1T6QA

Nickel superoxide dismutase (nisod) cn-treated apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6qA00
1T6IA 1Q0FA 1T6UA 3G50A 4NCQA 3G4ZA 3G4XA 1T6QA 1Q0GA 1Q0MA 1Q0KA 1Q0DA
chains in the Genus database with same CATH superfamily
3EH1A 5FZTA 1BDJB 2R7RA 1SZIA 3ABLC 3KYJA 2DB4A 3F46A 1O87A 1TWAA 1EKYA 1D1AA 4BEMJ 1Z3IX 3DE9A 3PMRA 4DVYP 2Q3TA 1TFKB 3ZQVA 4J32B 1QQ3A 4M63A 4R32A 2R7XA 1NSGB 3M4BA 1HMOA 3IHUA 2OCCC 4Q7CA 4NCQA 1OCRC 4ER9A 3LNMB 3U9JA 2Q7RA 1S05A 5EGYA 2WZGA 2NUTB 1CPRA 2J9WA 2KNHA 3TK0A 3FOPA 1YAUO 3SNHA 1Z5ZA 1DOWA 3EH2A 3F47A 4GYTA 4H4KC 5KYNA 3HKKA 4C7OB 5KYWA 4IRUA 3I4UA 2B0JA 4KNVA 4PFOA 3M79A 4YJWA 1C17M 3ZQYA 4BJ1A 1UG7A 3HJCA 3U3FA 4ZLDA 2XLEA 4CX9A 3K1IA 1V74B 3AQCA 4IAOA 3L1MA 3H2UA 1M6TA 3U3BA 1M56C 2R25A 1HW1A 2J46A 2BC5A 2P6VA 3ZC4A 5KYYA 3ABMC 4K0DA 4XWJA 3WAQA 2CNWA 3WHNA 4B6IA 5KYXA 3EFOB 5DLJA 4PR9A 3AJMA 3UMIA 3U5SA 5BQIA 5KYUA 1RJ9B 4MTOA 2HSBA 1ZU5A 2ZPAA 4I1OB 4JIOA 4DOZA 4D4XA 1A0BA 2HFIA 5CI9A 1H6GA 3MX3A 4I1MA 3I5QA 2OJQA 4W8KA 5JS5A 3ZIBA 3HNIA 3VM6A 4AE4B 2XM4A 1OKKD 2Z15A 4EBKA 4CIHA 2DYSC 1Z6AA 3EHMA 1IW7F 2ZXOA 1WN0A 3IPMO 3ZWIA 2ZXRA 4YWQA 5EHHA 3B0VC 1AEPA 3K1HA 2YL0A 1ZHXA 3CEXA 3SZRA 2R05A 4P9FA 1GGQA 2YWAA 2W4MA 1H9TA 2BE5F 3EGXA 3K7DA 2IOQA 3EGDA 4MVUA 1J8YF 1ZYRF 3C8GA 1WWPA 1OCZC 4AX2A 5B3SC 2A69F 1GQAA 2AP3A 4XPWA 5L0DA 1JPNA 3N2ZB 3EG9B 3OWTA 2CCYA 1QSPA 4FX5A 1JOGA 3RW0A 3WODF 4E18A 4XEFA 1ZZPA 4XLNF 4GEHA 2A1DD 3O10A 3PCVA 3DAFA 3L0IA 4E7ZA 5BQGA 3JSZA 3C18A 3QVYA 5JRAA 4G7HF 4NY3A 1G8XA 3I5PA 3RKOF 4YT2A 2J8WA 4N06A 3T4RA 1ZW3A 3EJNA 3K33A 2NUPB 1WASA 3AGTA 3C63A 3K66A 4Q4ZF 2XXAA 3ABKC 4NTFA 1BR1A 1VLSA 3NG1A 4BEJA 1ORSC 5A69A 2L6HA 2R9RB 2YEVA 4JC7A 2Q9CA 4DXWA 1OCCC 1Z23A 2L9JA 1OXBA 3B0UX 2C03A 2R7UA 3UMHA 4JJGA 1D0ZA 1TQGA 1ZU4A 3X1OA 4DJ9A 2VCAA 3HNLA 3QZCA 5DS6A 4OIQF 3PDMP 5F5FA 1DOVA 2AWCA 1EA8A 2XS1A 3LS1A 3N24A 4YL1A 2Y3GA 4U9DA 5DS5A 2IBFA 3JRMO 1AUEA 4G0HA 5AGFA 1L7CA 4MVQA 2P7VA 2B0HA 1LPEA 5B1AC 4CDAA 3RH3A 3B29A 1NFNA 3BEHA 3ZVRA 2YL7A 5COFA 2IXPA 1EI7A 2VC9A 1NU7D 2XL4A 5JUAA 1YA9A 3IQCA 3J06A 2PX0A 3DZAA 1OQCA 4IWBA 4LACB 4EUKB 5L0IA 4XEVA 1YARO 2H8AA 2XLMA 2EPLX 2FAPB 2M64A 2OJED 2W9YA 3DKAA 3W8IA 3UMKA 3LAYA 3GM3A 4J7TA 1PV3A 1V4AA 2QE9A 4Z9JA 4HEAJ 1G4US 4G78A 4RDAA 1XZQA 256BA 2HUJA 1OR2A 3B0PA 4U5GA 1UFBA 2EPKX 3HNKA 4YL3A 2IXNA 4XPXA 3LNRA 3KH2A 2WL8A 4RD9A 5A6BD 1APCA 3TOMA 3W2VA 1E83A 4ULWA 4OINF 1MNDA 1RCPA 3ZTZA 1E85A 3M4CA 3B71A 1CGME 5TJ5E 4OD5A 5L3VA 3AG3C 1JAFA 2PP4A 2XL6A 4DRJB 4DBRA 3CSKA 3IQ5A 2XLHA 2VCCA 3S90A 4H54A 3V5XA 2KJGA 3JSEO 4BPMA 4JKVA 3S9OA 1YZCA 4CS9A 4EIYA 1NU9C 5L0CA 1M2VA 2NSFA 3B9QA 2J45A 3RYLA 4BG0A 2YLGA 2PF4E 3G50A 1WGWA 1ZHZA 1WOLA 2J7PA 4JTDB 4EBJA 4XLPF 2A68F 4JCZA 5AC4A 1FMWA 1S7ZA 2R7WA 2YKZA 3MYFA 3W8HA 4CJOA 4K1OA 3UGPA 2YL1A 3ECSA 5DS4A 2HKVA 2LIGA 5GPGB 5JT4A 1JPJA 3OA1A 2KK1A 4MVSA 1E86A 2CGEA 3GANA 2L7AA 2A6HF 4JEBA 2A0UA 5IY5C 3NMJA 2R7OA 4IGGA 2EIMC 4QI0A 4PJNA 2ZXPA 5B1BC 3PHF2 2HS5A 1SMYF 2JPUA 2YRFA 3R7CA 4XTKA 4GQHA 1RKEB 3W4YA 1RXQA 4DRHB 5K0IA 3IQTA 1YYXA 4PJJA 1U6HA 1YZAA 1YA7O 2PFDA 4MTFA 2Q9BA 3CQZA 2R7SA 4Z9IA 2EIKC 1KU2A 3FXHA 4MVZA 2Y39A 4U5HA 1CGOA 3GEIA 2LCHA 3HTKC 4EHPA 5T3WA 3KYIA 2Q00A 2OEXA 3UR3C 4KC9A 1U0BB 3TJ6A 1D0XA 2HZ8A 1FTSA 2C04A 1O3UA 3DMDA 5FCLA 3JT1A 2QNLA 1D0YA 1ORJA 5L0FA 2CYDA 3ZG1A 3DE8A 2IXOA 2L6FA 3NYJA 2WVOA 3GWNA 1YLMA 1TR2A 2XLDA 1HE1A 4X0RA 1E84A 4WABA 4JRZA 5JP7A 4BJ5C 2WB7A 3KPHA 4NTAA 1Y4CA 3SXKA 3MBGA 4O6MA 1G4WR 1T6IA 5JSLA 3RFYA 4JE9A 4XQ1A 1FR0A 3DXJF 3O55A 4OD4A 2XS8A 4N6CA 4OIOF 1MMGA 4AL0A 5E3AA 1YJGA 4AL1A 4YT5A 4YT4A 4XPYA 2ZXWC 1ZHTA 2H7BA 2CW0F 3FAJA 4J30B 3US6A 3W2WA 2Y3DA 2UUIA 3FHDA 3LJBA 3LESA 1ZVZA 2OG2A 1JRAA 3UNGC 1WATA 3EQLF 2XRHA 3ZSUA 3AG4C 3EZHA 2H7OA 3KMIA 4D4NA 3FAPB 2GA0A 3NYMA 5D91A 2XLOA 4QI2A 2Y3HA 3A11A 3SXZA 3QW0A 3L34A 5COGA 1ZW2A 4NTBA 1LI7A 4WGYA 3QW1A 3DI5A 4C3EA 2DI3A 2KC3A 1GM5A 4FAPB 3OEOA 4CS8C 1MMNA 2D4UA 1OW8A 5DQTA 1LI5A 3DWWA 2LSEA 4EBBA 3POVA 3VRCA 1Z63A 2LFDA 3U8PA 2FGYA 3O6XA 3LEOA 1A41A 3EZIA 4E7SA 1QPUA 5KYWB 1RMVA 2EIJC 3V7OA 1JMWA 1YDIA 4YN0B 1I4ZA 3QMKA 4YK5A 1Q0DA 1VB5A 3C7JA 4U5BE 2R03A 1C03A 3S29A 4CS7A 2A6EF 2YL3A 5KYYB 2F22A 3E70C 4IB4A 2X0CA 2HV7A 1I5NA 1Y6DA 3RQFA 5L0HA 1A7DA 4CDYA 1OR3A 3RVZA 4U5DE 5KYUB 1Q0GA 4NQFA 3VYWA 4QDLA 3SEOA 2G62A 1Q0FA 3KKBA 2L81A 3NMKA 2NSGA 1B68A 4U5CE 3GEHA 2HMZA 1HE9A 1OXKA 2D5RB 1A7VA 3AGUA 3JYHA 3K6BA 5HV9A 1T01A 2NUTA 2IM8A 1BR2A 4O7GA 1LS1A 3TD7A 1SYQA 3U2MA 3BRJA 1C02A 4BJ6C 4O6YA 4C7OA 3U8VA 4MVRA 1NLXA 2G3KA 2QY9A 2VCBA 1NG1A 4J7YA 1K05A 2QUPA 3T6GB 2LFFA 3EGDB 3ZTMA 4CDVA 1JR8A 1TWCA 1YYJA 2JD3A 2BL2A 2O9XA 3MYIA 3NRHA 1VYKA 4PK4A 3T6JA 3NMIA 1TWHA 1T6QA 3EFOA 1CGNA 4MQ9F 4CBEA 2VASA 4PACA 4U5FE 2P1AA 4JZAA 4CSAC 3FVYA 3O39A 5DQZA 4EKWA 1RJ9A 3IEEA 1SF8A 2EPOA 2Q9AA 1OW6A 2X51A 2ZD9A 4BJTA 2J9VA 4HE8D 4IARA 2AU5A 4PJMA 1FFHA 2R7QA 4I3MA 4KNWA 4E17A 4ZLCA 1OW7A 1LVKA 2H7VC 4AE4A 5AC5A 5L0JA 5BUOA 2XXAB 3GEEA 1ZHWA 3TJ5A 3MLGA 1V55C 2I15A 5E2QA 4Q5SF 1IZMA 4N6HA 1KNYA 2XL8A 5L0GA 4YT8A 2NPUA 4LDKA 4CS8A 3AG1C 5L3QA 4MW3A 3SP1A 4RBNA 5A6JA 1LE2A 4JVSA 2LD6A 2XSEA 1Z7Qc 4I44A 3LS0A 3EG9A 4JCHA 5B3IA 1XWJA 2J7PD 2Q4FA 1F1MA 4JTAB 1NBBA 2HJ3A 2MWQA 3JYYA 3ASNC 2WZLA 4KBLA 1BR4A 1O5HA 2HSQA 3JRTA 4O79A 1LIHA 4EWCA 5CIVA 4CIPA 1T5OA 1FAPB 1NFOA 1VLTA 3IQ6A 3TOLA 3WG7C 4HFFB 3EHNA 3H65A 1W2WA 2JX0A 4K7BA 3X2QC 5JLIA 4UDVA 1QLEC 5E33A 3DM9B 2GDCA 2KW3C 4MS2A 4W8PA 2A0BA 2KYHA 2NUPA 1R4TA 3CAXA 3E9VA 3GODA 1H9GA 4FWVA 1M57C 1TWGA 4LERA 2GWWA 4IAQA 1T9KA 3LLIA 4MW8A 1VK5A 4WJ0A 3SXMA 2L6GA 5COMA 4MNDA 4FESA 3JCUQ 4JJFA 1TKNA 2EPMX 4PFPA 3T9OA 2LP4A 1QKRA 3M1CB 3GM2A 3U9MA 2OOCA 4HFKB 3TQOA 3S27A 1OKKA 2CNWD 2Y69C 4JTCB 4MTGA 4BJ6A 2GFHA 4OIRF 3V5YA 2KQ9A 1Q0MA 3C62A 4U5EE 1K40A 1H7IA 1HY5A 4G7OF 1D1CA 4JURI 3RIPA 3ZDLA 4LLCA 3AG2C 1LKXA 4CJGA 2P61A 4LLEA 3AQBA 2RD9A 3GORA 4P6IC 2EINC 2M4EA 1M2VB 2QTVA 1BBHA 2ICWG 1QVXA 1ORYA 3M15A 3QTHA 4Z9HA 3RVYA 5T3TA 3VAYA 1ZHYA 1G5ZA 2J9UA 3U0CA 4CSAA 3LEVA 5CI8A 2V3CC 2R7VA 3JTLO 2FFHA 1CPQA 4XEKA 2GAQA 1TFOB 5E3CA 2XLWA 3ASOC 3C8ZA 2I8BA 2OKUA 2IXMA 4LDQA 2TMVP 2R02A 5T1DB 2CDQA 3LUTB 2YVKA 4IJJA 2ASRA 3DAGA 3C8GD 1V54C 1PD0A 2HMQA 2IYLD 3T6BA 4DVZA 2YLDA 3Q6MA 2E87A 2LQGA 4A2NB 3MFNA 2OEVA 1RKCA 3DJNB 4CS9C 5BQHA 2VB6A 3GM1A 4AK9A 1BZ4A 1R5ID 1D1BA 1SR2A 2LK4A 4O6NA 5DVWA 3RQGA 2G3VA 3VF0A 1N1CA 3DM5A 3FDQA 1L3PA 1Q0KA 2AVKA 4ULVA 1OCOC 1PD1A 4NC3A 4MVMA 3CZ6A 1K04A 3L8IA 4MVOA 1QZXA 4KI2A 3GWLA 3L8JA 3NKDA 5KYXB 3RF3A 1T6UA 1J8MF 3R2PA 3U2LA 2P0NA 5D92A 5JVEA 2WVNA 3NYLA 2YZSA 4WGZA 3QVZA 2Y3BA 2V26A 2QLAA 1LS4A 1VYIA 2KGOA 2YHSA 1NZEA 2XLVA 1MNEA 1VOMA 2RSEB 4U9EA 3H2VA 3N0TA 4LDRA 1FNTc 1FFTC 1GS9A 3S0XA 4PJLA 1U89A 3K1IC 1LM3B 2MYSA 3RQEA 3NDBB 1FMVA 3HLZA 3TULA 2OU6A 3ITFA 2ETSA 1MQVA 4YL0A 4ANJA 2UUHA 4ONSA 1PCXA 2VH3A 4P9TA 1RKEA 5EK0A 1I4YA 2DGJA 4BJ5A 1E2XA 3EGXB 2YQYA 1AVOB 2MHRA 3C8GB 4DBQA 5A6AA 1A7EA 2OQMA 5A6BA 1VMAA 3JZ0A 4L6RA 1MMDA 3EPVA 4F4BA 2PX3A 3ATPA 2WVQA 5F5HA 2R7TA 5HSWA 3Q7GA 3HNJA 2PNOA 2J9BA 2J0WA 4E0HA 4DRIB 3S84A 1HMDA 1YVIA 4C3BA 3Q6NA 1WTYA 4E0IA 3DD7A 3G4ZA 3FMSA 1ST6A 2EILC 2XM0A 1HW2A 3S28A 3NKEA 4N4WA 1LE4A 3A9CA 1M2OA 2PBEA 2W4BA 3SYNA 3FOOA 2HV6A 2EPNA 4OIPF 3Q7LA 3AOUA 2DYRC 2NG1A 1MMAA 2YLIA 1EQ1A 2HJMA 3V5ZA 1VTMP 2KSFA 3DJUB 2W45A 3UGOA 1KTMA 4JEAA 4JW1A 2AWYA 4C3DA 5A6KA 3G4XA 2J0XA 3KL4A 5F28E 3SXYA 1XZPA 4A4AA 2WZFA 3LLKA 4G7ZF
chains in the Genus database with same CATH topology
1T6IA 1Q0FA 1T6UA 3G50A 4NCQA 3G4ZA 3G4XA 1T6QA 1Q0GA 1Q0MA 1Q0KA 1Q0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6I A;  1Q0F A;  1T6U A;  3G50 A;  4NCQ A;  3G4Z A;  3G4X A;  1T6Q A;  1Q0G A;  1Q0M A;  1Q0K A;  1Q0D A; 
#chains in the Genus database with same CATH topology
 3EH1 A;  5FZT A;  1BDJ B;  2R7R A;  1SZI A;  3ABL C;  3KYJ A;  2DB4 A;  3F46 A;  1O87 A;  1TWA A;  1EKY A;  1D1A A;  4BEM J;  1Z3I X;  3DE9 A;  3PMR A;  4DVY P;  2Q3T A;  1TFK B;  3ZQV A;  4J32 B;  1QQ3 A;  4M63 A;  4R32 A;  2R7X A;  1NSG B;  3M4B A;  1HMO A;  3IHU A;  2OCC C;  4Q7C A;  4NCQ A;  1OCR C;  4ER9 A;  3LNM B;  3U9J A;  2Q7R A;  1S05 A;  5EGY A;  2WZG A;  2NUT B;  1CPR A;  2J9W A;  2KNH A;  3TK0 A;  3FOP A;  1YAU O;  3SNH A;  1Z5Z A;  1DOW A;  3EH2 A;  3F47 A;  4GYT A;  4H4K C;  5KYN A;  3HKK A;  4C7O B;  5KYW A;  4IRU A;  3I4U A;  2B0J A;  4KNV A;  4PFO A;  3M79 A;  4YJW A;  1C17 M;  3ZQY A;  4BJ1 A;  1UG7 A;  3HJC A;  3U3F A;  4ZLD A;  2XLE A;  4CX9 A;  3K1I A;  1V74 B;  3AQC A;  4IAO A;  3L1M A;  3H2U A;  1M6T A;  3U3B A;  1M56 C;  2R25 A;  1HW1 A;  2J46 A;  2BC5 A;  2P6V A;  3ZC4 A;  5KYY A;  3ABM C;  4K0D A;  4XWJ A;  3WAQ A;  2CNW A;  3WHN A;  4B6I A;  5KYX A;  3EFO B;  5DLJ A;  4PR9 A;  3AJM A;  3UMI A;  3U5S A;  5BQI A;  5KYU A;  1RJ9 B;  4MTO A;  2HSB A;  1ZU5 A;  2ZPA A;  4I1O B;  4JIO A;  4DOZ A;  4D4X A;  1A0B A;  2HFI A;  5CI9 A;  1H6G A;  3MX3 A;  4I1M A;  3I5Q A;  2OJQ A;  4W8K A;  5JS5 A;  3ZIB A;  3HNI A;  3VM6 A;  4AE4 B;  2XM4 A;  1OKK D;  2Z15 A;  4EBK A;  4CIH A;  2DYS C;  1Z6A A;  3EHM A;  1IW7 F;  2ZXO A;  1WN0 A;  3IPM O;  3ZWI A;  2ZXR A;  4YWQ A;  5EHH A;  3B0V C;  1AEP A;  3K1H A;  2YL0 A;  1ZHX A;  3CEX A;  3SZR A;  2R05 A;  4P9F A;  1GGQ A;  2YWA A;  2W4M A;  1H9T A;  2BE5 F;  3EGX A;  3K7D A;  2IOQ A;  3EGD A;  4MVU A;  1J8Y F;  1ZYR F;  3C8G A;  1WWP A;  1OCZ C;  4AX2 A;  5B3S C;  2A69 F;  1GQA A;  2AP3 A;  4XPW A;  5L0D A;  1JPN A;  3N2Z B;  3EG9 B;  3OWT A;  2CCY A;  1QSP A;  4FX5 A;  1JOG A;  3RW0 A;  3WOD F;  4E18 A;  4XEF A;  1ZZP A;  4XLN F;  4GEH A;  2A1D D;  3O10 A;  3PCV A;  3DAF A;  3L0I A;  4E7Z A;  5BQG A;  3JSZ A;  3C18 A;  3QVY A;  5JRA A;  4G7H F;  4NY3 A;  1G8X A;  3I5P A;  3RKO F;  4YT2 A;  2J8W A;  4N06 A;  3T4R A;  1ZW3 A;  3EJN A;  3K33 A;  2NUP B;  1WAS A;  3AGT A;  3C63 A;  3K66 A;  4Q4Z F;  2XXA A;  3ABK C;  4NTF A;  1BR1 A;  1VLS A;  3NG1 A;  4BEJ A;  1ORS C;  5A69 A;  2L6H A;  2R9R B;  2YEV A;  4JC7 A;  2Q9C A;  4DXW A;  1OCC C;  1Z23 A;  2L9J A;  1OXB A;  3B0U X;  2C03 A;  2R7U A;  3UMH A;  4JJG A;  1D0Z A;  1TQG A;  1ZU4 A;  3X1O A;  4DJ9 A;  2VCA A;  3HNL A;  3QZC A;  5DS6 A;  4OIQ F;  3PDM P;  5F5F A;  1DOV A;  2AWC A;  1EA8 A;  2XS1 A;  3LS1 A;  3N24 A;  4YL1 A;  2Y3G A;  4U9D A;  5DS5 A;  2IBF A;  3JRM O;  1AUE A;  4G0H A;  5AGF A;  1L7C A;  4MVQ A;  2P7V A;  2B0H A;  1LPE A;  5B1A C;  4CDA A;  3RH3 A;  3B29 A;  1NFN A;  3BEH A;  3ZVR A;  2YL7 A;  5COF A;  2IXP A;  1EI7 A;  2VC9 A;  1NU7 D;  2XL4 A;  5JUA A;  1YA9 A;  3IQC A;  3J06 A;  2PX0 A;  3DZA A;  1OQC A;  4IWB A;  4LAC B;  4EUK B;  5L0I A;  4XEV A;  1YAR O;  2H8A A;  2XLM A;  2EPL X;  2FAP B;  2M64 A;  2OJE D;  2W9Y A;  3DKA A;  3W8I A;  3UMK A;  3LAY A;  3GM3 A;  4J7T A;  1PV3 A;  1V4A A;  2QE9 A;  4Z9J A;  4HEA J;  1G4U S;  4G78 A;  4RDA A;  1XZQ A;  256B A;  2HUJ A;  1OR2 A;  3B0P A;  4U5G A;  1UFB A;  2EPK X;  3HNK A;  4YL3 A;  2IXN A;  4XPX A;  3LNR A;  3KH2 A;  2WL8 A;  4RD9 A;  5A6B D;  1APC A;  3TOM A;  3W2V A;  1E83 A;  4ULW A;  4OIN F;  1MND A;  1RCP A;  3ZTZ A;  1E85 A;  3M4C A;  3B71 A;  1CGM E;  5TJ5 E;  4OD5 A;  5L3V A;  3AG3 C;  1JAF A;  2PP4 A;  2XL6 A;  4DRJ B;  4DBR A;  3CSK A;  3IQ5 A;  2XLH A;  2VCC A;  3S90 A;  4H54 A;  3V5X A;  2KJG A;  3JSE O;  4BPM A;  4JKV A;  3S9O A;  1YZC A;  4CS9 A;  4EIY A;  1NU9 C;  5L0C A;  1M2V A;  2NSF A;  3B9Q A;  2J45 A;  3RYL A;  4BG0 A;  2YLG A;  2PF4 E;  3G50 A;  1WGW A;  1ZHZ A;  1WOL A;  2J7P A;  4JTD B;  4EBJ A;  4XLP F;  2A68 F;  4JCZ A;  5AC4 A;  1FMW A;  1S7Z A;  2R7W A;  2YKZ A;  3MYF A;  3W8H A;  4CJO A;  4K1O A;  3UGP A;  2YL1 A;  3ECS A;  5DS4 A;  2HKV A;  2LIG A;  5GPG B;  5JT4 A;  1JPJ A;  3OA1 A;  2KK1 A;  4MVS A;  1E86 A;  2CGE A;  3GAN A;  2L7A A;  2A6H F;  4JEB A;  2A0U A;  5IY5 C;  3NMJ A;  2R7O A;  4IGG A;  2EIM C;  4QI0 A;  4PJN A;  2ZXP A;  5B1B C;  3PHF 2;  2HS5 A;  1SMY F;  2JPU A;  2YRF A;  3R7C A;  4XTK A;  4GQH A;  1RKE B;  3W4Y A;  1RXQ A;  4DRH B;  5K0I A;  3IQT A;  1YYX A;  4PJJ A;  1U6H A;  1YZA A;  1YA7 O;  2PFD A;  4MTF A;  2Q9B A;  3CQZ A;  2R7S A;  4Z9I A;  2EIK C;  1KU2 A;  3FXH A;  4MVZ A;  2Y39 A;  4U5H A;  1CGO A;  3GEI A;  2LCH A;  3HTK C;  4EHP A;  5T3W A;  3KYI A;  2Q00 A;  2OEX A;  3UR3 C;  4KC9 A;  1U0B B;  3TJ6 A;  1D0X A;  2HZ8 A;  1FTS A;  2C04 A;  1O3U A;  3DMD A;  5FCL A;  3JT1 A;  2QNL A;  1D0Y A;  1ORJ A;  5L0F A;  2CYD A;  3ZG1 A;  3DE8 A;  2IXO A;  2L6F A;  3NYJ A;  2WVO A;  3GWN A;  1YLM A;  1TR2 A;  2XLD A;  1HE1 A;  4X0R A;  1E84 A;  4WAB A;  4JRZ A;  5JP7 A;  4BJ5 C;  2WB7 A;  3KPH A;  4NTA A;  1Y4C A;  3SXK A;  3MBG A;  4O6M A;  1G4W R;  1T6I A;  5JSL A;  3RFY A;  4JE9 A;  4XQ1 A;  1FR0 A;  3DXJ F;  3O55 A;  4OD4 A;  2XS8 A;  4N6C A;  4OIO F;  1MMG A;  4AL0 A;  5E3A A;  1YJG A;  4AL1 A;  4YT5 A;  4YT4 A;  4XPY A;  2ZXW C;  1ZHT A;  2H7B A;  2CW0 F;  3FAJ A;  4J30 B;  3US6 A;  3W2W A;  2Y3D A;  2UUI A;  3FHD A;  3LJB A;  3LES A;  1ZVZ A;  2OG2 A;  1JRA A;  3UNG C;  1WAT A;  3EQL F;  2XRH A;  3ZSU A;  3AG4 C;  3EZH A;  2H7O A;  3KMI A;  4D4N A;  3FAP B;  2GA0 A;  3NYM A;  5D91 A;  2XLO A;  4QI2 A;  2Y3H A;  3A11 A;  3SXZ A;  3QW0 A;  3L34 A;  5COG A;  1ZW2 A;  4NTB A;  1LI7 A;  4WGY A;  3QW1 A;  3DI5 A;  4C3E A;  2DI3 A;  2KC3 A;  1GM5 A;  4FAP B;  3OEO A;  4CS8 C;  1MMN A;  2D4U A;  1OW8 A;  5DQT A;  1LI5 A;  3DWW A;  2LSE A;  4EBB A;  3POV A;  3VRC A;  1Z63 A;  2LFD A;  3U8P A;  2FGY A;  3O6X A;  3LEO A;  1A41 A;  3EZI A;  4E7S A;  1QPU A;  5KYW B;  1RMV A;  2EIJ C;  3V7O A;  1JMW A;  1YDI A;  4YN0 B;  1I4Z A;  3QMK A;  4YK5 A;  1Q0D A;  1VB5 A;  3C7J A;  4U5B E;  2R03 A;  1C03 A;  3S29 A;  4CS7 A;  2A6E F;  2YL3 A;  5KYY B;  2F22 A;  3E70 C;  4IB4 A;  2X0C A;  2HV7 A;  1I5N A;  1Y6D A;  3RQF A;  5L0H A;  1A7D A;  4CDY A;  1OR3 A;  3RVZ A;  4U5D E;  5KYU B;  1Q0G A;  4NQF A;  3VYW A;  4QDL A;  3SEO A;  2G62 A;  1Q0F A;  3KKB A;  2L81 A;  3NMK A;  2NSG A;  1B68 A;  4U5C E;  3GEH A;  2HMZ A;  1HE9 A;  1OXK A;  2D5R B;  1A7V A;  3AGU A;  3JYH A;  3K6B A;  5HV9 A;  1T01 A;  2NUT A;  2IM8 A;  1BR2 A;  4O7G A;  1LS1 A;  3TD7 A;  1SYQ A;  3U2M A;  3BRJ A;  1C02 A;  4BJ6 C;  4O6Y A;  4C7O A;  3U8V A;  4MVR A;  1NLX A;  2G3K A;  2QY9 A;  2VCB A;  1NG1 A;  4J7Y A;  1K05 A;  2QUP A;  3T6G B;  2LFF A;  3EGD B;  3ZTM A;  4CDV A;  1JR8 A;  1TWC A;  1YYJ A;  2JD3 A;  2BL2 A;  2O9X A;  3MYI A;  3NRH A;  1VYK A;  4PK4 A;  3T6J A;  3NMI A;  1TWH A;  1T6Q A;  3EFO A;  1CGN A;  4MQ9 F;  4CBE A;  2VAS A;  4PAC A;  4U5F E;  2P1A A;  4JZA A;  4CSA C;  3FVY A;  3O39 A;  5DQZ A;  4EKW A;  1RJ9 A;  3IEE A;  1SF8 A;  2EPO A;  2Q9A A;  1OW6 A;  2X51 A;  2ZD9 A;  4BJT A;  2J9V A;  4HE8 D;  4IAR A;  2AU5 A;  4PJM A;  1FFH A;  2R7Q A;  4I3M A;  4KNW A;  4E17 A;  4ZLC A;  1OW7 A;  1LVK A;  2H7V C;  4AE4 A;  5AC5 A;  5L0J A;  5BUO A;  2XXA B;  3GEE A;  1ZHW A;  3TJ5 A;  3MLG A;  1V55 C;  2I15 A;  5E2Q A;  4Q5S F;  1IZM A;  4N6H A;  1KNY A;  2XL8 A;  5L0G A;  4YT8 A;  2NPU A;  4LDK A;  4CS8 A;  3AG1 C;  5L3Q A;  4MW3 A;  3SP1 A;  4RBN A;  5A6J A;  1LE2 A;  4JVS A;  2LD6 A;  2XSE A;  1Z7Q c;  4I44 A;  3LS0 A;  3EG9 A;  4JCH A;  5B3I A;  1XWJ A;  2J7P D;  2Q4F A;  1F1M A;  4JTA B;  1NBB A;  2HJ3 A;  2MWQ A;  3JYY A;  3ASN C;  2WZL A;  4KBL A;  1BR4 A;  1O5H A;  2HSQ A;  3JRT A;  4O79 A;  1LIH A;  4EWC A;  5CIV A;  4CIP A;  1T5O A;  1FAP B;  1NFO A;  1VLT A;  3IQ6 A;  3TOL A;  3WG7 C;  4HFF B;  3EHN A;  3H65 A;  1W2W A;  2JX0 A;  4K7B A;  3X2Q C;  5JLI A;  4UDV A;  1QLE C;  5E33 A;  3DM9 B;  2GDC A;  2KW3 C;  4MS2 A;  4W8P A;  2A0B A;  2KYH A;  2NUP A;  1R4T A;  3CAX A;  3E9V A;  3GOD A;  1H9G A;  4FWV A;  1M57 C;  1TWG A;  4LER A;  2GWW A;  4IAQ A;  1T9K A;  3LLI A;  4MW8 A;  1VK5 A;  4WJ0 A;  3SXM A;  2L6G A;  5COM A;  4MND A;  4FES A;  3JCU Q;  4JJF A;  1TKN A;  2EPM X;  4PFP A;  3T9O A;  2LP4 A;  1QKR A;  3M1C B;  3GM2 A;  3U9M A;  2OOC A;  4HFK B;  3TQO A;  3S27 A;  1OKK A;  2CNW D;  2Y69 C;  4JTC B;  4MTG A;  4BJ6 A;  2GFH A;  4OIR F;  3V5Y A;  2KQ9 A;  1Q0M A;  3C62 A;  4U5E E;  1K40 A;  1H7I A;  1HY5 A;  4G7O F;  1D1C A;  4JUR I;  3RIP A;  3ZDL A;  4LLC A;  3AG2 C;  1LKX A;  4CJG A;  2P61 A;  4LLE A;  3AQB A;  2RD9 A;  3GOR A;  4P6I C;  2EIN C;  2M4E A;  1M2V B;  2QTV A;  1BBH A;  2ICW G;  1QVX A;  1ORY A;  3M15 A;  3QTH A;  4Z9H A;  3RVY A;  5T3T A;  3VAY A;  1ZHY A;  1G5Z A;  2J9U A;  3U0C A;  4CSA A;  3LEV A;  5CI8 A;  2V3C C;  2R7V A;  3JTL O;  2FFH A;  1CPQ A;  4XEK A;  2GAQ A;  1TFO B;  5E3C A;  2XLW A;  3ASO C;  3C8Z A;  2I8B A;  2OKU A;  2IXM A;  4LDQ A;  2TMV P;  2R02 A;  5T1D B;  2CDQ A;  3LUT B;  2YVK A;  4IJJ A;  2ASR A;  3DAG A;  3C8G D;  1V54 C;  1PD0 A;  2HMQ A;  2IYL D;  3T6B A;  4DVZ A;  2YLD A;  3Q6M A;  2E87 A;  2LQG A;  4A2N B;  3MFN A;  2OEV A;  1RKC A;  3DJN B;  4CS9 C;  5BQH A;  2VB6 A;  3GM1 A;  4AK9 A;  1BZ4 A;  1R5I D;  1D1B A;  1SR2 A;  2LK4 A;  4O6N A;  5DVW A;  3RQG A;  2G3V A;  3VF0 A;  1N1C A;  3DM5 A;  3FDQ A;  1L3P A;  1Q0K A;  2AVK A;  4ULV A;  1OCO C;  1PD1 A;  4NC3 A;  4MVM A;  3CZ6 A;  1K04 A;  3L8I A;  4MVO A;  1QZX A;  4KI2 A;  3GWL A;  3L8J A;  3NKD A;  5KYX B;  3RF3 A;  1T6U A;  1J8M F;  3R2P A;  3U2L A;  2P0N A;  5D92 A;  5JVE A;  2WVN A;  3NYL A;  2YZS A;  4WGZ A;  3QVZ A;  2Y3B A;  2V26 A;  2QLA A;  1LS4 A;  1VYI A;  2KGO A;  2YHS A;  1NZE A;  2XLV A;  1MNE A;  1VOM A;  2RSE B;  4U9E A;  3H2V A;  3N0T A;  4LDR A;  1FNT c;  1FFT C;  1GS9 A;  3S0X A;  4PJL A;  1U89 A;  3K1I C;  1LM3 B;  2MYS A;  3RQE A;  3NDB B;  1FMV A;  3HLZ A;  3TUL A;  2OU6 A;  3ITF A;  2ETS A;  1MQV A;  4YL0 A;  4ANJ A;  2UUH A;  4ONS A;  1PCX A;  2VH3 A;  4P9T A;  1RKE A;  5EK0 A;  1I4Y A;  2DGJ A;  4BJ5 A;  1E2X A;  3EGX B;  2YQY A;  1AVO B;  2MHR A;  3C8G B;  4DBQ A;  5A6A A;  1A7E A;  2OQM A;  5A6B A;  1VMA A;  3JZ0 A;  4L6R A;  1MMD A;  3EPV A;  4F4B A;  2PX3 A;  3ATP A;  2WVQ A;  5F5H A;  2R7T A;  5HSW A;  3Q7G A;  3HNJ A;  2PNO A;  2J9B A;  2J0W A;  4E0H A;  4DRI B;  3S84 A;  1HMD A;  1YVI A;  4C3B A;  3Q6N A;  1WTY A;  4E0I A;  3DD7 A;  3G4Z A;  3FMS A;  1ST6 A;  2EIL C;  2XM0 A;  1HW2 A;  3S28 A;  3NKE A;  4N4W A;  1LE4 A;  3A9C A;  1M2O A;  2PBE A;  2W4B A;  3SYN A;  3FOO A;  2HV6 A;  2EPN A;  4OIP F;  3Q7L A;  3AOU A;  2DYR C;  2NG1 A;  1MMA A;  2YLI A;  1EQ1 A;  2HJM A;  3V5Z A;  1VTM P;  2KSF A;  3DJU B;  2W45 A;  3UGO A;  1KTM A;  4JEA A;  4JW1 A;  2AWY A;  4C3D A;  5A6K A;  3G4X A;  2J0X A;  3KL4 A;  5F28 E;  3SXY A;  1XZP A;  4A4A A;  2WZF A;  3LLK A;  4G7Z F; 
#chains in the Genus database with same CATH homology
 1T6I A;  1Q0F A;  1T6U A;  3G50 A;  4NCQ A;  3G4Z A;  3G4X A;  1T6Q A;  1Q0G A;  1Q0M A;  1Q0K A;  1Q0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...