2L81A

Solution nmr structure of the serine-rich domain of hef1 (enhancer of filamentation 1) from homo sapiens, northeast structural genomics consortium target hr5554a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
MGHHHHHHSHMDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enhancer of filamentation 1
publication title Northeast Structural Genomics Consortium Target HR5554A
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l81A00
2L81A 1Z23A
chains in the Genus database with same CATH superfamily
2L6HA 2AWCA 1KTMA 1TR2A 1UG7A 3TQOA 1VLSA 1H9GA 5COFA 1ZHYA 3MLGA 3JSZA 3S27A 1FNTc 1YLMA 3SXMA 3K7DA 4C7OB 2EIKC 1EQ1A 2LFDA 1BR1A 2GDCA 2YWAA 4IJJA 1WATA 1NU9C 2WL8A 4WJ0A 1HMOA 2PNOA 5E3AA 3U3FA 1QKRA 5L0IA 4ONSA 4QI0A 4X0RA 3K33A 4OIOF 4NCQA 1ZW3A 2J0WA 2P61A 4A2NB 5EHHA 2R7SA 3SEOA 2CDQA 4G78A 4CDVA 4CDYA 5B3IA 4JURI 4IAQA 4BJTA 3RIPA 1PD1A 2GFHA 3ZTMA 2A0BA 3ATPA 4W8KA 4XLNF 2J7PD 3JCUQ 2YLDA 2LIGA 4BJ5C 2EPOA 1EI7A 4AL0A 1MMGA 1T5OA 2UUIA 1OXBA 4FX5A 2J46A 1U0BB 1T6QA 1T6IA 1CGME 2ICWG 5AC4A 3GWLA 4DVYP 4ZLCA 4KI2A 5L0GA 1D0XA 3CQZA 2UUHA 3N0TA 2A6HF 1HW1A 1JPJA 4B6IA 1OCRC 1K05A 3K66A 1WOLA 3AG3C 2M4EA 2NSFA 1M2VB 1YZAA 4MVQA 1RCPA 5KYUA 2HSQA 2KC3A 1BBHA 2VH3A 4J7YA 2Y3GA 3IEEA 5DQTA 1LS4A 5JT4A 3EGDB 1LI5A 2CNWA 4CS8C 3DD7A 4JEAA 4E17A 1OR3A 4YJWA 3AQBA 3GANA 5AGFA 1QZXA 4MVMA 1E83A 2R7QA 3CSKA 4U5EE 4BJ1A 4XTKA 3AGTA 1S7ZA 1K04A 1G5ZA 1D1BA 1Z23A 2EPLX 3O10A 4JW1A 4ULWA 3MX3A 5A6BA 3KH2A 5JRAA 1GM5A 5COGA 2VASA 3V5ZA 5F5FA 2IYLD 1D0ZA 3LJBA 4YT2A 3I4UA 1B68A 2RD9A 2WVQA 1TFOB 4AE4B 2G3KA 1OCOC 3H2UA 3IHUA 3EGXB 3T6GB 2PBEA 4JKVA 1OXKA 3NMKA 5L0FA 4UDVA 1A41A 1YAUO 1FFHA 3WODF 2HJMA 2OG2A 2ZXOA 3IQTA 4AK9A 2R7UA 1XZPA 1VOMA 1JOGA 1FMWA 2R03A 1AVOB 4N4WA 2KK1A 4NTFA 4JVSA 4EKWA 5L0JA 4C7OA 1U89A 4JEBA 2OJQA 1QSPA 1W2WA 3T6JA 4DRHB 1E84A 2RSEB 3M1CB 4YWQA 1LPEA 3L34A 5E3CA 2Q00A 4DRJB 4XPWA 4YL1A 3UR3C 2KNHA 4QDLA 5CI8A 1A0BA 3V7OA 3HTKC 3VRCA 4ER9A 3Q6NA 4P9TA 2BC5A 4Q5SF 2EPNA 3FAPB 3L0IA 1FMVA 3GM3A 3NKEA 4LLEA 3SYNA 3O6XA 3SXYA 1VLTA 1JPNA 2J7PA 1XZQA 5KYYA 3AG2C 1O87A 2ZXPA 5EGYA 4J32B 3DM9B 3DM5A 3QVYA 5L0HA 1KU2A 3T9OA 1SZIA 1ZZPA 4NTBA 3RF3A 2V3CC 4XLPF 5T3TA 2FFHA 3GODA 3HNKA 5KYUB 1DOWA 3HNJA 4P9FA 3ZDLA 4D4NA 3B0VC 2R25A 1YYXA 3C18A 3KL4A 3X1OA 3IQCA 3W2WA 4DJ9A 1M6TA 2PP4A 2IM8A 1R5ID 3UMIA 1T6UA 3VF0A 2IXPA 2D4UA 4I1OB 3NYLA 3HNLA 3TD7A 2R7VA 3US6A 2OQMA 4DBQA 1CPRA 2ZPAA 1HW2A 3C62A 2BE5F 3AQCA 3DE8A 3JRTA 2FAPB 2P0NA 2A69F 4CS8A 1FTSA 1OW6A 4HE8D 2LFFA 1I4ZA 1YVIA 1A7EA 4PFOA 1RJ9B 3DKAA 4N6HA 2YL0A 1NLXA 4DOZA 5JUAA 2O9XA 2Z15A 1Q0MA 3C63A 2FGYA 3I5PA 3EHNA 2QLAA 4IWBA 4MVOA 4E0HA 1Q0GA 3POVA 4D4XA 2OCCC 4WGZA 2WB7A 3G4ZA 5KYXB 4ZLDA 5CIVA 3QW1A 1K40A 3B71A 2G62A 3GEEA 4KNWA 4Z9IA 2KSFA 2XL4A 3EGXA 1OKKD 4MVSA 4N06A 2Y3HA 3V5YA 2J8WA 3DAFA 4JTAB 4IRUA 1EKYA 3DJUB 1JR8A 4MTGA 2YQYA 2MYSA 3NRHA 4PACA 4LACB 1PV3A 2CCYA 2YZSA 1BR4A 4JIOA 3Q6MA 5E2QA 5GPGB 5T1DB 3C8GD 2WZLA 1BDJB 1H7IA 1WWPA 4U5BE 1MNDA 1APCA 2OEXA 3Q7LA 4FESA 1OR2A 1Q0FA 4C3BA 3AOUA 4JCHA 1M57C 1ZHWA 2YL1A 2NUPB 4JTDB 4NTAA 1NZEA 4C3DA 1QQ3A 4EHPA 1SF8A 4PJJA 2ZXRA 4P6IC 1GQAA 2H7VC 1TWCA 2HUJA 4OD4A 4U9DA 4CJGA 3TK0A 5KYYB 2V26A 1M2OA 2P1AA 3U8PA 3MYFA 3NMIA 1RKEB 3LNRA 2YL7A 5BQIA 4LDQA 2YKZA 4MVZA 3S9OA 1MQVA 1LIHA 2CGEA 5JLIA 3EH1A 4MQ9F 3EG9B 3GEIA 5D91A 5E33A 1CPQA 2X51A 3IQ6A 1JAFA 4OIQF 1TWAA 2L6GA 2QUPA 2XM4A 3NMJA 3O55A 3W8HA 3B0UX 3OA1A 1XWJA 1TWGA 2LCHA 1VTMP 1I5NA 3LEVA 3ZVRA 3C7JA 4LDRA 3DJNB 4U5GA 4U5FE 3TOMA 2ZD9A 2XLVA 3LNMB 3LLIA 4MW8A 3A9CA 2HZ8A 3U5SA 5DVWA 4O7GA 4OIPF 2OOCA 4RD9A 4W8PA 3NDBB 3EHMA 3B0PA 2JD3A 2PF4E 2HMQA 1S05A 2VC9A 3VM6A 3LS0A 1BR2A 4U5DE 2W4MA 4C3EA 4F4BA 1LM3B 1FAPB 3MBGA 2LP4A 4HFKB 4XQ1A 1A7VA 4GQHA 2EPKX 3N2ZB 4K7BA 1I4YA 3DE9A 3RQGA 2Q9CA 3ASOC 1RJ9A 1IW7F 3MFNA 3VYWA 5DLJA 1L3PA 2A6EF 2AVKA 3CZ6A 5KYWB 4LLCA 2HV6A 2IOQA 3PCVA 1N1CA 3ABMC 5BQGA 2H7BA 3M4BA 3S90A 2WVOA 3GM2A 3W4YA 2LQGA 5COMA 5KYXA 3NG1A 4XEVA 4IAOA 2H7OA 2QTVA 2Q9AA 2WZGA 2IBFA 1VB5A 3CAXA 3KYJA 4WGYA 3JSEO 3SP1A 5BQHA 2LK4A 1VK5A 1H9TA 1OKKA 3ZC4A 1WASA 2IXNA 3L8IA 3NKDA 4JJFA 3TJ6A 4E7SA 3V5XA 4OIRF 4JE9A 2W45A 4DBRA 5B1AC 4BG0A 1LVKA 2R7RA 2A0UA 3R2PA 1PD0A 3QTHA 3W2VA 1E85A 1YA7O 3C8GA 256BA 2KGOA 3JT1A 1R4TA 2X0CA 2NUPA 1HE1A 1QVXA 4H4KC 1CGOA 1LE2A 2Q7RA 3WHNA 1Y6DA 5A69A 3HLZA 1KNYA 3JTLO 3K6BA 2R7TA 2HKVA 1ZW2A 3WG7C 3FMSA 3AG4C 1D0YA 2EIMC 4YT8A 1G4WR 2B0JA 3KMIA 3RW0A 2OKUA 3CEXA 5T3WA 1FFTC 1RKEA 2L81A 1NG1A 4XPYA 4WABA 4AX2A 5A6KA 1H6GA 3ZQYA 4BPMA 3DXJF 3KYIA 2KQ9A 1AUEA 3EG9A 4OD5A 2KJGA 4J30B 2YEVA 2HSBA 5L0DA 3AJMA 4FAPB 5F28E 3RKOF 1OCCC 1TWHA 2A68F 1F1MA 3T4RA 4I44A 2XLOA 2VCAA 1Q0DA 4EIYA 3JYYA 1C03A 4G7OF 1OW7A 3KKBA 3NYJA 4YL3A 4GEHA 5B3SC 3PMRA 1FR0A 1QLEC 2HFIA 3G4XA 3UMHA 2IXOA 1HMDA 3FAJA 3B29A 3LS1A 5L3VA 2J9UA 2YL3A 4GYTA 2XLWA 2YLIA 4YK5A 5DS4A 2P7VA 3ZQVA 1IZMA 4Z9JA 3H2VA 2XXAB 1WN0A 5L3QA 1NSGB 1Q0KA 3RVZA 4BJ6C 5KYWA 1DOVA 2Y39A 2EILC 3M15A 2VCBA 2BL2A 4JTCB 4MTOA 2XS1A 3Q7GA 5IY5C 3TULA 4JJGA 5F5HA 3JYHA 3IPMO 1ZVZA 2GWWA 2W9YA 2XL8A 1GS9A 4CIPA 1V4AA 2XLDA 3GWNA 3KPHA 4DRIB 3EZHA 3LAYA 4K0DA 2J9VA 2NG1A 2L7AA 2HMZA 1LI7A 3F46A 2D5RB 3C8GB 3ZSUA 1YA9A 3VAYA 1ST6A 3SNHA 3M79A 4IARA 2DYSC 3AGUA 1NU7D 4EBKA 3R7CA 1Z63A 3RQEA 1TQGA 2Q3TA 1LKXA 3SXKA 1D1CA 1V55C 2PX3A 4O79A 4XPXA 4CX9A 3DI5A 2GA0A 2HS5A 2DGJA 1C02A 3U9MA 4MS2A 4EBBA 1Y4CA 1MMDA 2OEVA 3L1MA 2R7WA 3GORA 4ULVA 4CS9C 1HY5A 3FVYA 4U5CE 1ZYRF 3AG1C 2AU5A 3E70C 3QMKA 4YL0A 3OEOA 2AWYA 4IB4A 4IGGA 3J06A 3ZG1A 1RXQA 3E9VA 3F47A 3B9QA 4RBNA 1QPUA 1ZU4A 5JSLA 2QY9A 3ZWIA 5JVEA 2PX0A 2NUTB 4Q7CA 1OCZC 4CBEA 1ORSC 3UNGC 2MWQA 5A6JA 1MNEA 4XEFA 4DVZA 2NSGA 1TFKB 3K1HA 3NYMA 5TJ5E 3UGOA 4A4AA 2ASRA 4K1OA 2L6FA 3EH2A 3T6BA 2JPUA 2LD6A 5EK0A 4QI2A 5D92A 4G7HF 2I15A 1E86A 4R32A 2J45A 1SYQA 3ABKC 5DS5A 2DYRC 2J0XA 3ITFA 4Z9HA 2AP3A 4CSAC 4E0IA 3FHDA 1G4US 3JZ0A 2XLMA 3O39A 3WAQA 4AL1A 1HE9A 1O5HA 3I5QA 1JMWA 4HEAJ 2XLEA 3EFOB 2XL6A 1T9KA 3S29A 3ZTZA 5JS5A 1A7DA 4CDAA 2EIJC 2W4BA 2XLHA 1NFOA 2YRFA 4JC7A 4U9EA 3U3BA 5DS6A 3DMDA 3FDQA 1L7CA 1VYIA 3QVZA 3U0CA 3K1IA 2L9JA 4O6NA 1LS1A 4O6MA 4RDAA 1EA8A 1SR2A 1YARO 1V54C 4PJNA 2M64A 2ZXWC 3RFYA 1V74B 2R9RB 3LLKA 3IQ5A 4JRZA 4MTFA 3UGPA 1SMYF 3U2MA 4KC9A 2HV7A 4NY3A 3RQFA 4Q4ZF 2XXAA 1Z3IX 2XSEA 1T01A 4KBLA 1RMVA 4PR9A 3X2QC 2R7OA 2OJED 1MMNA 4YT5A 1NBBA 1J8MF 2TMVP 2XS8A 4LDKA 4EWCA 4DXWA 3S0XA 3DWWA 4BJ6A 1JRAA 3U2LA 1AEPA 1O3UA 2J9WA 1YJGA 3MYIA 3U8VA 2QE9A 2PFDA 1PCXA 3GEHA 2J9BA 5JP7A 3ZIBA 4BEJA 1U6HA 2VCCA 4E18A 2CW0F 2LSEA 2Q9BA 3EPVA 4U5HA 4XEKA 2G3VA 2KYHA 4CS7A 1OQCA 2Q4FA 1VYKA 2Y3BA 1YYJA 1ORJA 4L6RA 1ZHXA 1G8XA 5B1BC 3H65A 5AC5A 3FXHA 4PJMA 1ZHTA 5A6AA 5CI9A 2Y69C 5DQZA 5KYNA 3RYLA 1WGWA 4PFPA 2I8BA 1RKCA 3A11A 3SXZA 4LERA 4CIHA 3OWTA 2Y3DA 1YZCA 5BUOA 1OW8A 4XWJA 2DI3A 3U9JA 4G7ZF 2YHSA 4CS9A 1Z5ZA 4HFFB 3ECSA 4N6CA 3HNIA 4I3MA 4NC3A 2NUTA 2EPMX 2H8AA 1NFNA 2WVNA 1YDIA 5FCLA 3DZAA 4MVUA 4ANJA 1M56C 3BRJA 2B0HA 2IXMA 4JCZA 1ORYA 1TKNA 3C8ZA 1BZ4A 3EQLF 2GAQA 2OU6A 3K1IC 2R02A 4MVRA 2ETSA 3G50A 2MHRA 3LEOA 4J7TA 4PJLA 2R7XA 3EZIA 1CGNA 2C04A 4YT4A 3BEHA 3FOPA 4G0HA 3EFOA 2DB4A 1Z6AA 4CSAA 1VMAA 1LE4A 3RH3A 3SZRA 4BJ5A 4OINF 2HJ3A 2A1DD 4NQFA 4BEMJ 2E87A 3HKKA 4EBJA 5K0IA 5L0CA 3FOOA 3HJCA 3M4CA 4JZAA 3L8JA 3QZCA 2YVKA 2NPUA 5HSWA 2P6VA 3ABLC 2CNWD 3ASNC 3DAGA 3QW0A 3TJ5A 1M2VA 3S84A 4PK4A 3LESA 3JRMO 1Z7Qc 3UMKA 1ZHZA 4MNDA 2C03A 3EGDA 2XRHA 3W8IA 2EINC 2VB6A 5A6BD 2WZFA 2F22A 1GGQA 3RVYA 3N24A 5FZTA 4M63A 2XM0A 4KNVA 2CYDA 4H54A 4E7ZA 4YN0B 4O6YA 4FWVA 4EUKB 4MW3A 3TOLA 3GM1A 4I1MA 1J8YF 4CJOA 3PHF2 2JX0A 1D1AA 2QNLA 1UFBA 1WTYA 3PDMP 3S28A 2R05A 3EJNA 2KW3C 1E2XA 1C17M 2YLGA 3LUTB 1MMAA 5HV9A 4AE4A 1ZU5A
chains in the Genus database with same CATH topology
1TR2A 1ZHYA 3MLGA 3JSZA 3S27A 4C7OB 3K7DA 2EIKC 1BR1A 4IJJA 4WJ0A 1NU9C 2WL8A 5E3AA 4QI0A 4X0RA 3K33A 4OIOF 2R7SA 2J0WA 5EHHA 3SEOA 2CDQA 4JURI 4BJTA 3RIPA 1PD1A 2GFHA 4W8KA 4XLNF 2J7PD 3JCUQ 4BJ5C 1MMGA 4FX5A 2J46A 4DVYP 4ZLCA 4KI2A 1D0XA 3CQZA 3N0TA 2A6HF 1JPJA 4B6IA 1OCRC 3K66A 3AG3C 2M4EA 1M2VB 5KYUA 2VH3A 2Y3GA 3IEEA 5DQTA 3EGDB 2CNWA 4CS8C 3DD7A 4YJWA 3AQBA 3GANA 1QZXA 2R7QA 3CSKA 4U5EE 4BJ1A 4XTKA 1S7ZA 1Z23A 1D1BA 4JW1A 4ULWA 3MX3A 3KH2A 2VASA 5F5FA 2IYLD 1D0ZA 3LJBA 4YT2A 3I4UA 2WVQA 4AE4B 2G3KA 1OCOC 3EGXB 1FFHA 3WODF 4AK9A 2OG2A 2ZXOA 2R7UA 1VOMA 1FMWA 4JVSA 4C7OA 1W2WA 3T6JA 3M1CB 4YWQA 3L34A 5E3CA 3UR3C 2KNHA 4QDLA 5CI8A 3V7OA 3HTKC 3Q6NA 4Q5SF 3NKEA 3L0IA 1FMVA 4LLEA 3SYNA 3O6XA 1JPNA 2J7PA 5KYYA 3AG2C 1O87A 2ZXPA 5EGYA 4J32B 3DM9B 3DM5A 2V3CC 1KU2A 1SZIA 4XLPF 5T3TA 2FFHA 3GODA 5KYUB 3B0VC 3KL4A 3X1OA 3W2WA 2PP4A 3UMIA 2IXPA 4I1OB 3NYLA 3TD7A 2R7VA 4DBQA 2ZPAA 2BE5F 3AQCA 3JRTA 2A69F 4CS8A 1FTSA 4HE8D 4PFOA 1RJ9B 4DOZA 2O9XA 2Z15A 2FGYA 3I5PA 3EHNA 4IWBA 3POVA 2OCCC 2WB7A 5KYXB 4ZLDA 2G62A 4KNWA 2XL4A 3EGXA 4N06A 1OKKD 2Y3HA 3DAFA 4IRUA 3DJUB 2MYSA 3NRHA 4LACB 5E2QA 2YZSA 1BR4A 5T1DB 3Q6MA 2WZLA 4U5BE 1MNDA 3Q7LA 4FESA 4C3BA 4JCHA 1M57C 1ZHWA 4C3DA 2NUPB 1NZEA 1SF8A 4PJJA 2ZXRA 4P6IC 2H7VC 1TWCA 4OD4A 5KYYB 2V26A 1M2OA 3LNRA 2CGEA 3EH1A 4MQ9F 3EG9B 5D91A 5E33A 2X51A 4OIQF 1TWAA 3B0UX 3W8HA 3OA1A 1TWGA 3LEVA 3ZVRA 3DJNB 4U5GA 4U5FE 3LLIA 5DVWA 4O7GA 4OIPF 4RD9A 3NDBB 3EHMA 3B0PA 2JD3A 2PF4E 3LS0A 1BR2A 4U5DE 2W4MA 4C3EA 4F4BA 4HFKB 4A2NB 4K7BA 3N2ZB 2Q9CA 3ASOC 1RJ9A 1IW7F 3VYWA 5DLJA 5KYWB 2A6EF 3CZ6A 4LLCA 2HV6A 2IOQA 1N1CA 3ABMC 2H7BA 2WVOA 5KYXA 3NG1A 4IAOA 2H7OA 2QTVA 2Q9AA 2WZGA 3SP1A 1VK5A 1OKKA 3ZC4A 2IXNA 3NKDA 4E7SA 4JJFA 4OIRF 4DBRA 2W45A 5B1AC 4BG0A 1LVKA 2R7RA 1PD0A 3W2VA 2KGOA 3JT1A 2NUPA 4H4KC 3HLZA 3K6BA 2R7TA 3WG7C 3AG4C 1D0YA 2EIMC 4YT8A 2B0JA 3KMIA 5T3WA 1FFTC 2L81A 1NG1A 4AX2A 3DXJF 2KQ9A 3EG9A 4OD5A 2KJGA 4J30B 2YEVA 3RKOF 1OCCC 1TWHA 2A68F 3T4RA 4I44A 4G7OF 3KKBA 3NYJA 4GEHA 5B3SC 3PMRA 1QLEC 3UMHA 2IXOA 3FAJA 3LS1A 5L3VA 2J9UA 4GYTA 5DS4A 2P7VA 1IZMA 2XXAB 5L3QA 4BJ6C 5KYWA 2Y39A 2EILC 3Q7GA 5IY5C 4JJGA 5F5HA 3JYHA 2W9YA 3EZHA 3LAYA 4K0DA 2J9VA 2NG1A 3F46A 2D5RB 3ZSUA 3VAYA 1ST6A 3SNHA 1Z63A 2DYSC 1NU7D 2Q3TA 1LKXA 1D1CA 1V55C 2PX3A 4O79A 2DGJA 4EBBA 1MMDA 2R7WA 4CS9C 3FVYA 4U5CE 1ZYRF 3AG1C 3E70C 3QMKA 3OEOA 3ZG1A 3E9VA 3F47A 3B9QA 4RBNA 1ZU4A 2QY9A 2PX0A 2NUTB 4Q7CA 1OCZC 4CBEA 3UNGC 2MWQA 1MNEA 4DVZA 3K1HA 3NYMA 3UGOA 3EH2A 3T6BA 4QI2A 5D92A 4G7HF 5DS5A 2J45A 3ABKC 2DYRC 2J0XA 3ITFA 4CSAC 3FHDA 3O39A 1O5HA 3I5QA 4HEAJ 3EFOB 3S29A 2EIJC 2W4BA 3FDQA 5DS6A 3DMDA 1VYIA 2L9JA 4O6NA 1LS1A 4O6MA 4RDAA 1V54C 4PJNA 2ZXWC 3RFYA 3LLKA 3UGPA 1SMYF 4KC9A 2HV7A 4NY3A 4Q4ZF 2XXAA 1Z3IX 2XSEA 4KBLA 3X2QC 2R7OA 1MMNA 4YT5A 1J8MF 4EWCA 3S0XA 4BJ6A 2J9WA 2PFDA 1PCXA 3ZIBA 4BEJA 2CW0F 2LSEA 2Q9BA 3EPVA 4U5HA 4CS7A 2G3VA 1VYKA 2Y3BA 1ZHXA 1G8XA 5B1BC 3H65A 4PJMA 1ZHTA 5CI9A 2Y69C 5DQZA 5KYNA 3RYLA 1WGWA 4PFPA 2I8BA 4LERA 4CIHA 3OWTA 2Y3DA 5BUOA 4XWJA 4G7ZF 2YHSA 4CS9A 1Z5ZA 4HFFB 3ECSA 4I3MA 2NUTA 2WVNA 5FCLA 3DZAA 4ANJA 1M56C 2IXMA 1TKNA 3EQLF 3K1IC 4PJLA 2R7XA 3EZIA 2C04A 4YT4A 4G0HA 3EFOA 1Z6AA 4CSAA 1VMAA 3RH3A 3SZRA 4BJ5A 4OINF 2A1DD 2E87A 3HJCA 4JZAA 3QZCA 5HSWA 2P6VA 3ABLC 2CNWD 3ASNC 3DAGA 1M2VA 4PK4A 3LESA 3UMKA 1ZHZA 4MNDA 2C03A 3EGDA 2XRHA 3W8IA 2EINC 2VB6A 2WZFA 3N24A 4M63A 4KNVA 4E7ZA 4YN0B 4O6YA 4FWVA 4I1MA 1J8YF 3PHF2 1D1AA 3S28A 3EJNA 2KW3C 1MMAA 4AE4A 1ZU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L81 A;  1Z23 A; 
#chains in the Genus database with same CATH topology
 2L6H A;  2AWC A;  1KTM A;  1TR2 A;  1UG7 A;  3TQO A;  1VLS A;  1H9G A;  5COF A;  1ZHY A;  3MLG A;  3JSZ A;  3S27 A;  1FNT c;  1YLM A;  3SXM A;  3K7D A;  4C7O B;  2EIK C;  1EQ1 A;  2LFD A;  1BR1 A;  2GDC A;  2YWA A;  4IJJ A;  1WAT A;  1NU9 C;  2WL8 A;  4WJ0 A;  1HMO A;  2PNO A;  5E3A A;  3U3F A;  1QKR A;  5L0I A;  4ONS A;  4QI0 A;  4X0R A;  3K33 A;  4OIO F;  4NCQ A;  1ZW3 A;  2J0W A;  2P61 A;  4A2N B;  5EHH A;  2R7S A;  3SEO A;  2CDQ A;  4G78 A;  4CDV A;  4CDY A;  5B3I A;  4JUR I;  4IAQ A;  4BJT A;  3RIP A;  1PD1 A;  2GFH A;  3ZTM A;  2A0B A;  3ATP A;  4W8K A;  4XLN F;  2J7P D;  3JCU Q;  2YLD A;  2LIG A;  4BJ5 C;  2EPO A;  1EI7 A;  4AL0 A;  1MMG A;  1T5O A;  2UUI A;  1OXB A;  4FX5 A;  2J46 A;  1U0B B;  1T6Q A;  1T6I A;  1CGM E;  2ICW G;  5AC4 A;  3GWL A;  4DVY P;  4ZLC A;  4KI2 A;  5L0G A;  1D0X A;  3CQZ A;  2UUH A;  3N0T A;  2A6H F;  1HW1 A;  1JPJ A;  4B6I A;  1OCR C;  1K05 A;  3K66 A;  1WOL A;  3AG3 C;  2M4E A;  2NSF A;  1M2V B;  1YZA A;  4MVQ A;  1RCP A;  5KYU A;  2HSQ A;  2KC3 A;  1BBH A;  2VH3 A;  4J7Y A;  2Y3G A;  3IEE A;  5DQT A;  1LS4 A;  5JT4 A;  3EGD B;  1LI5 A;  2CNW A;  4CS8 C;  3DD7 A;  4JEA A;  4E17 A;  1OR3 A;  4YJW A;  3AQB A;  3GAN A;  5AGF A;  1QZX A;  4MVM A;  1E83 A;  2R7Q A;  3CSK A;  4U5E E;  4BJ1 A;  4XTK A;  3AGT A;  1S7Z A;  1K04 A;  1G5Z A;  1D1B A;  1Z23 A;  2EPL X;  3O10 A;  4JW1 A;  4ULW A;  3MX3 A;  5A6B A;  3KH2 A;  5JRA A;  1GM5 A;  5COG A;  2VAS A;  3V5Z A;  5F5F A;  2IYL D;  1D0Z A;  3LJB A;  4YT2 A;  3I4U A;  1B68 A;  2RD9 A;  2WVQ A;  1TFO B;  4AE4 B;  2G3K A;  1OCO C;  3H2U A;  3IHU A;  3EGX B;  3T6G B;  2PBE A;  4JKV A;  1OXK A;  3NMK A;  5L0F A;  4UDV A;  1A41 A;  1YAU O;  1FFH A;  3WOD F;  2HJM A;  2OG2 A;  2ZXO A;  3IQT A;  4AK9 A;  2R7U A;  1XZP A;  1VOM A;  1JOG A;  1FMW A;  2R03 A;  1AVO B;  4N4W A;  2KK1 A;  4NTF A;  4JVS A;  4EKW A;  5L0J A;  4C7O A;  1U89 A;  4JEB A;  2OJQ A;  1QSP A;  1W2W A;  3T6J A;  4DRH B;  1E84 A;  2RSE B;  3M1C B;  4YWQ A;  1LPE A;  3L34 A;  5E3C A;  2Q00 A;  4DRJ B;  4XPW A;  4YL1 A;  3UR3 C;  2KNH A;  4QDL A;  5CI8 A;  1A0B A;  3V7O A;  3HTK C;  3VRC A;  4ER9 A;  3Q6N A;  4P9T A;  2BC5 A;  4Q5S F;  2EPN A;  3FAP B;  3L0I A;  1FMV A;  3GM3 A;  3NKE A;  4LLE A;  3SYN A;  3O6X A;  3SXY A;  1VLT A;  1JPN A;  2J7P A;  1XZQ A;  5KYY A;  3AG2 C;  1O87 A;  2ZXP A;  5EGY A;  4J32 B;  3DM9 B;  3DM5 A;  3QVY A;  5L0H A;  1KU2 A;  3T9O A;  1SZI A;  1ZZP A;  4NTB A;  3RF3 A;  2V3C C;  4XLP F;  5T3T A;  2FFH A;  3GOD A;  3HNK A;  5KYU B;  1DOW A;  3HNJ A;  4P9F A;  3ZDL A;  4D4N A;  3B0V C;  2R25 A;  1YYX A;  3C18 A;  3KL4 A;  3X1O A;  3IQC A;  3W2W A;  4DJ9 A;  1M6T A;  2PP4 A;  2IM8 A;  1R5I D;  3UMI A;  1T6U A;  3VF0 A;  2IXP A;  2D4U A;  4I1O B;  3NYL A;  3HNL A;  3TD7 A;  2R7V A;  3US6 A;  2OQM A;  4DBQ A;  1CPR A;  2ZPA A;  1HW2 A;  3C62 A;  2BE5 F;  3AQC A;  3DE8 A;  3JRT A;  2FAP B;  2P0N A;  2A69 F;  4CS8 A;  1FTS A;  1OW6 A;  4HE8 D;  2LFF A;  1I4Z A;  1YVI A;  1A7E A;  4PFO A;  1RJ9 B;  3DKA A;  4N6H A;  2YL0 A;  1NLX A;  4DOZ A;  5JUA A;  2O9X A;  2Z15 A;  1Q0M A;  3C63 A;  2FGY A;  3I5P A;  3EHN A;  2QLA A;  4IWB A;  4MVO A;  4E0H A;  1Q0G A;  3POV A;  4D4X A;  2OCC C;  4WGZ A;  2WB7 A;  3G4Z A;  5KYX B;  4ZLD A;  5CIV A;  3QW1 A;  1K40 A;  3B71 A;  2G62 A;  3GEE A;  4KNW A;  4Z9I A;  2KSF A;  2XL4 A;  3EGX A;  1OKK D;  4MVS A;  4N06 A;  2Y3H A;  3V5Y A;  2J8W A;  3DAF A;  4JTA B;  4IRU A;  1EKY A;  3DJU B;  1JR8 A;  4MTG A;  2YQY A;  2MYS A;  3NRH A;  4PAC A;  4LAC B;  1PV3 A;  2CCY A;  2YZS A;  1BR4 A;  4JIO A;  3Q6M A;  5E2Q A;  5GPG B;  5T1D B;  3C8G D;  2WZL A;  1BDJ B;  1H7I A;  1WWP A;  4U5B E;  1MND A;  1APC A;  2OEX A;  3Q7L A;  4FES A;  1OR2 A;  1Q0F A;  4C3B A;  3AOU A;  4JCH A;  1M57 C;  1ZHW A;  2YL1 A;  2NUP B;  4JTD B;  4NTA A;  1NZE A;  4C3D A;  1QQ3 A;  4EHP A;  1SF8 A;  4PJJ A;  2ZXR A;  4P6I C;  1GQA A;  2H7V C;  1TWC A;  2HUJ A;  4OD4 A;  4U9D A;  4CJG A;  3TK0 A;  5KYY B;  2V26 A;  1M2O A;  2P1A A;  3U8P A;  3MYF A;  3NMI A;  1RKE B;  3LNR A;  2YL7 A;  5BQI A;  4LDQ A;  2YKZ A;  4MVZ A;  3S9O A;  1MQV A;  1LIH A;  2CGE A;  5JLI A;  3EH1 A;  4MQ9 F;  3EG9 B;  3GEI A;  5D91 A;  5E33 A;  1CPQ A;  2X51 A;  3IQ6 A;  1JAF A;  4OIQ F;  1TWA A;  2L6G A;  2QUP A;  2XM4 A;  3NMJ A;  3O55 A;  3W8H A;  3B0U X;  3OA1 A;  1XWJ A;  1TWG A;  2LCH A;  1VTM P;  1I5N A;  3LEV A;  3ZVR A;  3C7J A;  4LDR A;  3DJN B;  4U5G A;  4U5F E;  3TOM A;  2ZD9 A;  2XLV A;  3LNM B;  3LLI A;  4MW8 A;  3A9C A;  2HZ8 A;  3U5S A;  5DVW A;  4O7G A;  4OIP F;  2OOC A;  4RD9 A;  4W8P A;  3NDB B;  3EHM A;  3B0P A;  2JD3 A;  2PF4 E;  2HMQ A;  1S05 A;  2VC9 A;  3VM6 A;  3LS0 A;  1BR2 A;  4U5D E;  2W4M A;  4C3E A;  4F4B A;  1LM3 B;  1FAP B;  3MBG A;  2LP4 A;  4HFK B;  4XQ1 A;  1A7V A;  4GQH A;  2EPK X;  3N2Z B;  4K7B A;  1I4Y A;  3DE9 A;  3RQG A;  2Q9C A;  3ASO C;  1RJ9 A;  1IW7 F;  3MFN A;  3VYW A;  5DLJ A;  1L3P A;  2A6E F;  2AVK A;  3CZ6 A;  5KYW B;  4LLC A;  2HV6 A;  2IOQ A;  3PCV A;  1N1C A;  3ABM C;  5BQG A;  2H7B A;  3M4B A;  3S90 A;  2WVO A;  3GM2 A;  3W4Y A;  2LQG A;  5COM A;  5KYX A;  3NG1 A;  4XEV A;  4IAO A;  2H7O A;  2QTV A;  2Q9A A;  2WZG A;  2IBF A;  1VB5 A;  3CAX A;  3KYJ A;  4WGY A;  3JSE O;  3SP1 A;  5BQH A;  2LK4 A;  1VK5 A;  1H9T A;  1OKK A;  3ZC4 A;  1WAS A;  2IXN A;  3L8I A;  3NKD A;  4JJF A;  3TJ6 A;  4E7S A;  3V5X A;  4OIR F;  4JE9 A;  2W45 A;  4DBR A;  5B1A C;  4BG0 A;  1LVK A;  2R7R A;  2A0U A;  3R2P A;  1PD0 A;  3QTH A;  3W2V A;  1E85 A;  1YA7 O;  3C8G A;  256B A;  2KGO A;  3JT1 A;  1R4T A;  2X0C A;  2NUP A;  1HE1 A;  1QVX A;  4H4K C;  1CGO A;  1LE2 A;  2Q7R A;  3WHN A;  1Y6D A;  5A69 A;  3HLZ A;  1KNY A;  3JTL O;  3K6B A;  2R7T A;  2HKV A;  1ZW2 A;  3WG7 C;  3FMS A;  3AG4 C;  1D0Y A;  2EIM C;  4YT8 A;  1G4W R;  2B0J A;  3KMI A;  3RW0 A;  2OKU A;  3CEX A;  5T3W A;  1FFT C;  1RKE A;  2L81 A;  1NG1 A;  4XPY A;  4WAB A;  4AX2 A;  5A6K A;  1H6G A;  3ZQY A;  4BPM A;  3DXJ F;  3KYI A;  2KQ9 A;  1AUE A;  3EG9 A;  4OD5 A;  2KJG A;  4J30 B;  2YEV A;  2HSB A;  5L0D A;  3AJM A;  4FAP B;  5F28 E;  3RKO F;  1OCC C;  1TWH A;  2A68 F;  1F1M A;  3T4R A;  4I44 A;  2XLO A;  2VCA A;  1Q0D A;  4EIY A;  3JYY A;  1C03 A;  4G7O F;  1OW7 A;  3KKB A;  3NYJ A;  4YL3 A;  4GEH A;  5B3S C;  3PMR A;  1FR0 A;  1QLE C;  2HFI A;  3G4X A;  3UMH A;  2IXO A;  1HMD A;  3FAJ A;  3B29 A;  3LS1 A;  5L3V A;  2J9U A;  2YL3 A;  4GYT A;  2XLW A;  2YLI A;  4YK5 A;  5DS4 A;  2P7V A;  3ZQV A;  1IZM A;  4Z9J A;  3H2V A;  2XXA B;  1WN0 A;  5L3Q A;  1NSG B;  1Q0K A;  3RVZ A;  4BJ6 C;  5KYW A;  1DOV A;  2Y39 A;  2EIL C;  3M15 A;  2VCB A;  2BL2 A;  4JTC B;  4MTO A;  2XS1 A;  3Q7G A;  5IY5 C;  3TUL A;  4JJG A;  5F5H A;  3JYH A;  3IPM O;  1ZVZ A;  2GWW A;  2W9Y A;  2XL8 A;  1GS9 A;  4CIP A;  1V4A A;  2XLD A;  3GWN A;  3KPH A;  4DRI B;  3EZH A;  3LAY A;  4K0D A;  2J9V A;  2NG1 A;  2L7A A;  2HMZ A;  1LI7 A;  3F46 A;  2D5R B;  3C8G B;  3ZSU A;  1YA9 A;  3VAY A;  1ST6 A;  3SNH A;  3M79 A;  4IAR A;  2DYS C;  3AGU A;  1NU7 D;  4EBK A;  3R7C A;  1Z63 A;  3RQE A;  1TQG A;  2Q3T A;  1LKX A;  3SXK A;  1D1C A;  1V55 C;  2PX3 A;  4O79 A;  4XPX A;  4CX9 A;  3DI5 A;  2GA0 A;  2HS5 A;  2DGJ A;  1C02 A;  3U9M A;  4MS2 A;  4EBB A;  1Y4C A;  1MMD A;  2OEV A;  3L1M A;  2R7W A;  3GOR A;  4ULV A;  4CS9 C;  1HY5 A;  3FVY A;  4U5C E;  1ZYR F;  3AG1 C;  2AU5 A;  3E70 C;  3QMK A;  4YL0 A;  3OEO A;  2AWY A;  4IB4 A;  4IGG A;  3J06 A;  3ZG1 A;  1RXQ A;  3E9V A;  3F47 A;  3B9Q A;  4RBN A;  1QPU A;  1ZU4 A;  5JSL A;  2QY9 A;  3ZWI A;  5JVE A;  2PX0 A;  2NUT B;  4Q7C A;  1OCZ C;  4CBE A;  1ORS C;  3UNG C;  2MWQ A;  5A6J A;  1MNE A;  4XEF A;  4DVZ A;  2NSG A;  1TFK B;  3K1H A;  3NYM A;  5TJ5 E;  3UGO A;  4A4A A;  2ASR A;  4K1O A;  2L6F A;  3EH2 A;  3T6B A;  2JPU A;  2LD6 A;  5EK0 A;  4QI2 A;  5D92 A;  4G7H F;  2I15 A;  1E86 A;  4R32 A;  2J45 A;  1SYQ A;  3ABK C;  5DS5 A;  2DYR C;  2J0X A;  3ITF A;  4Z9H A;  2AP3 A;  4CSA C;  4E0I A;  3FHD A;  1G4U S;  3JZ0 A;  2XLM A;  3O39 A;  3WAQ A;  4AL1 A;  1HE9 A;  1O5H A;  3I5Q A;  1JMW A;  4HEA J;  2XLE A;  3EFO B;  2XL6 A;  1T9K A;  3S29 A;  3ZTZ A;  5JS5 A;  1A7D A;  4CDA A;  2EIJ C;  2W4B A;  2XLH A;  1NFO A;  2YRF A;  4JC7 A;  4U9E A;  3U3B A;  5DS6 A;  3DMD A;  3FDQ A;  1L7C A;  1VYI A;  3QVZ A;  3U0C A;  3K1I A;  2L9J A;  4O6N A;  1LS1 A;  4O6M A;  4RDA A;  1EA8 A;  1SR2 A;  1YAR O;  1V54 C;  4PJN A;  2M64 A;  2ZXW C;  3RFY A;  1V74 B;  2R9R B;  3LLK A;  3IQ5 A;  4JRZ A;  4MTF A;  3UGP A;  1SMY F;  3U2M A;  4KC9 A;  2HV7 A;  4NY3 A;  3RQF A;  4Q4Z F;  2XXA A;  1Z3I X;  2XSE A;  1T01 A;  4KBL A;  1RMV A;  4PR9 A;  3X2Q C;  2R7O A;  2OJE D;  1MMN A;  4YT5 A;  1NBB A;  1J8M F;  2TMV P;  2XS8 A;  4LDK A;  4EWC A;  4DXW A;  3S0X A;  3DWW A;  4BJ6 A;  1JRA A;  3U2L A;  1AEP A;  1O3U A;  2J9W A;  1YJG A;  3MYI A;  3U8V A;  2QE9 A;  2PFD A;  1PCX A;  3GEH A;  2J9B A;  5JP7 A;  3ZIB A;  4BEJ A;  1U6H A;  2VCC A;  4E18 A;  2CW0 F;  2LSE A;  2Q9B A;  3EPV A;  4U5H A;  4XEK A;  2G3V A;  2KYH A;  4CS7 A;  1OQC A;  2Q4F A;  1VYK A;  2Y3B A;  1YYJ A;  1ORJ A;  4L6R A;  1ZHX A;  1G8X A;  5B1B C;  3H65 A;  5AC5 A;  3FXH A;  4PJM A;  1ZHT A;  5A6A A;  5CI9 A;  2Y69 C;  5DQZ A;  5KYN A;  3RYL A;  1WGW A;  4PFP A;  2I8B A;  1RKC A;  3A11 A;  3SXZ A;  4LER A;  4CIH A;  3OWT A;  2Y3D A;  1YZC A;  5BUO A;  1OW8 A;  4XWJ A;  2DI3 A;  3U9J A;  4G7Z F;  2YHS A;  4CS9 A;  1Z5Z A;  4HFF B;  3ECS A;  4N6C A;  3HNI A;  4I3M A;  4NC3 A;  2NUT A;  2EPM X;  2H8A A;  1NFN A;  2WVN A;  1YDI A;  5FCL A;  3DZA A;  4MVU A;  4ANJ A;  1M56 C;  3BRJ A;  2B0H A;  2IXM A;  4JCZ A;  1ORY A;  1TKN A;  3C8Z A;  1BZ4 A;  3EQL F;  2GAQ A;  2OU6 A;  3K1I C;  2R02 A;  4MVR A;  2ETS A;  3G50 A;  2MHR A;  3LEO A;  4J7T A;  4PJL A;  2R7X A;  3EZI A;  1CGN A;  2C04 A;  4YT4 A;  3BEH A;  3FOP A;  4G0H A;  3EFO A;  2DB4 A;  1Z6A A;  4CSA A;  1VMA A;  1LE4 A;  3RH3 A;  3SZR A;  4BJ5 A;  4OIN F;  2HJ3 A;  2A1D D;  4NQF A;  4BEM J;  2E87 A;  3HKK A;  4EBJ A;  5K0I A;  5L0C A;  3FOO A;  3HJC A;  3M4C A;  4JZA A;  3L8J A;  3QZC A;  2YVK A;  2NPU A;  5HSW A;  2P6V A;  3ABL C;  2CNW D;  3ASN C;  3DAG A;  3QW0 A;  3TJ5 A;  1M2V A;  3S84 A;  4PK4 A;  3LES A;  3JRM O;  1Z7Q c;  3UMK A;  1ZHZ A;  4MND A;  2C03 A;  3EGD A;  2XRH A;  3W8I A;  2EIN C;  2VB6 A;  5A6B D;  2WZF A;  2F22 A;  1GGQ A;  3RVY A;  3N24 A;  5FZT A;  4M63 A;  2XM0 A;  4KNV A;  2CYD A;  4H54 A;  4E7Z A;  4YN0 B;  4O6Y A;  4FWV A;  4EUK B;  4MW3 A;  3TOL A;  3GM1 A;  4I1M A;  1J8Y F;  4CJO A;  3PHF 2;  2JX0 A;  1D1A A;  2QNL A;  1UFB A;  1WTY A;  3PDM P;  3S28 A;  2R05 A;  3EJN A;  2KW3 C;  1E2X A;  1C17 M;  2YLG A;  3LUT B;  1MMA A;  5HV9 A;  4AE4 A;  1ZU5 A; 
#chains in the Genus database with same CATH homology
 1TR2 A;  1ZHY A;  3MLG A;  3JSZ A;  3S27 A;  4C7O B;  3K7D A;  2EIK C;  1BR1 A;  4IJJ A;  4WJ0 A;  1NU9 C;  2WL8 A;  5E3A A;  4QI0 A;  4X0R A;  3K33 A;  4OIO F;  2R7S A;  2J0W A;  5EHH A;  3SEO A;  2CDQ A;  4JUR I;  4BJT A;  3RIP A;  1PD1 A;  2GFH A;  4W8K A;  4XLN F;  2J7P D;  3JCU Q;  4BJ5 C;  1MMG A;  4FX5 A;  2J46 A;  4DVY P;  4ZLC A;  4KI2 A;  1D0X A;  3CQZ A;  3N0T A;  2A6H F;  1JPJ A;  4B6I A;  1OCR C;  3K66 A;  3AG3 C;  2M4E A;  1M2V B;  5KYU A;  2VH3 A;  2Y3G A;  3IEE A;  5DQT A;  3EGD B;  2CNW A;  4CS8 C;  3DD7 A;  4YJW A;  3AQB A;  3GAN A;  1QZX A;  2R7Q A;  3CSK A;  4U5E E;  4BJ1 A;  4XTK A;  1S7Z A;  1Z23 A;  1D1B A;  4JW1 A;  4ULW A;  3MX3 A;  3KH2 A;  2VAS A;  5F5F A;  2IYL D;  1D0Z A;  3LJB A;  4YT2 A;  3I4U A;  2WVQ A;  4AE4 B;  2G3K A;  1OCO C;  3EGX B;  1FFH A;  3WOD F;  4AK9 A;  2OG2 A;  2ZXO A;  2R7U A;  1VOM A;  1FMW A;  4JVS A;  4C7O A;  1W2W A;  3T6J A;  3M1C B;  4YWQ A;  3L34 A;  5E3C A;  3UR3 C;  2KNH A;  4QDL A;  5CI8 A;  3V7O A;  3HTK C;  3Q6N A;  4Q5S F;  3NKE A;  3L0I A;  1FMV A;  4LLE A;  3SYN A;  3O6X A;  1JPN A;  2J7P A;  5KYY A;  3AG2 C;  1O87 A;  2ZXP A;  5EGY A;  4J32 B;  3DM9 B;  3DM5 A;  2V3C C;  1KU2 A;  1SZI A;  4XLP F;  5T3T A;  2FFH A;  3GOD A;  5KYU B;  3B0V C;  3KL4 A;  3X1O A;  3W2W A;  2PP4 A;  3UMI A;  2IXP A;  4I1O B;  3NYL A;  3TD7 A;  2R7V A;  4DBQ A;  2ZPA A;  2BE5 F;  3AQC A;  3JRT A;  2A69 F;  4CS8 A;  1FTS A;  4HE8 D;  4PFO A;  1RJ9 B;  4DOZ A;  2O9X A;  2Z15 A;  2FGY A;  3I5P A;  3EHN A;  4IWB A;  3POV A;  2OCC C;  2WB7 A;  5KYX B;  4ZLD A;  2G62 A;  4KNW A;  2XL4 A;  3EGX A;  4N06 A;  1OKK D;  2Y3H A;  3DAF A;  4IRU A;  3DJU B;  2MYS A;  3NRH A;  4LAC B;  5E2Q A;  2YZS A;  1BR4 A;  5T1D B;  3Q6M A;  2WZL A;  4U5B E;  1MND A;  3Q7L A;  4FES A;  4C3B A;  4JCH A;  1M57 C;  1ZHW A;  4C3D A;  2NUP B;  1NZE A;  1SF8 A;  4PJJ A;  2ZXR A;  4P6I C;  2H7V C;  1TWC A;  4OD4 A;  5KYY B;  2V26 A;  1M2O A;  3LNR A;  2CGE A;  3EH1 A;  4MQ9 F;  3EG9 B;  5D91 A;  5E33 A;  2X51 A;  4OIQ F;  1TWA A;  3B0U X;  3W8H A;  3OA1 A;  1TWG A;  3LEV A;  3ZVR A;  3DJN B;  4U5G A;  4U5F E;  3LLI A;  5DVW A;  4O7G A;  4OIP F;  4RD9 A;  3NDB B;  3EHM A;  3B0P A;  2JD3 A;  2PF4 E;  3LS0 A;  1BR2 A;  4U5D E;  2W4M A;  4C3E A;  4F4B A;  4HFK B;  4A2N B;  4K7B A;  3N2Z B;  2Q9C A;  3ASO C;  1RJ9 A;  1IW7 F;  3VYW A;  5DLJ A;  5KYW B;  2A6E F;  3CZ6 A;  4LLC A;  2HV6 A;  2IOQ A;  1N1C A;  3ABM C;  2H7B A;  2WVO A;  5KYX A;  3NG1 A;  4IAO A;  2H7O A;  2QTV A;  2Q9A A;  2WZG A;  3SP1 A;  1VK5 A;  1OKK A;  3ZC4 A;  2IXN A;  3NKD A;  4E7S A;  4JJF A;  4OIR F;  4DBR A;  2W45 A;  5B1A C;  4BG0 A;  1LVK A;  2R7R A;  1PD0 A;  3W2V A;  2KGO A;  3JT1 A;  2NUP A;  4H4K C;  3HLZ A;  3K6B A;  2R7T A;  3WG7 C;  3AG4 C;  1D0Y A;  2EIM C;  4YT8 A;  2B0J A;  3KMI A;  5T3W A;  1FFT C;  2L81 A;  1NG1 A;  4AX2 A;  3DXJ F;  2KQ9 A;  3EG9 A;  4OD5 A;  2KJG A;  4J30 B;  2YEV A;  3RKO F;  1OCC C;  1TWH A;  2A68 F;  3T4R A;  4I44 A;  4G7O F;  3KKB A;  3NYJ A;  4GEH A;  5B3S C;  3PMR A;  1QLE C;  3UMH A;  2IXO A;  3FAJ A;  3LS1 A;  5L3V A;  2J9U A;  4GYT A;  5DS4 A;  2P7V A;  1IZM A;  2XXA B;  5L3Q A;  4BJ6 C;  5KYW A;  2Y39 A;  2EIL C;  3Q7G A;  5IY5 C;  4JJG A;  5F5H A;  3JYH A;  2W9Y A;  3EZH A;  3LAY A;  4K0D A;  2J9V A;  2NG1 A;  3F46 A;  2D5R B;  3ZSU A;  3VAY A;  1ST6 A;  3SNH A;  1Z63 A;  2DYS C;  1NU7 D;  2Q3T A;  1LKX A;  1D1C A;  1V55 C;  2PX3 A;  4O79 A;  2DGJ A;  4EBB A;  1MMD A;  2R7W A;  4CS9 C;  3FVY A;  4U5C E;  1ZYR F;  3AG1 C;  3E70 C;  3QMK A;  3OEO A;  3ZG1 A;  3E9V A;  3F47 A;  3B9Q A;  4RBN A;  1ZU4 A;  2QY9 A;  2PX0 A;  2NUT B;  4Q7C A;  1OCZ C;  4CBE A;  3UNG C;  2MWQ A;  1MNE A;  4DVZ A;  3K1H A;  3NYM A;  3UGO A;  3EH2 A;  3T6B A;  4QI2 A;  5D92 A;  4G7H F;  5DS5 A;  2J45 A;  3ABK C;  2DYR C;  2J0X A;  3ITF A;  4CSA C;  3FHD A;  3O39 A;  1O5H A;  3I5Q A;  4HEA J;  3EFO B;  3S29 A;  2EIJ C;  2W4B A;  3FDQ A;  5DS6 A;  3DMD A;  1VYI A;  2L9J A;  4O6N A;  1LS1 A;  4O6M A;  4RDA A;  1V54 C;  4PJN A;  2ZXW C;  3RFY A;  3LLK A;  3UGP A;  1SMY F;  4KC9 A;  2HV7 A;  4NY3 A;  4Q4Z F;  2XXA A;  1Z3I X;  2XSE A;  4KBL A;  3X2Q C;  2R7O A;  1MMN A;  4YT5 A;  1J8M F;  4EWC A;  3S0X A;  4BJ6 A;  2J9W A;  2PFD A;  1PCX A;  3ZIB A;  4BEJ A;  2CW0 F;  2LSE A;  2Q9B A;  3EPV A;  4U5H A;  4CS7 A;  2G3V A;  1VYK A;  2Y3B A;  1ZHX A;  1G8X A;  5B1B C;  3H65 A;  4PJM A;  1ZHT A;  5CI9 A;  2Y69 C;  5DQZ A;  5KYN A;  3RYL A;  1WGW A;  4PFP A;  2I8B A;  4LER A;  4CIH A;  3OWT A;  2Y3D A;  5BUO A;  4XWJ A;  4G7Z F;  2YHS A;  4CS9 A;  1Z5Z A;  4HFF B;  3ECS A;  4I3M A;  2NUT A;  2WVN A;  5FCL A;  3DZA A;  4ANJ A;  1M56 C;  2IXM A;  1TKN A;  3EQL F;  3K1I C;  4PJL A;  2R7X A;  3EZI A;  2C04 A;  4YT4 A;  4G0H A;  3EFO A;  1Z6A A;  4CSA A;  1VMA A;  3RH3 A;  3SZR A;  4BJ5 A;  4OIN F;  2A1D D;  2E87 A;  3HJC A;  4JZA A;  3QZC A;  5HSW A;  2P6V A;  3ABL C;  2CNW D;  3ASN C;  3DAG A;  1M2V A;  4PK4 A;  3LES A;  3UMK A;  1ZHZ A;  4MND A;  2C03 A;  3EGD A;  2XRH A;  3W8I A;  2EIN C;  2VB6 A;  2WZF A;  3N24 A;  4M63 A;  4KNV A;  4E7Z A;  4YN0 B;  4O6Y A;  4FWV A;  4I1M A;  1J8Y F;  3PHF 2;  1D1A A;  3S28 A;  3EJN A;  2KW3 C;  1MMA A;  4AE4 A;  1ZU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...