1BZ4A

Apolipoprotein e3 (apo-e3), truncation mutant 165
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 64
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1bz4A00
1B68A 1LS4A 1LE2A 1BZ4A 1NFNA 1NFOA 1GS9A 1LPEA 1OR3A 3R2PA 3S84A 1EA8A 1LE4A 1AEPA 1OR2A 1YA9A 1EQ1A 2KC3A 1H7IA
chains in the Genus database with same CATH superfamily
3SXYA 4JJFA 1TWGA 1XZPA 2LK4A 2R03A 4WGYA 3EHMA 3EFOA 4JJGA 4JTCB 1H9TA 2VH3A 3A9CA 4MVMA 5D92A 3X1OA 4AL0A 1OCZC 4BJ5A 4A4AA 5L0GA 1VTMP 2WVQA 2GDCA 2IXNA 5COMA 3NYJA 4MTGA 2BE5F 3NMJA 1T6UA 1LE4A 4IGGA 4O6MA 4DOZA 4YT5A 3UGPA 1R4TA 2VASA 2R7TA 2P0NA 1FR0A 2NSFA 5KYXB 1Q0MA 2KYHA 1M2OA 1TR2A 5EK0A 3ECSA 1RJ9B 5DQZA 1D1CA 4NTFA 1CPRA 2Z15A 2YLDA 3LLKA 4CDAA 4EHPA 2L7AA 1GM5A 3E70C 1GGQA 3RYLA 1NU7D 1LM3B 1LKXA 3SNHA 3W2WA 1BR4A 4I44A 4P6IC 2GA0A 5T3TA 1XWJA 1LS4A 1M57C 2V3CC 3AG2C 3AQBA 4P9FA 3TULA 1YLMA 2QE9A 4LLEA 1LVKA 1SR2A 3W4YA 4GQHA 2PX3A 5KYUA 2CCYA 1V54C 1ZHWA 3LESA 4LDKA 3NMKA 4YL1A 1AEPA 2ASRA 3CZ6A 4BJ6A 2YRFA 4YK5A 4YT2A 1T01A 4H4KC 5IY5C 1SZIA 1IW7F 3MLGA 2OCCC 2BL2A 2HKVA 3VF0A 2GAQA 4AL1A 3B0VC 2NUPB 3VAYA 3M1CB 2OKUA 2JX0A 1YA9A 3EG9B 4E0HA 1Y6DA 1JPNA 4UDVA 2ZD9A 4U5BE 4W8KA 5BQHA 1KU2A 5JT4A 2NSGA 2G3VA 1IZMA 3BEHA 2R7QA 1FTSA 2Q4FA 2VCCA 1O3UA 2NG1A 1HW1A 2B0JA 4IB4A 1K04A 3TK0A 2EPKX 2VB6A 1VMAA 4RD9A 3UR3C 3ZWIA 3QW0A 4WGZA 2YEVA 4A2NB 4CSAC 1LPEA 4NTAA 1NSGB 2EPNA 4RDAA 1LIHA 3SYNA 5JRAA 3S0XA 1U6HA 1HMDA 1M56C 2HFIA 5T3WA 2YHSA 3GWLA 5EHHA 4MNDA 1O5HA 2HS5A 2A1DD 3B0PA 3FHDA 4LERA 4MW8A 4PFOA 4Z9IA 3ZTZA 1Q0KA 3C8GA 1VB5A 4CIHA 3Q6NA 1VLTA 4MVZA 1APCA 1SYQA 2XM0A 1Z63A 2R25A 4DXWA 5KYWB 3GM1A 1FFHA 3NKDA 4NCQA 1WWPA 2XSEA 3O55A 5BQIA 3NYLA 2CNWD 3DAFA 1JMWA 2A0BA 4CJGA 1LE2A 2A6EF 1BZ4A 2NUTA 5KYNA 4JTDB 4C7OA 1QPUA 3B0UX 2P1AA 3US6A 1ST6A 2BC5A 1HW2A 3ZQYA 2E87A 2L81A 2PP4A 4IAQA 3DI5A 5A6BA 2H7BA 3ZIBA 3GM3A 5AC5A 4ONSA 4DRJB 3L1MA 2Y3HA 2VCAA 5COGA 5DQTA 2XL6A 1WOLA 2GFHA 4P9TA 2WL8A 4CS7A 3EFOB 4JVSA 4XEFA 4EBJA 2P61A 4N6CA 3ASNC 3K1IA 1TFOB 2H7OA 2YL0A 1DOWA 1Z23A 4CS9A 1TWHA 3O6XA 2QY9A 4IAOA 4Z9JA 2WZGA 3JYHA 1ZHXA 5KYYA 2AVKA 3NMIA 3KYIA 2HJ3A 3RH3A 3DE9A 1HY5A 4EKWA 2Q9CA 3X2QC 1T6IA 1MMNA 4PR9A 3DKAA 1ZU5A 1QLEC 2M4EA 4R32A 3CSKA 2DYSC 3TOLA 3EZHA 2R7WA 2IYLD 2A6HF 4O6YA 1O87A 1I5NA 2IXOA 2PNOA 3T6GB 3DXJF 2A0UA 4LACB 1FFTC 4EWCA 3I4UA 3LEVA 4MVUA 3WODF 1RCPA 2VC9A 3IQ6A 4HFKB 1ZYRF 3U3FA 1OW7A 1CGNA 2V26A 3C18A 3GANA 1QVXA 1NBBA 1YYJA 3QVYA 3QZCA 4D4XA 1E83A 4G7ZF 5FZTA 3ABKC 1CPQA 4MW3A 3HNJA 1HE9A 1YYXA 2KK1A 3LUTB 4XLNF 3MFNA 1YZAA 4MVOA 2EPOA 4PJLA 4EIYA 3QMKA 3AG4C 2L6HA 4J32B 4MQ9F 2J9BA 3ZTMA 5KYUB 2DGJA 1I4ZA 1OW8A 1J8YF 1VYKA 3K1HA 5A6KA 2HV7A 4DRHB 3VRCA 3Q7LA 3NKEA 2P6VA 4KNWA 4MTOA 5HSWA 4CBEA 1QQ3A 3SXMA 3H2UA 3U8PA 2C03A 3KKBA 4YN0B 2OQMA 4BPMA 3I5QA 2D4UA 4DVZA 3EGDA 2LFFA 3JZ0A 1H9GA 1GQAA 1ZHZA 1ZW3A 2DYRC 2J46A 1BR1A 1RMVA 5DS6A 4XEKA 2XLVA 3RQEA 3T9OA 2X51A 2KNHA 1ZW2A 5DS5A 2J9WA 3SXKA 3MYFA 4U5DE 4LLCA 2XS1A 4MTFA 3S9OA 2YWAA 3LJBA 3A11A 1Q0GA 4YT4A 2H8AA 4IRUA 3U9JA 1WN0A 4XWJA 4I1MA 2L6FA 1JPJA 2M64A 2WZLA 3C8GB 1UG7A 5JP7A 1RKEB 3RQGA 2Q3TA 4C3EA 2W45A 3EQLF 1RKCA 2XLDA 3JSZA 3TD7A 2EIKC 2LCHA 3DJNB 1HMOA 3M15A 1TWAA 3K1IC 2R7XA 3ZSUA 3ZDLA 1D0YA 2YVKA 3WG7C 5L0DA 1R5ID 2NUTB 3C8ZA 4CS9C 1RXQA 1T6QA 4C7OB 3MX3A 4NC3A 4KBLA 3PHF2 2OEVA 3LNMB 3L8IA 1PV3A 4YT8A 3FOOA 2G3KA 3MBGA 3I5PA 4JTAB 3AG1C 4X0RA 2QLAA 3OWTA 4U5FE 3CAXA 1QKRA 2HSQA 4AE4B 4KI2A 3Q7GA 1M2VB 1BBHA 1Z6AA 3G4ZA 2XXAB 1MMGA 1F1MA 3EH2A 3T6BA 4ULWA 3EZIA 2QNLA 1A7VA 2IXMA 4JE9A 2WB7A 5CI9A 1S7ZA 256BA 3S84A 5CIVA 3ZVRA 1V55C 4GEHA 3DM9B 4MVSA 5KYYB 1EA8A 3SZRA 3FOPA 3L34A 4B6IA 5F5FA 4K7BA 1OKKD 2YLIA 3DM5A 3L0IA 1WASA 3W8IA 3ZG1A 4YJWA 5D91A 3GEEA 3UMKA 4Z9HA 4BEMJ 2Y3DA 3IPMO 5E33A 4PK4A 2OJED 4HEAJ 4GYTA 3POVA 1AVOB 4Q4ZF 3T6JA 3NYMA 1VK5A 2DB4A 1SF8A 2ZPAA 1PCXA 1LI5A 2J0WA 1YDIA 4DBQA 1A7DA 3PCVA 4XLPF 2KGOA 4I1OB 2VCBA 3S27A 1QSPA 3HKKA 1N1CA 4N6HA 3V7OA 1YZCA 4J30B 4XQ1A 4U5CE 3RKOF 3UGOA 2KJGA 2LQGA 4DJ9A 3RFYA 1EI7A 2R02A 3DWWA 4YL3A 2L6GA 3ATPA 1LI7A 2ETSA 1NLXA 3OEOA 1ORSC 2Q7RA 2AP3A 3QTHA 5DVWA 2XS8A 3C8GD 1E84A 2XLHA 3FVYA 1D0ZA 3TJ6A 2HJMA 2HZ8A 3LLIA 1OW6A 3UMHA 2FAPB 4NQFA 1PD1A 1YA7O 2PFDA 3ABLC 4ZLDA 5BQGA 2XRHA 3HNLA 4H54A 1Y4CA 3EGXA 3E9VA 1D1AA 1EQ1A 3CQZA 3EGDB 5AGFA 1OCOC 3FAJA 4ULVA 2HMQA 1L3PA 4OIRF 5A69A 1OQCA 1VYIA 3F46A 3H65A 3S90A 3EHNA 2Q00A 3JCUQ 2HV6A 3SXZA 3U2MA 2Y69C 1T5OA 1FMVA 3AGTA 4HE8D 2LD6A 2P7VA 5JS5A 3EG9A 3NDBB 2J7PA 5HV9A 2YQYA 1E86A 2KQ9A 1DOVA 5TJ5E 3G4XA 3FAPB 2R7UA 4OD4A 4U5EE 3DD7A 1KTMA 2HUJA 2H7VC 3J06A 1E2XA 2RSEB 4CJOA 2TMVP 4OIOF 2D5RB 3CEXA 2XM4A 1TFKB 2JPUA 4OIQF 3U3BA 4D4NA 4J7YA 1C02A 2IM8A 1SMYF 5L3VA 2W9YA 2W4MA 3W2VA 4LDQA 4K1OA 1Q0FA 3RVYA 4FX5A 2F22A 3EJNA 4Q7CA 1OXBA 3BRJA 3Q6MA 4C3DA 3WAQA 2IOQA 3GEHA 4FESA 3FXHA 5E2QA 4QI0A 2R05A 2LFDA 2AWYA 3RVZA 3FMSA 1E85A 3AQCA 2OU6A 1NFNA 4IWBA 2EPLX 1OCRC 3LNRA 4G78A 3WHNA 3ZQVA 1G8XA 1OR3A 2Q9AA 1Q0DA 3VM6A 1V4AA 3AG3C 5COFA 4CDYA 3LEOA 1S05A 2Q9BA 2W4BA 3PMRA 4JEBA 2IBFA 2AWCA 3DAGA 2O9XA 2WVNA 2OJQA 4HFFB 4KC9A 3FDQA 4G7HF 4XEVA 3ABMC 4E7ZA 4JW1A 4KNVA 4EBBA 4ANJA 5F5HA 4U9DA 3HJCA 2UUHA 5JVEA 1CGOA 2CDQA 1MQVA 2XLOA 2XLMA 1K40A 3GORA 4Q5SF 4OD5A 3GWNA 1ZHYA 2QTVA 1I4YA 2X0CA 5B1BC 2ICWG 3ITFA 1TQGA 4JCZA 1NZEA 4YL0A 3TQOA 2L9JA 5L0JA 3AJMA 3H2VA 2IXPA 3B29A 1YVIA 4JZAA 2RD9A 3N24A 4U9EA 3QVZA 3DJUB 3LS1A 3TOMA 2YZSA 2A69F 3B9QA 2HSBA 1OXKA 3U0CA 1EKYA 2R9RB 3NG1A 3AOUA 3NRHA 1NG1A 3K66A 2EIMC 1H6GA 2OOCA 2ZXWC 2EINC 5JLIA 1XZQA 1QZXA 4O6NA 3JTLO 2I15A 2C04A 3ASOC 2R7OA 3KPHA 2R7VA 4IJJA 1MMDA 4CS8C 1U0BB 2GWWA 3C63A 1V74B 4JCHA 3U9MA 1TKNA 3U2LA 1G4WR 3PDMP 4PFPA 3JRTA 1L7CA 3N0TA 5F28E 1C17M 1FMWA 1ZVZA 1A7EA 3IHUA 3L8JA 5T1DB 5DLJA 3EPVA 1BDJB 4M63A 2EILC 5L0FA 2R7RA 1D0XA 5AC4A 3RW0A 3N2ZB 3EGXB 1PD0A 4MS2A 5A6AA 3EH1A 3HTKC 4PACA 1JAFA 4ZLCA 1ZZPA 2ZXPA 3W8HA 3RF3A 2ZXOA 3C62A 3GODA 3JRMO 2PX0A 4PJMA 4XPWA 3DZAA 3IEEA 1JRAA 2CW0F 2QUPA 4PJNA 1OCCC 4JIOA 1CGME 3M4BA 5CI8A 3HNIA 5E3AA 1HE1A 1OKKA 3B71A 1JR8A 4AK9A 4DVYP 2J9UA 4NY3A 3M4CA 2A68F 3KMIA 2Y39A 4MVRA 2HMZA 1JOGA 2MYSA 3KH2A 2KC3A 2I8BA 2XL8A 3MYIA 5B3IA 3IQ5A 3R7CA 4ER9A 2J45A 4J7TA 5EGYA 5L0HA 2ZXRA 5KYXA 4E18A 3S28A 1A0BA 4CDVA 1Z3IX 1RJ9A 3RQFA 1A41A 3R2PA 1LS1A 1ZU4A 2LP4A 3U5SA 3RIPA 4G7OF 4DBRA 2CNWA 1FNTc 1MMAA 4JKVA 3T4RA 3VYWA 4AX2A 1FAPB 4EUKB 1G5ZA 2UUIA 3S29A 4E17A 1OR2A 1VLSA 3GEIA 3K33A 4NTBA 5K0IA 4YWQA 2AU5A 4F4BA 1VOMA 3HLZA 4JC7A 2MWQA 3JT1A 1AUEA 1RKEA 4C3BA 4BG0A 4XPYA 4FWVA 1W2WA 2DI3A 2YKZA 2YL7A 4N4WA 2Y3GA 5GPGB 3V5YA 3UMIA 5L0CA 1WTYA 4LDRA 4BJ5C 5A6BD 1M6TA 4OIPF 5DS4A 1D1BA 4XTKA 2J9VA 4CS8A 4FAPB 1B68A 4QI2A 5E3CA 4RBNA 1Z5ZA 1ORJA 2G62A 1MNDA 4BEJA 4CX9A 1K05A 1NFOA 4I3MA 3IQTA 4MVQA 1GS9A 4PJJA 2NUPA 4K0DA 3UNGC 2FFHA 4O7GA 1C03A 1YAUO 2KW3C 1G4US 2LSEA 2XL4A 3HNKA 4BJTA 4DRIB 2WVOA 4AE4A 2R7SA 2LIGA 1M2VA 1TWCA 2Y3BA 4IARA 3U8VA 2PF4E 4O79A 2XXAA 1WATA 3AGUA 4EBKA 1ORYA 3K6BA 3V5ZA 1MNEA 2WZFA 3M79A 4L6RA 5B1AC 3O39A 2J8WA 1YARO 4E0IA 5L0IA 2J7PD 2J0XA 2XLEA 1WGWA 1J8MF 4BJ1A 4E7SA 2B0HA 3JSEO 4U5HA 1KNYA 2OG2A 4CIPA 3O10A 2MHRA 2NPUA 3KL4A 4U5GA 3OA1A 2CYDA 1YJGA 1ZHTA 3G50A 3LS0A 3K7DA 2OEXA 4N06A 3TJ5A 5A6JA 3DE8A 3SP1A 4BJ6C 1NU9C 2YLGA 3IQCA 2KSFA 4CSAA 2YL1A 5KYWA 5JSLA 4JRZA 3DMDA 2EPMX 5JUAA 2CGEA 3V5XA 2PBEA 3C7JA 1BR2A 4G0HA 4JEAA 1T9KA 4JURI 1Z7Qc 4XPXA 3F47A 5L3QA 3GM2A 3LAYA 3JYYA 2XLWA 2JD3A 1U89A 4WABA 5B3SC 4OINF 4QDLA 3SEOA 3QW1A 4W8PA 2YL3A 5BUOA 3KYJA 5FCLA 4WJ0A 2EIJC 3ZC4A 2FGYA 1UFBA 1H7IA
chains in the Genus database with same CATH topology
1B68A 1LS4A 1LE2A 1BZ4A 1NFNA 1NFOA 1GS9A 1LPEA 1OR3A 3R2PA 3S84A 1EA8A 1LE4A 1AEPA 1OR2A 1YA9A 1EQ1A 2KC3A 1H7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1LS4 A;  1LE2 A;  1BZ4 A;  1NFN A;  1NFO A;  1GS9 A;  1LPE A;  1OR3 A;  3R2P A;  3S84 A;  1EA8 A;  1LE4 A;  1AEP A;  1OR2 A;  1YA9 A;  1EQ1 A;  2KC3 A;  1H7I A; 
#chains in the Genus database with same CATH topology
 3SXY A;  4JJF A;  1TWG A;  1XZP A;  2LK4 A;  2R03 A;  4WGY A;  3EHM A;  3EFO A;  4JJG A;  4JTC B;  1H9T A;  2VH3 A;  3A9C A;  4MVM A;  5D92 A;  3X1O A;  4AL0 A;  1OCZ C;  4BJ5 A;  4A4A A;  5L0G A;  1VTM P;  2WVQ A;  2GDC A;  2IXN A;  5COM A;  3NYJ A;  4MTG A;  2BE5 F;  3NMJ A;  1T6U A;  1LE4 A;  4IGG A;  4O6M A;  4DOZ A;  4YT5 A;  3UGP A;  1R4T A;  2VAS A;  2R7T A;  2P0N A;  1FR0 A;  2NSF A;  5KYX B;  1Q0M A;  2KYH A;  1M2O A;  1TR2 A;  5EK0 A;  3ECS A;  1RJ9 B;  5DQZ A;  1D1C A;  4NTF A;  1CPR A;  2Z15 A;  2YLD A;  3LLK A;  4CDA A;  4EHP A;  2L7A A;  1GM5 A;  3E70 C;  1GGQ A;  3RYL A;  1NU7 D;  1LM3 B;  1LKX A;  3SNH A;  3W2W A;  1BR4 A;  4I44 A;  4P6I C;  2GA0 A;  5T3T A;  1XWJ A;  1LS4 A;  1M57 C;  2V3C C;  3AG2 C;  3AQB A;  4P9F A;  3TUL A;  1YLM A;  2QE9 A;  4LLE A;  1LVK A;  1SR2 A;  3W4Y A;  4GQH A;  2PX3 A;  5KYU A;  2CCY A;  1V54 C;  1ZHW A;  3LES A;  4LDK A;  3NMK A;  4YL1 A;  1AEP A;  2ASR A;  3CZ6 A;  4BJ6 A;  2YRF A;  4YK5 A;  4YT2 A;  1T01 A;  4H4K C;  5IY5 C;  1SZI A;  1IW7 F;  3MLG A;  2OCC C;  2BL2 A;  2HKV A;  3VF0 A;  2GAQ A;  4AL1 A;  3B0V C;  2NUP B;  3VAY A;  3M1C B;  2OKU A;  2JX0 A;  1YA9 A;  3EG9 B;  4E0H A;  1Y6D A;  1JPN A;  4UDV A;  2ZD9 A;  4U5B E;  4W8K A;  5BQH A;  1KU2 A;  5JT4 A;  2NSG A;  2G3V A;  1IZM A;  3BEH A;  2R7Q A;  1FTS A;  2Q4F A;  2VCC A;  1O3U A;  2NG1 A;  1HW1 A;  2B0J A;  4IB4 A;  1K04 A;  3TK0 A;  2EPK X;  2VB6 A;  1VMA A;  4RD9 A;  3UR3 C;  3ZWI A;  3QW0 A;  4WGZ A;  2YEV A;  4A2N B;  4CSA C;  1LPE A;  4NTA A;  1NSG B;  2EPN A;  4RDA A;  1LIH A;  3SYN A;  5JRA A;  3S0X A;  1U6H A;  1HMD A;  1M56 C;  2HFI A;  5T3W A;  2YHS A;  3GWL A;  5EHH A;  4MND A;  1O5H A;  2HS5 A;  2A1D D;  3B0P A;  3FHD A;  4LER A;  4MW8 A;  4PFO A;  4Z9I A;  3ZTZ A;  1Q0K A;  3C8G A;  1VB5 A;  4CIH A;  3Q6N A;  1VLT A;  4MVZ A;  1APC A;  1SYQ A;  2XM0 A;  1Z63 A;  2R25 A;  4DXW A;  5KYW B;  3GM1 A;  1FFH A;  3NKD A;  4NCQ A;  1WWP A;  2XSE A;  3O55 A;  5BQI A;  3NYL A;  2CNW D;  3DAF A;  1JMW A;  2A0B A;  4CJG A;  1LE2 A;  2A6E F;  1BZ4 A;  2NUT A;  5KYN A;  4JTD B;  4C7O A;  1QPU A;  3B0U X;  2P1A A;  3US6 A;  1ST6 A;  2BC5 A;  1HW2 A;  3ZQY A;  2E87 A;  2L81 A;  2PP4 A;  4IAQ A;  3DI5 A;  5A6B A;  2H7B A;  3ZIB A;  3GM3 A;  5AC5 A;  4ONS A;  4DRJ B;  3L1M A;  2Y3H A;  2VCA A;  5COG A;  5DQT A;  2XL6 A;  1WOL A;  2GFH A;  4P9T A;  2WL8 A;  4CS7 A;  3EFO B;  4JVS A;  4XEF A;  4EBJ A;  2P61 A;  4N6C A;  3ASN C;  3K1I A;  1TFO B;  2H7O A;  2YL0 A;  1DOW A;  1Z23 A;  4CS9 A;  1TWH A;  3O6X A;  2QY9 A;  4IAO A;  4Z9J A;  2WZG A;  3JYH A;  1ZHX A;  5KYY A;  2AVK A;  3NMI A;  3KYI A;  2HJ3 A;  3RH3 A;  3DE9 A;  1HY5 A;  4EKW A;  2Q9C A;  3X2Q C;  1T6I A;  1MMN A;  4PR9 A;  3DKA A;  1ZU5 A;  1QLE C;  2M4E A;  4R32 A;  3CSK A;  2DYS C;  3TOL A;  3EZH A;  2R7W A;  2IYL D;  2A6H F;  4O6Y A;  1O87 A;  1I5N A;  2IXO A;  2PNO A;  3T6G B;  3DXJ F;  2A0U A;  4LAC B;  1FFT C;  4EWC A;  3I4U A;  3LEV A;  4MVU A;  3WOD F;  1RCP A;  2VC9 A;  3IQ6 A;  4HFK B;  1ZYR F;  3U3F A;  1OW7 A;  1CGN A;  2V26 A;  3C18 A;  3GAN A;  1QVX A;  1NBB A;  1YYJ A;  3QVY A;  3QZC A;  4D4X A;  1E83 A;  4G7Z F;  5FZT A;  3ABK C;  1CPQ A;  4MW3 A;  3HNJ A;  1HE9 A;  1YYX A;  2KK1 A;  3LUT B;  4XLN F;  3MFN A;  1YZA A;  4MVO A;  2EPO A;  4PJL A;  4EIY A;  3QMK A;  3AG4 C;  2L6H A;  4J32 B;  4MQ9 F;  2J9B A;  3ZTM A;  5KYU B;  2DGJ A;  1I4Z A;  1OW8 A;  1J8Y F;  1VYK A;  3K1H A;  5A6K A;  2HV7 A;  4DRH B;  3VRC A;  3Q7L A;  3NKE A;  2P6V A;  4KNW A;  4MTO A;  5HSW A;  4CBE A;  1QQ3 A;  3SXM A;  3H2U A;  3U8P A;  2C03 A;  3KKB A;  4YN0 B;  2OQM A;  4BPM A;  3I5Q A;  2D4U A;  4DVZ A;  3EGD A;  2LFF A;  3JZ0 A;  1H9G A;  1GQA A;  1ZHZ A;  1ZW3 A;  2DYR C;  2J46 A;  1BR1 A;  1RMV A;  5DS6 A;  4XEK A;  2XLV A;  3RQE A;  3T9O A;  2X51 A;  2KNH A;  1ZW2 A;  5DS5 A;  2J9W A;  3SXK A;  3MYF A;  4U5D E;  4LLC A;  2XS1 A;  4MTF A;  3S9O A;  2YWA A;  3LJB A;  3A11 A;  1Q0G A;  4YT4 A;  2H8A A;  4IRU A;  3U9J A;  1WN0 A;  4XWJ A;  4I1M A;  2L6F A;  1JPJ A;  2M64 A;  2WZL A;  3C8G B;  1UG7 A;  5JP7 A;  1RKE B;  3RQG A;  2Q3T A;  4C3E A;  2W45 A;  3EQL F;  1RKC A;  2XLD A;  3JSZ A;  3TD7 A;  2EIK C;  2LCH A;  3DJN B;  1HMO A;  3M15 A;  1TWA A;  3K1I C;  2R7X A;  3ZSU A;  3ZDL A;  1D0Y A;  2YVK A;  3WG7 C;  5L0D A;  1R5I D;  2NUT B;  3C8Z A;  4CS9 C;  1RXQ A;  1T6Q A;  4C7O B;  3MX3 A;  4NC3 A;  4KBL A;  3PHF 2;  2OEV A;  3LNM B;  3L8I A;  1PV3 A;  4YT8 A;  3FOO A;  2G3K A;  3MBG A;  3I5P A;  4JTA B;  3AG1 C;  4X0R A;  2QLA A;  3OWT A;  4U5F E;  3CAX A;  1QKR A;  2HSQ A;  4AE4 B;  4KI2 A;  3Q7G A;  1M2V B;  1BBH A;  1Z6A A;  3G4Z A;  2XXA B;  1MMG A;  1F1M A;  3EH2 A;  3T6B A;  4ULW A;  3EZI A;  2QNL A;  1A7V A;  2IXM A;  4JE9 A;  2WB7 A;  5CI9 A;  1S7Z A;  256B A;  3S84 A;  5CIV A;  3ZVR A;  1V55 C;  4GEH A;  3DM9 B;  4MVS A;  5KYY B;  1EA8 A;  3SZR A;  3FOP A;  3L34 A;  4B6I A;  5F5F A;  4K7B A;  1OKK D;  2YLI A;  3DM5 A;  3L0I A;  1WAS A;  3W8I A;  3ZG1 A;  4YJW A;  5D91 A;  3GEE A;  3UMK A;  4Z9H A;  4BEM J;  2Y3D A;  3IPM O;  5E33 A;  4PK4 A;  2OJE D;  4HEA J;  4GYT A;  3POV A;  1AVO B;  4Q4Z F;  3T6J A;  3NYM A;  1VK5 A;  2DB4 A;  1SF8 A;  2ZPA A;  1PCX A;  1LI5 A;  2J0W A;  1YDI A;  4DBQ A;  1A7D A;  3PCV A;  4XLP F;  2KGO A;  4I1O B;  2VCB A;  3S27 A;  1QSP A;  3HKK A;  1N1C A;  4N6H A;  3V7O A;  1YZC A;  4J30 B;  4XQ1 A;  4U5C E;  3RKO F;  3UGO A;  2KJG A;  2LQG A;  4DJ9 A;  3RFY A;  1EI7 A;  2R02 A;  3DWW A;  4YL3 A;  2L6G A;  3ATP A;  1LI7 A;  2ETS A;  1NLX A;  3OEO A;  1ORS C;  2Q7R A;  2AP3 A;  3QTH A;  5DVW A;  2XS8 A;  3C8G D;  1E84 A;  2XLH A;  3FVY A;  1D0Z A;  3TJ6 A;  2HJM A;  2HZ8 A;  3LLI A;  1OW6 A;  3UMH A;  2FAP B;  4NQF A;  1PD1 A;  1YA7 O;  2PFD A;  3ABL C;  4ZLD A;  5BQG A;  2XRH A;  3HNL A;  4H54 A;  1Y4C A;  3EGX A;  3E9V A;  1D1A A;  1EQ1 A;  3CQZ A;  3EGD B;  5AGF A;  1OCO C;  3FAJ A;  4ULV A;  2HMQ A;  1L3P A;  4OIR F;  5A69 A;  1OQC A;  1VYI A;  3F46 A;  3H65 A;  3S90 A;  3EHN A;  2Q00 A;  3JCU Q;  2HV6 A;  3SXZ A;  3U2M A;  2Y69 C;  1T5O A;  1FMV A;  3AGT A;  4HE8 D;  2LD6 A;  2P7V A;  5JS5 A;  3EG9 A;  3NDB B;  2J7P A;  5HV9 A;  2YQY A;  1E86 A;  2KQ9 A;  1DOV A;  5TJ5 E;  3G4X A;  3FAP B;  2R7U A;  4OD4 A;  4U5E E;  3DD7 A;  1KTM A;  2HUJ A;  2H7V C;  3J06 A;  1E2X A;  2RSE B;  4CJO A;  2TMV P;  4OIO F;  2D5R B;  3CEX A;  2XM4 A;  1TFK B;  2JPU A;  4OIQ F;  3U3B A;  4D4N A;  4J7Y A;  1C02 A;  2IM8 A;  1SMY F;  5L3V A;  2W9Y A;  2W4M A;  3W2V A;  4LDQ A;  4K1O A;  1Q0F A;  3RVY A;  4FX5 A;  2F22 A;  3EJN A;  4Q7C A;  1OXB A;  3BRJ A;  3Q6M A;  4C3D A;  3WAQ A;  2IOQ A;  3GEH A;  4FES A;  3FXH A;  5E2Q A;  4QI0 A;  2R05 A;  2LFD A;  2AWY A;  3RVZ A;  3FMS A;  1E85 A;  3AQC A;  2OU6 A;  1NFN A;  4IWB A;  2EPL X;  1OCR C;  3LNR A;  4G78 A;  3WHN A;  3ZQV A;  1G8X A;  1OR3 A;  2Q9A A;  1Q0D A;  3VM6 A;  1V4A A;  3AG3 C;  5COF A;  4CDY A;  3LEO A;  1S05 A;  2Q9B A;  2W4B A;  3PMR A;  4JEB A;  2IBF A;  2AWC A;  3DAG A;  2O9X A;  2WVN A;  2OJQ A;  4HFF B;  4KC9 A;  3FDQ A;  4G7H F;  4XEV A;  3ABM C;  4E7Z A;  4JW1 A;  4KNV A;  4EBB A;  4ANJ A;  5F5H A;  4U9D A;  3HJC A;  2UUH A;  5JVE A;  1CGO A;  2CDQ A;  1MQV A;  2XLO A;  2XLM A;  1K40 A;  3GOR A;  4Q5S F;  4OD5 A;  3GWN A;  1ZHY A;  2QTV A;  1I4Y A;  2X0C A;  5B1B C;  2ICW G;  3ITF A;  1TQG A;  4JCZ A;  1NZE A;  4YL0 A;  3TQO A;  2L9J A;  5L0J A;  3AJM A;  3H2V A;  2IXP A;  3B29 A;  1YVI A;  4JZA A;  2RD9 A;  3N24 A;  4U9E A;  3QVZ A;  3DJU B;  3LS1 A;  3TOM A;  2YZS A;  2A69 F;  3B9Q A;  2HSB A;  1OXK A;  3U0C A;  1EKY A;  2R9R B;  3NG1 A;  3AOU A;  3NRH A;  1NG1 A;  3K66 A;  2EIM C;  1H6G A;  2OOC A;  2ZXW C;  2EIN C;  5JLI A;  1XZQ A;  1QZX A;  4O6N A;  3JTL O;  2I15 A;  2C04 A;  3ASO C;  2R7O A;  3KPH A;  2R7V A;  4IJJ A;  1MMD A;  4CS8 C;  1U0B B;  2GWW A;  3C63 A;  1V74 B;  4JCH A;  3U9M A;  1TKN A;  3U2L A;  1G4W R;  3PDM P;  4PFP A;  3JRT A;  1L7C A;  3N0T A;  5F28 E;  1C17 M;  1FMW A;  1ZVZ A;  1A7E A;  3IHU A;  3L8J A;  5T1D B;  5DLJ A;  3EPV A;  1BDJ B;  4M63 A;  2EIL C;  5L0F A;  2R7R A;  1D0X A;  5AC4 A;  3RW0 A;  3N2Z B;  3EGX B;  1PD0 A;  4MS2 A;  5A6A A;  3EH1 A;  3HTK C;  4PAC A;  1JAF A;  4ZLC A;  1ZZP A;  2ZXP A;  3W8H A;  3RF3 A;  2ZXO A;  3C62 A;  3GOD A;  3JRM O;  2PX0 A;  4PJM A;  4XPW A;  3DZA A;  3IEE A;  1JRA A;  2CW0 F;  2QUP A;  4PJN A;  1OCC C;  4JIO A;  1CGM E;  3M4B A;  5CI8 A;  3HNI A;  5E3A A;  1HE1 A;  1OKK A;  3B71 A;  1JR8 A;  4AK9 A;  4DVY P;  2J9U A;  4NY3 A;  3M4C A;  2A68 F;  3KMI A;  2Y39 A;  4MVR A;  2HMZ A;  1JOG A;  2MYS A;  3KH2 A;  2KC3 A;  2I8B A;  2XL8 A;  3MYI A;  5B3I A;  3IQ5 A;  3R7C A;  4ER9 A;  2J45 A;  4J7T A;  5EGY A;  5L0H A;  2ZXR A;  5KYX A;  4E18 A;  3S28 A;  1A0B A;  4CDV A;  1Z3I X;  1RJ9 A;  3RQF A;  1A41 A;  3R2P A;  1LS1 A;  1ZU4 A;  2LP4 A;  3U5S A;  3RIP A;  4G7O F;  4DBR A;  2CNW A;  1FNT c;  1MMA A;  4JKV A;  3T4R A;  3VYW A;  4AX2 A;  1FAP B;  4EUK B;  1G5Z A;  2UUI A;  3S29 A;  4E17 A;  1OR2 A;  1VLS A;  3GEI A;  3K33 A;  4NTB A;  5K0I A;  4YWQ A;  2AU5 A;  4F4B A;  1VOM A;  3HLZ A;  4JC7 A;  2MWQ A;  3JT1 A;  1AUE A;  1RKE A;  4C3B A;  4BG0 A;  4XPY A;  4FWV A;  1W2W A;  2DI3 A;  2YKZ A;  2YL7 A;  4N4W A;  2Y3G A;  5GPG B;  3V5Y A;  3UMI A;  5L0C A;  1WTY A;  4LDR A;  4BJ5 C;  5A6B D;  1M6T A;  4OIP F;  5DS4 A;  1D1B A;  4XTK A;  2J9V A;  4CS8 A;  4FAP B;  1B68 A;  4QI2 A;  5E3C A;  4RBN A;  1Z5Z A;  1ORJ A;  2G62 A;  1MND A;  4BEJ A;  4CX9 A;  1K05 A;  1NFO A;  4I3M A;  3IQT A;  4MVQ A;  1GS9 A;  4PJJ A;  2NUP A;  4K0D A;  3UNG C;  2FFH A;  4O7G A;  1C03 A;  1YAU O;  2KW3 C;  1G4U S;  2LSE A;  2XL4 A;  3HNK A;  4BJT A;  4DRI B;  2WVO A;  4AE4 A;  2R7S A;  2LIG A;  1M2V A;  1TWC A;  2Y3B A;  4IAR A;  3U8V A;  2PF4 E;  4O79 A;  2XXA A;  1WAT A;  3AGU A;  4EBK A;  1ORY A;  3K6B A;  3V5Z A;  1MNE A;  2WZF A;  3M79 A;  4L6R A;  5B1A C;  3O39 A;  2J8W A;  1YAR O;  4E0I A;  5L0I A;  2J7P D;  2J0X A;  2XLE A;  1WGW A;  1J8M F;  4BJ1 A;  4E7S A;  2B0H A;  3JSE O;  4U5H A;  1KNY A;  2OG2 A;  4CIP A;  3O10 A;  2MHR A;  2NPU A;  3KL4 A;  4U5G A;  3OA1 A;  2CYD A;  1YJG A;  1ZHT A;  3G50 A;  3LS0 A;  3K7D A;  2OEX A;  4N06 A;  3TJ5 A;  5A6J A;  3DE8 A;  3SP1 A;  4BJ6 C;  1NU9 C;  2YLG A;  3IQC A;  2KSF A;  4CSA A;  2YL1 A;  5KYW A;  5JSL A;  4JRZ A;  3DMD A;  2EPM X;  5JUA A;  2CGE A;  3V5X A;  2PBE A;  3C7J A;  1BR2 A;  4G0H A;  4JEA A;  1T9K A;  4JUR I;  1Z7Q c;  4XPX A;  3F47 A;  5L3Q A;  3GM2 A;  3LAY A;  3JYY A;  2XLW A;  2JD3 A;  1U89 A;  4WAB A;  5B3S C;  4OIN F;  4QDL A;  3SEO A;  3QW1 A;  4W8P A;  2YL3 A;  5BUO A;  3KYJ A;  5FCL A;  4WJ0 A;  2EIJ C;  3ZC4 A;  2FGY A;  1UFB A;  1H7I A; 
#chains in the Genus database with same CATH homology
 1B68 A;  1LS4 A;  1LE2 A;  1BZ4 A;  1NFN A;  1NFO A;  1GS9 A;  1LPE A;  1OR3 A;  3R2P A;  3S84 A;  1EA8 A;  1LE4 A;  1AEP A;  1OR2 A;  1YA9 A;  1EQ1 A;  2KC3 A;  1H7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...