1V74B

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic/immune system
molecule keywords Colicin D
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09204 Colicin_immun Bacterial self-protective colicin-like immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1v74B00
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH superfamily
1C17M 3C8GB 2ICWG 3CQZA 1ZU5A 3S0XA 1FMWA 2EPLX 3W8HA 5B3IA 2P0NA 2H7BA 3CSKA 3WAQA 2VCCA 2J9UA 2L7AA 3NMJA 5BQIA 4XEFA 1MNDA 2PFDA 2PP4A 4E0IA 1OCOC 4E18A 1YZAA 3RH3A 3UMKA 1VK5A 3QVZA 4KNWA 4NC3A 4OD5A 1A7VA 1LKXA 2UUIA 1FFTC 2BE5F 1QKRA 4CDVA 4HFKB 4W8PA 4E17A 4CSAC 3GM1A 3TD7A 1A7EA 4ONSA 4DOZA 3ZTMA 1NU7D 1TR2A 1OR2A 1SZIA 1JR8A 4CX9A 1XWJA 5TJ5E 2OU6A 3T4RA 4N06A 4BJ5C 1V4AA 4LACB 5CI8A 4NTBA 3US6A 1JOGA 2A68F 2M64A 3DMDA 5KYXA 3ZVRA 1H6GA 1ZHXA 3A9CA 3EQLF 4W8KA 1J8MF 2XL4A 4BJ1A 3EPVA 1D1CA 2W45A 2LFDA 4MVOA 4JTDB 4DJ9A 5EGYA 4JVSA 5KYWB 4CS9C 4YT5A 1G8XA 2Y3HA 2W9YA 4U9DA 1HMOA 1VOMA 2W4MA 2AWCA 3GEIA 3RF3A 3KH2A 3RIPA 4EIYA 2ZPAA 3B29A 5KYUA 1WOLA 4ER9A 1E85A 1MMGA 5AC5A 3BEHA 4U5HA 3DAGA 4J7YA 3QMKA 3RQEA 4GQHA 3IEEA 4CS9A 3EGXA 3KL4A 4JIOA 3L1MA 4H4KC 2L81A 4DVYP 1PV3A 1T01A 5FZTA 2XLHA 4HEAJ 3LS0A 1RKCA 3L0IA 2W4BA 4MVSA 2OKUA 1OR3A 3EGXB 1FFHA 4XEKA 5BQGA 3EZIA 3U9JA 4X0RA 3ZQYA 5E33A 2ZXPA 5A6JA 5KYUB 1FNTc 3DZAA 2ZXOA 1M2OA 2YRFA 4WGZA 5JS5A 2OOCA 1LE2A 1LS4A 4CS8A 1U0BB 2Q7RA 1NG1A 2J0XA 3L34A 5COMA 3M15A 3C62A 1ZYRF 3SZRA 3V5XA 4LDRA 2ZXRA 4O7GA 2H7VC 4CBEA 3TOMA 4BJ6A 2XL8A 4CS8C 5BQHA 2HJMA 2JX0A 3Q7GA 1OW7A 1S05A 1JPNA 4U5FE 4CDYA 4HFFB 2LSEA 2Y3DA 2H7OA 3KYIA 5DS6A 2BL2A 1EKYA 2HV6A 3H2UA 4KNVA 3RQFA 2AVKA 3AGUA 3AJMA 2EIKC 3O55A 2CCYA 2KK1A 3MX3A 3S90A 4XQ1A 1CGOA 2XXAA 3M1CB 2VCBA 4WGYA 4QDLA 4AL0A 4U5EE 3E70C 4Q5SF 2R25A 1YAUO 5JP7A 1M6TA 1TWAA 5L0FA 4XEVA 1A41A 3RKOF 3NDBB 5EK0A 5D91A 2G3KA 4BG0A 5L0DA 4MW3A 3N2ZB 1WGWA 3TK0A 3JTLO 4JJGA 4E0HA 1L7CA 3T6JA 1CGME 3IQCA 1I5NA 4DBQA 2J9VA 3E9VA 1OXKA 1Z23A 2J0WA 4H54A 1TKNA 3DM9B 4KBLA 4XLNF 2XSEA 4R32A 2A0UA 4ZLDA 1WN0A 1ST6A 2XXAB 4WJ0A 4P9TA 2GWWA 1Z3IX 3K66A 4J32B 1MNEA 1T6QA 2R05A 1PD0A 2C03A 2R7UA 2IYLD 2RD9A 3VYWA 2ZXWC 1RJ9B 5COGA 4BJ5A 3IQ5A 3VF0A 5L0JA 2YZSA 3LNRA 4O6MA 3B0UX 2UUHA 2WZGA 5CI9A 4RD9A 1ZHYA 1Z5ZA 2KQ9A 3JRMO 5B1AC 2DB4A 4YT4A 5HV9A 2MWQA 4AE4A 4ULWA 3SNHA 2M4EA 1DOVA 3ZG1A 3LAYA 4FWVA 4JZAA 1O87A 3ZTZA 1Q0GA 2HJ3A 1FTSA 3K1IA 3O10A 2OQMA 5DS4A 4XPYA 2YL0A 2OJQA 1BBHA 4YL3A 2DI3A 3R7CA 1L3PA 1XZQA 4A2NB 2GDCA 2L9JA 3EG9A 3I5QA 3L8JA 4IRUA 1K05A 4BEMJ 5L3QA 4O79A 2EPOA 4CJGA 1NSGB 2J7PA 4LLEA 2P6VA 4LERA 3OEOA 3X2QC 2LIGA 4NCQA 1TQGA 4U5BE 1I4YA 4EWCA 3GM3A 1JAFA 1LS1A 3CAXA 3KMIA 3NRHA 4OD4A 1UFBA 2CNWA 1LVKA 2Q9CA 1D0ZA 1GS9A 1RKEB 3WG7C 2OEXA 3EGDB 1D1AA 4LDQA 3FOPA 4MVMA 3MBGA 4IB4A 4P9FA 4Q4ZF 2PX0A 1JPJA 2P1AA 4PFPA 4PJLA 1Q0DA 3DKAA 1ZVZA 4E7ZA 2WVOA 1CGNA 4EUKB 3UR3C 3FHDA 2DYRC 1F1MA 1JRAA 3LS1A 4KC9A 5GPGB 2HKVA 3DJUB 3EGDA 3JYHA 4FESA 1ORJA 3AOUA 5A6KA 4YJWA 1ORYA 2YWAA 4PFOA 4J7TA 2Y69C 4J30B 5E3AA 5A6BA 5JT4A 2R02A 1KTMA 3POVA 2F22A 3ASOC 3LEVA 4D4XA 1WATA 4C7OB 2V26A 4EKWA 2KYHA 4JEAA 2VCAA 3GWNA 1HW2A 1ZZPA 1K04A 1SF8A 2VC9A 1LE4A 1HMDA 2WVQA 3S27A 2QNLA 2KC3A 3FAJA 1B68A 4ANJA 4DVZA 5IY5C 1T6IA 1H9TA 3MLGA 4MTOA 4NY3A 3K33A 5L3VA 2V3CC 1CPRA 1E2XA 4MQ9F 1BDJB 2YVKA 5E3CA 2XS8A 5FCLA 1YDIA 4I3MA 1NLXA 5F5FA 4IJJA 4MVQA 3DWWA 2WL8A 2ETSA 3B0PA 3DD7A 2JD3A 3RQGA 4G7ZF 3WODF 3SEOA 1BR4A 2QUPA 4MVUA 4PACA 3A11A 1NZEA 1T5OA 3EH1A 3K1HA 3AQBA 3SXYA 1HE1A 1YLMA 4YWQA 4I1MA 2YKZA 1M57C 2QTVA 3QW0A 1WTYA 3ATPA 3VRCA 3N24A 1Z6AA 5AC4A 1HW1A 1A0BA 1VYIA 2VB6A 3C8GA 5E2QA 5A6AA 3HNIA 2OJED 3JZ0A 2OEVA 3NMIA 3PCVA 1OCZC 4AX2A 3NYLA 3SXZA 2R7SA 1LPEA 3DJNB 3ITFA 4PK4A 1TFOB 4A4AA 2XLOA 3ECSA 1O5HA 5KYWA 1VTMP 2KGOA 1CPQA 1GGQA 1QVXA 3GM2A 1NBBA 4M63A 3K6BA 3SP1A 3ZIBA 5BUOA 3EJNA 4GEHA 4Z9IA 2BC5A 2G3VA 3CEXA 2R7XA 4YL0A 1VMAA 3TOLA 5KYYA 2LK4A 4B6IA 1SR2A 2L6FA 2R7QA 1ORSC 3K1IC 2Q3TA 4JJFA 4XWJA 5A69A 2R7OA 4O6YA 2D5RB 2DYSC 3FOOA 1C02A 3KYJA 3M4BA 3S29A 2ASRA 4Z9HA 4G7HF 4RBNA 4C3DA 3AG1C 2OCCC 1OKKD 1C03A 2NUPB 1OKKA 1D1BA 1AUEA 5KYNA 2WVNA 2YHSA 4YN0B 5DQZA 3RVZA 4OIQF 4JE9A 3HKKA 2NSGA 1Q0FA 1YYJA 1Z7Qc 2NUTA 2HSQA 4YT2A 5KYXB 4CDAA 1LI5A 3FMSA 4XPXA 3TQOA 1SYQA 4I1OB 3ZSUA 1Y6DA 1BZ4A 3C7JA 2D4UA 1D0YA 1NFNA 3V7OA 2KNHA 5KYYB 3NYJA 2HS5A 3QTHA 3LESA 3K7DA 4L6RA 3LLIA 2PF4E 3GORA 3MYIA 5D92A 3MYFA 1MQVA 1UG7A 3G50A 3GWLA 4K7BA 3UGOA 3AQCA 5T1DB 4YK5A 3TULA 3ABMC 4C3BA 2XM4A 4JW1A 1QQ3A 4C3EA 2Z15A 2A6EF 4IARA 3G4ZA 3AG3C 1NFOA 3JYYA 1KNYA 2HMZA 2HSBA 4LDKA 2IXNA 4XLPF 1ZHWA 4OINF 2IBFA 3CZ6A 3N0TA 3B9QA 4G78A 4DXWA 3WHNA 3T6BA 3Q6NA 1V54C 3HLZA 1TWGA 2HFIA 3I5PA 3GEHA 3W2VA 4K1OA 4PJJA 1IW7F 4AK9A 2B0JA 2YQYA 1D0XA 3JSZA 3EZHA 1OW6A 4EBKA 1E83A 1OXBA 256BA 2LD6A 4BJ6C 3W4YA 3ZC4A 2QY9A 4MTGA 4ZLCA 3V5ZA 1G4US 4PR9A 1E84A 2R7RA 2XLVA 2Q9BA 4UDVA 3JSEO 1SMYF 4OIPF 4QI0A 1RCPA 2XL6A 4JRZA 2I15A 2IXOA 4U9EA 2XRHA 1Q0KA 4LLCA 3ZQVA 5L0IA 2EILC 2NUTB 2J9BA 3B71A 4MS2A 3ABKC 3F46A 2IXMA 1O3UA 3EHMA 2G62A 4EHPA 3DE8A 4DRIB 2MHRA 3UMHA 2KJGA 1XZPA 2YLGA 4N4WA 3ZWIA 4OIRF 2X0CA 3U0CA 3EH2A 3KKBA 2LCHA 3QVYA 3QZCA 2HV7A 1PD1A 1T9KA 4MVZA 2PBEA 2EPKX 2XLDA 2RSEB 1H9GA 2XLWA 2MYSA 3C18A 2CYDA 3H65A 3HNKA 1BR2A 3HNLA 1IZMA 3H2VA 4ULVA 2I8BA 1ZHZA 3U3BA 4DBRA 2R03A 3Q6MA 1VLTA 4JCHA 2LP4A 4NTFA 3F47A 3U2LA 4AL1A 3UGPA 5T3TA 2Q9AA 1U6HA 3M79A 3J06A 1M56C 2FGYA 3Q7LA 2YLDA 3O6XA 2HUJA 3LEOA 1MMAA 3DAFA 4CJOA 4G7OF 1TWHA 5L0CA 1VB5A 3FVYA 5AGFA 4FAPB 3EHNA 3S9OA 2IXPA 1QPUA 1EI7A 5L0GA 4JKVA 3U2MA 1PCXA 2WZFA 3DXJF 2QLAA 2JPUA 2KSFA 4IAQA 2KW3C 2EINC 3BRJA 2Q4FA 2AP3A 1V55C 2IOQA 2AU5A 3IPMO 2GFHA 3U8PA 1A7DA 3O39A 1YA7O 3PMRA 2J45A 4IAOA 2FAPB 3R2PA 4AE4B 1U89A 4RDAA 1G4WR 1TFKB 2QE9A 4F4BA 3DM5A 1V74B 1OQCA 2L6GA 1R5ID 4MW8A 3SXKA 3T6GB 4PJMA 1M2VA 5DVWA 3ZDLA 5CIVA 4JTAB 1J8YF 3SXMA 1WASA 2LQGA 2CGEA 2X51A 4EBJA 1APCA 1AEPA 2E87A 3LLKA 4HE8D 5JRAA 3FDQA 1QLEC 2J9WA 1W2WA 3VM6A 4DRHB 2OG2A 4DRJB 1FMVA 2Y39A 5K0IA 4IGGA 3AGTA 4JEBA 2R7TA 5F28E 5F5HA 1S7ZA 2VH3A 3DI5A 2AWYA 2J8WA 2PX3A 3EFOA 2VASA 1OW8A 3MFNA 4YT8A 1ZU4A 1I4ZA 1JMWA 3C8GD 3JRTA 3AG2C 3U8VA 5HSWA 5L0HA 2PNOA 5B1BC 2NSFA 1VYKA 5DQTA 2TMVP 2ZD9A 4K0DA 3S84A 2GA0A 2Q00A 3W2WA 2FFHA 5EHHA 4OIOF 3U5SA 2XM0A 2NG1A 3TJ5A 3M4CA 4U5GA 3UNGC 3TJ6A 2A0BA 4IWBA 2CW0F 2YL3A 1YA9A 3AG4C 2YLIA 3KPHA 3NKDA 4MTFA 4YL1A 1Z63A 3HNJA 4NTAA 3LJBA 3GODA 1K40A 3I4UA 3C8ZA 3NG1A 1QSPA 2B0HA 2WB7A 5COFA 3VAYA 4MVRA 3PHF2 3FXHA 4JTCB 4P6IC 2O9XA 3FAPB 2A69F 2NPUA 4U5DE 1GQAA 1VLSA 1HY5A 4G0HA 2EPNA 4N6CA 3RVYA 5JLIA 4JCZA 2YL1A 3PDMP 1YVIA 3U3FA 3HTKC 3IQ6A 3RW0A 3ASNC 5A6BD 3IHUA 2C04A 1R4TA 2EPMX 2P61A 2R9RB 4CIHA 1EQ1A 1ZW2A 4Q7CA 4N6HA 1RJ9A 2R7VA 1YARO 4CS7A 5JSLA 1WWPA 4BEJA 4WABA 4U5CE 1YJGA 2J46A 2L6HA 4C7OA 1YZCA 1FAPB 1TWCA 2IM8A 1N1CA 2Y3GA 2HZ8A 4CIPA 3U9MA 3GANA 4GYTA 3OA1A 2CNWD 2EIJC 3JT1A 4O6NA 1RKEA 2CDQA 4CSAA 1RMVA 4EBBA 4JC7A 1OCCC 1G5ZA 5DS5A 5B3SC 2EIMC 1Q0MA 4MNDA 4XPWA 3B0VC 1BR1A 2A1DD 4QI2A 4Z9JA 4JURI 2J7PD 3EG9B 3G4XA 1EA8A 1MMDA 5T3WA 1ZW3A 5JVEA 3EFOB 1GM5A 2R7WA 3S28A 3DE9A 5JUAA 1Y4CA 3X1OA 2Y3BA 3ABLC 1LIHA 3RFYA 3QW1A 1M2VB 1ZHTA 1OCRC 2GAQA 4FX5A 1AVOB 3NKEA 2P7VA 3T9OA 1NU9C 3NMKA 3LUTB 3NYMA 2XLEA 1YYXA 5DLJA 2H8AA 1FR0A 2A6HF 1RXQA 2LFFA 3GEEA 3C63A 1LI7A 3HJCA 4KI2A 2NUPA 4BJTA 1H7IA 3IQTA 2DGJA 1LM3B 3RYLA 4I44A 1KU2A 2HMQA 4BPMA 4E7SA 1QZXA 3LNMB 1E86A 3V5YA 2XLMA 4D4NA 2YEVA 3L8IA 1MMNA 3UMIA 2YL7A 4NQFA 2XS1A 1HE9A 2WZLA 1DOWA 3JCUQ 3OWTA 4PJNA 4XTKA 1T6UA 3W8IA 3SYNA
chains in the Genus database with same CATH topology
1V74B 1TFKB 1TFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 B;  1TFK B;  1TFO B; 
#chains in the Genus database with same CATH topology
 1C17 M;  3C8G B;  2ICW G;  3CQZ A;  1ZU5 A;  3S0X A;  1FMW A;  2EPL X;  3W8H A;  5B3I A;  2P0N A;  2H7B A;  3CSK A;  3WAQ A;  2VCC A;  2J9U A;  2L7A A;  3NMJ A;  5BQI A;  4XEF A;  1MND A;  2PFD A;  2PP4 A;  4E0I A;  1OCO C;  4E18 A;  1YZA A;  3RH3 A;  3UMK A;  1VK5 A;  3QVZ A;  4KNW A;  4NC3 A;  4OD5 A;  1A7V A;  1LKX A;  2UUI A;  1FFT C;  2BE5 F;  1QKR A;  4CDV A;  4HFK B;  4W8P A;  4E17 A;  4CSA C;  3GM1 A;  3TD7 A;  1A7E A;  4ONS A;  4DOZ A;  3ZTM A;  1NU7 D;  1TR2 A;  1OR2 A;  1SZI A;  1JR8 A;  4CX9 A;  1XWJ A;  5TJ5 E;  2OU6 A;  3T4R A;  4N06 A;  4BJ5 C;  1V4A A;  4LAC B;  5CI8 A;  4NTB A;  3US6 A;  1JOG A;  2A68 F;  2M64 A;  3DMD A;  5KYX A;  3ZVR A;  1H6G A;  1ZHX A;  3A9C A;  3EQL F;  4W8K A;  1J8M F;  2XL4 A;  4BJ1 A;  3EPV A;  1D1C A;  2W45 A;  2LFD A;  4MVO A;  4JTD B;  4DJ9 A;  5EGY A;  4JVS A;  5KYW B;  4CS9 C;  4YT5 A;  1G8X A;  2Y3H A;  2W9Y A;  4U9D A;  1HMO A;  1VOM A;  2W4M A;  2AWC A;  3GEI A;  3RF3 A;  3KH2 A;  3RIP A;  4EIY A;  2ZPA A;  3B29 A;  5KYU A;  1WOL A;  4ER9 A;  1E85 A;  1MMG A;  5AC5 A;  3BEH A;  4U5H A;  3DAG A;  4J7Y A;  3QMK A;  3RQE A;  4GQH A;  3IEE A;  4CS9 A;  3EGX A;  3KL4 A;  4JIO A;  3L1M A;  4H4K C;  2L81 A;  4DVY P;  1PV3 A;  1T01 A;  5FZT A;  2XLH A;  4HEA J;  3LS0 A;  1RKC A;  3L0I A;  2W4B A;  4MVS A;  2OKU A;  1OR3 A;  3EGX B;  1FFH A;  4XEK A;  5BQG A;  3EZI A;  3U9J A;  4X0R A;  3ZQY A;  5E33 A;  2ZXP A;  5A6J A;  5KYU B;  1FNT c;  3DZA A;  2ZXO A;  1M2O A;  2YRF A;  4WGZ A;  5JS5 A;  2OOC A;  1LE2 A;  1LS4 A;  4CS8 A;  1U0B B;  2Q7R A;  1NG1 A;  2J0X A;  3L34 A;  5COM A;  3M15 A;  3C62 A;  1ZYR F;  3SZR A;  3V5X A;  4LDR A;  2ZXR A;  4O7G A;  2H7V C;  4CBE A;  3TOM A;  4BJ6 A;  2XL8 A;  4CS8 C;  5BQH A;  2HJM A;  2JX0 A;  3Q7G A;  1OW7 A;  1S05 A;  1JPN A;  4U5F E;  4CDY A;  4HFF B;  2LSE A;  2Y3D A;  2H7O A;  3KYI A;  5DS6 A;  2BL2 A;  1EKY A;  2HV6 A;  3H2U A;  4KNV A;  3RQF A;  2AVK A;  3AGU A;  3AJM A;  2EIK C;  3O55 A;  2CCY A;  2KK1 A;  3MX3 A;  3S90 A;  4XQ1 A;  1CGO A;  2XXA A;  3M1C B;  2VCB A;  4WGY A;  4QDL A;  4AL0 A;  4U5E E;  3E70 C;  4Q5S F;  2R25 A;  1YAU O;  5JP7 A;  1M6T A;  1TWA A;  5L0F A;  4XEV A;  1A41 A;  3RKO F;  3NDB B;  5EK0 A;  5D91 A;  2G3K A;  4BG0 A;  5L0D A;  4MW3 A;  3N2Z B;  1WGW A;  3TK0 A;  3JTL O;  4JJG A;  4E0H A;  1L7C A;  3T6J A;  1CGM E;  3IQC A;  1I5N A;  4DBQ A;  2J9V A;  3E9V A;  1OXK A;  1Z23 A;  2J0W A;  4H54 A;  1TKN A;  3DM9 B;  4KBL A;  4XLN F;  2XSE A;  4R32 A;  2A0U A;  4ZLD A;  1WN0 A;  1ST6 A;  2XXA B;  4WJ0 A;  4P9T A;  2GWW A;  1Z3I X;  3K66 A;  4J32 B;  1MNE A;  1T6Q A;  2R05 A;  1PD0 A;  2C03 A;  2R7U A;  2IYL D;  2RD9 A;  3VYW A;  2ZXW C;  1RJ9 B;  5COG A;  4BJ5 A;  3IQ5 A;  3VF0 A;  5L0J A;  2YZS A;  3LNR A;  4O6M A;  3B0U X;  2UUH A;  2WZG A;  5CI9 A;  4RD9 A;  1ZHY A;  1Z5Z A;  2KQ9 A;  3JRM O;  5B1A C;  2DB4 A;  4YT4 A;  5HV9 A;  2MWQ A;  4AE4 A;  4ULW A;  3SNH A;  2M4E A;  1DOV A;  3ZG1 A;  3LAY A;  4FWV A;  4JZA A;  1O87 A;  3ZTZ A;  1Q0G A;  2HJ3 A;  1FTS A;  3K1I A;  3O10 A;  2OQM A;  5DS4 A;  4XPY A;  2YL0 A;  2OJQ A;  1BBH A;  4YL3 A;  2DI3 A;  3R7C A;  1L3P A;  1XZQ A;  4A2N B;  2GDC A;  2L9J A;  3EG9 A;  3I5Q A;  3L8J A;  4IRU A;  1K05 A;  4BEM J;  5L3Q A;  4O79 A;  2EPO A;  4CJG A;  1NSG B;  2J7P A;  4LLE A;  2P6V A;  4LER A;  3OEO A;  3X2Q C;  2LIG A;  4NCQ A;  1TQG A;  4U5B E;  1I4Y A;  4EWC A;  3GM3 A;  1JAF A;  1LS1 A;  3CAX A;  3KMI A;  3NRH A;  4OD4 A;  1UFB A;  2CNW A;  1LVK A;  2Q9C A;  1D0Z A;  1GS9 A;  1RKE B;  3WG7 C;  2OEX A;  3EGD B;  1D1A A;  4LDQ A;  3FOP A;  4MVM A;  3MBG A;  4IB4 A;  4P9F A;  4Q4Z F;  2PX0 A;  1JPJ A;  2P1A A;  4PFP A;  4PJL A;  1Q0D A;  3DKA A;  1ZVZ A;  4E7Z A;  2WVO A;  1CGN A;  4EUK B;  3UR3 C;  3FHD A;  2DYR C;  1F1M A;  1JRA A;  3LS1 A;  4KC9 A;  5GPG B;  2HKV A;  3DJU B;  3EGD A;  3JYH A;  4FES A;  1ORJ A;  3AOU A;  5A6K A;  4YJW A;  1ORY A;  2YWA A;  4PFO A;  4J7T A;  2Y69 C;  4J30 B;  5E3A A;  5A6B A;  5JT4 A;  2R02 A;  1KTM A;  3POV A;  2F22 A;  3ASO C;  3LEV A;  4D4X A;  1WAT A;  4C7O B;  2V26 A;  4EKW A;  2KYH A;  4JEA A;  2VCA A;  3GWN A;  1HW2 A;  1ZZP A;  1K04 A;  1SF8 A;  2VC9 A;  1LE4 A;  1HMD A;  2WVQ A;  3S27 A;  2QNL A;  2KC3 A;  3FAJ A;  1B68 A;  4ANJ A;  4DVZ A;  5IY5 C;  1T6I A;  1H9T A;  3MLG A;  4MTO A;  4NY3 A;  3K33 A;  5L3V A;  2V3C C;  1CPR A;  1E2X A;  4MQ9 F;  1BDJ B;  2YVK A;  5E3C A;  2XS8 A;  5FCL A;  1YDI A;  4I3M A;  1NLX A;  5F5F A;  4IJJ A;  4MVQ A;  3DWW A;  2WL8 A;  2ETS A;  3B0P A;  3DD7 A;  2JD3 A;  3RQG A;  4G7Z F;  3WOD F;  3SEO A;  1BR4 A;  2QUP A;  4MVU A;  4PAC A;  3A11 A;  1NZE A;  1T5O A;  3EH1 A;  3K1H A;  3AQB A;  3SXY A;  1HE1 A;  1YLM A;  4YWQ A;  4I1M A;  2YKZ A;  1M57 C;  2QTV A;  3QW0 A;  1WTY A;  3ATP A;  3VRC A;  3N24 A;  1Z6A A;  5AC4 A;  1HW1 A;  1A0B A;  1VYI A;  2VB6 A;  3C8G A;  5E2Q A;  5A6A A;  3HNI A;  2OJE D;  3JZ0 A;  2OEV A;  3NMI A;  3PCV A;  1OCZ C;  4AX2 A;  3NYL A;  3SXZ A;  2R7S A;  1LPE A;  3DJN B;  3ITF A;  4PK4 A;  1TFO B;  4A4A A;  2XLO A;  3ECS A;  1O5H A;  5KYW A;  1VTM P;  2KGO A;  1CPQ A;  1GGQ A;  1QVX A;  3GM2 A;  1NBB A;  4M63 A;  3K6B A;  3SP1 A;  3ZIB A;  5BUO A;  3EJN A;  4GEH A;  4Z9I A;  2BC5 A;  2G3V A;  3CEX A;  2R7X A;  4YL0 A;  1VMA A;  3TOL A;  5KYY A;  2LK4 A;  4B6I A;  1SR2 A;  2L6F A;  2R7Q A;  1ORS C;  3K1I C;  2Q3T A;  4JJF A;  4XWJ A;  5A69 A;  2R7O A;  4O6Y A;  2D5R B;  2DYS C;  3FOO A;  1C02 A;  3KYJ A;  3M4B A;  3S29 A;  2ASR A;  4Z9H A;  4G7H F;  4RBN A;  4C3D A;  3AG1 C;  2OCC C;  1OKK D;  1C03 A;  2NUP B;  1OKK A;  1D1B A;  1AUE A;  5KYN A;  2WVN A;  2YHS A;  4YN0 B;  5DQZ A;  3RVZ A;  4OIQ F;  4JE9 A;  3HKK A;  2NSG A;  1Q0F A;  1YYJ A;  1Z7Q c;  2NUT A;  2HSQ A;  4YT2 A;  5KYX B;  4CDA A;  1LI5 A;  3FMS A;  4XPX A;  3TQO A;  1SYQ A;  4I1O B;  3ZSU A;  1Y6D A;  1BZ4 A;  3C7J A;  2D4U A;  1D0Y A;  1NFN A;  3V7O A;  2KNH A;  5KYY B;  3NYJ A;  2HS5 A;  3QTH A;  3LES A;  3K7D A;  4L6R A;  3LLI A;  2PF4 E;  3GOR A;  3MYI A;  5D92 A;  3MYF A;  1MQV A;  1UG7 A;  3G50 A;  3GWL A;  4K7B A;  3UGO A;  3AQC A;  5T1D B;  4YK5 A;  3TUL A;  3ABM C;  4C3B A;  2XM4 A;  4JW1 A;  1QQ3 A;  4C3E A;  2Z15 A;  2A6E F;  4IAR A;  3G4Z A;  3AG3 C;  1NFO A;  3JYY A;  1KNY A;  2HMZ A;  2HSB A;  4LDK A;  2IXN A;  4XLP F;  1ZHW A;  4OIN F;  2IBF A;  3CZ6 A;  3N0T A;  3B9Q A;  4G78 A;  4DXW A;  3WHN A;  3T6B A;  3Q6N A;  1V54 C;  3HLZ A;  1TWG A;  2HFI A;  3I5P A;  3GEH A;  3W2V A;  4K1O A;  4PJJ A;  1IW7 F;  4AK9 A;  2B0J A;  2YQY A;  1D0X A;  3JSZ A;  3EZH A;  1OW6 A;  4EBK A;  1E83 A;  1OXB A;  256B A;  2LD6 A;  4BJ6 C;  3W4Y A;  3ZC4 A;  2QY9 A;  4MTG A;  4ZLC A;  3V5Z A;  1G4U S;  4PR9 A;  1E84 A;  2R7R A;  2XLV A;  2Q9B A;  4UDV A;  3JSE O;  1SMY F;  4OIP F;  4QI0 A;  1RCP A;  2XL6 A;  4JRZ A;  2I15 A;  2IXO A;  4U9E A;  2XRH A;  1Q0K A;  4LLC A;  3ZQV A;  5L0I A;  2EIL C;  2NUT B;  2J9B A;  3B71 A;  4MS2 A;  3ABK C;  3F46 A;  2IXM A;  1O3U A;  3EHM A;  2G62 A;  4EHP A;  3DE8 A;  4DRI B;  2MHR A;  3UMH A;  2KJG A;  1XZP A;  2YLG A;  4N4W A;  3ZWI A;  4OIR F;  2X0C A;  3U0C A;  3EH2 A;  3KKB A;  2LCH A;  3QVY A;  3QZC A;  2HV7 A;  1PD1 A;  1T9K A;  4MVZ A;  2PBE A;  2EPK X;  2XLD A;  2RSE B;  1H9G A;  2XLW A;  2MYS A;  3C18 A;  2CYD A;  3H65 A;  3HNK A;  1BR2 A;  3HNL A;  1IZM A;  3H2V A;  4ULV A;  2I8B A;  1ZHZ A;  3U3B A;  4DBR A;  2R03 A;  3Q6M A;  1VLT A;  4JCH A;  2LP4 A;  4NTF A;  3F47 A;  3U2L A;  4AL1 A;  3UGP A;  5T3T A;  2Q9A A;  1U6H A;  3M79 A;  3J06 A;  1M56 C;  2FGY A;  3Q7L A;  2YLD A;  3O6X A;  2HUJ A;  3LEO A;  1MMA A;  3DAF A;  4CJO A;  4G7O F;  1TWH A;  5L0C A;  1VB5 A;  3FVY A;  5AGF A;  4FAP B;  3EHN A;  3S9O A;  2IXP A;  1QPU A;  1EI7 A;  5L0G A;  4JKV A;  3U2M A;  1PCX A;  2WZF A;  3DXJ F;  2QLA A;  2JPU A;  2KSF A;  4IAQ A;  2KW3 C;  2EIN C;  3BRJ A;  2Q4F A;  2AP3 A;  1V55 C;  2IOQ A;  2AU5 A;  3IPM O;  2GFH A;  3U8P A;  1A7D A;  3O39 A;  1YA7 O;  3PMR A;  2J45 A;  4IAO A;  2FAP B;  3R2P A;  4AE4 B;  1U89 A;  4RDA A;  1G4W R;  1TFK B;  2QE9 A;  4F4B A;  3DM5 A;  1V74 B;  1OQC A;  2L6G A;  1R5I D;  4MW8 A;  3SXK A;  3T6G B;  4PJM A;  1M2V A;  5DVW A;  3ZDL A;  5CIV A;  4JTA B;  1J8Y F;  3SXM A;  1WAS A;  2LQG A;  2CGE A;  2X51 A;  4EBJ A;  1APC A;  1AEP A;  2E87 A;  3LLK A;  4HE8 D;  5JRA A;  3FDQ A;  1QLE C;  2J9W A;  1W2W A;  3VM6 A;  4DRH B;  2OG2 A;  4DRJ B;  1FMV A;  2Y39 A;  5K0I A;  4IGG A;  3AGT A;  4JEB A;  2R7T A;  5F28 E;  5F5H A;  1S7Z A;  2VH3 A;  3DI5 A;  2AWY A;  2J8W A;  2PX3 A;  3EFO A;  2VAS A;  1OW8 A;  3MFN A;  4YT8 A;  1ZU4 A;  1I4Z A;  1JMW A;  3C8G D;  3JRT A;  3AG2 C;  3U8V A;  5HSW A;  5L0H A;  2PNO A;  5B1B C;  2NSF A;  1VYK A;  5DQT A;  2TMV P;  2ZD9 A;  4K0D A;  3S84 A;  2GA0 A;  2Q00 A;  3W2W A;  2FFH A;  5EHH A;  4OIO F;  3U5S A;  2XM0 A;  2NG1 A;  3TJ5 A;  3M4C A;  4U5G A;  3UNG C;  3TJ6 A;  2A0B A;  4IWB A;  2CW0 F;  2YL3 A;  1YA9 A;  3AG4 C;  2YLI A;  3KPH A;  3NKD A;  4MTF A;  4YL1 A;  1Z63 A;  3HNJ A;  4NTA A;  3LJB A;  3GOD A;  1K40 A;  3I4U A;  3C8Z A;  3NG1 A;  1QSP A;  2B0H A;  2WB7 A;  5COF A;  3VAY A;  4MVR A;  3PHF 2;  3FXH A;  4JTC B;  4P6I C;  2O9X A;  3FAP B;  2A69 F;  2NPU A;  4U5D E;  1GQA A;  1VLS A;  1HY5 A;  4G0H A;  2EPN A;  4N6C A;  3RVY A;  5JLI A;  4JCZ A;  2YL1 A;  3PDM P;  1YVI A;  3U3F A;  3HTK C;  3IQ6 A;  3RW0 A;  3ASN C;  5A6B D;  3IHU A;  2C04 A;  1R4T A;  2EPM X;  2P61 A;  2R9R B;  4CIH A;  1EQ1 A;  1ZW2 A;  4Q7C A;  4N6H A;  1RJ9 A;  2R7V A;  1YAR O;  4CS7 A;  5JSL A;  1WWP A;  4BEJ A;  4WAB A;  4U5C E;  1YJG A;  2J46 A;  2L6H A;  4C7O A;  1YZC A;  1FAP B;  1TWC A;  2IM8 A;  1N1C A;  2Y3G A;  2HZ8 A;  4CIP A;  3U9M A;  3GAN A;  4GYT A;  3OA1 A;  2CNW D;  2EIJ C;  3JT1 A;  4O6N A;  1RKE A;  2CDQ A;  4CSA A;  1RMV A;  4EBB A;  4JC7 A;  1OCC C;  1G5Z A;  5DS5 A;  5B3S C;  2EIM C;  1Q0M A;  4MND A;  4XPW A;  3B0V C;  1BR1 A;  2A1D D;  4QI2 A;  4Z9J A;  4JUR I;  2J7P D;  3EG9 B;  3G4X A;  1EA8 A;  1MMD A;  5T3W A;  1ZW3 A;  5JVE A;  3EFO B;  1GM5 A;  2R7W A;  3S28 A;  3DE9 A;  5JUA A;  1Y4C A;  3X1O A;  2Y3B A;  3ABL C;  1LIH A;  3RFY A;  3QW1 A;  1M2V B;  1ZHT A;  1OCR C;  2GAQ A;  4FX5 A;  1AVO B;  3NKE A;  2P7V A;  3T9O A;  1NU9 C;  3NMK A;  3LUT B;  3NYM A;  2XLE A;  1YYX A;  5DLJ A;  2H8A A;  1FR0 A;  2A6H F;  1RXQ A;  2LFF A;  3GEE A;  3C63 A;  1LI7 A;  3HJC A;  4KI2 A;  2NUP A;  4BJT A;  1H7I A;  3IQT A;  2DGJ A;  1LM3 B;  3RYL A;  4I44 A;  1KU2 A;  2HMQ A;  4BPM A;  4E7S A;  1QZX A;  3LNM B;  1E86 A;  3V5Y A;  2XLM A;  4D4N A;  2YEV A;  3L8I A;  1MMN A;  3UMI A;  2YL7 A;  4NQF A;  2XS1 A;  1HE9 A;  2WZL A;  1DOW A;  3JCU Q;  3OWT A;  4PJN A;  4XTK A;  1T6U A;  3W8I A;  3SYN A; 
#chains in the Genus database with same CATH homology
 1V74 B;  1TFK B;  1TFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...