1BZ4A

Apolipoprotein e3 (apo-e3), truncation mutant 165
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords PROTEIN (APOLIPOPROTEIN E)
publication title Conformational flexibility in the apolipoprotein E amino-terminal domain structure determined from three new crystal forms: implications for lipid binding.
pubmed rcsb
source organism Homo sapiens
total genus 64
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 1998-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1bz4A00
3S84A 1LE2A 1B68A 1LS4A 1EA8A 1OR3A 1BZ4A 1EQ1A 1GS9A 1LE4A 1OR2A 1NFOA 1YA9A 1NFNA 2KC3A 3R2PA 1LPEA 1H7IA 1AEPA
chains in the Genus database with same CATH superfamily
3HNIA 1OW6A 2YLGA 1NLXA 3FDQA 1LVKA 1NU9C 3RW0A 1RMVA 2YL1A 1U89A 4JEAA 3R7CA 4YJWA 2O9XA 3JRTA 4C7OB 2AWYA 3CAXA 1OCCC 4IJJA 1ZYRF 3O6XA 2PFDA 5JRAA 4IAOA 4ULWA 5AC4A 4OIPF 3U2LA 3ZTZA 5A6AA 1RCPA 5JSLA 4MNDA 3SEOA 1FNTc 4I44A 4LACB 3IQCA 3S9OA 2V26A 2F22A 1TWCA 3LNMB 2AVKA 4MVSA 3RVZA 2D4UA 1JPJA 3ZQVA 2ZPAA 4MW8A 4PK4A 256BA 4ONSA 4JTAB 1DOWA 4G7ZF 2A6HF 5BUOA 2JPUA 2IXOA 2HFIA 2CNWD 4N06A 4DRIB 2CYDA 2H7BA 2OKUA 3TOLA 3A11A 3DJNB 1T9KA 1GGQA 4XQ1A 5DS5A 2IXPA 2J7PD 3AG4C 2BL2A 3VYWA 5A6BA 3QW1A 4U9EA 3NYMA 3ABKC 4Q7CA 4XWJA 3BEHA 3CQZA 5DLJA 3FOPA 2L6GA 2W45A 1KNYA 2EIMC 1M57C 3FOOA 3MYIA 1Z6AA 3B0VC 3QMKA 4U5HA 2TMVP 2A0BA 3X1OA 2MYSA 2UUIA 4CS9C 1J8YF 1SMYF 3L1MA 3MYFA 4R32A 2HS5A 1MNEA 4OIQF 3HNLA 1G8XA 5KYNA 2X0CA 3W2WA 3NDBB 4EKWA 3I5QA 1V54C 2WZLA 3FAJA 3L34A 4U5DE 3EG9A 4MW3A 3WAQA 1Q0KA 5D91A 5FZTA 2WVNA 5JUAA 2NUTB 3HJCA 4O79A 2IOQA 1VLTA 3Q7LA 4MTGA 4CJOA 1WOLA 3MLGA 1QVXA 3C8GD 1V55C 1T6QA 1ZHTA 4CSAA 1LI5A 4WGZA 2E87A 1SF8A 3OEOA 3N2ZB 3SYNA 1MQVA 3V7OA 1M2OA 2CGEA 4IARA 2PNOA 1A7DA 1T5OA 1YA7O 1NBBA 1ST6A 1MMAA 1FMWA 3RFYA 3US6A 3T6GB 1OXBA 2RD9A 4D4XA 1IW7F 1CGNA 2VCAA 2HSQA 5KYUB 3ITFA 1ZHXA 2ZXRA 3O39A 3MBGA 2I8BA 1L3PA 1QZXA 4DRJB 5KYXB 1QKRA 3W4YA 3FAPB 5B3IA 4PJJA 2DB4A 2MHRA 4YL3A 4DRHB 1ZW3A 2YLIA 3G4XA 5DQZA 3K7DA 1K05A 2Y39A 3PCVA 5CI8A 2EPMX 2R7XA 2VH3A 3OWTA 3JTLO 4UDVA 3DI5A 3N0TA 3POVA 3QW0A 2R7OA 5D92A 1OCZC 1RKEB 1YYXA 2L6HA 3NRHA 3SXZA 1E84A 3AGTA 2BE5F 4KI2A 2R7SA 2ICWG 2EPNA 2Q00A 2XL4A 4A4AA 2L81A 1OKKA 5KYWA 1PD0A 2R02A 3V5YA 1Q0DA 2KC3A 2Q3TA 3QVZA 5TJ5E 4BEMJ 2HJMA 3HKKA 1MMNA 4NQFA 2QE9A 2ZD9A 3NYJA 4U5CE 5F28E 3B0UX 2DYSC 2KNHA 3LEVA 4E7SA 4Q5SF 4I1OB 4J7YA 2PX0A 3NKEA 5BQGA 2EINC 1L7CA 1G5ZA 4EWCA 4YL0A 3X2QC 1J8MF 1DOVA 3RH3A 5DS6A 3V5ZA 3RYLA 2IM8A 3GEEA 1KU2A 1QLEC 1Q0FA 2OJED 4O7GA 2R7RA 3C8GB 3NG1A 3KYIA 4JCHA 2XL6A 4IAQA 4BJTA 2NUPB 1EI7A 1D1AA 1A0BA 1O3UA 2OEXA 3JYHA 4YT5A 3SP1A 3RKOF 5AC5A 3CEXA 3GODA 1C02A 2VCCA 1Z7Qc 4MVMA 1VLSA 1VMAA 1LE4A 1NFOA 1OR2A 2EPLX 1D0XA 4MVUA 4BJ5A 4B6IA 2XLOA 1QQ3A 4HFFB 2YRFA 3GORA 4LDQA 4LDKA 1I5NA 1H9GA 2YL7A 3NMJA 5BQIA 2EIJC 3R2PA 3AGUA 1GQAA 3M15A 4J7TA 3T9OA 4E0HA 5IY5C 1VB5A 2L7AA 3VF0A 1YJGA 1K04A 3PHF2 2XXAB 1Q0MA 4DBRA 4M63A 4WGYA 4L6RA 2XL8A 4N6HA 4U9DA 3GWLA 4OD4A 4FAPB 4PR9A 3SXYA 1LE2A 2HZ8A 1B68A 2Z15A 3K6BA 4ANJA 1XZQA 3FHDA 2KW3C 3E9VA 1O5HA 3ZVRA 1VOMA 2DGJA 2PF4E 5JP7A 1WN0A 1PV3A 2J46A 2MWQA 2P61A 3EGXB 4QI2A 2M64A 1FMVA 1H9TA 3IEEA 5B1BC 4YT4A 1JRAA 5EK0A 2R05A 3PMRA 4AE4B 3ZC4A 3IQ6A 4XLNF 4YT2A 1JMWA 4U5GA 4BJ6A 2ZXWC 3EFOB 3TOMA 5JS5A 1JPNA 3SXMA 4KC9A 3M4CA 1RJ9B 3KH2A 5E33A 1Y4CA 2A68F 3I4UA 2WVOA 3UGPA 1SYQA 3KPHA 3RIPA 1ZW2A 4WJ0A 4JE9A 2P6VA 3DAGA 3HNJA 4CBEA 3EGDB 1OQCA 4P9TA 3DJUB 1JOGA 3LNRA 1MMDA 3F46A 3GM1A 4JJFA 4O6YA 4XEVA 4EUKB 2VASA 3ATPA 4Z9JA 3W2VA 4ER9A 1T6IA 2IXNA 2R7QA 1BDJB 3CZ6A 3LAYA 4KNVA 1HMOA 3C62A 2XLWA 3FMSA 4JW1A 2Q9AA 5DS4A 1ZHWA 1MMGA 2B0JA 1WGWA 1NFNA 2OJQA 3AG1C 5EHHA 2JX0A 4PFOA 1Z23A 2H7VC 3S90A 2PX3A 3L8JA 3C7JA 4JEBA 3A9CA 2HKVA 1PD1A 4NC3A 3K1IA 3AJMA 1VYIA 1E83A 4P6IC 1FR0A 1K40A 4YL1A 2LIGA 2W9YA 3TK0A 4JC7A 2NUTA 3ZIBA 2LCHA 2KGOA 4E17A 2A1DD 1QPUA 3JZ0A 2HJ3A 5COFA 4DBQA 2Y3BA 2XRHA 2R9RB 3ZTMA 3ABMC 2OG2A 3WG7C 5JT4A 3M4BA 2R7UA 4XEKA 2VB6A 1HMDA 4NY3A 3IQTA 1OXKA 2QNLA 4RBNA 3EQLF 1WWPA 2Q9BA 2WZFA 3GEIA 2UUHA 3VM6A 3NKDA 4YK5A 2YL3A 2HV7A 3H2VA 3ZWIA 2A69F 3EHNA 5L0GA 1E86A 3RQGA 4CSAC 1A7EA 2KSFA 4Z9HA 1TWHA 1EQ1A 2ZXOA 2HMQA 3N24A 1N1CA 5KYXA 4O6NA 2CNWA 4AK9A 5DQTA 2LK4A 4CDYA 2QLAA 1LI7A 4C3BA 2J7PA 3FVYA 3UR3C 2FFHA 4I1MA 1LPEA 1M2VB 2XLEA 3IPMO 3KYJA 2EPOA 4XPYA 4CS8C 3IHUA 3G4ZA 4Q4ZF 2V3CC 3L0IA 2AP3A 2J9BA 2WZGA 3WODF 2EPKX 3DE8A 3TJ6A 1FAPB 2LFFA 4NTBA 5B1AC 2IYLD 1RKEA 3EPVA 2A6EF 4IB4A 4H54A 1U6HA 1LS4A 1BR4A 2C04A 1TWGA 2J0WA 3RQFA 1FFHA 2YHSA 3GWNA 4EHPA 2YZSA 4E0IA 2LFDA 4BPMA 3WHNA 2D5RB 3NMKA 4QDLA 2EILC 1UG7A 4CS7A 5L3VA 1YDIA 1WTYA 2XS1A 2H7OA 4D4NA 2WVQA 3H2UA 3LLKA 3Q7GA 3J06A 1Y6DA 2DYRC 2XM4A 4PFPA 4CDAA 2PP4A 5KYYB 3SZRA 3MFNA 4PJMA 4AL1A 1H7IA 4IRUA 3C8GA 4OIRF 5DVWA 2CDQA 5F5FA 1S05A 1ORYA 1WATA 3PDMP 5EGYA 2NUPA 3G50A 1Q0GA 3LUTB 3O10A 4A2NB 5A6JA 3TD7A 2VC9A 3DXJF 2J9WA 1ZVZA 2KQ9A 1S7ZA 5B3SC 5L0JA 1ZHZA 3M79A 1TFOB 4CIPA 4CIHA 1D1CA 1NG1A 3I5PA 4OD5A 3JSEO 4MQ9F 3DWWA 1VK5A 4LDRA 3B29A 4LLEA 3S29A 1HW2A 5JVEA 3ASNC 2HV6A 4BJ5C 1BR1A 2J8WA 2XXAA 2G62A 4HFKB 5KYWB 2LD6A 2J45A 3UMHA 4E18A 1YZAA 2YVKA 4DXWA 1T6UA 4FWVA 2HSBA 4JURI 4XLPF 3S0XA 1A7VA 4W8PA 1RKCA 2FGYA 4C7OA 4MVQA 2KK1A 1XZPA 2OCCC 3DD7A 1NZEA 2R25A 3BRJA 3EGXA 3S84A 2PBEA 2OU6A 1R5ID 4H4KC 4XEFA 4AE4A 1GM5A 3GEHA 4OIOF 2YQYA 4KNWA 4N6CA 5A6BD 3U8PA 3EFOA 2Y3HA 1GS9A 4FX5A 3AG3C 3B9QA 3LESA 1RJ9A 3SNHA 1C03A 1I4YA 2AWCA 1OW7A 2P7VA 2KYHA 3QTHA 4I3MA 4JCZA 2OOCA 1Z5ZA 4MVOA 3AQBA 4G0HA 4MTFA 5GPGB 3U8VA 2FAPB 1LIHA 2OEVA 4X0RA 2IXMA 3LS1A 3U9MA 4CJGA 2HUJA 5COGA 3EGDA 1BR2A 4NTFA 4JZAA 3TJ5A 3TQOA 4EBJA 1C17M 3GM2A 2EIKC 3L8IA 1CGME 5T3WA 1ORJA 1AEPA 2LQGA 1YARO 1YVIA 3ABLC 5L0DA 5T3TA 2XSEA 3T6BA 4Z9IA 3U2MA 2Y3GA 2NPUA 4RD9A 4YN0B 3DE9A 1F1MA 1OCOC 2YEVA 3C18A 2Y69C 5L0CA 2QY9A 2XLHA 1W2WA 2J0XA 1HE9A 3Q6NA 1APCA 4CDVA 3U0CA 1A41A 2LP4A 2NSFA 2R7VA 3M1CB 5T1DB 2R7TA 2B0HA 4K7BA 1E2XA 4O6MA 4HEAJ 4G7HF 4IWBA 1D1BA 3C63A 3DM5A 4JKVA 4KBLA 4P9FA 4PJLA 1HY5A 2J9UA 4N4WA 4BEJA 5L0IA 3K1IC 1E85A 5BQHA 2GDCA 2OQMA 3GM3A 4E7ZA 2ZXPA 3RQEA 3ZG1A 1H6GA 1QSPA 2XLMA 1OW8A 2GAQA 3MX3A 2W4MA 3JT1A 4F4BA 2CW0F 4NTAA 4LERA 4YWQA 4WABA 3JYYA 3JRMO 2M4EA 4CS9A 1ORSC 2ETSA 2KJGA 1PCXA 2Q4FA 1YLMA 4W8KA 3B71A 5KYUA 1VTMP 4DJ9A 1M2VA 2BC5A 3LEOA 2IBFA 4NCQA 4EBBA 5K0IA 3UGOA 4K1OA 4BG0A 2P0NA 3W8HA 1LS1A 4DVZA 2XS8A 3T4RA 3KMIA 1V4AA 3AOUA 3AQCA 4GEHA 1OKKD 3LLIA 3H65A 3NMIA 1G4US 2YL0A 4CX9A 5JLIA 2CCYA 4JTCB 2A0UA 2JD3A 4ULVA 1IZMA 1SR2A 1EKYA 3EHMA 3NYLA 3HLZA 5FCLA 3U3FA 3EG9B 3JSZA 4IGGA 3T6JA 4LLCA 5HV9A 2XM0A 3QVYA 4MS2A 3UMKA 4AX2A 3IQ5A 1EA8A 1TWAA 4JVSA 2ASRA 4U5BE 3U3BA 2L6FA 3LJBA 3U5SA 4ZLDA 1TQGA 1Z63A 1MNDA 3EZHA 3K66A 4JTDB 3EH2A 2R7WA 1AUEA 1YZCA 4GYTA 1T01A 1YA9A 2J9VA 1TFKB 2NSGA 2WL8A 4XTKA 1LM3B 1CPQA 5KYYA 1M56C 2QTVA 3UNGC 1U0BB 4RDAA 1TR2A 4G7OF 1NSGB 2YKZA 1ZU4A 4MVRA 4CS8A 4C3DA 2RSEB 3GANA 5E3AA 3AG2C 1YYJA 3HTKC 2G3KA 4AL0A 3KL4A 2YLDA 2LSEA 3K1HA 2Q7RA 3CSKA 3SXKA 2GA0A 2G3VA 3EH1A 3KKBA 5F5HA 3EJNA 3S28A 5E3CA 4PACA 2W4BA 2R03A 4HE8D 3ZQYA 3S27A 1BBHA 4EBKA 1BZ4A 1R4TA 2L9JA 2HMZA 3JCUQ 2Q9CA 3O55A 1JR8A 5E2QA 3ZSUA 3U9JA 3HNKA 1D0ZA 4FESA 2X51A 4MTOA 4XPWA 5L0FA 3ECSA 2NG1A 1V74B 4JJGA 4DVYP 3F47A 5CI9A 1XWJA 1VYKA 2GWWA 1KTMA 3V5XA 1M6TA 1HW1A 5COMA 2H8AA 4J32B 1SZIA 3ASOC 4QI0A 3VRCA 3EZIA 1CPRA 3B0PA 3C8ZA 1OCRC 3QZCA 4XPXA 1LKXA 2WB7A 3DKAA 3E70C 5AGFA 4YT8A 4ZLCA 4G78A 4JRZA 1CGOA 4U5FE 4C3EA 1ZU5A 2YWAA 3FXHA 3UMIA 5L3QA 3Q6MA 1NU7D 1D0YA 2DI3A 1RXQA 4JIOA 2QUPA 5HSWA 3ZDLA 4K0DA 1OR3A 1G4WR 1Z3IX 3K33A 4PJNA 3LS0A 2VCBA 4BJ1A 5A6KA 1FFTC 4MVZA 4EIYA 4GQHA 2P1AA 5CIVA 3DMDA 3DAFA 2XLDA 1JAFA 3OA1A 2I15A 1FTSA 1I4ZA 4U5EE 3VAYA 3DM9B 1O87A 3RVYA 3DZAA 1ZHYA 2GFHA 2XLVA 1WASA 2Y3DA 3W8IA 2AU5A 2C03A 4BJ6C 5L0HA 1TKNA 4DOZA 5A69A 3TULA 3RF3A 1ZZPA 4J30B 1AVOB 1YAUO 1UFBA 4OINF 1HE1A
chains in the Genus database with same CATH topology
3S84A 1LE2A 1B68A 1LS4A 1EA8A 1OR3A 1BZ4A 1EQ1A 1GS9A 1LE4A 1OR2A 1NFOA 1YA9A 1NFNA 2KC3A 3R2PA 1LPEA 1H7IA 1AEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S84 A;  1LE2 A;  1B68 A;  1LS4 A;  1EA8 A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1GS9 A;  1LE4 A;  1OR2 A;  1NFO A;  1YA9 A;  1NFN A;  2KC3 A;  3R2P A;  1LPE A;  1H7I A;  1AEP A; 
#chains in the Genus database with same CATH topology
 3HNI A;  1OW6 A;  2YLG A;  1NLX A;  3FDQ A;  1LVK A;  1NU9 C;  3RW0 A;  1RMV A;  2YL1 A;  1U89 A;  4JEA A;  3R7C A;  4YJW A;  2O9X A;  3JRT A;  4C7O B;  2AWY A;  3CAX A;  1OCC C;  4IJJ A;  1ZYR F;  3O6X A;  2PFD A;  5JRA A;  4IAO A;  4ULW A;  5AC4 A;  4OIP F;  3U2L A;  3ZTZ A;  5A6A A;  1RCP A;  5JSL A;  4MND A;  3SEO A;  1FNT c;  4I44 A;  4LAC B;  3IQC A;  3S9O A;  2V26 A;  2F22 A;  1TWC A;  3LNM B;  2AVK A;  4MVS A;  3RVZ A;  2D4U A;  1JPJ A;  3ZQV A;  2ZPA A;  4MW8 A;  4PK4 A;  256B A;  4ONS A;  4JTA B;  1DOW A;  4G7Z F;  2A6H F;  5BUO A;  2JPU A;  2IXO A;  2HFI A;  2CNW D;  4N06 A;  4DRI B;  2CYD A;  2H7B A;  2OKU A;  3TOL A;  3A11 A;  3DJN B;  1T9K A;  1GGQ A;  4XQ1 A;  5DS5 A;  2IXP A;  2J7P D;  3AG4 C;  2BL2 A;  3VYW A;  5A6B A;  3QW1 A;  4U9E A;  3NYM A;  3ABK C;  4Q7C A;  4XWJ A;  3BEH A;  3CQZ A;  5DLJ A;  3FOP A;  2L6G A;  2W45 A;  1KNY A;  2EIM C;  1M57 C;  3FOO A;  3MYI A;  1Z6A A;  3B0V C;  3QMK A;  4U5H A;  2TMV P;  2A0B A;  3X1O A;  2MYS A;  2UUI A;  4CS9 C;  1J8Y F;  1SMY F;  3L1M A;  3MYF A;  4R32 A;  2HS5 A;  1MNE A;  4OIQ F;  3HNL A;  1G8X A;  5KYN A;  2X0C A;  3W2W A;  3NDB B;  4EKW A;  3I5Q A;  1V54 C;  2WZL A;  3FAJ A;  3L34 A;  4U5D E;  3EG9 A;  4MW3 A;  3WAQ A;  1Q0K A;  5D91 A;  5FZT A;  2WVN A;  5JUA A;  2NUT B;  3HJC A;  4O79 A;  2IOQ A;  1VLT A;  3Q7L A;  4MTG A;  4CJO A;  1WOL A;  3MLG A;  1QVX A;  3C8G D;  1V55 C;  1T6Q A;  1ZHT A;  4CSA A;  1LI5 A;  4WGZ A;  2E87 A;  1SF8 A;  3OEO A;  3N2Z B;  3SYN A;  1MQV A;  3V7O A;  1M2O A;  2CGE A;  4IAR A;  2PNO A;  1A7D A;  1T5O A;  1YA7 O;  1NBB A;  1ST6 A;  1MMA A;  1FMW A;  3RFY A;  3US6 A;  3T6G B;  1OXB A;  2RD9 A;  4D4X A;  1IW7 F;  1CGN A;  2VCA A;  2HSQ A;  5KYU B;  3ITF A;  1ZHX A;  2ZXR A;  3O39 A;  3MBG A;  2I8B A;  1L3P A;  1QZX A;  4DRJ B;  5KYX B;  1QKR A;  3W4Y A;  3FAP B;  5B3I A;  4PJJ A;  2DB4 A;  2MHR A;  4YL3 A;  4DRH B;  1ZW3 A;  2YLI A;  3G4X A;  5DQZ A;  3K7D A;  1K05 A;  2Y39 A;  3PCV A;  5CI8 A;  2EPM X;  2R7X A;  2VH3 A;  3OWT A;  3JTL O;  4UDV A;  3DI5 A;  3N0T A;  3POV A;  3QW0 A;  2R7O A;  5D92 A;  1OCZ C;  1RKE B;  1YYX A;  2L6H A;  3NRH A;  3SXZ A;  1E84 A;  3AGT A;  2BE5 F;  4KI2 A;  2R7S A;  2ICW G;  2EPN A;  2Q00 A;  2XL4 A;  4A4A A;  2L81 A;  1OKK A;  5KYW A;  1PD0 A;  2R02 A;  3V5Y A;  1Q0D A;  2KC3 A;  2Q3T A;  3QVZ A;  5TJ5 E;  4BEM J;  2HJM A;  3HKK A;  1MMN A;  4NQF A;  2QE9 A;  2ZD9 A;  3NYJ A;  4U5C E;  5F28 E;  3B0U X;  2DYS C;  2KNH A;  3LEV A;  4E7S A;  4Q5S F;  4I1O B;  4J7Y A;  2PX0 A;  3NKE A;  5BQG A;  2EIN C;  1L7C A;  1G5Z A;  4EWC A;  4YL0 A;  3X2Q C;  1J8M F;  1DOV A;  3RH3 A;  5DS6 A;  3V5Z A;  3RYL A;  2IM8 A;  3GEE A;  1KU2 A;  1QLE C;  1Q0F A;  2OJE D;  4O7G A;  2R7R A;  3C8G B;  3NG1 A;  3KYI A;  4JCH A;  2XL6 A;  4IAQ A;  4BJT A;  2NUP B;  1EI7 A;  1D1A A;  1A0B A;  1O3U A;  2OEX A;  3JYH A;  4YT5 A;  3SP1 A;  3RKO F;  5AC5 A;  3CEX A;  3GOD A;  1C02 A;  2VCC A;  1Z7Q c;  4MVM A;  1VLS A;  1VMA A;  1LE4 A;  1NFO A;  1OR2 A;  2EPL X;  1D0X A;  4MVU A;  4BJ5 A;  4B6I A;  2XLO A;  1QQ3 A;  4HFF B;  2YRF A;  3GOR A;  4LDQ A;  4LDK A;  1I5N A;  1H9G A;  2YL7 A;  3NMJ A;  5BQI A;  2EIJ C;  3R2P A;  3AGU A;  1GQA A;  3M15 A;  4J7T A;  3T9O A;  4E0H A;  5IY5 C;  1VB5 A;  2L7A A;  3VF0 A;  1YJG A;  1K04 A;  3PHF 2;  2XXA B;  1Q0M A;  4DBR A;  4M63 A;  4WGY A;  4L6R A;  2XL8 A;  4N6H A;  4U9D A;  3GWL A;  4OD4 A;  4FAP B;  4PR9 A;  3SXY A;  1LE2 A;  2HZ8 A;  1B68 A;  2Z15 A;  3K6B A;  4ANJ A;  1XZQ A;  3FHD A;  2KW3 C;  3E9V A;  1O5H A;  3ZVR A;  1VOM A;  2DGJ A;  2PF4 E;  5JP7 A;  1WN0 A;  1PV3 A;  2J46 A;  2MWQ A;  2P61 A;  3EGX B;  4QI2 A;  2M64 A;  1FMV A;  1H9T A;  3IEE A;  5B1B C;  4YT4 A;  1JRA A;  5EK0 A;  2R05 A;  3PMR A;  4AE4 B;  3ZC4 A;  3IQ6 A;  4XLN F;  4YT2 A;  1JMW A;  4U5G A;  4BJ6 A;  2ZXW C;  3EFO B;  3TOM A;  5JS5 A;  1JPN A;  3SXM A;  4KC9 A;  3M4C A;  1RJ9 B;  3KH2 A;  5E33 A;  1Y4C A;  2A68 F;  3I4U A;  2WVO A;  3UGP A;  1SYQ A;  3KPH A;  3RIP A;  1ZW2 A;  4WJ0 A;  4JE9 A;  2P6V A;  3DAG A;  3HNJ A;  4CBE A;  3EGD B;  1OQC A;  4P9T A;  3DJU B;  1JOG A;  3LNR A;  1MMD A;  3F46 A;  3GM1 A;  4JJF A;  4O6Y A;  4XEV A;  4EUK B;  2VAS A;  3ATP A;  4Z9J A;  3W2V A;  4ER9 A;  1T6I A;  2IXN A;  2R7Q A;  1BDJ B;  3CZ6 A;  3LAY A;  4KNV A;  1HMO A;  3C62 A;  2XLW A;  3FMS A;  4JW1 A;  2Q9A A;  5DS4 A;  1ZHW A;  1MMG A;  2B0J A;  1WGW A;  1NFN A;  2OJQ A;  3AG1 C;  5EHH A;  2JX0 A;  4PFO A;  1Z23 A;  2H7V C;  3S90 A;  2PX3 A;  3L8J A;  3C7J A;  4JEB A;  3A9C A;  2HKV A;  1PD1 A;  4NC3 A;  3K1I A;  3AJM A;  1VYI A;  1E83 A;  4P6I C;  1FR0 A;  1K40 A;  4YL1 A;  2LIG A;  2W9Y A;  3TK0 A;  4JC7 A;  2NUT A;  3ZIB A;  2LCH A;  2KGO A;  4E17 A;  2A1D D;  1QPU A;  3JZ0 A;  2HJ3 A;  5COF A;  4DBQ A;  2Y3B A;  2XRH A;  2R9R B;  3ZTM A;  3ABM C;  2OG2 A;  3WG7 C;  5JT4 A;  3M4B A;  2R7U A;  4XEK A;  2VB6 A;  1HMD A;  4NY3 A;  3IQT A;  1OXK A;  2QNL A;  4RBN A;  3EQL F;  1WWP A;  2Q9B A;  2WZF A;  3GEI A;  2UUH A;  3VM6 A;  3NKD A;  4YK5 A;  2YL3 A;  2HV7 A;  3H2V A;  3ZWI A;  2A69 F;  3EHN A;  5L0G A;  1E86 A;  3RQG A;  4CSA C;  1A7E A;  2KSF A;  4Z9H A;  1TWH A;  1EQ1 A;  2ZXO A;  2HMQ A;  3N24 A;  1N1C A;  5KYX A;  4O6N A;  2CNW A;  4AK9 A;  5DQT A;  2LK4 A;  4CDY A;  2QLA A;  1LI7 A;  4C3B A;  2J7P A;  3FVY A;  3UR3 C;  2FFH A;  4I1M A;  1LPE A;  1M2V B;  2XLE A;  3IPM O;  3KYJ A;  2EPO A;  4XPY A;  4CS8 C;  3IHU A;  3G4Z A;  4Q4Z F;  2V3C C;  3L0I A;  2AP3 A;  2J9B A;  2WZG A;  3WOD F;  2EPK X;  3DE8 A;  3TJ6 A;  1FAP B;  2LFF A;  4NTB A;  5B1A C;  2IYL D;  1RKE A;  3EPV A;  2A6E F;  4IB4 A;  4H54 A;  1U6H A;  1LS4 A;  1BR4 A;  2C04 A;  1TWG A;  2J0W A;  3RQF A;  1FFH A;  2YHS A;  3GWN A;  4EHP A;  2YZS A;  4E0I A;  2LFD A;  4BPM A;  3WHN A;  2D5R B;  3NMK A;  4QDL A;  2EIL C;  1UG7 A;  4CS7 A;  5L3V A;  1YDI A;  1WTY A;  2XS1 A;  2H7O A;  4D4N A;  2WVQ A;  3H2U A;  3LLK A;  3Q7G A;  3J06 A;  1Y6D A;  2DYR C;  2XM4 A;  4PFP A;  4CDA A;  2PP4 A;  5KYY B;  3SZR A;  3MFN A;  4PJM A;  4AL1 A;  1H7I A;  4IRU A;  3C8G A;  4OIR F;  5DVW A;  2CDQ A;  5F5F A;  1S05 A;  1ORY A;  1WAT A;  3PDM P;  5EGY A;  2NUP A;  3G50 A;  1Q0G A;  3LUT B;  3O10 A;  4A2N B;  5A6J A;  3TD7 A;  2VC9 A;  3DXJ F;  2J9W A;  1ZVZ A;  2KQ9 A;  1S7Z A;  5B3S C;  5L0J A;  1ZHZ A;  3M79 A;  1TFO B;  4CIP A;  4CIH A;  1D1C A;  1NG1 A;  3I5P A;  4OD5 A;  3JSE O;  4MQ9 F;  3DWW A;  1VK5 A;  4LDR A;  3B29 A;  4LLE A;  3S29 A;  1HW2 A;  5JVE A;  3ASN C;  2HV6 A;  4BJ5 C;  1BR1 A;  2J8W A;  2XXA A;  2G62 A;  4HFK B;  5KYW B;  2LD6 A;  2J45 A;  3UMH A;  4E18 A;  1YZA A;  2YVK A;  4DXW A;  1T6U A;  4FWV A;  2HSB A;  4JUR I;  4XLP F;  3S0X A;  1A7V A;  4W8P A;  1RKC A;  2FGY A;  4C7O A;  4MVQ A;  2KK1 A;  1XZP A;  2OCC C;  3DD7 A;  1NZE A;  2R25 A;  3BRJ A;  3EGX A;  3S84 A;  2PBE A;  2OU6 A;  1R5I D;  4H4K C;  4XEF A;  4AE4 A;  1GM5 A;  3GEH A;  4OIO F;  2YQY A;  4KNW A;  4N6C A;  5A6B D;  3U8P A;  3EFO A;  2Y3H A;  1GS9 A;  4FX5 A;  3AG3 C;  3B9Q A;  3LES A;  1RJ9 A;  3SNH A;  1C03 A;  1I4Y A;  2AWC A;  1OW7 A;  2P7V A;  2KYH A;  3QTH A;  4I3M A;  4JCZ A;  2OOC A;  1Z5Z A;  4MVO A;  3AQB A;  4G0H A;  4MTF A;  5GPG B;  3U8V A;  2FAP B;  1LIH A;  2OEV A;  4X0R A;  2IXM A;  3LS1 A;  3U9M A;  4CJG A;  2HUJ A;  5COG A;  3EGD A;  1BR2 A;  4NTF A;  4JZA A;  3TJ5 A;  3TQO A;  4EBJ A;  1C17 M;  3GM2 A;  2EIK C;  3L8I A;  1CGM E;  5T3W A;  1ORJ A;  1AEP A;  2LQG A;  1YAR O;  1YVI A;  3ABL C;  5L0D A;  5T3T A;  2XSE A;  3T6B A;  4Z9I A;  3U2M A;  2Y3G A;  2NPU A;  4RD9 A;  4YN0 B;  3DE9 A;  1F1M A;  1OCO C;  2YEV A;  3C18 A;  2Y69 C;  5L0C A;  2QY9 A;  2XLH A;  1W2W A;  2J0X A;  1HE9 A;  3Q6N A;  1APC A;  4CDV A;  3U0C A;  1A41 A;  2LP4 A;  2NSF A;  2R7V A;  3M1C B;  5T1D B;  2R7T A;  2B0H A;  4K7B A;  1E2X A;  4O6M A;  4HEA J;  4G7H F;  4IWB A;  1D1B A;  3C63 A;  3DM5 A;  4JKV A;  4KBL A;  4P9F A;  4PJL A;  1HY5 A;  2J9U A;  4N4W A;  4BEJ A;  5L0I A;  3K1I C;  1E85 A;  5BQH A;  2GDC A;  2OQM A;  3GM3 A;  4E7Z A;  2ZXP A;  3RQE A;  3ZG1 A;  1H6G A;  1QSP A;  2XLM A;  1OW8 A;  2GAQ A;  3MX3 A;  2W4M A;  3JT1 A;  4F4B A;  2CW0 F;  4NTA A;  4LER A;  4YWQ A;  4WAB A;  3JYY A;  3JRM O;  2M4E A;  4CS9 A;  1ORS C;  2ETS A;  2KJG A;  1PCX A;  2Q4F A;  1YLM A;  4W8K A;  3B71 A;  5KYU A;  1VTM P;  4DJ9 A;  1M2V A;  2BC5 A;  3LEO A;  2IBF A;  4NCQ A;  4EBB A;  5K0I A;  3UGO A;  4K1O A;  4BG0 A;  2P0N A;  3W8H A;  1LS1 A;  4DVZ A;  2XS8 A;  3T4R A;  3KMI A;  1V4A A;  3AOU A;  3AQC A;  4GEH A;  1OKK D;  3LLI A;  3H65 A;  3NMI A;  1G4U S;  2YL0 A;  4CX9 A;  5JLI A;  2CCY A;  4JTC B;  2A0U A;  2JD3 A;  4ULV A;  1IZM A;  1SR2 A;  1EKY A;  3EHM A;  3NYL A;  3HLZ A;  5FCL A;  3U3F A;  3EG9 B;  3JSZ A;  4IGG A;  3T6J A;  4LLC A;  5HV9 A;  2XM0 A;  3QVY A;  4MS2 A;  3UMK A;  4AX2 A;  3IQ5 A;  1EA8 A;  1TWA A;  4JVS A;  2ASR A;  4U5B E;  3U3B A;  2L6F A;  3LJB A;  3U5S A;  4ZLD A;  1TQG A;  1Z63 A;  1MND A;  3EZH A;  3K66 A;  4JTD B;  3EH2 A;  2R7W A;  1AUE A;  1YZC A;  4GYT A;  1T01 A;  1YA9 A;  2J9V A;  1TFK B;  2NSG A;  2WL8 A;  4XTK A;  1LM3 B;  1CPQ A;  5KYY A;  1M56 C;  2QTV A;  3UNG C;  1U0B B;  4RDA A;  1TR2 A;  4G7O F;  1NSG B;  2YKZ A;  1ZU4 A;  4MVR A;  4CS8 A;  4C3D A;  2RSE B;  3GAN A;  5E3A A;  3AG2 C;  1YYJ A;  3HTK C;  2G3K A;  4AL0 A;  3KL4 A;  2YLD A;  2LSE A;  3K1H A;  2Q7R A;  3CSK A;  3SXK A;  2GA0 A;  2G3V A;  3EH1 A;  3KKB A;  5F5H A;  3EJN A;  3S28 A;  5E3C A;  4PAC A;  2W4B A;  2R03 A;  4HE8 D;  3ZQY A;  3S27 A;  1BBH A;  4EBK A;  1BZ4 A;  1R4T A;  2L9J A;  2HMZ A;  3JCU Q;  2Q9C A;  3O55 A;  1JR8 A;  5E2Q A;  3ZSU A;  3U9J A;  3HNK A;  1D0Z A;  4FES A;  2X51 A;  4MTO A;  4XPW A;  5L0F A;  3ECS A;  2NG1 A;  1V74 B;  4JJG A;  4DVY P;  3F47 A;  5CI9 A;  1XWJ A;  1VYK A;  2GWW A;  1KTM A;  3V5X A;  1M6T A;  1HW1 A;  5COM A;  2H8A A;  4J32 B;  1SZI A;  3ASO C;  4QI0 A;  3VRC A;  3EZI A;  1CPR A;  3B0P A;  3C8Z A;  1OCR C;  3QZC A;  4XPX A;  1LKX A;  2WB7 A;  3DKA A;  3E70 C;  5AGF A;  4YT8 A;  4ZLC A;  4G78 A;  4JRZ A;  1CGO A;  4U5F E;  4C3E A;  1ZU5 A;  2YWA A;  3FXH A;  3UMI A;  5L3Q A;  3Q6M A;  1NU7 D;  1D0Y A;  2DI3 A;  1RXQ A;  4JIO A;  2QUP A;  5HSW A;  3ZDL A;  4K0D A;  1OR3 A;  1G4W R;  1Z3I X;  3K33 A;  4PJN A;  3LS0 A;  2VCB A;  4BJ1 A;  5A6K A;  1FFT C;  4MVZ A;  4EIY A;  4GQH A;  2P1A A;  5CIV A;  3DMD A;  3DAF A;  2XLD A;  1JAF A;  3OA1 A;  2I15 A;  1FTS A;  1I4Z A;  4U5E E;  3VAY A;  3DM9 B;  1O87 A;  3RVY A;  3DZA A;  1ZHY A;  2GFH A;  2XLV A;  1WAS A;  2Y3D A;  3W8I A;  2AU5 A;  2C03 A;  4BJ6 C;  5L0H A;  1TKN A;  4DOZ A;  5A69 A;  3TUL A;  3RF3 A;  1ZZP A;  4J30 B;  1AVO B;  1YAU O;  1UFB A;  4OIN F;  1HE1 A; 
#chains in the Genus database with same CATH homology
 3S84 A;  1LE2 A;  1B68 A;  1LS4 A;  1EA8 A;  1OR3 A;  1BZ4 A;  1EQ1 A;  1GS9 A;  1LE4 A;  1OR2 A;  1NFO A;  1YA9 A;  1NFN A;  2KC3 A;  3R2P A;  1LPE A;  1H7I A;  1AEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...