1V74B

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic/immune system
molecule keywords Colicin D
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09204 Colicin_immun Bacterial self-protective colicin-like immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1v74B00
1V74B 1TFOB 1TFKB
chains in the Genus database with same CATH superfamily
3GODA 1JOGA 4YL3A 4I3MA 3SEOA 4IAOA 3RIPA 2J9VA 3MFNA 4DVZA 2FGYA 1ZHTA 4C3EA 2XLOA 3JZ0A 4JVSA 2OU6A 2XL6A 4XEVA 3DJUB 1LI7A 2OJED 2P61A 4MVZA 1FMVA 2UUIA 1C03A 1BR2A 2G3VA 2H7OA 4ONSA 4U5FE 3VYWA 2R7TA 4O6NA 2J7PD 4XLPF 4MVQA 3K33A 1GQAA 1O3UA 2R7QA 3O55A 3GEIA 3R2PA 3NDBB 4K7BA 4IB4A 1L7CA 3WHNA 4BJ6A 2WVNA 4CDVA 3QW0A 4JJFA 1QLEC 5F5HA 5JSLA 1ZVZA 5DS5A 3TJ6A 1IZMA 2J9BA 2WZFA 1Y4CA 3RQGA 4KI2A 4DJ9A 1EKYA 1JR8A 3US6A 2LQGA 5KYYB 1YJGA 3EH2A 2MHRA 3U2LA 5KYNA 2AWCA 1E84A 3U3FA 4G7ZF 4B6IA 1RJ9B 4JEBA 3SXMA 3CAXA 3OEOA 2NG1A 4R32A 4A4AA 1JPJA 2IM8A 3HNLA 4PJJA 4DRJB 2A0BA 3HJCA 5KYUB 2NUTB 1ORSC 4MTGA 3LLKA 3T6JA 1CPRA 1Z3IX 4JCZA 3O39A 3U3BA 5AC5A 3U9MA 2LSEA 2YHSA 4RDAA 3RF3A 3U8PA 2XLDA 1F1MA 1ZHYA 1NLXA 3EFOA 4PFOA 4BEJA 5K0IA 4HE8D 3JSZA 4IRUA 4CS9C 3DD7A 1OR2A 2Y3GA 3LS1A 4MQ9F 1QQ3A 2Y3DA 2ASRA 3EHMA 3Q7GA 4BJ5C 4HEAJ 3V7OA 2LFFA 4AL0A 1WASA 4MW8A 5JS5A 1T5OA 3M1CB 3W2VA 1BR4A 1LI5A 3K66A 1RJ9A 1T6QA 2VH3A 1ORYA 3ZQYA 2EPOA 4KNVA 3EG9B 2YVKA 1G8XA 3DWWA 2R7OA 1XZQA 1U89A 2AVKA 3JCUQ 3RQFA 1ZU4A 2YQYA 1AUEA 3WODF 1D1AA 4CS8C 3GM2A 1BZ4A 3T4RA 2OKUA 3EGXA 2G3KA 3O10A 4Z9IA 2KW3C 3DAGA 3MBGA 2XXAA 1LIHA 4BJ1A 1U0BB 4U9DA 2R7VA 1D0ZA 1VOMA 4M63A 1FFHA 1Q0FA 2IXOA 1NFNA 3S29A 2DYSC 4JIOA 3NG1A 3S90A 2DB4A 1XWJA 3DKAA 4MS2A 4MVMA 4PACA 3LS0A 2XLMA 4IJJA 4RD9A 3A11A 1H7IA 2ICWG 5A69A 4QI2A 3AG1C 2HUJA 5E2QA 1YARO 2EPMX 1VYKA 3MYFA 2DGJA 2LCHA 1OCRC 3TD7A 1EI7A 3U9JA 4FWVA 2X0CA 4FESA 1CGOA 3DMDA 4U5DE 4EKWA 5KYWB 3AOUA 1OXBA 3C18A 4YT5A 2PP4A 2VCBA 3V5ZA 3L34A 3ZWIA 2MYSA 4K1OA 1IW7F 3G50A 4CS7A 3B0UX 4N6CA 1V4AA 2OQMA 2R25A 2WZLA 2E87A 3PMRA 2ZXWC 3NRHA 2HMQA 3AGUA 3AJMA 3Q6NA 3S84A 2J0WA 4JEAA 4H4KC 3T6BA 4HFFB 1AEPA 4CX9A 3LLIA 1NFOA 3FOPA 3H2VA 2D5RB 4K0DA 5E33A 2X51A 1G5ZA 1ZW2A 4GQHA 3IQTA 5DLJA 1KNYA 3KH2A 2L81A 1Z23A 3AG2C 2ZD9A 3DZAA 1Q0GA 4XEKA 5JP7A 1JMWA 3AQBA 2A6HF 1T6UA 4NTFA 3VRCA 5CIVA 2Q3TA 3B29A 5JUAA 4WGYA 5COMA 2Y3HA 4XQ1A 3DE8A 4NC3A 3WAQA 5F5FA 1MMDA 4N06A 4DXWA 1A41A 3ASOC 3V5XA 4OIQF 4ZLDA 5DS6A 4AK9A 3L8IA 4L6RA 5DS4A 4JTDB 2L6GA 1M6TA 1MMAA 2BE5F 4EUKB 3M4BA 2LK4A 4U5GA 5HV9A 4JTCB 1Q0DA 1ZW3A 2A1DD 2XLHA 4U5CE 2Q00A 4XEFA 2C04A 5BQGA 1D0YA 3FVYA 4J32B 1VTMP 3RVZA 4J30B 3C62A 2CW0F 2L9JA 3SP1A 4YK5A 2W4MA 5L0DA 4MVRA 4EHPA 1E86A 5COFA 2L6HA 2PF4E 5D92A 3S28A 1TKNA 1FNTc 1R5ID 2YL7A 4JZAA 1OCCC 2W4BA 1Z7Qc 1M2OA 4C3DA 5COGA 1ORJA 4G7OF 1RCPA 2XLWA 2L7AA 4BJ5A 4G78A 3IQ6A 5L0FA 3KYJA 4ULVA 2EIJC 3F46A 2HKVA 3OA1A 1UFBA 5KYUA 4P9FA 1YA9A 2H8AA 3W2WA 2HSBA 5E3AA 5L0JA 3DE9A 2V26A 3ASNC 1BR1A 3LNRA 1GS9A 1G4US 1UG7A 1TWCA 2KC3A 1I4ZA 2M4EA 4OINF 2Q7RA 3X1OA 5JT4A 2OEXA 5JLIA 5A6JA 3LUTB 4E0HA 4JW1A 3L1MA 2L6FA 3E70C 3FAPB 4EBKA 1YDIA 4YT4A 4AE4B 1KU2A 2KK1A 2H7VC 5EK0A 3EHNA 1FTSA 1HE1A 1O5HA 3KYIA 5KYYA 3I5QA 3S0XA 4OIOF 4EBBA 2R02A 4LERA 3M4CA 3VAYA 3RQEA 4C3BA 4CIHA 2XLEA 3FDQA 1YAUO 1RKEA 3SXYA 3UR3C 2R03A 5CI9A 2EIKC 3IQCA 3EZHA 4NY3A 2JPUA 1NSGB 3EGXB 1XZPA 1TFKB 3S27A 2PX0A 1YVIA 2VCCA 2LIGA 3QW1A 1I4YA 1OKKA 1ST6A 3POVA 3A9CA 1BDJB 1SMYF 2HMZA 3ABMC 2R7XA 1MMNA 2CYDA 2EINC 3EFOB 4I44A 2HV6A 1E83A 1B68A 2J8WA 1WOLA 2GA0A 4AE4A 5E3CA 1E85A 5B1AC 1W2WA 1OCZC 4LDRA 1MMGA 5L0HA 2BL2A 2YRFA 3X2QC 1V74B 3NKEA 2GWWA 3KMIA 3CZ6A 3EGDA 4FX5A 3EG9A 4LLCA 4BG0A 2R7UA 3HNKA 2HZ8A 1C02A 4Q4ZF 1M2VA 2P7VA 4C7OA 3TOMA 2J7PA 3HNJA 1YZAA 4DBQA 5D91A 3U2MA 4CBEA 4YJWA 1EQ1A 3C8GA 3UGPA 4RBNA 3O6XA 3FXHA 4LLEA 1FAPB 1LM3B 2ETSA 3T6GB 2O9XA 3WG7C 4CDYA 1YA7O 4IGGA 3FOOA 3SXZA 5BQIA 4U5HA 3N24A 1DOWA 1CPQA 3RVYA 3PDMP 1K40A 1MNDA 4KC9A 2NUPB 3JTLO 3VF0A 3ATPA 4U5EE 4J7TA 3F47A 4KNWA 4LACB 5AC4A 3J06A 1Q0KA 1NZEA 4W8KA 3L0IA 3E9VA 3ZC4A 3HLZA 3LEVA 2GDCA 1LS4A 1YYXA 2CNWD 3EH1A 1VLSA 2KQ9A 3SYNA 4JJGA 1PCXA 1WWPA 3EZIA 3Q6MA 2AP3A 2DYRC 4HFKB 2R7WA 1ZHWA 3K6BA 3M79A 1S05A 4ANJA 2MWQA 2R05A 5FCLA 5DQZA 3AGTA 3QVYA 1RMVA 4WGZA 3ZSUA 2QNLA 1A0BA 2CDQA 2R7SA 2RD9A 1TWHA 4UDVA 4W8PA 2XS1A 2AWYA 2QE9A 4YL1A 1H9TA 1KTMA 4BPMA 1J8YF 1PD1A 1WN0A 2J46A 1S7ZA 1SYQA 2J45A 3L8JA 3Q7LA 4PJNA 5T1DB 4G7HF 4H54A 4BEMJ 1ZHZA 2Q4FA 3BRJA 3ZVRA 2IYLD 3QMKA 4BJ6C 4PK4A 1T01A 1LKXA 2LD6A 2AU5A 3NKDA 1FFTC 1HMOA 4OIRF 4CIPA 4I1OB 2LP4A 5GPGB 4J7YA 4P6IC 2OG2A 1T9KA 4MVOA 2FAPB 1A7DA 1D1BA 3GEHA 4PFPA 3GEEA 3GM1A 2HJMA 4XPYA 4Z9HA 2Y3BA 2NUTA 1R4TA 2P6VA 2H7BA 2F22A 2XM0A 5AGFA 1GGQA 3MLGA 4EWCA 4U9EA 2NPUA 2Q9AA 1DOVA 4LDKA 1VB5A 1OW6A 2DI3A 2HV7A 4CDAA 3LAYA 4MVSA 1FMWA 5T3TA 1LE2A 1RXQA 1LVKA 4ULWA 3NYLA 2IOQA 2YL0A 4MTOA 2JD3A 3ZTMA 4ER9A 5A6KA 2P0NA 2A6EF 2VB6A 5DQTA 3DM9B 3AQCA 3IQ5A 3DM5A 4FAPB 1OXKA 5L0CA 3I4UA 3JT1A 1QPUA 1OR3A 2ZXOA 4OIPF 4XTKA 2CNWA 4NTBA 1JAFA 2YL1A 3GWLA 5F28E 3UMKA 3UMIA 1RKEB 1BBHA 4Q5SF 4YL0A 4I1MA 3TOLA 2A69F 2OCCC 3AG3C 2XLVA 1HW1A 1SF8A 3U5SA 1ZU5A 1VMAA 2CCYA 3R7CA 3W4YA 4MTFA 4BJTA 1M56C 1Z5ZA 2EPNA 2Z15A 5JRAA 2VCAA 2J9UA 4YN0B 1C17M 4U5BE 1QZXA 3JRTA 2YL3A 3CSKA 2WVQA 1NBBA 3DAFA 4O6MA 4E17A 4E7SA 5JVEA 1WTYA 4JE9A 4JCHA 4N4WA 4Q7CA 4MVUA 2KSFA 3HKKA 1LE4A 3IHUA 2GAQA 2ZPAA 3QZCA 4O6YA 4CJOA 2YLGA 1LPEA 1OKKD 2EPLX 4WABA 3GM3A 3PHF2 1M2VB 1YYJA 4JC7A 3UGOA 5CI8A 5KYWA 4DVYP 4IAQA 1OCOC 1K04A 2GFHA 2W9YA 3K1HA 1CGME 1RKCA 2EILC 3K1IA 3EJNA 2Y69C 1HMDA 3BEHA 2XM4A 1PV3A 256BA 2ZXPA 2I15A 3JYYA 1L3PA 1WATA 2HFIA 1E2XA 4G0HA 1A7EA 4QI0A 1HE9A 3M15A 3C8GD 1H9GA 2BC5A 1MNEA 1Z63A 1QVXA 2YLDA 3K1IC 1YLMA 3UNGC 3K7DA 5IY5C 3KPHA 2EPKX 4YWQA 1A7VA 1JPNA 3PCVA 3W8HA 4LDQA 3LNMB 2IXNA 2QLAA 2J9WA 4CJGA 2P1AA 3B0PA 2WL8A 1VYIA 4IARA 2OOCA 3EQLF 3ZTZA 4CS8A 2TMVP 4A2NB 2Q9CA 2KGOA 3N0TA 2YEVA 3QVZA 5T3WA 1VLTA 2YZSA 2QTVA 4D4NA 4AL1A 3UMHA 3FHDA 3IPMO 4E7ZA 4EIYA 2I8BA 3RYLA 1TQGA 1M57C 3CEXA 3C7JA 3RFYA 5EHHA 4WJ0A 3NMJA 3C63A 5DVWA 3TJ5A 3KKBA 4XLNF 1AVOB 3GANA 2HJ3A 2V3CC 4CSAC 3ITFA 2IBFA 1Y6DA 4YT8A 4JTAB 1VK5A 2WB7A 4DOZA 2XL8A 3TK0A 3S9OA 2CGEA 1CGNA 2FFHA 4DRIB 2HS5A 2C03A 3G4ZA 2B0HA 1H6GA 3ABKC 2PFDA 3V5YA 3B9QA 2QUPA 1NG1A 3JRMO 2QY9A 5L3VA 1V54C 3DXJF 2PNOA 3JYHA 1JRAA 5BUOA 2PX3A 1T6IA 4JURI 4O79A 1FR0A 1Q0MA 2NSFA 3G4XA 2KJGA 4AX2A 3AG4C 1APCA 3OWTA 3B0VC 4JKVA 3NMIA 5KYXA 3ZIBA 1D1CA 1V55C 3TQOA 4KBLA 4CSAA 3NYMA 1SZIA 3TULA 2G62A 1QKRA 1U6HA 3ECSA 2WZGA 3I5PA 5B1BC 4E0IA 1OW8A 2R9RB 2IXPA 4NCQA 4ZLCA 3GORA 3LJBA 5B3SC 2XXAB 4DBRA 5HSWA 2XSEA 4OD5A 2OEVA 4XPXA 5A6BA 4QDLA 4XWJA 3CQZA 3VM6A 5EGYA 3LESA 2RSEB 3MX3A 4MW3A 4DRHB 2Q9BA 3JSEO 3W8IA 2ZXRA 3ZG1A 3FMSA 1SR2A 2J0XA 3NMKA 1D0XA 4GYTA 1HW2A 1K05A 1ZYRF 2JX0A 5TJ5E 4PR9A 4PJMA 3GWNA 5A6BD 1TR2A 2WVOA 5L0GA 3U0CA 2YKZA 1QSPA 3DI5A 4Z9JA 3RKOF 5KYXB 1GM5A 1TWGA 4JRZA 2UUHA 4GEHA 3T9OA 3ZDLA 2R7RA 4PJLA 4P9TA 1PD0A 3B71A 1Z6AA 1HY5A 3DJNB 3IEEA 2YWAA 1YZCA 4XPWA 2Y39A 3FAJA 2VC9A 3SXKA 1TFOB 4IWBA 3QTHA 1I5NA 4EBJA 5BQHA 2OJQA 3H65A 4CS9A 3U8VA 2D4UA 5FZTA 2YLIA 2HSQA 3SZRA 4X0RA 5A6AA 3EGDB 1NU7D 1WGWA 4F4BA 2EIMC 2A0UA 1ZZPA 1OQCA 1EA8A 2B0JA 2KNHA 2XRHA 2W45A 5L0IA 1ZHXA 4NQFA 3C8ZA 1LS1A 2IXMA 2KYHA 3ABLC 4YT2A 2XL4A 3C8GB 3RW0A 4E18A 2XS8A 4C7OB 2PBEA 4O7GA 2A68F 3ZQVA 1O87A 2VASA 3H2UA 3HTKC 3KL4A 5L3QA 2NSGA 5B3IA 1G4WR 1MQVA 3N2ZB 1N1CA 4OD4A 1J8MF 3EPVA 3HNIA 3NYJA 4MNDA 4NTAA 3LEOA 1NU9C 3RH3A 1OW7A 3MYIA 2LFDA 3SNHA 2M64A 2NUPA 4N6HA 1TWAA 4D4XA
chains in the Genus database with same CATH topology
1V74B 1TFOB 1TFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V74 B;  1TFO B;  1TFK B; 
#chains in the Genus database with same CATH topology
 3GOD A;  1JOG A;  4YL3 A;  4I3M A;  3SEO A;  4IAO A;  3RIP A;  2J9V A;  3MFN A;  4DVZ A;  2FGY A;  1ZHT A;  4C3E A;  2XLO A;  3JZ0 A;  4JVS A;  2OU6 A;  2XL6 A;  4XEV A;  3DJU B;  1LI7 A;  2OJE D;  2P61 A;  4MVZ A;  1FMV A;  2UUI A;  1C03 A;  1BR2 A;  2G3V A;  2H7O A;  4ONS A;  4U5F E;  3VYW A;  2R7T A;  4O6N A;  2J7P D;  4XLP F;  4MVQ A;  3K33 A;  1GQA A;  1O3U A;  2R7Q A;  3O55 A;  3GEI A;  3R2P A;  3NDB B;  4K7B A;  4IB4 A;  1L7C A;  3WHN A;  4BJ6 A;  2WVN A;  4CDV A;  3QW0 A;  4JJF A;  1QLE C;  5F5H A;  5JSL A;  1ZVZ A;  5DS5 A;  3TJ6 A;  1IZM A;  2J9B A;  2WZF A;  1Y4C A;  3RQG A;  4KI2 A;  4DJ9 A;  1EKY A;  1JR8 A;  3US6 A;  2LQG A;  5KYY B;  1YJG A;  3EH2 A;  2MHR A;  3U2L A;  5KYN A;  2AWC A;  1E84 A;  3U3F A;  4G7Z F;  4B6I A;  1RJ9 B;  4JEB A;  3SXM A;  3CAX A;  3OEO A;  2NG1 A;  4R32 A;  4A4A A;  1JPJ A;  2IM8 A;  3HNL A;  4PJJ A;  4DRJ B;  2A0B A;  3HJC A;  5KYU B;  2NUT B;  1ORS C;  4MTG A;  3LLK A;  3T6J A;  1CPR A;  1Z3I X;  4JCZ A;  3O39 A;  3U3B A;  5AC5 A;  3U9M A;  2LSE A;  2YHS A;  4RDA A;  3RF3 A;  3U8P A;  2XLD A;  1F1M A;  1ZHY A;  1NLX A;  3EFO A;  4PFO A;  4BEJ A;  5K0I A;  4HE8 D;  3JSZ A;  4IRU A;  4CS9 C;  3DD7 A;  1OR2 A;  2Y3G A;  3LS1 A;  4MQ9 F;  1QQ3 A;  2Y3D A;  2ASR A;  3EHM A;  3Q7G A;  4BJ5 C;  4HEA J;  3V7O A;  2LFF A;  4AL0 A;  1WAS A;  4MW8 A;  5JS5 A;  1T5O A;  3M1C B;  3W2V A;  1BR4 A;  1LI5 A;  3K66 A;  1RJ9 A;  1T6Q A;  2VH3 A;  1ORY A;  3ZQY A;  2EPO A;  4KNV A;  3EG9 B;  2YVK A;  1G8X A;  3DWW A;  2R7O A;  1XZQ A;  1U89 A;  2AVK A;  3JCU Q;  3RQF A;  1ZU4 A;  2YQY A;  1AUE A;  3WOD F;  1D1A A;  4CS8 C;  3GM2 A;  1BZ4 A;  3T4R A;  2OKU A;  3EGX A;  2G3K A;  3O10 A;  4Z9I A;  2KW3 C;  3DAG A;  3MBG A;  2XXA A;  1LIH A;  4BJ1 A;  1U0B B;  4U9D A;  2R7V A;  1D0Z A;  1VOM A;  4M63 A;  1FFH A;  1Q0F A;  2IXO A;  1NFN A;  3S29 A;  2DYS C;  4JIO A;  3NG1 A;  3S90 A;  2DB4 A;  1XWJ A;  3DKA A;  4MS2 A;  4MVM A;  4PAC A;  3LS0 A;  2XLM A;  4IJJ A;  4RD9 A;  3A11 A;  1H7I A;  2ICW G;  5A69 A;  4QI2 A;  3AG1 C;  2HUJ A;  5E2Q A;  1YAR O;  2EPM X;  1VYK A;  3MYF A;  2DGJ A;  2LCH A;  1OCR C;  3TD7 A;  1EI7 A;  3U9J A;  4FWV A;  2X0C A;  4FES A;  1CGO A;  3DMD A;  4U5D E;  4EKW A;  5KYW B;  3AOU A;  1OXB A;  3C18 A;  4YT5 A;  2PP4 A;  2VCB A;  3V5Z A;  3L34 A;  3ZWI A;  2MYS A;  4K1O A;  1IW7 F;  3G50 A;  4CS7 A;  3B0U X;  4N6C A;  1V4A A;  2OQM A;  2R25 A;  2WZL A;  2E87 A;  3PMR A;  2ZXW C;  3NRH A;  2HMQ A;  3AGU A;  3AJM A;  3Q6N A;  3S84 A;  2J0W A;  4JEA A;  4H4K C;  3T6B A;  4HFF B;  1AEP A;  4CX9 A;  3LLI A;  1NFO A;  3FOP A;  3H2V A;  2D5R B;  4K0D A;  5E33 A;  2X51 A;  1G5Z A;  1ZW2 A;  4GQH A;  3IQT A;  5DLJ A;  1KNY A;  3KH2 A;  2L81 A;  1Z23 A;  3AG2 C;  2ZD9 A;  3DZA A;  1Q0G A;  4XEK A;  5JP7 A;  1JMW A;  3AQB A;  2A6H F;  1T6U A;  4NTF A;  3VRC A;  5CIV A;  2Q3T A;  3B29 A;  5JUA A;  4WGY A;  5COM A;  2Y3H A;  4XQ1 A;  3DE8 A;  4NC3 A;  3WAQ A;  5F5F A;  1MMD A;  4N06 A;  4DXW A;  1A41 A;  3ASO C;  3V5X A;  4OIQ F;  4ZLD A;  5DS6 A;  4AK9 A;  3L8I A;  4L6R A;  5DS4 A;  4JTD B;  2L6G A;  1M6T A;  1MMA A;  2BE5 F;  4EUK B;  3M4B A;  2LK4 A;  4U5G A;  5HV9 A;  4JTC B;  1Q0D A;  1ZW3 A;  2A1D D;  2XLH A;  4U5C E;  2Q00 A;  4XEF A;  2C04 A;  5BQG A;  1D0Y A;  3FVY A;  4J32 B;  1VTM P;  3RVZ A;  4J30 B;  3C62 A;  2CW0 F;  2L9J A;  3SP1 A;  4YK5 A;  2W4M A;  5L0D A;  4MVR A;  4EHP A;  1E86 A;  5COF A;  2L6H A;  2PF4 E;  5D92 A;  3S28 A;  1TKN A;  1FNT c;  1R5I D;  2YL7 A;  4JZA A;  1OCC C;  2W4B A;  1Z7Q c;  1M2O A;  4C3D A;  5COG A;  1ORJ A;  4G7O F;  1RCP A;  2XLW A;  2L7A A;  4BJ5 A;  4G78 A;  3IQ6 A;  5L0F A;  3KYJ A;  4ULV A;  2EIJ C;  3F46 A;  2HKV A;  3OA1 A;  1UFB A;  5KYU A;  4P9F A;  1YA9 A;  2H8A A;  3W2W A;  2HSB A;  5E3A A;  5L0J A;  3DE9 A;  2V26 A;  3ASN C;  1BR1 A;  3LNR A;  1GS9 A;  1G4U S;  1UG7 A;  1TWC A;  2KC3 A;  1I4Z A;  2M4E A;  4OIN F;  2Q7R A;  3X1O A;  5JT4 A;  2OEX A;  5JLI A;  5A6J A;  3LUT B;  4E0H A;  4JW1 A;  3L1M A;  2L6F A;  3E70 C;  3FAP B;  4EBK A;  1YDI A;  4YT4 A;  4AE4 B;  1KU2 A;  2KK1 A;  2H7V C;  5EK0 A;  3EHN A;  1FTS A;  1HE1 A;  1O5H A;  3KYI A;  5KYY A;  3I5Q A;  3S0X A;  4OIO F;  4EBB A;  2R02 A;  4LER A;  3M4C A;  3VAY A;  3RQE A;  4C3B A;  4CIH A;  2XLE A;  3FDQ A;  1YAU O;  1RKE A;  3SXY A;  3UR3 C;  2R03 A;  5CI9 A;  2EIK C;  3IQC A;  3EZH A;  4NY3 A;  2JPU A;  1NSG B;  3EGX B;  1XZP A;  1TFK B;  3S27 A;  2PX0 A;  1YVI A;  2VCC A;  2LIG A;  3QW1 A;  1I4Y A;  1OKK A;  1ST6 A;  3POV A;  3A9C A;  1BDJ B;  1SMY F;  2HMZ A;  3ABM C;  2R7X A;  1MMN A;  2CYD A;  2EIN C;  3EFO B;  4I44 A;  2HV6 A;  1E83 A;  1B68 A;  2J8W A;  1WOL A;  2GA0 A;  4AE4 A;  5E3C A;  1E85 A;  5B1A C;  1W2W A;  1OCZ C;  4LDR A;  1MMG A;  5L0H A;  2BL2 A;  2YRF A;  3X2Q C;  1V74 B;  3NKE A;  2GWW A;  3KMI A;  3CZ6 A;  3EGD A;  4FX5 A;  3EG9 A;  4LLC A;  4BG0 A;  2R7U A;  3HNK A;  2HZ8 A;  1C02 A;  4Q4Z F;  1M2V A;  2P7V A;  4C7O A;  3TOM A;  2J7P A;  3HNJ A;  1YZA A;  4DBQ A;  5D91 A;  3U2M A;  4CBE A;  4YJW A;  1EQ1 A;  3C8G A;  3UGP A;  4RBN A;  3O6X A;  3FXH A;  4LLE A;  1FAP B;  1LM3 B;  2ETS A;  3T6G B;  2O9X A;  3WG7 C;  4CDY A;  1YA7 O;  4IGG A;  3FOO A;  3SXZ A;  5BQI A;  4U5H A;  3N24 A;  1DOW A;  1CPQ A;  3RVY A;  3PDM P;  1K40 A;  1MND A;  4KC9 A;  2NUP B;  3JTL O;  3VF0 A;  3ATP A;  4U5E E;  4J7T A;  3F47 A;  4KNW A;  4LAC B;  5AC4 A;  3J06 A;  1Q0K A;  1NZE A;  4W8K A;  3L0I A;  3E9V A;  3ZC4 A;  3HLZ A;  3LEV A;  2GDC A;  1LS4 A;  1YYX A;  2CNW D;  3EH1 A;  1VLS A;  2KQ9 A;  3SYN A;  4JJG A;  1PCX A;  1WWP A;  3EZI A;  3Q6M A;  2AP3 A;  2DYR C;  4HFK B;  2R7W A;  1ZHW A;  3K6B A;  3M79 A;  1S05 A;  4ANJ A;  2MWQ A;  2R05 A;  5FCL A;  5DQZ A;  3AGT A;  3QVY A;  1RMV A;  4WGZ A;  3ZSU A;  2QNL A;  1A0B A;  2CDQ A;  2R7S A;  2RD9 A;  1TWH A;  4UDV A;  4W8P A;  2XS1 A;  2AWY A;  2QE9 A;  4YL1 A;  1H9T A;  1KTM A;  4BPM A;  1J8Y F;  1PD1 A;  1WN0 A;  2J46 A;  1S7Z A;  1SYQ A;  2J45 A;  3L8J A;  3Q7L A;  4PJN A;  5T1D B;  4G7H F;  4H54 A;  4BEM J;  1ZHZ A;  2Q4F A;  3BRJ A;  3ZVR A;  2IYL D;  3QMK A;  4BJ6 C;  4PK4 A;  1T01 A;  1LKX A;  2LD6 A;  2AU5 A;  3NKD A;  1FFT C;  1HMO A;  4OIR F;  4CIP A;  4I1O B;  2LP4 A;  5GPG B;  4J7Y A;  4P6I C;  2OG2 A;  1T9K A;  4MVO A;  2FAP B;  1A7D A;  1D1B A;  3GEH A;  4PFP A;  3GEE A;  3GM1 A;  2HJM A;  4XPY A;  4Z9H A;  2Y3B A;  2NUT A;  1R4T A;  2P6V A;  2H7B A;  2F22 A;  2XM0 A;  5AGF A;  1GGQ A;  3MLG A;  4EWC A;  4U9E A;  2NPU A;  2Q9A A;  1DOV A;  4LDK A;  1VB5 A;  1OW6 A;  2DI3 A;  2HV7 A;  4CDA A;  3LAY A;  4MVS A;  1FMW A;  5T3T A;  1LE2 A;  1RXQ A;  1LVK A;  4ULW A;  3NYL A;  2IOQ A;  2YL0 A;  4MTO A;  2JD3 A;  3ZTM A;  4ER9 A;  5A6K A;  2P0N A;  2A6E F;  2VB6 A;  5DQT A;  3DM9 B;  3AQC A;  3IQ5 A;  3DM5 A;  4FAP B;  1OXK A;  5L0C A;  3I4U A;  3JT1 A;  1QPU A;  1OR3 A;  2ZXO A;  4OIP F;  4XTK A;  2CNW A;  4NTB A;  1JAF A;  2YL1 A;  3GWL A;  5F28 E;  3UMK A;  3UMI A;  1RKE B;  1BBH A;  4Q5S F;  4YL0 A;  4I1M A;  3TOL A;  2A69 F;  2OCC C;  3AG3 C;  2XLV A;  1HW1 A;  1SF8 A;  3U5S A;  1ZU5 A;  1VMA A;  2CCY A;  3R7C A;  3W4Y A;  4MTF A;  4BJT A;  1M56 C;  1Z5Z A;  2EPN A;  2Z15 A;  5JRA A;  2VCA A;  2J9U A;  4YN0 B;  1C17 M;  4U5B E;  1QZX A;  3JRT A;  2YL3 A;  3CSK A;  2WVQ A;  1NBB A;  3DAF A;  4O6M A;  4E17 A;  4E7S A;  5JVE A;  1WTY A;  4JE9 A;  4JCH A;  4N4W A;  4Q7C A;  4MVU A;  2KSF A;  3HKK A;  1LE4 A;  3IHU A;  2GAQ A;  2ZPA A;  3QZC A;  4O6Y A;  4CJO A;  2YLG A;  1LPE A;  1OKK D;  2EPL X;  4WAB A;  3GM3 A;  3PHF 2;  1M2V B;  1YYJ A;  4JC7 A;  3UGO A;  5CI8 A;  5KYW A;  4DVY P;  4IAQ A;  1OCO C;  1K04 A;  2GFH A;  2W9Y A;  3K1H A;  1CGM E;  1RKC A;  2EIL C;  3K1I A;  3EJN A;  2Y69 C;  1HMD A;  3BEH A;  2XM4 A;  1PV3 A;  256B A;  2ZXP A;  2I15 A;  3JYY A;  1L3P A;  1WAT A;  2HFI A;  1E2X A;  4G0H A;  1A7E A;  4QI0 A;  1HE9 A;  3M15 A;  3C8G D;  1H9G A;  2BC5 A;  1MNE A;  1Z63 A;  1QVX A;  2YLD A;  3K1I C;  1YLM A;  3UNG C;  3K7D A;  5IY5 C;  3KPH A;  2EPK X;  4YWQ A;  1A7V A;  1JPN A;  3PCV A;  3W8H A;  4LDQ A;  3LNM B;  2IXN A;  2QLA A;  2J9W A;  4CJG A;  2P1A A;  3B0P A;  2WL8 A;  1VYI A;  4IAR A;  2OOC A;  3EQL F;  3ZTZ A;  4CS8 A;  2TMV P;  4A2N B;  2Q9C A;  2KGO A;  3N0T A;  2YEV A;  3QVZ A;  5T3W A;  1VLT A;  2YZS A;  2QTV A;  4D4N A;  4AL1 A;  3UMH A;  3FHD A;  3IPM O;  4E7Z A;  4EIY A;  2I8B A;  3RYL A;  1TQG A;  1M57 C;  3CEX A;  3C7J A;  3RFY A;  5EHH A;  4WJ0 A;  3NMJ A;  3C63 A;  5DVW A;  3TJ5 A;  3KKB A;  4XLN F;  1AVO B;  3GAN A;  2HJ3 A;  2V3C C;  4CSA C;  3ITF A;  2IBF A;  1Y6D A;  4YT8 A;  4JTA B;  1VK5 A;  2WB7 A;  4DOZ A;  2XL8 A;  3TK0 A;  3S9O A;  2CGE A;  1CGN A;  2FFH A;  4DRI B;  2HS5 A;  2C03 A;  3G4Z A;  2B0H A;  1H6G A;  3ABK C;  2PFD A;  3V5Y A;  3B9Q A;  2QUP A;  1NG1 A;  3JRM O;  2QY9 A;  5L3V A;  1V54 C;  3DXJ F;  2PNO A;  3JYH A;  1JRA A;  5BUO A;  2PX3 A;  1T6I A;  4JUR I;  4O79 A;  1FR0 A;  1Q0M A;  2NSF A;  3G4X A;  2KJG A;  4AX2 A;  3AG4 C;  1APC A;  3OWT A;  3B0V C;  4JKV A;  3NMI A;  5KYX A;  3ZIB A;  1D1C A;  1V55 C;  3TQO A;  4KBL A;  4CSA A;  3NYM A;  1SZI A;  3TUL A;  2G62 A;  1QKR A;  1U6H A;  3ECS A;  2WZG A;  3I5P A;  5B1B C;  4E0I A;  1OW8 A;  2R9R B;  2IXP A;  4NCQ A;  4ZLC A;  3GOR A;  3LJB A;  5B3S C;  2XXA B;  4DBR A;  5HSW A;  2XSE A;  4OD5 A;  2OEV A;  4XPX A;  5A6B A;  4QDL A;  4XWJ A;  3CQZ A;  3VM6 A;  5EGY A;  3LES A;  2RSE B;  3MX3 A;  4MW3 A;  4DRH B;  2Q9B A;  3JSE O;  3W8I A;  2ZXR A;  3ZG1 A;  3FMS A;  1SR2 A;  2J0X A;  3NMK A;  1D0X A;  4GYT A;  1HW2 A;  1K05 A;  1ZYR F;  2JX0 A;  5TJ5 E;  4PR9 A;  4PJM A;  3GWN A;  5A6B D;  1TR2 A;  2WVO A;  5L0G A;  3U0C A;  2YKZ A;  1QSP A;  3DI5 A;  4Z9J A;  3RKO F;  5KYX B;  1GM5 A;  1TWG A;  4JRZ A;  2UUH A;  4GEH A;  3T9O A;  3ZDL A;  2R7R A;  4PJL A;  4P9T A;  1PD0 A;  3B71 A;  1Z6A A;  1HY5 A;  3DJN B;  3IEE A;  2YWA A;  1YZC A;  4XPW A;  2Y39 A;  3FAJ A;  2VC9 A;  3SXK A;  1TFO B;  4IWB A;  3QTH A;  1I5N A;  4EBJ A;  5BQH A;  2OJQ A;  3H65 A;  4CS9 A;  3U8V A;  2D4U A;  5FZT A;  2YLI A;  2HSQ A;  3SZR A;  4X0R A;  5A6A A;  3EGD B;  1NU7 D;  1WGW A;  4F4B A;  2EIM C;  2A0U A;  1ZZP A;  1OQC A;  1EA8 A;  2B0J A;  2KNH A;  2XRH A;  2W45 A;  5L0I A;  1ZHX A;  4NQF A;  3C8Z A;  1LS1 A;  2IXM A;  2KYH A;  3ABL C;  4YT2 A;  2XL4 A;  3C8G B;  3RW0 A;  4E18 A;  2XS8 A;  4C7O B;  2PBE A;  4O7G A;  2A68 F;  3ZQV A;  1O87 A;  2VAS A;  3H2U A;  3HTK C;  3KL4 A;  5L3Q A;  2NSG A;  5B3I A;  1G4W R;  1MQV A;  3N2Z B;  1N1C A;  4OD4 A;  1J8M F;  3EPV A;  3HNI A;  3NYJ A;  4MND A;  4NTA A;  3LEO A;  1NU9 C;  3RH3 A;  1OW7 A;  3MYI A;  2LFD A;  3SNH A;  2M64 A;  2NUP A;  4N6H A;  1TWA A;  4D4X A; 
#chains in the Genus database with same CATH homology
 1V74 B;  1TFO B;  1TFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...