2L81A

Solution nmr structure of the serine-rich domain of hef1 (enhancer of filamentation 1) from homo sapiens, northeast structural genomics consortium target hr5554a
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
MGHHHHHHSHMDKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Enhancer of filamentation 1
publication title Northeast Structural Genomics Consortium Target HR5554A
rcsb
source organism Homo sapiens
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2010-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08824 Serine_rich Serine rich protein interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.830 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2l81A00
1Z23A 2L81A
chains in the Genus database with same CATH superfamily
2PX0A 3CZ6A 4XPWA 2EPNA 1R4TA 4J7YA 2YHSA 1G5ZA 2OKUA 3ASNC 2VH3A 3OEOA 3VF0A 1LE4A 1M6TA 1OQCA 3SZRA 3HLZA 4I1MA 3SYNA 4J30B 2J7PD 1O5HA 2OOCA 3UMIA 1KTMA 3DJNB 4JRZA 2WVOA 3JYYA 3UNGC 3ZQVA 2OEXA 2R7WA 2TMVP 2YLIA 4Z9IA 3EG9A 2IXPA 1XWJA 3W4YA 3MYIA 5A6BD 1T9KA 1YA7O 2M64A 3IEEA 1FFHA 4JJFA 3TJ5A 4JTCB 3U9MA 3AQCA 5L3VA 1JPNA 1YARO 3M1CB 3K6BA 3VRCA 1JRAA 2DB4A 2R02A 1MMAA 4JW1A 2J46A 4RDAA 4G7HF 3GM1A 1RKEA 1TWAA 5COGA 1U89A 4JIOA 3RKOF 1L3PA 3DI5A 3KKBA 2G62A 5KYXB 2YL1A 5JRAA 2D5RB 3T4RA 5JLIA 4KNVA 3CAXA 1H6GA 1LPEA 4W8KA 3IQTA 2EPKX 2XLWA 3FOOA 2CGEA 3TQOA 4JC7A 4ER9A 4CJOA 3ZIBA 1MMGA 2J0XA 1SR2A 1E83A 3UGPA 3U8VA 4EBJA 1GGQA 1S05A 1O3UA 3RW0A 2R7QA 3C62A 3NRHA 4GYTA 1QSPA 2XLDA 4F4BA 2W45A 5KYWA 1ZVZA 1G8XA 2PBEA 3VM6A 4OIRF 3HJCA 3QMKA 2H7VC 3FAJA 2CW0F 1ZYRF 1ZHZA 2AP3A 2X51A 3N0TA 4MVQA 3S28A 4YK5A 4U9DA 4BJ5C 5L0FA 3LJBA 4U5DE 3U9JA 2IYLD 3JCUQ 5KYYA 4BEMJ 1EA8A 1ST6A 2W4BA 4AE4A 1TFKB 3EPVA 3IHUA 3JZ0A 2HSQA 3HNLA 4U5BE 1ZHXA 1C03A 3S0XA 3LLKA 2OG2A 1Z6AA 3MLGA 5A6KA 4N06A 3KH2A 4YN0B 3WAQA 5JT4A 1T5OA 3I5PA 4PFOA 2LIGA 3S84A 4AX2A 3QTHA 1M2VA 3UMHA 1JOGA 3LUTB 4CSAC 1QZXA 2JD3A 4MVRA 2XSEA 1ZU4A 1NBBA 4I44A 4YT4A 1H9GA 3EZIA 4NCQA 3TD7A 1LS4A 3EJNA 3ZTMA 2YQYA 2A68F 3M15A 1SYQA 1OCCC 4P9TA 5B1BC 2DGJA 1NU7D 3EQLF 1A41A 2LFFA 3NG1A 3RFYA 1M57C 3C8ZA 2H7OA 3M79A 3U3FA 1XZQA 1MQVA 2KW3C 3EG9B 4IRUA 2PP4A 1K04A 5KYNA 4JEAA 1YYJA 1I5NA 1QVXA 2IM8A 1V55C 1FAPB 2NPUA 3DM9B 3NKEA 4KNWA 1T6IA 2IXMA 4JKVA 3FHDA 3RVYA 4DOZA 3W2VA 2LK4A 5COFA 3UGOA 2B0JA 1OR2A 3QW0A 5K0IA 5L0IA 4PJNA 1N1CA 2YWAA 1XZPA 1SF8A 3C8GA 5T3WA 4ONSA 2EPLX 5D91A 3DE8A 4PJLA 4PFPA 3PCVA 1D0ZA 2XM0A 2DI3A 2BE5F 1Y6DA 4LDQA 3UR3C 1VLSA 4FESA 1YYXA 5L0HA 3TJ6A 5T3TA 3T6BA 4MVMA 3HNJA 4G7ZF 3U0CA 5KYWB 5A69A 3CQZA 2XS8A 2VCAA 4NQFA 3AG2C 4PACA 2B0HA 1LI5A 3V5XA 4AL1A 2ICWG 5HV9A 4DVYP 1T01A 3JTLO 3S29A 2A0UA 3JRMO 3U2MA 2A6HF 4DBRA 2NSGA 1IZMA 1LE2A 1YA9A 3G4ZA 3HNIA 4MW8A 3A11A 3L8IA 1VYKA 2J9BA 2LCHA 2KK1A 5F28E 4AE4B 5AGFA 1BR1A 2QY9A 5DQZA 1PD0A 3GEIA 1QLEC 4Z9HA 4EKWA 5FCLA 1ZHWA 1A7VA 3ABLC 3GWNA 5GPGB 3KYJA 3S9OA 3TK0A 2R7RA 3QVZA 2XLMA 3I5QA 4OINF 1D1AA 2DYRC 2YVKA 1VB5A 3PDMP 1LI7A 1M2VB 1UG7A 3US6A 2L81A 1HMOA 1MMNA 1WATA 1V74B 2HV7A 3O39A 3O55A 5T1DB 1G4US 1OCZC 5BQIA 1CGME 1JMWA 4JZAA 3PHF2 1H9TA 2BC5A 3FAPB 3JSZA 3B71A 3R7CA 5DS5A 1CGNA 2MYSA 1G4WR 3ASOC 3EGDB 1BR4A 2J9VA 2P1AA 1V54C 2EIKC 1RMVA 1HY5A 1KU2A 1OCRC 4I1OB 2QNLA 3QW1A 3ECSA 3SEOA 5KYUA 4JURI 4B6IA 2PF4E 1KNYA 5DLJA 1QPUA 3EZHA 5E33A 2CYDA 3S90A 2XLHA 3LNRA 1LKXA 2D4UA 3B29A 3LEOA 4XQ1A 1C17M 2EIJC 2YLDA 2J9WA 4O79A 4FX5A 3GODA 4CDYA 1ZW3A 2AU5A 2NUTA 4CBEA 4DXWA 1LVKA 3B0VC 3V5YA 4QI2A 1OW8A 1YDIA 1ZW2A 3Q7GA 4CDAA 4GQHA 1WTYA 2QE9A 2GA0A 3C8GB 4JVSA 5CI8A 2Y3DA 1E2XA 3GEHA 1OW7A 3B9QA 5BQGA 1DOVA 2Y3BA 3ZSUA 5B3IA 1FFTC 1LS1A 2OU6A 4IAQA 3DJUB 3HTKC 4JEBA 1AEPA 1VLTA 4KBLA 2IOQA 4RD9A 5EK0A 2V3CC 3QVYA 4BJ6C 3SXKA 2W4MA 1WOLA 3H2VA 4EBBA 4OIQF 3X1OA 2HJMA 4BJTA 2WVQA 2R7VA 1LM3B 1YZCA 2Y3HA 3W8HA 5DS4A 2Y39A 5L0DA 2KJGA 2MHRA 3GANA 3OWTA 2Q9CA 2E87A 3DKAA 1GQAA 2UUHA 4YT8A 4PR9A 1FR0A 1GS9A 2Q7RA 2LD6A 2VB6A 3RVZA 4CS7A 5FZTA 3V7OA 1AVOB 1TKNA 4MVZA 2EPOA 3NYLA 3WODF 3CEXA 3K1IC 2HZ8A 5HSWA 3T6GB 4E7SA 1TWGA 2QLAA 2KSFA 4JE9A 4LACB 3JRTA 2G3KA 3BEHA 1VTMP 4U5CE 2ZD9A 3M4CA 2LP4A 5E3CA 2GAQA 3DM5A 2XLVA 2Q00A 4K7BA 2O9XA 4WJ0A 2WL8A 3OA1A 3SP1A 4HFKB 3LLIA 3KL4A 1IW7F 1K40A 3AQBA 4J7TA 4KC9A 4X0RA 4EHPA 4EUKB 5B3SC 4C7OB 1S7ZA 2CCYA 3ATPA 1MNEA 1WN0A 1OW6A 1TWHA 3POVA 3MBGA 4J32B 4CSAA 4U5HA 4W8PA 3N24A 3U3BA 1OCOC 1D0YA 2LQGA 2AWCA 4YL3A 3C8GD 2HS5A 4R32A 1T6QA 3L8JA 5KYUB 1RJ9A 1HMDA 4O6MA 4QI0A 4CS8C 1YZAA 3NMIA 1Z5ZA 3Q6MA 2L6GA 2XLEA 2YEVA 3DMDA 4A2NB 3TOLA 1A7EA 2HJ3A 3L34A 5L0GA 1B68A 1BBHA 2NUTB 1Q0MA 4Q5SF 4P6IC 2WB7A 1AUEA 2PNOA 4HFFB 5CIVA 2C04A 3FDQA 4E0HA 2R03A 2HSBA 3IQ6A 1RKEB 3A9CA 1QKRA 3SXMA 1TWCA 3U2LA 1U0BB 2XL6A 4C3DA 4UDVA 4N6HA 3O6XA 2NUPA 2WZGA 3AGUA 3W2WA 1I4ZA 4YL1A 3U8PA 4IGGA 3C63A 3AG4C 5B1AC 2CNWA 3MYFA 2I15A 3ABKC 3IQ5A 4XPXA 2J9UA 4MTOA 3ZVRA 4JJGA 2KYHA 2P61A 2V26A 3FOPA 4E0IA 4CS9C 2WZFA 2IXNA 3MFNA 4I3MA 2GWWA 4BEJA 2M4EA 5JS5A 4ANJA 3LEVA 4LDRA 3KPHA 2ZPAA 4MW3A 5A6JA 1BZ4A 5BQHA 3C7JA 2OJED 1PCXA 4MVUA 1NLXA 1NSGB 4O7GA 5KYYB 2LFDA 5EHHA 1MMDA 2AWYA 4E7ZA 5KYXA 2NG1A 2W9YA 4U5EE 3Q7LA 2R9RB 1ZZPA 2XLOA 2L9JA 2VCBA 4MS2A 1WASA 1J8YF 4ULWA 1HE9A 3L0IA 3S27A 1APCA 1L7CA 2H7BA 4E18A 4O6NA 4OIPF 3AG3C 1OXBA 4IARA 4CIPA 2PX3A 5DQTA 2IXOA 3FXHA 3SNHA 3W8IA 4U5GA 4NTFA 1FMVA 2A1DD 3IPMO 1EQ1A 3NKDA 1JR8A 2Q9BA 1OXKA 4QDLA 1UFBA 1VMAA 1Y4CA 3HKKA 1HW2A 3BRJA 2ZXPA 4H4KC 4RBNA 2KNHA 3JSEO 3ABMC 4LDKA 3T6JA 3M4BA 4K1OA 5A6AA 2VC9A 5DS6A 3K33A 4IB4A 2R7TA 2P7VA 1ZHTA 2OQMA 3DE9A 3DZAA 5AC4A 5EGYA 2WVNA 4XLPF 3F46A 1Z23A 4MQ9F 3EH2A 4BPMA 1OKKA 2ZXWC 4YL0A 3ZC4A 2HFIA 4CDVA 2J8WA 4A4AA 3Q6NA 4N6CA 1PD1A 2YLGA 4OD5A 2JPUA 4DJ9A 3E9VA 1Q0GA 3N2ZB 4O6YA 4WGZA 1I4YA 2NUPB 2IBFA 1SMYF 2YZSA 1MNDA 1E84A 2YRFA 3DWWA 3KMIA 4G0HA 2HMQA 1NG1A 2ETSA 5JSLA 3GWLA 2XS1A 4BJ6A 5F5FA 1EKYA 5F5HA 1RKCA 2JX0A 2OCCC 1O87A 2XM4A 4ULVA 1NZEA 3RQEA 3RF3A 4PJJA 2F22A 4G78A 2BL2A 1D1BA 1CPRA 3H65A 1NFOA 1Z3IX 3V5ZA 1CGOA 4HEAJ 2ZXRA 2R05A 4KI2A 1CPQA 1ORJA 3NYJA 1YAUO 5D92A 3NYMA 3VAYA 3WG7C 3K1IA 4BJ5A 1E85A 1EI7A 4HE8D 3JYHA 2C03A 4Q4ZF 3EH1A 1YLMA 3G4XA 1YJGA 4U9EA 4WABA 2VCCA 3NMJA 3FVYA 2UUIA 1JPJA 3E70C 3EGXA 3ZWIA 1LIHA 1WGWA 2J7PA 4YJWA 2GDCA 1FNTc 3LNMB 3J06A 3K66A 1TR2A 2HMZA 4K0DA 5A6BA 2KGOA 4XPYA 4NC3A 3FMSA 1V4AA 3K1HA 4Z9JA 1Z63A 3B0UX 1VYIA 3U5SA 2OEVA 3MX3A 1RCPA 2HKVA 4JTAB 4BJ1A 4DBQA 3NMKA 2VASA 1HE1A 1ZU5A 5E2QA 3EFOA 4OD4A 2P0NA 4E17A 2CDQA 1Q0KA 4EWCA 3EHNA 3TOMA 1D1CA 2XXAA 1JAFA 4CS8A 3DAGA 2EIMC 1NU9C 2CNWD 2Y69C 4MTGA 4MVSA 2MWQA 3IQCA 4AK9A 4DRHB 3GEEA 4YT5A 5CI9A 2FFHA 3TULA 1T6UA 2J45A 4OIOF 2YL0A 5BUOA 1SZIA 1TQGA 2R7UA 2G3VA 3PMRA 2GFHA 3LESA 4YT2A 2RSEB 4D4XA 4XEFA 1NFNA 4JCZA 4IWBA 1Z7Qc 2R7SA 2J0WA 2H8AA 2KC3A 3X2QC 4PK4A 3VYWA 3LS1A 3H2UA 1J8MF 4P9FA 1ZHYA 4G7OF 4AL0A 4H54A 3EGDA 5L0JA 2WZLA 3QZCA 3G50A 2I8BA 2R25A 4L6RA 1VOMA 2RD9A 3DAFA 1RXQA 4NY3A 5E3AA 3RQGA 3F47A 3WHNA 4N4WA 1FMWA 3LS0A 4D4NA 1M56C 2XL4A 1DOWA 4C3EA 256BA 2P6VA 4CS9A 1F1MA 3T9OA 3RYLA 2HV6A 4YWQA 3B0PA 1BR2A 4JTDB 3ZG1A 2PFDA 5COMA 3UMKA 4DVZA 4ZLCA 3RH3A 4CJGA 3ZTZA 4XTKA 5AC5A 1YVIA 2LSEA 4PJMA 5JVEA 3R2PA 2XRHA 1ORSC 1C02A 3I4UA 4XWJA 5TJ5E 3ZQYA 1Q0FA 1BDJB 2DYSC 2HUJA 3AJMA 3RIPA 3K7DA 3SXYA 1R5ID 1U6HA 3NDBB 1TFOB 3EGXB 2XL8A 4U5FE 1HW1A 3DD7A 5JUAA 1QQ3A 3CSKA 1D0XA 3O10A 2L7AA 2Y3GA 2NSFA 4MTFA 3AG1C 2YL7A 2FAPB 4JCHA 2X0CA 1K05A 5L3QA 4NTBA 3GM2A 4EIYA 1H7IA 1OKKD 4LLCA 5DVWA 4CX9A 2L6HA 1A0BA 4M63A 3ZDLA 2L6FA 4FAPB 2A6EF 3RQFA 1WWPA 4MNDA 3SXZA 3EFOB 2Q9AA 1FTSA 2EINC 2FGYA 1OR3A 2KQ9A 3ITFA 4XLNF 1E86A 2XXAB 1RJ9B 4C3BA 3EHMA 3HNKA 3AOUA 2Z15A 2Q3TA 4WGYA 4EBKA 2AVKA 2YL3A 4Q7CA 3L1MA 4IAOA 2R7XA 4CIHA 1W2WA 4DRIB 3JT1A 4BG0A 4LERA 4NTAA 5L0CA 4GEHA 2EILC 2OJQA 3DXJF 1GM5A 2A69F 4IJJA 1PV3A 2QTVA 2A0BA 1M2OA 4DRJB 4ZLDA 2QUPA 2ASRA 2R7OA 2YKZA 3GORA 3LAYA 5IY5C 1A7DA 1Q0DA 1VK5A 2EPMX 4C7OA 4XEVA 4LLEA 2Q4FA 3GM3A 3KYIA 3C18A 1ORYA 2ZXOA 5JP7A 4XEKA 4FWVA 4MVOA 3AGTA
chains in the Genus database with same CATH topology
2PX0A 3CZ6A 2YHSA 3ASNC 2VH3A 3OEOA 3SZRA 3HLZA 4I1MA 3SYNA 4J30B 2J7PD 1O5HA 3UMIA 3DJNB 2WVOA 3UNGC 2R7WA 3EG9A 2IXPA 3IEEA 1FFHA 4JJFA 5L3VA 3AQCA 1JPNA 3M1CB 3K6BA 4JW1A 1MMAA 2J46A 4RDAA 4G7HF 1TWAA 3RKOF 5KYXB 3KKBA 2G62A 2D5RB 3T4RA 4KNVA 4W8KA 2CGEA 3ZIBA 1MMGA 2J0XA 3UGPA 2R7QA 4GYTA 3NRHA 4F4BA 5KYWA 2W45A 1G8XA 4OIRF 3HJCA 3QMKA 2H7VC 3FAJA 2CW0F 1ZYRF 1ZHZA 3N0TA 2X51A 3S28A 4BJ5C 3LJBA 4U5DE 2IYLD 3JCUQ 5KYYA 1ST6A 2W4BA 4AE4A 3EPVA 4U5BE 3S0XA 1ZHXA 3LLKA 2OG2A 1Z6AA 3MLGA 4N06A 3KH2A 4YN0B 3I5PA 4PFOA 4AX2A 1M2VA 3UMHA 4CSAC 1QZXA 2JD3A 2XSEA 1ZU4A 4I44A 4YT4A 3EZIA 3TD7A 3EJNA 2A68F 1OCCC 5B1BC 2DGJA 1NU7D 3EQLF 3RFYA 3NG1A 1M57C 2H7OA 2KW3C 3EG9B 4IRUA 2PP4A 5KYNA 3DM9B 4KNWA 1V55C 3NKEA 2IXMA 3FHDA 4DOZA 3W2VA 3UGOA 2B0JA 4PJNA 1N1CA 1SF8A 5T3WA 5D91A 4PJLA 4PFPA 1D0ZA 2BE5F 3UR3C 4FESA 5T3TA 3T6BA 4G7ZF 5KYWB 3CQZA 3AG2C 4DVYP 3S29A 2A6HF 4DBRA 1IZMA 1VYKA 4AE4B 1BR1A 2QY9A 5DQZA 1PD0A 5FCLA 1QLEC 1ZHWA 3ABLC 2R7RA 3I5QA 4OINF 1D1AA 2DYRC 1M2VB 2L81A 3O39A 1MMNA 5T1DB 2HV7A 1OCZC 4JZAA 3PHF2 3JSZA 5DS5A 2MYSA 3EGDB 3ASOC 1BR4A 2J9VA 1V54C 2EIKC 1KU2A 1OCRC 4I1OB 4B6IA 3ECSA 3SEOA 5KYUA 4JURI 2PF4E 5DLJA 3EZHA 5E33A 3LNRA 1LKXA 2EIJC 4O79A 2J9WA 4FX5A 3GODA 2NUTA 4CBEA 1LVKA 3B0VC 4QI2A 3Q7GA 4JVSA 5CI8A 2Y3DA 3B9QA 3ZSUA 2Y3BA 1FFTC 1LS1A 3DJUB 3HTKC 4KBLA 2IOQA 4RD9A 2V3CC 4BJ6C 2W4MA 4EBBA 3X1OA 4BJTA 2WVQA 2R7VA 2Y3HA 3W8HA 5DS4A 2Y39A 2KJGA 3GANA 3OWTA 2Q9CA 2E87A 4YT8A 2VB6A 4CS7A 3V7OA 4Q5SF 1TKNA 5HSWA 3WODF 3NYLA 3K1IC 4E7SA 1TWGA 4LACB 3JRTA 2G3KA 4U5CE 5E3CA 3DM5A 4K7BA 2O9XA 4WJ0A 2WL8A 3OA1A 3SP1A 4HFKB 3LLIA 3KL4A 1IW7F 4KC9A 3AQBA 4X0RA 4C7OB 5B3SC 1S7ZA 1MNEA 1TWHA 3POVA 4J32B 4CSAA 4U5HA 3N24A 1OCOC 1D0YA 5KYUB 1RJ9A 4O6MA 4CS8C 4QI0A 1Z5ZA 3Q6MA 2YEVA 3DMDA 4A2NB 3L34A 2NUTB 4P6IC 2WB7A 4HFFB 2C04A 3FDQA 1TWCA 4C3DA 3O6XA 2NUPA 2WZGA 3W2WA 3AG4C 5B1AC 2CNWA 3ABKC 2J9UA 3ZVRA 4JJGA 2V26A 4CS9C 2WZFA 2IXNA 4I3MA 4BEJA 2M4EA 4ANJA 3LEVA 2ZPAA 1PCXA 4O7GA 5KYYB 5EHHA 1MMDA 4E7ZA 5KYXA 2NG1A 2W9YA 4U5EE 3Q7LA 2L9JA 1J8YF 4ULWA 3L0IA 3S27A 2H7BA 4O6NA 4OIPF 3AG3C 2PX3A 5DQTA 2IXOA 3SNHA 3W8IA 4U5GA 1FMVA 2A1DD 3NKDA 2Q9BA 4QDLA 1VMAA 2ZXPA 4H4KC 4RBNA 2KNHA 3T6JA 3ABMC 5DS6A 3K33A 2R7TA 2P7VA 1ZHTA 3DZAA 5EGYA 2WVNA 4XLPF 3F46A 1Z23A 4MQ9F 3EH2A 1OKKA 2ZXWC 3ZC4A 3Q6NA 4OD5A 1PD1A 3E9VA 3N2ZB 4O6YA 2NUPB 2YZSA 1SMYF 1MNDA 3KMIA 4G0HA 1NG1A 4BJ6A 5F5FA 5F5HA 2OCCC 1O87A 1NZEA 4PJJA 1D1BA 3H65A 1Z3IX 4HEAJ 2ZXRA 4KI2A 3NYJA 5D92A 3NYMA 3VAYA 3WG7C 4BJ5A 4HE8D 3JYHA 2C03A 4Q4ZF 3EH1A 4OIQF 3FVYA 3E70C 1JPJA 3EGXA 1WGWA 2J7PA 4YJWA 3K66A 1TR2A 4K0DA 2KGOA 3K1HA 1Z63A 3B0UX 1VYIA 4BJ1A 3MX3A 4DBQA 2VASA 1ZU5A 5E2QA 3EFOA 4OD4A 2CDQA 4EWCA 3EHNA 1D1CA 2XXAA 4CS8A 3DAGA 2EIMC 1NU9C 2CNWD 2Y69C 2MWQA 4AK9A 4YT5A 5CI9A 2FFHA 2J45A 4OIOF 5BUOA 1SZIA 2R7UA 2G3VA 3PMRA 2GFHA 3LESA 4YT2A 2R7SA 4IWBA 2J0WA 3X2QC 4PK4A 3VYWA 3LS1A 1J8MF 1ZHYA 4G7OF 3EGDA 2WZLA 3QZCA 2I8BA 1VOMA 3DAFA 4NY3A 5E3AA 3F47A 1FMWA 3LS0A 1M56C 2XL4A 4C3EA 2P6VA 4CS9A 3RYLA 2HV6A 4YWQA 3B0PA 1BR2A 4DVZA 3ZG1A 2PFDA 3UMKA 4ZLCA 3RH3A 4XTKA 2LSEA 4PJMA 2XRHA 3I4UA 4XWJA 3RIPA 2DYSC 3NDBB 3K7DA 3EGXB 4U5FE 3DD7A 3CSKA 1D0XA 2Y3GA 3AG1C 4JCHA 5L3QA 1OKKD 4LLCA 5DVWA 4M63A 2A6EF 4MNDA 3EFOB 2Q9AA 1FTSA 2EINC 2FGYA 3ITFA 2KQ9A 4XLNF 2XXAB 1RJ9B 4C3BA 3EHMA 2Z15A 2Q3TA 2R7XA 4Q7CA 4IAOA 4CIHA 1W2WA 3JT1A 4BG0A 4LERA 4GEHA 2EILC 3DXJF 2A69F 4IJJA 2QTVA 4ZLDA 1M2OA 2R7OA 3LAYA 5IY5C 1VK5A 4C7OA 4LLEA 2ZXOA 4FWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z23 A;  2L81 A; 
#chains in the Genus database with same CATH topology
 2PX0 A;  3CZ6 A;  4XPW A;  2EPN A;  1R4T A;  4J7Y A;  2YHS A;  1G5Z A;  2OKU A;  3ASN C;  2VH3 A;  3OEO A;  3VF0 A;  1LE4 A;  1M6T A;  1OQC A;  3SZR A;  3HLZ A;  4I1M A;  3SYN A;  4J30 B;  2J7P D;  1O5H A;  2OOC A;  3UMI A;  1KTM A;  3DJN B;  4JRZ A;  2WVO A;  3JYY A;  3UNG C;  3ZQV A;  2OEX A;  2R7W A;  2TMV P;  2YLI A;  4Z9I A;  3EG9 A;  2IXP A;  1XWJ A;  3W4Y A;  3MYI A;  5A6B D;  1T9K A;  1YA7 O;  2M64 A;  3IEE A;  1FFH A;  4JJF A;  3TJ5 A;  4JTC B;  3U9M A;  3AQC A;  5L3V A;  1JPN A;  1YAR O;  3M1C B;  3K6B A;  3VRC A;  1JRA A;  2DB4 A;  2R02 A;  1MMA A;  4JW1 A;  2J46 A;  4RDA A;  4G7H F;  3GM1 A;  1RKE A;  1TWA A;  5COG A;  1U89 A;  4JIO A;  3RKO F;  1L3P A;  3DI5 A;  3KKB A;  2G62 A;  5KYX B;  2YL1 A;  5JRA A;  2D5R B;  3T4R A;  5JLI A;  4KNV A;  3CAX A;  1H6G A;  1LPE A;  4W8K A;  3IQT A;  2EPK X;  2XLW A;  3FOO A;  2CGE A;  3TQO A;  4JC7 A;  4ER9 A;  4CJO A;  3ZIB A;  1MMG A;  2J0X A;  1SR2 A;  1E83 A;  3UGP A;  3U8V A;  4EBJ A;  1GGQ A;  1S05 A;  1O3U A;  3RW0 A;  2R7Q A;  3C62 A;  3NRH A;  4GYT A;  1QSP A;  2XLD A;  4F4B A;  2W45 A;  5KYW A;  1ZVZ A;  1G8X A;  2PBE A;  3VM6 A;  4OIR F;  3HJC A;  3QMK A;  2H7V C;  3FAJ A;  2CW0 F;  1ZYR F;  1ZHZ A;  2AP3 A;  2X51 A;  3N0T A;  4MVQ A;  3S28 A;  4YK5 A;  4U9D A;  4BJ5 C;  5L0F A;  3LJB A;  4U5D E;  3U9J A;  2IYL D;  3JCU Q;  5KYY A;  4BEM J;  1EA8 A;  1ST6 A;  2W4B A;  4AE4 A;  1TFK B;  3EPV A;  3IHU A;  3JZ0 A;  2HSQ A;  3HNL A;  4U5B E;  1ZHX A;  1C03 A;  3S0X A;  3LLK A;  2OG2 A;  1Z6A A;  3MLG A;  5A6K A;  4N06 A;  3KH2 A;  4YN0 B;  3WAQ A;  5JT4 A;  1T5O A;  3I5P A;  4PFO A;  2LIG A;  3S84 A;  4AX2 A;  3QTH A;  1M2V A;  3UMH A;  1JOG A;  3LUT B;  4CSA C;  1QZX A;  2JD3 A;  4MVR A;  2XSE A;  1ZU4 A;  1NBB A;  4I44 A;  4YT4 A;  1H9G A;  3EZI A;  4NCQ A;  3TD7 A;  1LS4 A;  3EJN A;  3ZTM A;  2YQY A;  2A68 F;  3M15 A;  1SYQ A;  1OCC C;  4P9T A;  5B1B C;  2DGJ A;  1NU7 D;  3EQL F;  1A41 A;  2LFF A;  3NG1 A;  3RFY A;  1M57 C;  3C8Z A;  2H7O A;  3M79 A;  3U3F A;  1XZQ A;  1MQV A;  2KW3 C;  3EG9 B;  4IRU A;  2PP4 A;  1K04 A;  5KYN A;  4JEA A;  1YYJ A;  1I5N A;  1QVX A;  2IM8 A;  1V55 C;  1FAP B;  2NPU A;  3DM9 B;  3NKE A;  4KNW A;  1T6I A;  2IXM A;  4JKV A;  3FHD A;  3RVY A;  4DOZ A;  3W2V A;  2LK4 A;  5COF A;  3UGO A;  2B0J A;  1OR2 A;  3QW0 A;  5K0I A;  5L0I A;  4PJN A;  1N1C A;  2YWA A;  1XZP A;  1SF8 A;  3C8G A;  5T3W A;  4ONS A;  2EPL X;  5D91 A;  3DE8 A;  4PJL A;  4PFP A;  3PCV A;  1D0Z A;  2XM0 A;  2DI3 A;  2BE5 F;  1Y6D A;  4LDQ A;  3UR3 C;  1VLS A;  4FES A;  1YYX A;  5L0H A;  3TJ6 A;  5T3T A;  3T6B A;  4MVM A;  3HNJ A;  4G7Z F;  3U0C A;  5KYW B;  5A69 A;  3CQZ A;  2XS8 A;  2VCA A;  4NQF A;  3AG2 C;  4PAC A;  2B0H A;  1LI5 A;  3V5X A;  4AL1 A;  2ICW G;  5HV9 A;  4DVY P;  1T01 A;  3JTL O;  3S29 A;  2A0U A;  3JRM O;  3U2M A;  2A6H F;  4DBR A;  2NSG A;  1IZM A;  1LE2 A;  1YA9 A;  3G4Z A;  3HNI A;  4MW8 A;  3A11 A;  3L8I A;  1VYK A;  2J9B A;  2LCH A;  2KK1 A;  5F28 E;  4AE4 B;  5AGF A;  1BR1 A;  2QY9 A;  5DQZ A;  1PD0 A;  3GEI A;  1QLE C;  4Z9H A;  4EKW A;  5FCL A;  1ZHW A;  1A7V A;  3ABL C;  3GWN A;  5GPG B;  3KYJ A;  3S9O A;  3TK0 A;  2R7R A;  3QVZ A;  2XLM A;  3I5Q A;  4OIN F;  1D1A A;  2DYR C;  2YVK A;  1VB5 A;  3PDM P;  1LI7 A;  1M2V B;  1UG7 A;  3US6 A;  2L81 A;  1HMO A;  1MMN A;  1WAT A;  1V74 B;  2HV7 A;  3O39 A;  3O55 A;  5T1D B;  1G4U S;  1OCZ C;  5BQI A;  1CGM E;  1JMW A;  4JZA A;  3PHF 2;  1H9T A;  2BC5 A;  3FAP B;  3JSZ A;  3B71 A;  3R7C A;  5DS5 A;  1CGN A;  2MYS A;  1G4W R;  3ASO C;  3EGD B;  1BR4 A;  2J9V A;  2P1A A;  1V54 C;  2EIK C;  1RMV A;  1HY5 A;  1KU2 A;  1OCR C;  4I1O B;  2QNL A;  3QW1 A;  3ECS A;  3SEO A;  5KYU A;  4JUR I;  4B6I A;  2PF4 E;  1KNY A;  5DLJ A;  1QPU A;  3EZH A;  5E33 A;  2CYD A;  3S90 A;  2XLH A;  3LNR A;  1LKX A;  2D4U A;  3B29 A;  3LEO A;  4XQ1 A;  1C17 M;  2EIJ C;  2YLD A;  2J9W A;  4O79 A;  4FX5 A;  3GOD A;  4CDY A;  1ZW3 A;  2AU5 A;  2NUT A;  4CBE A;  4DXW A;  1LVK A;  3B0V C;  3V5Y A;  4QI2 A;  1OW8 A;  1YDI A;  1ZW2 A;  3Q7G A;  4CDA A;  4GQH A;  1WTY A;  2QE9 A;  2GA0 A;  3C8G B;  4JVS A;  5CI8 A;  2Y3D A;  1E2X A;  3GEH A;  1OW7 A;  3B9Q A;  5BQG A;  1DOV A;  2Y3B A;  3ZSU A;  5B3I A;  1FFT C;  1LS1 A;  2OU6 A;  4IAQ A;  3DJU B;  3HTK C;  4JEB A;  1AEP A;  1VLT A;  4KBL A;  2IOQ A;  4RD9 A;  5EK0 A;  2V3C C;  3QVY A;  4BJ6 C;  3SXK A;  2W4M A;  1WOL A;  3H2V A;  4EBB A;  4OIQ F;  3X1O A;  2HJM A;  4BJT A;  2WVQ A;  2R7V A;  1LM3 B;  1YZC A;  2Y3H A;  3W8H A;  5DS4 A;  2Y39 A;  5L0D A;  2KJG A;  2MHR A;  3GAN A;  3OWT A;  2Q9C A;  2E87 A;  3DKA A;  1GQA A;  2UUH A;  4YT8 A;  4PR9 A;  1FR0 A;  1GS9 A;  2Q7R A;  2LD6 A;  2VB6 A;  3RVZ A;  4CS7 A;  5FZT A;  3V7O A;  1AVO B;  1TKN A;  4MVZ A;  2EPO A;  3NYL A;  3WOD F;  3CEX A;  3K1I C;  2HZ8 A;  5HSW A;  3T6G B;  4E7S A;  1TWG A;  2QLA A;  2KSF A;  4JE9 A;  4LAC B;  3JRT A;  2G3K A;  3BEH A;  1VTM P;  4U5C E;  2ZD9 A;  3M4C A;  2LP4 A;  5E3C A;  2GAQ A;  3DM5 A;  2XLV A;  2Q00 A;  4K7B A;  2O9X A;  4WJ0 A;  2WL8 A;  3OA1 A;  3SP1 A;  4HFK B;  3LLI A;  3KL4 A;  1IW7 F;  1K40 A;  3AQB A;  4J7T A;  4KC9 A;  4X0R A;  4EHP A;  4EUK B;  5B3S C;  4C7O B;  1S7Z A;  2CCY A;  3ATP A;  1MNE A;  1WN0 A;  1OW6 A;  1TWH A;  3POV A;  3MBG A;  4J32 B;  4CSA A;  4U5H A;  4W8P A;  3N24 A;  3U3B A;  1OCO C;  1D0Y A;  2LQG A;  2AWC A;  4YL3 A;  3C8G D;  2HS5 A;  4R32 A;  1T6Q A;  3L8J A;  5KYU B;  1RJ9 A;  1HMD A;  4O6M A;  4QI0 A;  4CS8 C;  1YZA A;  3NMI A;  1Z5Z A;  3Q6M A;  2L6G A;  2XLE A;  2YEV A;  3DMD A;  4A2N B;  3TOL A;  1A7E A;  2HJ3 A;  3L34 A;  5L0G A;  1B68 A;  1BBH A;  2NUT B;  1Q0M A;  4Q5S F;  4P6I C;  2WB7 A;  1AUE A;  2PNO A;  4HFF B;  5CIV A;  2C04 A;  3FDQ A;  4E0H A;  2R03 A;  2HSB A;  3IQ6 A;  1RKE B;  3A9C A;  1QKR A;  3SXM A;  1TWC A;  3U2L A;  1U0B B;  2XL6 A;  4C3D A;  4UDV A;  4N6H A;  3O6X A;  2NUP A;  2WZG A;  3AGU A;  3W2W A;  1I4Z A;  4YL1 A;  3U8P A;  4IGG A;  3C63 A;  3AG4 C;  5B1A C;  2CNW A;  3MYF A;  2I15 A;  3ABK C;  3IQ5 A;  4XPX A;  2J9U A;  4MTO A;  3ZVR A;  4JJG A;  2KYH A;  2P61 A;  2V26 A;  3FOP A;  4E0I A;  4CS9 C;  2WZF A;  2IXN A;  3MFN A;  4I3M A;  2GWW A;  4BEJ A;  2M4E A;  5JS5 A;  4ANJ A;  3LEV A;  4LDR A;  3KPH A;  2ZPA A;  4MW3 A;  5A6J A;  1BZ4 A;  5BQH A;  3C7J A;  2OJE D;  1PCX A;  4MVU A;  1NLX A;  1NSG B;  4O7G A;  5KYY B;  2LFD A;  5EHH A;  1MMD A;  2AWY A;  4E7Z A;  5KYX A;  2NG1 A;  2W9Y A;  4U5E E;  3Q7L A;  2R9R B;  1ZZP A;  2XLO A;  2L9J A;  2VCB A;  4MS2 A;  1WAS A;  1J8Y F;  4ULW A;  1HE9 A;  3L0I A;  3S27 A;  1APC A;  1L7C A;  2H7B A;  4E18 A;  4O6N A;  4OIP F;  3AG3 C;  1OXB A;  4IAR A;  4CIP A;  2PX3 A;  5DQT A;  2IXO A;  3FXH A;  3SNH A;  3W8I A;  4U5G A;  4NTF A;  1FMV A;  2A1D D;  3IPM O;  1EQ1 A;  3NKD A;  1JR8 A;  2Q9B A;  1OXK A;  4QDL A;  1UFB A;  1VMA A;  1Y4C A;  3HKK A;  1HW2 A;  3BRJ A;  2ZXP A;  4H4K C;  4RBN A;  2KNH A;  3JSE O;  3ABM C;  4LDK A;  3T6J A;  3M4B A;  4K1O A;  5A6A A;  2VC9 A;  5DS6 A;  3K33 A;  4IB4 A;  2R7T A;  2P7V A;  1ZHT A;  2OQM A;  3DE9 A;  3DZA A;  5AC4 A;  5EGY A;  2WVN A;  4XLP F;  3F46 A;  1Z23 A;  4MQ9 F;  3EH2 A;  4BPM A;  1OKK A;  2ZXW C;  4YL0 A;  3ZC4 A;  2HFI A;  4CDV A;  2J8W A;  4A4A A;  3Q6N A;  4N6C A;  1PD1 A;  2YLG A;  4OD5 A;  2JPU A;  4DJ9 A;  3E9V A;  1Q0G A;  3N2Z B;  4O6Y A;  4WGZ A;  1I4Y A;  2NUP B;  2IBF A;  1SMY F;  2YZS A;  1MND A;  1E84 A;  2YRF A;  3DWW A;  3KMI A;  4G0H A;  2HMQ A;  1NG1 A;  2ETS A;  5JSL A;  3GWL A;  2XS1 A;  4BJ6 A;  5F5F A;  1EKY A;  5F5H A;  1RKC A;  2JX0 A;  2OCC C;  1O87 A;  2XM4 A;  4ULV A;  1NZE A;  3RQE A;  3RF3 A;  4PJJ A;  2F22 A;  4G78 A;  2BL2 A;  1D1B A;  1CPR A;  3H65 A;  1NFO A;  1Z3I X;  3V5Z A;  1CGO A;  4HEA J;  2ZXR A;  2R05 A;  4KI2 A;  1CPQ A;  1ORJ A;  3NYJ A;  1YAU O;  5D92 A;  3NYM A;  3VAY A;  3WG7 C;  3K1I A;  4BJ5 A;  1E85 A;  1EI7 A;  4HE8 D;  3JYH A;  2C03 A;  4Q4Z F;  3EH1 A;  1YLM A;  3G4X A;  1YJG A;  4U9E A;  4WAB A;  2VCC A;  3NMJ A;  3FVY A;  2UUI A;  1JPJ A;  3E70 C;  3EGX A;  3ZWI A;  1LIH A;  1WGW A;  2J7P A;  4YJW A;  2GDC A;  1FNT c;  3LNM B;  3J06 A;  3K66 A;  1TR2 A;  2HMZ A;  4K0D A;  5A6B A;  2KGO A;  4XPY A;  4NC3 A;  3FMS A;  1V4A A;  3K1H A;  4Z9J A;  1Z63 A;  3B0U X;  1VYI A;  3U5S A;  2OEV A;  3MX3 A;  1RCP A;  2HKV A;  4JTA B;  4BJ1 A;  4DBQ A;  3NMK A;  2VAS A;  1HE1 A;  1ZU5 A;  5E2Q A;  3EFO A;  4OD4 A;  2P0N A;  4E17 A;  2CDQ A;  1Q0K A;  4EWC A;  3EHN A;  3TOM A;  1D1C A;  2XXA A;  1JAF A;  4CS8 A;  3DAG A;  2EIM C;  1NU9 C;  2CNW D;  2Y69 C;  4MTG A;  4MVS A;  2MWQ A;  3IQC A;  4AK9 A;  4DRH B;  3GEE A;  4YT5 A;  5CI9 A;  2FFH A;  3TUL A;  1T6U A;  2J45 A;  4OIO F;  2YL0 A;  5BUO A;  1SZI A;  1TQG A;  2R7U A;  2G3V A;  3PMR A;  2GFH A;  3LES A;  4YT2 A;  2RSE B;  4D4X A;  4XEF A;  1NFN A;  4JCZ A;  4IWB A;  1Z7Q c;  2R7S A;  2J0W A;  2H8A A;  2KC3 A;  3X2Q C;  4PK4 A;  3VYW A;  3LS1 A;  3H2U A;  1J8M F;  4P9F A;  1ZHY A;  4G7O F;  4AL0 A;  4H54 A;  3EGD A;  5L0J A;  2WZL A;  3QZC A;  3G50 A;  2I8B A;  2R25 A;  4L6R A;  1VOM A;  2RD9 A;  3DAF A;  1RXQ A;  4NY3 A;  5E3A A;  3RQG A;  3F47 A;  3WHN A;  4N4W A;  1FMW A;  3LS0 A;  4D4N A;  1M56 C;  2XL4 A;  1DOW A;  4C3E A;  256B A;  2P6V A;  4CS9 A;  1F1M A;  3T9O A;  3RYL A;  2HV6 A;  4YWQ A;  3B0P A;  1BR2 A;  4JTD B;  3ZG1 A;  2PFD A;  5COM A;  3UMK A;  4DVZ A;  4ZLC A;  3RH3 A;  4CJG A;  3ZTZ A;  4XTK A;  5AC5 A;  1YVI A;  2LSE A;  4PJM A;  5JVE A;  3R2P A;  2XRH A;  1ORS C;  1C02 A;  3I4U A;  4XWJ A;  5TJ5 E;  3ZQY A;  1Q0F A;  1BDJ B;  2DYS C;  2HUJ A;  3AJM A;  3RIP A;  3K7D A;  3SXY A;  1R5I D;  1U6H A;  3NDB B;  1TFO B;  3EGX B;  2XL8 A;  4U5F E;  1HW1 A;  3DD7 A;  5JUA A;  1QQ3 A;  3CSK A;  1D0X A;  3O10 A;  2L7A A;  2Y3G A;  2NSF A;  4MTF A;  3AG1 C;  2YL7 A;  2FAP B;  4JCH A;  2X0C A;  1K05 A;  5L3Q A;  4NTB A;  3GM2 A;  4EIY A;  1H7I A;  1OKK D;  4LLC A;  5DVW A;  4CX9 A;  2L6H A;  1A0B A;  4M63 A;  3ZDL A;  2L6F A;  4FAP B;  2A6E F;  3RQF A;  1WWP A;  4MND A;  3SXZ A;  3EFO B;  2Q9A A;  1FTS A;  2EIN C;  2FGY A;  1OR3 A;  2KQ9 A;  3ITF A;  4XLN F;  1E86 A;  2XXA B;  1RJ9 B;  4C3B A;  3EHM A;  3HNK A;  3AOU A;  2Z15 A;  2Q3T A;  4WGY A;  4EBK A;  2AVK A;  2YL3 A;  4Q7C A;  3L1M A;  4IAO A;  2R7X A;  4CIH A;  1W2W A;  4DRI B;  3JT1 A;  4BG0 A;  4LER A;  4NTA A;  5L0C A;  4GEH A;  2EIL C;  2OJQ A;  3DXJ F;  1GM5 A;  2A69 F;  4IJJ A;  1PV3 A;  2QTV A;  2A0B A;  1M2O A;  4DRJ B;  4ZLD A;  2QUP A;  2ASR A;  2R7O A;  2YKZ A;  3GOR A;  3LAY A;  5IY5 C;  1A7D A;  1Q0D A;  1VK5 A;  2EPM X;  4C7O A;  4XEV A;  4LLE A;  2Q4F A;  3GM3 A;  3KYI A;  3C18 A;  1ORY A;  2ZXO A;  5JP7 A;  4XEK A;  4FWV A;  4MVO A;  3AGT A; 
#chains in the Genus database with same CATH homology
 2PX0 A;  3CZ6 A;  2YHS A;  3ASN C;  2VH3 A;  3OEO A;  3SZR A;  3HLZ A;  4I1M A;  3SYN A;  4J30 B;  2J7P D;  1O5H A;  3UMI A;  3DJN B;  2WVO A;  3UNG C;  2R7W A;  3EG9 A;  2IXP A;  3IEE A;  1FFH A;  4JJF A;  5L3V A;  3AQC A;  1JPN A;  3M1C B;  3K6B A;  4JW1 A;  1MMA A;  2J46 A;  4RDA A;  4G7H F;  1TWA A;  3RKO F;  5KYX B;  3KKB A;  2G62 A;  2D5R B;  3T4R A;  4KNV A;  4W8K A;  2CGE A;  3ZIB A;  1MMG A;  2J0X A;  3UGP A;  2R7Q A;  4GYT A;  3NRH A;  4F4B A;  5KYW A;  2W45 A;  1G8X A;  4OIR F;  3HJC A;  3QMK A;  2H7V C;  3FAJ A;  2CW0 F;  1ZYR F;  1ZHZ A;  3N0T A;  2X51 A;  3S28 A;  4BJ5 C;  3LJB A;  4U5D E;  2IYL D;  3JCU Q;  5KYY A;  1ST6 A;  2W4B A;  4AE4 A;  3EPV A;  4U5B E;  3S0X A;  1ZHX A;  3LLK A;  2OG2 A;  1Z6A A;  3MLG A;  4N06 A;  3KH2 A;  4YN0 B;  3I5P A;  4PFO A;  4AX2 A;  1M2V A;  3UMH A;  4CSA C;  1QZX A;  2JD3 A;  2XSE A;  1ZU4 A;  4I44 A;  4YT4 A;  3EZI A;  3TD7 A;  3EJN A;  2A68 F;  1OCC C;  5B1B C;  2DGJ A;  1NU7 D;  3EQL F;  3RFY A;  3NG1 A;  1M57 C;  2H7O A;  2KW3 C;  3EG9 B;  4IRU A;  2PP4 A;  5KYN A;  3DM9 B;  4KNW A;  1V55 C;  3NKE A;  2IXM A;  3FHD A;  4DOZ A;  3W2V A;  3UGO A;  2B0J A;  4PJN A;  1N1C A;  1SF8 A;  5T3W A;  5D91 A;  4PJL A;  4PFP A;  1D0Z A;  2BE5 F;  3UR3 C;  4FES A;  5T3T A;  3T6B A;  4G7Z F;  5KYW B;  3CQZ A;  3AG2 C;  4DVY P;  3S29 A;  2A6H F;  4DBR A;  1IZM A;  1VYK A;  4AE4 B;  1BR1 A;  2QY9 A;  5DQZ A;  1PD0 A;  5FCL A;  1QLE C;  1ZHW A;  3ABL C;  2R7R A;  3I5Q A;  4OIN F;  1D1A A;  2DYR C;  1M2V B;  2L81 A;  3O39 A;  1MMN A;  5T1D B;  2HV7 A;  1OCZ C;  4JZA A;  3PHF 2;  3JSZ A;  5DS5 A;  2MYS A;  3EGD B;  3ASO C;  1BR4 A;  2J9V A;  1V54 C;  2EIK C;  1KU2 A;  1OCR C;  4I1O B;  4B6I A;  3ECS A;  3SEO A;  5KYU A;  4JUR I;  2PF4 E;  5DLJ A;  3EZH A;  5E33 A;  3LNR A;  1LKX A;  2EIJ C;  4O79 A;  2J9W A;  4FX5 A;  3GOD A;  2NUT A;  4CBE A;  1LVK A;  3B0V C;  4QI2 A;  3Q7G A;  4JVS A;  5CI8 A;  2Y3D A;  3B9Q A;  3ZSU A;  2Y3B A;  1FFT C;  1LS1 A;  3DJU B;  3HTK C;  4KBL A;  2IOQ A;  4RD9 A;  2V3C C;  4BJ6 C;  2W4M A;  4EBB A;  3X1O A;  4BJT A;  2WVQ A;  2R7V A;  2Y3H A;  3W8H A;  5DS4 A;  2Y39 A;  2KJG A;  3GAN A;  3OWT A;  2Q9C A;  2E87 A;  4YT8 A;  2VB6 A;  4CS7 A;  3V7O A;  4Q5S F;  1TKN A;  5HSW A;  3WOD F;  3NYL A;  3K1I C;  4E7S A;  1TWG A;  4LAC B;  3JRT A;  2G3K A;  4U5C E;  5E3C A;  3DM5 A;  4K7B A;  2O9X A;  4WJ0 A;  2WL8 A;  3OA1 A;  3SP1 A;  4HFK B;  3LLI A;  3KL4 A;  1IW7 F;  4KC9 A;  3AQB A;  4X0R A;  4C7O B;  5B3S C;  1S7Z A;  1MNE A;  1TWH A;  3POV A;  4J32 B;  4CSA A;  4U5H A;  3N24 A;  1OCO C;  1D0Y A;  5KYU B;  1RJ9 A;  4O6M A;  4CS8 C;  4QI0 A;  1Z5Z A;  3Q6M A;  2YEV A;  3DMD A;  4A2N B;  3L34 A;  2NUT B;  4P6I C;  2WB7 A;  4HFF B;  2C04 A;  3FDQ A;  1TWC A;  4C3D A;  3O6X A;  2NUP A;  2WZG A;  3W2W A;  3AG4 C;  5B1A C;  2CNW A;  3ABK C;  2J9U A;  3ZVR A;  4JJG A;  2V26 A;  4CS9 C;  2WZF A;  2IXN A;  4I3M A;  4BEJ A;  2M4E A;  4ANJ A;  3LEV A;  2ZPA A;  1PCX A;  4O7G A;  5KYY B;  5EHH A;  1MMD A;  4E7Z A;  5KYX A;  2NG1 A;  2W9Y A;  4U5E E;  3Q7L A;  2L9J A;  1J8Y F;  4ULW A;  3L0I A;  3S27 A;  2H7B A;  4O6N A;  4OIP F;  3AG3 C;  2PX3 A;  5DQT A;  2IXO A;  3SNH A;  3W8I A;  4U5G A;  1FMV A;  2A1D D;  3NKD A;  2Q9B A;  4QDL A;  1VMA A;  2ZXP A;  4H4K C;  4RBN A;  2KNH A;  3T6J A;  3ABM C;  5DS6 A;  3K33 A;  2R7T A;  2P7V A;  1ZHT A;  3DZA A;  5EGY A;  2WVN A;  4XLP F;  3F46 A;  1Z23 A;  4MQ9 F;  3EH2 A;  1OKK A;  2ZXW C;  3ZC4 A;  3Q6N A;  4OD5 A;  1PD1 A;  3E9V A;  3N2Z B;  4O6Y A;  2NUP B;  2YZS A;  1SMY F;  1MND A;  3KMI A;  4G0H A;  1NG1 A;  4BJ6 A;  5F5F A;  5F5H A;  2OCC C;  1O87 A;  1NZE A;  4PJJ A;  1D1B A;  3H65 A;  1Z3I X;  4HEA J;  2ZXR A;  4KI2 A;  3NYJ A;  5D92 A;  3NYM A;  3VAY A;  3WG7 C;  4BJ5 A;  4HE8 D;  3JYH A;  2C03 A;  4Q4Z F;  3EH1 A;  4OIQ F;  3FVY A;  3E70 C;  1JPJ A;  3EGX A;  1WGW A;  2J7P A;  4YJW A;  3K66 A;  1TR2 A;  4K0D A;  2KGO A;  3K1H A;  1Z63 A;  3B0U X;  1VYI A;  4BJ1 A;  3MX3 A;  4DBQ A;  2VAS A;  1ZU5 A;  5E2Q A;  3EFO A;  4OD4 A;  2CDQ A;  4EWC A;  3EHN A;  1D1C A;  2XXA A;  4CS8 A;  3DAG A;  2EIM C;  1NU9 C;  2CNW D;  2Y69 C;  2MWQ A;  4AK9 A;  4YT5 A;  5CI9 A;  2FFH A;  2J45 A;  4OIO F;  5BUO A;  1SZI A;  2R7U A;  2G3V A;  3PMR A;  2GFH A;  3LES A;  4YT2 A;  2R7S A;  4IWB A;  2J0W A;  3X2Q C;  4PK4 A;  3VYW A;  3LS1 A;  1J8M F;  1ZHY A;  4G7O F;  3EGD A;  2WZL A;  3QZC A;  2I8B A;  1VOM A;  3DAF A;  4NY3 A;  5E3A A;  3F47 A;  1FMW A;  3LS0 A;  1M56 C;  2XL4 A;  4C3E A;  2P6V A;  4CS9 A;  3RYL A;  2HV6 A;  4YWQ A;  3B0P A;  1BR2 A;  4DVZ A;  3ZG1 A;  2PFD A;  3UMK A;  4ZLC A;  3RH3 A;  4XTK A;  2LSE A;  4PJM A;  2XRH A;  3I4U A;  4XWJ A;  3RIP A;  2DYS C;  3NDB B;  3K7D A;  3EGX B;  4U5F E;  3DD7 A;  3CSK A;  1D0X A;  2Y3G A;  3AG1 C;  4JCH A;  5L3Q A;  1OKK D;  4LLC A;  5DVW A;  4M63 A;  2A6E F;  4MND A;  3EFO B;  2Q9A A;  1FTS A;  2EIN C;  2FGY A;  3ITF A;  2KQ9 A;  4XLN F;  2XXA B;  1RJ9 B;  4C3B A;  3EHM A;  2Z15 A;  2Q3T A;  2R7X A;  4Q7C A;  4IAO A;  4CIH A;  1W2W A;  3JT1 A;  4BG0 A;  4LER A;  4GEH A;  2EIL C;  3DXJ F;  2A69 F;  4IJJ A;  2QTV A;  4ZLD A;  1M2O A;  2R7O A;  3LAY A;  5IY5 C;  1VK5 A;  4C7O A;  4LLE A;  2ZXO A;  4FWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...