1V74B

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic/immune system
molecule keywords Colicin D
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09204 Colicin_immun Bacterial self-protective colicin-like immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1v74B00
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH superfamily
3K7DA 2P1AA 3JT1A 3TK0A 3ZTMA 5BQIA 3GWLA 1CPRA 1ST6A 3Q6NA 5DVWA 1HE1A 3MLGA 4CBEA 2PX3A 1M6TA 4KNVA 3C8GA 4LDRA 1LI5A 3KMIA 1Q0FA 4BJ5C 2PFDA 2XLHA 4F4BA 5B3SC 2XLDA 3TOMA 3HNKA 3ZTZA 3RIPA 2I15A 2JD3A 2XRHA 1H6GA 3HNJA 4I1OB 2HV7A 4IJJA 4MTFA 4XLNF 5DQTA 2C03A 4WGZA 2YVKA 1SR2A 3B0UX 1U6HA 2P61A 4JTAB 4MVUA 2R7QA 1ZW2A 3LS1A 5JVEA 2ZXOA 4E7ZA 3DWWA 3C8GD 1NBBA 3RYLA 2OG2A 3C8GB 5L0JA 4Q4ZF 3LLKA 5CIVA 1DOVA 2NG1A 4KBLA 2KC3A 4I1MA 4E0HA 1ORJA 2J8WA 5EHHA 4CS9A 4FAPB 3RVZA 1YZAA 4EKWA 4JCZA 4GQHA 1NLXA 2BL2A 2W4BA 4JW1A 4G78A 2ZXWC 2EPOA 2IOQA 3DE8A 3L34A 5FZTA 3E70C 3EZHA 1NG1A 5BQHA 1QSPA 4IWBA 2YZSA 1ZHYA 3TJ5A 4DBRA 3UGOA 4ULWA 3ZIBA 3NYLA 3US6A 3ZVRA 4RBNA 2WVNA 3S29A 3IQTA 3TOLA 4IGGA 3ASNC 2PNOA 3K6BA 3JZ0A 1Z5ZA 1MMDA 3DM9B 2QLAA 3ECSA 3Q6MA 1BR4A 1MMNA 1A7DA 2YLDA 3AQBA 4XPXA 2CNWA 3JTLO 4AL1A 1AVOB 3KYJA 1CGOA 1VYKA 3C8ZA 3GEIA 3WAQA 1E83A 1JRAA 2OEVA 4FX5A 5L0GA 3UGPA 1ZYRF 3T6JA 2ZD9A 3JRMO 5E3AA 2Q9AA 3VAYA 1MMAA 4NC3A 4ER9A 3SXZA 2C04A 1T6QA 1G8XA 5BQGA 1FR0A 2A6HF 4MQ9F 1UFBA 1RMVA 3PDMP 3KKBA 5A6BA 1Y6DA 4J7TA 1PD0A 4LDQA 2OQMA 2XXAB 4MVQA 3RQFA 1RJ9A 4XEKA 2CNWD 2YL7A 5A69A 3DAGA 2GA0A 3JSEO 1HW2A 3SXYA 3V7OA 3LUTB 4NCQA 3EGXA 2W45A 5BUOA 2ICWG 2CDQA 2OEXA 3AGUA 4G0HA 5IY5C 2EINC 2YL0A 4K0DA 1EKYA 3I4UA 2V3CC 1D1CA 1VB5A 2ZXRA 2TMVP 3LESA 2OU6A 3U5SA 4PK4A 1D1AA 5L0DA 4DRHB 2KGOA 4N06A 1A7EA 2VC9A 2M64A 2WZFA 1FFTC 1OCZC 4AX2A 2W4MA 2QE9A 2L7AA 2W9YA 3CZ6A 3QTHA 5B1BC 4MTOA 1XZPA 2E87A 2DB4A 3O55A 2EPLX 3EGXB 3B9QA 4Z9JA 2UUHA 4JTDB 2F22A 2Y3HA 2J7PA 1A41A 2XS1A 1BBHA 3C7JA 4G7HF 4O79A 4BG0A 5EGYA 1FAPB 1JPNA 4O6NA 5F5FA 1OKKD 2EIMC 3OWTA 1V55C 4YT8A 3EG9A 2KK1A 4C7OA 5KYYA 4M63A 4BPMA 4LACB 2Q9BA 4PFPA 4CJGA 3G4ZA 4XEFA 2AU5A 3O6XA 4RD9A 1EQ1A 2XLMA 3QMKA 4ZLCA 3GM2A 2J7PD 2VH3A 1TQGA 1ZU4A 3KL4A 2EPKX 4EBJA 1AEPA 1LS4A 4MVZA 1XZQA 1Z6AA 2LP4A 3A9CA 1NFNA 4CSAC 3EG9B 1QVXA 4C3DA 5COFA 3F47A 3N24A 1Q0GA 4N6CA 3VYWA 4PR9A 4FESA 1D0YA 3U8VA 4BEJA 4DBQA 3S0XA 3U0CA 1OCRC 1DOWA 1C03A 1J8MF 1OXBA 1WTYA 1ZVZA 4FWVA 3NG1A 3UMIA 2Y39A 4JCHA 1LI7A 2J9UA 1QPUA 2NPUA 3LJBA 1VTMP 1GM5A 2KJGA 3PCVA 1E2XA 5K0IA 3IHUA 4KI2A 4OIPF 4HEAJ 1A0BA 1T6IA 3HKKA 2XL4A 2YHSA 4P9FA 3S27A 4J7YA 2AWCA 3RQEA 3TULA 2L9JA 3K1IA 2R7VA 1WATA 2P6VA 3B71A 5JRAA 3T4RA 1GQAA 4QI2A 2HUJA 2HMQA 4UDVA 2LFFA 2WVQA 4PACA 1L3PA 1YVIA 3KH2A 4DXWA 2OJED 1HMOA 2IM8A 3HJCA 1ORYA 1RKEA 2HSQA 1SMYF 5KYYB 5D92A 3PMRA 3B0VC 4G7OF 4LLCA 1KTMA 1HY5A 1MNEA 4JEBA 4MS2A 3X2QC 1TWGA 1CPQA 1LIHA 2FFHA 1BZ4A 4DJ9A 4EWCA 2XM4A 3KPHA 1R4TA 2P0NA 1ZW3A 3IQ6A 1SZIA 1T5OA 1ZZPA 4OIOF 1LE2A 3U8PA 2OKUA 2PP4A 2R25A 3CSKA 4PJLA 3X1OA 3IQCA 2YWAA 4XPWA 1S7ZA 1WGWA 4CS8A 3U3FA 1NFOA 1F1MA 4Z9IA 1OR3A 1RKEB 3ASOC 3EH1A 3QW1A 4CJOA 4NTBA 4W8PA 2ZPAA 1LVKA 4O7GA 4J32B 1D1BA 1FMVA 1Z3IX 3ZSUA 4K1OA 1RXQA 4MW8A 4P6IC 1TKNA 4DRIB 2H7BA 1E86A 3FAPB 2Q9CA 4P9TA 1YJGA 1HE9A 1R5ID 2QY9A 2J0WA 5B1AC 3J06A 3DAFA 2B0JA 2EIKC 4MVRA 5DQZA 2NSFA 2A0BA 2R7SA 4OD5A 1H9TA 3W4YA 1FFHA 2AP3A 5T3WA 2HS5A 4E7SA 1D0XA 2KSFA 5A6AA 5DS5A 3EHNA 1QLEC 2XXAA 2LD6A 3AGTA 3RVYA 1Z63A 2NUPB 2A1DD 3GEHA 3GORA 4MVOA 5T1DB 3RW0A 1WN0A 5DLJA 3N0TA 4U5HA 4YT2A 1M57C 2XLWA 3POVA 1B68A 1WWPA 3O10A 2LIGA 3GM1A 3FMSA 1J8YF 1YA7O 1BDJB 3SYNA 1LM3B 3GM3A 4LLEA 4NQFA 3UMKA 4JJGA 3L0IA 3NKDA 1EA8A 3NYMA 1YYJA 5A6JA 4H54A 2VCCA 3HNLA 4JC7A 4U5DE 3IQ5A 4JE9A 2Q4FA 2PX0A 1E85A 2Y69C 4LDKA 4U5FE 3M79A 5CI9A 2XL6A 4JRZA 3LS0A 2FAPB 2PF4E 2WVOA 3AG1C 5JP7A 4EUKB 4KNWA 2B0HA 3JCUQ 3L8IA 2WL8A 5F28E 2MYSA 4CDAA 1RCPA 3L1MA 4E0IA 3AG2C 3W8HA 2WB7A 5L3VA 3V5YA 4XPYA 2EPNA 1VK5A 3SXMA 4EHPA 3A11A 4JEAA 2R7TA 1OKKA 1VLTA 1KU2A 2Y3DA 3U9JA 3U9MA 1NU7D 2AVKA 5DS6A 3SEOA 3ZDLA 2M4EA 2R7RA 4H4KC 5AC5A 2Y3GA 3H2UA 3ZQYA 3M4BA 1HW1A 4QI0A 1TWHA 3LNMB 1OR2A 3FHDA 2IXPA 2IXNA 1Q0KA 1O5HA 3M15A 2LFDA 2OCCC 1ORSC 2HJ3A 4AE4A 3H2VA 1L7CA 3EGDA 3Q7GA 4MNDA 2XS8A 4ULVA 1LKXA 5KYNA 1OQCA 2J46A 1PCXA 2XM0A 5COMA 4OIRF 4E17A 1CGNA 2G3VA 1JOGA 2GDCA 4OD4A 4EBBA 4PJNA 3OEOA 2YLGA 3ABKC 4AK9A 4DVZA 3AQCA 2RD9A 2H7VC 1TWAA 4NY3A 1O87A 4CSAA 3AG4C 3DXJF 2YRFA 4JTCB 4AE4B 2J9VA 3ZC4A 3NDBB 3EGDB 2NUTA 1K04A 2RSEB 3Q7LA 3QW0A 3M1CB 4OIQF 3CEXA 4C3EA 2ETSA 4CIPA 3B29A 5KYWA 1PD1A 3S90A 1C02A 1U89A 3O39A 1YAUO 4YT5A 3B0PA 3HNIA 3PHF2 3K1HA 1K40A 256BA 2FGYA 4JZAA 4BJTA 1EI7A 2BE5F 3DJNB 2VCBA 3MYIA 4IAOA 4IRUA 4Q7CA 2XL8A 3E9VA 1UG7A 3EHMA 3EH2A 4BJ6C 2MHRA 4WABA 3RQGA 2WZGA 3R7CA 4B6IA 4BJ1A 4JJFA 1JMWA 2NUTB 3WODF 3ABMC 2R7OA 2L81A 5T3TA 5KYWB 2KW3C 3T9OA 3GEEA 4BJ5A 3SXKA 4AL0A 5B3IA 3VRCA 2D4UA 4QDLA 1GS9A 4I3MA 1SYQA 2ASRA 4PJJA 5EK0A 1FNTc 4EBKA 3RKOF 2D5RB 1I5NA 5E3CA 3ZQVA 1QQ3A 4HFFB 3WG7C 3QVZA 5L0CA 3CAXA 3VM6A 3SNHA 1H7IA 4YK5A 2H8AA 3LLIA 1YDIA 3DJUB 4ONSA 2BC5A 2AWYA 3G50A 2X0CA 1KNYA 4U5BE 3AOUA 4WGYA 4YJWA 4XLPF 1VOMA 4LERA 4X0RA 4HFKB 1Q0MA 1Z23A 4C3BA 3LAYA 4XEVA 4DOZA 3MYFA 3NMIA 4IARA 2DYRC 2DYSC 1OCCC 4OINF 2R7UA 3UMHA 2KNHA 3S28A 4Q5SF 3OA1A 1RKCA 3NKEA 3WHNA 5HV9A 1YYXA 1OW6A 3AJMA 3BRJA 1G4WR 2VB6A 1O3UA 1HMDA 3FXHA 1MNDA 2KQ9A 4K7BA 4YL3A 2XLEA 1QZXA 3UR3C 3K1IC 2G3KA 5JLIA 2NSGA 4U9DA 1T01A 1ZU5A 1VYIA 4JKVA 3W8IA 4IB4A 3NMKA 1JAFA 2LK4A 2NUPA 3GANA 1TR2A 3LEOA 1ZHXA 5CI8A 2KYHA 2JX0A 3T6GB 3L8JA 4IAQA 4U5EE 3EFOA 5JSLA 4D4NA 3FOPA 1ZHTA 2EPMX 3JYHA 4KC9A 2YEVA 3VF0A 1V54C 2HSBA 2XLVA 1OXKA 1M2OA 3GODA 2R02A 4GEHA 4WJ0A 1T6UA 1YZCA 1FMWA 3DE9A 1D0ZA 2HMZA 1ZHWA 3BEHA 3C63A 2HZ8A 2YLIA 3LEVA 3SP1A 2XLOA 5E2QA 4YWQA 2HV6A 3QZCA 5KYXA 3K33A 3DD7A 4NTAA 4CS8C 1E84A 3EZIA 3SZRA 4ZLDA 1TFOB 2Q00A 3EFOB 1M2VA 2P7VA 1I4YA 1TWCA 1WOLA 2DI3A 2IXMA 4CS7A 4D4XA 4W8KA 1H9GA 2HJMA 4U5GA 4CS9C 2R03A 3M4CA 2GAQA 4JIOA 2L6GA 1W2WA 1IZMA 2HKVA 1TFKB 2DGJA 2ZXPA 3W2WA 5L0IA 1YLMA 3T6BA 2J0XA 1OW7A 4MW3A 5GPGB 3S9OA 1VMAA 1NSGB 3U2LA 5KYXB 5TJ5E 4O6MA 2IYLD 1M2VB 2WZLA 3V5ZA 2CCYA 5A6KA 3F46A 5FCLA 5E33A 4YT4A 4ANJA 5JT4A 4PFOA 5JUAA 3ZG1A 3K66A 3ITFA 4CDYA 3FAJA 2R05A 1MMGA 2X51A 3HLZA 3IEEA 3MFNA 2YQYA 1G4US 4DRJB 1M56C 1WASA 2EIJC 2YKZA 1LS1A 4EIYA 1U0BB 5AC4A 4YL1A 1VLSA 3QVYA 1SF8A 3DZAA 4N4WA 4CDVA 2YL1A 3DI5A 3DM5A 3H65A 4YN0B 2XSEA 4XWJA 3TJ6A 2LCHA 3EQLF 4N6HA 1QKRA 3G4XA 3RH3A 3AG3C 3V5XA 3JSZA 4U5CE 1APCA 2CW0F 1YARO 2QTVA 5D91A 4JVSA 5F5HA 3U3BA 4PJMA 5COGA 1LE4A 2VCAA 1NZEA 2CYDA 4I44A 4MVMA 4A4AA 5HSWA 3GWNA 5L3QA 3I5PA 2J45A 3IPMO 4RDAA 2GWWA 2LSEA 2A68F 4CX9A 4Z9HA 3NYJA 3ZWIA 4A2NB 2OOCA 3UNGC 5A6BD 2JPUA 4XTKA 2G62A 1A7VA 3MX3A 4NTFA 4E18A 2J9WA 1RJ9B 1AUEA 1JR8A 3DKAA 2R7WA 2GFHA 3JRTA 3FVYA 3I5QA 1I4ZA 1MQVA 2A69F 1N1CA 1ZHZA 3RF3A 3N2ZB 1PV3A 5AGFA 5L0HA 2YL3A 5KYUA 4BJ6A 1C17M 1CGME 4U9EA 3MBGA 1OW8A 3FOOA 3KYIA 1Q0DA 1FTSA 1V4AA 3C62A 4MTGA 4CIHA 3HTKC 2PBEA 2QUPA 2HFIA 1IW7F 1XWJA 3ATPA 2H7OA 2I8BA 2L6FA 2Q7RA 2QNLA 1V74B 4DVYP 4L6RA 1YA9A 3W2VA 2UUIA 4G7ZF 1LPEA 1Z7Qc 2CGEA 3C18A 3FDQA 1K05A 3R2PA 4GYTA 2LQGA 2A0UA 5KYUB 2IBFA 3S84A 3EJNA 2V26A 1T9KA 4YL0A 2MWQA 3NMJA 4R32A 2EILC 3EPVA 4XQ1A 2J9BA 3U2MA 2L6HA 1S05A 1OCOC 2A6EF 4MVSA 3RFYA 1NU9C 1JPJA 4J30B 5JS5A 5L0FA 4C7OB 4O6YA 2Q3TA 3JYYA 3NRHA 3TD7A 1BR2A 2O9XA 5DS4A 1G5ZA 3LNRA 4JURI 2OJQA 3ABLC 1Y4CA 3DMDA 1BR1A 2R9RB 2Z15A 3TQOA 4BEMJ 2VASA 2R7XA 2Y3BA 3CQZA 2IXOA 4HE8D 1GGQA
chains in the Genus database with same CATH topology
1TFKB 1V74B 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFK B;  1V74 B;  1TFO B; 
#chains in the Genus database with same CATH topology
 3K7D A;  2P1A A;  3JT1 A;  3TK0 A;  3ZTM A;  5BQI A;  3GWL A;  1CPR A;  1ST6 A;  3Q6N A;  5DVW A;  1HE1 A;  3MLG A;  4CBE A;  2PX3 A;  1M6T A;  4KNV A;  3C8G A;  4LDR A;  1LI5 A;  3KMI A;  1Q0F A;  4BJ5 C;  2PFD A;  2XLH A;  4F4B A;  5B3S C;  2XLD A;  3TOM A;  3HNK A;  3ZTZ A;  3RIP A;  2I15 A;  2JD3 A;  2XRH A;  1H6G A;  3HNJ A;  4I1O B;  2HV7 A;  4IJJ A;  4MTF A;  4XLN F;  5DQT A;  2C03 A;  4WGZ A;  2YVK A;  1SR2 A;  3B0U X;  1U6H A;  2P61 A;  4JTA B;  4MVU A;  2R7Q A;  1ZW2 A;  3LS1 A;  5JVE A;  2ZXO A;  4E7Z A;  3DWW A;  3C8G D;  1NBB A;  3RYL A;  2OG2 A;  3C8G B;  5L0J A;  4Q4Z F;  3LLK A;  5CIV A;  1DOV A;  2NG1 A;  4KBL A;  2KC3 A;  4I1M A;  4E0H A;  1ORJ A;  2J8W A;  5EHH A;  4CS9 A;  4FAP B;  3RVZ A;  1YZA A;  4EKW A;  4JCZ A;  4GQH A;  1NLX A;  2BL2 A;  2W4B A;  4JW1 A;  4G78 A;  2ZXW C;  2EPO A;  2IOQ A;  3DE8 A;  3L34 A;  5FZT A;  3E70 C;  3EZH A;  1NG1 A;  5BQH A;  1QSP A;  4IWB A;  2YZS A;  1ZHY A;  3TJ5 A;  4DBR A;  3UGO A;  4ULW A;  3ZIB A;  3NYL A;  3US6 A;  3ZVR A;  4RBN A;  2WVN A;  3S29 A;  3IQT A;  3TOL A;  4IGG A;  3ASN C;  2PNO A;  3K6B A;  3JZ0 A;  1Z5Z A;  1MMD A;  3DM9 B;  2QLA A;  3ECS A;  3Q6M A;  1BR4 A;  1MMN A;  1A7D A;  2YLD A;  3AQB A;  4XPX A;  2CNW A;  3JTL O;  4AL1 A;  1AVO B;  3KYJ A;  1CGO A;  1VYK A;  3C8Z A;  3GEI A;  3WAQ A;  1E83 A;  1JRA A;  2OEV A;  4FX5 A;  5L0G A;  3UGP A;  1ZYR F;  3T6J A;  2ZD9 A;  3JRM O;  5E3A A;  2Q9A A;  3VAY A;  1MMA A;  4NC3 A;  4ER9 A;  3SXZ A;  2C04 A;  1T6Q A;  1G8X A;  5BQG A;  1FR0 A;  2A6H F;  4MQ9 F;  1UFB A;  1RMV A;  3PDM P;  3KKB A;  5A6B A;  1Y6D A;  4J7T A;  1PD0 A;  4LDQ A;  2OQM A;  2XXA B;  4MVQ A;  3RQF A;  1RJ9 A;  4XEK A;  2CNW D;  2YL7 A;  5A69 A;  3DAG A;  2GA0 A;  3JSE O;  1HW2 A;  3SXY A;  3V7O A;  3LUT B;  4NCQ A;  3EGX A;  2W45 A;  5BUO A;  2ICW G;  2CDQ A;  2OEX A;  3AGU A;  4G0H A;  5IY5 C;  2EIN C;  2YL0 A;  4K0D A;  1EKY A;  3I4U A;  2V3C C;  1D1C A;  1VB5 A;  2ZXR A;  2TMV P;  3LES A;  2OU6 A;  3U5S A;  4PK4 A;  1D1A A;  5L0D A;  4DRH B;  2KGO A;  4N06 A;  1A7E A;  2VC9 A;  2M64 A;  2WZF A;  1FFT C;  1OCZ C;  4AX2 A;  2W4M A;  2QE9 A;  2L7A A;  2W9Y A;  3CZ6 A;  3QTH A;  5B1B C;  4MTO A;  1XZP A;  2E87 A;  2DB4 A;  3O55 A;  2EPL X;  3EGX B;  3B9Q A;  4Z9J A;  2UUH A;  4JTD B;  2F22 A;  2Y3H A;  2J7P A;  1A41 A;  2XS1 A;  1BBH A;  3C7J A;  4G7H F;  4O79 A;  4BG0 A;  5EGY A;  1FAP B;  1JPN A;  4O6N A;  5F5F A;  1OKK D;  2EIM C;  3OWT A;  1V55 C;  4YT8 A;  3EG9 A;  2KK1 A;  4C7O A;  5KYY A;  4M63 A;  4BPM A;  4LAC B;  2Q9B A;  4PFP A;  4CJG A;  3G4Z A;  4XEF A;  2AU5 A;  3O6X A;  4RD9 A;  1EQ1 A;  2XLM A;  3QMK A;  4ZLC A;  3GM2 A;  2J7P D;  2VH3 A;  1TQG A;  1ZU4 A;  3KL4 A;  2EPK X;  4EBJ A;  1AEP A;  1LS4 A;  4MVZ A;  1XZQ A;  1Z6A A;  2LP4 A;  3A9C A;  1NFN A;  4CSA C;  3EG9 B;  1QVX A;  4C3D A;  5COF A;  3F47 A;  3N24 A;  1Q0G A;  4N6C A;  3VYW A;  4PR9 A;  4FES A;  1D0Y A;  3U8V A;  4BEJ A;  4DBQ A;  3S0X A;  3U0C A;  1OCR C;  1DOW A;  1C03 A;  1J8M F;  1OXB A;  1WTY A;  1ZVZ A;  4FWV A;  3NG1 A;  3UMI A;  2Y39 A;  4JCH A;  1LI7 A;  2J9U A;  1QPU A;  2NPU A;  3LJB A;  1VTM P;  1GM5 A;  2KJG A;  3PCV A;  1E2X A;  5K0I A;  3IHU A;  4KI2 A;  4OIP F;  4HEA J;  1A0B A;  1T6I A;  3HKK A;  2XL4 A;  2YHS A;  4P9F A;  3S27 A;  4J7Y A;  2AWC A;  3RQE A;  3TUL A;  2L9J A;  3K1I A;  2R7V A;  1WAT A;  2P6V A;  3B71 A;  5JRA A;  3T4R A;  1GQA A;  4QI2 A;  2HUJ A;  2HMQ A;  4UDV A;  2LFF A;  2WVQ A;  4PAC A;  1L3P A;  1YVI A;  3KH2 A;  4DXW A;  2OJE D;  1HMO A;  2IM8 A;  3HJC A;  1ORY A;  1RKE A;  2HSQ A;  1SMY F;  5KYY B;  5D92 A;  3PMR A;  3B0V C;  4G7O F;  4LLC A;  1KTM A;  1HY5 A;  1MNE A;  4JEB A;  4MS2 A;  3X2Q C;  1TWG A;  1CPQ A;  1LIH A;  2FFH A;  1BZ4 A;  4DJ9 A;  4EWC A;  2XM4 A;  3KPH A;  1R4T A;  2P0N A;  1ZW3 A;  3IQ6 A;  1SZI A;  1T5O A;  1ZZP A;  4OIO F;  1LE2 A;  3U8P A;  2OKU A;  2PP4 A;  2R25 A;  3CSK A;  4PJL A;  3X1O A;  3IQC A;  2YWA A;  4XPW A;  1S7Z A;  1WGW A;  4CS8 A;  3U3F A;  1NFO A;  1F1M A;  4Z9I A;  1OR3 A;  1RKE B;  3ASO C;  3EH1 A;  3QW1 A;  4CJO A;  4NTB A;  4W8P A;  2ZPA A;  1LVK A;  4O7G A;  4J32 B;  1D1B A;  1FMV A;  1Z3I X;  3ZSU A;  4K1O A;  1RXQ A;  4MW8 A;  4P6I C;  1TKN A;  4DRI B;  2H7B A;  1E86 A;  3FAP B;  2Q9C A;  4P9T A;  1YJG A;  1HE9 A;  1R5I D;  2QY9 A;  2J0W A;  5B1A C;  3J06 A;  3DAF A;  2B0J A;  2EIK C;  4MVR A;  5DQZ A;  2NSF A;  2A0B A;  2R7S A;  4OD5 A;  1H9T A;  3W4Y A;  1FFH A;  2AP3 A;  5T3W A;  2HS5 A;  4E7S A;  1D0X A;  2KSF A;  5A6A A;  5DS5 A;  3EHN A;  1QLE C;  2XXA A;  2LD6 A;  3AGT A;  3RVY A;  1Z63 A;  2NUP B;  2A1D D;  3GEH A;  3GOR A;  4MVO A;  5T1D B;  3RW0 A;  1WN0 A;  5DLJ A;  3N0T A;  4U5H A;  4YT2 A;  1M57 C;  2XLW A;  3POV A;  1B68 A;  1WWP A;  3O10 A;  2LIG A;  3GM1 A;  3FMS A;  1J8Y F;  1YA7 O;  1BDJ B;  3SYN A;  1LM3 B;  3GM3 A;  4LLE A;  4NQF A;  3UMK A;  4JJG A;  3L0I A;  3NKD A;  1EA8 A;  3NYM A;  1YYJ A;  5A6J A;  4H54 A;  2VCC A;  3HNL A;  4JC7 A;  4U5D E;  3IQ5 A;  4JE9 A;  2Q4F A;  2PX0 A;  1E85 A;  2Y69 C;  4LDK A;  4U5F E;  3M79 A;  5CI9 A;  2XL6 A;  4JRZ A;  3LS0 A;  2FAP B;  2PF4 E;  2WVO A;  3AG1 C;  5JP7 A;  4EUK B;  4KNW A;  2B0H A;  3JCU Q;  3L8I A;  2WL8 A;  5F28 E;  2MYS A;  4CDA A;  1RCP A;  3L1M A;  4E0I A;  3AG2 C;  3W8H A;  2WB7 A;  5L3V A;  3V5Y A;  4XPY A;  2EPN A;  1VK5 A;  3SXM A;  4EHP A;  3A11 A;  4JEA A;  2R7T A;  1OKK A;  1VLT A;  1KU2 A;  2Y3D A;  3U9J A;  3U9M A;  1NU7 D;  2AVK A;  5DS6 A;  3SEO A;  3ZDL A;  2M4E A;  2R7R A;  4H4K C;  5AC5 A;  2Y3G A;  3H2U A;  3ZQY A;  3M4B A;  1HW1 A;  4QI0 A;  1TWH A;  3LNM B;  1OR2 A;  3FHD A;  2IXP A;  2IXN A;  1Q0K A;  1O5H A;  3M15 A;  2LFD A;  2OCC C;  1ORS C;  2HJ3 A;  4AE4 A;  3H2V A;  1L7C A;  3EGD A;  3Q7G A;  4MND A;  2XS8 A;  4ULV A;  1LKX A;  5KYN A;  1OQC A;  2J46 A;  1PCX A;  2XM0 A;  5COM A;  4OIR F;  4E17 A;  1CGN A;  2G3V A;  1JOG A;  2GDC A;  4OD4 A;  4EBB A;  4PJN A;  3OEO A;  2YLG A;  3ABK C;  4AK9 A;  4DVZ A;  3AQC A;  2RD9 A;  2H7V C;  1TWA A;  4NY3 A;  1O87 A;  4CSA A;  3AG4 C;  3DXJ F;  2YRF A;  4JTC B;  4AE4 B;  2J9V A;  3ZC4 A;  3NDB B;  3EGD B;  2NUT A;  1K04 A;  2RSE B;  3Q7L A;  3QW0 A;  3M1C B;  4OIQ F;  3CEX A;  4C3E A;  2ETS A;  4CIP A;  3B29 A;  5KYW A;  1PD1 A;  3S90 A;  1C02 A;  1U89 A;  3O39 A;  1YAU O;  4YT5 A;  3B0P A;  3HNI A;  3PHF 2;  3K1H A;  1K40 A;  256B A;  2FGY A;  4JZA A;  4BJT A;  1EI7 A;  2BE5 F;  3DJN B;  2VCB A;  3MYI A;  4IAO A;  4IRU A;  4Q7C A;  2XL8 A;  3E9V A;  1UG7 A;  3EHM A;  3EH2 A;  4BJ6 C;  2MHR A;  4WAB A;  3RQG A;  2WZG A;  3R7C A;  4B6I A;  4BJ1 A;  4JJF A;  1JMW A;  2NUT B;  3WOD F;  3ABM C;  2R7O A;  2L81 A;  5T3T A;  5KYW B;  2KW3 C;  3T9O A;  3GEE A;  4BJ5 A;  3SXK A;  4AL0 A;  5B3I A;  3VRC A;  2D4U A;  4QDL A;  1GS9 A;  4I3M A;  1SYQ A;  2ASR A;  4PJJ A;  5EK0 A;  1FNT c;  4EBK A;  3RKO F;  2D5R B;  1I5N A;  5E3C A;  3ZQV A;  1QQ3 A;  4HFF B;  3WG7 C;  3QVZ A;  5L0C A;  3CAX A;  3VM6 A;  3SNH A;  1H7I A;  4YK5 A;  2H8A A;  3LLI A;  1YDI A;  3DJU B;  4ONS A;  2BC5 A;  2AWY A;  3G50 A;  2X0C A;  1KNY A;  4U5B E;  3AOU A;  4WGY A;  4YJW A;  4XLP F;  1VOM A;  4LER A;  4X0R A;  4HFK B;  1Q0M A;  1Z23 A;  4C3B A;  3LAY A;  4XEV A;  4DOZ A;  3MYF A;  3NMI A;  4IAR A;  2DYR C;  2DYS C;  1OCC C;  4OIN F;  2R7U A;  3UMH A;  2KNH A;  3S28 A;  4Q5S F;  3OA1 A;  1RKC A;  3NKE A;  3WHN A;  5HV9 A;  1YYX A;  1OW6 A;  3AJM A;  3BRJ A;  1G4W R;  2VB6 A;  1O3U A;  1HMD A;  3FXH A;  1MND A;  2KQ9 A;  4K7B A;  4YL3 A;  2XLE A;  1QZX A;  3UR3 C;  3K1I C;  2G3K A;  5JLI A;  2NSG A;  4U9D A;  1T01 A;  1ZU5 A;  1VYI A;  4JKV A;  3W8I A;  4IB4 A;  3NMK A;  1JAF A;  2LK4 A;  2NUP A;  3GAN A;  1TR2 A;  3LEO A;  1ZHX A;  5CI8 A;  2KYH A;  2JX0 A;  3T6G B;  3L8J A;  4IAQ A;  4U5E E;  3EFO A;  5JSL A;  4D4N A;  3FOP A;  1ZHT A;  2EPM X;  3JYH A;  4KC9 A;  2YEV A;  3VF0 A;  1V54 C;  2HSB A;  2XLV A;  1OXK A;  1M2O A;  3GOD A;  2R02 A;  4GEH A;  4WJ0 A;  1T6U A;  1YZC A;  1FMW A;  3DE9 A;  1D0Z A;  2HMZ A;  1ZHW A;  3BEH A;  3C63 A;  2HZ8 A;  2YLI A;  3LEV A;  3SP1 A;  2XLO A;  5E2Q A;  4YWQ A;  2HV6 A;  3QZC A;  5KYX A;  3K33 A;  3DD7 A;  4NTA A;  4CS8 C;  1E84 A;  3EZI A;  3SZR A;  4ZLD A;  1TFO B;  2Q00 A;  3EFO B;  1M2V A;  2P7V A;  1I4Y A;  1TWC A;  1WOL A;  2DI3 A;  2IXM A;  4CS7 A;  4D4X A;  4W8K A;  1H9G A;  2HJM A;  4U5G A;  4CS9 C;  2R03 A;  3M4C A;  2GAQ A;  4JIO A;  2L6G A;  1W2W A;  1IZM A;  2HKV A;  1TFK B;  2DGJ A;  2ZXP A;  3W2W A;  5L0I A;  1YLM A;  3T6B A;  2J0X A;  1OW7 A;  4MW3 A;  5GPG B;  3S9O A;  1VMA A;  1NSG B;  3U2L A;  5KYX B;  5TJ5 E;  4O6M A;  2IYL D;  1M2V B;  2WZL A;  3V5Z A;  2CCY A;  5A6K A;  3F46 A;  5FCL A;  5E33 A;  4YT4 A;  4ANJ A;  5JT4 A;  4PFO A;  5JUA A;  3ZG1 A;  3K66 A;  3ITF A;  4CDY A;  3FAJ A;  2R05 A;  1MMG A;  2X51 A;  3HLZ A;  3IEE A;  3MFN A;  2YQY A;  1G4U S;  4DRJ B;  1M56 C;  1WAS A;  2EIJ C;  2YKZ A;  1LS1 A;  4EIY A;  1U0B B;  5AC4 A;  4YL1 A;  1VLS A;  3QVY A;  1SF8 A;  3DZA A;  4N4W A;  4CDV A;  2YL1 A;  3DI5 A;  3DM5 A;  3H65 A;  4YN0 B;  2XSE A;  4XWJ A;  3TJ6 A;  2LCH A;  3EQL F;  4N6H A;  1QKR A;  3G4X A;  3RH3 A;  3AG3 C;  3V5X A;  3JSZ A;  4U5C E;  1APC A;  2CW0 F;  1YAR O;  2QTV A;  5D91 A;  4JVS A;  5F5H A;  3U3B A;  4PJM A;  5COG A;  1LE4 A;  2VCA A;  1NZE A;  2CYD A;  4I44 A;  4MVM A;  4A4A A;  5HSW A;  3GWN A;  5L3Q A;  3I5P A;  2J45 A;  3IPM O;  4RDA A;  2GWW A;  2LSE A;  2A68 F;  4CX9 A;  4Z9H A;  3NYJ A;  3ZWI A;  4A2N B;  2OOC A;  3UNG C;  5A6B D;  2JPU A;  4XTK A;  2G62 A;  1A7V A;  3MX3 A;  4NTF A;  4E18 A;  2J9W A;  1RJ9 B;  1AUE A;  1JR8 A;  3DKA A;  2R7W A;  2GFH A;  3JRT A;  3FVY A;  3I5Q A;  1I4Z A;  1MQV A;  2A69 F;  1N1C A;  1ZHZ A;  3RF3 A;  3N2Z B;  1PV3 A;  5AGF A;  5L0H A;  2YL3 A;  5KYU A;  4BJ6 A;  1C17 M;  1CGM E;  4U9E A;  3MBG A;  1OW8 A;  3FOO A;  3KYI A;  1Q0D A;  1FTS A;  1V4A A;  3C62 A;  4MTG A;  4CIH A;  3HTK C;  2PBE A;  2QUP A;  2HFI A;  1IW7 F;  1XWJ A;  3ATP A;  2H7O A;  2I8B A;  2L6F A;  2Q7R A;  2QNL A;  1V74 B;  4DVY P;  4L6R A;  1YA9 A;  3W2V A;  2UUI A;  4G7Z F;  1LPE A;  1Z7Q c;  2CGE A;  3C18 A;  3FDQ A;  1K05 A;  3R2P A;  4GYT A;  2LQG A;  2A0U A;  5KYU B;  2IBF A;  3S84 A;  3EJN A;  2V26 A;  1T9K A;  4YL0 A;  2MWQ A;  3NMJ A;  4R32 A;  2EIL C;  3EPV A;  4XQ1 A;  2J9B A;  3U2M A;  2L6H A;  1S05 A;  1OCO C;  2A6E F;  4MVS A;  3RFY A;  1NU9 C;  1JPJ A;  4J30 B;  5JS5 A;  5L0F A;  4C7O B;  4O6Y A;  2Q3T A;  3JYY A;  3NRH A;  3TD7 A;  1BR2 A;  2O9X A;  5DS4 A;  1G5Z A;  3LNR A;  4JUR I;  2OJQ A;  3ABL C;  1Y4C A;  3DMD A;  1BR1 A;  2R9R B;  2Z15 A;  3TQO A;  4BEM J;  2VAS A;  2R7X A;  2Y3B A;  3CQZ A;  2IXO A;  4HE8 D;  1GGQ A; 
#chains in the Genus database with same CATH homology
 1TFK B;  1V74 B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...