  2CYD A;  5FIN A;  1XGW A;  5A6B A;  4PS8 A;  4APO A;  5KJM A;  3I5P A;  4L23 A;  4K03 A;  2C2L A;  1ELW A;  4JEB A;  3ZYL A;  3EJN A;  3FDH A;  4PH4 B;  2L6J A;  1MYO A;  3AAA C;  4GMR A;  3V2O A;  4E85 A;  3KYJ A;  3U8V A;  4EBA G;  3ZTZ A;  3L13 A;  3SF4 A;  1TFO B;  1YA0 A;  4HI9 A;  5FQ6 A;  4GTS A;  3T9K A;  1UOH A;  3AG3 E;  1XNF A;  2X6J A;  1RCP A;  3E32 A;  3QC1 A;  4GML A;  3PMR A;  2KC7 A;  2LSV A;  4J6I A;  4IAO A;  4DVY P;  4Q5S F;  4BEJ A;  2GRQ B;  3PUK A;  3ZTM A;  1EDU A;  1G3N B;  1AUE A;  5C2Y A;  3CAX A;  4PJM A;  4JC7 A;  5CI8 A;  3QAR A;  3GZ1 A;  1U2V G;  2XL4 A;  2L6G A;  2CHW A;  2PFD A;  4ATG A;  2VGX A;  4UI9 K;  4BTA A;  4MND A;  2V5Q C;  3HNK A;  1D1B A;  2ZGD A;  2R17 C;  4IUL A;  4PUC A;  1N4R A;  4RBN A;  4XLP F;  1O1S A;  3ABL E;  1QNF A;  1OW8 A;  2XEH A;  3U2L A;  1T6Q A;  3KPH A;  4W9R A;  1QVX A;  1GW6 A;  2XZD G;  3DST A;  1N4Q A;  4LDK A;  3ABM E;  3FEY A;  4M3O A;  1TNO A;  3TWS A;  3HDX A;  4GU5 A;  2PF4 E;  2FEZ A;  2EIK E;  2KZT B;  1PD0 A;  4LER A;  4QQI A;  1FTS A;  4F3V A;  3L0I A;  4J32 B;  3PZ3 A;  5B3S E;  3RO3 A;  2L81 A;  2KAT A;  4JIO A;  1EF1 C;  1MQV A;  2OJQ A;  3RRU A;  3QTH A;  2X0C A;  3PRZ A;  4BX9 A;  2MHK A;  4MTF A;  2BF0 X;  3VLD A;  3B7T A;  3K6B A;  4DJ9 A;  1EPU A;  3AS4 A;  5B1A C;  3RRN B;  1O5H A;  3V2X A;  4GB9 A;  3VLE A;  1ZBP A;  3JXJ A;  3FH7 A;  4CT0 A;  2P2C P;  3PDM P;  1INZ A;  1BR1 A;  2FI7 A;  2WXH A;  3T6B A;  1APC A;  2WM9 A;  3OTN A;  1ST6 A;  2YEV A;  4YT8 A;  2YHC A;  3MJW A;  3Q6M A;  3NMJ A;  2BL2 A;  2AJA A;  2G62 A;  2Q7R A;  4NTB A;  1HO8 A;  1N0R A;  1SR2 A;  3LLK A;  3K9I A;  2KCV A;  2MWQ A;  2XLD A;  3SZ7 A;  3AU5 A;  3TWU A;  3HJC A;  5CEC B;  2KQ9 A;  1IXV A;  2WXI A;  2R02 A;  2WXK A;  3APC A;  2QFC A;  4XEF A;  4DRJ B;  2NG1 A;  2V4L A;  4J8D A;  4LLE A;  5AJD A;  2CW0 F;  4BJ1 A;  5AC4 A;  2RG8 A;  5KYU A;  3TOM A;  3SXK A;  1K05 A;  2R7Q A;  5E2Q A;  2R5S A;  2BED A;  2XCB A;  2UUI A;  1NZN A;  4PFP A;  2CFU A;  3UMV A;  1ZU5 A;  2RD0 A;  1JAF A;  1M6T A;  3H2V A;  2HMZ A;  3W8H A;  2HR2 A;  2LO6 A;  2PX3 A;  1BDJ B;  3FY4 A;  2DBA A;  3N71 A;  4JTD B;  3FUJ A;  2IBF A;  4URK A;  3EZI A;  4UI9 C;  4GYT A;  5E75 A;  1HE9 A;  1DOV A;  4A1G A;  2P61 A;  4YN0 B;  1Z3X A;  4AY6 A;  4MS2 A;  3F46 A;  1N52 A;  3ESK A;  4I9C A;  4U9E A;  4ACL A;  1ELK A;  4D10 C;  3H2U A;  1H0A A;  2XSE A;  4U5G A;  5FQ7 A;  2GDC A;  4JCZ A;  4WNG A;  1QBQ A;  4P29 A;  1RXQ A;  2DWZ A;  3EZH A;  1OCO C;  2KCK A;  3CV0 A;  1OCC C;  4YJW A;  1WY6 A;  3WOD F;  3RQG A;  4MTO A;  3CK9 A;  3E9V A;  4HRN A;  3POV A;  2VCA A;  4ZFH A;  2HO1 A;  3EFO A;  5A6C A;  4AVX A;  2QC9 A;  2A6E F;  3NBN B;  5A6A A;  4TUM A;  2AVK A;  1SYQ A;  3UM3 A;  3CQZ A;  1N1C A;  2P6V A;  3G4X A;  5COM A;  2ZXW C;  3L9T A;  3B7U X;  3TWV A;  2YLG A;  1LPE A;  2B0H A;  1H9G A;  3DWW A;  4KNW A;  4U5E E;  2C0M A;  4HFG A;  2AXZ A;  3MBG A;  1YVI A;  4JEH A;  4YDY A;  1Q0M A;  3G2T A;  1X81 A;  3B29 A;  4HRL A;  3S0X A;  4U07 A;  2JX0 A;  3CEQ A;  2BKK B;  3EH2 A;  1Z5Z A;  1WAS A;  5JMN D;  3NYJ A;  3A11 A;  3L82 A;  1NLX A;  4CX9 A;  3B7B A;  3Q9U C;  3SGH A;  2J0X A;  1JOG A;  1TWG A;  2IY0 C;  3DZA A;  2WXJ A;  4MBG A;  1JWG A;  1G4W R;  3JTL O;  3DD7 A;  1VDY A;  3BQO A;  4XLN F;  3JUE A;  1O5M A;  3KL4 A;  2YQY A;  3NYM A;  2LAH A;  3APD A;  3HKK A;  5KJL A;  2R9R B;  1MX6 A;  2G3V A;  3T8M A;  4BJ6 C;  3AS8 A;  4PDX A;  4H4K C;  3SO8 A;  1DVP A;  3X2Q E;  4W8K A;  3CVU A;  4YVO A;  1D1C A;  3K33 A;  5CBO A;  5JHB A;  4OAU C;  2WL8 A;  5LCW C;  4DOZ A;  3UKU G;  3KSQ A;  2QY9 A;  4CSA C;  1S70 B;  3T4R A;  4L7T A;  1VTM P;  3APF A;  3CQG B;  2ETS A;  2H6F A;  3PE3 A;  2VTB B;  3CSF A;  2GRM A;  4XPW A;  2VSY A;  4G8L A;  3PCV A;  3RU0 A;  2XLO A;  1CGN A;  4EPZ A;  4J8F A;  4YDE A;  4N5C A;  4RVB A;  3KMI A;  3FTU A;  4GZ5 A;  3LUT B;  2VGY A;  2EPO A;  4L6R A;  2XL8 A;  5BQI A;  1YZA A;  3CIA A;  3NKD A;  1UG7 A;  3ZDL A;  4WNF A;  2F37 A;  4HOQ A;  1QZ2 A;  1SVX A;  3HXE A;  4OVV A;  4GTO A;  3C8G D;  3FU6 A;  1RJ9 A;  4RG6 A;  2H7O A;  5BV0 A;  3MCX A;  4Y6C A;  3J5P A;  2O9X A;  2IM8 A;  2IOS A;  1LTX A;  3FTW A;  2WXG A;  4F6R D;  2HYZ A;  5J08 A;  4N5Q A;  5FZQ A;  1H6O A;  3R7C A;  4APF A;  3NB2 A;  1HE8 A;  3KYI A;  4HQD A;  5FT9 A;  1I5N A;  5FZT A;  1IHB A;  3EHN A;  3GZS A;  3CQC B;  4U5D E;  4JD2 G;  5T4Y A;  3MV2 B;  2P0N A;  1VYK A;  3ZUV B;  3DMD A;  3ZQY A;  1SMY F;  1MNE A;  2Y3B A;  3GOR A;  4JTC B;  1A0B A;  2J0W A;  2P9P G;  1E85 A;  4JL0 A;  2Y69 E;  4E7S A;  3IPM O;  1NBB A;  3FMS A;  1N95 A;  1GGQ A;  3I4U A;  2PZI A;  3CLJ A;  3TWX A;  4C9B B;  1G5Z A;  4U5C E;  4O6N A;  3ASG A;  2ICW G;  4LNU D;  2VAS A;  3U3B A;  4ZLD A;  5CMW A;  3LYA A;  4JHJ A;  3C18 A;  1ZHX A;  3RFY A;  3LVQ E;  3CVW A;  2C0L A;  4G0H A;  2J9V A;  2VJ8 A;  3IHU A;  4CGW A;  1W2W A;  1E2X A;  4WGZ A;  2XQ0 A;  1H6P A;  2PNN A;  4E6H A;  2H6H A;  3O6X A;  4MVR A;  3S27 A;  2EIM E;  3PVL A;  3LS8 A;  1OWL A;  4U0S A;  1EA8 A;  2XCC A;  4NIK A;  3TG5 A;  2CDQ A;  5D0O D;  3IQ5 A;  5A23 A;  4KI2 A;  4BFR A;  4JHK A;  3NG1 A;  2V5F A;  4ILI A;  3LJN A;  3Q7A A;  2LP4 A;  5KJK A;  3WG7 E;  2KK1 A;  4DRI B;  4ILH B;  3ZW3 A;  3B13 A;  4AJW A;  4ER9 A;  5D0Q D;  1J8M F;  3L8I A;  1N11 A;  2EQX A;  1O3U A;  4I17 A;  3BEH A;  3D3M A;  4UDV A;  1FVF A;  2Q00 A;  3TD7 A;  3EU5 A;  5A7D B;  4O6F A;  1TWA A;  2OOC A;  1RKE A;  2V8S E;  4GYY A;  4YL3 A;  5HS0 A;  3MLG A;  2FF4 A;  2Y3H A;  4O60 A;  5ITZ F;  3G2V A;  5CRU A;  3SQV A;  5E3C A;  4UUC A;  1E86 A;  4XE0 A;  5G04 C;  5FWQ A;  5C1D A;  3IBE A;  2WXM A;  1BR4 A;  2OEV A;  1KNY A;  1HS6 A;  5FZS A;  5KYN A;  3B71 A;  4HI8 A;  3QW1 A;  2I1K A;  1HH8 A;  2LSU A;  3D9L A;  1BBH A;  2YKZ A;  4N3C A;  3ZGQ A;  2AW6 A;  1I4Z A;  1YA7 O;  3DXK G;  3QMK A;  3JYS A;  3LY7 A;  5E33 A;  2VCB A;  3IQ6 A;  3TJP A;  3FDQ A;  1VLT A;  5EN5 D;  4EIY A;  3GM1 A;  3MYV A;  3MA5 A;  2H8A A;  5BUO A;  3B9Q A;  2EIL E;  4KT6 B;  3TXN A;  4EHM A;  3C3Q A;  4ULW A;  2R7X A;  3OXL A;  4G78 A;  2VB6 A;  4U7E B;  1N4S A;  1LVK A;  4CS8 C;  2AWI A;  4J8Y A;  4CRW A;  4U5F E;  3C8Z A;  3L1M A;  2R7T A;  3GAN A;  4BEP A;  5T1D B;  1K3Z D;  1D0Y A;  1L5J A;  1JCR A;  1SA4 A;  1ZHT A;  1XWJ A;  3A9C A;  3X2Q C;  3ESL A;  3ULY A;  4R7L A;  2FUL A;  4YND A;  4GPK A;  2L6F A;  3AOU A;  2XZT G;  4GYW A;  4AL0 A;  4TUU A;  1ORJ A;  1WN0 A;  1U6H A;  2W45 A;  4OIO F;  2WXR A;  5JT4 A;  3HLZ A;  2DZO A;  1C03 A;  5EYL A;  3GEE A;  4I1M A;  2I2O A;  3FU5 A;  1D9S A;  2EIJ C;  3BU8 A;  4DX5 D;  2YVK A;  3DI5 A;  4A2N B;  3EIJ A;  1JPN A;  3KEZ A;  3ISM C;  3M79 A;  3SXZ A;  1SA5 A;  2XGO A;  3NDB B;  2R25 A;  2IJG X;  4R32 A;  2KSF A;  4CDY A;  2PM6 A;  2WMO A;  4KBL A;  1KLX A;  2B0O E;  4I9E A;  2LNI A;  1BLX B;  2ETB A;  3SEO A;  3LJ3 A;  3NMI A;  1HMO A;  4WWN A;  3EHM A;  1IQR A;  1LD8 A;  2OU6 A;  3O39 A;  2Q3T A;  2YL3 A;  4AXH A;  1OCR C;  2J08 A;  3HXD A;  3QWW A;  3QAQ A;  4BWR A;  3PEV B;  3G50 A;  2J09 A;  3EG9 B;  4KC9 A;  2J46 A;  4U95 D;  3R9M A;  1IW7 F;  5EDS A;  3US6 A;  3PEU B;  1YLM A;  3ZQV A;  4G1T A;  3CVQ A;  1LKX A;  4JE9 A;  3TK0 A;  2LK4 A;  4G11 A;  4BES A;  2J07 A;  5BXU A;  3X1O A;  3EQL F;  4OIP F;  4GA2 A;  1KTM A;  4MLP A;  4BPM A;  4IAR A;  4FP7 A;  1WG0 A;  1BR2 A;  3S2A A;  3UT4 A;  1R5I D;  3CGH A;  3K1I A;  2A69 F;  1U0B B;  1HW1 A;  4GMJ A;  3OEO A;  4CS9 C;  3Q47 B;  2NSF A;  5KYX A;  2IXM A;  5CIV A;  3DXJ F;  4I6G A;  4TV3 A;  2AWC A;  3HIZ A;  3ECS A;  1BPO A;  5AQB A;  1NU7 D;  3W2W A;  2OCC C;  2A5E A;  3M1C B;  2IU1 A;  1Y4C A;  2XLE A;  3EH1 A;  3LKU A;  3S29 A;  3TQO A;  4NTA A;  4DI4 A;  2LXL A;  4XPX A;  1QSP A;  3FAP B;  3ZEF A;  1H6G A;  2J4D A;  3I4R B;  4HXI A;  1ZW2 A;  3HTK C;  5BNW A;  1K1B A;  5A6J A;  4HBD A;  2XLH A;  3UTM A;  2H7B A;  1Y8M A;  4ACK A;  1OW6 A;  2CNW A;  2BKG A;  3FUM A;  3SNX A;  3DRA A;  3T8K A;  5E3A A;  3JRT A;  1DC2 A;  5G2N A;  2CNW D;  4JJF A;  256B A;  2RFM A;  1OXK A;  1HG5 A;  3JSZ A;  3LY9 A;  5ENT D;  3ZKJ A;  4PJJ A;  2MYO A;  4O1P A;  1QPU A;  3LJB A;  3QZC A;  3GWL A;  1TN7 A;  2L6H A;  4P6I C;  3FUL A;  4JTA B;  3HVE A;  4XX5 A;  4DX1 A;  1CPR A;  4MVQ A;  5L3Q A;  1A17 A;  1IYG A;  4FJY A;  5B1B E;  3V5Y A;  1H2U A;  1YYJ A;  4JHR A;  1CGO A;  1V74 B;  3TUL A;  1A41 A;  1ZU2 A;  3SI5 A;  4Q69 A;  3UKR G;  1KT1 A;  4BG0 A;  1GQA A;  5AQ7 A;  4DX6 D;  4DPR A;  2KXP C;  2FGY A;  3FOO A;  1YYH A;  1FCH A;  5AAR A;  2F22 A;  4RDA A;  1OR2 A;  3TG4 A;  3U5S A;  3UMH A;  4I2Z A;  4DLQ A;  1Q2Z A;  1E96 B;  2OND A;  1TWC A;  3O55 A;  3V79 K;  3P1U A;  1MMA A;  3UT7 A;  5LFA A;  3PNL B;  4XPY A;  2X6H A;  1Q0F A;  2NSZ A;  3U9W A;  2BE5 F;  1SZA A;  3K1I C;  3TL5 A;  3ZIB A;  3RF3 A;  4ZLC A;  3D9O A;  1HU3 A;  3LS1 A;  4LCT A;  3DKA A;  3DJU B;  1VLS A;  4XQ1 A;  1QZX A;  2ZU6 B;  4KNV A;  1TFK B;  3CK7 A;  3ZXP A;  2QNL A;  4D4N A;  3UX4 A;  1EI7 A;  5JS5 A;  2X51 A;  2PL2 A;  3MV3 B;  3S90 A;  3M4C A;  3I4G A;  4A3T A;  3W4Y A;  3RYL A;  3TXM A;  2PBE A;  3ZFW A;  2W4M A;  4MW3 A;  3ASD A;  5F5H A;  2QZA A;  5JJ7 A;  2JPU A;  4WUY A;  2EIL C;  1O1R A;  4WNE A;  3IXE A;  4PS3 A;  3U8P A;  2C04 A;  2AXV A;  4JB8 P;  4L1B A;  3MEK A;  3B0V C;  2XEE A;  5JJ6 A;  4B89 A;  4U8V D;  3ZYQ A;  4FHJ A;  1HW2 A;  1VOM A;  2I1J A;  1PD1 A;  5D91 A;  2W4B A;  1PV3 A;  3FVY A;  4J8E A;  2DCP A;  2IFU A;  5AJL A;  2X3M A;  1U3C A;  3Q73 A;  2M4E A;  3TOL A;  1T5O A;  1FT2 A;  5KYX B;  3SXY A;  3U66 A;  3BG0 B;  4RQI A;  2P9N G;  1HG2 A;  2D4U A;  3AQC A;  4GEH A;  5ENQ D;  3AG1 E;  4WAB A;  4M63 A;  2A0U A;  2B0J A;  4A3V A;  3PZD A;  4XEI G;  3DAF A;  3GM3 A;  3L54 A;  1JWF A;  1MMD A;  4AE4 A;  4XEV A;  3KKB A;  2NUT A;  4C3D A;  2CHZ A;  1HX8 A;  2KW3 C; 
#chains in the Genus database with same CATH homology
 2CG3 A;  5LX8 A;  2GGF A;  2A6H F;  5AIJ A;  2I8B A;  3CKC A;  4AV7 A;  4G7O F;  3NZS A;  1ZYR F;  4BJ6 A;  3NQP A;  3ZC4 A;  4Y6W A;  4C3B A;  4YT5 A;  2VGX B;  5L3V A;  2VSO E;  3Q7L A;  5DQZ A;  2WVN A;  3SP1 A;  2EIN C;  3HVE B;  4CSA A;  3JT1 A;  3QB2 A;  3QNK A;  2OOE A;  1JPJ A;  3ZG1 A;  4DVZ A;  1TJC A;  1O87 A;  2NXP A;  4JXT A;  5G05 C;  4FHK A;  4BJT A;  2X6F A;  4XTK A;  2PQR A;  3K66 A;  4HS2 A;  3JQ1 A;  3DAG A;  1E8W A;  1OWM A;  1OWP A;  1NG1 A;  1IQU A;  3LEW A;  3AS5 A;  4B0Z A;  1EYH A;  2I9C A;  3KS2 A;  2IQC A;  5BT1 A;  3L16 A;  4NAC A;  4ANJ A;  2PP4 A;  3ZPJ A;  5LCW J;  1S0P A;  3AG3 C;  4H7X A;  2D5R B;  4HE8 D;  4O6Y A;  3FHE A;  3PNT B;  1Z6A A;  4EBA A;  3Q49 B;  2L0I A;  4YVQ C;  1HZ4 A;  3LY8 A;  3O4Z A;  3L6A A;  4F1S A;  3D9K A;  1TR2 A;  4CEM A;  4XI0 A;  1UN9 A;  3NZU A;  5KYU B;  5ANL A;  3HYM B;  3UPV A;  4PS7 A;  4IWB A;  3ABL C;  4Q4Z F;  3EDT B;  2Q9B A;  5DS6 A;  1E8X A;  5F5F A;  1Y6I A;  4KVM A;  3I5Q A;  3DPD A;  3ABM C;  4UWG A;  3F47 A;  2VSN A;  1TEZ A;  4XWJ A;  1JUQ A;  3ZYM A;  2EIK C;  4QI0 A;  4J8S A;  1DNP A;  2FFH A;  4UWL A;  5LOZ A;  2I6H A;  4DBQ A;  4EWC A;  3FUD A;  4N06 A;  3NYL A;  1UN8 A;  5B3S C;  3IV0 A;  3CHS A;  3QKY A;  3UT8 A;  2HV7 A;  3N24 A;  4UWF A;  3CZ6 A;  4FLH A;  1VYI A;  1HX8 A;  2XEV A;  4JVS A;  2NC9 A;  4XI9 A;  4OIN F;  5M72 A;  2LSE A;  2UY1 A;  3EFO B;  2P7V A;  4N2S A;  2ZPA A;  3DM9 B;  3Q4A B;  3FWV A;  3CHO A;  4HFK B;  3MKQ A;  4YT2 A;  2ION A;  2DGJ A;  3RRM B;  2G3K A;  2BTD A;  4A55 A;  1S7Z A;  4C7O A;  3VAY A;  3N0T A;  2VQ2 A;  3NF1 A;  5HQ8 A;  2VH3 A;  2M63 A;  3S28 A;  1M57 C;  3ZSU A;  2R7U A;  3WXX A;  4I3M A;  2IOQ A;  3AG1 C;  3E4B A;  1MND A;  4UQZ A;  3QDN A;  4BT9 A;  1HF8 A;  3S7B A;  2Q9A A;  4C0M A;  4CS8 A;  3ZHE A;  4V3I A;  2J7P A;  4G25 A;  5G04 J;  2WB2 A;  3CHM A;  5FQ4 A;  3UGP A;  2J7P D;  3PS6 A;  3VTY A;  3CR3 A;  3FTZ A;  3D9M A;  2P58 C;  4IJJ A;  4N3A A;  2L9J A;  4FU3 A;  3FUH A;  5FQ8 A;  1H19 A;  2PQN A;  4O6M A;  2KM4 A;  3UMI A;  3PHF 2;  3QWP A;  3SHF A;  4YT4 A;  3SZR A;  3I3N A;  4B6I A;  4AOF A;  3RIP A;  4LRZ A;  3ULQ A;  4JCH A;  2A1D D;  3SNH A;  4E7Z A;  4DK5 A;  4OD5 A;  2WXL A;  3MX3 A;  3URZ A;  3AQB A;  4AK9 A;  4C0E A;  3U4T A;  2MOW A;  1RJ9 B;  1P5Q A;  2Y3G A;  4FWV A;  4AM9 A;  4YWQ A;  1TKN A;  2OV8 A;  3RH3 A;  5T3W A;  4ME2 A;  5DIZ A;  5T8I A;  2WZF A;  3Q6N A;  3OWT A;  1SZ9 A;  4OIQ F;  1U3D A;  3FU0 A;  3D9I A;  3MKQ B;  2XHE A;  4UWH A;  2MYS A;  2XPI A;  3LXU X;  1HFA A;  2KGO A;  2GW1 A;  5BPP A;  4WAF A;  2WB7 A;  4CS9 A;  4C7O B;  2XRZ A;  2CG2 A;  2WXP A;  4KYO B;  1HXI A;  4HOT A;  4IYP A;  2R7W A;  3NRH A;  3KH2 A;  1Z63 A;  5BW8 C;  2R7R A;  4LAC B;  4BSX A;  2GFH A;  4RD9 A;  2Y3A A;  1X5B A;  4G23 A;  4CDM A;  5DQT A;  3ASO C;  3EGX A;  4ANX A;  3PRE A;  3D9J A;  4HOR A;  3ZHE B;  4EEC A;  3S7D A;  3IHV A;  3FAJ A;  2FBN A;  3LLI A;  4AIF A;  3IKO B;  1OWO A;  1NA3 A;  2A5U A;  2WQ6 A;  4ABN A;  4G26 A;  2KZT A;  4L2L A;  2QTV A;  4QFV A;  5JJT A;  2XXA A;  4NQ0 A;  1NP7 A;  3CHQ A;  5G55 A;  3VYW A;  4EZK A;  4GA0 A;  1KT0 A;  1PC2 A;  2YNQ A;  1NZE A;  5ARG A;  2Z15 A;  4RG9 A;  3ML8 A;  3SD5 A;  2J9Q A;  1H6K A;  4J0U A;  1VMA A;  3KAE A;  5BV1 A;  4C3E A;  2V26 A;  4DI3 A;  3CVX A;  3RO2 A;  2PX0 A;  1Z3Y A;  3B7S A;  3SBT B;  1IHG A;  1ZHY A;  2Y69 C;  1FFT C;  2IYL D;  3MZL B;  4JJG A;  3ZVV A;  4EQF A;  4AX2 A;  4F7A A;  3FUI A;  3KD7 A;  4B94 A;  3L08 A;  3FP3 A;  2GRL A;  3S7F A;  4CIH A;  3RIB A;  1NU9 C;  5EHH A;  3ASF A;  1ZU4 A;  3FUE A;  3PUJ A;  3U64 A;  3FTX A;  2EIM C;  4DBR A;  4N3B A;  4OYS A;  1MQS A;  2XGM A;  2NUP A;  4Q96 A;  4U8H A;  3ONL A;  3K1H A;  4X0R A;  1N54 A;  4ILG A;  3CST A;  4GAA A;  1M56 C;  4GA1 A;  3QK0 A;  3WG7 C;  4HOS A;  3T5X A;  1SQM A;  4KMO A;  1ZHW A;  4I6E A;  3OA1 A;  4FUL A;  3LES A;  1Z6T A;  4HOU A;  3CHP A;  2E2E A;  3CHR A;  4IRU A;  4EZL A;  4JEU A;  3EGX B;  3Q5M A;  3MGB A;  3FUN A;  4JA7 A;  4GZD A;  4U04 A;  3O48 A;  4KZ0 A;  4B8A A;  2R7O A;  4XKC A;  1QQE A;  5EKQ D;  2WXQ A;  4TRQ A;  3RK6 A;  2XXA B;  1FFH A;  5FJY A;  3CK8 A;  2WQH A;  4FAD A;  1J8Y F;  4UI9 J;  2ILR A;  4L2Y A;  3RJV A;  3QOU A;  1ZHZ A;  5LP0 A;  5EX3 A;  2Y39 A;  3GW4 A;  2XPZ A;  4KBQ A;  3LEV A;  4GZC A;  4PJN A;  5T3R A;  3PE4 A;  1SZI A;  5HSW A;  2IXO A;  3UMK A;  2OVF A;  3LVR E;  4JPS A;  4I43 A;  3QWV A;  3W8I A;  2KJG A;  3G2U A;  2J45 A;  3PH0 C;  4JZA A;  4FJZ A;  3JCU Q;  4OD4 A;  4CGV A;  3BG1 B;  5ANR A;  5EX0 A;  1E7U A;  3BEE A;  2Y3D A;  3JQ0 A;  5G05 J;  3AU4 A;  4KXK B;  2HV6 A;  5KYW A;  2L0T B;  2NUP B;  3C98 A;  4AY5 A;  2YHE A;  4U0Z A;  2WVQ A;  5CCM A;  3B0P A;  3CKB A;  4G7Z F;  3ENE A;  2VTB A;  3TAX A;  3ZXS A;  1NA0 A;  3N2Z B;  4O79 A;  1TWH A;  4WWO A;  4H7Y A;  5KCM A;  3FU3 A;  3H65 A;  1Z23 A;  2LAI A;  1ELR A;  1OUV A;  2L9B A;  1MMG A;  3E70 C;  2R7V A;  2Q9C A;  4J30 B;  4JW1 A;  4CBE A;  3FEX A;  3IEG A;  1IZM A;  4CDN A;  2J9U A;  1SF8 A;  3OAW A;  2YZS A;  4HFF B;  3FH8 A;  1E7V A;  4HEA J;  3RKV A;  3W2V A;  3CSK A;  3P2B A;  5CI9 A;  2IXN A;  3LPZ A;  1G8X A;  3S7J A;  2UWJ G;  2IF4 A;  4OIR F;  4PK4 A;  1H2T C;  3L17 A;  5T3T A;  2WVO A;  2A68 F;  4AEZ C;  1PAQ A;  3T5V A;  5EGY A;  2YIN A;  4NRH B;  2C03 A;  3TGO A;  3JYH A;  5FCL A;  3SFZ A;  4EBB A;  1UG3 A;  3FTS A;  5BUZ A;  4IN3 B;  4CCA A;  4I1A A;  5B1B C;  5DLJ A;  3B7R L;  1OCZ C;  4K0D A;  4AE4 B;  2NUT B;  3QJZ A;  3ASN C;  2WVI A;  3FTY A;  4BJ5 A;  1MMN A;  4ANU A;  1Z3I X;  3CVV A;  5KYW B;  3U3W A;  4DLO A;  3NKE A;  5J90 A;  2J4B A;  2IOL A;  2JLB A;  4Q94 A;  2MRI A;  2X6I A;  1FVH A;  4JA9 A;  4N39 A;  3ZN3 A;  2XRH A;  4GZ3 A;  4XZ4 A;  1WM5 A;  3UUX A;  1FMW A;  2X38 A;  2IXP A;  4RSY A;  4MKT A;  1D0X A;  3AG2 C;  4UQY A;  3IHY A;  3DM5 A;  4KVO A;  3FH5 A;  2ZXO A;  4BTB A;  3ZVR A;  2QY7 A;  4NUR A;  3IEE A;  4G2V A;  4F4B A;  3DBS A;  2WZL A;  2BUG A;  5DBK A;  4FA6 A;  2VYI A;  5KYY A;  2XRY A;  4PFO A;  3LAY A;  5AEN A;  3FHD A;  4ANW A;  4AP2 A;  3LCA A;  4K0R A;  4FX5 A;  4GCO A;  4WWP A;  3LDZ A;  3PDN A;  1W3B A;  1D0Z A;  1OWN A;  4CDR A;  2WMN A;  3B0U X;  5ARF A;  3DJN B;  4G7H F;  5ENN A;  2WPV A;  5CCL A;  4UQX A;  2H7V C;  2PM7 A;  4I44 A;  5D92 A;  4FES A;  4BJ5 C;  2ZXR A;  4U5H A;  3ZRH A;  3SYN A;  2Q7F A;  2WXO A;  5IY5 C;  4QI2 A;  1V54 C;  3G2S A;  3FUK A;  4I6J A;  4JZY A;  4U5B E;  2AXU A;  4XKB A;  2YQ8 A;  5HI7 A;  4WJ0 A;  4CT4 A;  1FMV A;  4N2Q A;  4B8C B;  4NY3 A;  2WZG A;  2YHS A;  1E90 A;  1E8Y A;  3VLF A;  5E76 A;  3ABK C;  2VSX E;  2KCL A;  2FO7 A;  3HHM A;  1WAO 1;  3K7D A;  2KNH A;  5CHE E;  2X6K A;  3EG9 A;  3CVN A;  3GZ2 A;  1UW4 B;  4U0U A;  3VTX A;  3EGD A;  4XIF A;  2A4Z A;  3OXF A;  4MRU A;  2E0I A;  1V55 C;  3ONK A;  2JD3 A;  3OXG A;  2J9W A;  3G2W A;  1PCX A;  1D1A A;  1M2V A;  2V0P A;  3ZIM A;  2ZXP A;  4A1S A;  3D9P A;  3ITF A;  4LLC A;  2UY1 B;  5FZR A;  4K7B A;  3FFL A;  3LNR A;  4GYO A;  4CS7 A;  4I1O B;  3CVP A;  1UJJ A;  4DJA A;  5CMY A;  3RKO F;  1QLE C;  2W9Y A;  4GZ6 A;  1TJF A;  4FC8 A;  2CGE A;  2DIW A;  1LF8 A;  4G24 A;  3UQ3 A;  3CVL A;  3R9A B;  5DS4 A;  1H2V C;  3GYZ A;  2DYR C;  5KYY B;  4KZC A;  3FTV A;  4MS6 A;  3EIQ C;  3R7Q A;  3EPV A;  2Y4U A;  3L22 A;  4BX8 A;  3JUI A;  1WGW A;  3SBS A;  5AYW D;  4UWK A;  4BY6 A;  4I2W A;  3L34 A;  3R7R A;  4EZJ A;  2OG2 A;  2DYS C;  3UR3 C;  3GOD A;  4U63 A;  5FTP A;  1M2O A;  3CVY A;  2OVB A;  3T6J A;  4LUN U;  4BT8 A;  3UNG C;  2HM8 A;  3Q7G A;  2CHX A;  4LEU A;  2V3C C;  2J49 A;  4F53 A;  3MKR A;  3ASH A;  3AG4 C;  4OVU A;  1PY1 A;  3ZYK A;  4QDL A;  4O7G A;  5KJN A;  5DS5 A;  3JCK C;  2XGS A;  2CFZ A;  1VK5 A;  2WXN A;  4Q7C A;  4MQ9 F;  1UJK A;  1MHQ A;  2Y4T A;  1KU2 A;  2AVP A;  3ML9 A;  3LS0 A;  3UGO A;  4GCN A;  1JPL A;  3D9N A;  3EGD B;  3FUF A;  4ANV A;  2WXF A;  4PJL A;  1OKK A;  4JC8 A;  5JHA A;  1LS1 A;  2E87 A;  5DVW A;  4FLB A;  2R59 A;  2WQ7 A;  4JUR I;  1OKK D;  4WND A;  1B89 A;  2XPY A;  2JEK A;  1M2V B;  3Q15 A;  2R7S A;  1E8Z A;  3V7O A;  4HVB A;  4HLE A;  1XGW A;  4PS8 A;  4APO A;  5KJM A;  3I5P A;  4L23 A;  4K03 A;  2C2L A;  1ELW A;  3ZYL A;  3EJN A;  3FDH A;  4PH4 B;  2L6J A;  4E85 A;  4EBA G;  3L13 A;  3SF4 A;  1YA0 A;  5FQ6 A;  1XNF A;  2X6J A;  3QC1 A;  4GML A;  3PMR A;  2KC7 A;  2LSV A;  4J6I A;  4IAO A;  4DVY P;  4Q5S F;  4BEJ A;  3PUK A;  1EDU A;  5C2Y A;  4PJM A;  5CI8 A;  3QAR A;  3GZ1 A;  2XL4 A;  4ATG A;  2CHW A;  2PFD A;  2VGX A;  4UI9 K;  4BTA A;  4MND A;  1D1B A;  2R17 C;  4IUL A;  4PUC A;  4RBN A;  4XLP F;  1QNF A;  4W9R A;  1GW6 A;  3FEY A;  4M3O A;  3HDX A;  4GU5 A;  2PF4 E;  2FEZ A;  2KZT B;  1PD0 A;  4LER A;  1FTS A;  4F3V A;  3L0I A;  4J32 B;  3RO3 A;  2L81 A;  2KAT A;  1EF1 C;  3RRU A;  3PRZ A;  4BX9 A;  2MHK A;  2BF0 X;  3VLD A;  3B7T A;  3K6B A;  1EPU A;  3AS4 A;  5B1A C;  3RRN B;  1O5H A;  4GB9 A;  3VLE A;  1ZBP A;  3FH7 A;  4CT0 A;  1INZ A;  1BR1 A;  2FI7 A;  2WXH A;  2WM9 A;  3T6B A;  3OTN A;  1ST6 A;  2YHC A;  2YEV A;  4YT8 A;  3MJW A;  3Q6M A;  2G62 A;  1HO8 A;  3LLK A;  3K9I A;  2KCV A;  2MWQ A;  3SZ7 A;  3AU5 A;  3HJC A;  2KQ9 A;  2WXI A;  2WXK A;  3APC A;  2QFC A;  2NG1 A;  2V4L A;  4J8D A;  4LLE A;  5AJD A;  2CW0 F;  4BJ1 A;  2RG8 A;  5KYU A;  2R7Q A;  5E2Q A;  2R5S A;  2XCB A;  1NZN A;  4PFP A;  2CFU A;  3UMV A;  1ZU5 A;  2RD0 A;  3W8H A;  2HR2 A;  2LO6 A;  2PX3 A;  3FY4 A;  2DBA A;  3N71 A;  3FUJ A;  4URK A;  3EZI A;  4UI9 C;  4GYT A;  5E75 A;  4A1G A;  4YN0 B;  1Z3X A;  4AY6 A;  3F46 A;  1N52 A;  3ESK A;  4I9C A;  4ACL A;  4D10 C;  1ELK A;  1H0A A;  2XSE A;  4U5G A;  5FQ7 A;  4WNG A;  4P29 A;  3EZH A;  1OCO C;  2KCK A;  3CV0 A;  1OCC C;  4YJW A;  1WY6 A;  3WOD F;  3CK9 A;  3E9V A;  3POV A;  2HO1 A;  3EFO A;  5A6C A;  4AVX A;  2A6E F;  3CQZ A;  1N1C A;  2P6V A;  2ZXW C;  3B7U X;  4KNW A;  4U5E E;  2C0M A;  4HFG A;  2AXZ A;  4JEH A;  3G2T A;  3S0X A;  4U07 A;  3CEQ A;  3EH2 A;  1Z5Z A;  3NYJ A;  3SGH A;  2J0X A;  1TWG A;  3DZA A;  2WXJ A;  1JWG A;  3DD7 A;  1VDY A;  4XLN F;  3KL4 A;  3NYM A;  2LAH A;  3APD A;  5KJL A;  2G3V A;  3T8M A;  4BJ6 C;  3AS8 A;  4PDX A;  4H4K C;  1DVP A;  4W8K A;  3CVU A;  4YVO A;  1D1C A;  3K33 A;  5JHB A;  2WL8 A;  5LCW C;  4DOZ A;  2QY9 A;  4CSA C;  3T4R A;  4L7T A;  3APF A;  3CQG B;  3PE3 A;  2VTB B;  3CSF A;  2GRM A;  2VSY A;  3RU0 A;  4EPZ A;  4J8F A;  4N5C A;  4RVB A;  3KMI A;  3FTU A;  4GZ5 A;  2VGY A;  3CIA A;  3NKD A;  4WNF A;  4HOQ A;  1QZ2 A;  4OVV A;  3FU6 A;  1RJ9 A;  4RG6 A;  2H7O A;  5BV0 A;  3MCX A;  4Y6C A;  2O9X A;  2IOS A;  3FTW A;  2WXG A;  2HYZ A;  5J08 A;  5FZQ A;  4APF A;  1HE8 A;  5FT9 A;  3EHN A;  3GZS A;  3CQC B;  4U5D E;  5T4Y A;  3MV2 B;  1VYK A;  3DMD A;  1SMY F;  1MNE A;  2Y3B A;  2J0W A;  4JL0 A;  4E7S A;  4C9B B;  3I4U A;  2PZI A;  3CLJ A;  4U5C E;  4O6N A;  3ASG A;  2VAS A;  4ZLD A;  5CMW A;  3LYA A;  4JHJ A;  1ZHX A;  3RFY A;  3LVQ E;  3CVW A;  2C0L A;  4G0H A;  2J9V A;  2VJ8 A;  4CGW A;  1W2W A;  2XQ0 A;  4E6H A;  3O6X A;  3S27 A;  3PVL A;  3LS8 A;  1OWL A;  4U0S A;  2XCC A;  3TG5 A;  2CDQ A;  5D0O D;  5A23 A;  4KI2 A;  4BFR A;  4JHK A;  3NG1 A;  2V5F A;  4ILI A;  5KJK A;  4ILH B;  3ZW3 A;  3B13 A;  4AJW A;  5D0Q D;  1J8M F;  2EQX A;  4I17 A;  3D3M A;  1FVF A;  3TD7 A;  5A7D B;  4O6F A;  1TWA A;  2V8S E;  4GYY A;  3MLG A;  2FF4 A;  2Y3H A;  3G2V A;  5E3C A;  4XE0 A;  5G04 C;  5FWQ A;  5C1D A;  3IBE A;  2WXM A;  1BR4 A;  1HS6 A;  5FZS A;  5KYN A;  2I1K A;  1HH8 A;  2LSU A;  3D9L A;  4N3C A;  3ZGQ A;  2AW6 A;  3QMK A;  3JYS A;  3LY7 A;  5E33 A;  3TJP A;  3FDQ A;  3MYV A;  3MA5 A;  5BUO A;  3B9Q A;  4KT6 B;  3TXN A;  4ULW A;  2R7X A;  3OXL A;  2VB6 A;  1LVK A;  4CS8 C;  2AWI A;  4CRW A;  4U5F E;  2R7T A;  3GAN A;  5T1D B;  1D0Y A;  1L5J A;  1ZHT A;  3X2Q C;  3ESL A;  4R7L A;  2FUL A;  4YND A;  4GPK A;  4GYW A;  4TUU A;  2W45 A;  4OIO F;  2WXR A;  3HLZ A;  4I1M A;  2I2O A;  3FU5 A;  2EIJ C;  3EIJ A;  4A2N B;  1JPN A;  3KEZ A;  2XGO A;  3NDB B;  2IJG X;  2PM6 A;  2WMO A;  4KBL A;  1KLX A;  4I9E A;  2LNI A;  3SEO A;  3LJ3 A;  4WWN A;  3EHM A;  1IQR A;  3O39 A;  2Q3T A;  4AXH A;  1OCR C;  2J08 A;  3QWW A;  3QAQ A;  4BWR A;  3PEV B;  2J09 A;  3EG9 B;  4KC9 A;  2J46 A;  1IW7 F;  5EDS A;  3PEU B;  4G1T A;  3CVQ A;  1LKX A;  4G11 A;  2J07 A;  3X1O A;  3EQL F;  4OIP F;  4MLP A;  4FP7 A;  1BR2 A;  3S2A A;  3UT4 A;  3CGH A;  2A69 F;  4GMJ A;  3OEO A;  4CS9 C;  3Q47 B;  5KYX A;  2IXM A;  3DXJ F;  4I6G A;  4TV3 A;  3HIZ A;  3ECS A;  1BPO A;  1NU7 D;  3W2W A;  2OCC C;  3M1C B;  2IU1 A;  3EH1 A;  3LKU A;  3S29 A;  4DI4 A;  3ZEF A;  2J4D A;  3I4R B;  4HXI A;  3HTK C;  5BNW A;  2H7B A;  1Y8M A;  4ACK A;  2CNW A;  3FUM A;  3SNX A;  5E3A A;  3JRT A;  5G2N A;  2CNW D;  4JJF A;  1HG5 A;  3JSZ A;  3LY9 A;  4PJJ A;  3LJB A;  3QZC A;  4P6I C;  3FUL A;  3HVE A;  4XX5 A;  5L3Q A;  1A17 A;  1IYG A;  4FJY A;  1H2U A;  4JHR A;  3SI5 A;  4Q69 A;  1ZU2 A;  1KT1 A;  4BG0 A;  4DPR A;  2FGY A;  1FCH A;  4RDA A;  3TG4 A;  3UMH A;  4I2Z A;  4DLQ A;  2OND A;  1E96 B;  1TWC A;  3P1U A;  1MMA A;  3UT7 A;  5LFA A;  3PNL B;  2X6H A;  2NSZ A;  3U9W A;  2BE5 F;  1SZA A;  3K1I C;  3TL5 A;  3ZIB A;  3D9O A;  4ZLC A;  1HU3 A;  3LS1 A;  4LCT A;  3DJU B;  2ZU6 B;  1QZX A;  4KNV A;  3CK7 A;  3UX4 A;  2X51 A;  2PL2 A;  3MV3 B;  3I4G A;  4A3T A;  3RYL A;  3TXM A;  3ZFW A;  2W4M A;  3ASD A;  5F5H A;  5JJ7 A;  4WUY A;  2EIL C;  4WNE A;  4PS3 A;  2C04 A;  2AXV A;  4L1B A;  3MEK A;  3B0V C;  5JJ6 A;  4B89 A;  3ZYQ A;  4FHJ A;  1VOM A;  2I1J A;  1PD1 A;  5D91 A;  2W4B A;  3FVY A;  4J8E A;  2DCP A;  2IFU A;  5AJL A;  2X3M A;  1U3C A;  2M4E A;  5KYX B;  3U66 A;  3BG0 B;  1HG2 A;  3AQC A;  4GEH A;  4M63 A;  2B0J A;  4A3V A;  3PZD A;  3DAF A;  3L54 A;  1MMD A;  1JWF A;  4AE4 A;  2NUT A;  3KKB A;  4C3D A;  2CHZ A;  4GA2 A;  2KW3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...