2L81A

Solution nmr structure of the serine-rich domain of hef1 (enhancer of filamentation 1) from homo sapiens, northeast structural genomics consortium target hr5554a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
b'MGHHHHHHSHMDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enhancer of filamentation 1
molecule tags Cell adhesion
source organism Homo sapiens
publication title Northeast Structural Genomics Consortium Target HR5554A
rcsb
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l81A00
2L81A 1Z23A
chains in the Genus database with same CATH superfamily
3C8GB 4XEFA 1ZHTA 3G4XA 3B0PA 4JURI 4CS8A 5A6AA 3JCUQ 3ZG1A 1Z7Qc 4HE8D 2XLDA 4OINF 4O79A 3AOUA 4PR9A 4BJ1A 1H9TA 1NFOA 2EINC 2R7XA 3V7OA 3GM1A 3DJUB 1TFKB 4WGYA 4U9EA 4XPXA 1JAFA 3ZWIA 2P0NA 2YLDA 2FFHA 4JTDB 2XS8A 3ZQVA 1VK5A 2DGJA 3HLZA 1QQ3A 3EZHA 3K6BA 2HMQA 4I1OB 4EWCA 5L0GA 5CI8A 5F28E 2HV7A 4K7BA 1EI7A 4ONSA 3EH1A 3LLKA 3NKDA 2AVKA 4U5EE 1JR8A 2EPOA 3BEHA 1XZPA 3GM3A 3UMKA 3O39A 1FFTC 2Y3DA 1FTSA 3EQLF 2R05A 3U5SA 3QW1A 5A6BD 2PNOA 4MVZA 2D5RB 5HV9A 2C03A 2R9RB 3N24A 2OEXA 4MVMA 1VLTA 2YL0A 3FHDA 4YJWA 1PD0A 5KYXB 1DOVA 3U0CA 4XPWA 2R03A 1HY5A 2J7PD 2B0JA 4O6NA 3EGDB 5EHHA 5KYWA 3ZVRA 3RVZA 1O87A 4O6YA 4HEAJ 3TD7A 2WZLA 1ORSC 4P6IC 1CPQA 2DYRC 3EZIA 2EPMX 4I44A 5A6BA 4XEVA 5KYXA 4ZLDA 1IZMA 2BE5F 2CW0F 3K33A 1ZHZA 3L8JA 3B71A 3DJNB 1Z5ZA 3IQ5A 1WTYA 2ZXOA 4AL0A 4JJGA 2R25A 2WVOA 1LKXA 2HFIA 3C8GD 1OQCA 2PF4E 3RQEA 2I8BA 5KYNA 4YWQA 3NKEA 3R7CA 4KI2A 2ETSA 2Z15A 4BG0A 1M56C 4IAOA 3C63A 1NU7D 3EHMA 3UR3C 5EK0A 2L9JA 4J32B 1VTMP 1TR2A 3RH3A 3EFOB 3EHNA 4MTOA 4JRZA 2M4EA 2Q9AA 3MYFA 4CS9C 4EIYA 1B68A 1LS1A 2A6HF 2J0WA 4U5HA 2HUJA 3SXZA 4LLCA 5AGFA 4BJ5A 3UMHA 1VYKA 3I5PA 3QVZA 3Q7LA 1WOLA 4X0RA 4XWJA 2HZ8A 5JRAA 3FVYA 2R02A 2XL4A 4E0IA 1Q0KA 2DI3A 1OW8A 3DD7A 1Y4CA 2OQMA 2DB4A 1D0XA 2LP4A 3CZ6A 3NG1A 4EBBA 2L7AA 1YLMA 3S0XA 4CX9A 1D0ZA 1TFOB 3PDMP 1MQVA 2YL1A 2H7VC 3KYIA 2J9UA 5BUOA 3ITFA 3ZQYA 1WASA 3B0VC 3F47A 2EIMC 1Q0FA 4QDLA 4U5BE 3K66A 4W8KA 3JZ0A 2L6HA 1EA8A 4PFOA 1Q0MA 4MTGA 3F46A 2YKZA 4EHPA 1VOMA 4M63A 3H65A 1K40A 2Q4FA 4EBJA 2PBEA 2XL6A 3KYJA 4N06A 5DS5A 2XXAB 256BA 3JTLO 4ULWA 3B29A 1GS9A 2CGEA 1RJ9B 5L0IA 4Q5SF 4DJ9A 1NU9C 1OCZC 2IOQA 2QTVA 3TJ5A 4DBQA 4OIRF 3TK0A 1HW1A 1SZIA 4CDVA 1RMVA 2ZXRA 3NMJA 4BEJA 4FESA 5D92A 3I4UA 3SZRA 4KC9A 1OCCC 4U5CE 4U5GA 4MVOA 1BBHA 3R2PA 4CIHA 4XEKA 4OIQF 4K1OA 4BJ6A 5T3WA 5B3SC 2XXAA 3US6A 3KH2A 1JPJA 4C3DA 2H8AA 3ZIBA 3G4ZA 5K0IA 1U6HA 2VC9A 2QNLA 4IJJA 1T01A 1Z23A 3NYMA 1U89A 4IRUA 4N6CA 3RQFA 1NBBA 4K0DA 3DKAA 2R7RA 1JOGA 2VASA 3DE9A 1RCPA 5JLIA 3AG2C 1T6QA 5E3AA 2LFDA 1OR2A 1KU2A 1Z6AA 2A0UA 3W8IA 3DM5A 1JRAA 1PCXA 1QLEC 3ABMC 4DOZA 1YZCA 4DRJB 4PFPA 2P6VA 3LS0A 3GM2A 1JMWA 3G50A 4GYTA 4YN0B 1QZXA 3DM9B 5JT4A 2LQGA 3RQGA 2A68F 3T6JA 2L6FA 3O55A 2YVKA 5B3IA 1YZAA 1BDJB 1VMAA 4Q4ZF 2J0XA 3DZAA 5DQZA 4MVSA 3HTKC 3VAYA 3ZTMA 4G0HA 1HE1A 2LK4A 4LACB 3U2LA 3O10A 3HKKA 4E18A 5JVEA 1YAUO 1LS4A 5JUAA 2R7VA 4YL1A 1VLSA 4AX2A 3SXMA 1FR0A 1MNDA 2NSFA 3EG9A 5GPGB 5L3VA 2R7WA 1WATA 3V5XA 3NDBB 2OJQA 3LAYA 4CDYA 2L81A 3RVYA 2W4MA 2GWWA 3S29A 3GWNA 1CGOA 4D4NA 4YK5A 1AEPA 4NQFA 4G7OF 1MMDA 4QI0A 3ZTZA 2DYSC 1HW2A 4E7ZA 2WVNA 3AG4C 3K1IC 2R7UA 3VRCA 4DVYP 1J8YF 2YL7A 2CNWD 2A1DD 2CYDA 1Z63A 5L0FA 2EILC 5D91A 3HNLA 4FAPB 4PJJA 3OWTA 3TULA 1E2XA 3ABLC 5JS5A 1OXBA 2R7OA 3FAPB 2I15A 3GEEA 3MYIA 1FNTc 3L34A 3NYLA 5COMA 3UMIA 2B0HA 3VM6A 5TJ5E 3DAFA 4MVRA 4AL1A 3J06A 1GGQA 4NC3A 2CNWA 1T6UA 3W8HA 4B6IA 4EKWA 2XLHA 3ASOC 2HSBA 4WJ0A 1WGWA 1OCRC 3JYYA 2C04A 3FXHA 5KYYB 1U0BB 1M2OA 5E33A 2NG1A 5A6KA 2IXMA 2OU6A 1A7VA 1BR2A 1OKKD 1YDIA 2V26A 2YZSA 3NMIA 4BJTA 3LESA 1Y6DA 2J9WA 4JC7A 1EKYA 4XLNF 4HFKB 1S05A 1G5ZA 1MMGA 1O3UA 5T3TA 1I4YA 4JEAA 3ABKC 2D4UA 1T5OA 2IXPA 3Q6MA 4MQ9F 3WG7C 3QMKA 1YARO 3HJCA 4O7GA 5A69A 2XRHA 2RD9A 4MTFA 1IW7F 4YT5A 2L6GA 2EIJC 2CCYA 2NUPA 1LI5A 1V74B 2JX0A 1D0YA 3ZSUA 3C18A 3E9VA 3H2UA 2A0BA 2HS5A 4C7OA 4D4XA 4KNVA 5DS4A 2YWAA 1HMOA 1T9KA 1SR2A 4CS9A 3JYHA 4J7TA 1R4TA 1ORJA 3PCVA 2YLGA 2OEVA 3EGXA 1WN0A 3S84A 4N6HA 1YVIA 4LLEA 3EFOA 4G7HF 1OKKA 5KYUA 3S28A 3LJBA 4E17A 1ZU5A 3T9OA 3LS1A 2M64A 3AGUA 5CIVA 2YHSA 1JPNA 3RW0A 1A41A 4JJFA 4OD5A 4P9TA 3KL4A 1E86A 1LM3B 5FZTA 2QY9A 3ZC4A 2XLMA 2Q7RA 5KYYA 3NRHA 1ST6A 2UUHA 4IWBA 2VH3A 1OCOC 2YLIA 4MS2A 5KYUB 3CAXA 1NZEA 5AC5A 3LUTB 3UNGC 1I5NA 3OEOA 3W2VA 1QPUA 2MWQA 3WAQA 2EPLX 4JTAB 3PMRA 2KNHA 1HMDA 4QI2A 4XTKA 4DVZA 4YT8A 3EGXB 4DXWA 1Q0GA 3SNHA 3RFYA 5B1AC 2W9YA 2MYSA 3AJMA 1O5HA 3OA1A 4JE9A 3M15A 4JW1A 1K04A 4H4KC 4U5DE 5F5HA 4NTAA 2CDQA 4JCZA 3C8GA 5BQHA 1ZHXA 1TWHA 4XQ1A 3U8PA 2YRFA 4WABA 4NTFA 3JT1A 5E2QA 3U3FA 1M2VB 1BZ4A 3H2VA 3U3BA 1YJGA 3T6BA 2R7TA 3AG1C 1H7IA 2V3CC 4FX5A 3QTHA 2LSEA 1C17M 2E87A 3M1CB 4PJMA 2QUPA 2XLOA 4LDQA 2TMVP 4RBNA 3IHUA 4KNWA 1MNEA 2GDCA 3S9OA 1J8MF 2XL8A 3TQOA 1ORYA 4DRIB 1LI7A 4CSAC 5L0CA 1W2WA 3CSKA 1M2VA 4I3MA 2FGYA 1VB5A 4IB4A 4C3BA 5IY5C 2LD6A 3POVA 2NSGA 1LIHA 2OJED 3BRJA 3LEOA 3M4BA 4OIOF 3HNKA 2MHRA 2X51A 3N0TA 4A4AA 2EPKX 4MW8A 1M57C 2AWYA 3GWLA 2HV6A 4JZAA 2NUTB 4HFFB 5BQGA 2R7QA 3L1MA 4Z9JA 5JP7A 5DQTA 2XLEA 1ZZPA 2AP3A 2Q9CA 2UUIA 3FAJA 2P1AA 4U5FE 3TJ6A 3U8VA 3B0UX 3NYJA 3T6GB 1OW7A 3DE8A 4JCHA 2BL2A 2XLVA 2WZFA 3FDQA 3B9QA 1KNYA 1V55C 3M79A 2F22A 3C7JA 2ZXWC 5L0JA 2OCCC 3EPVA 2P7VA 3GODA 1LVKA 1OW6A 3TOMA 3MFNA 2O9XA 3K1IA 4P9FA 5T1DB 3L0IA 2A69F 3A11A 3AGTA 2R7SA 3X2QC 1YYJA 2VB6A 3SXYA 1BR4A 2Q00A 4LDRA 4O6MA 2G3VA 3CEXA 3W2WA 2J9VA 2Y3BA 3O6XA 4U9DA 2BC5A 4IGGA 5B1BC 3RIPA 3U9JA 3GEHA 5AC4A 3U9MA 3ASNC 3U2MA 1RKCA 2Y39A 1MMAA 1YA9A 4C3EA 5F5FA 2YQYA 5KYWB 2GAQA 2VCBA 2WVQA 1L3PA 1A7EA 4LDKA 2EPNA 4XPYA 5JSLA 2RSEB 3SXKA 3WODF 4CS8C 2KC3A 1C03A 3KMIA 4C7OB 1LE4A 4CSAA 4G78A 2IBFA 1OR3A 1QVXA 2KK1A 1QKRA 2PX0A 2Q9BA 2QE9A 2WB7A 1PV3A 1F1MA 3AG3C 3MLGA 2NPUA 2JD3A 4DRHB 1CGME 1SMYF 4ANJA 4NCQA 2IM8A 4CBEA 4MVUA 2ZXPA 5HSWA 3EH2A 3I5QA 2XM4A 3DMDA 3MBGA 1E83A 2A6EF 5L3QA 3MX3A 1C02A 2HJMA 4JTCB 1WWPA 2PX3A 3T4RA 1TWGA 4CDAA 5L0HA 4XLPF 4PACA 2Y3GA 4ZLCA 2ZPAA 2H7BA 1ZU4A 2QLAA 2HMZA 3N2ZB 4PJNA 1T6IA 2IXNA 3DI5A 4CS7A 2OG2A 5DVWA 2KQ9A 3JSZA 4CIPA 3NMKA 1G4WR 2X0CA 5E3CA 3LLIA 2XM0A 5BQIA 3RF3A 2Y3HA 4BPMA 3TOLA 5EGYA 3IPMO 3JSEO 2JPUA 2LFFA 3HNJA 4EUKB 4E7SA 4G7ZF 1ZHYA 1VYIA 1I4ZA 1ZW2A 1GQAA 4PJLA 2KGOA 3IQCA 3IQTA 4JVSA 2J7PA 3RYLA 4Q7CA 1E84A 1EQ1A 4Z9IA 4I1MA 3C62A 3AQCA 3FOOA 4L6RA 3X1OA 3QW0A 4CJGA 3K1HA 1E85A 3SP1A 3PHF2 3UGOA 1GM5A 2W45A 3V5ZA 4F4BA 2XS1A 1FMVA 3ECSA 3LNRA 5CI9A 1L7CA 4CJOA 1K05A 4YL0A 3FOPA 2PFDA 2H7OA 4H54A 4MNDA 2ASRA 4JIOA 4MW3A 3ZDLA 2PP4A 1AUEA 3DXJF 4YT4A 1YA7O 4Z9HA 4PK4A 4BJ6C 5DLJA 1Q0DA 1V54C 3K7DA 1CPRA 4BEMJ 3UGPA 1SYQA 2KJGA 3CQZA 1RKEB 1TWCA 2EIKC 3JRMO 1Z3IX 1KTMA 2HKVA 2OKUA 3Q7GA 2NUTA 5A6JA 1S7ZA 1TWAA 3HNIA 1ZW3A 2J45A 1CGNA 3EGDA 3QVYA 4A2NB 3GORA 3ATPA 1TQGA 1G8XA 4W8PA 4OD4A 4E0HA 2HSQA 4MVQA 1XZQA 2OOCA 1RKEA 2P61A 5COFA 3SYNA 2IYLD 5DS6A 3Q6NA 2FAPB 3S90A 3KPHA 2HJ3A 3VF0A 1ZYRF 2ICWG 2WL8A 2GFHA 2XSEA 3JRTA 3V5YA 4BJ5C 1G4US 1V4AA 2Y69C 5L0DA 2WZGA 4GEHA 1D1CA 1APCA 3FMSA 4JKVA 2AU5A 4KBLA 4YL3A 3WHNA 4DBRA 1NLXA 3KKBA 4RD9A 4LERA 1NG1A 2KYHA 2KSFA 1AVOB 2J8WA 1N1CA 4YT2A 2Q3TA 4J30B 3C8ZA 1NSGB 2AWCA 2YEVA 3S27A 1YYXA 3IQ6A 2IXOA 1FMWA 4AE4A 4EBKA 1TKNA 4J7YA 4AE4B 1XWJA 1RXQA 1M6TA 4NY3A 3VYWA 4OIPF 1NFNA 3EJNA 1UFBA 3E70C 3LNMB 1BR1A 1LPEA 3A9CA 4IAQA 3RKOF 3SEOA 2YL3A 3LEVA 1FFHA 1D1BA 1RJ9A 2W4BA 3GEIA 3W4YA 2XLWA 2VCAA 4JEBA 3GANA 4N4WA 2G62A 1A0BA 1OXKA 1H9GA 2NUPB 3IEEA 4GQHA 4IARA 2LCHA 5FCLA 1PD1A 1D1AA 4ER9A 1FAPB 1HE9A 2ZD9A 3M4CA 4R32A 2J46A 3DAGA 1QSPA 3DWWA 4WGZA 5COGA 1R5ID 2J9BA 4NTBA 4ULVA 4FWVA 2KW3C 1ZHWA 2GA0A 2VCCA 1A7DA 2LIGA 4UDVA 1ZVZA 2G3KA 1H6GA 3AQBA 3EG9B 1DOWA 4RDAA 3QZCA 4AK9A 1LE2A 1UG7A 1SF8A 1MMNA 3L8IA
chains in the Genus database with same CATH topology
1ZHTA 3B0PA 4JURI 4CS8A 3JCUQ 3ZG1A 4HE8D 4OINF 4O79A 4BJ1A 2R7XA 2EINC 3V7OA 3DJUB 2FFHA 1VK5A 2DGJA 3HLZA 3EZHA 3K6BA 4I1OB 4EWCA 5CI8A 2HV7A 4K7BA 3EH1A 3LLKA 3NKDA 4U5EE 3UMKA 3O39A 1FFTC 2Y3DA 1FTSA 3EQLF 2D5RB 2C03A 3N24A 3FHDA 4YJWA 5KYXB 1PD0A 2J7PD 2B0JA 4O6NA 3EGDB 5EHHA 5KYWA 3ZVRA 1O87A 4O6YA 4HEAJ 3TD7A 2WZLA 4P6IC 2DYRC 3EZIA 4I44A 5KYXA 4ZLDA 1IZMA 2BE5F 2CW0F 3K33A 1ZHZA 3DJNB 1Z5ZA 2ZXOA 4JJGA 2WVOA 1LKXA 2PF4E 5KYNA 2I8BA 4YWQA 3NKEA 4KI2A 4BG0A 2Z15A 1M56C 1NU7D 3EHMA 3UR3C 2L9JA 4J32B 1TR2A 3RH3A 3EFOB 3EHNA 2M4EA 2Q9AA 4CS9C 1LS1A 2A6HF 2J0WA 4U5HA 4BJ5A 4LLCA 3UMHA 1VYKA 3I5PA 3Q7LA 4X0RA 4XWJA 3FVYA 2XL4A 3DD7A 3CZ6A 4EBBA 1D0XA 3NG1A 3S0XA 1D0ZA 2H7VC 2J9UA 5BUOA 3ITFA 3B0VC 3F47A 2EIMC 4QDLA 4U5BE 3K66A 4W8KA 4PFOA 3F46A 1VOMA 3H65A 4N06A 5DS5A 2XXAB 4ULWA 2CGEA 1RJ9B 4Q5SF 1NU9C 1OCZC 2IOQA 2QTVA 4DBQA 4OIRF 1SZIA 2ZXRA 4BEJA 4FESA 5D92A 3I4UA 3SZRA 4KC9A 1OCCC 4U5CE 4U5GA 4CIHA 4OIQF 4BJ6A 5T3WA 5B3SC 2XXAA 3KH2A 1JPJA 4C3DA 3ZIBA 4IJJA 1Z23A 3NYMA 4IRUA 4K0DA 2R7RA 2VASA 3AG2C 5E3AA 1Z6AA 1KU2A 3W8IA 3DM5A 1PCXA 1QLEC 4DOZA 3ABMC 4PFPA 2P6VA 3LS0A 4GYTA 4YN0B 1QZXA 3DM9B 3T6JA 2A68F 1VMAA 4Q4ZF 2J0XA 3DZAA 5DQZA 3HTKC 3VAYA 4G0HA 4LACB 2R7VA 4AX2A 1MNDA 3EG9A 5L3VA 2R7WA 3NDBB 3LAYA 2L81A 2W4MA 3S29A 1MMDA 4QI0A 2DYSC 4E7ZA 2WVNA 3AG4C 3K1IC 2R7UA 4DVYP 1J8YF 2CNWD 2A1DD 1Z63A 2EILC 5D91A 4PJJA 3OWTA 3ABLC 2R7OA 3L34A 3NYLA 3UMIA 3DAFA 2CNWA 3W8HA 4B6IA 3ASOC 4WJ0A 1WGWA 1OCRC 2C04A 5KYYB 1M2OA 5E33A 2NG1A 2IXMA 1BR2A 1OKKD 2V26A 2YZSA 4BJTA 3LESA 2J9WA 4XLNF 4HFKB 5T3TA 1MMGA 3RYLA 3ABKC 2IXPA 3Q6MA 4MQ9F 3WG7C 3QMKA 4O7GA 3HJCA 2XRHA 1IW7F 4YT5A 2EIJC 2NUPA 1D0YA 3ZSUA 3E9VA 4C7OA 4KNVA 5DS4A 4CS9A 3JYHA 3EGXA 4LLEA 3EFOA 4G7HF 1OKKA 5KYUA 3S28A 3LJBA 1ZU5A 3LS1A 2YHSA 1JPNA 4OD5A 4JJFA 3KL4A 3ZC4A 2QY9A 5KYYA 3NRHA 1ST6A 4IWBA 2VH3A 1OCOC 5KYUB 1NZEA 3UNGC 3OEOA 3W2VA 2MWQA 3PMRA 2KNHA 4QI2A 4XTKA 4DVZA 4YT8A 3EGXB 3SNHA 3RFYA 5B1AC 2W9YA 2MYSA 1O5HA 3OA1A 4JW1A 4U5DE 4H4KC 5F5HA 2CDQA 1ZHXA 1TWHA 5E2QA 3JT1A 1M2VB 3T6BA 2R7TA 3AG1C 2V3CC 4FX5A 2LSEA 2E87A 3M1CB 4PJMA 4RBNA 4KNWA 1MNEA 1J8MF 4CSAC 4G7OF 1W2WA 3CSKA 1M2VA 4I3MA 2FGYA 4C3BA 5IY5C 3POVA 4OIOF 2X51A 3N0TA 1M57C 2HV6A 4JZAA 2NUTB 4HFFB 2R7QA 5DQTA 3FAJA 2Q9CA 4U5FE 3B0UX 3NYJA 4JCHA 2WZFA 3FDQA 3B9QA 1V55C 2ZXWC 2OCCC 3EPVA 2P7VA 3GODA 1LVKA 2O9XA 5T1DB 2A69F 2R7SA 3X2QC 2VB6A 1BR4A 4O6MA 2G3VA 3W2WA 2J9VA 2Y3BA 3O6XA 5B1BC 3RIPA 3ASNC 2Y39A 1MMAA 4C3EA 5F5FA 5KYWB 2WVQA 3WODF 4CS8C 3KMIA 4C7OB 4CSAA 4M63A 3AG3C 4G7ZF 2PX0A 2Q9BA 2WB7A 3MLGA 4IAOA 2JD3A 1SMYF 4ANJA 4CBEA 2ZXPA 5HSWA 3EH2A 3I5QA 3DMDA 2A6EF 5L3QA 3MX3A 2PX3A 3T4RA 1TWGA 4XLPF 2Y3GA 4ZLCA 2ZPAA 2H7BA 1ZU4A 3N2ZB 4PJNA 2IXNA 4CS7A 2OG2A 5DVWA 2KQ9A 3JSZA 5E3CA 3LLIA 2Y3HA 5EGYA 4E7SA 1ZHYA 1VYIA 4PJLA 2KGOA 4JVSA 2J7PA 4Q7CA 4I1MA 3AQCA 3X1OA 3PHF2 3K1HA 3UGOA 3SP1A 2W45A 4F4BA 1FMVA 3ECSA 3LNRA 2PFDA 2H7OA 4MNDA 4YT4A 2PP4A 3DXJF 4BJ6C 4PK4A 5DLJA 1V54C 3K7DA 3UGPA 2KJGA 3CQZA 1TWCA 2EIKC 1Z3IX 3Q7GA 2NUTA 1S7ZA 1TWAA 4A2NB 2J45A 3EGDA 1G8XA 4OD4A 3SYNA 2IYLD 5DS6A 3Q6NA 1ZYRF 2WL8A 2GFHA 2XSEA 3JRTA 4BJ5C 2Y69C 2WZGA 4GEHA 1D1CA 4KBLA 4DBRA 3KKBA 4RD9A 4LERA 1NG1A 1N1CA 4YT2A 2Q3TA 4J30B 3S27A 2YEVA 2IXOA 1FMWA 4AE4A 1TKNA 4AE4B 4NY3A 3VYWA 4OIPF 3RKOF 3EJNA 3SEOA 3E70C 1BR1A 3LEVA 1FFHA 1D1BA 1RJ9A 2W4BA 3GANA 5CI9A 2G62A 2NUPB 3IEEA 5FCLA 1PD1A 1D1AA 2J46A 3DAGA 4FWVA 2KW3C 1ZHWA 2G3KA 3AQBA 3EG9B 4RDAA 3QZCA 4AK9A 3L0IA 1SF8A 1MMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L81 A;  1Z23 A; 
#chains in the Genus database with same CATH topology
 3C8G B;  4XEF A;  1ZHT A;  3G4X A;  3B0P A;  4JUR I;  4CS8 A;  5A6A A;  3JCU Q;  3ZG1 A;  1Z7Q c;  4HE8 D;  2XLD A;  4OIN F;  4O79 A;  3AOU A;  4PR9 A;  4BJ1 A;  1H9T A;  1NFO A;  2EIN C;  2R7X A;  3V7O A;  3GM1 A;  3DJU B;  1TFK B;  4WGY A;  4U9E A;  4XPX A;  1JAF A;  3ZWI A;  2P0N A;  2YLD A;  2FFH A;  4JTD B;  2XS8 A;  3ZQV A;  1VK5 A;  2DGJ A;  3HLZ A;  1QQ3 A;  3EZH A;  3K6B A;  2HMQ A;  4I1O B;  4EWC A;  5L0G A;  5CI8 A;  5F28 E;  2HV7 A;  4K7B A;  1EI7 A;  4ONS A;  3EH1 A;  3LLK A;  3NKD A;  2AVK A;  4U5E E;  1JR8 A;  2EPO A;  3BEH A;  1XZP A;  3GM3 A;  3UMK A;  3O39 A;  1FFT C;  2Y3D A;  1FTS A;  3EQL F;  2R05 A;  3U5S A;  3QW1 A;  5A6B D;  2PNO A;  4MVZ A;  2D5R B;  5HV9 A;  2C03 A;  2R9R B;  3N24 A;  2OEX A;  4MVM A;  1VLT A;  2YL0 A;  3FHD A;  4YJW A;  1PD0 A;  5KYX B;  1DOV A;  3U0C A;  4XPW A;  2R03 A;  1HY5 A;  2J7P D;  2B0J A;  4O6N A;  3EGD B;  5EHH A;  5KYW A;  3ZVR A;  3RVZ A;  1O87 A;  4O6Y A;  4HEA J;  3TD7 A;  2WZL A;  1ORS C;  4P6I C;  1CPQ A;  2DYR C;  3EZI A;  2EPM X;  4I44 A;  5A6B A;  4XEV A;  5KYX A;  4ZLD A;  1IZM A;  2BE5 F;  2CW0 F;  3K33 A;  1ZHZ A;  3L8J A;  3B71 A;  3DJN B;  1Z5Z A;  3IQ5 A;  1WTY A;  2ZXO A;  4AL0 A;  4JJG A;  2R25 A;  2WVO A;  1LKX A;  2HFI A;  3C8G D;  1OQC A;  2PF4 E;  3RQE A;  2I8B A;  5KYN A;  4YWQ A;  3NKE A;  3R7C A;  4KI2 A;  2ETS A;  2Z15 A;  4BG0 A;  1M56 C;  4IAO A;  3C63 A;  1NU7 D;  3EHM A;  3UR3 C;  5EK0 A;  2L9J A;  4J32 B;  1VTM P;  1TR2 A;  3RH3 A;  3EFO B;  3EHN A;  4MTO A;  4JRZ A;  2M4E A;  2Q9A A;  3MYF A;  4CS9 C;  4EIY A;  1B68 A;  1LS1 A;  2A6H F;  2J0W A;  4U5H A;  2HUJ A;  3SXZ A;  4LLC A;  5AGF A;  4BJ5 A;  3UMH A;  1VYK A;  3I5P A;  3QVZ A;  3Q7L A;  1WOL A;  4X0R A;  4XWJ A;  2HZ8 A;  5JRA A;  3FVY A;  2R02 A;  2XL4 A;  4E0I A;  1Q0K A;  2DI3 A;  1OW8 A;  3DD7 A;  1Y4C A;  2OQM A;  2DB4 A;  1D0X A;  2LP4 A;  3CZ6 A;  3NG1 A;  4EBB A;  2L7A A;  1YLM A;  3S0X A;  4CX9 A;  1D0Z A;  1TFO B;  3PDM P;  1MQV A;  2YL1 A;  2H7V C;  3KYI A;  2J9U A;  5BUO A;  3ITF A;  3ZQY A;  1WAS A;  3B0V C;  3F47 A;  2EIM C;  1Q0F A;  4QDL A;  4U5B E;  3K66 A;  4W8K A;  3JZ0 A;  2L6H A;  1EA8 A;  4PFO A;  1Q0M A;  4MTG A;  3F46 A;  2YKZ A;  4EHP A;  1VOM A;  4M63 A;  3H65 A;  1K40 A;  2Q4F A;  4EBJ A;  2PBE A;  2XL6 A;  3KYJ A;  4N06 A;  5DS5 A;  2XXA B;  256B A;  3JTL O;  4ULW A;  3B29 A;  1GS9 A;  2CGE A;  1RJ9 B;  5L0I A;  4Q5S F;  4DJ9 A;  1NU9 C;  1OCZ C;  2IOQ A;  2QTV A;  3TJ5 A;  4DBQ A;  4OIR F;  3TK0 A;  1HW1 A;  1SZI A;  4CDV A;  1RMV A;  2ZXR A;  3NMJ A;  4BEJ A;  4FES A;  5D92 A;  3I4U A;  3SZR A;  4KC9 A;  1OCC C;  4U5C E;  4U5G A;  4MVO A;  1BBH A;  3R2P A;  4CIH A;  4XEK A;  4OIQ F;  4K1O A;  4BJ6 A;  5T3W A;  5B3S C;  2XXA A;  3US6 A;  3KH2 A;  1JPJ A;  4C3D A;  2H8A A;  3ZIB A;  3G4Z A;  5K0I A;  1U6H A;  2VC9 A;  2QNL A;  4IJJ A;  1T01 A;  1Z23 A;  3NYM A;  1U89 A;  4IRU A;  4N6C A;  3RQF A;  1NBB A;  4K0D A;  3DKA A;  2R7R A;  1JOG A;  2VAS A;  3DE9 A;  1RCP A;  5JLI A;  3AG2 C;  1T6Q A;  5E3A A;  2LFD A;  1OR2 A;  1KU2 A;  1Z6A A;  2A0U A;  3W8I A;  3DM5 A;  1JRA A;  1PCX A;  1QLE C;  3ABM C;  4DOZ A;  1YZC A;  4DRJ B;  4PFP A;  2P6V A;  3LS0 A;  3GM2 A;  1JMW A;  3G50 A;  4GYT A;  4YN0 B;  1QZX A;  3DM9 B;  5JT4 A;  2LQG A;  3RQG A;  2A68 F;  3T6J A;  2L6F A;  3O55 A;  2YVK A;  5B3I A;  1YZA A;  1BDJ B;  1VMA A;  4Q4Z F;  2J0X A;  3DZA A;  5DQZ A;  4MVS A;  3HTK C;  3VAY A;  3ZTM A;  4G0H A;  1HE1 A;  2LK4 A;  4LAC B;  3U2L A;  3O10 A;  3HKK A;  4E18 A;  5JVE A;  1YAU O;  1LS4 A;  5JUA A;  2R7V A;  4YL1 A;  1VLS A;  4AX2 A;  3SXM A;  1FR0 A;  1MND A;  2NSF A;  3EG9 A;  5GPG B;  5L3V A;  2R7W A;  1WAT A;  3V5X A;  3NDB B;  2OJQ A;  3LAY A;  4CDY A;  2L81 A;  3RVY A;  2W4M A;  2GWW A;  3S29 A;  3GWN A;  1CGO A;  4D4N A;  4YK5 A;  1AEP A;  4NQF A;  4G7O F;  1MMD A;  4QI0 A;  3ZTZ A;  2DYS C;  1HW2 A;  4E7Z A;  2WVN A;  3AG4 C;  3K1I C;  2R7U A;  3VRC A;  4DVY P;  1J8Y F;  2YL7 A;  2CNW D;  2A1D D;  2CYD A;  1Z63 A;  5L0F A;  2EIL C;  5D91 A;  3HNL A;  4FAP B;  4PJJ A;  3OWT A;  3TUL A;  1E2X A;  3ABL C;  5JS5 A;  1OXB A;  2R7O A;  3FAP B;  2I15 A;  3GEE A;  3MYI A;  1FNT c;  3L34 A;  3NYL A;  5COM A;  3UMI A;  2B0H A;  3VM6 A;  5TJ5 E;  3DAF A;  4MVR A;  4AL1 A;  3J06 A;  1GGQ A;  4NC3 A;  2CNW A;  1T6U A;  3W8H A;  4B6I A;  4EKW A;  2XLH A;  3ASO C;  2HSB A;  4WJ0 A;  1WGW A;  1OCR C;  3JYY A;  2C04 A;  3FXH A;  5KYY B;  1U0B B;  1M2O A;  5E33 A;  2NG1 A;  5A6K A;  2IXM A;  2OU6 A;  1A7V A;  1BR2 A;  1OKK D;  1YDI A;  2V26 A;  2YZS A;  3NMI A;  4BJT A;  3LES A;  1Y6D A;  2J9W A;  4JC7 A;  1EKY A;  4XLN F;  4HFK B;  1S05 A;  1G5Z A;  1MMG A;  1O3U A;  5T3T A;  1I4Y A;  4JEA A;  3ABK C;  2D4U A;  1T5O A;  2IXP A;  3Q6M A;  4MQ9 F;  3WG7 C;  3QMK A;  1YAR O;  3HJC A;  4O7G A;  5A69 A;  2XRH A;  2RD9 A;  4MTF A;  1IW7 F;  4YT5 A;  2L6G A;  2EIJ C;  2CCY A;  2NUP A;  1LI5 A;  1V74 B;  2JX0 A;  1D0Y A;  3ZSU A;  3C18 A;  3E9V A;  3H2U A;  2A0B A;  2HS5 A;  4C7O A;  4D4X A;  4KNV A;  5DS4 A;  2YWA A;  1HMO A;  1T9K A;  1SR2 A;  4CS9 A;  3JYH A;  4J7T A;  1R4T A;  1ORJ A;  3PCV A;  2YLG A;  2OEV A;  3EGX A;  1WN0 A;  3S84 A;  4N6H A;  1YVI A;  4LLE A;  3EFO A;  4G7H F;  1OKK A;  5KYU A;  3S28 A;  3LJB A;  4E17 A;  1ZU5 A;  3T9O A;  3LS1 A;  2M64 A;  3AGU A;  5CIV A;  2YHS A;  1JPN A;  3RW0 A;  1A41 A;  4JJF A;  4OD5 A;  4P9T A;  3KL4 A;  1E86 A;  1LM3 B;  5FZT A;  2QY9 A;  3ZC4 A;  2XLM A;  2Q7R A;  5KYY A;  3NRH A;  1ST6 A;  2UUH A;  4IWB A;  2VH3 A;  1OCO C;  2YLI A;  4MS2 A;  5KYU B;  3CAX A;  1NZE A;  5AC5 A;  3LUT B;  3UNG C;  1I5N A;  3OEO A;  3W2V A;  1QPU A;  2MWQ A;  3WAQ A;  2EPL X;  4JTA B;  3PMR A;  2KNH A;  1HMD A;  4QI2 A;  4XTK A;  4DVZ A;  4YT8 A;  3EGX B;  4DXW A;  1Q0G A;  3SNH A;  3RFY A;  5B1A C;  2W9Y A;  2MYS A;  3AJM A;  1O5H A;  3OA1 A;  4JE9 A;  3M15 A;  4JW1 A;  1K04 A;  4H4K C;  4U5D E;  5F5H A;  4NTA A;  2CDQ A;  4JCZ A;  3C8G A;  5BQH A;  1ZHX A;  1TWH A;  4XQ1 A;  3U8P A;  2YRF A;  4WAB A;  4NTF A;  3JT1 A;  5E2Q A;  3U3F A;  1M2V B;  1BZ4 A;  3H2V A;  3U3B A;  1YJG A;  3T6B A;  2R7T A;  3AG1 C;  1H7I A;  2V3C C;  4FX5 A;  3QTH A;  2LSE A;  1C17 M;  2E87 A;  3M1C B;  4PJM A;  2QUP A;  2XLO A;  4LDQ A;  2TMV P;  4RBN A;  3IHU A;  4KNW A;  1MNE A;  2GDC A;  3S9O A;  1J8M F;  2XL8 A;  3TQO A;  1ORY A;  4DRI B;  1LI7 A;  4CSA C;  5L0C A;  1W2W A;  3CSK A;  1M2V A;  4I3M A;  2FGY A;  1VB5 A;  4IB4 A;  4C3B A;  5IY5 C;  2LD6 A;  3POV A;  2NSG A;  1LIH A;  2OJE D;  3BRJ A;  3LEO A;  3M4B A;  4OIO F;  3HNK A;  2MHR A;  2X51 A;  3N0T A;  4A4A A;  2EPK X;  4MW8 A;  1M57 C;  2AWY A;  3GWL A;  2HV6 A;  4JZA A;  2NUT B;  4HFF B;  5BQG A;  2R7Q A;  3L1M A;  4Z9J A;  5JP7 A;  5DQT A;  2XLE A;  1ZZP A;  2AP3 A;  2Q9C A;  2UUI A;  3FAJ A;  2P1A A;  4U5F E;  3TJ6 A;  3U8V A;  3B0U X;  3NYJ A;  3T6G B;  1OW7 A;  3DE8 A;  4JCH A;  2BL2 A;  2XLV A;  2WZF A;  3FDQ A;  3B9Q A;  1KNY A;  1V55 C;  3M79 A;  2F22 A;  3C7J A;  2ZXW C;  5L0J A;  2OCC C;  3EPV A;  2P7V A;  3GOD A;  1LVK A;  1OW6 A;  3TOM A;  3MFN A;  2O9X A;  3K1I A;  4P9F A;  5T1D B;  3L0I A;  2A69 F;  3A11 A;  3AGT A;  2R7S A;  3X2Q C;  1YYJ A;  2VB6 A;  3SXY A;  1BR4 A;  2Q00 A;  4LDR A;  4O6M A;  2G3V A;  3CEX A;  3W2W A;  2J9V A;  2Y3B A;  3O6X A;  4U9D A;  2BC5 A;  4IGG A;  5B1B C;  3RIP A;  3U9J A;  3GEH A;  5AC4 A;  3U9M A;  3ASN C;  3U2M A;  1RKC A;  2Y39 A;  1MMA A;  1YA9 A;  4C3E A;  5F5F A;  2YQY A;  5KYW B;  2GAQ A;  2VCB A;  2WVQ A;  1L3P A;  1A7E A;  4LDK A;  2EPN A;  4XPY A;  5JSL A;  2RSE B;  3SXK A;  3WOD F;  4CS8 C;  2KC3 A;  1C03 A;  3KMI A;  4C7O B;  1LE4 A;  4CSA A;  4G78 A;  2IBF A;  1OR3 A;  1QVX A;  2KK1 A;  1QKR A;  2PX0 A;  2Q9B A;  2QE9 A;  2WB7 A;  1PV3 A;  1F1M A;  3AG3 C;  3MLG A;  2NPU A;  2JD3 A;  4DRH B;  1CGM E;  1SMY F;  4ANJ A;  4NCQ A;  2IM8 A;  4CBE A;  4MVU A;  2ZXP A;  5HSW A;  3EH2 A;  3I5Q A;  2XM4 A;  3DMD A;  3MBG A;  1E83 A;  2A6E F;  5L3Q A;  3MX3 A;  1C02 A;  2HJM A;  4JTC B;  1WWP A;  2PX3 A;  3T4R A;  1TWG A;  4CDA A;  5L0H A;  4XLP F;  4PAC A;  2Y3G A;  4ZLC A;  2ZPA A;  2H7B A;  1ZU4 A;  2QLA A;  2HMZ A;  3N2Z B;  4PJN A;  1T6I A;  2IXN A;  3DI5 A;  4CS7 A;  2OG2 A;  5DVW A;  2KQ9 A;  3JSZ A;  4CIP A;  3NMK A;  1G4W R;  2X0C A;  5E3C A;  3LLI A;  2XM0 A;  5BQI A;  3RF3 A;  2Y3H A;  4BPM A;  3TOL A;  5EGY A;  3IPM O;  3JSE O;  2JPU A;  2LFF A;  3HNJ A;  4EUK B;  4E7S A;  4G7Z F;  1ZHY A;  1VYI A;  1I4Z A;  1ZW2 A;  1GQA A;  4PJL A;  2KGO A;  3IQC A;  3IQT A;  4JVS A;  2J7P A;  3RYL A;  4Q7C A;  1E84 A;  1EQ1 A;  4Z9I A;  4I1M A;  3C62 A;  3AQC A;  3FOO A;  4L6R A;  3X1O A;  3QW0 A;  4CJG A;  3K1H A;  1E85 A;  3SP1 A;  3PHF 2;  3UGO A;  1GM5 A;  2W45 A;  3V5Z A;  4F4B A;  2XS1 A;  1FMV A;  3ECS A;  3LNR A;  5CI9 A;  1L7C A;  4CJO A;  1K05 A;  4YL0 A;  3FOP A;  2PFD A;  2H7O A;  4H54 A;  4MND A;  2ASR A;  4JIO A;  4MW3 A;  3ZDL A;  2PP4 A;  1AUE A;  3DXJ F;  4YT4 A;  1YA7 O;  4Z9H A;  4PK4 A;  4BJ6 C;  5DLJ A;  1Q0D A;  1V54 C;  3K7D A;  1CPR A;  4BEM J;  3UGP A;  1SYQ A;  2KJG A;  3CQZ A;  1RKE B;  1TWC A;  2EIK C;  3JRM O;  1Z3I X;  1KTM A;  2HKV A;  2OKU A;  3Q7G A;  2NUT A;  5A6J A;  1S7Z A;  1TWA A;  3HNI A;  1ZW3 A;  2J45 A;  1CGN A;  3EGD A;  3QVY A;  4A2N B;  3GOR A;  3ATP A;  1TQG A;  1G8X A;  4W8P A;  4OD4 A;  4E0H A;  2HSQ A;  4MVQ A;  1XZQ A;  2OOC A;  1RKE A;  2P61 A;  5COF A;  3SYN A;  2IYL D;  5DS6 A;  3Q6N A;  2FAP B;  3S90 A;  3KPH A;  2HJ3 A;  3VF0 A;  1ZYR F;  2ICW G;  2WL8 A;  2GFH A;  2XSE A;  3JRT A;  3V5Y A;  4BJ5 C;  1G4U S;  1V4A A;  2Y69 C;  5L0D A;  2WZG A;  4GEH A;  1D1C A;  1APC A;  3FMS A;  4JKV A;  2AU5 A;  4KBL A;  4YL3 A;  3WHN A;  4DBR A;  1NLX A;  3KKB A;  4RD9 A;  4LER A;  1NG1 A;  2KYH A;  2KSF A;  1AVO B;  2J8W A;  1N1C A;  4YT2 A;  2Q3T A;  4J30 B;  3C8Z A;  1NSG B;  2AWC A;  2YEV A;  3S27 A;  1YYX A;  3IQ6 A;  2IXO A;  1FMW A;  4AE4 A;  4EBK A;  1TKN A;  4J7Y A;  4AE4 B;  1XWJ A;  1RXQ A;  1M6T A;  4NY3 A;  3VYW A;  4OIP F;  1NFN A;  3EJN A;  1UFB A;  3E70 C;  3LNM B;  1BR1 A;  1LPE A;  3A9C A;  4IAQ A;  3RKO F;  3SEO A;  2YL3 A;  3LEV A;  1FFH A;  1D1B A;  1RJ9 A;  2W4B A;  3GEI A;  3W4Y A;  2XLW A;  2VCA A;  4JEB A;  3GAN A;  4N4W A;  2G62 A;  1A0B A;  1OXK A;  1H9G A;  2NUP B;  3IEE A;  4GQH A;  4IAR A;  2LCH A;  5FCL A;  1PD1 A;  1D1A A;  4ER9 A;  1FAP B;  1HE9 A;  2ZD9 A;  3M4C A;  4R32 A;  2J46 A;  3DAG A;  1QSP A;  3DWW A;  4WGZ A;  5COG A;  1R5I D;  2J9B A;  4NTB A;  4ULV A;  4FWV A;  2KW3 C;  1ZHW A;  2GA0 A;  2VCC A;  1A7D A;  2LIG A;  4UDV A;  1ZVZ A;  2G3K A;  1H6G A;  3AQB A;  3EG9 B;  1DOW A;  4RDA A;  3QZC A;  4AK9 A;  1LE2 A;  1UG7 A;  1SF8 A;  1MMN A;  3L8I A; 
#chains in the Genus database with same CATH homology
 1ZHT A;  3B0P A;  4JUR I;  4CS8 A;  3JCU Q;  3ZG1 A;  4HE8 D;  4OIN F;  4O79 A;  4BJ1 A;  2R7X A;  2EIN C;  3V7O A;  3DJU B;  2FFH A;  1VK5 A;  2DGJ A;  3HLZ A;  3EZH A;  3K6B A;  4I1O B;  4EWC A;  5CI8 A;  2HV7 A;  4K7B A;  3EH1 A;  3LLK A;  3NKD A;  4U5E E;  3UMK A;  3O39 A;  1FFT C;  2Y3D A;  1FTS A;  3EQL F;  2D5R B;  2C03 A;  3N24 A;  3FHD A;  4YJW A;  5KYX B;  1PD0 A;  2J7P D;  2B0J A;  4O6N A;  3EGD B;  5EHH A;  5KYW A;  3ZVR A;  1O87 A;  4O6Y A;  4HEA J;  3TD7 A;  2WZL A;  4P6I C;  2DYR C;  3EZI A;  4I44 A;  5KYX A;  4ZLD A;  1IZM A;  2BE5 F;  2CW0 F;  3K33 A;  1ZHZ A;  3DJN B;  1Z5Z A;  2ZXO A;  4JJG A;  2WVO A;  1LKX A;  2PF4 E;  5KYN A;  2I8B A;  4YWQ A;  3NKE A;  4KI2 A;  4BG0 A;  2Z15 A;  1M56 C;  1NU7 D;  3EHM A;  3UR3 C;  2L9J A;  4J32 B;  1TR2 A;  3RH3 A;  3EFO B;  3EHN A;  2M4E A;  2Q9A A;  4CS9 C;  1LS1 A;  2A6H F;  2J0W A;  4U5H A;  4BJ5 A;  4LLC A;  3UMH A;  1VYK A;  3I5P A;  3Q7L A;  4X0R A;  4XWJ A;  3FVY A;  2XL4 A;  3DD7 A;  3CZ6 A;  4EBB A;  1D0X A;  3NG1 A;  3S0X A;  1D0Z A;  2H7V C;  2J9U A;  5BUO A;  3ITF A;  3B0V C;  3F47 A;  2EIM C;  4QDL A;  4U5B E;  3K66 A;  4W8K A;  4PFO A;  3F46 A;  1VOM A;  3H65 A;  4N06 A;  5DS5 A;  2XXA B;  4ULW A;  2CGE A;  1RJ9 B;  4Q5S F;  1NU9 C;  1OCZ C;  2IOQ A;  2QTV A;  4DBQ A;  4OIR F;  1SZI A;  2ZXR A;  4BEJ A;  4FES A;  5D92 A;  3I4U A;  3SZR A;  4KC9 A;  1OCC C;  4U5C E;  4U5G A;  4CIH A;  4OIQ F;  4BJ6 A;  5T3W A;  5B3S C;  2XXA A;  3KH2 A;  1JPJ A;  4C3D A;  3ZIB A;  4IJJ A;  1Z23 A;  3NYM A;  4IRU A;  4K0D A;  2R7R A;  2VAS A;  3AG2 C;  5E3A A;  1Z6A A;  1KU2 A;  3W8I A;  3DM5 A;  1PCX A;  1QLE C;  4DOZ A;  3ABM C;  4PFP A;  2P6V A;  3LS0 A;  4GYT A;  4YN0 B;  1QZX A;  3DM9 B;  3T6J A;  2A68 F;  1VMA A;  4Q4Z F;  2J0X A;  3DZA A;  5DQZ A;  3HTK C;  3VAY A;  4G0H A;  4LAC B;  2R7V A;  4AX2 A;  1MND A;  3EG9 A;  5L3V A;  2R7W A;  3NDB B;  3LAY A;  2L81 A;  2W4M A;  3S29 A;  1MMD A;  4QI0 A;  2DYS C;  4E7Z A;  2WVN A;  3AG4 C;  3K1I C;  2R7U A;  4DVY P;  1J8Y F;  2CNW D;  2A1D D;  1Z63 A;  2EIL C;  5D91 A;  4PJJ A;  3OWT A;  3ABL C;  2R7O A;  3L34 A;  3NYL A;  3UMI A;  3DAF A;  2CNW A;  3W8H A;  4B6I A;  3ASO C;  4WJ0 A;  1WGW A;  1OCR C;  2C04 A;  5KYY B;  1M2O A;  5E33 A;  2NG1 A;  2IXM A;  1BR2 A;  1OKK D;  2V26 A;  2YZS A;  4BJT A;  3LES A;  2J9W A;  4XLN F;  4HFK B;  5T3T A;  1MMG A;  3RYL A;  3ABK C;  2IXP A;  3Q6M A;  4MQ9 F;  3WG7 C;  3QMK A;  4O7G A;  3HJC A;  2XRH A;  1IW7 F;  4YT5 A;  2EIJ C;  2NUP A;  1D0Y A;  3ZSU A;  3E9V A;  4C7O A;  4KNV A;  5DS4 A;  4CS9 A;  3JYH A;  3EGX A;  4LLE A;  3EFO A;  4G7H F;  1OKK A;  5KYU A;  3S28 A;  3LJB A;  1ZU5 A;  3LS1 A;  2YHS A;  1JPN A;  4OD5 A;  4JJF A;  3KL4 A;  3ZC4 A;  2QY9 A;  5KYY A;  3NRH A;  1ST6 A;  4IWB A;  2VH3 A;  1OCO C;  5KYU B;  1NZE A;  3UNG C;  3OEO A;  3W2V A;  2MWQ A;  3PMR A;  2KNH A;  4QI2 A;  4XTK A;  4DVZ A;  4YT8 A;  3EGX B;  3SNH A;  3RFY A;  5B1A C;  2W9Y A;  2MYS A;  1O5H A;  3OA1 A;  4JW1 A;  4U5D E;  4H4K C;  5F5H A;  2CDQ A;  1ZHX A;  1TWH A;  5E2Q A;  3JT1 A;  1M2V B;  3T6B A;  2R7T A;  3AG1 C;  2V3C C;  4FX5 A;  2LSE A;  2E87 A;  3M1C B;  4PJM A;  4RBN A;  4KNW A;  1MNE A;  1J8M F;  4CSA C;  4G7O F;  1W2W A;  3CSK A;  1M2V A;  4I3M A;  2FGY A;  4C3B A;  5IY5 C;  3POV A;  4OIO F;  2X51 A;  3N0T A;  1M57 C;  2HV6 A;  4JZA A;  2NUT B;  4HFF B;  2R7Q A;  5DQT A;  3FAJ A;  2Q9C A;  4U5F E;  3B0U X;  3NYJ A;  4JCH A;  2WZF A;  3FDQ A;  3B9Q A;  1V55 C;  2ZXW C;  2OCC C;  3EPV A;  2P7V A;  3GOD A;  1LVK A;  2O9X A;  5T1D B;  2A69 F;  2R7S A;  3X2Q C;  2VB6 A;  1BR4 A;  4O6M A;  2G3V A;  3W2W A;  2J9V A;  2Y3B A;  3O6X A;  5B1B C;  3RIP A;  3ASN C;  2Y39 A;  1MMA A;  4C3E A;  5F5F A;  5KYW B;  2WVQ A;  3WOD F;  4CS8 C;  3KMI A;  4C7O B;  4CSA A;  4M63 A;  3AG3 C;  4G7Z F;  2PX0 A;  2Q9B A;  2WB7 A;  3MLG A;  4IAO A;  2JD3 A;  1SMY F;  4ANJ A;  4CBE A;  2ZXP A;  5HSW A;  3EH2 A;  3I5Q A;  3DMD A;  2A6E F;  5L3Q A;  3MX3 A;  2PX3 A;  3T4R A;  1TWG A;  4XLP F;  2Y3G A;  4ZLC A;  2ZPA A;  2H7B A;  1ZU4 A;  3N2Z B;  4PJN A;  2IXN A;  4CS7 A;  2OG2 A;  5DVW A;  2KQ9 A;  3JSZ A;  5E3C A;  3LLI A;  2Y3H A;  5EGY A;  4E7S A;  1ZHY A;  1VYI A;  4PJL A;  2KGO A;  4JVS A;  2J7P A;  4Q7C A;  4I1M A;  3AQC A;  3X1O A;  3PHF 2;  3K1H A;  3UGO A;  3SP1 A;  2W45 A;  4F4B A;  1FMV A;  3ECS A;  3LNR A;  2PFD A;  2H7O A;  4MND A;  4YT4 A;  2PP4 A;  3DXJ F;  4BJ6 C;  4PK4 A;  5DLJ A;  1V54 C;  3K7D A;  3UGP A;  2KJG A;  3CQZ A;  1TWC A;  2EIK C;  1Z3I X;  3Q7G A;  2NUT A;  1S7Z A;  1TWA A;  4A2N B;  2J45 A;  3EGD A;  1G8X A;  4OD4 A;  3SYN A;  2IYL D;  5DS6 A;  3Q6N A;  1ZYR F;  2WL8 A;  2GFH A;  2XSE A;  3JRT A;  4BJ5 C;  2Y69 C;  2WZG A;  4GEH A;  1D1C A;  4KBL A;  4DBR A;  3KKB A;  4RD9 A;  4LER A;  1NG1 A;  1N1C A;  4YT2 A;  2Q3T A;  4J30 B;  3S27 A;  2YEV A;  2IXO A;  1FMW A;  4AE4 A;  1TKN A;  4AE4 B;  4NY3 A;  3VYW A;  4OIP F;  3RKO F;  3EJN A;  3SEO A;  3E70 C;  1BR1 A;  3LEV A;  1FFH A;  1D1B A;  1RJ9 A;  2W4B A;  3GAN A;  5CI9 A;  2G62 A;  2NUP B;  3IEE A;  5FCL A;  1PD1 A;  1D1A A;  2J46 A;  3DAG A;  4FWV A;  2KW3 C;  1ZHW A;  2G3K A;  3AQB A;  3EG9 B;  4RDA A;  3QZC A;  4AK9 A;  3L0I A;  1SF8 A;  1MMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...