1T6QA

Nickel superoxide dismutase (nisod) cn-treated apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6qA00
1Q0KA 1Q0MA 4NCQA 1Q0GA 3G4XA 1Q0DA 1T6IA 3G4ZA 1T6QA 1T6UA 3G50A 1Q0FA
chains in the Genus database with same CATH superfamily
4QI0A 2PNOA 4OIQF 5JRAA 3H2VA 4LDKA 5AGFA 4OIRF 2AWCA 3DM9B 3AOUA 3OA1A 2R7SA 1WATA 2QNLA 3V5XA 2JPUA 2J0WA 4MVOA 2PBEA 4K7BA 3ZG1A 3AGUA 1OW8A 4I44A 1YZAA 1G8XA 4BJ1A 4Z9HA 4UDVA 3UGPA 1NG1A 5FZTA 2YEVA 4ANJA 3ZC4A 4YL1A 1NZEA 2XL8A 2XLWA 1MNDA 3SXYA 1TWAA 3I4UA 3EH1A 3TD7A 4F4BA 3OWTA 3CZ6A 5BQHA 4ZLDA 4BJTA 4J32B 5BUOA 3BRJA 3S0XA 4NCQA 5EK0A 1TR2A 3ZIBA 3DKAA 4GYTA 5GPGB 3ABMC 3W2WA 5COGA 1MMDA 1VB5A 3LNMB 3LEOA 4O6NA 4EIYA 5DS6A 4CX9A 3ZDLA 4U9EA 3ZSUA 1FFTC 2H7VC 4JCZA 2ZXOA 3VF0A 2AVKA 3DD7A 3EHNA 4O7GA 1PCXA 4BPMA 1JPJA 1WGWA 3X2QC 2P6VA 3U8PA 3RYLA 1YDIA 5DQTA 1EI7A 4ULWA 4DRJB 2JX0A 1W2WA 3ABLC 2R7TA 3LAYA 1HE1A 3C63A 1OQCA 1OCOC 3IPMO 3K7DA 1LI7A 2L6GA 3SP1A 3U2LA 3NKEA 3G4ZA 1LVKA 5KYYB 2HSQA 3US6A 5T3TA 3RQFA 1ORJA 2A68F 4E7ZA 1ZZPA 1OR2A 1YJGA 4YN0B 2H7OA 1ZHZA 3U3FA 4MVMA 3NMKA 3QW1A 4DXWA 5COFA 3IQCA 4O79A 4EHPA 3G50A 5L0GA 3ZTZA 1AEPA 4YT4A 2Y3DA 1I5NA 1ORSC 2J46A 3DMDA 3GM2A 1WASA 2Q00A 3PCVA 5E3AA 4EBBA 3U0CA 2KQ9A 1NU7D 4U5HA 3U8VA 3R2PA 2R05A 4X0RA 3WHNA 1C02A 2UUHA 3TULA 1PV3A 2LQGA 4YT2A 1FAPB 4P9FA 4K0DA 1OXKA 1T6IA 2B0HA 2A6HF 2CDQA 1TWGA 1TWHA 2G62A 2OJED 3MLGA 5KYWB 3UMKA 2LK4A 3N0TA 1D0XA 4G7HF 1VTMP 2KC3A 4CS9C 2L6FA 2OOCA 1T6QA 4P9TA 1WWPA 2LFFA 2LIGA 2DYRC 2LFDA 4YJWA 4U5GA 2J7PA 2A6EF 4JZAA 2Y69C 2R7VA 2HS5A 4CJOA 3IQ6A 4YL0A 3V5YA 3O6XA 2EIKC 1ORYA 1T5OA 2H7BA 1E2XA 2GFHA 5KYUB 1S05A 2PP4A 2PX3A 1Z7Qc 1RJ9A 1F1MA 5E2QA 3NDBB 3NYJA 2KJGA 5KYWA 4R32A 4XPWA 1NBBA 2LP4A 4PK4A 1YA9A 1CGNA 1NU9C 2IOQA 3RQEA 2DGJA 4CJGA 4DVYP 1DOVA 3V7OA 3VRCA 1Q0KA 3EZHA 3AG1C 2DYSC 3WODF 4XQ1A 1QQ3A 4JEBA 1CGOA 5FCLA 1B68A 2Q9BA 3AG4C 4E0HA 1CGME 4JVSA 3EPVA 1BR2A 4Q7CA 3F47A 4GQHA 2YLIA 2R7QA 2XLMA 5F28E 4N6HA 4U5BE 4JE9A 2R03A 3G4XA 2YVKA 5DS4A 1QKRA 1D1BA 3HJCA 3NG1A 1M2VB 3RVZA 2NSFA 3CEXA 2LD6A 4LDQA 3LUTB 3SXZA 3UMHA 1OW7A 2VASA 1Q0MA 2R02A 2XLVA 3A11A 2YLDA 2L7AA 4A4AA 1JRAA 2R25A 1OR3A 4I1OB 1IZMA 3B71A 3HLZA 1HE9A 3NMIA 4IAOA 4IRUA 2HJ3A 5B3SC 3DI5A 2Q9CA 3M4CA 5AC4A 2KNHA 1R4TA 2KSFA 1M2VA 2ETSA 3BEHA 4JC7A 3LESA 1TWCA 2AU5A 2R7WA 2P7VA 4MTGA 4CBEA 1Y6DA 4KI2A 4FWVA 3TQOA 1BDJB 5D92A 2OEVA 2IXOA 3DE8A 2BL2A 5B1AC 1O3UA 2YQYA 3M15A 4WJ0A 1LI5A 4IARA 4NY3A 1D1CA 4W8KA 2ZXWC 3I5PA 2YKZA 2YLGA 3O10A 3QMKA 4XPXA 2IM8A 3L8IA 3KMIA 4JTAB 1PD0A 4B6IA 3IHUA 3B0VC 4CSAA 4JIOA 3FOOA 1V74B 3DE9A 4LLEA 3V5ZA 5KYXB 1HW1A 3CAXA 4JURI 3RFYA 1GGQA 2AP3A 4IWBA 5L0IA 1D0YA 5B3IA 1A0BA 2WVNA 3FXHA 4IJJA 4CS9A 1ZHYA 2P0NA 4K1OA 4RD9A 3AGTA 1EA8A 1V54C 1XWJA 3KL4A 1E84A 4IAQA 4I1MA 5JUAA 3T4RA 4C7OB 1K40A 2OG2A 4CS8C 3RW0A 2YZSA 4Z9IA 2W4MA 1D1AA 1LPEA 2L6HA 3EZIA 4CDAA 5L0JA 4XTKA 1IW7F 2XS1A 4PFPA 2XRHA 4AK9A 4DRIB 3HNLA 3L34A 2ZD9A 3EGDB 4U9DA 3VAYA 4PJNA 2Y3BA 1HMDA 4NC3A 3ASOC 2PFDA 3ECSA 1K05A 1U6HA 5L3QA 4C7OA 3S27A 1XZQA 3JRMO 2J45A 2R7XA 4FESA 3T6JA 1FR0A 1R5ID 5T1DB 1T6UA 3UR3C 3W2VA 3HTKC 5AC5A 1A41A 1NLXA 3B29A 4HEAJ 4WGZA 5HV9A 3JSEO 3RF3A 4ER9A 5CI8A 5HSWA 4D4NA 4H54A 3EGXB 2EPOA 3DXJF 5A6JA 2XLDA 3C8GD 1YAUO 3C18A 3ZWIA 1WOLA 4KNWA 2Q4FA 2YHSA 4CDVA 2ZPAA 3C8ZA 3K6BA 4O6YA 2D4UA 5JP7A 4JTCB 4EWCA 3EH2A 5JT4A 1ZHTA 4EBKA 1YZCA 2GDCA 2WVQA 1OXBA 1FTSA 3K1IC 3FHDA 3MYFA 3EGXA 256BA 2CGEA 1HY5A 1OKKD 1S7ZA 4PACA 3Q7GA 3RQGA 1YA7O 2XM4A 4JCHA 3T6BA 1SR2A 5KYYA 4BJ6A 1FNTc 3AJMA 3U2MA 2KK1A 4BEMJ 1O87A 3OEOA 2A69F 2WL8A 3Q6NA 1WN0A 1AUEA 1ZHXA 4HE8D 4CS7A 4XLPF 1BBHA 4YWQA 1VK5A 2V26A 1BZ4A 1G4WR 1TKNA 4C3EA 1QSPA 3H65A 3NYLA 2CCYA 1L3PA 4KNVA 4XEFA 3M4BA 3ASNC 3QVYA 4P6IC 4XLNF 2EPKX 4AL0A 5JVEA 3S90A 3S9OA 3VM6A 3E9VA 4J7YA 4QI2A 4E0IA 2R7OA 3B9QA 4MNDA 4JJGA 4N06A 1I4ZA 1QVXA 1ZU4A 3QZCA 2J8WA 1T01A 1SYQA 3RVYA 1GM5A 2WB7A 2XLEA 4CS8A 3KH2A 3C62A 5A6BD 2PX0A 2QY9A 2IXNA 2DI3A 1CPRA 3NRHA 1KU2A 1Z23A 1Z6AA 2BC5A 2EINC 1H7IA 3CSKA 4MVSA 4U5FE 3LS0A 4HFKB 2EPNA 4AE4B 2J9UA 3TK0A 2HMZA 1ZHWA 2C03A 4NTBA 1WTYA 2G3VA 5COMA 3Q6MA 5CI9A 2FFHA 2Q7RA 3EQLF 5KYUA 3WG7C 2W45A 1V4AA 5DQZA 4EUKB 3R7CA 3U3BA 4E18A 3PMRA 4XPYA 4KBLA 1LM3B 1JMWA 1YYXA 1Z63A 3GEIA 1VLSA 3JYYA 1AVOB 4AE4A 3KPHA 1LS1A 1MMAA 4YK5A 3S28A 3MBGA 2VB6A 3C8GB 2FGYA 2NSGA 3ITFA 4MS2A 4BG0A 2OCCC 2FAPB 2J9VA 2XM0A 4JRZA 2A0UA 4A2NB 2DB4A 4OD4A 4WGYA 3CQZA 2OEXA 3SZRA 3JYHA 4ZLCA 1OCRC 3JZ0A 1VMAA 1ZYRF 4BJ5C 2E87A 3AQCA 4Z9JA 2VH3A 3FDQA 2WZGA 3PDMP 2HFIA 3A9CA 2GWWA 2R9RB 5A6AA 1C17M 4E7SA 3C8GA 3M79A 3O55A 1G5ZA 2IXMA 2JD3A 3U5SA 3MYIA 3GORA 1UG7A 1PD1A 1QPUA 3EG9B 1ZU5A 2NUPB 4OD5A 1GQAA 4PR9A 2ZXPA 1Q0DA 3HKKA 2BE5F 4NQFA 2X0CA 4L6RA 4PJMA 4MVQA 4EBJA 2Y3GA 2PF4E 3AG3C 4HFFB 3DAGA 3LEVA 1A7VA 1DOWA 2TMVP 1OKKA 4N6CA 2HUJA 3W4YA 5JSLA 2J0XA 3GWNA 3GM1A 3EFOB 2UUIA 2NUPA 3EG9A 3LLIA 4U5CE 3EJNA 4I3MA 2QLAA 2XL4A 3DM5A 5EHHA 2VC9A 4J7TA 3ZQYA 2V3CC 4U5EE 2NPUA 3AG2C 1M6TA 3H2UA 1LIHA 1MQVA 1ZW3A 2EIJC 3FAJA 3K33A 3KKBA 1MNEA 3NKDA 3WAQA 3T6GB 1RCPA 1Y4CA 4U5DE 4CDYA 3FVYA 4E17A 4J30B 4OIOF 2Q3TA 2YL0A 3TJ5A 3W8HA 3MFNA 3HNIA 1FMWA 1BR1A 4OINF 3QVZA 2OJQA 3W8IA 3Q7LA 4DRHB 1E86A 2W9YA 4DBRA 2HZ8A 1U89A 5A6BA 1J8YF 5EGYA 4OIPF 1H9GA 1LE4A 2HJMA 1G4US 3U9JA 2XSEA 5D91A 2MWQA 4BEJA 5F5FA 4KC9A 4PJLA 1ST6A 1Z5ZA 2R7UA 4LACB 2OQMA 4XWJA 4FX5A 1KNYA 2IXPA 3FMSA 5IY5C 2OU6A 2YWAA 4GEHA 4QDLA 2WZFA 2OKUA 4YT8A 2CNWD 3EGDA 3JT1A 4DOZA 5CIVA 1HW2A 4G7OF 1KTMA 2W4BA 1YARO 1A7DA 2A0BA 5T3WA 1SZIA 4MW8A 4MQ9F 3JTLO 1J8MF 1L7CA 3ZQVA 3FAPB 2A1DD 4G78A 1VLTA 1CPQA 2XS8A 2CYDA 3DWWA 4JEAA 4MVRA 4NTFA 1QLEC 2GA0A 3UGOA 3X1OA 4NTAA 2VCBA 1V55C 4ONSA 4BJ5A 5L0CA 1JR8A 3POVA 3J06A 4IGGA 3ABKC 3GANA 3IQ5A 3JCUQ 1EKYA 1MMNA 3B0PA 5BQIA 2KW3C 3K66A 4EKWA 4LLCA 2YL3A 4Q5SF 1M2OA 1M56C 4MTFA 2EPMX 4Q4ZF 2XL6A 2I8BA 2RD9A 3ZVRA 2NUTB 2EIMC 2HKVA 2L9JA 3S84A 3RIPA 2HSBA 3GEEA 1LS4A 3QW0A 1JAFA 4MVUA 4DVZA 2YL1A 3UMIA 2O9XA 2QE9A 2R7RA 5L3VA 2Y3HA 1E85A 4W8PA 3LJBA 3GODA 2G3KA 3L0IA 3M1CB 3MX3A 4LDRA 5DLJA 2NUTA 3DJUB 3RKOF 1YYJA 2LCHA 3VYWA 2X51A 3KYJA 3C7JA 1O5HA 3EHMA 1VYIA 1LE2A 1U0BB 2ASRA 3K1HA 4PFOA 5A69A 4CSAC 3UNGC 5L0FA 3U9MA 1K04A 4YL3A 1NFNA 1XZPA 2MHRA 3GM3A 1TFKB 1RJ9B 3AQBA 4ULVA 3RH3A 5L0HA 5K0IA 3FOPA 5L0DA 2I15A 4DJ9A 2D5RB 3TJ6A 1C03A 1VYKA 2Y39A 1Z3IX 1LKXA 2KYHA 5A6KA 1APCA 4AX2A 1VOMA 2F22A 2M4EA 3ATPA 3NMJA 2XLHA 3ZTMA 1NFOA 4WABA 3L8JA 1M57C 1YLMA 1RKCA 2P61A 4D4XA 1SMYF 3GEHA 2B0JA 1QZXA 3SEOA 2RSEB 4YT5A 2C04A 1H6GA 4AL1A 4RDAA 5B1BC 3SNHA 3SYNA 3DZAA 1H9TA 5F5HA 2XXAB 4H4KC 3GWLA 1MMGA 3NYMA 5E33A 1EQ1A 1SF8A 2P1AA 3S29A 1TQGA 2WZLA 3JSZA 3N24A 1BR4A 2CNWA 2YRFA 2EPLX 2ZXRA 4CIPA 5JS5A 4C3BA 3DJNB 2LSEA 4O6MA 4C3DA 2Q9AA 5DVWA 4IB4A 3JRTA 3HNJA 2CW0F 2QUPA 4G7ZF 1TFOB 5E3CA 1FMVA 4LERA 3IQTA 5TJ5E 2J9WA 2J9BA 3K1IA 3L1MA 4DBQA 3LLKA 3LNRA 3T9OA 2IBFA 5KYXA 3PHF2 1RMVA 2XXAA 2HV7A 1ZW2A 3SXMA 1HMOA 4XEVA 3I5QA 3N2ZB 3HNKA 3IEEA 1JPNA 3QTHA 3DAFA 1FFHA 4PJJA 1OW6A 2IYLD 4JTDB 4CIHA 4FAPB 4MW3A 1YVIA 2HMQA 5JLIA 1RXQA 1OCCC 3SXKA 4JW1A 3KYIA 3F46A 1Q0GA 3TOMA 4XEKA 3O39A 1UFBA 2H8AA 4RBNA 1T9KA 1NSGB 2MYSA 2HV6A 3LS1A 5KYNA 2WVOA 2GAQA 1RKEB 2KGOA 1E83A 5DS5A 4M63A 1Q0FA 2EILC 2QTVA 4MVZA 4N4WA 2AWYA 2VCAA 1D0ZA 4JKVA 4MTOA 2XLOA 4G0HA 4JJFA 1ZVZA 4BJ6C 1I4YA 3TOLA 5BQGA 2Z15A 2J7PD 2ICWG 2VCCA 1GS9A 1N1CA 1JOGA 1OCZC 2M64A 2YL7A 3E70C 3EFOA 2NG1A 3B0UX 1A7EA 2L81A 1RKEA
chains in the Genus database with same CATH topology
1Q0KA 1Q0MA 4NCQA 1Q0GA 3G4XA 1Q0DA 1T6IA 3G4ZA 1T6QA 1T6UA 3G50A 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  1Q0M A;  4NCQ A;  1Q0G A;  3G4X A;  1Q0D A;  1T6I A;  3G4Z A;  1T6Q A;  1T6U A;  3G50 A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 4QI0 A;  2PNO A;  4OIQ F;  5JRA A;  3H2V A;  4LDK A;  5AGF A;  4OIR F;  2AWC A;  3DM9 B;  3AOU A;  3OA1 A;  2R7S A;  1WAT A;  2QNL A;  3V5X A;  2JPU A;  2J0W A;  4MVO A;  2PBE A;  4K7B A;  3ZG1 A;  3AGU A;  1OW8 A;  4I44 A;  1YZA A;  1G8X A;  4BJ1 A;  4Z9H A;  4UDV A;  3UGP A;  1NG1 A;  5FZT A;  2YEV A;  4ANJ A;  3ZC4 A;  4YL1 A;  1NZE A;  2XL8 A;  2XLW A;  1MND A;  3SXY A;  1TWA A;  3I4U A;  3EH1 A;  3TD7 A;  4F4B A;  3OWT A;  3CZ6 A;  5BQH A;  4ZLD A;  4BJT A;  4J32 B;  5BUO A;  3BRJ A;  3S0X A;  4NCQ A;  5EK0 A;  1TR2 A;  3ZIB A;  3DKA A;  4GYT A;  5GPG B;  3ABM C;  3W2W A;  5COG A;  1MMD A;  1VB5 A;  3LNM B;  3LEO A;  4O6N A;  4EIY A;  5DS6 A;  4CX9 A;  3ZDL A;  4U9E A;  3ZSU A;  1FFT C;  2H7V C;  4JCZ A;  2ZXO A;  3VF0 A;  2AVK A;  3DD7 A;  3EHN A;  4O7G A;  1PCX A;  4BPM A;  1JPJ A;  1WGW A;  3X2Q C;  2P6V A;  3U8P A;  3RYL A;  1YDI A;  5DQT A;  1EI7 A;  4ULW A;  4DRJ B;  2JX0 A;  1W2W A;  3ABL C;  2R7T A;  3LAY A;  1HE1 A;  3C63 A;  1OQC A;  1OCO C;  3IPM O;  3K7D A;  1LI7 A;  2L6G A;  3SP1 A;  3U2L A;  3NKE A;  3G4Z A;  1LVK A;  5KYY B;  2HSQ A;  3US6 A;  5T3T A;  3RQF A;  1ORJ A;  2A68 F;  4E7Z A;  1ZZP A;  1OR2 A;  1YJG A;  4YN0 B;  2H7O A;  1ZHZ A;  3U3F A;  4MVM A;  3NMK A;  3QW1 A;  4DXW A;  5COF A;  3IQC A;  4O79 A;  4EHP A;  3G50 A;  5L0G A;  3ZTZ A;  1AEP A;  4YT4 A;  2Y3D A;  1I5N A;  1ORS C;  2J46 A;  3DMD A;  3GM2 A;  1WAS A;  2Q00 A;  3PCV A;  5E3A A;  4EBB A;  3U0C A;  2KQ9 A;  1NU7 D;  4U5H A;  3U8V A;  3R2P A;  2R05 A;  4X0R A;  3WHN A;  1C02 A;  2UUH A;  3TUL A;  1PV3 A;  2LQG A;  4YT2 A;  1FAP B;  4P9F A;  4K0D A;  1OXK A;  1T6I A;  2B0H A;  2A6H F;  2CDQ A;  1TWG A;  1TWH A;  2G62 A;  2OJE D;  3MLG A;  5KYW B;  3UMK A;  2LK4 A;  3N0T A;  1D0X A;  4G7H F;  1VTM P;  2KC3 A;  4CS9 C;  2L6F A;  2OOC A;  1T6Q A;  4P9T A;  1WWP A;  2LFF A;  2LIG A;  2DYR C;  2LFD A;  4YJW A;  4U5G A;  2J7P A;  2A6E F;  4JZA A;  2Y69 C;  2R7V A;  2HS5 A;  4CJO A;  3IQ6 A;  4YL0 A;  3V5Y A;  3O6X A;  2EIK C;  1ORY A;  1T5O A;  2H7B A;  1E2X A;  2GFH A;  5KYU B;  1S05 A;  2PP4 A;  2PX3 A;  1Z7Q c;  1RJ9 A;  1F1M A;  5E2Q A;  3NDB B;  3NYJ A;  2KJG A;  5KYW A;  4R32 A;  4XPW A;  1NBB A;  2LP4 A;  4PK4 A;  1YA9 A;  1CGN A;  1NU9 C;  2IOQ A;  3RQE A;  2DGJ A;  4CJG A;  4DVY P;  1DOV A;  3V7O A;  3VRC A;  1Q0K A;  3EZH A;  3AG1 C;  2DYS C;  3WOD F;  4XQ1 A;  1QQ3 A;  4JEB A;  1CGO A;  5FCL A;  1B68 A;  2Q9B A;  3AG4 C;  4E0H A;  1CGM E;  4JVS A;  3EPV A;  1BR2 A;  4Q7C A;  3F47 A;  4GQH A;  2YLI A;  2R7Q A;  2XLM A;  5F28 E;  4N6H A;  4U5B E;  4JE9 A;  2R03 A;  3G4X A;  2YVK A;  5DS4 A;  1QKR A;  1D1B A;  3HJC A;  3NG1 A;  1M2V B;  3RVZ A;  2NSF A;  3CEX A;  2LD6 A;  4LDQ A;  3LUT B;  3SXZ A;  3UMH A;  1OW7 A;  2VAS A;  1Q0M A;  2R02 A;  2XLV A;  3A11 A;  2YLD A;  2L7A A;  4A4A A;  1JRA A;  2R25 A;  1OR3 A;  4I1O B;  1IZM A;  3B71 A;  3HLZ A;  1HE9 A;  3NMI A;  4IAO A;  4IRU A;  2HJ3 A;  5B3S C;  3DI5 A;  2Q9C A;  3M4C A;  5AC4 A;  2KNH A;  1R4T A;  2KSF A;  1M2V A;  2ETS A;  3BEH A;  4JC7 A;  3LES A;  1TWC A;  2AU5 A;  2R7W A;  2P7V A;  4MTG A;  4CBE A;  1Y6D A;  4KI2 A;  4FWV A;  3TQO A;  1BDJ B;  5D92 A;  2OEV A;  2IXO A;  3DE8 A;  2BL2 A;  5B1A C;  1O3U A;  2YQY A;  3M15 A;  4WJ0 A;  1LI5 A;  4IAR A;  4NY3 A;  1D1C A;  4W8K A;  2ZXW C;  3I5P A;  2YKZ A;  2YLG A;  3O10 A;  3QMK A;  4XPX A;  2IM8 A;  3L8I A;  3KMI A;  4JTA B;  1PD0 A;  4B6I A;  3IHU A;  3B0V C;  4CSA A;  4JIO A;  3FOO A;  1V74 B;  3DE9 A;  4LLE A;  3V5Z A;  5KYX B;  1HW1 A;  3CAX A;  4JUR I;  3RFY A;  1GGQ A;  2AP3 A;  4IWB A;  5L0I A;  1D0Y A;  5B3I A;  1A0B A;  2WVN A;  3FXH A;  4IJJ A;  4CS9 A;  1ZHY A;  2P0N A;  4K1O A;  4RD9 A;  3AGT A;  1EA8 A;  1V54 C;  1XWJ A;  3KL4 A;  1E84 A;  4IAQ A;  4I1M A;  5JUA A;  3T4R A;  4C7O B;  1K40 A;  2OG2 A;  4CS8 C;  3RW0 A;  2YZS A;  4Z9I A;  2W4M A;  1D1A A;  1LPE A;  2L6H A;  3EZI A;  4CDA A;  5L0J A;  4XTK A;  1IW7 F;  2XS1 A;  4PFP A;  2XRH A;  4AK9 A;  4DRI B;  3HNL A;  3L34 A;  2ZD9 A;  3EGD B;  4U9D A;  3VAY A;  4PJN A;  2Y3B A;  1HMD A;  4NC3 A;  3ASO C;  2PFD A;  3ECS A;  1K05 A;  1U6H A;  5L3Q A;  4C7O A;  3S27 A;  1XZQ A;  3JRM O;  2J45 A;  2R7X A;  4FES A;  3T6J A;  1FR0 A;  1R5I D;  5T1D B;  1T6U A;  3UR3 C;  3W2V A;  3HTK C;  5AC5 A;  1A41 A;  1NLX A;  3B29 A;  4HEA J;  4WGZ A;  5HV9 A;  3JSE O;  3RF3 A;  4ER9 A;  5CI8 A;  5HSW A;  4D4N A;  4H54 A;  3EGX B;  2EPO A;  3DXJ F;  5A6J A;  2XLD A;  3C8G D;  1YAU O;  3C18 A;  3ZWI A;  1WOL A;  4KNW A;  2Q4F A;  2YHS A;  4CDV A;  2ZPA A;  3C8Z A;  3K6B A;  4O6Y A;  2D4U A;  5JP7 A;  4JTC B;  4EWC A;  3EH2 A;  5JT4 A;  1ZHT A;  4EBK A;  1YZC A;  2GDC A;  2WVQ A;  1OXB A;  1FTS A;  3K1I C;  3FHD A;  3MYF A;  3EGX A;  256B A;  2CGE A;  1HY5 A;  1OKK D;  1S7Z A;  4PAC A;  3Q7G A;  3RQG A;  1YA7 O;  2XM4 A;  4JCH A;  3T6B A;  1SR2 A;  5KYY A;  4BJ6 A;  1FNT c;  3AJM A;  3U2M A;  2KK1 A;  4BEM J;  1O87 A;  3OEO A;  2A69 F;  2WL8 A;  3Q6N A;  1WN0 A;  1AUE A;  1ZHX A;  4HE8 D;  4CS7 A;  4XLP F;  1BBH A;  4YWQ A;  1VK5 A;  2V26 A;  1BZ4 A;  1G4W R;  1TKN A;  4C3E A;  1QSP A;  3H65 A;  3NYL A;  2CCY A;  1L3P A;  4KNV A;  4XEF A;  3M4B A;  3ASN C;  3QVY A;  4P6I C;  4XLN F;  2EPK X;  4AL0 A;  5JVE A;  3S90 A;  3S9O A;  3VM6 A;  3E9V A;  4J7Y A;  4QI2 A;  4E0I A;  2R7O A;  3B9Q A;  4MND A;  4JJG A;  4N06 A;  1I4Z A;  1QVX A;  1ZU4 A;  3QZC A;  2J8W A;  1T01 A;  1SYQ A;  3RVY A;  1GM5 A;  2WB7 A;  2XLE A;  4CS8 A;  3KH2 A;  3C62 A;  5A6B D;  2PX0 A;  2QY9 A;  2IXN A;  2DI3 A;  1CPR A;  3NRH A;  1KU2 A;  1Z23 A;  1Z6A A;  2BC5 A;  2EIN C;  1H7I A;  3CSK A;  4MVS A;  4U5F E;  3LS0 A;  4HFK B;  2EPN A;  4AE4 B;  2J9U A;  3TK0 A;  2HMZ A;  1ZHW A;  2C03 A;  4NTB A;  1WTY A;  2G3V A;  5COM A;  3Q6M A;  5CI9 A;  2FFH A;  2Q7R A;  3EQL F;  5KYU A;  3WG7 C;  2W45 A;  1V4A A;  5DQZ A;  4EUK B;  3R7C A;  3U3B A;  4E18 A;  3PMR A;  4XPY A;  4KBL A;  1LM3 B;  1JMW A;  1YYX A;  1Z63 A;  3GEI A;  1VLS A;  3JYY A;  1AVO B;  4AE4 A;  3KPH A;  1LS1 A;  1MMA A;  4YK5 A;  3S28 A;  3MBG A;  2VB6 A;  3C8G B;  2FGY A;  2NSG A;  3ITF A;  4MS2 A;  4BG0 A;  2OCC C;  2FAP B;  2J9V A;  2XM0 A;  4JRZ A;  2A0U A;  4A2N B;  2DB4 A;  4OD4 A;  4WGY A;  3CQZ A;  2OEX A;  3SZR A;  3JYH A;  4ZLC A;  1OCR C;  3JZ0 A;  1VMA A;  1ZYR F;  4BJ5 C;  2E87 A;  3AQC A;  4Z9J A;  2VH3 A;  3FDQ A;  2WZG A;  3PDM P;  2HFI A;  3A9C A;  2GWW A;  2R9R B;  5A6A A;  1C17 M;  4E7S A;  3C8G A;  3M79 A;  3O55 A;  1G5Z A;  2IXM A;  2JD3 A;  3U5S A;  3MYI A;  3GOR A;  1UG7 A;  1PD1 A;  1QPU A;  3EG9 B;  1ZU5 A;  2NUP B;  4OD5 A;  1GQA A;  4PR9 A;  2ZXP A;  1Q0D A;  3HKK A;  2BE5 F;  4NQF A;  2X0C A;  4L6R A;  4PJM A;  4MVQ A;  4EBJ A;  2Y3G A;  2PF4 E;  3AG3 C;  4HFF B;  3DAG A;  3LEV A;  1A7V A;  1DOW A;  2TMV P;  1OKK A;  4N6C A;  2HUJ A;  3W4Y A;  5JSL A;  2J0X A;  3GWN A;  3GM1 A;  3EFO B;  2UUI A;  2NUP A;  3EG9 A;  3LLI A;  4U5C E;  3EJN A;  4I3M A;  2QLA A;  2XL4 A;  3DM5 A;  5EHH A;  2VC9 A;  4J7T A;  3ZQY A;  2V3C C;  4U5E E;  2NPU A;  3AG2 C;  1M6T A;  3H2U A;  1LIH A;  1MQV A;  1ZW3 A;  2EIJ C;  3FAJ A;  3K33 A;  3KKB A;  1MNE A;  3NKD A;  3WAQ A;  3T6G B;  1RCP A;  1Y4C A;  4U5D E;  4CDY A;  3FVY A;  4E17 A;  4J30 B;  4OIO F;  2Q3T A;  2YL0 A;  3TJ5 A;  3W8H A;  3MFN A;  3HNI A;  1FMW A;  1BR1 A;  4OIN F;  3QVZ A;  2OJQ A;  3W8I A;  3Q7L A;  4DRH B;  1E86 A;  2W9Y A;  4DBR A;  2HZ8 A;  1U89 A;  5A6B A;  1J8Y F;  5EGY A;  4OIP F;  1H9G A;  1LE4 A;  2HJM A;  1G4U S;  3U9J A;  2XSE A;  5D91 A;  2MWQ A;  4BEJ A;  5F5F A;  4KC9 A;  4PJL A;  1ST6 A;  1Z5Z A;  2R7U A;  4LAC B;  2OQM A;  4XWJ A;  4FX5 A;  1KNY A;  2IXP A;  3FMS A;  5IY5 C;  2OU6 A;  2YWA A;  4GEH A;  4QDL A;  2WZF A;  2OKU A;  4YT8 A;  2CNW D;  3EGD A;  3JT1 A;  4DOZ A;  5CIV A;  1HW2 A;  4G7O F;  1KTM A;  2W4B A;  1YAR O;  1A7D A;  2A0B A;  5T3W A;  1SZI A;  4MW8 A;  4MQ9 F;  3JTL O;  1J8M F;  1L7C A;  3ZQV A;  3FAP B;  2A1D D;  4G78 A;  1VLT A;  1CPQ A;  2XS8 A;  2CYD A;  3DWW A;  4JEA A;  4MVR A;  4NTF A;  1QLE C;  2GA0 A;  3UGO A;  3X1O A;  4NTA A;  2VCB A;  1V55 C;  4ONS A;  4BJ5 A;  5L0C A;  1JR8 A;  3POV A;  3J06 A;  4IGG A;  3ABK C;  3GAN A;  3IQ5 A;  3JCU Q;  1EKY A;  1MMN A;  3B0P A;  5BQI A;  2KW3 C;  3K66 A;  4EKW A;  4LLC A;  2YL3 A;  4Q5S F;  1M2O A;  1M56 C;  4MTF A;  2EPM X;  4Q4Z F;  2XL6 A;  2I8B A;  2RD9 A;  3ZVR A;  2NUT B;  2EIM C;  2HKV A;  2L9J A;  3S84 A;  3RIP A;  2HSB A;  3GEE A;  1LS4 A;  3QW0 A;  1JAF A;  4MVU A;  4DVZ A;  2YL1 A;  3UMI A;  2O9X A;  2QE9 A;  2R7R A;  5L3V A;  2Y3H A;  1E85 A;  4W8P A;  3LJB A;  3GOD A;  2G3K A;  3L0I A;  3M1C B;  3MX3 A;  4LDR A;  5DLJ A;  2NUT A;  3DJU B;  3RKO F;  1YYJ A;  2LCH A;  3VYW A;  2X51 A;  3KYJ A;  3C7J A;  1O5H A;  3EHM A;  1VYI A;  1LE2 A;  1U0B B;  2ASR A;  3K1H A;  4PFO A;  5A69 A;  4CSA C;  3UNG C;  5L0F A;  3U9M A;  1K04 A;  4YL3 A;  1NFN A;  1XZP A;  2MHR A;  3GM3 A;  1TFK B;  1RJ9 B;  3AQB A;  4ULV A;  3RH3 A;  5L0H A;  5K0I A;  3FOP A;  5L0D A;  2I15 A;  4DJ9 A;  2D5R B;  3TJ6 A;  1C03 A;  1VYK A;  2Y39 A;  1Z3I X;  1LKX A;  2KYH A;  5A6K A;  1APC A;  4AX2 A;  1VOM A;  2F22 A;  2M4E A;  3ATP A;  3NMJ A;  2XLH A;  3ZTM A;  1NFO A;  4WAB A;  3L8J A;  1M57 C;  1YLM A;  1RKC A;  2P61 A;  4D4X A;  1SMY F;  3GEH A;  2B0J A;  1QZX A;  3SEO A;  2RSE B;  4YT5 A;  2C04 A;  1H6G A;  4AL1 A;  4RDA A;  5B1B C;  3SNH A;  3SYN A;  3DZA A;  1H9T A;  5F5H A;  2XXA B;  4H4K C;  3GWL A;  1MMG A;  3NYM A;  5E33 A;  1EQ1 A;  1SF8 A;  2P1A A;  3S29 A;  1TQG A;  2WZL A;  3JSZ A;  3N24 A;  1BR4 A;  2CNW A;  2YRF A;  2EPL X;  2ZXR A;  4CIP A;  5JS5 A;  4C3B A;  3DJN B;  2LSE A;  4O6M A;  4C3D A;  2Q9A A;  5DVW A;  4IB4 A;  3JRT A;  3HNJ A;  2CW0 F;  2QUP A;  4G7Z F;  1TFO B;  5E3C A;  1FMV A;  4LER A;  3IQT A;  5TJ5 E;  2J9W A;  2J9B A;  3K1I A;  3L1M A;  4DBQ A;  3LLK A;  3LNR A;  3T9O A;  2IBF A;  5KYX A;  3PHF 2;  1RMV A;  2XXA A;  2HV7 A;  1ZW2 A;  3SXM A;  1HMO A;  4XEV A;  3I5Q A;  3N2Z B;  3HNK A;  3IEE A;  1JPN A;  3QTH A;  3DAF A;  1FFH A;  4PJJ A;  1OW6 A;  2IYL D;  4JTD B;  4CIH A;  4FAP B;  4MW3 A;  1YVI A;  2HMQ A;  5JLI A;  1RXQ A;  1OCC C;  3SXK A;  4JW1 A;  3KYI A;  3F46 A;  1Q0G A;  3TOM A;  4XEK A;  3O39 A;  1UFB A;  2H8A A;  4RBN A;  1T9K A;  1NSG B;  2MYS A;  2HV6 A;  3LS1 A;  5KYN A;  2WVO A;  2GAQ A;  1RKE B;  2KGO A;  1E83 A;  5DS5 A;  4M63 A;  1Q0F A;  2EIL C;  2QTV A;  4MVZ A;  4N4W A;  2AWY A;  2VCA A;  1D0Z A;  4JKV A;  4MTO A;  2XLO A;  4G0H A;  4JJF A;  1ZVZ A;  4BJ6 C;  1I4Y A;  3TOL A;  5BQG A;  2Z15 A;  2J7P D;  2ICW G;  2VCC A;  1GS9 A;  1N1C A;  1JOG A;  1OCZ C;  2M64 A;  2YL7 A;  3E70 C;  3EFO A;  2NG1 A;  3B0U X;  1A7E A;  2L81 A;  1RKE A; 
#chains in the Genus database with same CATH homology
 1Q0K A;  1Q0M A;  4NCQ A;  1Q0G A;  3G4X A;  1Q0D A;  1T6I A;  3G4Z A;  1T6Q A;  1T6U A;  3G50 A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...