1T6QA

Nickel superoxide dismutase (nisod) cn-treated apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
b'GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6qA00
3G4XA 3G50A 1Q0FA 1Q0DA 1T6IA 3G4ZA 1T6UA 1T6QA 1Q0MA 1Q0KA 1Q0GA 4NCQA
chains in the Genus database with same CATH superfamily
5B1BC 1LKXA 3EHMA 1MMDA 3Q7GA 1E2XA 3AG1C 2HMZA 3T6GB 5BQIA 3C8ZA 3JZ0A 2XSEA 1TQGA 2HS5A 3DMDA 4DBQA 5A6KA 2L6FA 4D4XA 1SYQA 1YJGA 4IRUA 4X0RA 5JUAA 4J7TA 3WAQA 3JYHA 1MNEA 2HKVA 2L81A 2OKUA 5F5HA 2OU6A 1VYIA 2HSBA 1U6HA 2YRFA 3A11A 3L34A 4C3DA 3H2VA 1D0YA 3EG9B 1JR8A 3JSZA 3ZWIA 1CGME 3T6BA 1WN0A 4LLEA 1LI5A 3TOMA 3S0XA 1SF8A 4CX9A 4KBLA 1HW1A 3AQBA 2V3CC 2XL6A 4PR9A 1OKKA 2W4BA 4I3MA 3HNLA 1XZPA 1KU2A 1YA7O 1O5HA 3OWTA 1QSPA 2DGJA 2G3KA 2G62A 2QNLA 1NZEA 3KYJA 4FESA 3B0UX 2R02A 2YWAA 3EH1A 1A0BA 3IEEA 3V5YA 1R5ID 3UGOA 5K0IA 2DYRC 1NFOA 3FOPA 4CDVA 1M56C 2Q7RA 4BJ5A 2EPMX 5JT4A 2CW0F 2IXNA 3UMKA 4BJTA 5DS4A 5EGYA 4Q4ZF 1MNDA 2BC5A 3O55A 3QMKA 3EGXA 2WZFA 3QVYA 2J0XA 2VCAA 4O7GA 3LNRA 1PD0A 2BE5F 3MYIA 1JRAA 2J9BA 3VYWA 3ZQYA 3R2PA 2UUIA 4FWVA 1ORSC 1CGNA 2J9UA 3GEHA 4OD4A 3K1IA 5L0FA 2VC9A 3IHUA 3UR3C 1RXQA 1QQ3A 3ZSUA 1FR0A 4KC9A 1G4US 3C8GB 3IQCA 3U3BA 4C7OB 3LAYA 2LFFA 2NG1A 4JJFA 1JMWA 4N6CA 2WZLA 3DKAA 1M57C 3NG1A 4G7OF 2OJED 3GM2A 4CS9C 1MMGA 1Q0FA 2Z15A 3IQTA 2IXMA 1K04A 2AU5A 1LS4A 4EHPA 5E3AA 4YT4A 3C18A 3SEOA 3CEXA 3B71A 3W4YA 1RKEA 4A2NB 4CS9A 3ECSA 3LEOA 2CYDA 4YL0A 3US6A 3WODF 1BR4A 3I5QA 5HSWA 1WATA 3BEHA 4U5EE 2B0JA 4I1OB 1H9GA 1YAUO 2EILC 2R7TA 2ZXRA 1LE4A 3OEOA 2XS1A 3CQZA 3UNGC 5FCLA 1QKRA 4CS8C 3K1HA 1RJ9A 4KI2A 4H54A 4R32A 1CGOA 2EPOA 3RVZA 5A6BD 5L0HA 4D4NA 1WGWA 4DBRA 1YLMA 2X0CA 1M2OA 2IXOA 4EKWA 1HMOA 1JPJA 1BR2A 1BBHA 3LLKA 2HUJA 5AC5A 4ULVA 2Q9CA 3NMIA 4ZLDA 4IAQA 4IARA 3G4ZA 3NYJA 1VB5A 4FX5A 4W8PA 5JP7A 1B68A 4Z9JA 1V54C 4YL1A 4CDYA 1FAPB 4DJ9A 1OCCC 4CIPA 3F47A 2EIJC 2YZSA 4LDQA 5B1AC 2GDCA 4FAPB 2XXAA 1NFNA 3ITFA 3VRCA 3S27A 1VLTA 4GYTA 3JTLO 1YDIA 4G0HA 3LS1A 2HJMA 2IBFA 3KKBA 1D1BA 4K1OA 3X2QC 3RFYA 4B6IA 5JSLA 3O6XA 5BUOA 4XEVA 5JRAA 3B0PA 2OOCA 3TJ6A 3NKEA 5KYXA 1Z63A 2MYSA 5DQZA 2UUHA 2VB6A 1D0XA 4XEKA 3W8IA 3ATPA 1WWPA 3GM3A 3EGXB 2J7PA 2YVKA 3E70C 3HTKC 4RD9A 3VAYA 2PF4E 1O3UA 1ZW2A 1HW2A 3V7OA 3H65A 2YLGA 1E84A 3UMIA 2ZPAA 1XWJA 4W8KA 3T9OA 2P61A 2CGEA 3DM5A 3TK0A 1A7EA 1UFBA 3RH3A 4P9TA 2L9JA 4WGZA 4I44A 2XL4A 4PJLA 3KH2A 3NKDA 1QVXA 2CNWD 3EPVA 3MX3A 4MVMA 5GPGB 4JVSA 4XPYA 2HFIA 1OCRC 3L8IA 5CI9A 1ZHTA 3JSEO 3TQOA 4HFFB 4JJGA 3V5XA 5KYYA 2Q00A 4QDLA 2I8BA 3ASNC 1Y6DA 1RKEB 2LFDA 2OEXA 1HY5A 3HKKA 1ORJA 5T3TA 3JRMO 3JT1A 1ZHXA 4P6IC 4U9DA 1LVKA 3ZG1A 4LLCA 1DOWA 3HNKA 2KGOA 2O9XA 4XQ1A 3ZIBA 3ZVRA 4DVZA 2HMQA 2DYSC 1RJ9B 1L3PA 2OG2A 1CPQA 1Y4CA 1Q0MA 2WZGA 3WG7C 1H9TA 1MMAA 1OQCA 3RF3A 5B3IA 2KYHA 3AOUA 3RQGA 3DI5A 2IXPA 2YL7A 2A68F 4O6MA 4DXWA 2AP3A 1LI7A 3LEVA 3CSKA 4JE9A 5COFA 3SXMA 2A69F 3O39A 1IW7F 3GODA 1E86A 5D91A 2XXAB 4OINF 3M4CA 2QY9A 4L6RA 4MW3A 5KYWA 1FNTc 4ANJA 3N2ZB 1NG1A 3KL4A 4I1MA 3X1OA 2HSQA 2R05A 2LSEA 4ZLCA 1QPUA 5EHHA 4U5BE 4EUKB 5T3WA 4U5CE 2J8WA 1YYXA 3EFOB 4N4WA 1Q0DA 3I4UA 5DQTA 3NDBB 4MW8A 2FFHA 2KJGA 5T1DB 4OIQF 3K66A 5KYXB 2J9VA 1ZHWA 4EIYA 3DD7A 1LM3B 1AVOB 1ST6A 4E7ZA 2YQYA 5E2QA 5HV9A 1K40A 1UG7A 4JEBA 4NTFA 1YVIA 2YHSA 3K7DA 3TD7A 1GQAA 3AG4C 3B0VC 3Q6MA 4OIOF 1U89A 2XLVA 3EZHA 4EBJA 1E83A 4E0HA 4MVOA 3JCUQ 3RQEA 1OCOC 4KNWA 4IJJA 1ZU4A 3SXYA 2AWCA 5COMA 1AUEA 3W2WA 5BQGA 3S84A 3L1MA 2L6GA 3QVZA 4YK5A 3TOLA 2MWQA 3SNHA 5KYYB 1Z6AA 1SZIA 5DS5A 2M64A 2P6VA 1VMAA 1ZZPA 5BQHA 1LPEA 2EPKX 4F4BA 5DS6A 1C02A 4J32B 2J46A 3IPMO 4HEAJ 2EIMC 2MHRA 3B9QA 1TWCA 1OW7A 1ZHYA 2PNOA 2VCCA 3M79A 2D5RB 3K33A 2BL2A 3H2UA 3DXJF 3RQFA 1TWGA 5L0JA 2KSFA 4G78A 3C8GD 2R7QA 5L3VA 2R9RB 3S90A 1E85A 2R7SA 1JAFA 2KK1A 3PMRA 1TFKB 4JW1A 3W8HA 1IZMA 2LP4A 2Y3HA 3TULA 1NU7D 2VH3A 2YEVA 3FMSA 4WABA 3G50A 4A4AA 5A69A 4BJ6C 1WTYA 4O79A 4HFKB 2LK4A 1OCZC 3AQCA 1ZU5A 4Z9IA 3NMJA 4CS8A 1R4TA 2EPNA 3JYYA 1FMVA 1JPNA 2KNHA 1LIHA 4NCQA 4BJ6A 3J06A 1XZQA 3N24A 4E0IA 3U8VA 2LD6A 3GWNA 3DE8A 1FMWA 2I15A 3BRJA 3MYFA 3DM9B 1EA8A 5JS5A 3ASOC 5KYWB 2Y39A 4K7BA 3RVYA 1FFHA 4UDVA 2R03A 1AEPA 4PFOA 3LNMB 4CIHA 1G5ZA 3FAJA 1Z7Qc 3DZAA 1M6TA 2XLDA 1TWHA 4LACB 2C04A 3QW0A 1YYJA 3EZIA 3LS0A 3R7CA 3VM6A 1S7ZA 4IWBA 4NTAA 4CS7A 1T9KA 2HJ3A 2XM4A 4OIPF 4YT5A 3NRHA 4JTDB 2H7OA 2W4MA 2GFHA 2LIGA 2PFDA 3LJBA 4E17A 3QW1A 2X51A 3HLZA 4PK4A 4RDAA 2QLAA 1OKKD 2F22A 4XPWA 1L7CA 3UMHA 5JVEA 3C7JA 5L0DA 4AK9A 2DI3A 1VK5A 3CAXA 3G4XA 3U9MA 1WASA 4E7SA 4NTBA 4P9FA 3SZRA 5COGA 3U9JA 2YL0A 2R7XA 4MNDA 2IYLD 2OCCC 2W9YA 2JD3A 3RYLA 4DRHB 5AC4A 4XEFA 1Q0KA 1VYKA 2QUPA 4JZAA 1JOGA 3U0CA 2C03A 2XL8A 4JIOA 1NU9C 2Y3GA 1TKNA 2L6HA 3EGDA 3M1CB 4PACA 2KQ9A 3U8PA 1J8YF 4CJGA 2YL1A 2YKZA 4NC3A 4QI2A 3RKOF 1DOVA 4OIRF 3ZC4A 3SYNA 3SP1A 2IM8A 2NUPA 1NSGB 1I4ZA 1O87A 2L7AA 2WVOA 1YZAA 4MVZA 3S9OA 4XLNF 1HMDA 1GGQA 4G7HF 2Y3DA 1KNYA 4LERA 3C62A 4U9EA 3M15A 2Q4FA 2VCBA 2ETSA 1K05A 3V5ZA 5FZTA 3HJCA 4ER9A 4MQ9F 3F46A 4YJWA 1D1CA 1TFOB 1HE1A 2CDQA 2R7RA 2AWYA 4EWCA 2Q3TA 1Z3IX 1D1AA 1NBBA 2QE9A 2A1DD 4BEMJ 1D0ZA 2P7VA 2ZD9A 3VF0A 5KYUA 3NYMA 3ZTMA 4LDRA 5B3SC 2KC3A 4ULWA 1EKYA 4JEAA 2H8AA 2Q9AA 4PJNA 2E87A 2WVQA 1LE2A 2P0NA 2A6HF 4AL0A 2XLEA 5A6BA 3S28A 3AG3C 3FAPB 4J7YA 2NSFA 3S29A 4AX2A 2IOQA 5DVWA 1RMVA 2W45A 2EIKC 3CZ6A 3DWWA 4MVRA 3DE9A 2PP4A 1MQVA 5E33A 4QI0A 2H7BA 1OW8A 4N06A 3GWLA 3MLGA 3ZQVA 4GEHA 1OW6A 1WOLA 2VASA 2R7WA 1VLSA 4MS2A 2GA0A 2XLOA 1ZW3A 5L3QA 4ONSA 1YA9A 4WGYA 3ABKC 3AG2C 3K6BA 4K0DA 4GQHA 4YWQA 2KW3C 4MTFA 3KMIA 4CSAC 2OJQA 2WVNA 1SR2A 2HV6A 2LQGA 4JTCB 4JKVA 2YLDA 4XWJA 1G8XA 5L0IA 4XTKA 4CSAA 2HZ8A 2A0UA 4HE8D 2NSGA 2XRHA 3HNIA 2PX3A 3LESA 1V55C 1H7IA 2HV7A 3EGDB 4JC7A 1NLXA 1YZCA 2JPUA 1N1CA 3ZDLA 1VTMP 1PCXA 3C63A 3EJNA 3MFNA 1T01A 1BR1A 4DRJB 4BJ5C 2J7PD 4C3EA 3GANA 5CI8A 4YL3A 1HE9A 4BEJA 5F5FA 2CCYA 3RW0A 1YARO 2NUPB 3SXZA 4AE4A 1SMYF 1V4AA 2P1AA 2CNWA 1VOMA 3A9CA 3Q6NA 3EQLF 2RSEB 2R7UA 2WL8A 1QZXA 3DJUB 4IB4A 4PJMA 3KPHA 1Z23A 4M63A 2A6EF 4Z9HA 3TJ5A 3K1IC 2TMVP 4WJ0A 3T4RA 4DOZA 1C03A 3DAGA 2GWWA 4N6HA 1U0BB 4U5DE 3U2LA 1A41A 1M2VA 2NPUA 2XLMA 3JRTA 1H6GA 4JRZA 3AJMA 4JCZA 1BZ4A 5L0CA 1BDJB 3MBGA 256BA 2PX0A 2FAPB 1J8MF 3HNJA 2A0BA 3GM1A 1ORYA 3QTHA 1OR3A 5AGFA 3SXKA 4YT8A 5F28E 1T5OA 1RCPA 1T6IA 4RBNA 5KYUB 3UGPA 4CBEA 4BPMA 4O6YA 3KYIA 3EH2A 2LCHA 2R7OA 3I5PA 4EBBA 1F1MA 2OEVA 2WB7A 4OD5A 2YL3A 3U3FA 3FVYA 3ABLC 2DB4A 2J0WA 3B29A 3W2VA 2QTVA 3NYLA 2R7VA 3Q7LA 3N0TA 2NUTA 1FFTC 1PD1A 2XLHA 3NMKA 5EK0A 1RKCA 2PBEA 4YN0B 5KYNA 4Q7CA 2EINC 2ZXPA 2Y69C 4MTOA 4KNVA 4O6NA 4MVUA 3ZTZA 3GEEA 4U5HA 1PV3A 2J9WA 4CJOA 2J45A 4H4KC 1MMNA 4LDKA 4G7ZF 5TJ5E 2ZXOA 3GEIA 5IY5C 5JLIA 4IAOA 4MVSA 3EG9A 2V26A 1V74B 5D92A 5A6AA 3FOOA 3AGUA 1Z5ZA 5CIVA 1KTMA 3U5SA 1OXBA 3FDQA 3IQ5A 5A6JA 2JX0A 2XLWA 4YT2A 3FXHA 4NY3A 3O10A 1T6UA 3PDMP 3EHNA 4NQFA 1A7VA 2G3VA 2EPLX 4JCHA 2B0HA 3EFOA 4PFPA 1G4WR 3U2MA 2H7VC 3DAFA 4AE4B 1ZVZA 1FTSA 3POVA 1OXKA 1Q0GA 2RD9A 4C3BA 5L0GA 2AVKA 5E3CA 1EI7A 3LLIA 3L0IA 2XS8A 4IGGA 3IQ6A 3RIPA 3PCVA 5DLJA 3DJNB 2FGYA 4JURI 4DVYP 2R25A 3QZCA 4J30B 3L8JA 1CPRA 4MTGA 3PHF2 2XM0A 3T6JA 4U5FE 4AL1A 1OR2A 1M2VB 2ICWG 1C17M 1ZHZA 3M4BA 4MVQA 2YLIA 3WHNA 4BG0A 4DRIB 4EBKA 3GORA 3C8GA 4CDAA 4C7OA 2Y3BA 3AGTA 3ABMC 2OQMA 1W2WA 1EQ1A 3E9VA 4XPXA 4XLPF 1A7DA 2GAQA 4PJJA 2Q9BA 1T6QA 3FHDA 3OA1A 2D4UA 1ZYRF 1I4YA 2ZXWC 3LUTB 4U5GA 1APCA 1GS9A 1QLEC 1LS1A 1TR2A 1TWAA 2ASRA 2M4EA 1GM5A 4Q5SF 2NUTB 4JTAB 1S05A 4E18A 4BJ1A 1I5NA
chains in the Genus database with same CATH topology
3G4XA 3G50A 1Q0FA 1Q0DA 1T6IA 3G4ZA 1T6UA 1T6QA 1Q0MA 1Q0KA 1Q0GA 4NCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4X A;  3G50 A;  1Q0F A;  1Q0D A;  1T6I A;  3G4Z A;  1T6U A;  1T6Q A;  1Q0M A;  1Q0K A;  1Q0G A;  4NCQ A; 
#chains in the Genus database with same CATH topology
 5B1B C;  1LKX A;  3EHM A;  1MMD A;  3Q7G A;  1E2X A;  3AG1 C;  2HMZ A;  3T6G B;  5BQI A;  3C8Z A;  3JZ0 A;  2XSE A;  1TQG A;  2HS5 A;  3DMD A;  4DBQ A;  5A6K A;  2L6F A;  4D4X A;  1SYQ A;  1YJG A;  4IRU A;  4X0R A;  5JUA A;  4J7T A;  3WAQ A;  3JYH A;  1MNE A;  2HKV A;  2L81 A;  2OKU A;  5F5H A;  2OU6 A;  1VYI A;  2HSB A;  1U6H A;  2YRF A;  3A11 A;  3L34 A;  4C3D A;  3H2V A;  1D0Y A;  3EG9 B;  1JR8 A;  3JSZ A;  3ZWI A;  1CGM E;  3T6B A;  1WN0 A;  4LLE A;  1LI5 A;  3TOM A;  3S0X A;  1SF8 A;  4CX9 A;  4KBL A;  1HW1 A;  3AQB A;  2V3C C;  2XL6 A;  4PR9 A;  1OKK A;  2W4B A;  4I3M A;  3HNL A;  1XZP A;  1KU2 A;  1YA7 O;  1O5H A;  3OWT A;  1QSP A;  2DGJ A;  2G3K A;  2G62 A;  2QNL A;  1NZE A;  3KYJ A;  4FES A;  3B0U X;  2R02 A;  2YWA A;  3EH1 A;  1A0B A;  3IEE A;  3V5Y A;  1R5I D;  3UGO A;  5K0I A;  2DYR C;  1NFO A;  3FOP A;  4CDV A;  1M56 C;  2Q7R A;  4BJ5 A;  2EPM X;  5JT4 A;  2CW0 F;  2IXN A;  3UMK A;  4BJT A;  5DS4 A;  5EGY A;  4Q4Z F;  1MND A;  2BC5 A;  3O55 A;  3QMK A;  3EGX A;  2WZF A;  3QVY A;  2J0X A;  2VCA A;  4O7G A;  3LNR A;  1PD0 A;  2BE5 F;  3MYI A;  1JRA A;  2J9B A;  3VYW A;  3ZQY A;  3R2P A;  2UUI A;  4FWV A;  1ORS C;  1CGN A;  2J9U A;  3GEH A;  4OD4 A;  3K1I A;  5L0F A;  2VC9 A;  3IHU A;  3UR3 C;  1RXQ A;  1QQ3 A;  3ZSU A;  1FR0 A;  4KC9 A;  1G4U S;  3C8G B;  3IQC A;  3U3B A;  4C7O B;  3LAY A;  2LFF A;  2NG1 A;  4JJF A;  1JMW A;  4N6C A;  2WZL A;  3DKA A;  1M57 C;  3NG1 A;  4G7O F;  2OJE D;  3GM2 A;  4CS9 C;  1MMG A;  1Q0F A;  2Z15 A;  3IQT A;  2IXM A;  1K04 A;  2AU5 A;  1LS4 A;  4EHP A;  5E3A A;  4YT4 A;  3C18 A;  3SEO A;  3CEX A;  3B71 A;  3W4Y A;  1RKE A;  4A2N B;  4CS9 A;  3ECS A;  3LEO A;  2CYD A;  4YL0 A;  3US6 A;  3WOD F;  1BR4 A;  3I5Q A;  5HSW A;  1WAT A;  3BEH A;  4U5E E;  2B0J A;  4I1O B;  1H9G A;  1YAU O;  2EIL C;  2R7T A;  2ZXR A;  1LE4 A;  3OEO A;  2XS1 A;  3CQZ A;  3UNG C;  5FCL A;  1QKR A;  4CS8 C;  3K1H A;  1RJ9 A;  4KI2 A;  4H54 A;  4R32 A;  1CGO A;  2EPO A;  3RVZ A;  5A6B D;  5L0H A;  4D4N A;  1WGW A;  4DBR A;  1YLM A;  2X0C A;  1M2O A;  2IXO A;  4EKW A;  1HMO A;  1JPJ A;  1BR2 A;  1BBH A;  3LLK A;  2HUJ A;  5AC5 A;  4ULV A;  2Q9C A;  3NMI A;  4ZLD A;  4IAQ A;  4IAR A;  3G4Z A;  3NYJ A;  1VB5 A;  4FX5 A;  4W8P A;  5JP7 A;  1B68 A;  4Z9J A;  1V54 C;  4YL1 A;  4CDY A;  1FAP B;  4DJ9 A;  1OCC C;  4CIP A;  3F47 A;  2EIJ C;  2YZS A;  4LDQ A;  5B1A C;  2GDC A;  4FAP B;  2XXA A;  1NFN A;  3ITF A;  3VRC A;  3S27 A;  1VLT A;  4GYT A;  3JTL O;  1YDI A;  4G0H A;  3LS1 A;  2HJM A;  2IBF A;  3KKB A;  1D1B A;  4K1O A;  3X2Q C;  3RFY A;  4B6I A;  5JSL A;  3O6X A;  5BUO A;  4XEV A;  5JRA A;  3B0P A;  2OOC A;  3TJ6 A;  3NKE A;  5KYX A;  1Z63 A;  2MYS A;  5DQZ A;  2UUH A;  2VB6 A;  1D0X A;  4XEK A;  3W8I A;  3ATP A;  1WWP A;  3GM3 A;  3EGX B;  2J7P A;  2YVK A;  3E70 C;  3HTK C;  4RD9 A;  3VAY A;  2PF4 E;  1O3U A;  1ZW2 A;  1HW2 A;  3V7O A;  3H65 A;  2YLG A;  1E84 A;  3UMI A;  2ZPA A;  1XWJ A;  4W8K A;  3T9O A;  2P61 A;  2CGE A;  3DM5 A;  3TK0 A;  1A7E A;  1UFB A;  3RH3 A;  4P9T A;  2L9J A;  4WGZ A;  4I44 A;  2XL4 A;  4PJL A;  3KH2 A;  3NKD A;  1QVX A;  2CNW D;  3EPV A;  3MX3 A;  4MVM A;  5GPG B;  4JVS A;  4XPY A;  2HFI A;  1OCR C;  3L8I A;  5CI9 A;  1ZHT A;  3JSE O;  3TQO A;  4HFF B;  4JJG A;  3V5X A;  5KYY A;  2Q00 A;  4QDL A;  2I8B A;  3ASN C;  1Y6D A;  1RKE B;  2LFD A;  2OEX A;  1HY5 A;  3HKK A;  1ORJ A;  5T3T A;  3JRM O;  3JT1 A;  1ZHX A;  4P6I C;  4U9D A;  1LVK A;  3ZG1 A;  4LLC A;  1DOW A;  3HNK A;  2KGO A;  2O9X A;  4XQ1 A;  3ZIB A;  3ZVR A;  4DVZ A;  2HMQ A;  2DYS C;  1RJ9 B;  1L3P A;  2OG2 A;  1CPQ A;  1Y4C A;  1Q0M A;  2WZG A;  3WG7 C;  1H9T A;  1MMA A;  1OQC A;  3RF3 A;  5B3I A;  2KYH A;  3AOU A;  3RQG A;  3DI5 A;  2IXP A;  2YL7 A;  2A68 F;  4O6M A;  4DXW A;  2AP3 A;  1LI7 A;  3LEV A;  3CSK A;  4JE9 A;  5COF A;  3SXM A;  2A69 F;  3O39 A;  1IW7 F;  3GOD A;  1E86 A;  5D91 A;  2XXA B;  4OIN F;  3M4C A;  2QY9 A;  4L6R A;  4MW3 A;  5KYW A;  1FNT c;  4ANJ A;  3N2Z B;  1NG1 A;  3KL4 A;  4I1M A;  3X1O A;  2HSQ A;  2R05 A;  2LSE A;  4ZLC A;  1QPU A;  5EHH A;  4U5B E;  4EUK B;  5T3W A;  4U5C E;  2J8W A;  1YYX A;  3EFO B;  4N4W A;  1Q0D A;  3I4U A;  5DQT A;  3NDB B;  4MW8 A;  2FFH A;  2KJG A;  5T1D B;  4OIQ F;  3K66 A;  5KYX B;  2J9V A;  1ZHW A;  4EIY A;  3DD7 A;  1LM3 B;  1AVO B;  1ST6 A;  4E7Z A;  2YQY A;  5E2Q A;  5HV9 A;  1K40 A;  1UG7 A;  4JEB A;  4NTF A;  1YVI A;  2YHS A;  3K7D A;  3TD7 A;  1GQA A;  3AG4 C;  3B0V C;  3Q6M A;  4OIO F;  1U89 A;  2XLV A;  3EZH A;  4EBJ A;  1E83 A;  4E0H A;  4MVO A;  3JCU Q;  3RQE A;  1OCO C;  4KNW A;  4IJJ A;  1ZU4 A;  3SXY A;  2AWC A;  5COM A;  1AUE A;  3W2W A;  5BQG A;  3S84 A;  3L1M A;  2L6G A;  3QVZ A;  4YK5 A;  3TOL A;  2MWQ A;  3SNH A;  5KYY B;  1Z6A A;  1SZI A;  5DS5 A;  2M64 A;  2P6V A;  1VMA A;  1ZZP A;  5BQH A;  1LPE A;  2EPK X;  4F4B A;  5DS6 A;  1C02 A;  4J32 B;  2J46 A;  3IPM O;  4HEA J;  2EIM C;  2MHR A;  3B9Q A;  1TWC A;  1OW7 A;  1ZHY A;  2PNO A;  2VCC A;  3M79 A;  2D5R B;  3K33 A;  2BL2 A;  3H2U A;  3DXJ F;  3RQF A;  1TWG A;  5L0J A;  2KSF A;  4G78 A;  3C8G D;  2R7Q A;  5L3V A;  2R9R B;  3S90 A;  1E85 A;  2R7S A;  1JAF A;  2KK1 A;  3PMR A;  1TFK B;  4JW1 A;  3W8H A;  1IZM A;  2LP4 A;  2Y3H A;  3TUL A;  1NU7 D;  2VH3 A;  2YEV A;  3FMS A;  4WAB A;  3G50 A;  4A4A A;  5A69 A;  4BJ6 C;  1WTY A;  4O79 A;  4HFK B;  2LK4 A;  1OCZ C;  3AQC A;  1ZU5 A;  4Z9I A;  3NMJ A;  4CS8 A;  1R4T A;  2EPN A;  3JYY A;  1FMV A;  1JPN A;  2KNH A;  1LIH A;  4NCQ A;  4BJ6 A;  3J06 A;  1XZQ A;  3N24 A;  4E0I A;  3U8V A;  2LD6 A;  3GWN A;  3DE8 A;  1FMW A;  2I15 A;  3BRJ A;  3MYF A;  3DM9 B;  1EA8 A;  5JS5 A;  3ASO C;  5KYW B;  2Y39 A;  4K7B A;  3RVY A;  1FFH A;  4UDV A;  2R03 A;  1AEP A;  4PFO A;  3LNM B;  4CIH A;  1G5Z A;  3FAJ A;  1Z7Q c;  3DZA A;  1M6T A;  2XLD A;  1TWH A;  4LAC B;  2C04 A;  3QW0 A;  1YYJ A;  3EZI A;  3LS0 A;  3R7C A;  3VM6 A;  1S7Z A;  4IWB A;  4NTA A;  4CS7 A;  1T9K A;  2HJ3 A;  2XM4 A;  4OIP F;  4YT5 A;  3NRH A;  4JTD B;  2H7O A;  2W4M A;  2GFH A;  2LIG A;  2PFD A;  3LJB A;  4E17 A;  3QW1 A;  2X51 A;  3HLZ A;  4PK4 A;  4RDA A;  2QLA A;  1OKK D;  2F22 A;  4XPW A;  1L7C A;  3UMH A;  5JVE A;  3C7J A;  5L0D A;  4AK9 A;  2DI3 A;  1VK5 A;  3CAX A;  3G4X A;  3U9M A;  1WAS A;  4E7S A;  4NTB A;  4P9F A;  3SZR A;  5COG A;  3U9J A;  2YL0 A;  2R7X A;  4MND A;  2IYL D;  2OCC C;  2W9Y A;  2JD3 A;  3RYL A;  4DRH B;  5AC4 A;  4XEF A;  1Q0K A;  1VYK A;  2QUP A;  4JZA A;  1JOG A;  3U0C A;  2C03 A;  2XL8 A;  4JIO A;  1NU9 C;  2Y3G A;  1TKN A;  2L6H A;  3EGD A;  3M1C B;  4PAC A;  2KQ9 A;  3U8P A;  1J8Y F;  4CJG A;  2YL1 A;  2YKZ A;  4NC3 A;  4QI2 A;  3RKO F;  1DOV A;  4OIR F;  3ZC4 A;  3SYN A;  3SP1 A;  2IM8 A;  2NUP A;  1NSG B;  1I4Z A;  1O87 A;  2L7A A;  2WVO A;  1YZA A;  4MVZ A;  3S9O A;  4XLN F;  1HMD A;  1GGQ A;  4G7H F;  2Y3D A;  1KNY A;  4LER A;  3C62 A;  4U9E A;  3M15 A;  2Q4F A;  2VCB A;  2ETS A;  1K05 A;  3V5Z A;  5FZT A;  3HJC A;  4ER9 A;  4MQ9 F;  3F46 A;  4YJW A;  1D1C A;  1TFO B;  1HE1 A;  2CDQ A;  2R7R A;  2AWY A;  4EWC A;  2Q3T A;  1Z3I X;  1D1A A;  1NBB A;  2QE9 A;  2A1D D;  4BEM J;  1D0Z A;  2P7V A;  2ZD9 A;  3VF0 A;  5KYU A;  3NYM A;  3ZTM A;  4LDR A;  5B3S C;  2KC3 A;  4ULW A;  1EKY A;  4JEA A;  2H8A A;  2Q9A A;  4PJN A;  2E87 A;  2WVQ A;  1LE2 A;  2P0N A;  2A6H F;  4AL0 A;  2XLE A;  5A6B A;  3S28 A;  3AG3 C;  3FAP B;  4J7Y A;  2NSF A;  3S29 A;  4AX2 A;  2IOQ A;  5DVW A;  1RMV A;  2W45 A;  2EIK C;  3CZ6 A;  3DWW A;  4MVR A;  3DE9 A;  2PP4 A;  1MQV A;  5E33 A;  4QI0 A;  2H7B A;  1OW8 A;  4N06 A;  3GWL A;  3MLG A;  3ZQV A;  4GEH A;  1OW6 A;  1WOL A;  2VAS A;  2R7W A;  1VLS A;  4MS2 A;  2GA0 A;  2XLO A;  1ZW3 A;  5L3Q A;  4ONS A;  1YA9 A;  4WGY A;  3ABK C;  3AG2 C;  3K6B A;  4K0D A;  4GQH A;  4YWQ A;  2KW3 C;  4MTF A;  3KMI A;  4CSA C;  2OJQ A;  2WVN A;  1SR2 A;  2HV6 A;  2LQG A;  4JTC B;  4JKV A;  2YLD A;  4XWJ A;  1G8X A;  5L0I A;  4XTK A;  4CSA A;  2HZ8 A;  2A0U A;  4HE8 D;  2NSG A;  2XRH A;  3HNI A;  2PX3 A;  3LES A;  1V55 C;  1H7I A;  2HV7 A;  3EGD B;  4JC7 A;  1NLX A;  1YZC A;  2JPU A;  1N1C A;  3ZDL A;  1VTM P;  1PCX A;  3C63 A;  3EJN A;  3MFN A;  1T01 A;  1BR1 A;  4DRJ B;  4BJ5 C;  2J7P D;  4C3E A;  3GAN A;  5CI8 A;  4YL3 A;  1HE9 A;  4BEJ A;  5F5F A;  2CCY A;  3RW0 A;  1YAR O;  2NUP B;  3SXZ A;  4AE4 A;  1SMY F;  1V4A A;  2P1A A;  2CNW A;  1VOM A;  3A9C A;  3Q6N A;  3EQL F;  2RSE B;  2R7U A;  2WL8 A;  1QZX A;  3DJU B;  4IB4 A;  4PJM A;  3KPH A;  1Z23 A;  4M63 A;  2A6E F;  4Z9H A;  3TJ5 A;  3K1I C;  2TMV P;  4WJ0 A;  3T4R A;  4DOZ A;  1C03 A;  3DAG A;  2GWW A;  4N6H A;  1U0B B;  4U5D E;  3U2L A;  1A41 A;  1M2V A;  2NPU A;  2XLM A;  3JRT A;  1H6G A;  4JRZ A;  3AJM A;  4JCZ A;  1BZ4 A;  5L0C A;  1BDJ B;  3MBG A;  256B A;  2PX0 A;  2FAP B;  1J8M F;  3HNJ A;  2A0B A;  3GM1 A;  1ORY A;  3QTH A;  1OR3 A;  5AGF A;  3SXK A;  4YT8 A;  5F28 E;  1T5O A;  1RCP A;  1T6I A;  4RBN A;  5KYU B;  3UGP A;  4CBE A;  4BPM A;  4O6Y A;  3KYI A;  3EH2 A;  2LCH A;  2R7O A;  3I5P A;  4EBB A;  1F1M A;  2OEV A;  2WB7 A;  4OD5 A;  2YL3 A;  3U3F A;  3FVY A;  3ABL C;  2DB4 A;  2J0W A;  3B29 A;  3W2V A;  2QTV A;  3NYL A;  2R7V A;  3Q7L A;  3N0T A;  2NUT A;  1FFT C;  1PD1 A;  2XLH A;  3NMK A;  5EK0 A;  1RKC A;  2PBE A;  4YN0 B;  5KYN A;  4Q7C A;  2EIN C;  2ZXP A;  2Y69 C;  4MTO A;  4KNV A;  4O6N A;  4MVU A;  3ZTZ A;  3GEE A;  4U5H A;  1PV3 A;  2J9W A;  4CJO A;  2J45 A;  4H4K C;  1MMN A;  4LDK A;  4G7Z F;  5TJ5 E;  2ZXO A;  3GEI A;  5IY5 C;  5JLI A;  4IAO A;  4MVS A;  3EG9 A;  2V26 A;  1V74 B;  5D92 A;  5A6A A;  3FOO A;  3AGU A;  1Z5Z A;  5CIV A;  1KTM A;  3U5S A;  1OXB A;  3FDQ A;  3IQ5 A;  5A6J A;  2JX0 A;  2XLW A;  4YT2 A;  3FXH A;  4NY3 A;  3O10 A;  1T6U A;  3PDM P;  3EHN A;  4NQF A;  1A7V A;  2G3V A;  2EPL X;  4JCH A;  2B0H A;  3EFO A;  4PFP A;  1G4W R;  3U2M A;  2H7V C;  3DAF A;  4AE4 B;  1ZVZ A;  1FTS A;  3POV A;  1OXK A;  1Q0G A;  2RD9 A;  4C3B A;  5L0G A;  2AVK A;  5E3C A;  1EI7 A;  3LLI A;  3L0I A;  2XS8 A;  4IGG A;  3IQ6 A;  3RIP A;  3PCV A;  5DLJ A;  3DJN B;  2FGY A;  4JUR I;  4DVY P;  2R25 A;  3QZC A;  4J30 B;  3L8J A;  1CPR A;  4MTG A;  3PHF 2;  2XM0 A;  3T6J A;  4U5F E;  4AL1 A;  1OR2 A;  1M2V B;  2ICW G;  1C17 M;  1ZHZ A;  3M4B A;  4MVQ A;  2YLI A;  3WHN A;  4BG0 A;  4DRI B;  4EBK A;  3GOR A;  3C8G A;  4CDA A;  4C7O A;  2Y3B A;  3AGT A;  3ABM C;  2OQM A;  1W2W A;  1EQ1 A;  3E9V A;  4XPX A;  4XLP F;  1A7D A;  2GAQ A;  4PJJ A;  2Q9B A;  1T6Q A;  3FHD A;  3OA1 A;  2D4U A;  1ZYR F;  1I4Y A;  2ZXW C;  3LUT B;  4U5G A;  1APC A;  1GS9 A;  1QLE C;  1LS1 A;  1TR2 A;  1TWA A;  2ASR A;  2M4E A;  1GM5 A;  4Q5S F;  2NUT B;  4JTA B;  1S05 A;  4E18 A;  4BJ1 A;  1I5N A; 
#chains in the Genus database with same CATH homology
 3G4X A;  3G50 A;  1Q0F A;  1Q0D A;  1T6I A;  3G4Z A;  1T6U A;  1T6Q A;  1Q0M A;  1Q0K A;  1Q0G A;  4NCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...