1BZ4A

Apolipoprotein e3 (apo-e3), truncation mutant 165
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 64
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1bz4A00
1NFNA 1OR2A 2KC3A 1GS9A 1EA8A 1YA9A 1BZ4A 1NFOA 1LE4A 1OR3A 1LE2A 3R2PA 1H7IA 1LS4A 1EQ1A 1B68A 3S84A 1AEPA 1LPEA
chains in the Genus database with same CATH superfamily
3T4RA 4U9EA 4AE4B 3K33A 2J9WA 2LD6A 4HFFB 4I1OB 5L3VA 1GM5A 4Q5SF 2WZLA 5A6AA 2AVKA 2MHRA 2OU6A 2Q00A 3VF0A 2QNLA 3W2VA 3IPMO 3LS0A 3T6JA 1C02A 3X1OA 1ZHTA 4LDQA 2V3CC 4JJGA 2R7XA 1M57C 2J9BA 5HSWA 1PD1A 2HMQA 2X51A 3R7CA 1G4WR 1SR2A 2JPUA 1E2XA 3DAFA 3JCUQ 3EH2A 1LKXA 2VCAA 4EBKA 4PR9A 1VOMA 3VM6A 1NBBA 5A6JA 3LESA 5E33A 1VYKA 4EKWA 4XLPF 2D4UA 2H8AA 3HJCA 1W2WA 3GM1A 2LK4A 3H65A 2XLVA 2YEVA 4DOZA 4P9TA 4C7OB 1OQCA 3DZAA 5JS5A 4K0DA 2YLIA 2C04A 1O3UA 2R7VA 2H7VC 5JT4A 2YLDA 5F28E 4DRIB 2XM4A 2DYRC 2VC9A 1Z3IX 4KNWA 1EA8A 2KQ9A 4IAQA 3IQCA 2XRHA 1FMWA 3UGOA 4O7GA 5GPGB 3ZDLA 2LFFA 4MVMA 3ZC4A 1YZAA 2OJQA 2XXAA 3O55A 3ZQYA 2OEXA 3QW0A 1A0BA 1I4ZA 2ZXWC 4UDVA 4JTDB 1Z23A 1R4TA 3FAJA 1MNEA 1LM3B 1YJGA 1O87A 2A1DD 5L3QA 4I3MA 4Q7CA 1Z63A 2WVOA 2B0JA 4E7SA 4J32B 1A7VA 1WOLA 3I5PA 2GFHA 2J7PA 3K7DA 3KMIA 5HV9A 2XXAB 4JIOA 1NZEA 3EG9A 2JD3A 1CPRA 4BG0A 2A68F 4JTAB 1OKKA 1M2VB 4U5HA 1M6TA 4PJLA 1ZZPA 3PCVA 1OKKD 3CEXA 3N24A 1A7EA 1Q0DA 3AG1C 2TMVP 4G7OF 4WGZA 3NYLA 4GQHA 2Q3TA 1MNDA 5KYYA 4L6RA 4OIPF 4M63A 1T01A 3GORA 3SP1A 3Q6MA 3FOOA 4ULWA 3EG9B 3ZG1A 5JRAA 1APCA 3R2PA 4CS7A 1AVOB 4O6NA 4GEHA 2Y3HA 2EPKX 2YL7A 2MYSA 3CSKA 3OA1A 4MVOA 4EHPA 1YARO 3POVA 5E3CA 2YWAA 4FWVA 4DVZA 2R7TA 2IXNA 3EZIA 4MVUA 3C18A 3GANA 2R02A 3KKBA 3N2ZB 3WHNA 1DOWA 3SXYA 1V4AA 4XTKA 4YL0A 1EI7A 1U6HA 3NMJA 5DVWA 1A7DA 5KYXA 3DM9B 3B29A 1D0YA 2WZFA 4IRUA 4JURI 1H9TA 1WN0A 3EHMA 1S7ZA 3SXMA 1TWGA 2GA0A 4YT2A 1YZCA 5BQIA 2A0BA 3DE8A 3PHF2 5EGYA 3PMRA 3JYHA 4ER9A 4QDLA 2WZGA 2R25A 1J8MF 1WTYA 1TWAA 1YA7O 2CNWD 1RJ9A 3NMIA 2R7OA 1XZQA 4OD4A 1SZIA 5KYXB 3SEOA 3HLZA 3BEHA 4OIOF 2HMZA 2EPOA 4Z9JA 1CGNA 2LP4A 1IW7F 1HY5A 1LS4A 2OKUA 3EQLF 3OWTA 4H54A 2QUPA 4IGGA 4MNDA 5DS4A 3ECSA 2OQMA 1OXKA 2W4MA 4BEMJ 3UMKA 1VB5A 4MVRA 3SXZA 4E0IA 1VK5A 1C03A 1QQ3A 3NRHA 2KW3C 2KYHA 3UNGC 3FMSA 3HTKC 5L0HA 2RSEB 2BC5A 3E70C 4PK4A 5AGFA 5F5FA 5DQTA 1DOVA 1LVKA 2R7UA 4BEJA 3L8JA 2E87A 2CW0F 3LAYA 4N06A 2L6FA 3KH2A 4MTFA 3U8VA 1ST6A 4CX9A 3EGXA 1PV3A 1VYIA 2Z15A 4YT5A 3ZIBA 3I5QA 4D4XA 3EFOB 4W8KA 1MMGA 2I8BA 3KL4A 3WG7C 4AE4A 3ATPA 2LSEA 2R7RA 3RVYA 4B6IA 4XPWA 1NU7D 5B1BC 4HEAJ 2AWCA 3PDMP 4PJNA 5A6BA 2DI3A 2J46A 3RYLA 3EGXB 2CGEA 3LLKA 3CZ6A 3DD7A 5B3IA 3EZHA 2Q9CA 3DM5A 1ZHWA 3AQCA 4IARA 5L0CA 3U3FA 2RD9A 1E84A 2KJGA 2IXMA 3LEOA 2IOQA 2J8WA 3AG2C 3TJ6A 3ASOC 1Z5ZA 4DBQA 4EIYA 2EIJC 1RKEB 2BL2A 1LE4A 4WGYA 4C7OA 2LCHA 4DRJB 1LE2A 3O10A 2XL4A 5KYNA 3G4XA 1SF8A 4EWCA 3NKEA 4CJOA 1MQVA 2W9YA 3EHNA 1FMVA 4LLEA 2EPLX 2YLGA 3RH3A 2GWWA 3S27A 3VRCA 1B68A 3NKDA 5DS6A 2Y3DA 5D92A 1TWHA 3IQTA 4XPYA 3DI5A 1A41A 3JYYA 3NYJA 1JR8A 4AL0A 3A11A 1KTMA 4MS2A 5JVEA 2F22A 1ZW3A 4JKVA 1ZYRF 2DGJA 4NY3A 5DS5A 1BR1A 4OIQF 3BRJA 2XS8A 5JUAA 1T5OA 3U2MA 4QI0A 2J45A 3CAXA 1JPNA 2G62A 3B71A 2HZ8A 4XEKA 3RW0A 4MVQA 2A6HF 2OCCC 3UMIA 1BR4A 2HSBA 3K1HA 5EHHA 4CSAC 1OR3A 4E0HA 2M64A 2BE5F 4IB4A 3LS1A 4AX2A 2HJ3A 1CGOA 2R03A 1M2VA 3EH1A 2XS1A 3LNRA 1KNYA 5CIVA 2Y69C 1CGME 5EK0A 3RIPA 1ORYA 2NG1A 3HKKA 1WWPA 3KYIA 4BJ1A 2A69F 2L6GA 4Z9IA 1G4US 3V5XA 1C17M 2OJED 1RMVA 1YAUO 3J06A 1D1CA 2MWQA 3U8PA 4DVYP 4G7ZF 3DE9A 1MMDA 1WASA 3GM2A 3ABMC 4AL1A 1M2OA 1I4YA 3GWLA 3SYNA 2R05A 2XLDA 3UR3C 4MW3A 2PP4A 5BQGA 2L81A 1GQAA 2YZSA 4W8PA 4WJ0A 1NFOA 3C62A 3MYFA 1I5NA 4JCZA 2XM0A 4K1OA 2KK1A 4AK9A 3QZCA 5CI9A 3JSEO 1H7IA 2HKVA 1F1MA 1Q0MA 1Q0FA 3GWNA 4BJ5A 3W2WA 1WATA 1T6QA 1K05A 2XLMA 4JE9A 1M56C 4WABA 2NSFA 1FR0A 3U0CA 4DXWA 3TOLA 3FDQA 3U9JA 1JRAA 1ZHXA 4MVSA 3QW1A 5TJ5E 4NQFA 1NFNA 1U89A 3FXHA 2P0NA 4C3EA 4NTBA 4A4AA 3AGTA 1GGQA 3GEEA 1RCPA 2DYSC 3V5YA 5K0IA 4NCQA 4A2NB 5F5HA 4JW1A 4OD5A 2A6EF 1YYJA 3SXKA 2HV7A 4EUKB 3O39A 1FFTC 2ZXOA 3V5ZA 4PACA 3NDBB 2CNWA 5D91A 4CS9C 4LDKA 3RVZA 4PFOA 4FESA 3G4ZA 2XSEA 1G8XA 3RFYA 2A0UA 1H6GA 3VAYA 4XWJA 3WODF 1FAPB 3T6GB 1V55C 4CJGA 4E17A 2YL3A 2L9JA 1VLSA 2XLHA 3EGDB 1HW1A 2CDQA 2FGYA 3M79A 2IXPA 3U5SA 4DJ9A 3RF3A 2LFDA 4JC7A 3FAPB 1O5HA 3MBGA 4H4KC 3B0VC 3RKOF 3EFOA 4E18A 4JVSA 4U5GA 2H7OA 3RQGA 3OEOA 2G3VA 2ETSA 4RD9A 2YL0A 2J9VA 2Q9BA 2M4EA 1NSGB 1QVXA 3UMHA 4YN0B 4ZLCA 2Y3BA 2O9XA 2HUJA 3TOMA 5L0JA 4CS8A 1QPUA 3NMKA 3DJNB 2C03A 1LIHA 2Q9AA 4CIHA 1QSPA 3MYIA 1QLEC 3JRMO 3T6BA 2LIGA 1YLMA 5T3TA 3L8IA 2JX0A 2NUTA 1QZXA 2V26A 4KI2A 3AJMA 3B9QA 4LDRA 2PBEA 4N6HA 1ZVZA 3EJNA 2PNOA 3NYMA 4YWQA 1RKEA 4CSAA 4F4BA 1AUEA 2IBFA 3AG4C 2PX0A 2IXOA 5FCLA 2ASRA 3AG3C 4HE8D 1NLXA 1JOGA 1HMDA 1OR2A 1S05A 2KC3A 2W4BA 5CI8A 3UGPA 1GS9A 3S29A 2R7WA 2AP3A 2NUTB 1PD0A 2VCBA 1BR2A 3DAGA 1TFKB 3LEVA 5BQHA 1YA9A 4JJFA 2L6HA 3C8GD 4NTAA 1WGWA 2QY9A 1LS1A 1OCRC 4YK5A 4BJ5C 3SNHA 2Q4FA 2NPUA 4U5CE 1RXQA 2P7VA 4D4NA 5BUOA 4CS9A 2NSGA 3QMKA 2EPMX 2PFDA 3C8GB 1FNTc 3M15A 1UFBA 3AOUA 3KYJA 4IAOA 3L0IA 5COMA 3VYWA 3QVYA 5FZTA 5L0FA 1ORJA 2KNHA 5IY5C 1AEPA 3NG1A 5AC4A 2WL8A 4JEBA 5KYWA 2ICWG 2W45A 3T9OA 4LLCA 2AU5A 2L7AA 2XLWA 3L34A 1T6UA 2HV6A 1OCCC 2P61A 2WVQA 3M4BA 4G0HA 1TR2A 1BZ4A 4PJJA 3MFNA 4JEAA 1D1BA 4U5FE 1HMOA 3DWWA 4N6CA 5L0IA 2J0XA 3JSZA 1YVIA 1L3PA 1Z7Qc 5KYWB 1Q0GA 3GM3A 4KNVA 2UUIA 4R32A 2EPNA 2XL6A 1H9GA 1ZW2A 2HJMA 2ZXPA 4U5BE 4CIPA 3IHUA 3F46A 4XPXA 1Q0KA 4QI2A 2YQYA 1V54C 1TWCA 3E9VA 2QLAA 3G50A 4C3BA 3RQFA 2Q7RA 3DJUB 3MLGA 256BA 2P1AA 3Q7GA 2QE9A 3AQBA 3HNIA 4YL1A 4CDYA 4CDAA 1LPEA 2I15A 3JRTA 4IJJA 2XLEA 3TQOA 1E86A 1UG7A 4MVZA 1Z6AA 1OW7A 3ITFA 1XZPA 3K66A 2EINC 2R7QA 2QTVA 1OCZC 3TULA 3QTHA 4DBRA 3I4UA 4CS8C 2IYLD 1ZHYA 1JMWA 1HE1A 2ZPAA 2J0WA 3K6BA 4Q4ZF 2VCCA 4P9FA 3GEHA 3HNLA 3K1IC 4KBLA 4O79A 3ASNC 4YJWA 1OCOC 3S9OA 4BJ6A 1ORSC 3Q7LA 1MMAA 3QVZA 1NU9C 2R7SA 2G3KA 2GDCA 2YRFA 1XWJA 3A9CA 1HE9A 1LI5A 3O6XA 2HS5A 4MQ9F 4ONSA 5JSLA 3TJ5A 3JT1A 2VH3A 2YVKA 4U5EE 3B0UX 4C3DA 4XEVA 5A6KA 2OOCA 3TK0A 3ZQVA 1LI7A 4YT8A 4RDAA 1K04A 4EBBA 5KYUA 1BDJB 4XEFA 3ZSUA 1V74B 1Y6DA 2J7PD 3H2VA 5COGA 3V7OA 3N0TA 4FAPB 3ABKC 1K40A 3IEEA 1IZMA 5T3WA 1D1AA 1JAFA 3JTLO 1FFHA 4I44A 1D0ZA 1HW2A 2FFHA 2OG2A 1E83A 3F47A 3EGDA 1YDIA 1U0BB 5DLJA 2P6VA 3C63A 4KC9A 1PCXA 2EIKC 5E3AA 5KYUB 4I1MA 1ZHZA 3TD7A 3W8HA 1OW6A 2Y39A 5DQZA 4IWBA 1T9KA 4ULVA 3LUTB 1QKRA 1SMYF 1EQ1A 2YL1A 3LLIA 4PFPA 3GODA 4NTFA 4J30B 5JLIA 1D0XA 1BBHA 4YT4A 3S90A 4N4WA 4OIRF 4CBEA 5KYYB 3HNKA 4P6IC 2ZD9A 3RQEA 3CQZA 3C7JA 4U9DA 2YKZA 3JZ0A 1NG1A 3LJBA 5E2QA 5L0GA 2VASA 3ABLC 3FOPA 2X0CA 1VLTA 2WVNA 4Z9HA 2R9RB 1KU2A 2HSQA 2OEVA 3S28A 3S0XA 3W4YA 1J8YF 4OINF 2UUHA 1FTSA 2GAQA 5B1AC 4JCHA 3X2QC 4X0RA 1G5ZA 2VB6A 3B0PA 3IQ5A 3W8IA 1RKCA 1VTMP 3DKAA 1SYQA 1T6IA 2EILC 3GEIA 2Y3GA 4FX5A 1R5ID 3WAQA 1E85A 4O6MA 4XQ1A 4K7BA 4XLNF 3C8ZA 3K1IA 2ZXRA 3L1MA 4O6YA 3U2LA 2XLOA 4LERA 2NUPA 4ANJA 3FHDA 3ZWIA 4J7TA 1N1CA 4EBJA 3AGUA 1TKNA 4MW8A 4DRHB 2J9UA 1RJ9B 3LNMB 4LACB 5T1DB 3US6A 4ZLDA 2PX3A 3Q6NA 2KGOA 2YHSA 3MX3A 5AC5A 3M4CA 2PF4E 4BPMA 2IM8A 5L0DA 2NUPB 3DMDA 3M1CB 3C8GA 4RBNA 3SZRA 3H2UA 3HNJA 1TFOB 2AWYA 2KSFA 4BJ6C 4G7HF 4JRZA 2D5RB 2WB7A 2XL8A 5JP7A 1MMNA 1OXBA 3DXJF 3IQ6A 4U5DE 3U9MA 3ZTZA 1Y4CA 2B0HA 4J7YA 2H7BA 4JTCB 4YL3A 1VMAA 4PJMA 3ZTMA 2LQGA 5B3SC 1YYXA 3EPVA 4E7ZA 3KPHA 4GYTA 4NC3A 4HFKB 1TQGA 4BJTA 2DB4A 4MTOA 1CPQA 3FVYA 5COFA 1ZU4A 3ZVRA 2FAPB 1OW8A 4G78A 3S84A 3U3BA 2CCYA 2CYDA 2EIMC 4CDVA 1L7CA 1ZU5A 5A69A 4JZAA 5A6BD 2HFIA 1EKYA 4MTGA 1JPJA
chains in the Genus database with same CATH topology
1NFNA 1OR2A 2KC3A 1GS9A 1EA8A 1YA9A 1BZ4A 1NFOA 1LE4A 1OR3A 1LE2A 3R2PA 1H7IA 1LS4A 1EQ1A 1B68A 3S84A 1AEPA 1LPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFN A;  1OR2 A;  2KC3 A;  1GS9 A;  1EA8 A;  1YA9 A;  1BZ4 A;  1NFO A;  1LE4 A;  1OR3 A;  1LE2 A;  3R2P A;  1H7I A;  1LS4 A;  1EQ1 A;  1B68 A;  3S84 A;  1AEP A;  1LPE A; 
#chains in the Genus database with same CATH topology
 3T4R A;  4U9E A;  4AE4 B;  3K33 A;  2J9W A;  2LD6 A;  4HFF B;  4I1O B;  5L3V A;  1GM5 A;  4Q5S F;  2WZL A;  5A6A A;  2AVK A;  2MHR A;  2OU6 A;  2Q00 A;  3VF0 A;  2QNL A;  3W2V A;  3IPM O;  3LS0 A;  3T6J A;  1C02 A;  3X1O A;  1ZHT A;  4LDQ A;  2V3C C;  4JJG A;  2R7X A;  1M57 C;  2J9B A;  5HSW A;  1PD1 A;  2HMQ A;  2X51 A;  3R7C A;  1G4W R;  1SR2 A;  2JPU A;  1E2X A;  3DAF A;  3JCU Q;  3EH2 A;  1LKX A;  2VCA A;  4EBK A;  4PR9 A;  1VOM A;  3VM6 A;  1NBB A;  5A6J A;  3LES A;  5E33 A;  1VYK A;  4EKW A;  4XLP F;  2D4U A;  2H8A A;  3HJC A;  1W2W A;  3GM1 A;  2LK4 A;  3H65 A;  2XLV A;  2YEV A;  4DOZ A;  4P9T A;  4C7O B;  1OQC A;  3DZA A;  5JS5 A;  4K0D A;  2YLI A;  2C04 A;  1O3U A;  2R7V A;  2H7V C;  5JT4 A;  2YLD A;  5F28 E;  4DRI B;  2XM4 A;  2DYR C;  2VC9 A;  1Z3I X;  4KNW A;  1EA8 A;  2KQ9 A;  4IAQ A;  3IQC A;  2XRH A;  1FMW A;  3UGO A;  4O7G A;  5GPG B;  3ZDL A;  2LFF A;  4MVM A;  3ZC4 A;  1YZA A;  2OJQ A;  2XXA A;  3O55 A;  3ZQY A;  2OEX A;  3QW0 A;  1A0B A;  1I4Z A;  2ZXW C;  4UDV A;  4JTD B;  1Z23 A;  1R4T A;  3FAJ A;  1MNE A;  1LM3 B;  1YJG A;  1O87 A;  2A1D D;  5L3Q A;  4I3M A;  4Q7C A;  1Z63 A;  2WVO A;  2B0J A;  4E7S A;  4J32 B;  1A7V A;  1WOL A;  3I5P A;  2GFH A;  2J7P A;  3K7D A;  3KMI A;  5HV9 A;  2XXA B;  4JIO A;  1NZE A;  3EG9 A;  2JD3 A;  1CPR A;  4BG0 A;  2A68 F;  4JTA B;  1OKK A;  1M2V B;  4U5H A;  1M6T A;  4PJL A;  1ZZP A;  3PCV A;  1OKK D;  3CEX A;  3N24 A;  1A7E A;  1Q0D A;  3AG1 C;  2TMV P;  4G7O F;  4WGZ A;  3NYL A;  4GQH A;  2Q3T A;  1MND A;  5KYY A;  4L6R A;  4OIP F;  4M63 A;  1T01 A;  3GOR A;  3SP1 A;  3Q6M A;  3FOO A;  4ULW A;  3EG9 B;  3ZG1 A;  5JRA A;  1APC A;  3R2P A;  4CS7 A;  1AVO B;  4O6N A;  4GEH A;  2Y3H A;  2EPK X;  2YL7 A;  2MYS A;  3CSK A;  3OA1 A;  4MVO A;  4EHP A;  1YAR O;  3POV A;  5E3C A;  2YWA A;  4FWV A;  4DVZ A;  2R7T A;  2IXN A;  3EZI A;  4MVU A;  3C18 A;  3GAN A;  2R02 A;  3KKB A;  3N2Z B;  3WHN A;  1DOW A;  3SXY A;  1V4A A;  4XTK A;  4YL0 A;  1EI7 A;  1U6H A;  3NMJ A;  5DVW A;  1A7D A;  5KYX A;  3DM9 B;  3B29 A;  1D0Y A;  2WZF A;  4IRU A;  4JUR I;  1H9T A;  1WN0 A;  3EHM A;  1S7Z A;  3SXM A;  1TWG A;  2GA0 A;  4YT2 A;  1YZC A;  5BQI A;  2A0B A;  3DE8 A;  3PHF 2;  5EGY A;  3PMR A;  3JYH A;  4ER9 A;  4QDL A;  2WZG A;  2R25 A;  1J8M F;  1WTY A;  1TWA A;  1YA7 O;  2CNW D;  1RJ9 A;  3NMI A;  2R7O A;  1XZQ A;  4OD4 A;  1SZI A;  5KYX B;  3SEO A;  3HLZ A;  3BEH A;  4OIO F;  2HMZ A;  2EPO A;  4Z9J A;  1CGN A;  2LP4 A;  1IW7 F;  1HY5 A;  1LS4 A;  2OKU A;  3EQL F;  3OWT A;  4H54 A;  2QUP A;  4IGG A;  4MND A;  5DS4 A;  3ECS A;  2OQM A;  1OXK A;  2W4M A;  4BEM J;  3UMK A;  1VB5 A;  4MVR A;  3SXZ A;  4E0I A;  1VK5 A;  1C03 A;  1QQ3 A;  3NRH A;  2KW3 C;  2KYH A;  3UNG C;  3FMS A;  3HTK C;  5L0H A;  2RSE B;  2BC5 A;  3E70 C;  4PK4 A;  5AGF A;  5F5F A;  5DQT A;  1DOV A;  1LVK A;  2R7U A;  4BEJ A;  3L8J A;  2E87 A;  2CW0 F;  3LAY A;  4N06 A;  2L6F A;  3KH2 A;  4MTF A;  3U8V A;  1ST6 A;  4CX9 A;  3EGX A;  1PV3 A;  1VYI A;  2Z15 A;  4YT5 A;  3ZIB A;  3I5Q A;  4D4X A;  3EFO B;  4W8K A;  1MMG A;  2I8B A;  3KL4 A;  3WG7 C;  4AE4 A;  3ATP A;  2LSE A;  2R7R A;  3RVY A;  4B6I A;  4XPW A;  1NU7 D;  5B1B C;  4HEA J;  2AWC A;  3PDM P;  4PJN A;  5A6B A;  2DI3 A;  2J46 A;  3RYL A;  3EGX B;  2CGE A;  3LLK A;  3CZ6 A;  3DD7 A;  5B3I A;  3EZH A;  2Q9C A;  3DM5 A;  1ZHW A;  3AQC A;  4IAR A;  5L0C A;  3U3F A;  2RD9 A;  1E84 A;  2KJG A;  2IXM A;  3LEO A;  2IOQ A;  2J8W A;  3AG2 C;  3TJ6 A;  3ASO C;  1Z5Z A;  4DBQ A;  4EIY A;  2EIJ C;  1RKE B;  2BL2 A;  1LE4 A;  4WGY A;  4C7O A;  2LCH A;  4DRJ B;  1LE2 A;  3O10 A;  2XL4 A;  5KYN A;  3G4X A;  1SF8 A;  4EWC A;  3NKE A;  4CJO A;  1MQV A;  2W9Y A;  3EHN A;  1FMV A;  4LLE A;  2EPL X;  2YLG A;  3RH3 A;  2GWW A;  3S27 A;  3VRC A;  1B68 A;  3NKD A;  5DS6 A;  2Y3D A;  5D92 A;  1TWH A;  3IQT A;  4XPY A;  3DI5 A;  1A41 A;  3JYY A;  3NYJ A;  1JR8 A;  4AL0 A;  3A11 A;  1KTM A;  4MS2 A;  5JVE A;  2F22 A;  1ZW3 A;  4JKV A;  1ZYR F;  2DGJ A;  4NY3 A;  5DS5 A;  1BR1 A;  4OIQ F;  3BRJ A;  2XS8 A;  5JUA A;  1T5O A;  3U2M A;  4QI0 A;  2J45 A;  3CAX A;  1JPN A;  2G62 A;  3B71 A;  2HZ8 A;  4XEK A;  3RW0 A;  4MVQ A;  2A6H F;  2OCC C;  3UMI A;  1BR4 A;  2HSB A;  3K1H A;  5EHH A;  4CSA C;  1OR3 A;  4E0H A;  2M64 A;  2BE5 F;  4IB4 A;  3LS1 A;  4AX2 A;  2HJ3 A;  1CGO A;  2R03 A;  1M2V A;  3EH1 A;  2XS1 A;  3LNR A;  1KNY A;  5CIV A;  2Y69 C;  1CGM E;  5EK0 A;  3RIP A;  1ORY A;  2NG1 A;  3HKK A;  1WWP A;  3KYI A;  4BJ1 A;  2A69 F;  2L6G A;  4Z9I A;  1G4U S;  3V5X A;  1C17 M;  2OJE D;  1RMV A;  1YAU O;  3J06 A;  1D1C A;  2MWQ A;  3U8P A;  4DVY P;  4G7Z F;  3DE9 A;  1MMD A;  1WAS A;  3GM2 A;  3ABM C;  4AL1 A;  1M2O A;  1I4Y A;  3GWL A;  3SYN A;  2R05 A;  2XLD A;  3UR3 C;  4MW3 A;  2PP4 A;  5BQG A;  2L81 A;  1GQA A;  2YZS A;  4W8P A;  4WJ0 A;  1NFO A;  3C62 A;  3MYF A;  1I5N A;  4JCZ A;  2XM0 A;  4K1O A;  2KK1 A;  4AK9 A;  3QZC A;  5CI9 A;  3JSE O;  1H7I A;  2HKV A;  1F1M A;  1Q0M A;  1Q0F A;  3GWN A;  4BJ5 A;  3W2W A;  1WAT A;  1T6Q A;  1K05 A;  2XLM A;  4JE9 A;  1M56 C;  4WAB A;  2NSF A;  1FR0 A;  3U0C A;  4DXW A;  3TOL A;  3FDQ A;  3U9J A;  1JRA A;  1ZHX A;  4MVS A;  3QW1 A;  5TJ5 E;  4NQF A;  1NFN A;  1U89 A;  3FXH A;  2P0N A;  4C3E A;  4NTB A;  4A4A A;  3AGT A;  1GGQ A;  3GEE A;  1RCP A;  2DYS C;  3V5Y A;  5K0I A;  4NCQ A;  4A2N B;  5F5H A;  4JW1 A;  4OD5 A;  2A6E F;  1YYJ A;  3SXK A;  2HV7 A;  4EUK B;  3O39 A;  1FFT C;  2ZXO A;  3V5Z A;  4PAC A;  3NDB B;  2CNW A;  5D91 A;  4CS9 C;  4LDK A;  3RVZ A;  4PFO A;  4FES A;  3G4Z A;  2XSE A;  1G8X A;  3RFY A;  2A0U A;  1H6G A;  3VAY A;  4XWJ A;  3WOD F;  1FAP B;  3T6G B;  1V55 C;  4CJG A;  4E17 A;  2YL3 A;  2L9J A;  1VLS A;  2XLH A;  3EGD B;  1HW1 A;  2CDQ A;  2FGY A;  3M79 A;  2IXP A;  3U5S A;  4DJ9 A;  3RF3 A;  2LFD A;  4JC7 A;  3FAP B;  1O5H A;  3MBG A;  4H4K C;  3B0V C;  3RKO F;  3EFO A;  4E18 A;  4JVS A;  4U5G A;  2H7O A;  3RQG A;  3OEO A;  2G3V A;  2ETS A;  4RD9 A;  2YL0 A;  2J9V A;  2Q9B A;  2M4E A;  1NSG B;  1QVX A;  3UMH A;  4YN0 B;  4ZLC A;  2Y3B A;  2O9X A;  2HUJ A;  3TOM A;  5L0J A;  4CS8 A;  1QPU A;  3NMK A;  3DJN B;  2C03 A;  1LIH A;  2Q9A A;  4CIH A;  1QSP A;  3MYI A;  1QLE C;  3JRM O;  3T6B A;  2LIG A;  1YLM A;  5T3T A;  3L8I A;  2JX0 A;  2NUT A;  1QZX A;  2V26 A;  4KI2 A;  3AJM A;  3B9Q A;  4LDR A;  2PBE A;  4N6H A;  1ZVZ A;  3EJN A;  2PNO A;  3NYM A;  4YWQ A;  1RKE A;  4CSA A;  4F4B A;  1AUE A;  2IBF A;  3AG4 C;  2PX0 A;  2IXO A;  5FCL A;  2ASR A;  3AG3 C;  4HE8 D;  1NLX A;  1JOG A;  1HMD A;  1OR2 A;  1S05 A;  2KC3 A;  2W4B A;  5CI8 A;  3UGP A;  1GS9 A;  3S29 A;  2R7W A;  2AP3 A;  2NUT B;  1PD0 A;  2VCB A;  1BR2 A;  3DAG A;  1TFK B;  3LEV A;  5BQH A;  1YA9 A;  4JJF A;  2L6H A;  3C8G D;  4NTA A;  1WGW A;  2QY9 A;  1LS1 A;  1OCR C;  4YK5 A;  4BJ5 C;  3SNH A;  2Q4F A;  2NPU A;  4U5C E;  1RXQ A;  2P7V A;  4D4N A;  5BUO A;  4CS9 A;  2NSG A;  3QMK A;  2EPM X;  2PFD A;  3C8G B;  1FNT c;  3M15 A;  1UFB A;  3AOU A;  3KYJ A;  4IAO A;  3L0I A;  5COM A;  3VYW A;  3QVY A;  5FZT A;  5L0F A;  1ORJ A;  2KNH A;  5IY5 C;  1AEP A;  3NG1 A;  5AC4 A;  2WL8 A;  4JEB A;  5KYW A;  2ICW G;  2W45 A;  3T9O A;  4LLC A;  2AU5 A;  2L7A A;  2XLW A;  3L34 A;  1T6U A;  2HV6 A;  1OCC C;  2P61 A;  2WVQ A;  3M4B A;  4G0H A;  1TR2 A;  1BZ4 A;  4PJJ A;  3MFN A;  4JEA A;  1D1B A;  4U5F E;  1HMO A;  3DWW A;  4N6C A;  5L0I A;  2J0X A;  3JSZ A;  1YVI A;  1L3P A;  1Z7Q c;  5KYW B;  1Q0G A;  3GM3 A;  4KNV A;  2UUI A;  4R32 A;  2EPN A;  2XL6 A;  1H9G A;  1ZW2 A;  2HJM A;  2ZXP A;  4U5B E;  4CIP A;  3IHU A;  3F46 A;  4XPX A;  1Q0K A;  4QI2 A;  2YQY A;  1V54 C;  1TWC A;  3E9V A;  2QLA A;  3G50 A;  4C3B A;  3RQF A;  2Q7R A;  3DJU B;  3MLG A;  256B A;  2P1A A;  3Q7G A;  2QE9 A;  3AQB A;  3HNI A;  4YL1 A;  4CDY A;  4CDA A;  1LPE A;  2I15 A;  3JRT A;  4IJJ A;  2XLE A;  3TQO A;  1E86 A;  1UG7 A;  4MVZ A;  1Z6A A;  1OW7 A;  3ITF A;  1XZP A;  3K66 A;  2EIN C;  2R7Q A;  2QTV A;  1OCZ C;  3TUL A;  3QTH A;  4DBR A;  3I4U A;  4CS8 C;  2IYL D;  1ZHY A;  1JMW A;  1HE1 A;  2ZPA A;  2J0W A;  3K6B A;  4Q4Z F;  2VCC A;  4P9F A;  3GEH A;  3HNL A;  3K1I C;  4KBL A;  4O79 A;  3ASN C;  4YJW A;  1OCO C;  3S9O A;  4BJ6 A;  1ORS C;  3Q7L A;  1MMA A;  3QVZ A;  1NU9 C;  2R7S A;  2G3K A;  2GDC A;  2YRF A;  1XWJ A;  3A9C A;  1HE9 A;  1LI5 A;  3O6X A;  2HS5 A;  4MQ9 F;  4ONS A;  5JSL A;  3TJ5 A;  3JT1 A;  2VH3 A;  2YVK A;  4U5E E;  3B0U X;  4C3D A;  4XEV A;  5A6K A;  2OOC A;  3TK0 A;  3ZQV A;  1LI7 A;  4YT8 A;  4RDA A;  1K04 A;  4EBB A;  5KYU A;  1BDJ B;  4XEF A;  3ZSU A;  1V74 B;  1Y6D A;  2J7P D;  3H2V A;  5COG A;  3V7O A;  3N0T A;  4FAP B;  3ABK C;  1K40 A;  3IEE A;  1IZM A;  5T3W A;  1D1A A;  1JAF A;  3JTL O;  1FFH A;  4I44 A;  1D0Z A;  1HW2 A;  2FFH A;  2OG2 A;  1E83 A;  3F47 A;  3EGD A;  1YDI A;  1U0B B;  5DLJ A;  2P6V A;  3C63 A;  4KC9 A;  1PCX A;  2EIK C;  5E3A A;  5KYU B;  4I1M A;  1ZHZ A;  3TD7 A;  3W8H A;  1OW6 A;  2Y39 A;  5DQZ A;  4IWB A;  1T9K A;  4ULV A;  3LUT B;  1QKR A;  1SMY F;  1EQ1 A;  2YL1 A;  3LLI A;  4PFP A;  3GOD A;  4NTF A;  4J30 B;  5JLI A;  1D0X A;  1BBH A;  4YT4 A;  3S90 A;  4N4W A;  4OIR F;  4CBE A;  5KYY B;  3HNK A;  4P6I C;  2ZD9 A;  3RQE A;  3CQZ A;  3C7J A;  4U9D A;  2YKZ A;  3JZ0 A;  1NG1 A;  3LJB A;  5E2Q A;  5L0G A;  2VAS A;  3ABL C;  3FOP A;  2X0C A;  1VLT A;  2WVN A;  4Z9H A;  2R9R B;  1KU2 A;  2HSQ A;  2OEV A;  3S28 A;  3S0X A;  3W4Y A;  1J8Y F;  4OIN F;  2UUH A;  1FTS A;  2GAQ A;  5B1A C;  4JCH A;  3X2Q C;  4X0R A;  1G5Z A;  2VB6 A;  3B0P A;  3IQ5 A;  3W8I A;  1RKC A;  1VTM P;  3DKA A;  1SYQ A;  1T6I A;  2EIL C;  3GEI A;  2Y3G A;  4FX5 A;  1R5I D;  3WAQ A;  1E85 A;  4O6M A;  4XQ1 A;  4K7B A;  4XLN F;  3C8Z A;  3K1I A;  2ZXR A;  3L1M A;  4O6Y A;  3U2L A;  2XLO A;  4LER A;  2NUP A;  4ANJ A;  3FHD A;  3ZWI A;  4J7T A;  1N1C A;  4EBJ A;  3AGU A;  1TKN A;  4MW8 A;  4DRH B;  2J9U A;  1RJ9 B;  3LNM B;  4LAC B;  5T1D B;  3US6 A;  4ZLD A;  2PX3 A;  3Q6N A;  2KGO A;  2YHS A;  3MX3 A;  5AC5 A;  3M4C A;  2PF4 E;  4BPM A;  2IM8 A;  5L0D A;  2NUP B;  3DMD A;  3M1C B;  3C8G A;  4RBN A;  3SZR A;  3H2U A;  3HNJ A;  1TFO B;  2AWY A;  2KSF A;  4BJ6 C;  4G7H F;  4JRZ A;  2D5R B;  2WB7 A;  2XL8 A;  5JP7 A;  1MMN A;  1OXB A;  3DXJ F;  3IQ6 A;  4U5D E;  3U9M A;  3ZTZ A;  1Y4C A;  2B0H A;  4J7Y A;  2H7B A;  4JTC B;  4YL3 A;  1VMA A;  4PJM A;  3ZTM A;  2LQG A;  5B3S C;  1YYX A;  3EPV A;  4E7Z A;  3KPH A;  4GYT A;  4NC3 A;  4HFK B;  1TQG A;  4BJT A;  2DB4 A;  4MTO A;  1CPQ A;  3FVY A;  5COF A;  1ZU4 A;  3ZVR A;  2FAP B;  1OW8 A;  4G78 A;  3S84 A;  3U3B A;  2CCY A;  2CYD A;  2EIM C;  4CDV A;  1L7C A;  1ZU5 A;  5A69 A;  4JZA A;  5A6B D;  2HFI A;  1EKY A;  4MTG A;  1JPJ A; 
#chains in the Genus database with same CATH homology
 1NFN A;  1OR2 A;  2KC3 A;  1GS9 A;  1EA8 A;  1YA9 A;  1BZ4 A;  1NFO A;  1LE4 A;  1OR3 A;  1LE2 A;  3R2P A;  1H7I A;  1LS4 A;  1EQ1 A;  1B68 A;  3S84 A;  1AEP A;  1LPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...