1V74B

Structure of the e. coli colicin d bound to its immunity protein immd
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
87
structure length
87
Chain Sequence
MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVKDLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin D
publication title Structural inhibition of the colicin D tRNase by the tRNA-mimicking immunity protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Antibiotic/immune system
total genus 31
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2003-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09204 Colicin_immun Bacterial self-protective colicin-like immunity
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.650 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Colicin D 1v74B00
1TFOB 1V74B 1TFKB
chains in the Genus database with same CATH superfamily
5T3TA 1IW7F 1LKXA 4DJ9A 1BR2A 5DS4A 4JTCB 3A11A 5KYYA 1JAFA 1I4ZA 4CSAC 3J06A 2CGEA 2Y39A 2XXAA 2LD6A 3AGTA 3Q7LA 1RKEA 2R03A 4BEMJ 4AX2A 1K40A 1YARO 1XWJA 2HUJA 4E7SA 3G4XA 5AC5A 2YRFA 3DXJF 3KPHA 2J9BA 4GEHA 4C7OA 2VCAA 1M2VB 1HMOA 2Q7RA 2J9VA 3U8VA 2P0NA 1G4US 2UUHA 4LACB 2R7UA 1BDJB 4MTOA 2M4EA 1WASA 3HNJA 5L3QA 3V7OA 2CYDA 3U3FA 3V5YA 5BQIA 3B0UX 2YWAA 2NPUA 1OW8A 3U2MA 3LUTB 2IXNA 4NTAA 1CGNA 3V5ZA 5KYXA 4U9DA 3B0VC 3KKBA 4U5FE 5B1AC 2QNLA 1OXBA 5L0HA 2J8WA 2WZFA 3EZIA 1RMVA 5A6BA 1PCXA 3AOUA 3PDMP 4LDRA 4E0IA 5CIVA 1ZU4A 2CCYA 2J7PD 2HKVA 2CDQA 3EGXA 3M4CA 3T9OA 1D1CA 1ZVZA 2Y69C 1M2OA 4JE9A 1DOVA 3DJUB 1YJGA 2R7OA 4JZAA 4M63A 1RKCA 2H7OA 1T6UA 4YL0A 5B1BC 1F1MA 2OJED 4D4NA 2LIGA 2OG2A 2P1AA 2WVQA 2EPOA 3M1CB 1SF8A 2KC3A 1H7IA 2A6EF 4BJ5A 1G4WR 1M6TA 1V54C 3C8GA 5COFA 3S9OA 5COGA 4YT8A 3ZVRA 3K1IA 3OWTA 3RQGA 5DLJA 5F5FA 5A6KA 1K04A 3ZQVA 3DD7A 1AUEA 4JEAA 5KYWB 1LIHA 3RQFA 2L81A 2QUPA 2NUPA 2KW3C 3DKAA 3X2QC 4CBEA 5JUAA 2DYRC 3LESA 5DVWA 3KYIA 1FNTc 4BJ1A 4RDAA 3RIPA 4U9EA 4DXWA 1JMWA 3NMKA 1EI7A 2DI3A 3O6XA 4CIHA 3TULA 4QI2A 2VH3A 4Q5SF 1Z23A 3BEHA 4YWQA 2KGOA 4AL1A 5EHHA 2IOQA 4JVSA 1SMYF 4NY3A 3U0CA 3HKKA 4YT2A 1ZHTA 1J8MF 3B0PA 3MLGA 4XTKA 2J9UA 3LEOA 3AJMA 3IEEA 2M64A 4EUKB 3GORA 1C17M 3JYYA 5JSLA 2XS8A 1CPQA 2NSGA 2XRHA 2VCCA 4O6YA 4Q7CA 3RVYA 3LS0A 2LCHA 1VTMP 5AGFA 2EPLX 4A4AA 2YVKA 2H7BA 3AGUA 4N4WA 3U2LA 5A6JA 1I4YA 3K66A 2NG1A 2R02A 1MNDA 1BR4A 1ORJA 1OQCA 2PFDA 2ZXOA 1MQVA 2J0XA 1TWGA 2HZ8A 5DQZA 5KYYB 3DAFA 1D0XA 5A6AA 1NLXA 4WABA 1E84A 4JRZA 1VOMA 2Z15A 1WWPA 3W8IA 1NFNA 4BPMA 3PHF2 3ZDLA 5FZTA 3Q6MA 1T6IA 3ZQYA 2XL6A 2LK4A 4JW1A 4O79A 2KNHA 1QQ3A 2ZXPA 4YL3A 1ST6A 3SEOA 5KYUA 4JJGA 4J32B 2O9XA 1L3PA 2EILC 3FAJA 2W9YA 2J9WA 1U6HA 1CPRA 3HNIA 2XSEA 3TOLA 3EZHA 1CGME 1XZPA 1YLMA 3GM1A 4IGGA 4ONSA 5L3VA 2JD3A 4CDYA 2QY9A 3DMDA 4N6HA 2E87A 2L6FA 2Q9CA 2V3CC 2Y3HA 1S05A 2EINC 2G3VA 3C18A 3W8HA 4DBQA 3FVYA 3S84A 2R7VA 5KYUB 1MMAA 1Z6AA 2EIMC 1OCCC 1S7ZA 1VYKA 3DJNB 4IARA 3IHUA 1HMDA 2G3KA 2H8AA 4YL1A 3X1OA 1U0BB 5T3WA 4CS7A 3E70C 2PF4E 3MBGA 1K05A 2OOCA 1YZCA 1JPJA 3OEOA 3DE9A 1T5OA 4K7BA 2R9RB 3QW0A 1R5ID 4C3DA 2IXMA 4CS9A 4G7ZF 2R7TA 1QZXA 2PNOA 2A0UA 2XLMA 2XLEA 1N1CA 2GAQA 2RSEB 4OD5A 1OXKA 4F4BA 5BUOA 2HFIA 1YYXA 3BRJA 4CS8A 3FMSA 2R7WA 4KC9A 4HFFB 1YA9A 2XLHA 4IAOA 4Z9IA 4C3EA 2EIJC 3HTKC 3CEXA 2JPUA 2WB7A 3JT1A 2XLWA 3K33A 3NDBB 1OCOC 3ZTZA 1OR2A 2R7QA 4J7TA 3W2WA 1E86A 3AG2C 2XS1A 3O10A 4QI0A 3EGDB 2YQYA 4LLCA 4KI2A 4IB4A 2HMZA 2JX0A 4K0DA 4MVUA 4XEVA 1ZU5A 2A68F 3RVZA 4XEKA 3GWLA 4ULVA 3Q7GA 1U89A 1WATA 2CNWA 3FOPA 4P9FA 4YJWA 4L6RA 2A1DD 5COMA 3S90A 2NUTB 3S28A 5DQTA 2XL4A 1LS1A 2VC9A 1MMDA 1TFOB 2YLGA 3NG1A 1VLSA 4Z9HA 1A0BA 2J0WA 2X51A 1Q0GA 3IQ5A 3NYMA 4I1MA 4W8KA 3WG7C 1BZ4A 2R7SA 2OQMA 2LFFA 3PMRA 4FX5A 3SYNA 2A0BA 2ZXWC 1EQ1A 3QZCA 4MVQA 5HV9A 2BE5F 4MW8A 4AE4A 4MW3A 4CSAA 2Q9BA 2FGYA 2WL8A 3R2PA 2A69F 4PACA 1AEPA 1ZHZA 5D92A 4BJ6C 1ZYRF 2XL8A 3QVZA 256BA 2VB6A 3AQCA 5EGYA 3ZWIA 2Q9AA 4I3MA 3T4RA 4JTAB 2L6GA 3NYJA 3UNGC 3B29A 3HLZA 4WGZA 2Q00A 3Q6NA 3EG9B 1QPUA 3UGOA 2VCBA 4H4KC 3LS1A 4JIOA 4U5GA 1NU9C 1BR1A 2BL2A 3B9QA 4MNDA 3VF0A 4AK9A 4XLPF 3GEHA 1H6GA 1FFHA 2J45A 1OKKD 1TWHA 4P9TA 1TWAA 4JJFA 2ZXRA 1FR0A 3ECSA 5L0GA 3LLIA 2AU5A 1E2XA 5L0FA 4GQHA 1KNYA 2QTVA 2R05A 2YKZA 3CSKA 4UDVA 1OW7A 2I8BA 1A7DA 1YA7O 3DZAA 5L0CA 1GS9A 3NYLA 3IQCA 1FTSA 2B0JA 1M2VA 1RJ9B 1Y4CA 3CAXA 5JP7A 1Z7Qc 4DBRA 4ZLCA 1UFBA 2AP3A 2XLVA 2YL3A 3EGDA 1Z63A 1BBHA 2XM4A 3EFOB 1XZQA 4XWJA 3EHNA 4MVSA 2P61A 1I5NA 4NTBA 4EBKA 2RD9A 2HV6A 3KL4A 4PJLA 3G4ZA 3TQOA 3QMKA 1LPEA 1NFOA 4EHPA 2WVNA 3DM5A 3R7CA 2NUTA 3VM6A 5B3SC 3TJ5A 4FWVA 3I5QA 3EQLF 4DRIB 3C62A 2D4UA 1NBBA 3S27A 5F5HA 4HE8D 4NCQA 4OD4A 5E2QA 3A9CA 3KYJA 1JOGA 1JPNA 4WGYA 1D1AA 3U3BA 2NSFA 1W2WA 1QLEC 4MQ9F 1UG7A 2PX0A 1OCRC 3AG3C 3DI5A 1TQGA 4JCHA 4XPYA 3UMHA 1IZMA 3UR3C 2ZPAA 3ABLC 4EIYA 5A6BD 2XXAB 1OCZC 1RKEB 4JURI 2YLDA 1PD0A 2YEVA 3S0XA 1HE9A 3SP1A 1QSPA 3HNLA 1TFKB 1M56C 3C8ZA 3JZ0A 2WZLA 3N2ZB 3NMJA 1EA8A 3OA1A 4C7OB 2ETSA 3JCUQ 4K1OA 1T9KA 2VASA 4E18A 5JS5A 2MHRA 1WGWA 4N06A 3L0IA 2HMQA 4E0HA 1GQAA 2EPKX 3N24A 3RQEA 3SNHA 4CS9C 4G7HF 1FMVA 2ASRA 2GDCA 2MYSA 5E33A 4O6NA 3VRCA 1V4AA 2HJ3A 3JSEO 3H2UA 2AWYA 2KK1A 3L34A 1D0ZA 4PJJA 4EBJA 5KYWA 2DB4A 3C8GD 4ANJA 2Q3TA 3ABMC 2J7PA 5KYXB 4ZLDA 5DS5A 3UGPA 1O5HA 1PD1A 3JYHA 2AWCA 3O55A 5CI8A 1YDIA 3M4BA 4O6MA 3U8PA 1OR3A 4XLNF 3PCVA 4MTGA 3W4YA 1WTYA 5L0JA 3TJ6A 1Q0DA 3ZC4A 3EGXB 5JLIA 2Q4FA 1L7CA 4XPWA 4CIPA 2R7XA 4BEJA 3QVYA 2W4MA 3DM9B 1RJ9A 1J8YF 1Q0FA 1TWCA 3NRHA 1Q0KA 4LDQA 2OU6A 4PFOA 4WJ0A 1H9GA 3AG1C 1Z5ZA 3WODF 2H7VC 3DE8A 1FAPB 3K1HA 3NKEA 4OIPF 1LVKA 2GA0A 1C02A 3FAPB 1GM5A 2W4BA 1MMGA 2YLIA 2PX3A 3HJCA 2YHSA 3C8GB 3WHNA 2Y3GA 3ZIBA 4C3BA 2G62A 2HJMA 2I15A 1D0YA 3UMIA 3W2VA 5TJ5E 3SXYA 2FFHA 4CJOA 1T6QA 2WZGA 2LQGA 4LLEA 3EHMA 2BC5A 1QVXA 3H65A 3ITFA 1LE2A 4AL0A 2HS5A 2IXOA 3GANA 4Z9JA 2NUPB 2KJGA 2PBEA 3EJNA 5KYNA 2Y3BA 3F47A 3JRTA 1OW6A 1FFTC 1QKRA 4QDLA 4J30B 3K6BA 3IQ6A 3GODA 1CGOA 1HW1A 2P7VA 4EKWA 1YYJA 4P6IC 4CX9A 3LLKA 4OIOF 4W8PA 2L6HA 4PK4A 5T1DB 5CI9A 1SYQA 2XM0A 1PV3A 1VB5A 4BJ5C 3T6BA 1VLTA 2F22A 1G5ZA 3WAQA 3M15A 1VMAA 1VK5A 2ZD9A 1HE1A 3K1IC 2GWWA 2OEVA 3O39A 3HNKA 4O7GA 4RBNA 3LAYA 5GPGB 4BG0A 1VYIA 3E9VA 3B71A 1RCPA 2IXPA 4HEAJ 3T6JA 1TR2A 4I1OB 3ZSUA 3NMIA 1APCA 3QW1A 4U5HA 1KU2A 3SXZA 1DOWA 4XQ1A 1ZW2A 4CDVA 3RKOF 1O87A 4CDAA 4YT4A 1R4TA 3U9JA 3VAYA 4XPXA 3U9MA 5F28E 1AVOB 1FMWA 3JTLO 1NZEA 5JVEA 4R32A 3ZTMA 2QE9A 3RF3A 5IY5C 1Q0MA 3GEIA 4DRHB 2IBFA 2J46A 2YZSA 3I5PA 3MYFA 4LDKA 4PR9A 2W45A 4KNVA 3U5SA 1Z3IX 2X0CA 5JT4A 5FCLA 1C03A 2L9JA 2AVKA 3C7JA 2C04A 4MVMA 3GM2A 5K0IA 3AQBA 3JSZA 1ZHXA 3VYWA 4PJNA 4DVZA 2KSFA 1MMNA 4IAQA 5B3IA 4Q4ZF 2OCCC 5E3CA 5L0IA 4MVOA 4FAPB 3LJBA 4MTFA 1JRAA 2R25A 3CQZA 3M79A 4U5DE 2B0HA 4GYTA 4KBLA 2P6VA 1LM3B 4MVZA 3RH3A 3L1MA 3ASNC 4XEFA 4FESA 1ZZPA 2XLOA 4BJ6A 4D4XA 2Y3DA 1LE4A 5A69A 4G0HA 3FDQA 2EIKC 2EPMX 1YAUO 1YVIA 3I4UA 4A2NB 4RD9A 1JR8A 2CW0F 2LFDA 4KNWA 5D91A 3KMIA 4PJMA 5L0DA 3POVA 1H9TA 1LI7A 1MNEA 3FHDA 3IQTA 4EWCA 3V5XA 4B6IA 3RW0A 4E17A 2R7RA 3T6GB 2V26A 2CNWD 5JRAA 1SR2A 1NG1A 2MWQA 1A7VA 1LI5A 1Y6DA 3IPMO 2TMVP 4JC7A 3JRMO 2D5RB 2OKUA 3MYIA 3SXKA 2A6HF 1GGQA 2HV7A 3DWWA 4NC3A 1G8XA 2YL0A 4EBBA 4E7ZA 3QTHA 4CJGA 3CZ6A 1ZW3A 1WN0A 3ATPA 4JEBA 2OJQA 4YK5A 4OINF 3LEVA 4IJJA 1ZHWA 3EG9A 3TOMA 3FXHA 1SZIA 1NU7D 4H54A 1E85A 2WVOA 3RYLA 5HSWA 1A7EA 1WOLA 1YZAA 3TD7A 1V55C 3US6A 4NTFA 3LNRA 1E83A 5AC4A 4YN0B 2UUIA 4G78A 3KH2A 2OEXA 3N0TA 4YT5A 4MS2A 3SZRA 3MFNA 1D1BA 3EPVA 1RXQA 3FOOA 4I44A 1T01A 3DAGA 1ORSC 4J7YA 2KQ9A 4LERA 3K7DA 4CS8C 1KTMA 4DVYP 4NQFA 2L7AA 2XLDA 4OIRF 2GFHA 2YL1A 2EPNA 2HSBA 2QLAA 3ABKC 3LNMB 2IM8A 4IWBA 4JKVA 3ASOC 1HW2A 3UMKA 4BJTA 4JCZA 4PFPA 4IRUA 2LSEA 5E3AA 5EK0A 3ZG1A 5DS6A 4OIQF 4X0RA 1EKYA 4DOZA 4AE4B 3SXMA 3C63A 4G7OF 3G50A 3MX3A 5BQGA 1M57C 2HSQA 3RFYA 1O3UA 1TKNA 1B68A 3H2VA 3L8IA 3EFOA 3NKDA 3EH1A 2C03A 4U5CE 2DGJA 1ORYA 3F46A 4N6CA 1V74B 3GWNA 1HY5A 4MVRA 3L8JA 3GEEA 2LP4A 1LS4A 1OKKA 3GM3A 3AG4C 3TK0A 2KYHA 4U5EE 2DYSC 2IYLD 4JTDB 1A41A 2ICWG 4HFKB 4ULWA 4ER9A 2FAPB 4U5BE 3S29A 2YL7A 1NSGB 1ZHYA 5BQHA 2PP4A 3EH2A 4DRJB
chains in the Genus database with same CATH topology
1TFOB 1V74B 1TFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFO B;  1V74 B;  1TFK B; 
#chains in the Genus database with same CATH topology
 5T3T A;  1IW7 F;  1LKX A;  4DJ9 A;  1BR2 A;  5DS4 A;  4JTC B;  3A11 A;  5KYY A;  1JAF A;  1I4Z A;  4CSA C;  3J06 A;  2CGE A;  2Y39 A;  2XXA A;  2LD6 A;  3AGT A;  3Q7L A;  1RKE A;  2R03 A;  4BEM J;  4AX2 A;  1K40 A;  1YAR O;  1XWJ A;  2HUJ A;  4E7S A;  3G4X A;  5AC5 A;  2YRF A;  3DXJ F;  3KPH A;  2J9B A;  4GEH A;  4C7O A;  2VCA A;  1M2V B;  1HMO A;  2Q7R A;  2J9V A;  3U8V A;  2P0N A;  1G4U S;  2UUH A;  4LAC B;  2R7U A;  1BDJ B;  4MTO A;  2M4E A;  1WAS A;  3HNJ A;  5L3Q A;  3V7O A;  2CYD A;  3U3F A;  3V5Y A;  5BQI A;  3B0U X;  2YWA A;  2NPU A;  1OW8 A;  3U2M A;  3LUT B;  2IXN A;  4NTA A;  1CGN A;  3V5Z A;  5KYX A;  4U9D A;  3B0V C;  3KKB A;  4U5F E;  5B1A C;  2QNL A;  1OXB A;  5L0H A;  2J8W A;  2WZF A;  3EZI A;  1RMV A;  5A6B A;  1PCX A;  3AOU A;  3PDM P;  4LDR A;  4E0I A;  5CIV A;  1ZU4 A;  2CCY A;  2J7P D;  2HKV A;  2CDQ A;  3EGX A;  3M4C A;  3T9O A;  1D1C A;  1ZVZ A;  2Y69 C;  1M2O A;  4JE9 A;  1DOV A;  3DJU B;  1YJG A;  2R7O A;  4JZA A;  4M63 A;  1RKC A;  2H7O A;  1T6U A;  4YL0 A;  5B1B C;  1F1M A;  2OJE D;  4D4N A;  2LIG A;  2OG2 A;  2P1A A;  2WVQ A;  2EPO A;  3M1C B;  1SF8 A;  2KC3 A;  1H7I A;  2A6E F;  4BJ5 A;  1G4W R;  1M6T A;  1V54 C;  3C8G A;  5COF A;  3S9O A;  5COG A;  4YT8 A;  3ZVR A;  3K1I A;  3OWT A;  3RQG A;  5DLJ A;  5F5F A;  5A6K A;  1K04 A;  3ZQV A;  3DD7 A;  1AUE A;  4JEA A;  5KYW B;  1LIH A;  3RQF A;  2L81 A;  2QUP A;  2NUP A;  2KW3 C;  3DKA A;  3X2Q C;  4CBE A;  5JUA A;  2DYR C;  3LES A;  5DVW A;  3KYI A;  1FNT c;  4BJ1 A;  4RDA A;  3RIP A;  4U9E A;  4DXW A;  1JMW A;  3NMK A;  1EI7 A;  2DI3 A;  3O6X A;  4CIH A;  3TUL A;  4QI2 A;  2VH3 A;  4Q5S F;  1Z23 A;  3BEH A;  4YWQ A;  2KGO A;  4AL1 A;  5EHH A;  2IOQ A;  4JVS A;  1SMY F;  4NY3 A;  3U0C A;  3HKK A;  4YT2 A;  1ZHT A;  1J8M F;  3B0P A;  3MLG A;  4XTK A;  2J9U A;  3LEO A;  3AJM A;  3IEE A;  2M64 A;  4EUK B;  3GOR A;  1C17 M;  3JYY A;  5JSL A;  2XS8 A;  1CPQ A;  2NSG A;  2XRH A;  2VCC A;  4O6Y A;  4Q7C A;  3RVY A;  3LS0 A;  2LCH A;  1VTM P;  5AGF A;  2EPL X;  4A4A A;  2YVK A;  2H7B A;  3AGU A;  4N4W A;  3U2L A;  5A6J A;  1I4Y A;  3K66 A;  2NG1 A;  2R02 A;  1MND A;  1BR4 A;  1ORJ A;  1OQC A;  2PFD A;  2ZXO A;  1MQV A;  2J0X A;  1TWG A;  2HZ8 A;  5DQZ A;  5KYY B;  3DAF A;  1D0X A;  5A6A A;  1NLX A;  4WAB A;  1E84 A;  4JRZ A;  1VOM A;  2Z15 A;  1WWP A;  3W8I A;  1NFN A;  4BPM A;  3PHF 2;  3ZDL A;  5FZT A;  3Q6M A;  1T6I A;  3ZQY A;  2XL6 A;  2LK4 A;  4JW1 A;  4O79 A;  2KNH A;  1QQ3 A;  2ZXP A;  4YL3 A;  1ST6 A;  3SEO A;  5KYU A;  4JJG A;  4J32 B;  2O9X A;  1L3P A;  2EIL C;  3FAJ A;  2W9Y A;  2J9W A;  1U6H A;  1CPR A;  3HNI A;  2XSE A;  3TOL A;  3EZH A;  1CGM E;  1XZP A;  1YLM A;  3GM1 A;  4IGG A;  4ONS A;  5L3V A;  2JD3 A;  4CDY A;  2QY9 A;  3DMD A;  4N6H A;  2E87 A;  2L6F A;  2Q9C A;  2V3C C;  2Y3H A;  1S05 A;  2EIN C;  2G3V A;  3C18 A;  3W8H A;  4DBQ A;  3FVY A;  3S84 A;  2R7V A;  5KYU B;  1MMA A;  1Z6A A;  2EIM C;  1OCC C;  1S7Z A;  1VYK A;  3DJN B;  4IAR A;  3IHU A;  1HMD A;  2G3K A;  2H8A A;  4YL1 A;  3X1O A;  1U0B B;  5T3W A;  4CS7 A;  3E70 C;  2PF4 E;  3MBG A;  1K05 A;  2OOC A;  1YZC A;  1JPJ A;  3OEO A;  3DE9 A;  1T5O A;  4K7B A;  2R9R B;  3QW0 A;  1R5I D;  4C3D A;  2IXM A;  4CS9 A;  4G7Z F;  2R7T A;  1QZX A;  2PNO A;  2A0U A;  2XLM A;  2XLE A;  1N1C A;  2GAQ A;  2RSE B;  4OD5 A;  1OXK A;  4F4B A;  5BUO A;  2HFI A;  1YYX A;  3BRJ A;  4CS8 A;  3FMS A;  2R7W A;  4KC9 A;  4HFF B;  1YA9 A;  2XLH A;  4IAO A;  4Z9I A;  4C3E A;  2EIJ C;  3HTK C;  3CEX A;  2JPU A;  2WB7 A;  3JT1 A;  2XLW A;  3K33 A;  3NDB B;  1OCO C;  3ZTZ A;  1OR2 A;  2R7Q A;  4J7T A;  3W2W A;  1E86 A;  3AG2 C;  2XS1 A;  3O10 A;  4QI0 A;  3EGD B;  2YQY A;  4LLC A;  4KI2 A;  4IB4 A;  2HMZ A;  2JX0 A;  4K0D A;  4MVU A;  4XEV A;  1ZU5 A;  2A68 F;  3RVZ A;  4XEK A;  3GWL A;  4ULV A;  3Q7G A;  1U89 A;  1WAT A;  2CNW A;  3FOP A;  4P9F A;  4YJW A;  4L6R A;  2A1D D;  5COM A;  3S90 A;  2NUT B;  3S28 A;  5DQT A;  2XL4 A;  1LS1 A;  2VC9 A;  1MMD A;  1TFO B;  2YLG A;  3NG1 A;  1VLS A;  4Z9H A;  1A0B A;  2J0W A;  2X51 A;  1Q0G A;  3IQ5 A;  3NYM A;  4I1M A;  4W8K A;  3WG7 C;  1BZ4 A;  2R7S A;  2OQM A;  2LFF A;  3PMR A;  4FX5 A;  3SYN A;  2A0B A;  2ZXW C;  1EQ1 A;  3QZC A;  4MVQ A;  5HV9 A;  2BE5 F;  4MW8 A;  4AE4 A;  4MW3 A;  4CSA A;  2Q9B A;  2FGY A;  2WL8 A;  3R2P A;  2A69 F;  4PAC A;  1AEP A;  1ZHZ A;  5D92 A;  4BJ6 C;  1ZYR F;  2XL8 A;  3QVZ A;  256B A;  2VB6 A;  3AQC A;  5EGY A;  3ZWI A;  2Q9A A;  4I3M A;  3T4R A;  4JTA B;  2L6G A;  3NYJ A;  3UNG C;  3B29 A;  3HLZ A;  4WGZ A;  2Q00 A;  3Q6N A;  3EG9 B;  1QPU A;  3UGO A;  2VCB A;  4H4K C;  3LS1 A;  4JIO A;  4U5G A;  1NU9 C;  1BR1 A;  2BL2 A;  3B9Q A;  4MND A;  3VF0 A;  4AK9 A;  4XLP F;  3GEH A;  1H6G A;  1FFH A;  2J45 A;  1OKK D;  1TWH A;  4P9T A;  1TWA A;  4JJF A;  2ZXR A;  1FR0 A;  3ECS A;  5L0G A;  3LLI A;  2AU5 A;  1E2X A;  5L0F A;  4GQH A;  1KNY A;  2QTV A;  2R05 A;  2YKZ A;  3CSK A;  4UDV A;  1OW7 A;  2I8B A;  1A7D A;  1YA7 O;  3DZA A;  5L0C A;  1GS9 A;  3NYL A;  3IQC A;  1FTS A;  2B0J A;  1M2V A;  1RJ9 B;  1Y4C A;  3CAX A;  5JP7 A;  1Z7Q c;  4DBR A;  4ZLC A;  1UFB A;  2AP3 A;  2XLV A;  2YL3 A;  3EGD A;  1Z63 A;  1BBH A;  2XM4 A;  3EFO B;  1XZQ A;  4XWJ A;  3EHN A;  4MVS A;  2P61 A;  1I5N A;  4NTB A;  4EBK A;  2RD9 A;  2HV6 A;  3KL4 A;  4PJL A;  3G4Z A;  3TQO A;  3QMK A;  1LPE A;  1NFO A;  4EHP A;  2WVN A;  3DM5 A;  3R7C A;  2NUT A;  3VM6 A;  5B3S C;  3TJ5 A;  4FWV A;  3I5Q A;  3EQL F;  4DRI B;  3C62 A;  2D4U A;  1NBB A;  3S27 A;  5F5H A;  4HE8 D;  4NCQ A;  4OD4 A;  5E2Q A;  3A9C A;  3KYJ A;  1JOG A;  1JPN A;  4WGY A;  1D1A A;  3U3B A;  2NSF A;  1W2W A;  1QLE C;  4MQ9 F;  1UG7 A;  2PX0 A;  1OCR C;  3AG3 C;  3DI5 A;  1TQG A;  4JCH A;  4XPY A;  3UMH A;  1IZM A;  3UR3 C;  2ZPA A;  3ABL C;  4EIY A;  5A6B D;  2XXA B;  1OCZ C;  1RKE B;  4JUR I;  2YLD A;  1PD0 A;  2YEV A;  3S0X A;  1HE9 A;  3SP1 A;  1QSP A;  3HNL A;  1TFK B;  1M56 C;  3C8Z A;  3JZ0 A;  2WZL A;  3N2Z B;  3NMJ A;  1EA8 A;  3OA1 A;  4C7O B;  2ETS A;  3JCU Q;  4K1O A;  1T9K A;  2VAS A;  4E18 A;  5JS5 A;  2MHR A;  1WGW A;  4N06 A;  3L0I A;  2HMQ A;  4E0H A;  1GQA A;  2EPK X;  3N24 A;  3RQE A;  3SNH A;  4CS9 C;  4G7H F;  1FMV A;  2ASR A;  2GDC A;  2MYS A;  5E33 A;  4O6N A;  3VRC A;  1V4A A;  2HJ3 A;  3JSE O;  3H2U A;  2AWY A;  2KK1 A;  3L34 A;  1D0Z A;  4PJJ A;  4EBJ A;  5KYW A;  2DB4 A;  3C8G D;  4ANJ A;  2Q3T A;  3ABM C;  2J7P A;  5KYX B;  4ZLD A;  5DS5 A;  3UGP A;  1O5H A;  1PD1 A;  3JYH A;  2AWC A;  3O55 A;  5CI8 A;  1YDI A;  3M4B A;  4O6M A;  3U8P A;  1OR3 A;  4XLN F;  3PCV A;  4MTG A;  3W4Y A;  1WTY A;  5L0J A;  3TJ6 A;  1Q0D A;  3ZC4 A;  3EGX B;  5JLI A;  2Q4F A;  1L7C A;  4XPW A;  4CIP A;  2R7X A;  4BEJ A;  3QVY A;  2W4M A;  3DM9 B;  1RJ9 A;  1J8Y F;  1Q0F A;  1TWC A;  3NRH A;  1Q0K A;  4LDQ A;  2OU6 A;  4PFO A;  4WJ0 A;  1H9G A;  3AG1 C;  1Z5Z A;  3WOD F;  2H7V C;  3DE8 A;  1FAP B;  3K1H A;  3NKE A;  4OIP F;  1LVK A;  2GA0 A;  1C02 A;  3FAP B;  1GM5 A;  2W4B A;  1MMG A;  2YLI A;  2PX3 A;  3HJC A;  2YHS A;  3C8G B;  3WHN A;  2Y3G A;  3ZIB A;  4C3B A;  2G62 A;  2HJM A;  2I15 A;  1D0Y A;  3UMI A;  3W2V A;  5TJ5 E;  3SXY A;  2FFH A;  4CJO A;  1T6Q A;  2WZG A;  2LQG A;  4LLE A;  3EHM A;  2BC5 A;  1QVX A;  3H65 A;  3ITF A;  1LE2 A;  4AL0 A;  2HS5 A;  2IXO A;  3GAN A;  4Z9J A;  2NUP B;  2KJG A;  2PBE A;  3EJN A;  5KYN A;  2Y3B A;  3F47 A;  3JRT A;  1OW6 A;  1FFT C;  1QKR A;  4QDL A;  4J30 B;  3K6B A;  3IQ6 A;  3GOD A;  1CGO A;  1HW1 A;  2P7V A;  4EKW A;  1YYJ A;  4P6I C;  4CX9 A;  3LLK A;  4OIO F;  4W8P A;  2L6H A;  4PK4 A;  5T1D B;  5CI9 A;  1SYQ A;  2XM0 A;  1PV3 A;  1VB5 A;  4BJ5 C;  3T6B A;  1VLT A;  2F22 A;  1G5Z A;  3WAQ A;  3M15 A;  1VMA A;  1VK5 A;  2ZD9 A;  1HE1 A;  3K1I C;  2GWW A;  2OEV A;  3O39 A;  3HNK A;  4O7G A;  4RBN A;  3LAY A;  5GPG B;  4BG0 A;  1VYI A;  3E9V A;  3B71 A;  1RCP A;  2IXP A;  4HEA J;  3T6J A;  1TR2 A;  4I1O B;  3ZSU A;  3NMI A;  1APC A;  3QW1 A;  4U5H A;  1KU2 A;  3SXZ A;  1DOW A;  4XQ1 A;  1ZW2 A;  4CDV A;  3RKO F;  1O87 A;  4CDA A;  4YT4 A;  1R4T A;  3U9J A;  3VAY A;  4XPX A;  3U9M A;  5F28 E;  1AVO B;  1FMW A;  3JTL O;  1NZE A;  5JVE A;  4R32 A;  3ZTM A;  2QE9 A;  3RF3 A;  5IY5 C;  1Q0M A;  3GEI A;  4DRH B;  2IBF A;  2J46 A;  2YZS A;  3I5P A;  3MYF A;  4LDK A;  4PR9 A;  2W45 A;  4KNV A;  3U5S A;  1Z3I X;  2X0C A;  5JT4 A;  5FCL A;  1C03 A;  2L9J A;  2AVK A;  3C7J A;  2C04 A;  4MVM A;  3GM2 A;  5K0I A;  3AQB A;  3JSZ A;  1ZHX A;  3VYW A;  4PJN A;  4DVZ A;  2KSF A;  1MMN A;  4IAQ A;  5B3I A;  4Q4Z F;  2OCC C;  5E3C A;  5L0I A;  4MVO A;  4FAP B;  3LJB A;  4MTF A;  1JRA A;  2R25 A;  3CQZ A;  3M79 A;  4U5D E;  2B0H A;  4GYT A;  4KBL A;  2P6V A;  1LM3 B;  4MVZ A;  3RH3 A;  3L1M A;  3ASN C;  4XEF A;  4FES A;  1ZZP A;  2XLO A;  4BJ6 A;  4D4X A;  2Y3D A;  1LE4 A;  5A69 A;  4G0H A;  3FDQ A;  2EIK C;  2EPM X;  1YAU O;  1YVI A;  3I4U A;  4A2N B;  4RD9 A;  1JR8 A;  2CW0 F;  2LFD A;  4KNW A;  5D91 A;  3KMI A;  4PJM A;  5L0D A;  3POV A;  1H9T A;  1LI7 A;  1MNE A;  3FHD A;  3IQT A;  4EWC A;  3V5X A;  4B6I A;  3RW0 A;  4E17 A;  2R7R A;  3T6G B;  2V26 A;  2CNW D;  5JRA A;  1SR2 A;  1NG1 A;  2MWQ A;  1A7V A;  1LI5 A;  1Y6D A;  3IPM O;  2TMV P;  4JC7 A;  3JRM O;  2D5R B;  2OKU A;  3MYI A;  3SXK A;  2A6H F;  1GGQ A;  2HV7 A;  3DWW A;  4NC3 A;  1G8X A;  2YL0 A;  4EBB A;  4E7Z A;  3QTH A;  4CJG A;  3CZ6 A;  1ZW3 A;  1WN0 A;  3ATP A;  4JEB A;  2OJQ A;  4YK5 A;  4OIN F;  3LEV A;  4IJJ A;  1ZHW A;  3EG9 A;  3TOM A;  3FXH A;  1SZI A;  1NU7 D;  4H54 A;  1E85 A;  2WVO A;  3RYL A;  5HSW A;  1A7E A;  1WOL A;  1YZA A;  3TD7 A;  1V55 C;  3US6 A;  4NTF A;  3LNR A;  1E83 A;  5AC4 A;  4YN0 B;  2UUI A;  4G78 A;  3KH2 A;  2OEX A;  3N0T A;  4YT5 A;  4MS2 A;  3SZR A;  3MFN A;  1D1B A;  3EPV A;  1RXQ A;  3FOO A;  4I44 A;  1T01 A;  3DAG A;  1ORS C;  4J7Y A;  2KQ9 A;  4LER A;  3K7D A;  4CS8 C;  1KTM A;  4DVY P;  4NQF A;  2L7A A;  2XLD A;  4OIR F;  2GFH A;  2YL1 A;  2EPN A;  2HSB A;  2QLA A;  3ABK C;  3LNM B;  2IM8 A;  4IWB A;  4JKV A;  3ASO C;  1HW2 A;  3UMK A;  4BJT A;  4JCZ A;  4PFP A;  4IRU A;  2LSE A;  5E3A A;  5EK0 A;  3ZG1 A;  5DS6 A;  4OIQ F;  4X0R A;  1EKY A;  4DOZ A;  4AE4 B;  3SXM A;  3C63 A;  4G7O F;  3G50 A;  3MX3 A;  5BQG A;  1M57 C;  2HSQ A;  3RFY A;  1O3U A;  1TKN A;  1B68 A;  3H2V A;  3L8I A;  3EFO A;  3NKD A;  3EH1 A;  2C03 A;  4U5C E;  2DGJ A;  1ORY A;  3F46 A;  4N6C A;  1V74 B;  3GWN A;  1HY5 A;  4MVR A;  3L8J A;  3GEE A;  2LP4 A;  1LS4 A;  1OKK A;  3GM3 A;  3AG4 C;  3TK0 A;  2KYH A;  4U5E E;  2DYS C;  2IYL D;  4JTD B;  1A41 A;  2ICW G;  4HFK B;  4ULW A;  4ER9 A;  2FAP B;  4U5B E;  3S29 A;  2YL7 A;  1NSG B;  1ZHY A;  5BQH A;  2PP4 A;  3EH2 A;  4DRJ B; 
#chains in the Genus database with same CATH homology
 1TFO B;  1V74 B;  1TFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...