1T6QA

Nickel superoxide dismutase (nisod) cn-treated apo structure
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
110
structure length
110
Chain Sequence
GVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQRAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKAMSAAKGSKDPATGQKALDYIAQIDKIFWETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nickel superoxide dismutase structure and mechanism.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Ni]
total genus 48
structure length 110
sequence length 110
chains with identical sequence B, C
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1t6qA00
4NCQA 3G4XA 1T6UA 3G50A 1Q0MA 1T6QA 1T6IA 3G4ZA 1Q0GA 1Q0DA 1Q0KA 1Q0FA
chains in the Genus database with same CATH superfamily
1IZMA 3G4XA 3EFOB 3O10A 3EZHA 2A6EF 2A69F 1OKKD 1Y4CA 3KKBA 2ZPAA 3M1CB 4FWVA 1R5ID 1NG1A 1YAUO 3S28A 4CDVA 3RQFA 2GWWA 4U9EA 1NBBA 4XEVA 2Q3TA 5A6BA 1YARO 1H6GA 5F5FA 1F1MA 2YRFA 4JJFA 2OQMA 3T9OA 2ETSA 2EPOA 3DM9B 5A6AA 4GQHA 3U9MA 3JRMO 4MTFA 5DS4A 1EA8A 5HV9A 3W8HA 4LDRA 3ABKC 1CGNA 4JTAB 2R7OA 5JT4A 2QE9A 1BDJB 1BR1A 2J9BA 3ZSUA 2R7SA 4J32B 3K1IA 2OEVA 4N6HA 4B6IA 5A6KA 1OQCA 1RKEA 2YL7A 2A68F 4O6YA 5JUAA 2EPMX 4F4BA 2Q4FA 1ZHZA 4CSAC 2R7QA 2YQYA 3HLZA 4K1OA 3LLKA 2WZFA 2HV6A 1V4AA 3K33A 3GORA 1OKKA 5E2QA 3TOMA 1I5NA 1ZU4A 3K6BA 4K0DA 3SP1A 3U3FA 4H54A 4A2NB 3JYYA 2F22A 2RD9A 3L1MA 3DD7A 3W2VA 3ZWIA 1YJGA 1WWPA 2C03A 2IXNA 1OXKA 4JIOA 4CS8C 2ZXPA 2GDCA 1M6TA 2EILC 2YL1A 3JTLO 4XTKA 4CSAA 3RKOF 1ZZPA 4R32A 2AVKA 2Y3BA 1D0YA 1VB5A 2HSBA 4IARA 4BJ1A 3DE9A 3QW0A 2G62A 2XL6A 1ORJA 1L7CA 4YK5A 4DJ9A 4OD5A 2CNWA 3ASNC 3R2PA 5KYYB 5L3VA 4Q4ZF 3FOOA 4IJJA 4KNVA 3QTHA 3S9OA 1TWAA 2AWYA 2XS1A 4HFKB 5JP7A 2XLWA 4UDVA 1QQ3A 2WVQA 1T6UA 4X0RA 1MMDA 1XZPA 5F28E 2EIJC 3POVA 2L9JA 4U5HA 3Q6NA 5DVWA 5AC4A 5COGA 5L0JA 1BR4A 2XS8A 3QMKA 1D0XA 3WHNA 4DVYP 3UGOA 1QPUA 2A1DD 3A9CA 1A7DA 2AWCA 3IQTA 4IGGA 4J7YA 5DQTA 3GANA 1AEPA 3HNIA 3AG3C 5BUOA 3DAGA 1FNTc 3B71A 3KL4A 2OOCA 4NCQA 4P6IC 5KYUA 4E7ZA 2PX3A 3IPMO 3M79A 1YYJA 4L6RA 4MS2A 1VLTA 1BZ4A 1MMGA 4C3EA 3L8IA 4RDAA 4ULVA 1I4ZA 5JVEA 1LE2A 3B0VC 4U5DE 1ZHWA 3GM2A 1WATA 3FHDA 4AL1A 3NYLA 3TOLA 4C3BA 1DOVA 4PACA 1WASA 3C7JA 3H2VA 2EPKX 2XRHA 1VTMP 2JPUA 3ABLC 2XLMA 3NYMA 1WTYA 1ZW3A 4GYTA 3K1HA 2QY9A 4JEAA 2DB4A 2G3KA 1OR2A 5KYWA 4HE8D 2IOQA 2RSEB 2GA0A 5DQZA 2NSFA 3DI5A 1NFNA 1QSPA 2KNHA 4XPYA 1D1AA 1MQVA 3ZVRA 4DRIB 4FAPB 5A6BD 2KSFA 5JLIA 1ZU5A 3I5PA 1S7ZA 1MMNA 2DI3A 4NC3A 1O3UA 1H9TA 2XLDA 3OEOA 2Y69C 3AGUA 5HSWA 3RH3A 2O9XA 4CS9A 4XPWA 4D4NA 2OKUA 5L0HA 2LCHA 3DKAA 3LS0A 2HKVA 1YDIA 3TULA 1PV3A 1NSGB 2IXMA 4J30B 1OR3A 2IBFA 4G78A 4BJ6A 1FR0A 2BC5A 3KYIA 4WABA 1PD1A 1V55C 1VYIA 1LS1A 5T1DB 3T6BA 3AQBA 5L0GA 2EIMC 5KYXB 2EPNA 2LD6A 4O6NA 5BQIA 2L81A 4C7OB 4YWQA 2J7PD 3OWTA 4YT4A 1RCPA 3TK0A 1KTMA 3IHUA 2CGEA 4DOZA 1CGOA 1CPQA 4ANJA 5CIVA 1H7IA 2OEXA 4DRJB 3QW1A 1RKCA 2UUHA 4JRZA 4C3DA 2BL2A 2XLEA 3ZDLA 4CIHA 3EQLF 3GM3A 4MVMA 3RW0A 2H7BA 3UR3C 4BJ6C 3PCVA 5COMA 3LUTB 3HKKA 3C8ZA 5EGYA 3MX3A 3DAFA 2XLHA 3M4BA 4OIOF 3WG7C 3K7DA 2VCCA 2WVOA 3AG2C 3ATPA 2Z15A 3T6GB 3B29A 1JPNA 2CDQA 2J45A 1RJ9A 2R25A 3NRHA 2R02A 3U8VA 1YA7O 2M64A 3WAQA 5BQHA 2LIGA 1I4YA 4JZAA 1WOLA 3FOPA 3ITFA 4YT8A 5CI9A 2VH3A 3GWLA 3NKDA 4U5BE 3DXJF 4RD9A 1LI7A 3ZTZA 2XSEA 3QZCA 3WODF 1OW8A 3Q6MA 3EGDB 3SXMA 3C8GD 2H7VC 1B68A 2CNWD 3PMRA 1OW6A 2MYSA 3UGPA 4MTGA 1HY5A 1ZHTA 5FCLA 4G7ZF 2R9RB 3EG9A 3Q7GA 2ZXRA 3CQZA 1EQ1A 3DJUB 3FXHA 3GEHA 1Q0DA 4GEHA 3RVYA 2YLIA 1QKRA 2HSQA 3M15A 1J8MF 3X2QC 2QTVA 4G7HF 4O7GA 4BG0A 1Z63A 1G4WR 4E0HA 4PJLA 3VM6A 4LERA 2LSEA 1M57C 3A11A 2R03A 2C04A 2PX0A 4N4WA 4EBKA 2J46A 3SEOA 3F46A 4K7BA 4I3MA 3CZ6A 3BRJA 2OJQA 4AX2A 1GM5A 4MNDA 5BQGA 3U9JA 3VYWA 3BEHA 3ZC4A 2PNOA 2HMZA 1YZAA 4BPMA 2D5RB 3SZRA 5L3QA 2QLAA 1BR2A 3O6XA 1RMVA 1SZIA 1O87A 1WGWA 2NUPA 3TD7A 2I15A 1T9KA 3JSEO 2HJ3A 4IAOA 5IY5C 1EKYA 3NYJA 1GS9A 4XEFA 3EGXB 4U5EE 3GODA 2J8WA 1XZQA 4MVQA 1QVXA 3NMJA 4MVOA 2IYLD 3DM5A 4I1MA 3F47A 2NPUA 4IB4A 1LPEA 1PD0A 1W2WA 3E9VA 4DBQA 3L8JA 2ZXWC 2FGYA 3B9QA 1NFOA 4MVSA 2J7PA 3QVYA 1ZYRF 3LEVA 5L0FA 5A69A 5EK0A 4OD4A 4IAQA 4U9DA 1OCOC 2B0HA 3EHMA 2I8BA 4XLNF 2EIKC 2FFHA 3LLIA 3HNJA 1Z6AA 3LNRA 4MVUA 4MW8A 4CJGA 3ZQYA 4U5CE 3W2WA 1HE9A 1Z5ZA 3S29A 1G4US 2IXPA 3ZQVA 3DE8A 2W45A 4Z9JA 2YL3A 3IQ5A 4CDAA 2DYSC 5L0CA 2R05A 2CCYA 5E3CA 1ZHYA 5JS5A 1WN0A 2R7WA 1Q0GA 1D0ZA 5TJ5E 3EPVA 1K40A 3O39A 4EBBA 3S0XA 3B0UX 1Z23A 4AE4A 5AGFA 1C03A 3C62A 2PF4E 1HE1A 1GGQA 2WZGA 4BEMJ 4QI2A 1OCZC 4Z9IA 1YZCA 1BBHA 5DS6A 2YL0A 2YWAA 4JW1A 4WGYA 3VF0A 2XLVA 3DMDA 3FAJA 3N24A 3ZIBA 3S90A 4A4AA 4O6MA 2X0CA 4OIQF 2PBEA 2W9YA 4OINF 5E3AA 3R7CA 4CDYA 2KYHA 2LQGA 2V26A 4Z9HA 3EZIA 2DGJA 2QNLA 5A6JA 3EJNA 4DBRA 1KU2A 2R7XA 1O5HA 2YLDA 3DJNB 3MYIA 4CIPA 5DS5A 3QVZA 1TFKB 1EI7A 2P61A 3MBGA 4PJJA 3C8GB 4JCHA 5B3IA 1D1BA 1A7VA 4NTAA 2M4EA 1KNYA 2P0NA 3LESA 1OXBA 1E85A 1JR8A 4IWBA 4EHPA 2YKZA 4BJ5A 2JD3A 2YHSA 1H9GA 2WB7A 4YL3A 3FAPB 4PJNA 3RF3A 2PP4A 1TWHA 3KPHA 1SMYF 1VLSA 4U5FE 3LS1A 2LP4A 1YYXA 3JYHA 2OCCC 4JVSA 4ONSA 2HUJA 1LI5A 2LFDA 4PFOA 2CYDA 1FMVA 1Z7Qc 2J0WA 2H8AA 2L6FA 3LNMB 3SXZA 3HTKC 1ZVZA 2NUTA 2W4MA 4PFPA 5L0DA 1LIHA 2HZ8A 2KK1A 3AG4C 4KC9A 3RVZA 1NU9C 1MNDA 3GEIA 4MVRA 4PK4A 2XXAA 3N0TA 3SNHA 3RFYA 1ORYA 2V3CC 2OJED 4HEAJ 4EUKB 1C17M 1M2VB 2J9WA 1C02A 2A0BA 2W4BA 4AK9A 3AJMA 4YT2A 1R4TA 2R7VA 2G3VA 1FMWA 3G50A 4WJ0A 3VAYA 4JC7A 5L0IA 3ABMC 1MNEA 5KYXA 2PFDA 1JOGA 3EFOA 3MFNA 4NTFA 4D4XA 2MHRA 2KQ9A 1T01A 2OG2A 2CW0F 2TMVP 2R7UA 2DYRC 1MMAA 3H2UA 4EWCA 1OCRC 4LLCA 4DXWA 2KGOA 3U2MA 1OW7A 3KYJA 3S84A 5DLJA 3LJBA 3GEEA 1S05A 3O55A 1Q0MA 4DRHB 3FVYA 5AC5A 3AOUA 4LDKA 1HMDA 4M63A 2VB6A 1YVIA 3ASOC 5B3SC 2AU5A 2NG1A 2YVKA 2KC3A 4IRUA 4XWJA 5COFA 4E18A 1RKEB 1JRAA 3JCUQ 2MWQA 3HNLA 4EIYA 4E7SA 1RJ9B 1Q0KA 1AVOB 2A0UA 3NMKA 3V5YA 4PJMA 1A41A 1ZHXA 4CS9C 4MQ9F 1L3PA 4G0HA 3V5ZA 2WL8A 1UG7A 1UFBA 4ZLDA 2HV7A 2J9UA 2Y3HA 2R7RA 3K1IC 2WVNA 1E2XA 2HS5A 3CEXA 4BJ5C 4JKVA 2P6VA 2Q00A 3I5QA 3ZG1A 2NSGA 2ZD9A 4I1OB 3ZTMA 1VOMA 4CBEA 2FAPB 3EG9B 1N1CA 4MTOA 3MLGA 1DOWA 2R7TA 1A7EA 1ST6A 1VK5A 5JSLA 4XQ1A 5EHHA 5JRAA 1RXQA 4NQFA 4Q7CA 4XEKA 2B0JA 1Q0FA 4W8KA 3UMIA 5KYYA 1TR2A 3U0CA 2XL4A 1GQAA 1SF8A 1LE4A 4YJWA 1HW2A 2HJMA 3JZ0A 2AP3A 3J06A 4LLEA 2YLGA 1TFOB 1YLMA 1Z3IX 2OU6A 4OIRF 4LACB 3TQOA 2A6HF 2Q9CA 3HJCA 3M4CA 4N06A 5E33A 1SR2A 4NTBA 3PHF2 3X1OA 1CPRA 3UMHA 1TKNA 4I44A 4JTDB 2Y3GA 1TWCA 3ECSA 3RIPA 2J9VA 4LDQA 2L7AA 2YZSA 4JCZA 1JMWA 2NUPB 1Y6DA 4E17A 4NY3A 2KW3C 5KYUB 3RQEA 3K66A 3EGXA 4KNWA 4WGZA 1JPJA 3AQCA 2D4UA 3S27A 4KBLA 4QI0A 4RBNA 2IXOA 5KYNA 1E83A 3V5XA 1JAFA 1V74B 2GFHA 4YL0A 5F5HA 3NKEA 1U0BB 1NZEA 3U2LA 3IQCA 2X51A 3LEOA 4W8PA 3TJ6A 1J8YF 3VRCA 4CS7A 2LFFA 3NMIA 1G5ZA 1K04A 1VMAA 1LM3B 2Q7RA 3US6A 2Y3DA 4PR9A 5D92A 2XM4A 3G4ZA 5KYWB 2HMQA 4P9FA 1FAPB 4U5GA 1E84A 3L34A 3RQGA 4H4KC 3UNGC 3EH1A 4FX5A 1APCA 1TWGA 1D1CA 4E0IA 1CGME 4FESA 3EH2A 2ICWG 2VCBA 5K0IA 3CSKA 2ZXOA 1M56C 3T4RA 3JT1A 1M2OA 2YEVA 1HMOA 1OCCC 2L6GA 1QZXA 3B0PA 1NLXA 4AE4B 2VC9A 3HNKA 4OIPF 4EBJA 2QUPA 3DZAA 4Q5SF 1A0BA 4YN0B 3NDBB 3W4YA 4CS8A 3AGTA 1FFTC 3EHNA 5D91A 3U3BA 1LVKA 3V7OA 2KJGA 1K05A 4HFFB 3MYFA 4XPXA 2JX0A 5B1BC 256BA 4C7OA 3C63A 1YA9A 2L6HA 3N2ZB 2HFIA 4JJGA 3W8IA 2LK4A 4P9TA 5T3WA 2BE5F 3PDMP 1T5OA 2Y39A 1T6QA 3IEEA 4EKWA 1QLEC 2EINC 4BEJA 3T6JA 4JE9A 1XWJA 1U89A 4BJTA 2ASRA 2Q9AA 3AG1C 4YL1A 1TQGA 1PCXA 1ZW2A 3C8GA 4JTCB 2GAQA 3GM1A 4MW3A 3I4UA 4AL0A 1E86A 2XM0A 1SYQA 4ZLCA 1ORSC 4KI2A 1LKXA 3FDQA 2J0XA 4CX9A 2Q9BA 2WZLA 1HW1A 3FMSA 5T3TA 3U8PA 1AUEA 2H7OA 2UUIA 4YT5A 1NU7D 3KMIA 3LAYA 3SYNA 1FTSA 2E87A 2P1AA 1IW7F 1T6IA 3NG1A 1FFHA 2VCAA 1V54C 3H65A 3SXYA 2P7VA 3C18A 3CAXA 3EGDA 3OA1A 4J7TA 3TJ5A 3GWNA 5CI8A 4DVZA 4JEBA 2IM8A 2VASA 3KH2A 4JURI 1G8XA 4O79A 2XL8A 4QDLA 2NUTB 3SXKA 2XLOA 4ER9A 4XLPF 1U6HA 5B1AC 3L0IA 4MVZA 2XXAB 3RYLA 3E70C 2EPLX 3JRTA 3U5SA 4ULWA 3IQ6A 4G7OF 1LS4A 3JSZA 3Q7LA 4N6CA 1M2VA 3DWWA 4CJOA 5FZTA 1VYKA 5GPGB 3UMKA
chains in the Genus database with same CATH topology
4NCQA 3G4XA 1T6UA 3G50A 1Q0MA 1T6QA 1T6IA 3G4ZA 1Q0GA 1Q0DA 1Q0KA 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCQ A;  3G4X A;  1T6U A;  3G50 A;  1Q0M A;  1T6Q A;  1T6I A;  3G4Z A;  1Q0G A;  1Q0D A;  1Q0K A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 1IZM A;  3G4X A;  3EFO B;  3O10 A;  3EZH A;  2A6E F;  2A69 F;  1OKK D;  1Y4C A;  3KKB A;  2ZPA A;  3M1C B;  4FWV A;  1R5I D;  1NG1 A;  1YAU O;  3S28 A;  4CDV A;  3RQF A;  2GWW A;  4U9E A;  1NBB A;  4XEV A;  2Q3T A;  5A6B A;  1YAR O;  1H6G A;  5F5F A;  1F1M A;  2YRF A;  4JJF A;  2OQM A;  3T9O A;  2ETS A;  2EPO A;  3DM9 B;  5A6A A;  4GQH A;  3U9M A;  3JRM O;  4MTF A;  5DS4 A;  1EA8 A;  5HV9 A;  3W8H A;  4LDR A;  3ABK C;  1CGN A;  4JTA B;  2R7O A;  5JT4 A;  2QE9 A;  1BDJ B;  1BR1 A;  2J9B A;  3ZSU A;  2R7S A;  4J32 B;  3K1I A;  2OEV A;  4N6H A;  4B6I A;  5A6K A;  1OQC A;  1RKE A;  2YL7 A;  2A68 F;  4O6Y A;  5JUA A;  2EPM X;  4F4B A;  2Q4F A;  1ZHZ A;  4CSA C;  2R7Q A;  2YQY A;  3HLZ A;  4K1O A;  3LLK A;  2WZF A;  2HV6 A;  1V4A A;  3K33 A;  3GOR A;  1OKK A;  5E2Q A;  3TOM A;  1I5N A;  1ZU4 A;  3K6B A;  4K0D A;  3SP1 A;  3U3F A;  4H54 A;  4A2N B;  3JYY A;  2F22 A;  2RD9 A;  3L1M A;  3DD7 A;  3W2V A;  3ZWI A;  1YJG A;  1WWP A;  2C03 A;  2IXN A;  1OXK A;  4JIO A;  4CS8 C;  2ZXP A;  2GDC A;  1M6T A;  2EIL C;  2YL1 A;  3JTL O;  4XTK A;  4CSA A;  3RKO F;  1ZZP A;  4R32 A;  2AVK A;  2Y3B A;  1D0Y A;  1VB5 A;  2HSB A;  4IAR A;  4BJ1 A;  3DE9 A;  3QW0 A;  2G62 A;  2XL6 A;  1ORJ A;  1L7C A;  4YK5 A;  4DJ9 A;  4OD5 A;  2CNW A;  3ASN C;  3R2P A;  5KYY B;  5L3V A;  4Q4Z F;  3FOO A;  4IJJ A;  4KNV A;  3QTH A;  3S9O A;  1TWA A;  2AWY A;  2XS1 A;  4HFK B;  5JP7 A;  2XLW A;  4UDV A;  1QQ3 A;  2WVQ A;  1T6U A;  4X0R A;  1MMD A;  1XZP A;  5F28 E;  2EIJ C;  3POV A;  2L9J A;  4U5H A;  3Q6N A;  5DVW A;  5AC4 A;  5COG A;  5L0J A;  1BR4 A;  2XS8 A;  3QMK A;  1D0X A;  3WHN A;  4DVY P;  3UGO A;  1QPU A;  2A1D D;  3A9C A;  1A7D A;  2AWC A;  3IQT A;  4IGG A;  4J7Y A;  5DQT A;  3GAN A;  1AEP A;  3HNI A;  3AG3 C;  5BUO A;  3DAG A;  1FNT c;  3B71 A;  3KL4 A;  2OOC A;  4NCQ A;  4P6I C;  5KYU A;  4E7Z A;  2PX3 A;  3IPM O;  3M79 A;  1YYJ A;  4L6R A;  4MS2 A;  1VLT A;  1BZ4 A;  1MMG A;  4C3E A;  3L8I A;  4RDA A;  4ULV A;  1I4Z A;  5JVE A;  1LE2 A;  3B0V C;  4U5D E;  1ZHW A;  3GM2 A;  1WAT A;  3FHD A;  4AL1 A;  3NYL A;  3TOL A;  4C3B A;  1DOV A;  4PAC A;  1WAS A;  3C7J A;  3H2V A;  2EPK X;  2XRH A;  1VTM P;  2JPU A;  3ABL C;  2XLM A;  3NYM A;  1WTY A;  1ZW3 A;  4GYT A;  3K1H A;  2QY9 A;  4JEA A;  2DB4 A;  2G3K A;  1OR2 A;  5KYW A;  4HE8 D;  2IOQ A;  2RSE B;  2GA0 A;  5DQZ A;  2NSF A;  3DI5 A;  1NFN A;  1QSP A;  2KNH A;  4XPY A;  1D1A A;  1MQV A;  3ZVR A;  4DRI B;  4FAP B;  5A6B D;  2KSF A;  5JLI A;  1ZU5 A;  3I5P A;  1S7Z A;  1MMN A;  2DI3 A;  4NC3 A;  1O3U A;  1H9T A;  2XLD A;  3OEO A;  2Y69 C;  3AGU A;  5HSW A;  3RH3 A;  2O9X A;  4CS9 A;  4XPW A;  4D4N A;  2OKU A;  5L0H A;  2LCH A;  3DKA A;  3LS0 A;  2HKV A;  1YDI A;  3TUL A;  1PV3 A;  1NSG B;  2IXM A;  4J30 B;  1OR3 A;  2IBF A;  4G78 A;  4BJ6 A;  1FR0 A;  2BC5 A;  3KYI A;  4WAB A;  1PD1 A;  1V55 C;  1VYI A;  1LS1 A;  5T1D B;  3T6B A;  3AQB A;  5L0G A;  2EIM C;  5KYX B;  2EPN A;  2LD6 A;  4O6N A;  5BQI A;  2L81 A;  4C7O B;  4YWQ A;  2J7P D;  3OWT A;  4YT4 A;  1RCP A;  3TK0 A;  1KTM A;  3IHU A;  2CGE A;  4DOZ A;  1CGO A;  1CPQ A;  4ANJ A;  5CIV A;  1H7I A;  2OEX A;  4DRJ B;  3QW1 A;  1RKC A;  2UUH A;  4JRZ A;  4C3D A;  2BL2 A;  2XLE A;  3ZDL A;  4CIH A;  3EQL F;  3GM3 A;  4MVM A;  3RW0 A;  2H7B A;  3UR3 C;  4BJ6 C;  3PCV A;  5COM A;  3LUT B;  3HKK A;  3C8Z A;  5EGY A;  3MX3 A;  3DAF A;  2XLH A;  3M4B A;  4OIO F;  3WG7 C;  3K7D A;  2VCC A;  2WVO A;  3AG2 C;  3ATP A;  2Z15 A;  3T6G B;  3B29 A;  1JPN A;  2CDQ A;  2J45 A;  1RJ9 A;  2R25 A;  3NRH A;  2R02 A;  3U8V A;  1YA7 O;  2M64 A;  3WAQ A;  5BQH A;  2LIG A;  1I4Y A;  4JZA A;  1WOL A;  3FOP A;  3ITF A;  4YT8 A;  5CI9 A;  2VH3 A;  3GWL A;  3NKD A;  4U5B E;  3DXJ F;  4RD9 A;  1LI7 A;  3ZTZ A;  2XSE A;  3QZC A;  3WOD F;  1OW8 A;  3Q6M A;  3EGD B;  3SXM A;  3C8G D;  2H7V C;  1B68 A;  2CNW D;  3PMR A;  1OW6 A;  2MYS A;  3UGP A;  4MTG A;  1HY5 A;  1ZHT A;  5FCL A;  4G7Z F;  2R9R B;  3EG9 A;  3Q7G A;  2ZXR A;  3CQZ A;  1EQ1 A;  3DJU B;  3FXH A;  3GEH A;  1Q0D A;  4GEH A;  3RVY A;  2YLI A;  1QKR A;  2HSQ A;  3M15 A;  1J8M F;  3X2Q C;  2QTV A;  4G7H F;  4O7G A;  4BG0 A;  1Z63 A;  1G4W R;  4E0H A;  4PJL A;  3VM6 A;  4LER A;  2LSE A;  1M57 C;  3A11 A;  2R03 A;  2C04 A;  2PX0 A;  4N4W A;  4EBK A;  2J46 A;  3SEO A;  3F46 A;  4K7B A;  4I3M A;  3CZ6 A;  3BRJ A;  2OJQ A;  4AX2 A;  1GM5 A;  4MND A;  5BQG A;  3U9J A;  3VYW A;  3BEH A;  3ZC4 A;  2PNO A;  2HMZ A;  1YZA A;  4BPM A;  2D5R B;  3SZR A;  5L3Q A;  2QLA A;  1BR2 A;  3O6X A;  1RMV A;  1SZI A;  1O87 A;  1WGW A;  2NUP A;  3TD7 A;  2I15 A;  1T9K A;  3JSE O;  2HJ3 A;  4IAO A;  5IY5 C;  1EKY A;  3NYJ A;  1GS9 A;  4XEF A;  3EGX B;  4U5E E;  3GOD A;  2J8W A;  1XZQ A;  4MVQ A;  1QVX A;  3NMJ A;  4MVO A;  2IYL D;  3DM5 A;  4I1M A;  3F47 A;  2NPU A;  4IB4 A;  1LPE A;  1PD0 A;  1W2W A;  3E9V A;  4DBQ A;  3L8J A;  2ZXW C;  2FGY A;  3B9Q A;  1NFO A;  4MVS A;  2J7P A;  3QVY A;  1ZYR F;  3LEV A;  5L0F A;  5A69 A;  5EK0 A;  4OD4 A;  4IAQ A;  4U9D A;  1OCO C;  2B0H A;  3EHM A;  2I8B A;  4XLN F;  2EIK C;  2FFH A;  3LLI A;  3HNJ A;  1Z6A A;  3LNR A;  4MVU A;  4MW8 A;  4CJG A;  3ZQY A;  4U5C E;  3W2W A;  1HE9 A;  1Z5Z A;  3S29 A;  1G4U S;  2IXP A;  3ZQV A;  3DE8 A;  2W45 A;  4Z9J A;  2YL3 A;  3IQ5 A;  4CDA A;  2DYS C;  5L0C A;  2R05 A;  2CCY A;  5E3C A;  1ZHY A;  5JS5 A;  1WN0 A;  2R7W A;  1Q0G A;  1D0Z A;  5TJ5 E;  3EPV A;  1K40 A;  3O39 A;  4EBB A;  3S0X A;  3B0U X;  1Z23 A;  4AE4 A;  5AGF A;  1C03 A;  3C62 A;  2PF4 E;  1HE1 A;  1GGQ A;  2WZG A;  4BEM J;  4QI2 A;  1OCZ C;  4Z9I A;  1YZC A;  1BBH A;  5DS6 A;  2YL0 A;  2YWA A;  4JW1 A;  4WGY A;  3VF0 A;  2XLV A;  3DMD A;  3FAJ A;  3N24 A;  3ZIB A;  3S90 A;  4A4A A;  4O6M A;  2X0C A;  4OIQ F;  2PBE A;  2W9Y A;  4OIN F;  5E3A A;  3R7C A;  4CDY A;  2KYH A;  2LQG A;  2V26 A;  4Z9H A;  3EZI A;  2DGJ A;  2QNL A;  5A6J A;  3EJN A;  4DBR A;  1KU2 A;  2R7X A;  1O5H A;  2YLD A;  3DJN B;  3MYI A;  4CIP A;  5DS5 A;  3QVZ A;  1TFK B;  1EI7 A;  2P61 A;  3MBG A;  4PJJ A;  3C8G B;  4JCH A;  5B3I A;  1D1B A;  1A7V A;  4NTA A;  2M4E A;  1KNY A;  2P0N A;  3LES A;  1OXB A;  1E85 A;  1JR8 A;  4IWB A;  4EHP A;  2YKZ A;  4BJ5 A;  2JD3 A;  2YHS A;  1H9G A;  2WB7 A;  4YL3 A;  3FAP B;  4PJN A;  3RF3 A;  2PP4 A;  1TWH A;  3KPH A;  1SMY F;  1VLS A;  4U5F E;  3LS1 A;  2LP4 A;  1YYX A;  3JYH A;  2OCC C;  4JVS A;  4ONS A;  2HUJ A;  1LI5 A;  2LFD A;  4PFO A;  2CYD A;  1FMV A;  1Z7Q c;  2J0W A;  2H8A A;  2L6F A;  3LNM B;  3SXZ A;  3HTK C;  1ZVZ A;  2NUT A;  2W4M A;  4PFP A;  5L0D A;  1LIH A;  2HZ8 A;  2KK1 A;  3AG4 C;  4KC9 A;  3RVZ A;  1NU9 C;  1MND A;  3GEI A;  4MVR A;  4PK4 A;  2XXA A;  3N0T A;  3SNH A;  3RFY A;  1ORY A;  2V3C C;  2OJE D;  4HEA J;  4EUK B;  1C17 M;  1M2V B;  2J9W A;  1C02 A;  2A0B A;  2W4B A;  4AK9 A;  3AJM A;  4YT2 A;  1R4T A;  2R7V A;  2G3V A;  1FMW A;  3G50 A;  4WJ0 A;  3VAY A;  4JC7 A;  5L0I A;  3ABM C;  1MNE A;  5KYX A;  2PFD A;  1JOG A;  3EFO A;  3MFN A;  4NTF A;  4D4X A;  2MHR A;  2KQ9 A;  1T01 A;  2OG2 A;  2CW0 F;  2TMV P;  2R7U A;  2DYR C;  1MMA A;  3H2U A;  4EWC A;  1OCR C;  4LLC A;  4DXW A;  2KGO A;  3U2M A;  1OW7 A;  3KYJ A;  3S84 A;  5DLJ A;  3LJB A;  3GEE A;  1S05 A;  3O55 A;  1Q0M A;  4DRH B;  3FVY A;  5AC5 A;  3AOU A;  4LDK A;  1HMD A;  4M63 A;  2VB6 A;  1YVI A;  3ASO C;  5B3S C;  2AU5 A;  2NG1 A;  2YVK A;  2KC3 A;  4IRU A;  4XWJ A;  5COF A;  4E18 A;  1RKE B;  1JRA A;  3JCU Q;  2MWQ A;  3HNL A;  4EIY A;  4E7S A;  1RJ9 B;  1Q0K A;  1AVO B;  2A0U A;  3NMK A;  3V5Y A;  4PJM A;  1A41 A;  1ZHX A;  4CS9 C;  4MQ9 F;  1L3P A;  4G0H A;  3V5Z A;  2WL8 A;  1UG7 A;  1UFB A;  4ZLD A;  2HV7 A;  2J9U A;  2Y3H A;  2R7R A;  3K1I C;  2WVN A;  1E2X A;  2HS5 A;  3CEX A;  4BJ5 C;  4JKV A;  2P6V A;  2Q00 A;  3I5Q A;  3ZG1 A;  2NSG A;  2ZD9 A;  4I1O B;  3ZTM A;  1VOM A;  4CBE A;  2FAP B;  3EG9 B;  1N1C A;  4MTO A;  3MLG A;  1DOW A;  2R7T A;  1A7E A;  1ST6 A;  1VK5 A;  5JSL A;  4XQ1 A;  5EHH A;  5JRA A;  1RXQ A;  4NQF A;  4Q7C A;  4XEK A;  2B0J A;  1Q0F A;  4W8K A;  3UMI A;  5KYY A;  1TR2 A;  3U0C A;  2XL4 A;  1GQA A;  1SF8 A;  1LE4 A;  4YJW A;  1HW2 A;  2HJM A;  3JZ0 A;  2AP3 A;  3J06 A;  4LLE A;  2YLG A;  1TFO B;  1YLM A;  1Z3I X;  2OU6 A;  4OIR F;  4LAC B;  3TQO A;  2A6H F;  2Q9C A;  3HJC A;  3M4C A;  4N06 A;  5E33 A;  1SR2 A;  4NTB A;  3PHF 2;  3X1O A;  1CPR A;  3UMH A;  1TKN A;  4I44 A;  4JTD B;  2Y3G A;  1TWC A;  3ECS A;  3RIP A;  2J9V A;  4LDQ A;  2L7A A;  2YZS A;  4JCZ A;  1JMW A;  2NUP B;  1Y6D A;  4E17 A;  4NY3 A;  2KW3 C;  5KYU B;  3RQE A;  3K66 A;  3EGX A;  4KNW A;  4WGZ A;  1JPJ A;  3AQC A;  2D4U A;  3S27 A;  4KBL A;  4QI0 A;  4RBN A;  2IXO A;  5KYN A;  1E83 A;  3V5X A;  1JAF A;  1V74 B;  2GFH A;  4YL0 A;  5F5H A;  3NKE A;  1U0B B;  1NZE A;  3U2L A;  3IQC A;  2X51 A;  3LEO A;  4W8P A;  3TJ6 A;  1J8Y F;  3VRC A;  4CS7 A;  2LFF A;  3NMI A;  1G5Z A;  1K04 A;  1VMA A;  1LM3 B;  2Q7R A;  3US6 A;  2Y3D A;  4PR9 A;  5D92 A;  2XM4 A;  3G4Z A;  5KYW B;  2HMQ A;  4P9F A;  1FAP B;  4U5G A;  1E84 A;  3L34 A;  3RQG A;  4H4K C;  3UNG C;  3EH1 A;  4FX5 A;  1APC A;  1TWG A;  1D1C A;  4E0I A;  1CGM E;  4FES A;  3EH2 A;  2ICW G;  2VCB A;  5K0I A;  3CSK A;  2ZXO A;  1M56 C;  3T4R A;  3JT1 A;  1M2O A;  2YEV A;  1HMO A;  1OCC C;  2L6G A;  1QZX A;  3B0P A;  1NLX A;  4AE4 B;  2VC9 A;  3HNK A;  4OIP F;  4EBJ A;  2QUP A;  3DZA A;  4Q5S F;  1A0B A;  4YN0 B;  3NDB B;  3W4Y A;  4CS8 A;  3AGT A;  1FFT C;  3EHN A;  5D91 A;  3U3B A;  1LVK A;  3V7O A;  2KJG A;  1K05 A;  4HFF B;  3MYF A;  4XPX A;  2JX0 A;  5B1B C;  256B A;  4C7O A;  3C63 A;  1YA9 A;  2L6H A;  3N2Z B;  2HFI A;  4JJG A;  3W8I A;  2LK4 A;  4P9T A;  5T3W A;  2BE5 F;  3PDM P;  1T5O A;  2Y39 A;  1T6Q A;  3IEE A;  4EKW A;  1QLE C;  2EIN C;  4BEJ A;  3T6J A;  4JE9 A;  1XWJ A;  1U89 A;  4BJT A;  2ASR A;  2Q9A A;  3AG1 C;  4YL1 A;  1TQG A;  1PCX A;  1ZW2 A;  3C8G A;  4JTC B;  2GAQ A;  3GM1 A;  4MW3 A;  3I4U A;  4AL0 A;  1E86 A;  2XM0 A;  1SYQ A;  4ZLC A;  1ORS C;  4KI2 A;  1LKX A;  3FDQ A;  2J0X A;  4CX9 A;  2Q9B A;  2WZL A;  1HW1 A;  3FMS A;  5T3T A;  3U8P A;  1AUE A;  2H7O A;  2UUI A;  4YT5 A;  1NU7 D;  3KMI A;  3LAY A;  3SYN A;  1FTS A;  2E87 A;  2P1A A;  1IW7 F;  1T6I A;  3NG1 A;  1FFH A;  2VCA A;  1V54 C;  3H65 A;  3SXY A;  2P7V A;  3C18 A;  3CAX A;  3EGD A;  3OA1 A;  4J7T A;  3TJ5 A;  3GWN A;  5CI8 A;  4DVZ A;  4JEB A;  2IM8 A;  2VAS A;  3KH2 A;  4JUR I;  1G8X A;  4O79 A;  2XL8 A;  4QDL A;  2NUT B;  3SXK A;  2XLO A;  4ER9 A;  4XLP F;  1U6H A;  5B1A C;  3L0I A;  4MVZ A;  2XXA B;  3RYL A;  3E70 C;  2EPL X;  3JRT A;  3U5S A;  4ULW A;  3IQ6 A;  4G7O F;  1LS4 A;  3JSZ A;  3Q7L A;  4N6C A;  1M2V A;  3DWW A;  4CJO A;  5FZT A;  1VYK A;  5GPG B;  3UMK A; 
#chains in the Genus database with same CATH homology
 4NCQ A;  3G4X A;  1T6U A;  3G50 A;  1Q0M A;  1T6Q A;  1T6I A;  3G4Z A;  1Q0G A;  1Q0D A;  1Q0K A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...