1T6QA

Nickel superoxide dismutase (nisod) cn-treated apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6qA00
1T6QA 1Q0GA 3G50A 3G4ZA 1Q0FA 1T6IA 1T6UA 1Q0DA 3G4XA 4NCQA 1Q0MA 1Q0KA
chains in the Genus database with same CATH superfamily
1YZAA 5A6KA 3HKKA 3AOUA 4RBNA 1R4TA 3U0CA 5JS5A 2PBEA 3ZQYA 3NDBB 2MYSA 3U9MA 2X0CA 1EA8A 1LIHA 1U89A 1FFHA 1Z5ZA 2XM4A 3HNJA 4W8PA 2R7XA 5KYUB 1FNTc 4PACA 3RVZA 1YA9A 3GEEA 1BDJB 1OR3A 2BC5A 3LAYA 2IOQA 2J0WA 4PR9A 1Q0DA 4CSAC 2DYRC 4CDAA 1D1AA 4CS9C 1Z6AA 2M64A 3O10A 4EHPA 3J06A 3IQ6A 4E0IA 5KYWB 3EFOB 3WODF 1BR1A 2C03A 3FXHA 3UGPA 5L0CA 1Q0GA 2Q3TA 3M4CA 1JPJA 1RKEA 4JTDB 3M4BA 4U5CE 1APCA 2P1AA 3PDMP 1T6IA 2JD3A 4P9FA 5KYWA 2H8AA 1YJGA 1LM3B 2A6HF 2R03A 2W4BA 5GPGB 1CGNA 4B6IA 4CBEA 3LS0A 3ZG1A 1ST6A 3PCVA 4NY3A 2CNWA 3EGDB 1O5HA 3I5QA 5A6JA 5L3VA 1GQAA 2AVKA 2OEVA 2XLMA 2QY9A 2XLWA 4MVQA 4AL1A 2KK1A 1GGQA 3DKAA 4CS8A 3EZHA 3AJMA 1MMNA 3IHUA 4YT4A 3ITFA 3VAYA 1G5ZA 2DI3A 3VM6A 3S27A 4AK9A 3V5YA 3DE8A 1EQ1A 5B3SC 4E18A 3SEOA 1L7CA 4U5EE 5EGYA 1OXKA 3E9VA 2L6GA 3UNGC 3U5SA 5DQZA 3L8JA 3ZDLA 2R25A 4IAOA 4CDYA 4Q7CA 4G7HF 2R7QA 3DI5A 3B29A 4JURI 3Q7GA 4Q4ZF 5TJ5E 2XXAB 3N2ZB 1D1BA 1VTMP 2I15A 1BR4A 3Q6MA 1C02A 2RD9A 3ABLC 1RKEB 3CEXA 2KGOA 3G4ZA 5E3AA 4U5HA 2FGYA 4DBQA 3B0VC 4DRJB 3OEOA 4U5FE 2EIJC 3O6XA 4PFPA 3L8IA 3K1IA 1NSGB 1PV3A 4WABA 4NQFA 1FTSA 1K40A 2GWWA 4PJNA 4ONSA 2B0JA 4JRZA 4QI0A 2XLVA 4JIOA 2H7BA 4KNWA 4N4WA 1CPQA 3OWTA 2VCBA 3JYHA 3N24A 4U5BE 4DBRA 4BEMJ 2XLDA 3F46A 3IQ5A 4F4BA 1AUEA 1PD1A 2YLIA 3AG4C 5L0GA 2H7VC 2VASA 3U9JA 3T6JA 2CYDA 1E86A 2EILC 2XRHA 2LD6A 3ECSA 2P6VA 1LS4A 2HSBA 4EIYA 1ZW3A 2LFDA 1FR0A 2XM0A 3LNMB 4YT2A 1EKYA 2L7AA 2W4MA 2JX0A 4OD5A 4K0DA 3UMKA 1A7DA 4BJ6A 4Z9IA 2Y3HA 3C7JA 4XLNF 3IQTA 2Q9CA 1I4YA 2Y3DA 3HNKA 4KC9A 3JTLO 4XEKA 3RIPA 2OEXA 2R05A 3NYLA 4L6RA 5JP7A 2GFHA 1H7IA 1OR2A 3RVYA 1LI7A 1T9KA 2IM8A 3NMIA 3T6GB 4BJ1A 1V54C 2JPUA 2OCCC 2G3KA 3E70C 1SR2A 4HE8D 1ZHXA 5FCLA 3S90A 1TR2A 3RFYA 2J9BA 3H2UA 4MS2A 1NU9C 2Q9BA 5K0IA 1Z3IX 2FFHA 4MNDA 5E2QA 4MTFA 3TOMA 3TQOA 4D4NA 1G4WR 1M2OA 2WVNA 3Q7LA 1D0XA 2EPOA 4JW1A 3SXKA 3GODA 4OINF 3DMDA 3AG2C 1NU7D 3SYNA 1V4AA 2XS8A 2Q00A 5DS4A 5KYXA 4Z9JA 2HS5A 3F47A 4G0HA 3R7CA 4Z9HA 5BQGA 4AE4A 4DXWA 4PJJA 3LEOA 2A0BA 2OJED 1ORYA 2P0NA 2YL0A 3I5PA 4JCZA 3U2LA 1BZ4A 1UFBA 3KL4A 5L3QA 3S29A 2A1DD 2MWQA 3X2QC 4BPMA 3WAQA 3MYIA 4AL0A 3NYMA 1Z23A 2Z15A 3GM1A 1A0BA 4YL3A 4U5GA 5JRAA 1Y6DA 3UR3C 3TD7A 3RW0A 4X0RA 3RKOF 4MW3A 1YAUO 1TFKB 1MMDA 3B71A 2HJMA 4GYTA 5BUOA 4C7OA 4Q5SF 1RJ9A 1ZYRF 2B0HA 2HSQA 1LE2A 3H65A 1HE9A 2NSFA 3QVZA 3R2PA 1FMVA 2FAPB 2AU5A 1M57C 1LKXA 1KU2A 2V26A 2CW0F 2D4UA 2WVOA 5COGA 4LDRA 3BRJA 4BJ5A 5DS5A 1TWHA 2J7PA 1SMYF 4XQ1A 4DVYP 2ZD9A 4H54A 2VB6A 4I44A 3QW1A 4U9DA 4EWCA 4JKVA 1TFOB 2IXMA 4MVOA 1JMWA 3ABMC 4GQHA 3AQBA 3T9OA 2L9JA 3HNIA 5T1DB 2Y3GA 4E0HA 1M2VA 3C63A 2G3VA 3NYJA 4MW8A 4IJJA 1V74B 4KNVA 1OCOC 3DZAA 3KYJA 2ICWG 4GEHA 1E85A 4UDVA 1HMDA 2KSFA 1JAFA 4MVZA 2ZXPA 5DS6A 2NUTB 3FVYA 2EIKC 1YYXA 4JE9A 4U5DE 4IRUA 1WGWA 2HKVA 1U6HA 1IW7F 1MNEA 4MVSA 2J46A 1YARO 1PCXA 1XZQA 4J32B 1HMOA 5EHHA 1T6QA 4G7ZF 4WGZA 5KYXB 4KI2A 3EZIA 2YRFA 4XPXA 4YJWA 4BG0A 2OG2A 1LE4A 4A2NB 5HSWA 2WVQA 3LESA 1UG7A 3L1MA 3MYFA 2PFDA 5DLJA 4AX2A 3RH3A 2IXPA 3Q6NA 1M6TA 3N0TA 5JVEA 2R7RA 3K6BA 2A6EF 4YL0A 4I3MA 1FAPB 3K1HA 3C8GA 4U9EA 5CI9A 1MMGA 2C04A 4XWJA 4R32A 1GM5A 5FZTA 3BEHA 3DAGA 4O6NA 3V5XA 1L3PA 1JRAA 1M2VB 2Y3BA 4D4XA 4DVZA 1NLXA 1F1MA 256BA 4ER9A 3MLGA 3O39A 2UUIA 3GWLA 1OW8A 1W2WA 2ETSA 1TWCA 1VK5A 1ZZPA 4CS8C 4DRIB 2OQMA 2Q4FA 2Q7RA 1OW7A 2PF4E 4MTOA 3VRCA 1Q0MA 1NZEA 3AG3C 3MX3A 2VC9A 1ZU5A 3KMIA 5E33A 1OCRC 1WN0A 2OOCA 2QLAA 3EFOA 4NTFA 4C3DA 2J45A 2Y69C 4A4AA 2GA0A 3JT1A 3MFNA 1SF8A 1A7VA 1OKKA 4WJ0A 1CGOA 3V7OA 2OKUA 4ZLCA 5JUAA 2P61A 1T5OA 1ZHTA 2ZXWC 1WWPA 2IXNA 5D91A 3L0IA 5E3CA 2LP4A 4CS9A 4PJLA 2Q9AA 1VYIA 3KH2A 3ZIBA 5CIVA 3KYIA 2W9YA 3LS1A 2V3CC 2R7UA 3POVA 1ZHYA 2KC3A 3FAJA 2LK4A 2R7WA 4CX9A 3RYLA 3KPHA 4MQ9F 5IY5C 2HMZA 4O6MA 3LUTB 3S0XA 3FMSA 3ASNC 1T6UA 2R9RB 4HFKB 2AP3A 1ZVZA 4YK5A 2YL7A 1O87A 4PJMA 3RQEA 2M4EA 4NTBA 2HUJA 3DXJF 5L0DA 1JPNA 1HW1A 5B3IA 1I5NA 4JZAA 3EH2A 3C8GB 2ZPAA 5AC5A 4ZLDA 4KBLA 4PFOA 3RF3A 1Q0KA 4G7OF 2NG1A 3AG1C 1C03A 3K66A 1A7EA 1VB5A 3CZ6A 1QVXA 3EG9B 4ULWA 3C8GD 1KNYA 2KYHA 1YYJA 2W45A 3JRMO 4I1MA 3ZQVA 2LIGA 4J7YA 2IBFA 4RD9A 4CIPA 5KYNA 2LQGA 3DD7A 2A68F 1Q0FA 3UMIA 2YWAA 5DVWA 2J7PD 2XLOA 1C17M 4CSAA 4OIOF 2BE5F 2XL4A 3S9OA 3ZWIA 1FMWA 3B0PA 2PNOA 1YDIA 3QMKA 1ZHWA 1I4ZA 1ZW2A 1ZHZA 4JVSA 4QI2A 1QLEC 3NMJA 1LPEA 1ORJA 2D5RB 4YT5A 1YVIA 5L0FA 4JJGA 1QKRA 2ZXOA 2CCYA 2OJQA 3W2WA 4DOZA 3SNHA 2AWCA 3U3FA 2R7TA 2DGJA 3B0UX 1R5ID 2ASRA 3EJNA 3GORA 1G8XA 4YT8A 1NFOA 2EINC 1WOLA 2HZ8A 4LLEA 4P9TA 3TULA 1IZMA 3M1CB 3A9CA 4XEFA 1Z63A 2RSEB 4DJ9A 3GM3A 2R7SA 2WL8A 1S7ZA 1QSPA 4XPYA 2QNLA 1D0YA 2YVKA 1TQGA 3AQCA 3C18A 3LEVA 2HMQA 1VYKA 1NBBA 3ATPA 5KYYB 2R7OA 5COFA 3QTHA 2G62A 2TMVP 2PX3A 1S05A 3DM5A 1VLTA 4NCQA 1RJ9B 1WATA 2XL6A 3QZCA 4J30B 3DWWA 3TJ5A 5L0HA 3VF0A 4IB4A 1H9GA 3UMHA 4G78A 2R02A 3WG7C 2L81A 4E7SA 3QW0A 2O9XA 3LJBA 1HY5A 4OIQF 4LDQA 2ZXRA 2NUTA 3OA1A 3U2MA 4LERA 3NG1A 3NKEA 2KW3C 3HLZA 4YL1A 1MQVA 2I8BA 3GANA 3PMRA 4QDLA 1JOGA 2XXAA 4MVRA 4EKWA 4IWBA 2LSEA 1H6GA 1YA7O 4NTAA 1D1CA 3NRHA 4RDAA 1RXQA 3K7DA 2NSGA 1WASA 3JCUQ 3DAFA 1MNDA 1VLSA 1TWGA 1PD0A 5A69A 4I1OB 1CGME 3TJ6A 4HFFB 1OKKD 1QQ3A 3SZRA 3H2VA 1LVKA 1ZU4A 3GEIA 4JC7A 1Z7Qc 4FWVA 3JSEO 4XTKA 3FAPB 4M63A 2R7VA 3HTKC 5JSLA 3DJUB 2NUPB 1DOWA 5T3WA 4LACB 5F5HA 1DOVA 1XZPA 1RKCA 3K1IC 3U8VA 5T3TA 2E87A 3FDQA 3M79A 3UGOA 2J8WA 3EQLF 3JYYA 2QTVA 2J9VA 3DM9B 3EGXB 4FESA 4CS7A 5A6BD 1B68A 3EPVA 2XL8A 1NG1A 3US6A 4YN0B 5JT4A 2EIMC 3RQGA 3VYWA 4OIPF 5F5FA 1G4US 5DQTA 3SXMA 4PK4A 4JTCB 2XSEA 2HFIA 1YZCA 3S28A 3I4UA 3K33A 4O6YA 1Y4CA 3G4XA 1O3UA 3IPMO 3RQFA 3U3BA 2IYLD 1OQCA 3ZSUA 3IEEA 3S84A 3A11A 2X51A 3CQZA 3FOOA 3CAXA 2UUHA 3SXYA 2GDCA 3DJNB 3ZTZA 2YHSA 4WGYA 5KYYA 2DYSC 5A6BA 2HV7A 1JR8A 1H9TA 3B9QA 3QVYA 2HV6A 2EPLX 3EH1A 2QE9A 1E84A 4H4KC 4C3BA 3W2VA 2XLHA 4N6CA 2WZLA 1NFNA 3TK0A 1E83A 4OD4A 2KQ9A 4O7GA 4E17A 4EBBA 5L0IA 2H7OA 1RCPA 4XLPF 2KNHA 4FAPB 4JCHA 5JLIA 3CSKA 1LI5A 1SZIA 3ZTMA 3GEHA 3EGDA 4C3EA 4EBKA 4E7ZA 2CNWD 4J7TA 1TKNA 1HE1A 1ORSC 4NC3A 1EI7A 2P7VA 2KJGA 3EGXA 5AC4A 2EPNA 4DRHB 3GWNA 4CJGA 2A0UA 2L6FA 2QUPA 2BL2A 4LLCA 2YLGA 2CDQA 3U8PA 1OCCC 4FX5A 1U0BB 3WHNA 2L6HA 2LCHA 3HNLA 1VMAA 3ZC4A 2YL1A 3JSZA 4AE4B 1BBHA 5EK0A 1QZXA 1XWJA 3ABKC 4K1OA 5KYUA 1MMAA 4OIRF 1T01A 4K7BA 5A6AA 2CGEA 5AGFA 4BJ5C 3G50A 3O55A 4HEAJ 2F22A 1TWAA 1V55C 3L34A 3HJCA 3JRTA 2OU6A 1N1CA 2PP4A 4O79A 3V5ZA 4MTGA 2NUPA 1J8MF 3C62A 1HW2A 3EHNA 4EBJA 2WB7A 4BJ6C 2VCCA 4CJOA 3DE9A 4XEVA 5B1AC 5F28E 5COMA 2IXOA 2HJ3A 3NKDA 4YWQA 1K04A 4BEJA 4IARA 2YQYA 3M15A 4C7OB 3AGTA 2YKZA 2DB4A 2J9WA 2XLEA 4CIHA 2YEVA 3IQCA 2PX0A 4JJFA 3T6BA 2VCAA 2XS1A 1QPUA 5L0JA 3AGUA 3LLKA 3LNRA 1OCZC 1K05A 4MVMA 3W4YA 3W8HA 1J8YF 1LS1A 3GM2A 5D92A 2WZGA 5B1BC 1M56C 4EUKB 4JEAA 2YLDA 1D0ZA 1OXBA 4N06A 1VOMA 1GS9A 3JZ0A 3ASOC 2GAQA 2VH3A 3LLIA 4N6HA 5CI8A 4BJTA 1OW6A 2AWYA 3C8ZA 3ZVRA 3T4RA 2WZFA 1KTMA 2EPKX 3FHDA 1AEPA 3KKBA 4W8KA 3X1OA 2YZSA 4MVUA 1RMVA 2Y39A 1A41A 4XPWA 4ULVA 3TOLA 2LFFA 3EHMA 3PHF2 2MHRA 1AVOB 3EG9A 2J0XA 4LDKA 1BR2A 4JTAB 1SYQA 1YLMA 2A69F 3NMKA 4IGGA 4ANJA 1E2XA 1FFTC 3SP1A 5BQIA 5HV9A 2EPMX 1CPRA 3MBGA 1WTYA 3SXZA 3W8IA 5BQHA 3FOPA 4IAQA 2NPUA 4P6IC 4CDVA 2YL3A 2J9UA 4JEBA
chains in the Genus database with same CATH topology
1T6QA 1Q0GA 3G50A 3G4ZA 1Q0FA 1T6IA 1T6UA 1Q0DA 3G4XA 4NCQA 1Q0MA 1Q0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6Q A;  1Q0G A;  3G50 A;  3G4Z A;  1Q0F A;  1T6I A;  1T6U A;  1Q0D A;  3G4X A;  4NCQ A;  1Q0M A;  1Q0K A; 
#chains in the Genus database with same CATH topology
 1YZA A;  5A6K A;  3HKK A;  3AOU A;  4RBN A;  1R4T A;  3U0C A;  5JS5 A;  2PBE A;  3ZQY A;  3NDB B;  2MYS A;  3U9M A;  2X0C A;  1EA8 A;  1LIH A;  1U89 A;  1FFH A;  1Z5Z A;  2XM4 A;  3HNJ A;  4W8P A;  2R7X A;  5KYU B;  1FNT c;  4PAC A;  3RVZ A;  1YA9 A;  3GEE A;  1BDJ B;  1OR3 A;  2BC5 A;  3LAY A;  2IOQ A;  2J0W A;  4PR9 A;  1Q0D A;  4CSA C;  2DYR C;  4CDA A;  1D1A A;  4CS9 C;  1Z6A A;  2M64 A;  3O10 A;  4EHP A;  3J06 A;  3IQ6 A;  4E0I A;  5KYW B;  3EFO B;  3WOD F;  1BR1 A;  2C03 A;  3FXH A;  3UGP A;  5L0C A;  1Q0G A;  2Q3T A;  3M4C A;  1JPJ A;  1RKE A;  4JTD B;  3M4B A;  4U5C E;  1APC A;  2P1A A;  3PDM P;  1T6I A;  2JD3 A;  4P9F A;  5KYW A;  2H8A A;  1YJG A;  1LM3 B;  2A6H F;  2R03 A;  2W4B A;  5GPG B;  1CGN A;  4B6I A;  4CBE A;  3LS0 A;  3ZG1 A;  1ST6 A;  3PCV A;  4NY3 A;  2CNW A;  3EGD B;  1O5H A;  3I5Q A;  5A6J A;  5L3V A;  1GQA A;  2AVK A;  2OEV A;  2XLM A;  2QY9 A;  2XLW A;  4MVQ A;  4AL1 A;  2KK1 A;  1GGQ A;  3DKA A;  4CS8 A;  3EZH A;  3AJM A;  1MMN A;  3IHU A;  4YT4 A;  3ITF A;  3VAY A;  1G5Z A;  2DI3 A;  3VM6 A;  3S27 A;  4AK9 A;  3V5Y A;  3DE8 A;  1EQ1 A;  5B3S C;  4E18 A;  3SEO A;  1L7C A;  4U5E E;  5EGY A;  1OXK A;  3E9V A;  2L6G A;  3UNG C;  3U5S A;  5DQZ A;  3L8J A;  3ZDL A;  2R25 A;  4IAO A;  4CDY A;  4Q7C A;  4G7H F;  2R7Q A;  3DI5 A;  3B29 A;  4JUR I;  3Q7G A;  4Q4Z F;  5TJ5 E;  2XXA B;  3N2Z B;  1D1B A;  1VTM P;  2I15 A;  1BR4 A;  3Q6M A;  1C02 A;  2RD9 A;  3ABL C;  1RKE B;  3CEX A;  2KGO A;  3G4Z A;  5E3A A;  4U5H A;  2FGY A;  4DBQ A;  3B0V C;  4DRJ B;  3OEO A;  4U5F E;  2EIJ C;  3O6X A;  4PFP A;  3L8I A;  3K1I A;  1NSG B;  1PV3 A;  4WAB A;  4NQF A;  1FTS A;  1K40 A;  2GWW A;  4PJN A;  4ONS A;  2B0J A;  4JRZ A;  4QI0 A;  2XLV A;  4JIO A;  2H7B A;  4KNW A;  4N4W A;  1CPQ A;  3OWT A;  2VCB A;  3JYH A;  3N24 A;  4U5B E;  4DBR A;  4BEM J;  2XLD A;  3F46 A;  3IQ5 A;  4F4B A;  1AUE A;  1PD1 A;  2YLI A;  3AG4 C;  5L0G A;  2H7V C;  2VAS A;  3U9J A;  3T6J A;  2CYD A;  1E86 A;  2EIL C;  2XRH A;  2LD6 A;  3ECS A;  2P6V A;  1LS4 A;  2HSB A;  4EIY A;  1ZW3 A;  2LFD A;  1FR0 A;  2XM0 A;  3LNM B;  4YT2 A;  1EKY A;  2L7A A;  2W4M A;  2JX0 A;  4OD5 A;  4K0D A;  3UMK A;  1A7D A;  4BJ6 A;  4Z9I A;  2Y3H A;  3C7J A;  4XLN F;  3IQT A;  2Q9C A;  1I4Y A;  2Y3D A;  3HNK A;  4KC9 A;  3JTL O;  4XEK A;  3RIP A;  2OEX A;  2R05 A;  3NYL A;  4L6R A;  5JP7 A;  2GFH A;  1H7I A;  1OR2 A;  3RVY A;  1LI7 A;  1T9K A;  2IM8 A;  3NMI A;  3T6G B;  4BJ1 A;  1V54 C;  2JPU A;  2OCC C;  2G3K A;  3E70 C;  1SR2 A;  4HE8 D;  1ZHX A;  5FCL A;  3S90 A;  1TR2 A;  3RFY A;  2J9B A;  3H2U A;  4MS2 A;  1NU9 C;  2Q9B A;  5K0I A;  1Z3I X;  2FFH A;  4MND A;  5E2Q A;  4MTF A;  3TOM A;  3TQO A;  4D4N A;  1G4W R;  1M2O A;  2WVN A;  3Q7L A;  1D0X A;  2EPO A;  4JW1 A;  3SXK A;  3GOD A;  4OIN F;  3DMD A;  3AG2 C;  1NU7 D;  3SYN A;  1V4A A;  2XS8 A;  2Q00 A;  5DS4 A;  5KYX A;  4Z9J A;  2HS5 A;  3F47 A;  4G0H A;  3R7C A;  4Z9H A;  5BQG A;  4AE4 A;  4DXW A;  4PJJ A;  3LEO A;  2A0B A;  2OJE D;  1ORY A;  2P0N A;  2YL0 A;  3I5P A;  4JCZ A;  3U2L A;  1BZ4 A;  1UFB A;  3KL4 A;  5L3Q A;  3S29 A;  2A1D D;  2MWQ A;  3X2Q C;  4BPM A;  3WAQ A;  3MYI A;  4AL0 A;  3NYM A;  1Z23 A;  2Z15 A;  3GM1 A;  1A0B A;  4YL3 A;  4U5G A;  5JRA A;  1Y6D A;  3UR3 C;  3TD7 A;  3RW0 A;  4X0R A;  3RKO F;  4MW3 A;  1YAU O;  1TFK B;  1MMD A;  3B71 A;  2HJM A;  4GYT A;  5BUO A;  4C7O A;  4Q5S F;  1RJ9 A;  1ZYR F;  2B0H A;  2HSQ A;  1LE2 A;  3H65 A;  1HE9 A;  2NSF A;  3QVZ A;  3R2P A;  1FMV A;  2FAP B;  2AU5 A;  1M57 C;  1LKX A;  1KU2 A;  2V26 A;  2CW0 F;  2D4U A;  2WVO A;  5COG A;  4LDR A;  3BRJ A;  4BJ5 A;  5DS5 A;  1TWH A;  2J7P A;  1SMY F;  4XQ1 A;  4DVY P;  2ZD9 A;  4H54 A;  2VB6 A;  4I44 A;  3QW1 A;  4U9D A;  4EWC A;  4JKV A;  1TFO B;  2IXM A;  4MVO A;  1JMW A;  3ABM C;  4GQH A;  3AQB A;  3T9O A;  2L9J A;  3HNI A;  5T1D B;  2Y3G A;  4E0H A;  1M2V A;  3C63 A;  2G3V A;  3NYJ A;  4MW8 A;  4IJJ A;  1V74 B;  4KNV A;  1OCO C;  3DZA A;  3KYJ A;  2ICW G;  4GEH A;  1E85 A;  4UDV A;  1HMD A;  2KSF A;  1JAF A;  4MVZ A;  2ZXP A;  5DS6 A;  2NUT B;  3FVY A;  2EIK C;  1YYX A;  4JE9 A;  4U5D E;  4IRU A;  1WGW A;  2HKV A;  1U6H A;  1IW7 F;  1MNE A;  4MVS A;  2J46 A;  1YAR O;  1PCX A;  1XZQ A;  4J32 B;  1HMO A;  5EHH A;  1T6Q A;  4G7Z F;  4WGZ A;  5KYX B;  4KI2 A;  3EZI A;  2YRF A;  4XPX A;  4YJW A;  4BG0 A;  2OG2 A;  1LE4 A;  4A2N B;  5HSW A;  2WVQ A;  3LES A;  1UG7 A;  3L1M A;  3MYF A;  2PFD A;  5DLJ A;  4AX2 A;  3RH3 A;  2IXP A;  3Q6N A;  1M6T A;  3N0T A;  5JVE A;  2R7R A;  3K6B A;  2A6E F;  4YL0 A;  4I3M A;  1FAP B;  3K1H A;  3C8G A;  4U9E A;  5CI9 A;  1MMG A;  2C04 A;  4XWJ A;  4R32 A;  1GM5 A;  5FZT A;  3BEH A;  3DAG A;  4O6N A;  3V5X A;  1L3P A;  1JRA A;  1M2V B;  2Y3B A;  4D4X A;  4DVZ A;  1NLX A;  1F1M A;  256B A;  4ER9 A;  3MLG A;  3O39 A;  2UUI A;  3GWL A;  1OW8 A;  1W2W A;  2ETS A;  1TWC A;  1VK5 A;  1ZZP A;  4CS8 C;  4DRI B;  2OQM A;  2Q4F A;  2Q7R A;  1OW7 A;  2PF4 E;  4MTO A;  3VRC A;  1Q0M A;  1NZE A;  3AG3 C;  3MX3 A;  2VC9 A;  1ZU5 A;  3KMI A;  5E33 A;  1OCR C;  1WN0 A;  2OOC A;  2QLA A;  3EFO A;  4NTF A;  4C3D A;  2J45 A;  2Y69 C;  4A4A A;  2GA0 A;  3JT1 A;  3MFN A;  1SF8 A;  1A7V A;  1OKK A;  4WJ0 A;  1CGO A;  3V7O A;  2OKU A;  4ZLC A;  5JUA A;  2P61 A;  1T5O A;  1ZHT A;  2ZXW C;  1WWP A;  2IXN A;  5D91 A;  3L0I A;  5E3C A;  2LP4 A;  4CS9 A;  4PJL A;  2Q9A A;  1VYI A;  3KH2 A;  3ZIB A;  5CIV A;  3KYI A;  2W9Y A;  3LS1 A;  2V3C C;  2R7U A;  3POV A;  1ZHY A;  2KC3 A;  3FAJ A;  2LK4 A;  2R7W A;  4CX9 A;  3RYL A;  3KPH A;  4MQ9 F;  5IY5 C;  2HMZ A;  4O6M A;  3LUT B;  3S0X A;  3FMS A;  3ASN C;  1T6U A;  2R9R B;  4HFK B;  2AP3 A;  1ZVZ A;  4YK5 A;  2YL7 A;  1O87 A;  4PJM A;  3RQE A;  2M4E A;  4NTB A;  2HUJ A;  3DXJ F;  5L0D A;  1JPN A;  1HW1 A;  5B3I A;  1I5N A;  4JZA A;  3EH2 A;  3C8G B;  2ZPA A;  5AC5 A;  4ZLD A;  4KBL A;  4PFO A;  3RF3 A;  1Q0K A;  4G7O F;  2NG1 A;  3AG1 C;  1C03 A;  3K66 A;  1A7E A;  1VB5 A;  3CZ6 A;  1QVX A;  3EG9 B;  4ULW A;  3C8G D;  1KNY A;  2KYH A;  1YYJ A;  2W45 A;  3JRM O;  4I1M A;  3ZQV A;  2LIG A;  4J7Y A;  2IBF A;  4RD9 A;  4CIP A;  5KYN A;  2LQG A;  3DD7 A;  2A68 F;  1Q0F A;  3UMI A;  2YWA A;  5DVW A;  2J7P D;  2XLO A;  1C17 M;  4CSA A;  4OIO F;  2BE5 F;  2XL4 A;  3S9O A;  3ZWI A;  1FMW A;  3B0P A;  2PNO A;  1YDI A;  3QMK A;  1ZHW A;  1I4Z A;  1ZW2 A;  1ZHZ A;  4JVS A;  4QI2 A;  1QLE C;  3NMJ A;  1LPE A;  1ORJ A;  2D5R B;  4YT5 A;  1YVI A;  5L0F A;  4JJG A;  1QKR A;  2ZXO A;  2CCY A;  2OJQ A;  3W2W A;  4DOZ A;  3SNH A;  2AWC A;  3U3F A;  2R7T A;  2DGJ A;  3B0U X;  1R5I D;  2ASR A;  3EJN A;  3GOR A;  1G8X A;  4YT8 A;  1NFO A;  2EIN C;  1WOL A;  2HZ8 A;  4LLE A;  4P9T A;  3TUL A;  1IZM A;  3M1C B;  3A9C A;  4XEF A;  1Z63 A;  2RSE B;  4DJ9 A;  3GM3 A;  2R7S A;  2WL8 A;  1S7Z A;  1QSP A;  4XPY A;  2QNL A;  1D0Y A;  2YVK A;  1TQG A;  3AQC A;  3C18 A;  3LEV A;  2HMQ A;  1VYK A;  1NBB A;  3ATP A;  5KYY B;  2R7O A;  5COF A;  3QTH A;  2G62 A;  2TMV P;  2PX3 A;  1S05 A;  3DM5 A;  1VLT A;  4NCQ A;  1RJ9 B;  1WAT A;  2XL6 A;  3QZC A;  4J30 B;  3DWW A;  3TJ5 A;  5L0H A;  3VF0 A;  4IB4 A;  1H9G A;  3UMH A;  4G78 A;  2R02 A;  3WG7 C;  2L81 A;  4E7S A;  3QW0 A;  2O9X A;  3LJB A;  1HY5 A;  4OIQ F;  4LDQ A;  2ZXR A;  2NUT A;  3OA1 A;  3U2M A;  4LER A;  3NG1 A;  3NKE A;  2KW3 C;  3HLZ A;  4YL1 A;  1MQV A;  2I8B A;  3GAN A;  3PMR A;  4QDL A;  1JOG A;  2XXA A;  4MVR A;  4EKW A;  4IWB A;  2LSE A;  1H6G A;  1YA7 O;  4NTA A;  1D1C A;  3NRH A;  4RDA A;  1RXQ A;  3K7D A;  2NSG A;  1WAS A;  3JCU Q;  3DAF A;  1MND A;  1VLS A;  1TWG A;  1PD0 A;  5A69 A;  4I1O B;  1CGM E;  3TJ6 A;  4HFF B;  1OKK D;  1QQ3 A;  3SZR A;  3H2V A;  1LVK A;  1ZU4 A;  3GEI A;  4JC7 A;  1Z7Q c;  4FWV A;  3JSE O;  4XTK A;  3FAP B;  4M63 A;  2R7V A;  3HTK C;  5JSL A;  3DJU B;  2NUP B;  1DOW A;  5T3W A;  4LAC B;  5F5H A;  1DOV A;  1XZP A;  1RKC A;  3K1I C;  3U8V A;  5T3T A;  2E87 A;  3FDQ A;  3M79 A;  3UGO A;  2J8W A;  3EQL F;  3JYY A;  2QTV A;  2J9V A;  3DM9 B;  3EGX B;  4FES A;  4CS7 A;  5A6B D;  1B68 A;  3EPV A;  2XL8 A;  1NG1 A;  3US6 A;  4YN0 B;  5JT4 A;  2EIM C;  3RQG A;  3VYW A;  4OIP F;  5F5F A;  1G4U S;  5DQT A;  3SXM A;  4PK4 A;  4JTC B;  2XSE A;  2HFI A;  1YZC A;  3S28 A;  3I4U A;  3K33 A;  4O6Y A;  1Y4C A;  3G4X A;  1O3U A;  3IPM O;  3RQF A;  3U3B A;  2IYL D;  1OQC A;  3ZSU A;  3IEE A;  3S84 A;  3A11 A;  2X51 A;  3CQZ A;  3FOO A;  3CAX A;  2UUH A;  3SXY A;  2GDC A;  3DJN B;  3ZTZ A;  2YHS A;  4WGY A;  5KYY A;  2DYS C;  5A6B A;  2HV7 A;  1JR8 A;  1H9T A;  3B9Q A;  3QVY A;  2HV6 A;  2EPL X;  3EH1 A;  2QE9 A;  1E84 A;  4H4K C;  4C3B A;  3W2V A;  2XLH A;  4N6C A;  2WZL A;  1NFN A;  3TK0 A;  1E83 A;  4OD4 A;  2KQ9 A;  4O7G A;  4E17 A;  4EBB A;  5L0I A;  2H7O A;  1RCP A;  4XLP F;  2KNH A;  4FAP B;  4JCH A;  5JLI A;  3CSK A;  1LI5 A;  1SZI A;  3ZTM A;  3GEH A;  3EGD A;  4C3E A;  4EBK A;  4E7Z A;  2CNW D;  4J7T A;  1TKN A;  1HE1 A;  1ORS C;  4NC3 A;  1EI7 A;  2P7V A;  2KJG A;  3EGX A;  5AC4 A;  2EPN A;  4DRH B;  3GWN A;  4CJG A;  2A0U A;  2L6F A;  2QUP A;  2BL2 A;  4LLC A;  2YLG A;  2CDQ A;  3U8P A;  1OCC C;  4FX5 A;  1U0B B;  3WHN A;  2L6H A;  2LCH A;  3HNL A;  1VMA A;  3ZC4 A;  2YL1 A;  3JSZ A;  4AE4 B;  1BBH A;  5EK0 A;  1QZX A;  1XWJ A;  3ABK C;  4K1O A;  5KYU A;  1MMA A;  4OIR F;  1T01 A;  4K7B A;  5A6A A;  2CGE A;  5AGF A;  4BJ5 C;  3G50 A;  3O55 A;  4HEA J;  2F22 A;  1TWA A;  1V55 C;  3L34 A;  3HJC A;  3JRT A;  2OU6 A;  1N1C A;  2PP4 A;  4O79 A;  3V5Z A;  4MTG A;  2NUP A;  1J8M F;  3C62 A;  1HW2 A;  3EHN A;  4EBJ A;  2WB7 A;  4BJ6 C;  2VCC A;  4CJO A;  3DE9 A;  4XEV A;  5B1A C;  5F28 E;  5COM A;  2IXO A;  2HJ3 A;  3NKD A;  4YWQ A;  1K04 A;  4BEJ A;  4IAR A;  2YQY A;  3M15 A;  4C7O B;  3AGT A;  2YKZ A;  2DB4 A;  2J9W A;  2XLE A;  4CIH A;  2YEV A;  3IQC A;  2PX0 A;  4JJF A;  3T6B A;  2VCA A;  2XS1 A;  1QPU A;  5L0J A;  3AGU A;  3LLK A;  3LNR A;  1OCZ C;  1K05 A;  4MVM A;  3W4Y A;  3W8H A;  1J8Y F;  1LS1 A;  3GM2 A;  5D92 A;  2WZG A;  5B1B C;  1M56 C;  4EUK B;  4JEA A;  2YLD A;  1D0Z A;  1OXB A;  4N06 A;  1VOM A;  1GS9 A;  3JZ0 A;  3ASO C;  2GAQ A;  2VH3 A;  3LLI A;  4N6H A;  5CI8 A;  4BJT A;  1OW6 A;  2AWY A;  3C8Z A;  3ZVR A;  3T4R A;  2WZF A;  1KTM A;  2EPK X;  3FHD A;  1AEP A;  3KKB A;  4W8K A;  3X1O A;  2YZS A;  4MVU A;  1RMV A;  2Y39 A;  1A41 A;  4XPW A;  4ULV A;  3TOL A;  2LFF A;  3EHM A;  3PHF 2;  2MHR A;  1AVO B;  3EG9 A;  2J0X A;  4LDK A;  1BR2 A;  4JTA B;  1SYQ A;  1YLM A;  2A69 F;  3NMK A;  4IGG A;  4ANJ A;  1E2X A;  1FFT C;  3SP1 A;  5BQI A;  5HV9 A;  2EPM X;  1CPR A;  3MBG A;  1WTY A;  3SXZ A;  3W8I A;  5BQH A;  3FOP A;  4IAQ A;  2NPU A;  4P6I C;  4CDV A;  2YL3 A;  2J9U A;  4JEB A; 
#chains in the Genus database with same CATH homology
 1T6Q A;  1Q0G A;  3G50 A;  3G4Z A;  1Q0F A;  1T6I A;  1T6U A;  1Q0D A;  3G4X A;  4NCQ A;  1Q0M A;  1Q0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...