1V74B

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic/immune system
molecule keywords Colicin D
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09204 Colicin_immun Bacterial self-protective colicin-like immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1v74B00
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH superfamily
2IXNA 4U5DE 3B71A 1ORSC 4Z9HA 1V55C 3ZQVA 2EPOA 1E86A 2MHRA 3EGDB 2YWAA 3DM5A 3N0TA 4P9FA 2L9JA 4JJGA 2W4BA 3LNMB 3IPMO 4HFFB 3AGUA 3QW1A 1TWHA 1XZQA 3H65A 1Z3IX 4AK9A 1ZW2A 4P6IC 4C3DA 1L3PA 4E17A 1QVXA 1KTMA 3AOUA 2LIGA 3V5XA 2UUIA 1Z7Qc 3L0IA 1BDJB 2HSBA 3EPVA 3U3FA 4CS8C 1FTSA 2EPNA 3WG7C 2J0XA 4QI2A 2YL7A 1H7IA 2YVKA 1H9GA 4LACB 4EHPA 3GANA 1MQVA 4JRZA 5AC5A 256BA 2GAQA 5CI9A 1V74B 4QDLA 2ETSA 1S7ZA 1CPQA 4KBLA 3LEVA 5JS5A 1HY5A 3MYIA 2WL8A 3SXMA 2EIJC 2DB4A 3DD7A 1YA7O 4ULWA 5DQZA 4U9EA 4CIHA 2YEVA 1DOWA 3U9MA 4BJ5C 2F22A 3JYYA 2XLVA 5DQTA 2AVKA 1TWCA 2OG2A 5KYXA 1ZHTA 1JPJA 1NU9C 1O5HA 3HNJA 4JKVA 3SXZA 2R7WA 1Z63A 2P0NA 4I1MA 1M56C 3QVYA 1OQCA 1Q0GA 2XM4A 3TOLA 3ITFA 3F46A 4U9DA 3RIPA 3RVZA 3VAYA 4JCHA 4Z9JA 1WASA 1U6HA 4YT5A 2XM0A 3UGOA 2J9WA 1FAPB 2EINC 4YL3A 4OINF 1TWGA 3NYJA 3K7DA 2OEVA 2GA0A 3IQ6A 1NU7D 3HJCA 4O7GA 5D92A 4DJ9A 4OIPF 5E3AA 3U8PA 2XXAB 5JP7A 3DE9A 3S0XA 2R05A 1YA9A 3DJUB 2C03A 3ATPA 3IEEA 4LLEA 1G4US 2ZXPA 3WODF 2LCHA 1ZYRF 2G62A 1YJGA 1VOMA 4JW1A 4U5EE 2R9RB 3K66A 1HE1A 4E7SA 2EILC 5IY5C 2XL6A 1E85A 2ZPAA 3SXYA 1TFKB 1R5ID 2P61A 1MMDA 1VLSA 1GQAA 4E18A 1GGQA 1VB5A 4IRUA 4O6YA 2WVOA 3MX3A 3AJMA 1SZIA 2J9BA 3JZ0A 1FFHA 4PJJA 4MVSA 1LPEA 1RKEB 3OA1A 2HKVA 3Q6NA 1ORJA 3GM2A 3OWTA 2A1DD 1B68A 2M4EA 4MW3A 4DXWA 1JMWA 1SR2A 3JSEO 3QVZA 4J32B 2PBEA 4CJOA 2XXAA 1OW6A 2H8AA 3PMRA 1O87A 4E0IA 5L3VA 1T01A 4AL1A 5L0GA 4XQ1A 5DS5A 3JSZA 3UMIA 2XLEA 1K05A 1U0BB 1ZVZA 4CBEA 2XL4A 3AG1C 4AE4B 2NG1A 4OIOF 3X2QC 4H4KC 2NUPA 1R4TA 1U89A 5JRAA 4K1OA 3SYNA 1QZXA 2AWCA 5KYXB 2WVNA 3TOMA 1IW7F 4X0RA 1LE2A 2R03A 3EG9A 4RBNA 3RKOF 3Q6MA 4JTDB 4G7OF 4FWVA 5CI8A 2P1AA 1T5OA 1NFOA 2XLMA 1LM3B 1T6QA 1VLTA 4OD4A 4BJ6A 5KYNA 1RJ9B 3W2VA 4K0DA 2TMVP 3M15A 1LIHA 3SNHA 3ZDLA 4Q5SF 2AU5A 4A4AA 1FFTC 2WVQA 1T6IA 1M2VB 4C3EA 1TWAA 4JURI 1ZU5A 4JZAA 2EPKX 4M63A 1OXBA 3TQOA 3JYHA 3OEOA 2A6EF 3EFOA 4E0HA 4FAPB 4NCQA 2A0BA 2YLGA 2I8BA 4JTCB 4MS2A 5JT4A 3DKAA 3C8ZA 5T1DB 2LP4A 2YL3A 3C8GB 3FVYA 2R7RA 4IJJA 1SYQA 3H2UA 1S05A 2JX0A 5COMA 4YT8A 5KYYA 2NUTB 1WWPA 3T4RA 1VMAA 2EIMC 2IYLD 2KQ9A 3L8JA 3ZTZA 1MNEA 1NFNA 5KYUA 3QZCA 4C3BA 1IZMA 1JRAA 3NYMA 3US6A 3VF0A 5B3SC 1BZ4A 1H9TA 1LS1A 1QSPA 4DRJB 1XWJA 5JLIA 3HTKC 4G78A 3NMKA 3VRCA 1O3UA 3B0PA 2GWWA 2HJMA 2VCAA 2R7TA 3RYLA 2J9VA 3IQCA 4FX5A 4IWBA 1HW1A 5L0JA 3IQTA 1YZAA 3S27A 1I4YA 3LS1A 1QKRA 2OQMA 3X1OA 1JPNA 2ZXOA 3AG4C 2VB6A 3I5QA 2L81A 3NKDA 4MQ9F 5E3CA 3ZIBA 3FOOA 4NY3A 4PJMA 4WGZA 4BJ1A 1HMDA 2OEXA 1CPRA 2Q9AA 1C02A 1D1BA 2OKUA 1JR8A 2XLDA 3RVYA 1LI5A 1PD0A 4BEJA 4C7OB 4HFKB 1D1AA 3U2MA 1EKYA 3AQBA 5KYWB 2OJQA 1EI7A 2Q9BA 3RQEA 3SZRA 2AWYA 1Q0FA 4CDVA 1YZCA 4G0HA 5COGA 4CX9A 3G50A 1ORYA 4DBRA 2Y3GA 2YL1A 4YL1A 4XPWA 2QNLA 2H7BA 2R7OA 3L1MA 4D4XA 3S84A 4OIQF 5FZTA 2JD3A 3MYFA 5A6BD 2IBFA 4PFPA 3JRTA 4IGGA 3B0VC 2Q9CA 4J7YA 4WJ0A 4PACA 2YHSA 4WGYA 4CS9A 3LLKA 3LLIA 1ZHWA 1MMNA 2HJ3A 2YLIA 3L34A 1E2XA 4YT4A 2L6FA 4N06A 2LFFA 3W8IA 3LS0A 4EBBA 2YKZA 3C62A 4A2NB 4QI0A 1WGWA 2R25A 2NUTA 5KYUB 3EJNA 4XEKA 2HSQA 2KK1A 3K1IC 3Q7LA 4EIYA 5BQIA 2DYRC 3ASOC 3GWLA 1G4WR 2ZXRA 2NUPB 3KYJA 5K0IA 3UR3C 4UDVA 1DOVA 3IHUA 3TD7A 4BG0A 5EHHA 1Z23A 2WB7A 3FXHA 4F4BA 4N4WA 1OCCC 5BQHA 2Y3DA 1PV3A 4IAQA 1M2VA 1V4AA 4MTGA 2H7OA 3W8HA 2VCCA 3KPHA 1Z5ZA 1ZHYA 1C03A 3GM1A 4YJWA 4U5GA 3Q7GA 3E70C 1PD1A 2CNWD 1VK5A 2PP4A 2OU6A 1A7EA 3A9CA 1D0XA 3AG3C 3EH1A 4CIPA 3HNLA 4JVSA 3B9QA 4DVZA 1TR2A 2QTVA 3EGDA 2B0HA 2XRHA 4LERA 5F5HA 5L0HA 2PNOA 2BL2A 1LS4A 2Q4FA 3SEOA 1JOGA 2Q7RA 5JVEA 2ASRA 1I4ZA 1M6TA 3W4YA 4JTAB 1VTMP 1ZHZA 4ONSA 5KYYB 1Q0MA 4KNVA 4O79A 2CCYA 5DLJA 1ZU4A 4P9TA 2MYSA 2X51A 4PK4A 2KNHA 5B3IA 4EKWA 2PX0A 3CZ6A 4ZLDA 3RW0A 3B0UX 1AEPA 2KYHA 5E2QA 4OIRF 4RDAA 1HW2A 3UMKA 4CSAC 1UG7A 4YT2A 1N1CA 2IM8A 3U8VA 2HUJA 1RCPA 1A41A 2QUPA 3VYWA 4OD5A 1CGOA 1OR2A 2KSFA 3JRMO 4JE9A 3U5SA 2Y3BA 4ER9A 1FMWA 1A7VA 1Y6DA 2CW0F 5L0CA 1FR0A 2XL8A 5F5FA 1QLEC 4E7ZA 2LFDA 3VM6A 3CQZA 2R7VA 4DRHB 3G4XA 4LDRA 4XPXA 1KU2A 1WOLA 2V26A 4MNDA 3UMHA 4EBKA 1RMVA 1K04A 2VASA 3LUTB 1Q0DA 2A0UA 3BRJA 2DGJA 3FAJA 4LDKA 3CSKA 1Q0KA 3ASNC 1L7CA 3GM3A 1OCZC 3AQCA 4GQHA 1MMAA 4HE8D 3EZHA 2YZSA 4KC9A 5DVWA 5BQGA 3RFYA 4AE4A 1A7DA 5A6AA 2VCBA 3DMDA 2WZLA 2A6HF 2FFHA 4NTBA 4YL0A 1JAFA 3FMSA 3RQGA 4XWJA 3O10A 2IXPA 4AL0A 2L6GA 1M57C 3NG1A 1MNDA 3H2VA 3J06A 1YYXA 2HV7A 2Z15A 1FMVA 2HV6A 3BEHA 3GEIA 3HNIA 3V5ZA 5FCLA 1T6UA 2LSEA 4O6MA 2XS8A 1ST6A 2EPLX 3EQLF 3M79A 1RJ9A 3MLGA 2GFHA 1YARO 4JEBA 5HV9A 2OCCC 2H7VC 3O6XA 4H54A 5E33A 1WTYA 3R7CA 3U9JA 1J8YF 1TQGA 1Z6AA 4MTOA 4DVYP 3WAQA 4IB4A 1YAUO 3FOPA 2GDCA 5JSLA 5AC4A 2MWQA 1OCRC 3R2PA 4JC7A 2KW3C 1RXQA 1OW7A 3PDMP 3WHNA 4JEAA 2LK4A 3DE8A 4I1OB 4PJNA 4YN0B 5T3TA 3TULA 2R7UA 3FHDA 1YLMA 3RH3A 1GS9A 2HMQA 2L7AA 5COFA 2W45A 3HNKA 2PFDA 3I4UA 4D4NA 3U2LA 3LESA 4JCZA 4BJTA 4CS7A 5A6JA 2NSGA 3AGTA 3NMIA 2J9UA 1A0BA 4KNWA 3A11A 4N6HA 4PR9A 3V7OA 2XSEA 4BEMJ 2A68F 4MVUA 2J45A 3FAPB 3G4ZA 4KI2A 2G3KA 2R7XA 3PHF2 2HFIA 3L8IA 1ZW3A 4JJFA 2YQYA 1C17M 4N6CA 4NC3A 4NTAA 2JPUA 1J8MF 4RD9A 4AX2A 3HLZA 5CIVA 3GWNA 3E9VA 2RD9A 2P7VA 4U5CE 1NBBA 3KYIA 3KMIA 2LD6A 4DBQA 2BC5A 2J46A 4IAOA 4XPYA 1Y4CA 1HE9A 4MVMA 3ZTMA 3K1IA 3C7JA 1CGNA 1SMYF 1TFOB 3N24A 4EUKB 3ABLC 2HMZA 3EHNA 3ZC4A 1FNTc 2DYSC 5HSWA 2IXOA 2YLDA 3ZWIA 2B0JA 2G3VA 2XLHA 4MVZA 4G7ZF 3DI5A 2QY9A 4U5BE 3ABMC 4NQFA 1WATA 1BR4A 2EPMX 3U0CA 3KH2A 3ECSA 1D0YA 5EGYA 2IXMA 3S29A 2D5RB 5BUOA 1XZPA 1D0ZA 4J30B 5D91A 3W2WA 4MVQA 1NG1A 5GPGB 4U5FE 2PF4E 1APCA 1W2WA 2NPUA 2Q3TA 1E84A 2X0CA 3K6BA 4LLCA 1VYKA 4J7TA 4W8PA 2Q00A 3NDBB 3K1HA 4R32A 1MMGA 1E83A 3JT1A 2DI3A 3EHMA 3I5PA 4O6NA 2C04A 3DAFA 3SP1A 4YWQA 3GEHA 2R7QA 3MFNA 5JUAA 3SXKA 4CSAA 4W8KA 3DJNB 4BPMA 1CGME 2V3CC 3EH2A 3IQ5A 4MVOA 3S28A 2CGEA 3CAXA 1T9KA 3LNRA 1EA8A 2CDQA 4LDQA 3V5YA 2WZFA 4Q7CA 3M4CA 3M4BA 4BJ6C 1HMOA 2CNWA 2W9YA 4XEFA 3EZIA 3GODA 3O55A 4Q4ZF 2XS1A 3ABKC 2J7PD 4EBJA 3PCVA 1LVKA 1OXKA 4MTFA 2BE5F 2LQGA 3LAYA 1OKKA 1YDIA 1UFBA 5DS4A 4ULVA 2QE9A 2HZ8A 1RKEA 3GORA 1V54C 3NKEA 2CYDA 2I15A 3UGPA 1NZEA 1QQ3A 2ICWG 3O39A 3AG2C 3S9OA 4HEAJ 1I5NA 2IOQA 3U3BA 1G8XA 1NSGB 3C8GD 3DWWA 3KKBA 5B1BC 5L0IA 4XEVA 4PFOA 3LJBA 3UNGC 2A69F 3DXJF 3TJ6A 5A6KA 5AGFA 3NYLA 2AP3A 3ZG1A 4CJGA 4IARA 1G5ZA 1ZHXA 3QTHA 2VH3A 1K40A 5EK0A 2KJGA 2ZXWC 3POVA 1D1CA 1AUEA 4I44A 2PX3A 3T6GB 2Y39A 4CS9C 3QW0A 4MW8A 3TJ5A 1WN0A 4GYTA 1PCXA 2R02A 2RSEB 2HS5A 3ZQYA 2D4UA 3NMJA 2Y3HA 1OR3A 3MBGA 1LE4A 2VC9A 4XLNF 1EQ1A 3T9OA 4DRIB 3M1CB 3EGXB 4ANJA 4C7OA 4CDAA 3KL4A 4I3MA 5L3QA 2L6HA 1OW8A 3RQFA 4ZLCA 1OKKD 3C63A 4MVRA 4JIOA 4G7HF 3T6JA 3TK0A 2OJED 1YVIA 2FAPB 3F47A 3HKKA 1SF8A 3C18A 1VYIA 5A6BA 5A69A 3S90A 4NTFA 2P6VA 3K33A 4FESA 1M2OA 1GM5A 4K7BA 3RF3A 3JCUQ 1LI7A 2NSFA 2J7PA 3T6BA 1BR1A 1F1MA 3GEEA 3JTLO 2QLAA 1BR2A 4CDYA 2M64A 3EG9B 4L6RA 1TKNA 3CEXA 3NRHA 4GEHA 2KGOA 2J0WA 2UUHA 2Y69C 2FGYA 4YK5A 3ZVRA 5DS6A 5L0FA 1AVOB 3DAGA 4EWCA 2YL0A 3EGXA 4Z9IA 3B29A 2R7SA 3N2ZB 4WABA 4CS8A 1NLXA 3C8GA 3DM9B 3LEOA 2E87A 1OCOC 1QPUA 1LKXA 1RKCA 2XLWA 3QMKA 4PJLA 1ZZPA 4U5HA 5F28E 5B1AC 2J8WA 4DOZA 5KYWA 2EIKC 1H6GA 3ZSUA 3EFOB 2XLOA 2KC3A 2O9XA 4BJ5A 5L0DA 1KNYA 5T3WA 2WZGA 2W4MA 2YRFA 4XLPF 1YYJA 3FDQA 2OOCA 1BBHA 2ZD9A 4B6IA 5TJ5E 3DZAA 4XTKA
chains in the Genus database with same CATH topology
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFK B;  1V74 B;  1TFO B; 
#chains in the Genus database with same CATH topology
 2IXN A;  4U5D E;  3B71 A;  1ORS C;  4Z9H A;  1V55 C;  3ZQV A;  2EPO A;  1E86 A;  2MHR A;  3EGD B;  2YWA A;  3DM5 A;  3N0T A;  4P9F A;  2L9J A;  4JJG A;  2W4B A;  3LNM B;  3IPM O;  4HFF B;  3AGU A;  3QW1 A;  1TWH A;  1XZQ A;  3H65 A;  1Z3I X;  4AK9 A;  1ZW2 A;  4P6I C;  4C3D A;  1L3P A;  4E17 A;  1QVX A;  1KTM A;  3AOU A;  2LIG A;  3V5X A;  2UUI A;  1Z7Q c;  3L0I A;  1BDJ B;  2HSB A;  3EPV A;  3U3F A;  4CS8 C;  1FTS A;  2EPN A;  3WG7 C;  2J0X A;  4QI2 A;  2YL7 A;  1H7I A;  2YVK A;  1H9G A;  4LAC B;  4EHP A;  3GAN A;  1MQV A;  4JRZ A;  5AC5 A;  256B A;  2GAQ A;  5CI9 A;  1V74 B;  4QDL A;  2ETS A;  1S7Z A;  1CPQ A;  4KBL A;  3LEV A;  5JS5 A;  1HY5 A;  3MYI A;  2WL8 A;  3SXM A;  2EIJ C;  2DB4 A;  3DD7 A;  1YA7 O;  4ULW A;  5DQZ A;  4U9E A;  4CIH A;  2YEV A;  1DOW A;  3U9M A;  4BJ5 C;  2F22 A;  3JYY A;  2XLV A;  5DQT A;  2AVK A;  1TWC A;  2OG2 A;  5KYX A;  1ZHT A;  1JPJ A;  1NU9 C;  1O5H A;  3HNJ A;  4JKV A;  3SXZ A;  2R7W A;  1Z63 A;  2P0N A;  4I1M A;  1M56 C;  3QVY A;  1OQC A;  1Q0G A;  2XM4 A;  3TOL A;  3ITF A;  3F46 A;  4U9D A;  3RIP A;  3RVZ A;  3VAY A;  4JCH A;  4Z9J A;  1WAS A;  1U6H A;  4YT5 A;  2XM0 A;  3UGO A;  2J9W A;  1FAP B;  2EIN C;  4YL3 A;  4OIN F;  1TWG A;  3NYJ A;  3K7D A;  2OEV A;  2GA0 A;  3IQ6 A;  1NU7 D;  3HJC A;  4O7G A;  5D92 A;  4DJ9 A;  4OIP F;  5E3A A;  3U8P A;  2XXA B;  5JP7 A;  3DE9 A;  3S0X A;  2R05 A;  1YA9 A;  3DJU B;  2C03 A;  3ATP A;  3IEE A;  4LLE A;  1G4U S;  2ZXP A;  3WOD F;  2LCH A;  1ZYR F;  2G62 A;  1YJG A;  1VOM A;  4JW1 A;  4U5E E;  2R9R B;  3K66 A;  1HE1 A;  4E7S A;  2EIL C;  5IY5 C;  2XL6 A;  1E85 A;  2ZPA A;  3SXY A;  1TFK B;  1R5I D;  2P61 A;  1MMD A;  1VLS A;  1GQA A;  4E18 A;  1GGQ A;  1VB5 A;  4IRU A;  4O6Y A;  2WVO A;  3MX3 A;  3AJM A;  1SZI A;  2J9B A;  3JZ0 A;  1FFH A;  4PJJ A;  4MVS A;  1LPE A;  1RKE B;  3OA1 A;  2HKV A;  3Q6N A;  1ORJ A;  3GM2 A;  3OWT A;  2A1D D;  1B68 A;  2M4E A;  4MW3 A;  4DXW A;  1JMW A;  1SR2 A;  3JSE O;  3QVZ A;  4J32 B;  2PBE A;  4CJO A;  2XXA A;  1OW6 A;  2H8A A;  3PMR A;  1O87 A;  4E0I A;  5L3V A;  1T01 A;  4AL1 A;  5L0G A;  4XQ1 A;  5DS5 A;  3JSZ A;  3UMI A;  2XLE A;  1K05 A;  1U0B B;  1ZVZ A;  4CBE A;  2XL4 A;  3AG1 C;  4AE4 B;  2NG1 A;  4OIO F;  3X2Q C;  4H4K C;  2NUP A;  1R4T A;  1U89 A;  5JRA A;  4K1O A;  3SYN A;  1QZX A;  2AWC A;  5KYX B;  2WVN A;  3TOM A;  1IW7 F;  4X0R A;  1LE2 A;  2R03 A;  3EG9 A;  4RBN A;  3RKO F;  3Q6M A;  4JTD B;  4G7O F;  4FWV A;  5CI8 A;  2P1A A;  1T5O A;  1NFO A;  2XLM A;  1LM3 B;  1T6Q A;  1VLT A;  4OD4 A;  4BJ6 A;  5KYN A;  1RJ9 B;  3W2V A;  4K0D A;  2TMV P;  3M15 A;  1LIH A;  3SNH A;  3ZDL A;  4Q5S F;  2AU5 A;  4A4A A;  1FFT C;  2WVQ A;  1T6I A;  1M2V B;  4C3E A;  1TWA A;  4JUR I;  1ZU5 A;  4JZA A;  2EPK X;  4M63 A;  1OXB A;  3TQO A;  3JYH A;  3OEO A;  2A6E F;  3EFO A;  4E0H A;  4FAP B;  4NCQ A;  2A0B A;  2YLG A;  2I8B A;  4JTC B;  4MS2 A;  5JT4 A;  3DKA A;  3C8Z A;  5T1D B;  2LP4 A;  2YL3 A;  3C8G B;  3FVY A;  2R7R A;  4IJJ A;  1SYQ A;  3H2U A;  1S05 A;  2JX0 A;  5COM A;  4YT8 A;  5KYY A;  2NUT B;  1WWP A;  3T4R A;  1VMA A;  2EIM C;  2IYL D;  2KQ9 A;  3L8J A;  3ZTZ A;  1MNE A;  1NFN A;  5KYU A;  3QZC A;  4C3B A;  1IZM A;  1JRA A;  3NYM A;  3US6 A;  3VF0 A;  5B3S C;  1BZ4 A;  1H9T A;  1LS1 A;  1QSP A;  4DRJ B;  1XWJ A;  5JLI A;  3HTK C;  4G78 A;  3NMK A;  3VRC A;  1O3U A;  3B0P A;  2GWW A;  2HJM A;  2VCA A;  2R7T A;  3RYL A;  2J9V A;  3IQC A;  4FX5 A;  4IWB A;  1HW1 A;  5L0J A;  3IQT A;  1YZA A;  3S27 A;  1I4Y A;  3LS1 A;  1QKR A;  2OQM A;  3X1O A;  1JPN A;  2ZXO A;  3AG4 C;  2VB6 A;  3I5Q A;  2L81 A;  3NKD A;  4MQ9 F;  5E3C A;  3ZIB A;  3FOO A;  4NY3 A;  4PJM A;  4WGZ A;  4BJ1 A;  1HMD A;  2OEX A;  1CPR A;  2Q9A A;  1C02 A;  1D1B A;  2OKU A;  1JR8 A;  2XLD A;  3RVY A;  1LI5 A;  1PD0 A;  4BEJ A;  4C7O B;  4HFK B;  1D1A A;  3U2M A;  1EKY A;  3AQB A;  5KYW B;  2OJQ A;  1EI7 A;  2Q9B A;  3RQE A;  3SZR A;  2AWY A;  1Q0F A;  4CDV A;  1YZC A;  4G0H A;  5COG A;  4CX9 A;  3G50 A;  1ORY A;  4DBR A;  2Y3G A;  2YL1 A;  4YL1 A;  4XPW A;  2QNL A;  2H7B A;  2R7O A;  3L1M A;  4D4X A;  3S84 A;  4OIQ F;  5FZT A;  2JD3 A;  3MYF A;  5A6B D;  2IBF A;  4PFP A;  3JRT A;  4IGG A;  3B0V C;  2Q9C A;  4J7Y A;  4WJ0 A;  4PAC A;  2YHS A;  4WGY A;  4CS9 A;  3LLK A;  3LLI A;  1ZHW A;  1MMN A;  2HJ3 A;  2YLI A;  3L34 A;  1E2X A;  4YT4 A;  2L6F A;  4N06 A;  2LFF A;  3W8I A;  3LS0 A;  4EBB A;  2YKZ A;  3C62 A;  4A2N B;  4QI0 A;  1WGW A;  2R25 A;  2NUT A;  5KYU B;  3EJN A;  4XEK A;  2HSQ A;  2KK1 A;  3K1I C;  3Q7L A;  4EIY A;  5BQI A;  2DYR C;  3ASO C;  3GWL A;  1G4W R;  2ZXR A;  2NUP B;  3KYJ A;  5K0I A;  3UR3 C;  4UDV A;  1DOV A;  3IHU A;  3TD7 A;  4BG0 A;  5EHH A;  1Z23 A;  2WB7 A;  3FXH A;  4F4B A;  4N4W A;  1OCC C;  5BQH A;  2Y3D A;  1PV3 A;  4IAQ A;  1M2V A;  1V4A A;  4MTG A;  2H7O A;  3W8H A;  2VCC A;  3KPH A;  1Z5Z A;  1ZHY A;  1C03 A;  3GM1 A;  4YJW A;  4U5G A;  3Q7G A;  3E70 C;  1PD1 A;  2CNW D;  1VK5 A;  2PP4 A;  2OU6 A;  1A7E A;  3A9C A;  1D0X A;  3AG3 C;  3EH1 A;  4CIP A;  3HNL A;  4JVS A;  3B9Q A;  4DVZ A;  1TR2 A;  2QTV A;  3EGD A;  2B0H A;  2XRH A;  4LER A;  5F5H A;  5L0H A;  2PNO A;  2BL2 A;  1LS4 A;  2Q4F A;  3SEO A;  1JOG A;  2Q7R A;  5JVE A;  2ASR A;  1I4Z A;  1M6T A;  3W4Y A;  4JTA B;  1VTM P;  1ZHZ A;  4ONS A;  5KYY B;  1Q0M A;  4KNV A;  4O79 A;  2CCY A;  5DLJ A;  1ZU4 A;  4P9T A;  2MYS A;  2X51 A;  4PK4 A;  2KNH A;  5B3I A;  4EKW A;  2PX0 A;  3CZ6 A;  4ZLD A;  3RW0 A;  3B0U X;  1AEP A;  2KYH A;  5E2Q A;  4OIR F;  4RDA A;  1HW2 A;  3UMK A;  4CSA C;  1UG7 A;  4YT2 A;  1N1C A;  2IM8 A;  3U8V A;  2HUJ A;  1RCP A;  1A41 A;  2QUP A;  3VYW A;  4OD5 A;  1CGO A;  1OR2 A;  2KSF A;  3JRM O;  4JE9 A;  3U5S A;  2Y3B A;  4ER9 A;  1FMW A;  1A7V A;  1Y6D A;  2CW0 F;  5L0C A;  1FR0 A;  2XL8 A;  5F5F A;  1QLE C;  4E7Z A;  2LFD A;  3VM6 A;  3CQZ A;  2R7V A;  4DRH B;  3G4X A;  4LDR A;  4XPX A;  1KU2 A;  1WOL A;  2V26 A;  4MND A;  3UMH A;  4EBK A;  1RMV A;  1K04 A;  2VAS A;  3LUT B;  1Q0D A;  2A0U A;  3BRJ A;  2DGJ A;  3FAJ A;  4LDK A;  3CSK A;  1Q0K A;  3ASN C;  1L7C A;  3GM3 A;  1OCZ C;  3AQC A;  4GQH A;  1MMA A;  4HE8 D;  3EZH A;  2YZS A;  4KC9 A;  5DVW A;  5BQG A;  3RFY A;  4AE4 A;  1A7D A;  5A6A A;  2VCB A;  3DMD A;  2WZL A;  2A6H F;  2FFH A;  4NTB A;  4YL0 A;  1JAF A;  3FMS A;  3RQG A;  4XWJ A;  3O10 A;  2IXP A;  4AL0 A;  2L6G A;  1M57 C;  3NG1 A;  1MND A;  3H2V A;  3J06 A;  1YYX A;  2HV7 A;  2Z15 A;  1FMV A;  2HV6 A;  3BEH A;  3GEI A;  3HNI A;  3V5Z A;  5FCL A;  1T6U A;  2LSE A;  4O6M A;  2XS8 A;  1ST6 A;  2EPL X;  3EQL F;  3M79 A;  1RJ9 A;  3MLG A;  2GFH A;  1YAR O;  4JEB A;  5HV9 A;  2OCC C;  2H7V C;  3O6X A;  4H54 A;  5E33 A;  1WTY A;  3R7C A;  3U9J A;  1J8Y F;  1TQG A;  1Z6A A;  4MTO A;  4DVY P;  3WAQ A;  4IB4 A;  1YAU O;  3FOP A;  2GDC A;  5JSL A;  5AC4 A;  2MWQ A;  1OCR C;  3R2P A;  4JC7 A;  2KW3 C;  1RXQ A;  1OW7 A;  3PDM P;  3WHN A;  4JEA A;  2LK4 A;  3DE8 A;  4I1O B;  4PJN A;  4YN0 B;  5T3T A;  3TUL A;  2R7U A;  3FHD A;  1YLM A;  3RH3 A;  1GS9 A;  2HMQ A;  2L7A A;  5COF A;  2W45 A;  3HNK A;  2PFD A;  3I4U A;  4D4N A;  3U2L A;  3LES A;  4JCZ A;  4BJT A;  4CS7 A;  5A6J A;  2NSG A;  3AGT A;  3NMI A;  2J9U A;  1A0B A;  4KNW A;  3A11 A;  4N6H A;  4PR9 A;  3V7O A;  2XSE A;  4BEM J;  2A68 F;  4MVU A;  2J45 A;  3FAP B;  3G4Z A;  4KI2 A;  2G3K A;  2R7X A;  3PHF 2;  2HFI A;  3L8I A;  1ZW3 A;  4JJF A;  2YQY A;  1C17 M;  4N6C A;  4NC3 A;  4NTA A;  2JPU A;  1J8M F;  4RD9 A;  4AX2 A;  3HLZ A;  5CIV A;  3GWN A;  3E9V A;  2RD9 A;  2P7V A;  4U5C E;  1NBB A;  3KYI A;  3KMI A;  2LD6 A;  4DBQ A;  2BC5 A;  2J46 A;  4IAO A;  4XPY A;  1Y4C A;  1HE9 A;  4MVM A;  3ZTM A;  3K1I A;  3C7J A;  1CGN A;  1SMY F;  1TFO B;  3N24 A;  4EUK B;  3ABL C;  2HMZ A;  3EHN A;  3ZC4 A;  1FNT c;  2DYS C;  5HSW A;  2IXO A;  2YLD A;  3ZWI A;  2B0J A;  2G3V A;  2XLH A;  4MVZ A;  4G7Z F;  3DI5 A;  2QY9 A;  4U5B E;  3ABM C;  4NQF A;  1WAT A;  1BR4 A;  2EPM X;  3U0C A;  3KH2 A;  3ECS A;  1D0Y A;  5EGY A;  2IXM A;  3S29 A;  2D5R B;  5BUO A;  1XZP A;  1D0Z A;  4J30 B;  5D91 A;  3W2W A;  4MVQ A;  1NG1 A;  5GPG B;  4U5F E;  2PF4 E;  1APC A;  1W2W A;  2NPU A;  2Q3T A;  1E84 A;  2X0C A;  3K6B A;  4LLC A;  1VYK A;  4J7T A;  4W8P A;  2Q00 A;  3NDB B;  3K1H A;  4R32 A;  1MMG A;  1E83 A;  3JT1 A;  2DI3 A;  3EHM A;  3I5P A;  4O6N A;  2C04 A;  3DAF A;  3SP1 A;  4YWQ A;  3GEH A;  2R7Q A;  3MFN A;  5JUA A;  3SXK A;  4CSA A;  4W8K A;  3DJN B;  4BPM A;  1CGM E;  2V3C C;  3EH2 A;  3IQ5 A;  4MVO A;  3S28 A;  2CGE A;  3CAX A;  1T9K A;  3LNR A;  1EA8 A;  2CDQ A;  4LDQ A;  3V5Y A;  2WZF A;  4Q7C A;  3M4C A;  3M4B A;  4BJ6 C;  1HMO A;  2CNW A;  2W9Y A;  4XEF A;  3EZI A;  3GOD A;  3O55 A;  4Q4Z F;  2XS1 A;  3ABK C;  2J7P D;  4EBJ A;  3PCV A;  1LVK A;  1OXK A;  4MTF A;  2BE5 F;  2LQG A;  3LAY A;  1OKK A;  1YDI A;  1UFB A;  5DS4 A;  4ULV A;  2QE9 A;  2HZ8 A;  1RKE A;  3GOR A;  1V54 C;  3NKE A;  2CYD A;  2I15 A;  3UGP A;  1NZE A;  1QQ3 A;  2ICW G;  3O39 A;  3AG2 C;  3S9O A;  4HEA J;  1I5N A;  2IOQ A;  3U3B A;  1G8X A;  1NSG B;  3C8G D;  3DWW A;  3KKB A;  5B1B C;  5L0I A;  4XEV A;  4PFO A;  3LJB A;  3UNG C;  2A69 F;  3DXJ F;  3TJ6 A;  5A6K A;  5AGF A;  3NYL A;  2AP3 A;  3ZG1 A;  4CJG A;  4IAR A;  1G5Z A;  1ZHX A;  3QTH A;  2VH3 A;  1K40 A;  5EK0 A;  2KJG A;  2ZXW C;  3POV A;  1D1C A;  1AUE A;  4I44 A;  2PX3 A;  3T6G B;  2Y39 A;  4CS9 C;  3QW0 A;  4MW8 A;  3TJ5 A;  1WN0 A;  4GYT A;  1PCX A;  2R02 A;  2RSE B;  2HS5 A;  3ZQY A;  2D4U A;  3NMJ A;  2Y3H A;  1OR3 A;  3MBG A;  1LE4 A;  2VC9 A;  4XLN F;  1EQ1 A;  3T9O A;  4DRI B;  3M1C B;  3EGX B;  4ANJ A;  4C7O A;  4CDA A;  3KL4 A;  4I3M A;  5L3Q A;  2L6H A;  1OW8 A;  3RQF A;  4ZLC A;  1OKK D;  3C63 A;  4MVR A;  4JIO A;  4G7H F;  3T6J A;  3TK0 A;  2OJE D;  1YVI A;  2FAP B;  3F47 A;  3HKK A;  1SF8 A;  3C18 A;  1VYI A;  5A6B A;  5A69 A;  3S90 A;  4NTF A;  2P6V A;  3K33 A;  4FES A;  1M2O A;  1GM5 A;  4K7B A;  3RF3 A;  3JCU Q;  1LI7 A;  2NSF A;  2J7P A;  3T6B A;  1BR1 A;  1F1M A;  3GEE A;  3JTL O;  2QLA A;  1BR2 A;  4CDY A;  2M64 A;  3EG9 B;  4L6R A;  1TKN A;  3CEX A;  3NRH A;  4GEH A;  2KGO A;  2J0W A;  2UUH A;  2Y69 C;  2FGY A;  4YK5 A;  3ZVR A;  5DS6 A;  5L0F A;  1AVO B;  3DAG A;  4EWC A;  2YL0 A;  3EGX A;  4Z9I A;  3B29 A;  2R7S A;  3N2Z B;  4WAB A;  4CS8 A;  1NLX A;  3C8G A;  3DM9 B;  3LEO A;  2E87 A;  1OCO C;  1QPU A;  1LKX A;  1RKC A;  2XLW A;  3QMK A;  4PJL A;  1ZZP A;  4U5H A;  5F28 E;  5B1A C;  2J8W A;  4DOZ A;  5KYW A;  2EIK C;  1H6G A;  3ZSU A;  3EFO B;  2XLO A;  2KC3 A;  2O9X A;  4BJ5 A;  5L0D A;  1KNY A;  5T3W A;  2WZG A;  2W4M A;  2YRF A;  4XLP F;  1YYJ A;  3FDQ A;  2OOC A;  1BBH A;  2ZD9 A;  4B6I A;  5TJ5 E;  3DZA A;  4XTK A; 
#chains in the Genus database with same CATH homology
 1TFK B;  1V74 B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...