2L81A

Solution nmr structure of the serine-rich domain of hef1 (enhancer of filamentation 1) from homo sapiens, northeast structural genomics consortium target hr5554a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
b'MGHHHHHHSHMDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enhancer of filamentation 1
publication title Northeast Structural Genomics Consortium Target HR5554A
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l81A00
2L81A 1Z23A
chains in the Genus database with same CATH superfamily
3DD7A 2YRFA 3FMSA 2Y3BA 4XLPF 3AG2C 4LDQA 3JYHA 3SEOA 1JAFA 3AGUA 4P9FA 4MTGA 2YL3A 3ASNC 3QW1A 1YA9A 3EJNA 4O6NA 4JCZA 4JJGA 1Y4CA 4PACA 4YK5A 4DRJB 4I44A 4UDVA 2XL4A 4KBLA 4P9TA 1MMGA 1FAPB 5K0IA 1S7ZA 2NPUA 2XLMA 1Z3IX 3JTLO 2KC3A 3HNIA 3PCVA 4FWVA 3RIPA 2IYLD 1ST6A 2MWQA 2M4EA 2YL1A 3KKBA 4JC7A 2ZPAA 2J0XA 3Q6MA 1QZXA 5L0CA 2V3CC 4OIRF 1T9KA 2WVOA 4BJ5C 4ZLDA 3A9CA 3HNLA 3ECSA 3V5YA 1ORSC 4N4WA 3IQ5A 5D92A 4CX9A 2A0UA 4AE4B 3EH1A 3UGOA 2R7OA 2A6EF 2FGYA 2Y39A 1CGOA 3BEHA 3TULA 3U8PA 3C62A 1MMDA 3ZQVA 2LP4A 3AQBA 2HZ8A 4NQFA 5A6BA 5KYXA 2J46A 3DAGA 4MTOA 3UMKA 2ASRA 5EGYA 4JZAA 2YVKA 4EBKA 2QTVA 4YT5A 2J7PD 1OCCC 3TJ6A 1H9GA 1WTYA 1NU7D 2PF4E 2XLVA 2IXOA 3V7OA 1VYKA 5COGA 5JVEA 2IXMA 2NG1A 4G0HA 4ONSA 2CNWA 1AEPA 2X51A 5DQZA 4IARA 4BPMA 1JPJA 3UNGC 4LERA 2YEVA 3QMKA 4AL1A 4MNDA 4FX5A 1V4AA 2XLWA 2A69F 4R32A 5D91A 1B68A 1H6GA 1TWGA 4LACB 3C7JA 2YHSA 4DRIB 4FAPB 4YT2A 5DS5A 1OKKD 2EPMX 2KJGA 2WL8A 3JZ0A 4AL0A 3TOLA 1ZZPA 4IAOA 1Z63A 2V26A 2Q9BA 4P6IC 4NTFA 4LLCA 1OXKA 3O10A 1OR3A 3GWNA 1SF8A 1V54C 2HS5A 1VLTA 3DI5A 3JYYA 3LLKA 4ULVA 4XEFA 4EKWA 1PV3A 4PK4A 1CPQA 3RQGA 1TKNA 3Q7GA 2L6HA 2YZSA 5E3AA 3H2UA 4MW8A 1YLMA 1O87A 2J0WA 1LIHA 1PCXA 1Q0KA 2YLGA 4ULWA 5F5HA 3A11A 5CIVA 3G4XA 2R7XA 3ZSUA 1E83A 1HE1A 3SXZA 3RQEA 2EILC 3WHNA 2EIMC 4G7ZF 4H4KC 3E70C 1SR2A 1YVIA 4EUKB 1YJGA 4IGGA 4Z9JA 3PMRA 4JW1A 2L6FA 2EPNA 2G3VA 1BZ4A 2RD9A 3U8VA 4JIOA 1HY5A 5T3TA 3GM1A 1T6QA 3U9JA 3EGXB 2DGJA 3U2LA 3MX3A 4RDAA 2VC9A 3PHF2 1TFOB 4AE4A 4OIOF 2OG2A 2ZXOA 1NZEA 3G4ZA 3EGDB 2ZXPA 3LS1A 1TWHA 1OR2A 3SXMA 5EHHA 1EA8A 3AGTA 1U89A 2QY9A 4ER9A 1AVOB 4G7HF 4ANJA 4CBEA 2P7VA 2VCCA 3C8GB 2PP4A 4U5HA 4U5CE 1G4WR 1Z23A 2Y3HA 4CS9C 4CS8C 3WAQA 4H54A 1SMYF 2F22A 3AG1C 3I4UA 2O9XA 4KNVA 3RVZA 1JPNA 4U9EA 3KMIA 2KQ9A 5KYWB 3JSEO 4MVMA 4NTBA 3SXYA 3I5QA 1D0ZA 1RKCA 1WOLA 3OEOA 4DXWA 3F47A 3SP1A 3CSKA 3LESA 1T6IA 4CIHA 1N1CA 4LDKA 4C3DA 2P1AA 3R2PA 4DBRA 4MTFA 5A6AA 1LI5A 1TWAA 4QI2A 2BL2A 3ZVRA 3MYIA 4E17A 4BJ6C 1BR1A 3NRHA 3ZTZA 5FZTA 1LPEA 3HTKC 2X0CA 1PD0A 5IY5C 2M64A 2XS8A 3K1IA 1OCOC 3JRMO 3ZC4A 2XL6A 5COFA 2L6GA 2LK4A 2OEXA 1OQCA 3NMIA 4C3EA 5EK0A 4DBQA 5L0FA 4E7ZA 1IW7F 1VK5A 3JT1A 1JR8A 1YA7O 3LJBA 4IJJA 5E2QA 2HSQA 4U5GA 3HNKA 2VASA 3RVYA 2LSEA 2DYSC 1FNTc 3W8IA 4MVSA 2HMZA 5A6BD 3AJMA 4JJFA 2ZXWC 4XLNF 4HEAJ 3B0PA 3M1CB 2XLDA 1W2WA 1YYXA 4Q5SF 3Q7LA 3ZIBA 4EBBA 1K40A 1HW2A 4OD4A 1LE4A 3EHNA 5L0IA 3NKDA 2OU6A 3DM9B 3EGXA 2A68F 1A7VA 3W4YA 1YZAA 4OIPF 2R03A 4W8PA 1LI7A 4JKVA 1NFOA 4IAQA 3MYFA 2PX3A 3SNHA 1SYQA 2ETSA 3N2ZB 1LS4A 3EGDA 2NUPB 1RJ9B 3TD7A 1G5ZA 1HMDA 2L9JA 2H7OA 1TR2A 3FOPA 4O6YA 1GS9A 1D0XA 3EQLF 3L0IA 5HSWA 3IQ6A 4PJMA 5L0JA 1VMAA 2IXPA 1ORJA 2QUPA 3R7CA 1YAUO 2R7VA 3H65A 1LE2A 3C8GA 5AGFA 4CJOA 2YWAA 2B0JA 2KSFA 3EPVA 4CSAC 1L7CA 1I4ZA 1S05A 1J8MF 4J7TA 4YN0B 5JRAA 2UUHA 1WWPA 2Q4FA 4U5EE 4D4XA 1FR0A 1VB5A 5KYWA 1MMAA 3AG4C 1H7IA 3MBGA 3X2QC 2P6VA 1LS1A 2EINC 1MNDA 1JRAA 2J8WA 2R7SA 5F5FA 2Q00A 4JTCB 3T6GB 3C8ZA 4E0HA 1K04A 1DOVA 2LQGA 2WZLA 5B1BC 2MHRA 1ZU5A 1AUEA 2VH3A 1Q0DA 4IRUA 1E84A 2WZGA 4GQHA 4OINF 3JSZA 3RF3A 3GM2A 4XQ1A 3ZQYA 4XTKA 4X0RA 1I4YA 1U6HA 3EZHA 4FESA 3CEXA 2LFDA 2EIJC 4HE8D 1RCPA 2XLHA 3I5PA 3DE9A 4WABA 2CYDA 3T9OA 1OCZC 4MW3A 3K6BA 3N24A 1ZHWA 3NKEA 4KNWA 4GEHA 3T6BA 5DQTA 1OW8A 2YQYA 4EIYA 5L3QA 1E85A 2B0HA 3ASOC 5A6JA 1WN0A 4MQ9F 3HNJA 1QVXA 3US6A 2ICWG 2FAPB 1YARO 3O6XA 3QW0A 3LNRA 2GDCA 3DE8A 3DJUB 3GWLA 1QKRA 1NU9C 1IZMA 2J7PA 3HLZA 4XEKA 2NSGA 5TJ5E 4E18A 5T3WA 3RKOF 3ZWIA 2Q9AA 3T4RA 1Q0FA 3M15A 4A4AA 4WGZA 2DYRC 1VLSA 3M4BA 3DJNB 4DOZA 4DVZA 1G8XA 1QPUA 3IEEA 3DXJF 4N6CA 3U5SA 2VCBA 2IXNA 1T6UA 2JPUA 3ATPA 3EFOB 3GODA 4NCQA 1BR4A 5DS4A 1M56C 2OOCA 3NYLA 4KC9A 4WGYA 3FHDA 1LM3B 3DMDA 3QZCA 4K1OA 4BJ5A 1RMVA 3K7DA 1MQVA 3V5ZA 2NUPA 4Q4ZF 1RJ9A 3L8JA 2J9UA 5AC5A 4YL1A 1M57C 3VRCA 2Q9CA 3ABMC 1XZPA 1OW6A 3NYJA 5BQGA 3DKAA 1J8YF 4EHPA 1A7DA 1WATA 2R25A 1OXBA 3RQFA 2DB4A 1V74B 4LDRA 2OQMA 4BEMJ 3KH2A 1Q0MA 2PFDA 3S29A 3VM6A 4CJGA 1O3UA 4PR9A 4IB4A 1XWJA 2LIGA 2YL0A 3UMIA 3M79A 4XPWA 4YJWA 1O5HA 4O79A 3U0CA 4N06A 4YT8A 3WG7C 2HSBA 5JLIA 1OW7A 1KU2A 1ZHYA 1D1BA 1GGQA 2CCYA 3T6JA 1ZYRF 3IPMO 3B0VC 2LFFA 4JTDB 4YL0A 5B3SC 3SXKA 1BR2A 3N0TA 2WZFA 1BDJB 3EHMA 3QTHA 3OA1A 4HFFB 4CDVA 1E2XA 4I3MA 4PJLA 3ABLC 1U0BB 2EPKX 3CZ6A 3O39A 4PFOA 1LKXA 2QLAA 3NDBB 1XZQA 4CIPA 4PFPA 3LEOA 1D1CA 2XM4A 4ZLCA 2HJMA 2C03A 1CPRA 4F4BA 3FOOA 4Z9HA 4EBJA 4JRZA 1QLEC 3SYNA 1WGWA 1C03A 2E87A 1Z5ZA 2XLEA 4G78A 2Q3TA 4XPYA 3KL4A 3UMHA 5JT4A 3MLGA 5HV9A 4IWBA 4O6MA 3W2VA 2L7AA 2AVKA 3MFNA 1UFBA 3CQZA 5CI9A 1I5NA 3E9VA 1EI7A 1ZHZA 3DAFA 4LLEA 1A41A 3RFYA 3GM3A 4D4NA 2HUJA 5FCLA 4C7OB 2XXAB 3NG1A 2OKUA 2NSFA 3Q6NA 1ORYA 4MVQA 1EQ1A 3FAPB 3GEIA 5F28E 3IQTA 2D5RB 2CDQA 5B3IA 3EG9B 5KYUB 1Q0GA 3WODF 3PDMP 1CGNA 4JEBA 2OJED 1A0BA 4J32B 1M6TA 5KYYB 4U5BE 3W8HA 4DVYP 5BUOA 2UUIA 1A7EA 1FFHA 1FTSA 2KK1A 3G50A 2A6HF 3C63A 3KPHA 2KW3C 2P0NA 4RBNA 2CNWD 3K66A 1CGME 3SZRA 3EFOA 2R7TA 2JD3A 2WVNA 3S28A 2IOQA 3S84A 2ZD9A 2KNHA 2A1DD 4QI0A 3S27A 5L0GA 2L81A 3AOUA 3UR3C 4JURI 4N6HA 4PJJA 3NMKA 5A6KA 5L3VA 1NSGB 5JSLA 1WASA 4PJNA 3DWWA 1NFNA 2AWCA 3ZG1A 4U5DE 1M2VB 4JVSA 2I8BA 1TWCA 2H7VC 3HJCA 3GEHA 1E86A 1DOWA 5DLJA 3B71A 2R7UA 2EPLX 1TFKB 3U2MA 1YYJA 3IHUA 1VTMP 2KGOA 2XL8A 2AU5A 3IQCA 1MMNA 2R7QA 2QNLA 1ZVZA 3LEVA 5JS5A 4CS9A 4CS8A 1VOMA 2EIKC 3C18A 3EZIA 1R5ID 256BA 3BRJA 3JRTA 1Z7Qc 5L0HA 1RXQA 1TQGA 2YLIA 2AP3A 2J9WA 3TJ5A 2GA0A 3DM5A 4J7YA 2W45A 4OD5A 2Y69C 1F1MA 1K05A 4G7OF 1H9TA 3K33A 2Y3DA 1RKEB 4MVUA 5DVWA 3AG3C 3FDQA 4XWJA 3TQOA 3FVYA 2QE9A 1KTMA 1JMWA 3V5XA 4KI2A 4BJ6A 4OIQF 2IBFA 2R05A 4JTAB 3RH3A 2HV6A 2YKZA 4O7GA 2W4MA 1C02A 2R02A 3ZTMA 4C7OA 1ZHXA 4U5FE 1D1AA 3O55A 5T1DB 3JCUQ 4BJ1A 1FFTC 4I1MA 4JEAA 5GPGB 2GWWA 3U9MA 4A2NB 1T5OA 2XXAA 1KNYA 2YLDA 3NYMA 4Z9IA 2R9RB 4AX2A 1BBHA 1GM5A 2VB6A 4Q7CA 2OEVA 2HJ3A 3K1IC 2H7BA 3QVYA 4CDAA 5JUAA 3DZAA 3B0UX 3J06A 1NG1A 3U3FA 1FMWA 1MNEA 1FMVA 2LD6A 3EG9A 5KYUA 2NUTB 4MS2A 5KYYA 2WVQA 4CS7A 2H8AA 2YL7A 4EWCA 5DS6A 2D4UA 4QDLA 4C3BA 4CDYA 1QSPA 1ZW3A 4BJTA 3KYJA 2JX0A 4RD9A 4AK9A 3HKKA 4GYTA 1VYIA 4XEVA 4MVZA 4NTAA 2J9VA 1D0YA 5JP7A 2W4BA 1OKKA 3L8IA 4E7SA 1T01A 2BC5A 1V55C 2J9BA 3RYLA 2G62A 4MVRA 4NC3A 2VCAA 1M2VA 1R4TA 3K1HA 2G3KA 5E33A 3POVA 3LUTB 1Y6DA 2OJQA 1JOGA 4M63A 2LCHA 2MYSA 3VAYA 3CAXA 2XSEA 2GAQA 3LAYA 4MVOA 2C04A 5E3CA 2RSEB 2CW0F 3L1MA 1M2OA 4YWQA 3GORA 3S90A 5BQHA 4CSAA 1OCRC 3GEEA 2OCCC 2J45A 4YT4A 3EH2A 3OWTA 2Q7RA 2A0BA 2PNOA 1YZCA 1LVKA 3LS0A 4E0IA 2HV7A 4L6RA 2HFIA 5KYXB 1NLXA 1L3PA 3X1OA 1YDIA 4JE9A 2R7RA 3KYIA 1NBBA 5CI8A 3UGPA 5BQIA 2BE5F 2KYHA 3AQCA 1RKEA 3S9OA 3GANA 5A69A 4BG0A 5AC4A 2ZXRA 1SZIA 3ITFA 3QVZA 2PBEA 2IM8A 1ZU4A 1GQAA 4JCHA 4U9DA 2XLOA 3B29A 4W8KA 1ZHTA 2XRHA 3FXHA 5KYNA 1G4US 3LNMB 3LLIA 4HFKB 2W9YA 2I15A 2PX0A 3M4CA 3W2WA 3L34A 2Z15A 3U3BA 1QQ3A 2GFHA 3S0XA 2HMQA 4K0DA 1HW1A 1PD1A 1UG7A 4XPXA 2XS1A 3ABKC 2CGEA 3NMJA 2EPOA 3TOMA 5COMA 4YL3A 1C17M 4DJ9A 2AWYA 4WJ0A 4J30B 1HE9A 2TMVP 3C8GD 4NY3A 5B1AC 1Z6AA 3FAJA 3RW0A 1EKYA 3F46A 2NUTA 1APCA 2DI3A 3TK0A 2WB7A 2P61A 2XM0A 2Y3GA 4BEJA 4K7BA 3VF0A 3VYWA 5L0DA 3ZDLA 2HKVA 3H2VA 4B6IA 1ZW2A 1HMOA 4DRHB 2FFHA 4I1OB 2R7WA 3B9QA
chains in the Genus database with same CATH topology
3DD7A 2Y3BA 4XLPF 3AG2C 3JYHA 3SEOA 3ASNC 4O6NA 3EJNA 4JJGA 4I44A 2XL4A 4KBLA 1MMGA 1S7ZA 1Z3IX 4FWVA 3RIPA 2IYLD 1ST6A 2MWQA 2M4EA 3KKBA 2ZPAA 2J0XA 3Q6MA 1QZXA 2V3CC 4OIRF 4BJ5C 2WVOA 4ZLDA 3ECSA 5D92A 4AE4B 3EH1A 3UGOA 2R7OA 2A6EF 2FGYA 2Y39A 1MMDA 3AQBA 5KYXA 2J46A 3DAGA 3UMKA 5EGYA 4JZAA 2QTVA 4YT5A 2J7PD 1OCCC 1NU7D 2PF4E 2IXOA 3V7OA 1VYKA 2IXMA 2NG1A 4G0HA 2CNWA 2X51A 5DQZA 1JPJA 3UNGC 4LERA 2YEVA 3QMKA 4MNDA 4FX5A 2A69F 5D91A 1TWGA 4LACB 2YHSA 5DS5A 4YT2A 1OKKD 2KJGA 2WL8A 4IAOA 1Z63A 2V26A 2Q9BA 4LLCA 1SF8A 1V54C 3LLKA 4PK4A 1TKNA 3Q7GA 2YZSA 5E3AA 3SP1A 2J0WA 1O87A 1PCXA 4ULWA 5F5HA 2R7XA 3ZSUA 2EILC 2EIMC 4G7ZF 4H4KC 3E70C 3PMRA 4JW1A 2G3VA 5T3TA 3EGXB 2DGJA 3MX3A 4RDAA 3PHF2 4AE4A 4OIOF 2OG2A 2ZXOA 1NZEA 3EGDB 2ZXPA 3LS1A 1TWHA 5EHHA 2QY9A 4ANJA 4CBEA 2P7VA 2PP4A 4U5HA 4U5CE 1Z23A 2Y3HA 4CS9C 4CS8C 1SMYF 3I4UA 3AG1C 4KNVA 2O9XA 1JPNA 3KMIA 2KQ9A 5KYWB 3I5QA 1D0ZA 3OEOA 3F47A 3CSKA 3LESA 4CIHA 1N1CA 4C3DA 4DBRA 1TWAA 4QI2A 3ZVRA 4BJ6C 1BR1A 3NRHA 5IY5C 3HTKC 1PD0A 1OCOC 3ZC4A 4C3EA 4DBQA 4E7ZA 1IW7F 1VK5A 3JT1A 3LJBA 4IJJA 5E2QA 4U5GA 2VASA 2LSEA 2DYSC 3W8IA 4JJFA 2ZXWC 4XLNF 4HEAJ 3B0PA 3M1CB 4Q5SF 1W2WA 3Q7LA 3ZIBA 4EBBA 4OD4A 3EHNA 3NKDA 3DM9B 3EGXA 2A68F 4OIPF 2PX3A 3SNHA 3N2ZB 3EGDA 2NUPB 1RJ9B 3TD7A 2L9JA 2H7OA 1TR2A 4O6YA 1D0XA 3EQLF 3L0IA 5HSWA 4PJMA 1VMAA 2IXPA 2R7VA 3H65A 2B0JA 3EPVA 4CSAC 1J8MF 4YN0B 4U5EE 5KYWA 1MMAA 3AG4C 3X2QC 2P6VA 1LS1A 2EINC 1MNDA 2R7SA 5F5FA 2WZLA 5B1BC 2VH3A 1ZU5A 4IRUA 2WZGA 4OINF 3JSZA 4XTKA 4X0RA 4FESA 3EZHA 2EIJC 4HE8D 3I5PA 1OCZC 3K6BA 3N24A 1ZHWA 3NKEA 4KNWA 4GEHA 3T6BA 5DQTA 5L3QA 3ASOC 4MQ9F 3O6XA 3LNRA 3DJUB 2J7PA 1NU9C 3HLZA 1IZMA 5T3WA 3RKOF 2Q9AA 3T4RA 2DYRC 3DJNB 4DOZA 4DVZA 1G8XA 3IEEA 3DXJF 5DS4A 2IXNA 3GODA 3EFOB 1BR4A 1M56C 4KC9A 3NYLA 4BJ5A 4YT4A 3FHDA 3DMDA 3QZCA 3K7DA 2NUPA 4Q4ZF 1RJ9A 2J9UA 1M57C 2Q9CA 3ABMC 3NYJA 1J8YF 3KH2A 2PFDA 3S29A 3UMIA 4YJWA 1O5HA 4O79A 4N06A 4YT8A 3WG7C 4G7HF 1KU2A 1ZHYA 1D1BA 3B0VC 3T6JA 1ZYRF 5B3SC 1BR2A 3N0TA 2WZFA 3EHMA 4HFFB 3OA1A 4I3MA 4PJLA 3ABLC 3O39A 3CZ6A 4PFOA 1LKXA 3NDBB 4PFPA 4ZLCA 1D1CA 2C03A 4F4BA 1QLEC 3SYNA 1WGWA 2E87A 1Z5ZA 2Q3TA 3UMHA 3KL4A 3MLGA 4IWBA 4O6MA 3W2VA 5CI9A 3CQZA 3E9VA 3DAFA 1ZHZA 3RFYA 4LLEA 5FCLA 4C7OB 2XXAB 3NG1A 3Q6NA 2D5RB 2CDQA 3EG9B 5KYUB 3WODF 4J32B 5KYYB 4U5BE 3W8HA 5BUOA 1FTSA 1FFHA 2A6HF 2KW3C 4RBNA 2CNWD 3K66A 3SZRA 3EFOA 2R7TA 2JD3A 2WVNA 3S28A 2IOQA 3S27A 2KNHA 2A1DD 4QI0A 2L81A 3UR3C 4JURI 4PJJA 5L3VA 4PJNA 3ZG1A 4U5DE 1M2VB 4JVSA 2I8BA 1TWCA 2H7VC 3HJCA 5DLJA 2R7UA 2KGOA 1MMNA 2R7QA 3LEVA 4CS9A 4CS8A 1VOMA 2EIKC 3EZIA 3JRTA 2J9WA 3DM5A 2W45A 4OD5A 2Y69C 4G7OF 3K33A 2Y3DA 5DVWA 3AG3C 3FDQA 4XWJA 3FVYA 4KI2A 4BJ6A 4OIQF 3RH3A 2HV6A 4O7GA 2W4MA 4C7OA 1ZHXA 4U5FE 1D1AA 4BJ1A 5T1DB 3JCUQ 1FFTC 4I1MA 2XXAA 4A2NB 3NYMA 4AX2A 2VB6A 4Q7CA 3K1IC 2H7BA 3B0UX 3DZAA 1NG1A 1FMWA 1MNEA 1FMVA 3EG9A 5KYUA 2NUTB 5KYYA 2WVQA 4CS7A 4EWCA 5DS6A 4QDLA 4C3BA 4BJTA 4RD9A 4AK9A 4GYTA 1VYIA 2J9VA 1D0YA 2W4BA 1OKKA 4E7SA 1V55C 3RYLA 2G62A 1M2VA 3K1HA 2G3KA 5E33A 3POVA 4M63A 2MYSA 3VAYA 2XSEA 3LAYA 2C04A 5E3CA 2CW0F 1M2OA 4YWQA 4CSAA 1OCRC 2OCCC 2J45A 3EH2A 3OWTA 1LVKA 3LS0A 2HV7A 5KYXB 3X1OA 2R7RA 5CI8A 3UGPA 2BE5F 3AQCA 3GANA 4BG0A 2ZXRA 1SZIA 3ITFA 1ZU4A 4JCHA 4W8KA 1ZHTA 2XRHA 5KYNA 4HFKB 3LLIA 2W9YA 2PX0A 3W2WA 3L34A 2Z15A 2GFHA 3S0XA 4K0DA 1PD1A 4DVYP 3ABKC 2CGEA 4WJ0A 4J30B 5B1AC 4NY3A 1Z6AA 3FAJA 3F46A 2NUTA 2WB7A 2Y3GA 4BEJA 4K7BA 3VYWA 4B6IA 4P6IC 2FFHA 4I1OB 2R7WA 3B9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L81 A;  1Z23 A; 
#chains in the Genus database with same CATH topology
 3DD7 A;  2YRF A;  3FMS A;  2Y3B A;  4XLP F;  3AG2 C;  4LDQ A;  3JYH A;  3SEO A;  1JAF A;  3AGU A;  4P9F A;  4MTG A;  2YL3 A;  3ASN C;  3QW1 A;  1YA9 A;  3EJN A;  4O6N A;  4JCZ A;  4JJG A;  1Y4C A;  4PAC A;  4YK5 A;  4DRJ B;  4I44 A;  4UDV A;  2XL4 A;  4KBL A;  4P9T A;  1MMG A;  1FAP B;  5K0I A;  1S7Z A;  2NPU A;  2XLM A;  1Z3I X;  3JTL O;  2KC3 A;  3HNI A;  3PCV A;  4FWV A;  3RIP A;  2IYL D;  1ST6 A;  2MWQ A;  2M4E A;  2YL1 A;  3KKB A;  4JC7 A;  2ZPA A;  2J0X A;  3Q6M A;  1QZX A;  5L0C A;  2V3C C;  4OIR F;  1T9K A;  2WVO A;  4BJ5 C;  4ZLD A;  3A9C A;  3HNL A;  3ECS A;  3V5Y A;  1ORS C;  4N4W A;  3IQ5 A;  5D92 A;  4CX9 A;  2A0U A;  4AE4 B;  3EH1 A;  3UGO A;  2R7O A;  2A6E F;  2FGY A;  2Y39 A;  1CGO A;  3BEH A;  3TUL A;  3U8P A;  3C62 A;  1MMD A;  3ZQV A;  2LP4 A;  3AQB A;  2HZ8 A;  4NQF A;  5A6B A;  5KYX A;  2J46 A;  3DAG A;  4MTO A;  3UMK A;  2ASR A;  5EGY A;  4JZA A;  2YVK A;  4EBK A;  2QTV A;  4YT5 A;  2J7P D;  1OCC C;  3TJ6 A;  1H9G A;  1WTY A;  1NU7 D;  2PF4 E;  2XLV A;  2IXO A;  3V7O A;  1VYK A;  5COG A;  5JVE A;  2IXM A;  2NG1 A;  4G0H A;  4ONS A;  2CNW A;  1AEP A;  2X51 A;  5DQZ A;  4IAR A;  4BPM A;  1JPJ A;  3UNG C;  4LER A;  2YEV A;  3QMK A;  4AL1 A;  4MND A;  4FX5 A;  1V4A A;  2XLW A;  2A69 F;  4R32 A;  5D91 A;  1B68 A;  1H6G A;  1TWG A;  4LAC B;  3C7J A;  2YHS A;  4DRI B;  4FAP B;  4YT2 A;  5DS5 A;  1OKK D;  2EPM X;  2KJG A;  2WL8 A;  3JZ0 A;  4AL0 A;  3TOL A;  1ZZP A;  4IAO A;  1Z63 A;  2V26 A;  2Q9B A;  4P6I C;  4NTF A;  4LLC A;  1OXK A;  3O10 A;  1OR3 A;  3GWN A;  1SF8 A;  1V54 C;  2HS5 A;  1VLT A;  3DI5 A;  3JYY A;  3LLK A;  4ULV A;  4XEF A;  4EKW A;  1PV3 A;  4PK4 A;  1CPQ A;  3RQG A;  1TKN A;  3Q7G A;  2L6H A;  2YZS A;  5E3A A;  3H2U A;  4MW8 A;  1YLM A;  1O87 A;  2J0W A;  1LIH A;  1PCX A;  1Q0K A;  2YLG A;  4ULW A;  5F5H A;  3A11 A;  5CIV A;  3G4X A;  2R7X A;  3ZSU A;  1E83 A;  1HE1 A;  3SXZ A;  3RQE A;  2EIL C;  3WHN A;  2EIM C;  4G7Z F;  4H4K C;  3E70 C;  1SR2 A;  1YVI A;  4EUK B;  1YJG A;  4IGG A;  4Z9J A;  3PMR A;  4JW1 A;  2L6F A;  2EPN A;  2G3V A;  1BZ4 A;  2RD9 A;  3U8V A;  4JIO A;  1HY5 A;  5T3T A;  3GM1 A;  1T6Q A;  3U9J A;  3EGX B;  2DGJ A;  3U2L A;  3MX3 A;  4RDA A;  2VC9 A;  3PHF 2;  1TFO B;  4AE4 A;  4OIO F;  2OG2 A;  2ZXO A;  1NZE A;  3G4Z A;  3EGD B;  2ZXP A;  3LS1 A;  1TWH A;  1OR2 A;  3SXM A;  5EHH A;  1EA8 A;  3AGT A;  1U89 A;  2QY9 A;  4ER9 A;  1AVO B;  4G7H F;  4ANJ A;  4CBE A;  2P7V A;  2VCC A;  3C8G B;  2PP4 A;  4U5H A;  4U5C E;  1G4W R;  1Z23 A;  2Y3H A;  4CS9 C;  4CS8 C;  3WAQ A;  4H54 A;  1SMY F;  2F22 A;  3AG1 C;  3I4U A;  2O9X A;  4KNV A;  3RVZ A;  1JPN A;  4U9E A;  3KMI A;  2KQ9 A;  5KYW B;  3JSE O;  4MVM A;  4NTB A;  3SXY A;  3I5Q A;  1D0Z A;  1RKC A;  1WOL A;  3OEO A;  4DXW A;  3F47 A;  3SP1 A;  3CSK A;  3LES A;  1T6I A;  4CIH A;  1N1C A;  4LDK A;  4C3D A;  2P1A A;  3R2P A;  4DBR A;  4MTF A;  5A6A A;  1LI5 A;  1TWA A;  4QI2 A;  2BL2 A;  3ZVR A;  3MYI A;  4E17 A;  4BJ6 C;  1BR1 A;  3NRH A;  3ZTZ A;  5FZT A;  1LPE A;  3HTK C;  2X0C A;  1PD0 A;  5IY5 C;  2M64 A;  2XS8 A;  3K1I A;  1OCO C;  3JRM O;  3ZC4 A;  2XL6 A;  5COF A;  2L6G A;  2LK4 A;  2OEX A;  1OQC A;  3NMI A;  4C3E A;  5EK0 A;  4DBQ A;  5L0F A;  4E7Z A;  1IW7 F;  1VK5 A;  3JT1 A;  1JR8 A;  1YA7 O;  3LJB A;  4IJJ A;  5E2Q A;  2HSQ A;  4U5G A;  3HNK A;  2VAS A;  3RVY A;  2LSE A;  2DYS C;  1FNT c;  3W8I A;  4MVS A;  2HMZ A;  5A6B D;  3AJM A;  4JJF A;  2ZXW C;  4XLN F;  4HEA J;  3B0P A;  3M1C B;  2XLD A;  1W2W A;  1YYX A;  4Q5S F;  3Q7L A;  3ZIB A;  4EBB A;  1K40 A;  1HW2 A;  4OD4 A;  1LE4 A;  3EHN A;  5L0I A;  3NKD A;  2OU6 A;  3DM9 B;  3EGX A;  2A68 F;  1A7V A;  3W4Y A;  1YZA A;  4OIP F;  2R03 A;  4W8P A;  1LI7 A;  4JKV A;  1NFO A;  4IAQ A;  3MYF A;  2PX3 A;  3SNH A;  1SYQ A;  2ETS A;  3N2Z B;  1LS4 A;  3EGD A;  2NUP B;  1RJ9 B;  3TD7 A;  1G5Z A;  1HMD A;  2L9J A;  2H7O A;  1TR2 A;  3FOP A;  4O6Y A;  1GS9 A;  1D0X A;  3EQL F;  3L0I A;  5HSW A;  3IQ6 A;  4PJM A;  5L0J A;  1VMA A;  2IXP A;  1ORJ A;  2QUP A;  3R7C A;  1YAU O;  2R7V A;  3H65 A;  1LE2 A;  3C8G A;  5AGF A;  4CJO A;  2YWA A;  2B0J A;  2KSF A;  3EPV A;  4CSA C;  1L7C A;  1I4Z A;  1S05 A;  1J8M F;  4J7T A;  4YN0 B;  5JRA A;  2UUH A;  1WWP A;  2Q4F A;  4U5E E;  4D4X A;  1FR0 A;  1VB5 A;  5KYW A;  1MMA A;  3AG4 C;  1H7I A;  3MBG A;  3X2Q C;  2P6V A;  1LS1 A;  2EIN C;  1MND A;  1JRA A;  2J8W A;  2R7S A;  5F5F A;  2Q00 A;  4JTC B;  3T6G B;  3C8Z A;  4E0H A;  1K04 A;  1DOV A;  2LQG A;  2WZL A;  5B1B C;  2MHR A;  1ZU5 A;  1AUE A;  2VH3 A;  1Q0D A;  4IRU A;  1E84 A;  2WZG A;  4GQH A;  4OIN F;  3JSZ A;  3RF3 A;  3GM2 A;  4XQ1 A;  3ZQY A;  4XTK A;  4X0R A;  1I4Y A;  1U6H A;  3EZH A;  4FES A;  3CEX A;  2LFD A;  2EIJ C;  4HE8 D;  1RCP A;  2XLH A;  3I5P A;  3DE9 A;  4WAB A;  2CYD A;  3T9O A;  1OCZ C;  4MW3 A;  3K6B A;  3N24 A;  1ZHW A;  3NKE A;  4KNW A;  4GEH A;  3T6B A;  5DQT A;  1OW8 A;  2YQY A;  4EIY A;  5L3Q A;  1E85 A;  2B0H A;  3ASO C;  5A6J A;  1WN0 A;  4MQ9 F;  3HNJ A;  1QVX A;  3US6 A;  2ICW G;  2FAP B;  1YAR O;  3O6X A;  3QW0 A;  3LNR A;  2GDC A;  3DE8 A;  3DJU B;  3GWL A;  1QKR A;  1NU9 C;  1IZM A;  2J7P A;  3HLZ A;  4XEK A;  2NSG A;  5TJ5 E;  4E18 A;  5T3W A;  3RKO F;  3ZWI A;  2Q9A A;  3T4R A;  1Q0F A;  3M15 A;  4A4A A;  4WGZ A;  2DYR C;  1VLS A;  3M4B A;  3DJN B;  4DOZ A;  4DVZ A;  1G8X A;  1QPU A;  3IEE A;  3DXJ F;  4N6C A;  3U5S A;  2VCB A;  2IXN A;  1T6U A;  2JPU A;  3ATP A;  3EFO B;  3GOD A;  4NCQ A;  1BR4 A;  5DS4 A;  1M56 C;  2OOC A;  3NYL A;  4KC9 A;  4WGY A;  3FHD A;  1LM3 B;  3DMD A;  3QZC A;  4K1O A;  4BJ5 A;  1RMV A;  3K7D A;  1MQV A;  3V5Z A;  2NUP A;  4Q4Z F;  1RJ9 A;  3L8J A;  2J9U A;  5AC5 A;  4YL1 A;  1M57 C;  3VRC A;  2Q9C A;  3ABM C;  1XZP A;  1OW6 A;  3NYJ A;  5BQG A;  3DKA A;  1J8Y F;  4EHP A;  1A7D A;  1WAT A;  2R25 A;  1OXB A;  3RQF A;  2DB4 A;  1V74 B;  4LDR A;  2OQM A;  4BEM J;  3KH2 A;  1Q0M A;  2PFD A;  3S29 A;  3VM6 A;  4CJG A;  1O3U A;  4PR9 A;  4IB4 A;  1XWJ A;  2LIG A;  2YL0 A;  3UMI A;  3M79 A;  4XPW A;  4YJW A;  1O5H A;  4O79 A;  3U0C A;  4N06 A;  4YT8 A;  3WG7 C;  2HSB A;  5JLI A;  1OW7 A;  1KU2 A;  1ZHY A;  1D1B A;  1GGQ A;  2CCY A;  3T6J A;  1ZYR F;  3IPM O;  3B0V C;  2LFF A;  4JTD B;  4YL0 A;  5B3S C;  3SXK A;  1BR2 A;  3N0T A;  2WZF A;  1BDJ B;  3EHM A;  3QTH A;  3OA1 A;  4HFF B;  4CDV A;  1E2X A;  4I3M A;  4PJL A;  3ABL C;  1U0B B;  2EPK X;  3CZ6 A;  3O39 A;  4PFO A;  1LKX A;  2QLA A;  3NDB B;  1XZQ A;  4CIP A;  4PFP A;  3LEO A;  1D1C A;  2XM4 A;  4ZLC A;  2HJM A;  2C03 A;  1CPR A;  4F4B A;  3FOO A;  4Z9H A;  4EBJ A;  4JRZ A;  1QLE C;  3SYN A;  1WGW A;  1C03 A;  2E87 A;  1Z5Z A;  2XLE A;  4G78 A;  2Q3T A;  4XPY A;  3KL4 A;  3UMH A;  5JT4 A;  3MLG A;  5HV9 A;  4IWB A;  4O6M A;  3W2V A;  2L7A A;  2AVK A;  3MFN A;  1UFB A;  3CQZ A;  5CI9 A;  1I5N A;  3E9V A;  1EI7 A;  1ZHZ A;  3DAF A;  4LLE A;  1A41 A;  3RFY A;  3GM3 A;  4D4N A;  2HUJ A;  5FCL A;  4C7O B;  2XXA B;  3NG1 A;  2OKU A;  2NSF A;  3Q6N A;  1ORY A;  4MVQ A;  1EQ1 A;  3FAP B;  3GEI A;  5F28 E;  3IQT A;  2D5R B;  2CDQ A;  5B3I A;  3EG9 B;  5KYU B;  1Q0G A;  3WOD F;  3PDM P;  1CGN A;  4JEB A;  2OJE D;  1A0B A;  4J32 B;  1M6T A;  5KYY B;  4U5B E;  3W8H A;  4DVY P;  5BUO A;  2UUI A;  1A7E A;  1FFH A;  1FTS A;  2KK1 A;  3G50 A;  2A6H F;  3C63 A;  3KPH A;  2KW3 C;  2P0N A;  4RBN A;  2CNW D;  3K66 A;  1CGM E;  3SZR A;  3EFO A;  2R7T A;  2JD3 A;  2WVN A;  3S28 A;  2IOQ A;  3S84 A;  2ZD9 A;  2KNH A;  2A1D D;  4QI0 A;  3S27 A;  5L0G A;  2L81 A;  3AOU A;  3UR3 C;  4JUR I;  4N6H A;  4PJJ A;  3NMK A;  5A6K A;  5L3V A;  1NSG B;  5JSL A;  1WAS A;  4PJN A;  3DWW A;  1NFN A;  2AWC A;  3ZG1 A;  4U5D E;  1M2V B;  4JVS A;  2I8B A;  1TWC A;  2H7V C;  3HJC A;  3GEH A;  1E86 A;  1DOW A;  5DLJ A;  3B71 A;  2R7U A;  2EPL X;  1TFK B;  3U2M A;  1YYJ A;  3IHU A;  1VTM P;  2KGO A;  2XL8 A;  2AU5 A;  3IQC A;  1MMN A;  2R7Q A;  2QNL A;  1ZVZ A;  3LEV A;  5JS5 A;  4CS9 A;  4CS8 A;  1VOM A;  2EIK C;  3C18 A;  3EZI A;  1R5I D;  256B A;  3BRJ A;  3JRT A;  1Z7Q c;  5L0H A;  1RXQ A;  1TQG A;  2YLI A;  2AP3 A;  2J9W A;  3TJ5 A;  2GA0 A;  3DM5 A;  4J7Y A;  2W45 A;  4OD5 A;  2Y69 C;  1F1M A;  1K05 A;  4G7O F;  1H9T A;  3K33 A;  2Y3D A;  1RKE B;  4MVU A;  5DVW A;  3AG3 C;  3FDQ A;  4XWJ A;  3TQO A;  3FVY A;  2QE9 A;  1KTM A;  1JMW A;  3V5X A;  4KI2 A;  4BJ6 A;  4OIQ F;  2IBF A;  2R05 A;  4JTA B;  3RH3 A;  2HV6 A;  2YKZ A;  4O7G A;  2W4M A;  1C02 A;  2R02 A;  3ZTM A;  4C7O A;  1ZHX A;  4U5F E;  1D1A A;  3O55 A;  5T1D B;  3JCU Q;  4BJ1 A;  1FFT C;  4I1M A;  4JEA A;  5GPG B;  2GWW A;  3U9M A;  4A2N B;  1T5O A;  2XXA A;  1KNY A;  2YLD A;  3NYM A;  4Z9I A;  2R9R B;  4AX2 A;  1BBH A;  1GM5 A;  2VB6 A;  4Q7C A;  2OEV A;  2HJ3 A;  3K1I C;  2H7B A;  3QVY A;  4CDA A;  5JUA A;  3DZA A;  3B0U X;  3J06 A;  1NG1 A;  3U3F A;  1FMW A;  1MNE A;  1FMV A;  2LD6 A;  3EG9 A;  5KYU A;  2NUT B;  4MS2 A;  5KYY A;  2WVQ A;  4CS7 A;  2H8A A;  2YL7 A;  4EWC A;  5DS6 A;  2D4U A;  4QDL A;  4C3B A;  4CDY A;  1QSP A;  1ZW3 A;  4BJT A;  3KYJ A;  2JX0 A;  4RD9 A;  4AK9 A;  3HKK A;  4GYT A;  1VYI A;  4XEV A;  4MVZ A;  4NTA A;  2J9V A;  1D0Y A;  5JP7 A;  2W4B A;  1OKK A;  3L8I A;  4E7S A;  1T01 A;  2BC5 A;  1V55 C;  2J9B A;  3RYL A;  2G62 A;  4MVR A;  4NC3 A;  2VCA A;  1M2V A;  1R4T A;  3K1H A;  2G3K A;  5E33 A;  3POV A;  3LUT B;  1Y6D A;  2OJQ A;  1JOG A;  4M63 A;  2LCH A;  2MYS A;  3VAY A;  3CAX A;  2XSE A;  2GAQ A;  3LAY A;  4MVO A;  2C04 A;  5E3C A;  2RSE B;  2CW0 F;  3L1M A;  1M2O A;  4YWQ A;  3GOR A;  3S90 A;  5BQH A;  4CSA A;  1OCR C;  3GEE A;  2OCC C;  2J45 A;  4YT4 A;  3EH2 A;  3OWT A;  2Q7R A;  2A0B A;  2PNO A;  1YZC A;  1LVK A;  3LS0 A;  4E0I A;  2HV7 A;  4L6R A;  2HFI A;  5KYX B;  1NLX A;  1L3P A;  3X1O A;  1YDI A;  4JE9 A;  2R7R A;  3KYI A;  1NBB A;  5CI8 A;  3UGP A;  5BQI A;  2BE5 F;  2KYH A;  3AQC A;  1RKE A;  3S9O A;  3GAN A;  5A69 A;  4BG0 A;  5AC4 A;  2ZXR A;  1SZI A;  3ITF A;  3QVZ A;  2PBE A;  2IM8 A;  1ZU4 A;  1GQA A;  4JCH A;  4U9D A;  2XLO A;  3B29 A;  4W8K A;  1ZHT A;  2XRH A;  3FXH A;  5KYN A;  1G4U S;  3LNM B;  3LLI A;  4HFK B;  2W9Y A;  2I15 A;  2PX0 A;  3M4C A;  3W2W A;  3L34 A;  2Z15 A;  3U3B A;  1QQ3 A;  2GFH A;  3S0X A;  2HMQ A;  4K0D A;  1HW1 A;  1PD1 A;  1UG7 A;  4XPX A;  2XS1 A;  3ABK C;  2CGE A;  3NMJ A;  2EPO A;  3TOM A;  5COM A;  4YL3 A;  1C17 M;  4DJ9 A;  2AWY A;  4WJ0 A;  4J30 B;  1HE9 A;  2TMV P;  3C8G D;  4NY3 A;  5B1A C;  1Z6A A;  3FAJ A;  3RW0 A;  1EKY A;  3F46 A;  2NUT A;  1APC A;  2DI3 A;  3TK0 A;  2WB7 A;  2P61 A;  2XM0 A;  2Y3G A;  4BEJ A;  4K7B A;  3VF0 A;  3VYW A;  5L0D A;  3ZDL A;  2HKV A;  3H2V A;  4B6I A;  1ZW2 A;  1HMO A;  4DRH B;  2FFH A;  4I1O B;  2R7W A;  3B9Q A; 
#chains in the Genus database with same CATH homology
 3DD7 A;  2Y3B A;  4XLP F;  3AG2 C;  3JYH A;  3SEO A;  3ASN C;  4O6N A;  3EJN A;  4JJG A;  4I44 A;  2XL4 A;  4KBL A;  1MMG A;  1S7Z A;  1Z3I X;  4FWV A;  3RIP A;  2IYL D;  1ST6 A;  2MWQ A;  2M4E A;  3KKB A;  2ZPA A;  2J0X A;  3Q6M A;  1QZX A;  2V3C C;  4OIR F;  4BJ5 C;  2WVO A;  4ZLD A;  3ECS A;  5D92 A;  4AE4 B;  3EH1 A;  3UGO A;  2R7O A;  2A6E F;  2FGY A;  2Y39 A;  1MMD A;  3AQB A;  5KYX A;  2J46 A;  3DAG A;  3UMK A;  5EGY A;  4JZA A;  2QTV A;  4YT5 A;  2J7P D;  1OCC C;  1NU7 D;  2PF4 E;  2IXO A;  3V7O A;  1VYK A;  2IXM A;  2NG1 A;  4G0H A;  2CNW A;  2X51 A;  5DQZ A;  1JPJ A;  3UNG C;  4LER A;  2YEV A;  3QMK A;  4MND A;  4FX5 A;  2A69 F;  5D91 A;  1TWG A;  4LAC B;  2YHS A;  5DS5 A;  4YT2 A;  1OKK D;  2KJG A;  2WL8 A;  4IAO A;  1Z63 A;  2V26 A;  2Q9B A;  4LLC A;  1SF8 A;  1V54 C;  3LLK A;  4PK4 A;  1TKN A;  3Q7G A;  2YZS A;  5E3A A;  3SP1 A;  2J0W A;  1O87 A;  1PCX A;  4ULW A;  5F5H A;  2R7X A;  3ZSU A;  2EIL C;  2EIM C;  4G7Z F;  4H4K C;  3E70 C;  3PMR A;  4JW1 A;  2G3V A;  5T3T A;  3EGX B;  2DGJ A;  3MX3 A;  4RDA A;  3PHF 2;  4AE4 A;  4OIO F;  2OG2 A;  2ZXO A;  1NZE A;  3EGD B;  2ZXP A;  3LS1 A;  1TWH A;  5EHH A;  2QY9 A;  4ANJ A;  4CBE A;  2P7V A;  2PP4 A;  4U5H A;  4U5C E;  1Z23 A;  2Y3H A;  4CS9 C;  4CS8 C;  1SMY F;  3I4U A;  3AG1 C;  4KNV A;  2O9X A;  1JPN A;  3KMI A;  2KQ9 A;  5KYW B;  3I5Q A;  1D0Z A;  3OEO A;  3F47 A;  3CSK A;  3LES A;  4CIH A;  1N1C A;  4C3D A;  4DBR A;  1TWA A;  4QI2 A;  3ZVR A;  4BJ6 C;  1BR1 A;  3NRH A;  5IY5 C;  3HTK C;  1PD0 A;  1OCO C;  3ZC4 A;  4C3E A;  4DBQ A;  4E7Z A;  1IW7 F;  1VK5 A;  3JT1 A;  3LJB A;  4IJJ A;  5E2Q A;  4U5G A;  2VAS A;  2LSE A;  2DYS C;  3W8I A;  4JJF A;  2ZXW C;  4XLN F;  4HEA J;  3B0P A;  3M1C B;  4Q5S F;  1W2W A;  3Q7L A;  3ZIB A;  4EBB A;  4OD4 A;  3EHN A;  3NKD A;  3DM9 B;  3EGX A;  2A68 F;  4OIP F;  2PX3 A;  3SNH A;  3N2Z B;  3EGD A;  2NUP B;  1RJ9 B;  3TD7 A;  2L9J A;  2H7O A;  1TR2 A;  4O6Y A;  1D0X A;  3EQL F;  3L0I A;  5HSW A;  4PJM A;  1VMA A;  2IXP A;  2R7V A;  3H65 A;  2B0J A;  3EPV A;  4CSA C;  1J8M F;  4YN0 B;  4U5E E;  5KYW A;  1MMA A;  3AG4 C;  3X2Q C;  2P6V A;  1LS1 A;  2EIN C;  1MND A;  2R7S A;  5F5F A;  2WZL A;  5B1B C;  2VH3 A;  1ZU5 A;  4IRU A;  2WZG A;  4OIN F;  3JSZ A;  4XTK A;  4X0R A;  4FES A;  3EZH A;  2EIJ C;  4HE8 D;  3I5P A;  1OCZ C;  3K6B A;  3N24 A;  1ZHW A;  3NKE A;  4KNW A;  4GEH A;  3T6B A;  5DQT A;  5L3Q A;  3ASO C;  4MQ9 F;  3O6X A;  3LNR A;  3DJU B;  2J7P A;  1NU9 C;  3HLZ A;  1IZM A;  5T3W A;  3RKO F;  2Q9A A;  3T4R A;  2DYR C;  3DJN B;  4DOZ A;  4DVZ A;  1G8X A;  3IEE A;  3DXJ F;  5DS4 A;  2IXN A;  3GOD A;  3EFO B;  1BR4 A;  1M56 C;  4KC9 A;  3NYL A;  4BJ5 A;  4YT4 A;  3FHD A;  3DMD A;  3QZC A;  3K7D A;  2NUP A;  4Q4Z F;  1RJ9 A;  2J9U A;  1M57 C;  2Q9C A;  3ABM C;  3NYJ A;  1J8Y F;  3KH2 A;  2PFD A;  3S29 A;  3UMI A;  4YJW A;  1O5H A;  4O79 A;  4N06 A;  4YT8 A;  3WG7 C;  4G7H F;  1KU2 A;  1ZHY A;  1D1B A;  3B0V C;  3T6J A;  1ZYR F;  5B3S C;  1BR2 A;  3N0T A;  2WZF A;  3EHM A;  4HFF B;  3OA1 A;  4I3M A;  4PJL A;  3ABL C;  3O39 A;  3CZ6 A;  4PFO A;  1LKX A;  3NDB B;  4PFP A;  4ZLC A;  1D1C A;  2C03 A;  4F4B A;  1QLE C;  3SYN A;  1WGW A;  2E87 A;  1Z5Z A;  2Q3T A;  3UMH A;  3KL4 A;  3MLG A;  4IWB A;  4O6M A;  3W2V A;  5CI9 A;  3CQZ A;  3E9V A;  3DAF A;  1ZHZ A;  3RFY A;  4LLE A;  5FCL A;  4C7O B;  2XXA B;  3NG1 A;  3Q6N A;  2D5R B;  2CDQ A;  3EG9 B;  5KYU B;  3WOD F;  4J32 B;  5KYY B;  4U5B E;  3W8H A;  5BUO A;  1FTS A;  1FFH A;  2A6H F;  2KW3 C;  4RBN A;  2CNW D;  3K66 A;  3SZR A;  3EFO A;  2R7T A;  2JD3 A;  2WVN A;  3S28 A;  2IOQ A;  3S27 A;  2KNH A;  2A1D D;  4QI0 A;  2L81 A;  3UR3 C;  4JUR I;  4PJJ A;  5L3V A;  4PJN A;  3ZG1 A;  4U5D E;  1M2V B;  4JVS A;  2I8B A;  1TWC A;  2H7V C;  3HJC A;  5DLJ A;  2R7U A;  2KGO A;  1MMN A;  2R7Q A;  3LEV A;  4CS9 A;  4CS8 A;  1VOM A;  2EIK C;  3EZI A;  3JRT A;  2J9W A;  3DM5 A;  2W45 A;  4OD5 A;  2Y69 C;  4G7O F;  3K33 A;  2Y3D A;  5DVW A;  3AG3 C;  3FDQ A;  4XWJ A;  3FVY A;  4KI2 A;  4BJ6 A;  4OIQ F;  3RH3 A;  2HV6 A;  4O7G A;  2W4M A;  4C7O A;  1ZHX A;  4U5F E;  1D1A A;  4BJ1 A;  5T1D B;  3JCU Q;  1FFT C;  4I1M A;  2XXA A;  4A2N B;  3NYM A;  4AX2 A;  2VB6 A;  4Q7C A;  3K1I C;  2H7B A;  3B0U X;  3DZA A;  1NG1 A;  1FMW A;  1MNE A;  1FMV A;  3EG9 A;  5KYU A;  2NUT B;  5KYY A;  2WVQ A;  4CS7 A;  4EWC A;  5DS6 A;  4QDL A;  4C3B A;  4BJT A;  4RD9 A;  4AK9 A;  4GYT A;  1VYI A;  2J9V A;  1D0Y A;  2W4B A;  1OKK A;  4E7S A;  1V55 C;  3RYL A;  2G62 A;  1M2V A;  3K1H A;  2G3K A;  5E33 A;  3POV A;  4M63 A;  2MYS A;  3VAY A;  2XSE A;  3LAY A;  2C04 A;  5E3C A;  2CW0 F;  1M2O A;  4YWQ A;  4CSA A;  1OCR C;  2OCC C;  2J45 A;  3EH2 A;  3OWT A;  1LVK A;  3LS0 A;  2HV7 A;  5KYX B;  3X1O A;  2R7R A;  5CI8 A;  3UGP A;  2BE5 F;  3AQC A;  3GAN A;  4BG0 A;  2ZXR A;  1SZI A;  3ITF A;  1ZU4 A;  4JCH A;  4W8K A;  1ZHT A;  2XRH A;  5KYN A;  4HFK B;  3LLI A;  2W9Y A;  2PX0 A;  3W2W A;  3L34 A;  2Z15 A;  2GFH A;  3S0X A;  4K0D A;  1PD1 A;  4DVY P;  3ABK C;  2CGE A;  4WJ0 A;  4J30 B;  5B1A C;  4NY3 A;  1Z6A A;  3FAJ A;  3F46 A;  2NUT A;  2WB7 A;  2Y3G A;  4BEJ A;  4K7B A;  3VYW A;  4B6I A;  4P6I C;  2FFH A;  4I1O B;  2R7W A;  3B9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...