2ICWG

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
MKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 213
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2icwG02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2icwG01
2OJED 1R5ID 2ICWG 3KPHA
chains in the Genus database with same CATH superfamily
1NG7A 3AG4C 1R1TA 2WB7A 4UY8I 3M8FA 1ZRCA 1A36A 1R9TJ 2R7SA 3NKDA 2V6EA 4EJVA 3AG4H 3CCEI 4HF2A 1QPUA 4LIUA 2EZIA 1YYJA 4IRUA 1OR2A 3CQZA 4MVSA 1I4YA 1YYXA 3KL4A 2JA5J 2R7XA 5KYXB 1J75A 3Q7GA 4C2UA 1ZH5A 4WGYA 1LVAA 2NOJB 3KX2A 2UV1A 4YRVA 4EBBA 2XAUA 2KPMA 4I2OA 5GPAA 3HOUJ 1FTSA 1AU7A 2DI3A 1LDDA 2KJBA 4GCVA 2KGOA 2DW4A 3E9VA 3EFOB 3O8GA 1KU3A 1HOMA 1MIJA 5D4RA 3FXHA 4DVYP 4MIMA 2RNGA 2H8RA 1ZHTA 3PHF2 1Q0KA 3HG9A 3NRHA 3W4YA 2A05A 3V5XA 2AP3A 5IY5C 2K9NA 3G1OA 2XB0X 1W2WA 2WZGA 3AG1C 3IL2A 1IXSB 4A0XA 5E3NA 3HRTA 2IEKA 4IJAA 1FWZA 2W00A 4M3EA 5EZHA 2DT6A 2OTJI 4V2GA 2JUGA 3R61A 4UVBA 1WJFA 4IQJA 3DU5A 2VASA 3K4KA 4A3JJ 3H3ZA 2E87A 5HS9A 3CTAA 4M9ZA 4AIKA 1K05A 4TV7A 1LB2A 3UNGC 3LNQA 5AC4A 4C7OB 3JRBA 4WJ0A 1YE9A 1T01A 3K4JA 4E7LA 2HYGD 2VE8A 1C0WA 3F8MA 4XONA 2CQNA 2EZLA 1JOGA 4UB6C 2V1NA 1WJDA 1YITI 2M9HA 4XKVA 3CCVI 1K04A 4FHTA 5E20A 2G0EA 2KIFA 1D3YA 4L9JA 2WZFA 2V1UA 4BJ6C 2VPRA 1DQUA 4Z9HA 2LQGA 4HW0A 5FFZA 3MAJA 4RDUA 2Y48A 4YJWA 1W5TA 2QKLB 5DV5A 2FBHA 1NTCA 4LLEA 1GLNA 3S1RJ 5EEHA 1LNWA 2W25A 3H92A 4G6QA 3GWLA 5DD8A 2DMUA 3LOCA 1T38A 1BM9A 2IS1A 2EIKC 4BKXA 1EKYA 2OU6A 3FXKA 1T98A 1ETOA 2K4JA 2UWMA 1W36C 1Z6RA 3VEPA 2HFIA 4U0VA 4I01A 2EIKH 1UB9A 3HOZJ 2HTJA 3C63A 1FMVA 1S29A 3MZ8A 5LGUA 2RSEB 2R7QA 1MDMB 4IO9F 2VL8A 1XZQA 3U2RA 2BBYA 3KETA 1MNMC 2NNNA 3C18A 4NDLA 3JTLO 1X2MA 4HV5A 3L2QA 2X6OA 4IAQA 2VKDA 3EZIA 1OISA 1MBGA 4P1WA 1ZVZA 2RNJA 1O5HA 3BZ6A 1Z7LA 3U3FA 2J9BA 2IS2A 4EMSA 1FYMA 2ZBKA 3U1DA 1CPQA 2Y69C 2UUIA 1J59A 1Z7UA 4B8XA 5GAEJ 3GTJJ 4CCJA 2MLGA 5HODA 1WI3A 3QU3A 1ZR4A 1LFUP 2X51A 3FF5A 2Q00A 3NQOA 1GDTA 5FO5A 4LDQA 2E19A 2M8GX 1IDYA 5L3QA 1XSDA 2V9PA 2C6YA 3K33A 4ULVA 1BBHA 3OIPA 4OMZA 4KYWA 5GPCA 3K70D 1WJAA 1NFNA 4OU0A 2NS7A 4CZZA 1VFCA 4D4XA 2EQRA 3C2GA 1M57C 5A6AA 1KTMA 3OOPA 3RKOF 4E7SA 2X1CA 4CYCB 3TL4X 2LVSA 5ED4A 2R7WA 3S9OA 3S3NA 4YT2A 3I58A 1TNTA 1FSHA 4A3CJ 2KFDA 5L3EA 4OINF 2LG4A 2PBEA 2QUPA 2B7EA 1Y6DA 3DE9A 2XSDC 4Z9IA 4JW1A 1ZRFA 2BHYA 1VTMP 4S0HB 5F1RA 1SFXA 5DEQA 1ODDA 2D4UA 2IW5A 9ANTA 1R5ID 2GAUA 1UCRA 2PX0A 1RMVA 2P7CB 2EV5A 4G6DA 5J3LA 4IX7A 1VQOI 4CS7A 3MYFA 2XLOA 2ELKA 3JRMO 2XPUA 4AE4A 1C02A 1R4MB 3WG7C 5L0IA 4F3QA 3RCOA 3HLZA 3MFNA 1WJ5A 4LLNA 3WG7H 5JLIA 5BQIA 2NPUA 1ETYA 3GWZA 4HBLA 3MEXA 3H5AA 2EZHA 3ZVRA 4B1RA 1KU9A 3RKQA 1RR7A 2X4HA 3S27A 2W4BA 3F21A 1QZZA 3KEOA 3PCVA 3RPUD 1LUJB 1S7OA 1GHCA 2KT0A 2CRGA 5CI9A 4HOBA 1Z3XA 1FOKA 2G3VA 1PCXA 4IHTA 1D5VA 3GEEA 2HJ3A 4Y17A 3S2HJ 5D8KB 1R5HA 4DBQA 1H9TA 2HEOA 3TK0A 4WX9A 3JW4A 5ICCA 3Q9VA 1RCPA 2DA3A 3GLXA 4MGRA 1D0YA 3PIOF 4XEVA 3J7AY 2DQRA 3BZKA 4RGUA 2A0UA 2MFZA 3C7JA 1FZPB 4DOZA 1TWCJ 3BR2A 5KNLA 4EVIA 4UB8C 1A0BA 3E97A 3LAJA 1HE1A 3L0IA 4B43A 4LG0A 4D7NA 3BTLA 3DU6A 3S0XA 2W9YA 3BG5A 2ICWG 4BBRJ 2BVMA 3O6BB 1I1GA 4DRJB 2WY7Q 1H7IA 5JRAA 2D45A 3LUTB 3U1KA 2IGOA 2PN6A 1VB5A 2JVHA 1ZG1A 1QHGA 1MBHA 2IA2A 1TW2A 3CEXA 2KNHA 3B9QA 3N2ZB 4JTAB 3K1NA 3G73A 2AS5F 2EH3A 2R3SA 2IXMA 2W1OA 4UXNA 3FIWA 1YI2I 3U8VA 3EH2A 4RA2A 5E3AA 3CCYA 1YZAA 3SFIA 2W4SA 2QWWA 2R92J 2XRNA 2OEVA 4MVRA 2YQYA 4AWXB 3UGOA 1S6LA 2P0NA 1QHHD 1R00A 4L5EA 1U89A 2ME6A 4NQFA 2CV2A 3IHUA 4MVQA 2DOAA 2AVKA 2XXAB 2XLDA 5IP6A 4YFNF 4W97A 3A01A 2PI0A 3DJUB 4OD5A 5L3BA 2X1DA 3LSHA 4F7ZA 2ID3A 3CLOA 3VYTB 1D1AA 4YFKF 1GT0C 2L3DA 1G4US 2LK4A 5B5EC 1XMKA 2JZYA 3SFZA 3ZPLA 3S15J 2IXNA 4GEHA 5AONA 1T6QA 2XAJA 3BWGA 1GVDA 3FX3A 2FQ3A 2R4GA 3JCUC 2HPMA 1ZGAA 3GBGA 1HKTA 1YX5A 5L3VA 2DFHA 5A6KA 3D5RC 5LGTA 3JYHA 2XL4A 3QYFA 2YEVA 4XEKA 4LB5A 1XGSA 1R4TA 3PMRA 5DS5A 3JREA 3S2DJ 3HJCA 4EWCA 3LSMA 1XDUA 4FCYA 3ABMC 1FFTC 1Q0GA 2KRCA 2P5VA 1A41A 1DDNA 5JS5A 2Z16A 5HLTA 5F6FA 1R1UA 3ABMH 1HKQA 1YYVA 3HGYA 1EQ1A 1WTYA 1LFPA 3EETA 3TDZC 1LS1A 4CDYA 3WE3A 1TWCA 2KC3A 2JA2A 3B6CA 5DUIA 5IYCJ 2TMVP 3GODA 1RKEB 3K6GA 2BXYA 4BUPA 2LD5A 3H9QA 3T5XA 3U5SA 4XBFA 3HKKA 5FLXZ 3S1MJ 4X6AJ 1Q0DA 2BVLA 5T1DB 2F22A 3TQOA 5JP7A 4KNYA 4PGHA 3K4NA 1I3QJ 4FX5A 1BR4A 1ZHZA 2L9VA 2WC2A 4YG2F 4PDKA 1OCTC 3TO9A 4RAYA 2KL4A 2LH9A 4N06A 4HLXA 2NS8A 3RH3A 3ABKC 1P7IA 3VYUB 1S5LC 2RKHA 3OYCA 2FNAA 1VQPI 5D5WB 3FBIB 4OIQF 1ACIA 3DTKA 4IEJA 2R93J 5JLXA 1WWPA 2GWWA 3ABKH 4N9HA 1U9OA 1JPNA 1W5CC 2R7FA 1K78B 3HIFA 2CYDA 2RN7A 1LDJA 4M74A 5KCMA 3JRDA 4BDZA 1RR8C 5BQHA 3GYHX 3DCFA 2GOMA 4HNUA 1WKMA 2X85A 4FTHA 5JVGF 5BOXA 1B8IA 4XQ1A 4CBEA 1X58A 4F4BA 2YU3A 2ELJA 5CVIA 4AUXA 1JRAA 4JCHA 1SR2A 1FSEA 4Z2YA 2R5YA 3DLAA 4CA0A 5E1ZB 5LGNA 3IH4A 5BQGA 2NVQJ 3GWNA 4PCQA 1ZAOA 1QA6A 3PQKA 2J0WA 1QBJA 1HDDC 4DZPA 4RBOA 4A2UA 2HV6A 4A3EJ 1AUEA 3H2UA 4RBNA 1HMDA 3Q9SA 1O4XA 1DPUA 3BTCA 1OCPA 4BJ5C 3WU0A 4PJMA 5CJ9A 1ZW3A 3DWWA 4NCQA 3M8EA 1UHSA 2HDCA 2HKOA 2XKOA 2L7ZA 3SXMA 4PUSA 1MD0A 3TP0A 3ZG1A 1FP2A 3TQNA 4JP0A 2PFBA 3ZQVA 1KQ8A 2F5EA 5HS7A 2DA4A 1K6OA 4IF4A 2YLDA 2XRLA 4IHXA 2H7OA 3ZQYA 4B4CA 5DQZA 3QYBA 3I53A 3MVPA 3I4NJ 5HV9A 2NYXA 4PR9A 5K7HA 1U6HA 2CNWD 3REOA 3CUOA 2P6VA 2QNLA 3F8FA 3OYHA 1BIAA 3F8NA 5IOYA 3RPUA 2YL0A 5B3IA 1HC8A 2CV1A 4MS2A 5BQTA 3N24A 1B72A 4BL0B 2IBFA 2FOKA 2F4IA 3V4GA 2XV4S 2HOAA 1B59A 2CQQA 5DCMA 4XM3A 3FAJA 5TJJA 5AC5A 1FBSA 3JRGA 1Y39A 2ESHA 2W85A 3B0PA 4II2A 3TEDA 3WTVC 1YARO 1WHUA 1IUYA 3K1IC 1GVJA 3BTJA 1H8AC 3HOSA 2L5QA 3G4XA 3LS0A 5F0FA 2H8WA 1ZHXA 3F6VA 4Y3OA 2K3PA 3NDBB 1YW8A 2HWVA 1ZGJA 5J8CA 1T6SA 3DF8A 3VYWA 3G4SI 1WSUA 2GA1A 3MWMA 3B02A 2I5UA 5LD2C 4JBAA 1N78A 1O7FA 3OYJA 1AWCA 3A2KA 2JA6J 3VYSB 3BTIA 1KQ9A 2EK5A 4HG2A 3WHNA 1T6IA 3FDYA 4MO7A 3SEZA 3TGNA 2VXZA 3KKBA 3CMEI 5KYUB 3TKYA 1N75A 3BCBA 3VSKA 3K10A 3W6KB 2ASRA 1NZEA 2GZWA 2ZO4A 4I1MA 4ESBA 2P61A 4NQWA 3S8PA 2WVQA 1RJ9B 2KDZA 1ZR2A 3LSJA 4II3A 2BYVE 4UUSB 1YO5C 2H27A 4IHYA 1WRJA 3H9GA 4IHWA 1U9NA 2LLKA 3RQEA 1OXKA 1H88C 4CCOA 2A68F 1RUNA 1UZCA 2Y3DA 1W7PA 3FK6A 4F91B 3RKWA 5DTDA 2XHKA 1DGRM 2WVNA 1SMYF 2P7VA 5IYBJ 4AD9A 1L0OC 3MLGA 1T95A 3SZTA 2DTZA 3NYJA 3V7SA 2YL7A 3T9OA 4CS9C 3JRFA 3G1LA 1XMAA 2FNPA 3D1NI 3F8CA 4LOCA 2CDQA 3CJRB 5COGA 5ERIA 5BPIA 1JGSA 3HJEA 1H89C 2B63J 4H54A 1DP3A 4YN0B 1YJNI 2K9LA 2MC4A 1FIAA 2G9WA 2KLOA 1POGA 3L00A 1RETA 3J7ZI 3ISPA 1KONA 1LPQA 5KYXA 3N97A 2CV0A 1DOVA 3IQ6A 1APCA 1HSTA 1RESA 2A61A 3EDPA 3SYNA 1FLIA 1M1EB 2D2WA 2BY2A 1PUEE 4BU2A 3BOQA 4HSRA 1ZLKA 4OWRB 4LIVA 3EFOA 3M4CA 2ZKZA 2NVXJ 3EUHC 1P2FA 3WTXC 1Y56A 3ZN1A 3NEUA 4LJZF 2BEOA 3U2LA 3V5YA 4NY3A 1YW9A 3QODA 5H2FC 2P8TA 1HA8A 3AGUA 2R7OA 4HYEA 4QPOA 4BHBA 1HBXG 1YLMA 1X2NA 4XSXF 4ER9A 1QGPA 3FKIJ 2DMQA 2VJIA 4G12A 3ERED 1IN4A 3D5LA 5DD4A 3EG9B 2MGQA 2WAQA 4QWQA 2PMZN 4BQOA 4D9JA 4L0ZB 2ZC2A 1TT0A 2KP6A 3FMRA 1JR8A 2IYLD 3LEOA 2R7VA 4MTOA 4CSAA 3H1CA 3I59B 3KP3A 2OV7A 4E70A 2HQ5A 4EEFG 2OAZA 1A31A 2VJ5A 1MBKA 5F1JA 4A5MA 1E0EA 2HKXA 1R6RA 2X0CA 2DT7B 4C7OA 2LK2A 4WWCA 3MZYA 3NG1A 5DQTA 5EGOB 1RNLA 2XLHA 1G59A 2A3SA 3B29A 4JQFA 2IP2A 1X1PA 3WGHA 1E85A 2EILC 5L0CA 1UHMA 1V5EA 4I99C 2E2JJ 3KLNA 2FQ4A 2R7TA 3IAS2 4L9TA 4XNFA 1KA8A 2EILH 1E3HA 2ELHA 4HSTA 4PSWA 3OL4A 4QLCU 1Y0UA 4BE1A 3I4MJ 3W6VA 2IOQA 3AOUA 3DAGA 1O3RA 5JVTA 2L9RA 3CUQC 5HLIA 2Q2EB 2Z5UA 2LP4A 1K4TA 3AGTA 1MBJA 4HLYA 3O2PE 4PK4A 1JKPC 2ID6A 3LESA 2V79A 1R71A 3O39A 2X1EA 3K9TA 3HZJA 1RZ4A 2O03A 5FKOA 1EF4A 2P81A 3HRSA 2DDBA 1CF7B 3A1YA 2W45A 1SFOJ 4PACA 4DW6A 1ORJA 3BZCA 3K66A 1MDMA 4DYCA 3DLLF 2RDPA 3HM5A 1LVKA 3PFIA 3FISA 3RZDJ 3EYIA 1KYWA 3CQZJ 3F22A 1RXQA 3CZ6A 1JXSA 2LY9A 1UELB 2KIMA 2M0MA 2PEXA 4JX6A 3LSGA 5DS9A 2K85A 4I98B 1VQMI 3TJ5A 2ISYA 1S9HA 2IRFG 3S14J 2DLLA 1HMOA 2CNWA 2BOLA 3RW0A 2CGEA 2VOPA 1N77A 3ZMTA 1GV5A 4HRIA 2ZCWA 5LLQA 5FLXK 2OBPA 3HPHA 3I0TA 4U0YA 2DA5A 1MJBA 5FKLA 2VE9A 5CVVA 5L0HA 3TW6A 1EH8A 3HBLA 4U5FE 2E1MC 1MH4A 2GWRA 4UVAA 3GEIA 2KHMA 1EH6A 1OR3A 4P6IC 3HHGA 2DA7A 1ZG3A 2HQAA 1ZGWA 3NYMA 3UMKA 1F36A 1RIOH 3U9MA 2OUMA 2EV0A 4D5FA 4JKVA 1MJAA 2OU2A 3G1MA 1LDKB 4FT8A 4NC6A 3RDIA 3I56I 1A5JA 2ZXWC 3OIQA 4XRFA 3L2UA 1TWHA 4ULWA 3N05A 5TISC 2JT1A 2L9JA 3IQ5A 1U5TC 1PYVA 1T39A 1FOWA 2V1XA 1TC3C 5E79C 4ZTFA 2E1NA 3GORA 4F55A 2JRMA 4IVNA 2E36A 3I5QA 4CYCA 3WGGA 1J7KA 4DQ2A 1OW6A 3OYLA 4L6RA 4HX4A 2QBYB 2ZXPA 1P4XA 2XIGA 2M87A 1SF8A 1WJCA 3M1EA 5HSWA 2VJJA 3WTYC 2ME0A 4QPQA 2X6WA 1P4AA 2LIGA 4ZH4F 1Y6IA 2F5CA 2IAIA 2ZMEA 1EA8A 2FFHA 5DS6A 2D5VA 1SVLA 1ZHWA 3VDXA 4LGWA 1YVIA 1RI7A 1ZYRF 3HHHA 4ENJA 2XL6A 3WU2C 3SEQA 1Y4CA 1AKHA 2R7UA 2CU7A 2K7LA 3LSRA 1TWAJ 1MZBA 1LPEA 2EPNA 2W57A 1C03A 5M3MJ 3HC7A 3HUGB 4GGGA 4XN0A 4FQGA 4A3GJ 3E5XA 1T6UA 1CGME 4HNTA 2NUPB 2YVKA 1SD5A 2BE5F 2J5PA 3RPQA 2EPOA 3T6GB 1H6GA 3K4BA 4MFEA 2H1KA 1ORSC 3LLKA 3Q0WA 1G2HA 1L3LA 2ZJRF 2HVRA 2C04A 2E7XA 3PO3J 2L81A 3LA3A 2LFFA 4KIGA 4E4HA 3P9CA 1QU3A 3QPLA 1W0TA 3T1BA 1VQ6I 1ZELA 3H0GJ 2A1DD 3CCJI 3JSZA 4MTEA 1F5TA 1FTZA 4YIIA 2GA2A 3UKGA 1JT0A 2LBFB 2GXAA 1UHWA 3DBRB 2WV0A 1T8IA 4ESFA 4XN3A 4GYGA 3HRUA 4N6HA 3T4RA 2NVYJ 3QVYA 4EJUA 2DA1A 2QE9A 4I02A 4CS8C 1DOWA 3T8RA 5ILUA 1FYLA 1OXBA 3H36A 4CXFA 2CCYA 4NBQA 4ZLCA 4RLFA 2VODA 3CJQB 2VT3A 5IY5H 3AG3C 3AG1H 4PJ0C 3V42A 3J80Z 3L1MA 3JR9A 2UXXA 1MBEA 4AL0A 4Y52J 2DPUA 2XLEA 3K69A 1S72I 2CJJA 1J2XA 1LEAA 3AG3H 3CSKA 4Z9JA 3TOMA 1E86A 2YUSA 4XKWA 1IJWC 1YFHA 2M7AA 1R5GA 5JHFA 2Y39A 2M34A 4HA8A 2E2IJ 5EZGA 256BA 2AXTC 4HX7A 1FOXA 3TP3A 3NWTA 4U5BE 3U8PA 4LITA 4DZJA 3DTEA 3BG3A 2B0HA 1I50J 1T33A 1VMAA 3ZMZA 1NFOA 5E2QA 1HLVA 2XSJC 1N25A 4ENMA 4WGZA 1E3PA 3QWLA 1DU6A 1ZHYA 3JZ0A 1CPRA 4WK8F 3FOPA 3SXKA 1IG7A 3J81K 2COBA 1IF1A 4K0DA 2PJPA 2QM3A 1TWAA 3ZMDA 1U8BA 2NS0A 3BC8A 1IN8A 3E6BA 4NTFA 1WATA 4W1UA 4P96A 5ILSA 3K7AJ 4EM1A 2K9MA 2EPMX 1Z6AA 4KT5C 4I3MA 4O7GA 2E35A 3EGDB 2XASA 3HKZA 3X1OA 2QYOA 3ECOA 4IGGA 4P9TA 2IJLA 1FP1D 1X3UA 1YLFA 2COMA 2XXAA 1WCMJ 1WGWA 2J7PA 1V3FA 3L09A 1LQ1A 2FGYA 2L9NA 2VQLA 4U87A 5F27A 1UG7A 1T0FC 3BR0A 3OSGA 2E1OA 3FKJA 1MGTA 2ESNA 3DFGA 3ONQA 2CG4A 4XWJA 2GQQA 3HOVJ 4PFPA 3CDIA 1E2XA 2JRTA 5TRDA 4NHJA 3M07A 1K40A 1I3AA 1MMGA 5FKNA 2XAQA 3BCAA 1I6HJ 2KRHA 3OR1C 1U0JA 2HZDA 3BPXA 4ETSA 5M5XJ 3EGXB 1X1CA 2Q1ZB 3GTOJ 2LREA 1MNEA 1WOLA 4XPXA 3H2VA 2EIJC 1I6XA 3F23A 4ZC3A 2Y69H 3KZZA 1S7ZA 5DDGA 1OPCA 2ZXIA 3QVZA 2EIJH 3OR2C 1KYZA 3HL2A 3BG6A 2IXSA 2J9VA 4XIDA 4HPQA 1VQNI 3M1CB 3ZR8X 2F4MB 1RKEA 2HOEA 1KGSA 1VK5A 4WXCA 1TWFJ 2HS5A 2ZB9A 4PJLA 2BZTA 5F0CA 2PF4E 2Q9CA 3ASOC 3CJTB 1QQ3A 5A6BD 5EJCA 3C8GB 2ZSHB 2VUMJ 2L2OA 2H94A 2JJ7A 3ASOH 5DVWA 4KDPA 2NSFA 4BGDA 3C8ZA 1ST6A 2CS3A 2KRFA 4K2EA 3SZPA 5K1YA 1M56C 2NRAC 2FD5A 3I4PA 2WAFA 1XD7A 2O8KA 2K40A 4N9IA 2ADUA 4KT6A 2M2EA 1ZHFA 3ZQCA 2KK1A 2WADA 5JHUA 2QCOA 4MQ9F 4A3BJ 3IKVA 2Y30A 4EGYA 2QSHX 1SD6A 4OAZA 3WE2A 4IHSA 1A7EA 1K78A 3C3WA 4XLAA 3OS2A 2RD9A 3RYRA 2VLAA 1UMQA 4FWVA 3I4UA 2DK8A 1Y8QB 5DYMA 2WV1A 3J7AO 1XWJA 3MX3A 1VQ9I 2O9XA 3OYMA 4MVZA 1YDIA 3A02A 3LL7A 2ZXJA 1MSFC 3Q6MA 3BR5A 1IRFA 2HFHA 2X9DA 1V74B 3FOOA 1XB4A 2HYFA 3FWEA 2FMYA 3LMMA 3B0UX 1RKCA 1S3JA 2DXIA 2A0BA 4KA4A 2JPCA 1IO2A 2DA6A 1G3TA 3K6BA 3CCQI 1WPKA 4XR6A 2D5RB 3TO7A 2X6XA 2STWA 4N4WA 2W48A 5E18F 4CCNA 2OCEA 4A93J 4KJZA 2BW3B 5COMA 1WQ2A 3WTSC 4O79A 3QW1A 3FXJA 5LRSA 2EFQA 2X6YA 2DYRC 5L0DA 2ZXHA 1GUUA 1SC7A 1MQVA 3R7CA 2CUFA 3TDUC 1VQLI 2UXNA 3VB2A 3K1HA 2JA7J 2J0XA 3WTTC 1V5FA 2DYRH 4BJ6A 4O6YA 4PFOA 2FOWA 5LBQA 1HY5A 2DU9A 4M9SA 1M6TA 2A07F 3RYLA 3S93A 4L9NA 4ZYAA 5FJ8J 2IA1A 3SXZA 3CUQB 2NSGA 1ZREA 3JCUQ 3CJNA 5IP9J 2L0KA 2OTLI 4B6IA 2DJIA 2RVCA 2RQQA 4YIFA 3MZHA 4YT4A 4G7HF 3DMDA 2CQKA 2LTPA 2P6SA 3D5SC 5B66C 5H20A 2F6CA 3VFZA 4CCMA 3OYFA 1QKRA 1P4WA 2OZUA 4PZJA 2ZXOA 1XX5A 2X48A 1BL0A 2B0JA 3UGPA 4RDAA 3DBHB 4W8PA 1Q0FA 3IH3A 2LKPA 3HGGA 4Q4ZF 2P4WA 2V7FA 2HGCA 5F04A 3H9JA 1EI7A 5E8GA 1GM5A 3TOLA 2PJRB 2AO9A 1GS9A 5KYYA 2MYSA 1IV8A 1FOYA 4I6ZA 1HW1A 4C3IJ 2DGJA 1J0RA 1Z63A 3EJNA 5FFXA 4U9EA 4GDFA 4R32A 1EA3A 2LY1A 1TP4A 3V8KA 4KI2A 1QRYA 2M4KA 3GFLA 3HRMA 3J7YJ 2LNBA 3WG9A 2MWQA 1IN6A 1U6GA 2HJMA 3KE2A 3O10A 2EFPA 1BC7C 2IPQX 4J19A 2YX4A 1MMDA 2E1MB 3S32A 5EG0B 2FSWA 1VNDA 3Q3SA 4JOMA 4F52A 1W7PD 4QDLA 3CCUI 4O3MA 5KYUA 4EBKA 3NRVA 3T6JA 3QMKA 2PBIA 1JKQC 3LFUA 4EJTA 1ERDA 4G6TB 4A3IJ 3AJMA 3B0VC 1OW8A 3GEHA 1Z3YA 3MKYB 1MW7A 4ENKA 5IT9Z 1QO0D 2EPFA 1WN0A 2WY8Q 2KDOA 1RJ9A 1Q0MA 4UUSA 1D1CA 2XGCA 3IPMO 4ZYGA 3QTHA 2QVOA 3BJ6A 2QSFX 3JTHA 2F5VA 1OKRA 4HDUA 2K86A 4L18B 1OQCA 2Y9YA 4XOPA 2L6HA 5J6XA 2VONA 2RAEA 1U5TB 4I0BA 1FMWA 1BJAA 3VSLA 4XLNF 4ABZA 3OOUA 1Y0NA 3LQRA 4XOTA 1U3EM 4XTKA 3TJ6A 4HFKB 2L7MP 4BH9A 2J8WA 4BACA 3LNMB 3BDDA 1XSXA 1T56A 3MYIA 4HQEA 4P55A 1STZA 5EYRA 4AX2A 4XRSG 1LE4A 3HEFA 5FRNA 5C3EJ 1SYQA 2CW8A 3G50A 2XUBA 4HE8D 2Q9AA 4IHVA 5J8FA 1TBXA 2DN0A 1LM3B 3O8HA 2Y9ZA 4HFFB 1SAUA 4C3EA 5D6EA 4YK5A 2XM0A 4C3HJ 3I5UA 4HNVA 5EF6A 2RC4A 3ZMVA 1DU0A 4KNWA 3HB9A 2XM4A 1WVRA 3ZXSA 2DODA 5F5HA 3BY6A 1XZPA 2LF8A 4KMUX 4B3XA 2VBWA 1WASA 3ZWIA 3RSNA 5J1YA 2O3FA 2Y31A 3ULQB 3W2VA 1P7JA 3LFKA 4D7MA 4IQ4A 4FX4A 3H0DA 1XPXA 2TRTA 5IP7J 3J80K 2MH9A 1OQYA 2DMPA 2CFXA 3GTPJ 1O87A 3OY9A 3PNVA 3EPZA 2HDDA 5FLMJ 3GF2A 2M8EA 4G9YA 1YIJI 1BR1A 4FESA 5L0GA 3DZAA 5DM7F 3AKZA 5A6BA 3HDDA 4IAOA 2FAPB 2MD5A 2V4JC 4LLGF 2KQ9A 3DKAA 3EG9A 4FAPB 3L1PA 3FAPB 1ON1A 1SVOA 1IV6A 4Q5SF 4XRMA 1NU9C 3GCMA 1Z1DA 5CVUA 3AQBA 3I59A 4L5IA 2WA0A 3BP8A 4YL1A 3F72A 2DO7A 3U2MA 4DBRA 1JHFA 2IGMA 2A6TA 2M0CA 3DE8A 2FXAA 2XB5A 3CESA 3SHFA 1KU7A 3ZOBA 5L3DA 4ASNA 3LA7A 4KITB 5M5YJ 1PD0A 5EGOA 3BPVA 3POVA 4JURI 2E5NA 3GO5A 3DPUA 3PL8A 5T3WA 3IWZA 1NHAA 4E17A 5GTHC 2BC5A 4M71A 5TGTA 2K27A 1IXRC 3QU6A 3RVYA 2IXPA 3KP2A 2QQBA 2KW3C 3I3LA 3DEEA 1UJ8A 5B1BC 1Z21A 4KN7X 2HU9A 4U5CE 5EK0A 2DYSC 2HXIA 2YL3A 3EH1A 1HQCA 5B1BH 3HOYJ 3ASNC 5ICEA 4DVZA 2XGEA 2Q2EA 3L7WA 1DPRA 3GXOA 4AYBA 5LHHA 2JX0A 4JEAA 5AGFA 2DYSH 1BW6A 2YWAA 4A69C 3ASNH 1MNDA 5CQGA 4RB3C 4C30A 3X2QC 3GMEA 4JEBA 4NC3A 1TQIA 2M4EA 2Y2ZA 1CF7A 2K5CA 2K9SA 3X2QH 2IT0A 1I5ZA 3SYTA 2F48A 3PSIA 3OA1A 3OMYA 1VYIA 2FBIA 3L2RA 5JLWA 5IYDJ 1USSA 1UG0A 3H5NA 1V55C 1XCVA 3O55A 4LB6B 3GM1A 3UMHA 5K7FA 2LKSA 4EIYA 4XLPF 3L2VA 1V55H 1VLTA 4A5NA 1PP8F 2DB4A 2A5WA 1BOBA 3TBIA 3Q5FA 1H0MA 2N8GA 5LFAA 3KEQA 4J01A 3C2BA 3DV8A 1X1DA 5D4SA 2L9SA 2DPDA 2J9WA 3JYYA 3GVAA 1Z23A 3FXUA 1BI2A 2DAOA 1B68A 1M2VB 5C44J 3CO6C 3N4MA 2HPIA 4CJGA 2ZNYA 4FASD 1BI1A 1BN5A 1S05A 1LE8B 4B47A 3V7OA 2CW0F 1Z91A 4E18A 5FD6A 1LJ9A 3M3YJ 5HNHA 3PUFA 5E3LA 5EEAA 4J00A 1JTYA 3BQYA 4HEA2 5J40A 5LHGA 4NTBA 2LMDA 1YA9A 3T6BA 2OZ6A 3A0BC 2O5RA 1F9NA 2IGNA 3R0AA 3FXOA 3L2WA 1G4WR 3FVYA 3IQCA 3KP7A 1PV3A 4G94A 1OKKA 2J46A 3KCCA 2ZNZA 4C9YA 2R5ZB 2KISA 3WAQA 2DMTA 4GRIA 3F46A 2HXOA 2GDCA 5JUAA 3J81Z 3OYNA 1XN7A 4I1OB 5FROA 2GXBA 2PQ8A 5DUKA 2QBYA 3L8IA 4KBLA 3K4MA 3F0CA 4XICA 3IC7A 4XL9A 2OG2A 3KZIC 4NC8A 1MH3A 4DIQA 4X0RA 4BHCA 2D1HA 2HZ8A 3M4OJ 3TO6A 3RKXA 1SEUA 4N0BA 4MTGA 2MABA 3MMYB 5COFA 2VC0A 5KYWB 5J1UA 2OEXA 5HDGA 3SDGA 3FHZA 4N4OB 1S7AA 5E17F 4CIPA 3S1NJ 3V8JA 4EM2A 1OR7C 2GM4A 1GGQA 3BR3A 1FIPA 3HUGA 3HOTA 2DT5A 1K4SA 1BZ4A 4YL0A 2F4OB 4L5JA 2VBXA 2VKHA 2DFEA 1Z9CA 5DLJA 2M45A 2NUPA 4F92B 3OSFA 1FY7A 3I9V2 5C4JJ 1FYKA 3FM5A 5D5VB 2YRFA 2E60A 1BOAA 1PD1A 1G8XA 2DK5A 1BW5A 4V19K 1ETWA 2QY9A 1ORKA 5AIPA 5FLVA 3B6AA 2W82A 2UUHA 2Z15A 3CF5F 3QP6A 2O9LA 4MTDA 2F5DA 2H1LA 4RGRA 3O6XA 4D4NA 3G2BA 1Q1HA 3ZC4A 1NK2P 4D1QA 3ABLC 2W24A 3VPRA 1JJ6C 1S8NA 2DA2A 3SJMA 1XS9A 4M3DA 3ABLH 2LBFA 1R7JA 4BJ5A 4GYIA 5CYVA 1AVOB 4R1HA 2O0YA 2XKPA 4HZFA 4JE9A 1I1SA 3EHMA 5L3FA 3LS1A 2Q8KA 3RQ4A 4IPAA 2VCBA 2OD5A 2HSBA 3RF3A 1IN5A 1QPMA 4XORA 3T8TA 1B6AA 1QZXA 3H65A 3DEUA 2K9QA 3MCZA 3ML6A 4LD5A 4O6JA 1GQAA 1D5YA 1Y8RB 3OYGA 1QLEC 5BUOA 1HF0A 3PDMP 1HDPA 2XAGA 5J4YA 1TWGA 3ZMUA 1VOMA 4DYQA 1A35A 4U5DE 4A3LJ 3K4LA 5H6RA 4EATA 4G7ZF 2HVSA 4BXXJ 2ZMEC 2Z33A 1IDZA 2J9UA 2YSRA 3GM2A 4EHPA 4BXFA 3OYEA 3E0JB 1WWXA 4FX0A 2Q3TA 3IP4B 3RYPA 4BG0A 1PUFB 1TWHJ 5JI6A 3AL0C 3GM3A 2OJED 3F3XA 3T0YA 3ZQIA 4ZZLA 4K7BA 3A03A 4BPMA 4D0PA 3MBGA 5K5OA 1ENHA 5HDKA 1Z6TA 1G3SA 2F5FA 2OPTA 5A6JA 3ZQGA 3M79A 2VQCA 4EGZA 1D8JA 3QOPA 3TULA 1G3YA 1I39A 2HZTA 5IT9K 1P6RA 2VCCA 1QVUA 1MKMA 3FMSA 3SP1A 2QTVA 2J7PD 1RPWA 4HF1A 1BJZA 3K1IA 2LY2A 3L9FA 2MW8A 3WHBA 2ZFUA 2KMUA 4I0AA 4XKBA 1NK3P 2NVTJ 3GTKJ 5GAGJ 4KISA 2WZLA 5JSLA 2EINC 2CSOA 2Y75A 3EGDA 2STTA 3KYJA 3KFWX 3TOAA 4CX9A 3ZSUA 1P9QC 3OYAA 3SEOA 4BEMJ 3DEWA 2EINH 5F28E 4BQAA 3E5QA 2W4MA 1TFKB 4IJJA 5DS4A 2MH2A 2CWEA 3U3BA 3UR3C 3F8BA 4AM3A 3JRAA 3FZVA 3NMKA 3JRTA 4DXWA 4CDGA 1SZIA 4KIBA 3RIPA 2HTSA 1OCRC 1E3OC 4BQNA 2AQEA 1YQAA 3BQZA 4M72A 2ZPAA 1CGPA 1XGOA 4M3GA 2XLMA 1FBQA 2ZSIB 1QQIA 1K83J 2DOEA 4O6MA 2EZKA 4YEJA 1X4PA 3GFMA 4BDYA 2XGDA 4U0WA 4YELA 1G6NA 2WB1N 4CCKA 4A3FJ 1JKOC 2FRHA 2HMQA 4JRZA 5KVRA 1ZK8A 4KUMA 2G62A 2M3AA 2H6BA 1VQ7I 2EPKX 1JTXA 2XF5A 2YLGA 2Y0MA 2YS9A 4A0YA 4BY1J 4JC7A 3BG7A 3GEZA 2P5LC 4KIFA 4KC9A 2Y0SN 3CF2A 3KP6A 4B3AA 1J8MF 4U88A 4UVCA 3P7NA 4MEYF 4JIOA 2WTEA 4EM0B 4CJOA 1JHHA 3M1CA 4CS9A 3LSTA 4ZDPA 4AVZA 2FU4A 3ZP5A 1IGNA 3EPVA 1OYYA 1H9GA 1O3QA 2NOGA 4Y15A 4YFXF 3C8GA 2O6GE 4RAZA 2OKUA 2DFIA 4OMYA 1YAUO 1XGMA 2LDUA 4DJAA 2L4AA 2JQ7A 2YZSA 4IWBA 3Q0VA 3PSFA 2DCEA 2IM8A 2Y3HA 2Z99A 2ZXWH 3K1MA 4MW8A 1CGOA 1D0XA 3KIOA 2R7ZJ 2BY3A 3ABUA 3CAXA 4GYTA 2PMUA 3BJAA 4G78A 1TT5B 3VODA 1L7CA 5E3CA 5K5RA 3LSKA 3E1SA 3EUHA 1BDJB 2YPRA 3H3VK 1J09A 3E6DA 3FDQA 2CQ7A 2XDVA 4J32B 2VIXA 2OJQA 3S29A 2MA3A 1G3WA 2HI3A 4BJ1A 3ITFA 3LNRA 2O7OA 2K4BA 4ITVA 4RAGA 3C2HA 3PUBA 2ACJA 3MFKA 3KEYA 2LOOA 3FXRA 3W8HA 4MVOA 2EFWA 2AHQA 4CICA 1LS4A 4KMFA 5C4XJ 2PMHA 3I54A 3RJPA 1K79A 2QENA 3V8LA 3S17J 5F08A 3CCSI 4QSHA 4G0HA 3HNKA 1NG1A 3CMMA 1UFBA 3HOWJ 2OQMA 3DTIA 3HPGA 4GXOA 2EA2A 4KN4X 4EV0A 4JJGA 1G4DA 3KYLA 3L34A 2GXGA 1I4ZA 4Q48A 2BW3A 2LF7A 4L9VA 1MSEC 4UUVA 4XKCA 4LERA 3LEVA 1OCCC 1USTA 1YRNB 3IKTA 4LG3A 1QZYA 5CLSA 1OCCH 3QPHA 1W36D 2EFOA 1V4AA 1VQ5I 2YR2A 2CMPA 2MLKA 3DPTA 1K6YA 2JK3A 4AVPA 3CUQA 4U5GA 1VI0A 4EQQA 4IOAF 5E33A 1BA5A 1B4AA 4ZDLA 4F93B 1D0ZA 3CD6I 2H7BA 3TW7A 2HV7A 2NAZA 2NVUB 1APLC 1I27A 2VXDA 4CUGA 3K2ZA 5E3OA 4BEJA 3C1DA 4CSWA 4AL1A 2VPLA 2R0QC 2ETSA 2B0LA 2LYCA 3JAMZ 2L6FA 5E1XA 2IA0A 1J8YF 3P9IA 4UV8A 1ZW2A 1XCBA 3HOXJ 4JK1X 4J30B 3FHNA 3BEHA 3M4BA 1IC8A 1PP7U 2PJRA 4M3FA 2P5KA 1LE2A 2XPWA 1YHQI 2XLVA 1WGXA 1ETXA 2P0WA 3R6SA 5LEKA 1IRZA 5CIVA 1EJ9A 3TOBA 1BR2A 3FM3A 2HOSA 3HKZN 4BS9A 4E7IA 4OIOF 2RGVA 5TJ5E 5DCFA 3OL3A 1Z77A 3WU1B 2DFFA 4Y4RA 3RIRA 1VLSA 2PFDA 4BEHB 4PSXA 2XAHA 1IW7F 2PX9A 2YU9J 1ETVA 2L7KA 2XSEA 1JT6A 2QUFA 1A6IA 2CUEA 5FKMA 4AIHA 4BJTA 5EG0A 1FBUA 2NNYA 4E7KA 2JA8J 2E7WA 3BLYA 4FETA 1A7VA 2V3CC 2UZKA 3R0JA 3IV5A 1WJEA 2BXZA 3HSRA 3U21A 1IRXA 5GADJ 5J47A 1PDNC 1W1WE 4I44A 3N0TA 3ZIBA 1Y1WJ 5BMZA 4RB0A 2NG1A 3WHCA 4XRSA 3QOEA 3GFIA 3JSEO 2ZD9A 4EBJA 3S1QJ 1U5TA 2VQHA 5HOOA 5A2QZ 1TR2A 3BJOA 4IB4A 3GZ5A 4R8HA 1TFOB 1YOVB 3OYKA 2NUTB 4DGWB 3PIPF 1KQ0A 1HXDA 2KZGA 3LQQA 4XQFA 4UDVA 4ZLDA 2OCCC 4JX4A 1FTTA 4M6VA 5KYNA 5GPGB 2CUJA 2M1BA 3FXMA 3BG9A 2KZVA 5GP9A 5KAFC 2O8XA 3BRJA 2OCCH 1A7DA 4B44A 1F1MA 1FNTc 5CVRA 5HVQC 3C62A 4IRHA 2VCAA 3BR6A 3A11A 1IXCA 2LRDA 2OQGA 4C2MJ 1Q1VA 2JD3A 2P1AA 2F2EA 2Q7RA 1MMSA 2BY0A 4DJ9A 2H09A 1SD4A 1YJ9I 4RD9A 4N4NB 1HSJA 2TCTA 4ZZDA 5E3MA 1SAXA 2KYHA 3S90A 1SFKA 2VKEA 1TW3A 4E6KG 4A3KJ 1JUSA 4CDAA 4U7BA 3F47A 3W8IA 4HQMA 2AWYA 5CI8A 3U0CA 2QZ8A 4MFDA 4MQVA 1HW5A 4YL3A 3PJRA 3BT9A 5GAHJ 5FRMA 4BAYA 4Y33A 3SZGA 2HOTA 1ITYA 3HTUA 4CYDA 3G4ZA 2HUJA 4Q47A 2H7VC 1XMXA 5FGMA 4E0HA 2L6GA 4ZYHA 4ZTJA 3MKWB 1OYIA 2G7HA 2QQAA 4E7JA 1BC8C 1QPIA 4WABA 5T3TA 3S2WA 3EHNA 4QIWN 2Q9BA 4JCZA 2EPLX 4JZAA 1B9NA 3KLOA 4P9FA 1EH7A 2Y3GA 1O57A 1IZ1A 3CC7I 4XLHA 1EV7A 5JR3A 4CS8A 4YT8A 3JRHA 4ON0A 1V54C 3AG2C 3RQFA 1X1AA 1T08B 3QAHA 1GXPA 4AU7A 2E34A 1R58A 4I76A 3HTSB 2EBIA 4HDVA 1V5GA 1V54H 3GANA 3AG2H 2ZJ2A 4WXDA 4MW3A 2GIVA 4ESJA 1UAAA 4N6CA 3OYIA 1LKXA 3GZ6A 2GFHA 3ZQLA 3QYEA 2ZMEB 3E3VA 2ZJQF 2K02A 4HV6A 3RZOJ 5LEJA 1Y1VJ 3K4CA 4M9XA 2LP0A 1YS6A 2H8AA 4YT5A 2VC9A 2WVOA 2FX0A 1AKHB 2EA4A 3SXYA 3V7CA 4Y13A 1ZQ3P 5LRRA 3AL0B 1VYKA 1FT9A 2V26A 3ZCOA 2DTRA 3SQNA 4Q7CA 2M64A 4HAMA 2JPBA 2FF4A 3GFJA 3CLQA 3R60A 3IWFA 1RRJA 2PNOA 4CCLA 2MG4A 3E70C 1O7LA 1W0UA 3IEEA 4EUKB 1IUFA 3V7RA 1HKSA 1ZLJA 2M4GA 2OF7A 3FXLA 2B9SA 1X3ZB 3I5PA 5KHDA 4E7ZA 4BYYA 5BNGA 1OCZC 2R7DA 4PJNA 5L0JA 1WZ2A 2LCHA 1D1BA 1OCZH 2IVMA 3DXJF 5FZTA 1ETQA 1ZU4A 5CVJA 3K70C 4U5EE 3GTQJ 4J7TA 1YJWI 2Q0OA 5JT4A 2FA5A 3G3ZA 4XPYA 3S3OA 3Q6NA 1Z3IX 2WL8A 1T0FA 3QRFF 2JVGA 4CHUA 5J4VA 3HSFA 5HDNA 2QEXI 1YIOA 1R1VA 2K3FA 3PO2J 1OMIA 1M2VA 2IBDA 4IL6C 3GX4X 1R4NB 1DP7P 3PNTA 3LWFA 1LE8A 3NYLA 4FISA 3K7DA 3KPHA 2XF6A 1OKKD 1TL8A 2YHSA 3OS0A 3CCMI 4IZZA 1YZCA 4KFCA 2IGKA 4NNJA 3ROUA 3DKYA 3COAC 3AQCA 2BV6A 3PM1A 3E6MA 3H35A 3NMJA 4CDVA 2JTVA 3DWLE 1OLTA 2Q4FA 3W3CA 1X3WB 1MBFA 3SNHA 1J9IA 1IAWA 1C17M 1UFMA 5FKKA 3JTGA 2R02A 4IARA 1B9MA 2J45A 3DKWA 1F43A 4BE0A 4OOIA 4S05A 2GA0A 5JFRA 5D92A 2VBYA 2R5ZA 1W4MA 4O5VA 2E1CA 1R23A 2VT2A 2OOCA 4DRIB 2XLWA 3ZN0A 1RUOA 2MHRA 3I55I 3CDHA 1FEXA 1B1BA 3GZNB 3VWBA 3PNYA 4I7HA 4IOCF 2CUZA 4M6YA 5D6FA 3A9CA 2CGPA 4A6EA 5M5WJ 5ICFA 1NH3A 1RKTA 3GTMJ 2R25A 1NBBA 5KYWA 5D5UB 3S16J 3US6A 1ULYA 3Q7LA 2DMNA 2XS1A 2VN2A 2RV8A 1ON2A 3KH2A 2C03A 2Z3YA 2BGCA 3OYBA 4EKWA 4UUTA 3JSPA 2CFOA 3CP2A 2XROA 4BBSJ 1RKWA 3ZRGA 3ZQFA 4M63A 3LSIA 3RQIA 4A12A 2PX3A 4U7DA 4HF0A 1NU7D 1WI9A 3BR1A 4G7OF 1JI8A 4A4AA 1U2WA 3S28A 3QP5A 3CP8A 4RLQA 3H5RA 3MN2A 1AEPA 2PP4A 3ZMSA 5DM6F 2NXNB 1F4KA 1NG6A 5EGYA 1WH7A 2E71A 4XMYA 3K1PA 1Z05A 2KKOA 4RMNA 3VAYA 2L7FP 3RTRA 1KZHA 2VI6A 4E7HA 1K7AA 2AWCA 4XLFA 2KJCA 2XF7A 4BHPA 2XAFA 6PAXA 1WJBA 2JSCA 2QQ8A 1YTYA 2DDAA 5L0FA 3R4KA 3ERMA 1OJLA 3CC4I 4LK0F 2WBMA 3P5JA 1RC9A 2YKZA 2XRHA 4JTDB 3UMIA 3JAMK 1SMTA 1CGNA 1TQGA 1TLHB 1BIBA 1O3TA 4OIRF 2JSPA 3H3UA 1A6QA 4AIJA 3ESWB 4ZDOA 3F9KA 4XEFA 5ILVA 2KJGA 3M9AA 4AC0A 2A69F 5HNFA 1YW7A 4XLEA 3SDBA 2ISZA 1ONVA 1XTAA 2YX7A 5KK1A 3LSPA 3B73A 2QQ9A 3KZYA 2WWYA 2BY1A 4U9DA 1LI7A 1TTYA 2Z2SB 1O3SA 3SZRA 2VQGA 1FJLA 5B3SC 4OIPF 1AA7A 1BI0A 3ELKA 2MSYA 3OEOA 1FC3A 4IRGA 4MHGA 1YJGA 5B3SH 3EQLF 3LA2A 1R22A 4CO8A 1PUFA 1IZMA 2Z1DA 3IQTA 2KIQA 4RGSA 1TKNA 4P9UA 4LACB 2JWTA 1DGWY 3OWTA 4H4KC 3ZQHA 3KYIA 2R7RA 4ZJZA 4AYBN 3KP5A 3GUDA 2LSEA 2KSFA 3R2PA 1XDSA 2LC2A 2QKMB 5EEGA 4D5CA 2XGXA 2IS6A 4LFUA 2M7BA 4JJFA 3CC2I 5IOZA 1T9KA 3J06A 4M73A 5AIQA 3I71A 4XSZF 2KIUA 3PFYA 2J5OA 4A6DA 4JTCB 2A6EF 2HQRA 3IAM2 3QPSA 4FE7A 5A2QK 3NKEA 3ZTZA 2HVQA 1E84A 5D91A 4MNDA 1JAFA 4AE4B 5LHIA 2HYJA 4UHTA 3DQVC 1U8RA 4BNCA 1E83A 1TQPA 2DBBA 1ZKGA 1YS7A 5CQEA 1VF9A 2V9VA 3P9KA 5GTIC 3AFHA 1X4OA 1UG2A 4RM3A 3AAFA 4H0EA 1VQ4I 4LLCA 3S3MA 4PJJA 5ICGA 3ZTMA 1MJ9A 4M6XA 4C3BA 1LIHA 4JYKA 4CSAC 1WH5A 2CYYA 2UUZA 4CZCA 1YG2A 4UNOA 4LMYA 5E8IA 3ECSA 1X1BA 4A3MJ 3C8GD 1VQKI 1T5OA 4MVMA 2V6CA 1XG1A 2R9RB 5EHHA 1FNNA 2I8BA 4GQHA 4LK1F 1OYWA 4E0IA 4X0GA 3M8JA 1Z5ZA 1SVMA 1EKEA 3NMIA 2HR3A 3G71I 4LG0B 4KNVA 3VOEA 3B71A 2FUG2 4NTAA 2A5YB 2GOXB 2L4MA 2QGUA 4NC7A 1YX3A 2QLAA 1QZEA 1TWGJ 4R79A 1F1ZA 3MD2A 3ZGKA 1TZLA 2EFNA 2XVCA 4GO1A 3ZQQA 4RB1A 1PJRA 4DNCA 1M2OA 5KYYB 5F64A 3EYYA 2ZJPF 4WXHA 2OQRA 4RS8A 2LKXA 1TQMA 4B48A 1DUXC 1CQTA 3ZDLA 4OAYA 3ZQ7A 2RQPA 1ZU5A 2CH0A 2AQFA 4NUBA 3LJBA 5L3GA 1QSPA 3LAYA 3MKZA 4QI2A 3EUKL 4EJOA 3HXLA 1JKRC 2RREA 3F6OA 1L3PA 1OFCX 2G3KA 2H6CA 5HS8A 3HTKC 4EJWA 1ETKA 5M3FJ 4I09A 2Y3BA 3W6JB 1V4RA 2A6HF 2ZXRA 2EJRA 4LDRA 4IRIA 4FE4A 2E5ZA 3A01B 2AU5A 1BI3A 3EUAA 2LD6A 1SD7A 4CH7A 3DM5A 2D1VA 2W84A 3ABTA 4MEXF 4Y7NJ 2XL8A 2HQNA 4GFBA 3KYCB 1JPJA 3DAFA 3E5UA 3JRCA 4XK4A 1ZTRA 5H6QA 2DOFA 2MC3A 3NARA 3DP7A 4RAFA 1PVEA 5BS6A 5FB2A 3DBLB 1ZARA 4MVUA 4LDKA 3HNIA 1J5YA 3Q0UA 1W5SA 2WAEA 1P92A 1QVTA 2XPVA 2M5WA 1YRNA 3U9GA 3DD7A 2KQRA 4A2NB 3M7GA 2WAQN 3QW0A 2FE3A 2VOOA 4BY7J 3L8JA 4OD4A 1SANA 3WTUC 3GTLJ 3DM9B 1I5NA 4JX5A 3TMOA 4V2FA 1OW7A 2JMWA 4A0ZA 1ZN2A 3MKLA 1JJ8C 5K0IA 1JE8A 2L01A 1HCRA 3VRCA 4MLOA 1NSGB 4NB5A 5KAIC 3JSOA 1LEBA 3CDLA 1IRGA 2HSQA 5CKTA 3IH2A 2L54A 2G7UA 5L3CA 4U5HA 4ONSA 2VH3A 3RQGA 5J1RA 1OCOC 2OA4A 3FK7A 3HSEA 2CW7A 2V1DA 4M3BA 3I64A 3PQJA 4P5OA 3IRRA 1U0BB 1FPQA 4BXUA 1OCOH 3OS1A 3VM6A 3S84A 4C2TA 1FX7A 4AK9A 2XS8A 4BQQA 3DKXA 3QQAA 2I10A 4DRHB 1R36A 1JUMA 1QNTA 1JMWA 5K7ZA 2QLZA 3CCRI 1K61A 2P6TA 2VC1A 3OIOA 3BROA 2HNHA 3OV8A 2R05A 5FCLA 2W7NA 3W2WA 1B8IB 3M15A 3GTGJ 2EIMC 4ZYDA 3O3KA 5B1AC 2L02A 4C3JJ 4BEHA 4YWQA 2HKVA 4BE2A 5IPAA 3VF0A 3FXQA 2JPUA 3TD7A 2PMZA 2EIMH 3K2AA 2R5YB 5B1AH 1VTNC 4QTRA 2VB6A 5E1WA 2PG4A 4UV9A 2DQLA 4WF2A 2IXOA 2O61A 2EV6A 1R49A 3LLIA 3RKYA 1Z67A 2HMZA 1A04A 1FAPB 4DYRA 2GLOA 1MMNA 1S7EA 2ECBA 4Z6YA 3FBNB 3CMAI 2LFDA 5K5QA 5F0HA 3HNJA 3RI4A 4XPWA 2Z9OA 4W8KA 4ENNA 2DJNA 4RM2A 4ZYEA 3KYDB 1JUPA 2JUCA 4RB2C 1OCRH 2NUTA 3KMIA 3RVZA 1AOYA 3RFYA 2FEZA 4X1EA 3EGXA 1D8KA 3NWSA 2GBYA 3WTWC 3A4CA 2YL1A 3IUOA 1G5ZA 4MTFA 3QZCA 2V9KA 3FMQA 1AHDP 5IT3A 4ANJA 3QPTA 2R03A 1HE9A 1N1CA 3WTZA 2I15A 5BPDA 1FFHA 3NAUA 4K1OA 1ZG5A 2ETHA 2GAQA 3W2AA 2ECCA 1ORYA 4HEAJ 1NLXA 1OR7A 3K0LA 1JGGA 1GV2A 2AXLA 4KICA 2FMLA 4B09A 5HLGA 1B72B 1VQ8I 2BL2A 3D0SA 4MNUA 2EB7A 1SFEA 4CGZA 1XSVA 4CIHA 3GW2A 3KP4A 2MBFA 2VKVA 5DCMB 3E7LA 1XGNA 2IS4A 3EZHA 2I8DA 1Z0XA 3DI5A 1YA7O 4YIRX 3ECHA 1IN7A 3CMYA 3LAPA 2JN6A 5F5FA 4C3DA 2CQXA 3GLLA 3DJNB 4HX8A 3L2CA 3CO7C 4QI0A 1T2KA 2FJ1A 3MQ0A 2QA4I 2WB1A 4RGXA 1QVXA 3JT1A 4S04A 4O6NA 1SFUA 2QF7A 5EDNA 2E2HJ 1O3UA 3DPLC 2FBKA 1GXQA 3HNLA 4IKFA 4A3DJ 1REPC 1LFBA 3G6EI 2VJ4A 2L7AA 3JRIA 2M30A 2HDWA 2Y0SA 1WFXA 1ZRDA 2GIZA 4PGGA 2LR8A 2ZFWA 2QSGX 3HYIA 1LI5A 4WCGA 2XC7A 1BBYA 4LLLA 2LSOA 3VYRB 2PLYA 5HLHA 3ATPA 3A0HC 1E17A 4AIDA 3OYDA 4JVSA 3IRQA 1VZ0A 1FR0A 5FD5A 4NQWB 2OC6A 3V5ZA 3WGIA 2TDXA 2X0LA 1Z7Qc 1TNSA 4G8XA 5JVEA 1KU2A 1HW2A 1XC5A 1W7PB 3E6CC 4J7YA 2BHZA 4XLCA 2VBZA 4L0YB 3CCLI 1ZZPA 3WODF 1MMAA 1X19A 2P7VB 5D8LB 1KNYA 5D5XB 5A69A 2LFBA 2MD0A 3FHDA 2CO5A 4IXAA 5CPRB 2YLIA 3U9JA 1U78A 2EWNA
chains in the Genus database with same CATH topology
2OJED 1R5ID 2ICWG 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  1R5I D;  2ICW G;  3KPH A; 
#chains in the Genus database with same CATH topology
 1NG7 A;  3AG4 C;  1R1T A;  2WB7 A;  4UY8 I;  3M8F A;  1ZRC A;  1A36 A;  1R9T J;  2R7S A;  3NKD A;  2V6E A;  4EJV A;  3AG4 H;  3CCE I;  4HF2 A;  1QPU A;  4LIU A;  2EZI A;  1YYJ A;  4IRU A;  1OR2 A;  3CQZ A;  4MVS A;  1I4Y A;  1YYX A;  3KL4 A;  2JA5 J;  2R7X A;  5KYX B;  1J75 A;  3Q7G A;  4C2U A;  1ZH5 A;  4WGY A;  1LVA A;  2NOJ B;  3KX2 A;  2UV1 A;  4YRV A;  4EBB A;  2XAU A;  2KPM A;  4I2O A;  5GPA A;  3HOU J;  1FTS A;  1AU7 A;  2DI3 A;  1LDD A;  2KJB A;  4GCV A;  2KGO A;  2DW4 A;  3E9V A;  3EFO B;  3O8G A;  1KU3 A;  1HOM A;  1MIJ A;  5D4R A;  3FXH A;  4DVY P;  4MIM A;  2RNG A;  2H8R A;  1ZHT A;  3PHF 2;  1Q0K A;  3HG9 A;  3NRH A;  3W4Y A;  2A05 A;  3V5X A;  2AP3 A;  5IY5 C;  2K9N A;  3G1O A;  2XB0 X;  1W2W A;  2WZG A;  3AG1 C;  3IL2 A;  1IXS B;  4A0X A;  5E3N A;  3HRT A;  2IEK A;  4IJA A;  1FWZ A;  2W00 A;  4M3E A;  5EZH A;  2DT6 A;  2OTJ I;  4V2G A;  2JUG A;  3R61 A;  4UVB A;  1WJF A;  4IQJ A;  3DU5 A;  2VAS A;  3K4K A;  4A3J J;  3H3Z A;  2E87 A;  5HS9 A;  3CTA A;  4M9Z A;  4AIK A;  1K05 A;  4TV7 A;  1LB2 A;  3UNG C;  3LNQ A;  5AC4 A;  4C7O B;  3JRB A;  4WJ0 A;  1YE9 A;  1T01 A;  3K4J A;  4E7L A;  2HYG D;  2VE8 A;  1C0W A;  3F8M A;  4XON A;  2CQN A;  2EZL A;  1JOG A;  4UB6 C;  2V1N A;  1WJD A;  1YIT I;  2M9H A;  4XKV A;  3CCV I;  1K04 A;  4FHT A;  5E20 A;  2G0E A;  2KIF A;  1D3Y A;  4L9J A;  2WZF A;  2V1U A;  4BJ6 C;  2VPR A;  1DQU A;  4Z9H A;  2LQG A;  4HW0 A;  5FFZ A;  3MAJ A;  4RDU A;  2Y48 A;  4YJW A;  1W5T A;  2QKL B;  5DV5 A;  2FBH A;  1NTC A;  4LLE A;  1GLN A;  3S1R J;  5EEH A;  1LNW A;  2W25 A;  3H92 A;  4G6Q A;  3GWL A;  5DD8 A;  2DMU A;  3LOC A;  1T38 A;  1BM9 A;  2IS1 A;  2EIK C;  4BKX A;  1EKY A;  2OU6 A;  3FXK A;  1T98 A;  1ETO A;  2K4J A;  2UWM A;  1W36 C;  1Z6R A;  3VEP A;  2HFI A;  4U0V A;  4I01 A;  2EIK H;  1UB9 A;  3HOZ J;  2HTJ A;  3C63 A;  1FMV A;  1S29 A;  3MZ8 A;  5LGU A;  2RSE B;  2R7Q A;  1MDM B;  4IO9 F;  2VL8 A;  1XZQ A;  3U2R A;  2BBY A;  3KET A;  1MNM C;  2NNN A;  3C18 A;  4NDL A;  3JTL O;  1X2M A;  4HV5 A;  3L2Q A;  2X6O A;  4IAQ A;  2VKD A;  3EZI A;  1OIS A;  1MBG A;  4P1W A;  1ZVZ A;  2RNJ A;  1O5H A;  3BZ6 A;  1Z7L A;  3U3F A;  2J9B A;  2IS2 A;  4EMS A;  1FYM A;  2ZBK A;  3U1D A;  1CPQ A;  2Y69 C;  2UUI A;  1J59 A;  1Z7U A;  4B8X A;  5GAE J;  3GTJ J;  4CCJ A;  2MLG A;  5HOD A;  1WI3 A;  3QU3 A;  1ZR4 A;  1LFU P;  2X51 A;  3FF5 A;  2Q00 A;  3NQO A;  1GDT A;  5FO5 A;  4LDQ A;  2E19 A;  2M8G X;  1IDY A;  5L3Q A;  1XSD A;  2V9P A;  2C6Y A;  3K33 A;  4ULV A;  1BBH A;  3OIP A;  4OMZ A;  4KYW A;  5GPC A;  3K70 D;  1WJA A;  1NFN A;  4OU0 A;  2NS7 A;  4CZZ A;  1VFC A;  4D4X A;  2EQR A;  3C2G A;  1M57 C;  5A6A A;  1KTM A;  3OOP A;  3RKO F;  4E7S A;  2X1C A;  4CYC B;  3TL4 X;  2LVS A;  5ED4 A;  2R7W A;  3S9O A;  3S3N A;  4YT2 A;  3I58 A;  1TNT A;  1FSH A;  4A3C J;  2KFD A;  5L3E A;  4OIN F;  2LG4 A;  2PBE A;  2QUP A;  2B7E A;  1Y6D A;  3DE9 A;  2XSD C;  4Z9I A;  4JW1 A;  1ZRF A;  2BHY A;  1VTM P;  4S0H B;  5F1R A;  1SFX A;  5DEQ A;  1ODD A;  2D4U A;  2IW5 A;  9ANT A;  1R5I D;  2GAU A;  1UCR A;  2PX0 A;  1RMV A;  2P7C B;  2EV5 A;  4G6D A;  5J3L A;  4IX7 A;  1VQO I;  4CS7 A;  3MYF A;  2XLO A;  2ELK A;  3JRM O;  2XPU A;  4AE4 A;  1C02 A;  1R4M B;  3WG7 C;  5L0I A;  4F3Q A;  3RCO A;  3HLZ A;  3MFN A;  1WJ5 A;  4LLN A;  3WG7 H;  5JLI A;  5BQI A;  2NPU A;  1ETY A;  3GWZ A;  4HBL A;  3MEX A;  3H5A A;  2EZH A;  3ZVR A;  4B1R A;  1KU9 A;  3RKQ A;  1RR7 A;  2X4H A;  3S27 A;  2W4B A;  3F21 A;  1QZZ A;  3KEO A;  3PCV A;  3RPU D;  1LUJ B;  1S7O A;  1GHC A;  2KT0 A;  2CRG A;  5CI9 A;  4HOB A;  1Z3X A;  1FOK A;  2G3V A;  1PCX A;  4IHT A;  1D5V A;  3GEE A;  2HJ3 A;  4Y17 A;  3S2H J;  5D8K B;  1R5H A;  4DBQ A;  1H9T A;  2HEO A;  3TK0 A;  4WX9 A;  3JW4 A;  5ICC A;  3Q9V A;  1RCP A;  2DA3 A;  3GLX A;  4MGR A;  1D0Y A;  3PIO F;  4XEV A;  3J7A Y;  2DQR A;  3BZK A;  4RGU A;  2A0U A;  2MFZ A;  3C7J A;  1FZP B;  4DOZ A;  1TWC J;  3BR2 A;  5KNL A;  4EVI A;  4UB8 C;  1A0B A;  3E97 A;  3LAJ A;  1HE1 A;  3L0I A;  4B43 A;  4LG0 A;  4D7N A;  3BTL A;  3DU6 A;  3S0X A;  2W9Y A;  3BG5 A;  2ICW G;  4BBR J;  2BVM A;  3O6B B;  1I1G A;  4DRJ B;  2WY7 Q;  1H7I A;  5JRA A;  2D45 A;  3LUT B;  3U1K A;  2IGO A;  2PN6 A;  1VB5 A;  2JVH A;  1ZG1 A;  1QHG A;  1MBH A;  2IA2 A;  1TW2 A;  3CEX A;  2KNH A;  3B9Q A;  3N2Z B;  4JTA B;  3K1N A;  3G73 A;  2AS5 F;  2EH3 A;  2R3S A;  2IXM A;  2W1O A;  4UXN A;  3FIW A;  1YI2 I;  3U8V A;  3EH2 A;  4RA2 A;  5E3A A;  3CCY A;  1YZA A;  3SFI A;  2W4S A;  2QWW A;  2R92 J;  2XRN A;  2OEV A;  4MVR A;  2YQY A;  4AWX B;  3UGO A;  1S6L A;  2P0N A;  1QHH D;  1R00 A;  4L5E A;  1U89 A;  2ME6 A;  4NQF A;  2CV2 A;  3IHU A;  4MVQ A;  2DOA A;  2AVK A;  2XXA B;  2XLD A;  5IP6 A;  4YFN F;  4W97 A;  3A01 A;  2PI0 A;  3DJU B;  4OD5 A;  5L3B A;  2X1D A;  3LSH A;  4F7Z A;  2ID3 A;  3CLO A;  3VYT B;  1D1A A;  4YFK F;  1GT0 C;  2L3D A;  1G4U S;  2LK4 A;  5B5E C;  1XMK A;  2JZY A;  3SFZ A;  3ZPL A;  3S15 J;  2IXN A;  4GEH A;  5AON A;  1T6Q A;  2XAJ A;  3BWG A;  1GVD A;  3FX3 A;  2FQ3 A;  2R4G A;  3JCU C;  2HPM A;  1ZGA A;  3GBG A;  1HKT A;  1YX5 A;  5L3V A;  2DFH A;  5A6K A;  3D5R C;  5LGT A;  3JYH A;  2XL4 A;  3QYF A;  2YEV A;  4XEK A;  4LB5 A;  1XGS A;  1R4T A;  3PMR A;  5DS5 A;  3JRE A;  3S2D J;  3HJC A;  4EWC A;  3LSM A;  1XDU A;  4FCY A;  3ABM C;  1FFT C;  1Q0G A;  2KRC A;  2P5V A;  1A41 A;  1DDN A;  5JS5 A;  2Z16 A;  5HLT A;  5F6F A;  1R1U A;  3ABM H;  1HKQ A;  1YYV A;  3HGY A;  1EQ1 A;  1WTY A;  1LFP A;  3EET A;  3TDZ C;  1LS1 A;  4CDY A;  3WE3 A;  1TWC A;  2KC3 A;  2JA2 A;  3B6C A;  5DUI A;  5IYC J;  2TMV P;  3GOD A;  1RKE B;  3K6G A;  2BXY A;  4BUP A;  2LD5 A;  3H9Q A;  3T5X A;  3U5S A;  4XBF A;  3HKK A;  5FLX Z;  3S1M J;  4X6A J;  1Q0D A;  2BVL A;  5T1D B;  2F22 A;  3TQO A;  5JP7 A;  4KNY A;  4PGH A;  3K4N A;  1I3Q J;  4FX5 A;  1BR4 A;  1ZHZ A;  2L9V A;  2WC2 A;  4YG2 F;  4PDK A;  1OCT C;  3TO9 A;  4RAY A;  2KL4 A;  2LH9 A;  4N06 A;  4HLX A;  2NS8 A;  3RH3 A;  3ABK C;  1P7I A;  3VYU B;  1S5L C;  2RKH A;  3OYC A;  2FNA A;  1VQP I;  5D5W B;  3FBI B;  4OIQ F;  1ACI A;  3DTK A;  4IEJ A;  2R93 J;  5JLX A;  1WWP A;  2GWW A;  3ABK H;  4N9H A;  1U9O A;  1JPN A;  1W5C C;  2R7F A;  1K78 B;  3HIF A;  2CYD A;  2RN7 A;  1LDJ A;  4M74 A;  5KCM A;  3JRD A;  4BDZ A;  1RR8 C;  5BQH A;  3GYH X;  3DCF A;  2GOM A;  4HNU A;  1WKM A;  2X85 A;  4FTH A;  5JVG F;  5BOX A;  1B8I A;  4XQ1 A;  4CBE A;  1X58 A;  4F4B A;  2YU3 A;  2ELJ A;  5CVI A;  4AUX A;  1JRA A;  4JCH A;  1SR2 A;  1FSE A;  4Z2Y A;  2R5Y A;  3DLA A;  4CA0 A;  5E1Z B;  5LGN A;  3IH4 A;  5BQG A;  2NVQ J;  3GWN A;  4PCQ A;  1ZAO A;  1QA6 A;  3PQK A;  2J0W A;  1QBJ A;  1HDD C;  4DZP A;  4RBO A;  4A2U A;  2HV6 A;  4A3E J;  1AUE A;  3H2U A;  4RBN A;  1HMD A;  3Q9S A;  1O4X A;  1DPU A;  3BTC A;  1OCP A;  4BJ5 C;  3WU0 A;  4PJM A;  5CJ9 A;  1ZW3 A;  3DWW A;  4NCQ A;  3M8E A;  1UHS A;  2HDC A;  2HKO A;  2XKO A;  2L7Z A;  3SXM A;  4PUS A;  1MD0 A;  3TP0 A;  3ZG1 A;  1FP2 A;  3TQN A;  4JP0 A;  2PFB A;  3ZQV A;  1KQ8 A;  2F5E A;  5HS7 A;  2DA4 A;  1K6O A;  4IF4 A;  2YLD A;  2XRL A;  4IHX A;  2H7O A;  3ZQY A;  4B4C A;  5DQZ A;  3QYB A;  3I53 A;  3MVP A;  3I4N J;  5HV9 A;  2NYX A;  4PR9 A;  5K7H A;  1U6H A;  2CNW D;  3REO A;  3CUO A;  2P6V A;  2QNL A;  3F8F A;  3OYH A;  1BIA A;  3F8N A;  5IOY A;  3RPU A;  2YL0 A;  5B3I A;  1HC8 A;  2CV1 A;  4MS2 A;  5BQT A;  3N24 A;  1B72 A;  4BL0 B;  2IBF A;  2FOK A;  2F4I A;  3V4G A;  2XV4 S;  2HOA A;  1B59 A;  2CQQ A;  5DCM A;  4XM3 A;  3FAJ A;  5TJJ A;  5AC5 A;  1FBS A;  3JRG A;  1Y39 A;  2ESH A;  2W85 A;  3B0P A;  4II2 A;  3TED A;  3WTV C;  1YAR O;  1WHU A;  1IUY A;  3K1I C;  1GVJ A;  3BTJ A;  1H8A C;  3HOS A;  2L5Q A;  3G4X A;  3LS0 A;  5F0F A;  2H8W A;  1ZHX A;  3F6V A;  4Y3O A;  2K3P A;  3NDB B;  1YW8 A;  2HWV A;  1ZGJ A;  5J8C A;  1T6S A;  3DF8 A;  3VYW A;  3G4S I;  1WSU A;  2GA1 A;  3MWM A;  3B02 A;  2I5U A;  5LD2 C;  4JBA A;  1N78 A;  1O7F A;  3OYJ A;  1AWC A;  3A2K A;  2JA6 J;  3VYS B;  3BTI A;  1KQ9 A;  2EK5 A;  4HG2 A;  3WHN A;  1T6I A;  3FDY A;  4MO7 A;  3SEZ A;  3TGN A;  2VXZ A;  3KKB A;  3CME I;  5KYU B;  3TKY A;  1N75 A;  3BCB A;  3VSK A;  3K10 A;  3W6K B;  2ASR A;  1NZE A;  2GZW A;  2ZO4 A;  4I1M A;  4ESB A;  2P61 A;  4NQW A;  3S8P A;  2WVQ A;  1RJ9 B;  2KDZ A;  1ZR2 A;  3LSJ A;  4II3 A;  2BYV E;  4UUS B;  1YO5 C;  2H27 A;  4IHY A;  1WRJ A;  3H9G A;  4IHW A;  1U9N A;  2LLK A;  3RQE A;  1OXK A;  1H88 C;  4CCO A;  2A68 F;  1RUN A;  1UZC A;  2Y3D A;  1W7P A;  3FK6 A;  4F91 B;  3RKW A;  5DTD A;  2XHK A;  1DGR M;  2WVN A;  1SMY F;  2P7V A;  5IYB J;  4AD9 A;  1L0O C;  3MLG A;  1T95 A;  3SZT A;  2DTZ A;  3NYJ A;  3V7S A;  2YL7 A;  3T9O A;  4CS9 C;  3JRF A;  3G1L A;  1XMA A;  2FNP A;  3D1N I;  3F8C A;  4LOC A;  2CDQ A;  3CJR B;  5COG A;  5ERI A;  5BPI A;  1JGS A;  3HJE A;  1H89 C;  2B63 J;  4H54 A;  1DP3 A;  4YN0 B;  1YJN I;  2K9L A;  2MC4 A;  1FIA A;  2G9W A;  2KLO A;  1POG A;  3L00 A;  1RET A;  3J7Z I;  3ISP A;  1KON A;  1LPQ A;  5KYX A;  3N97 A;  2CV0 A;  1DOV A;  3IQ6 A;  1APC A;  1HST A;  1RES A;  2A61 A;  3EDP A;  3SYN A;  1FLI A;  1M1E B;  2D2W A;  2BY2 A;  1PUE E;  4BU2 A;  3BOQ A;  4HSR A;  1ZLK A;  4OWR B;  4LIV A;  3EFO A;  3M4C A;  2ZKZ A;  2NVX J;  3EUH C;  1P2F A;  3WTX C;  1Y56 A;  3ZN1 A;  3NEU A;  4LJZ F;  2BEO A;  3U2L A;  3V5Y A;  4NY3 A;  1YW9 A;  3QOD A;  5H2F C;  2P8T A;  1HA8 A;  3AGU A;  2R7O A;  4HYE A;  4QPO A;  4BHB A;  1HBX G;  1YLM A;  1X2N A;  4XSX F;  4ER9 A;  1QGP A;  3FKI J;  2DMQ A;  2VJI A;  4G12 A;  3ERE D;  1IN4 A;  3D5L A;  5DD4 A;  3EG9 B;  2MGQ A;  2WAQ A;  4QWQ A;  2PMZ N;  4BQO A;  4D9J A;  4L0Z B;  2ZC2 A;  1TT0 A;  2KP6 A;  3FMR A;  1JR8 A;  2IYL D;  3LEO A;  2R7V A;  4MTO A;  4CSA A;  3H1C A;  3I59 B;  3KP3 A;  2OV7 A;  4E70 A;  2HQ5 A;  4EEF G;  2OAZ A;  1A31 A;  2VJ5 A;  1MBK A;  5F1J A;  4A5M A;  1E0E A;  2HKX A;  1R6R A;  2X0C A;  2DT7 B;  4C7O A;  2LK2 A;  4WWC A;  3MZY A;  3NG1 A;  5DQT A;  5EGO B;  1RNL A;  2XLH A;  1G59 A;  2A3S A;  3B29 A;  4JQF A;  2IP2 A;  1X1P A;  3WGH A;  1E85 A;  2EIL C;  5L0C A;  1UHM A;  1V5E A;  4I99 C;  2E2J J;  3KLN A;  2FQ4 A;  2R7T A;  3IAS 2;  4L9T A;  4XNF A;  1KA8 A;  2EIL H;  1E3H A;  2ELH A;  4HST A;  4PSW A;  3OL4 A;  4QLC U;  1Y0U A;  4BE1 A;  3I4M J;  3W6V A;  2IOQ A;  3AOU A;  3DAG A;  1O3R A;  5JVT A;  2L9R A;  3CUQ C;  5HLI A;  2Q2E B;  2Z5U A;  2LP4 A;  1K4T A;  3AGT A;  1MBJ A;  4HLY A;  3O2P E;  4PK4 A;  1JKP C;  2ID6 A;  3LES A;  2V79 A;  1R71 A;  3O39 A;  2X1E A;  3K9T A;  3HZJ A;  1RZ4 A;  2O03 A;  5FKO A;  1EF4 A;  2P81 A;  3HRS A;  2DDB A;  1CF7 B;  3A1Y A;  2W45 A;  1SFO J;  4PAC A;  4DW6 A;  1ORJ A;  3BZC A;  3K66 A;  1MDM A;  4DYC A;  3DLL F;  2RDP A;  3HM5 A;  1LVK A;  3PFI A;  3FIS A;  3RZD J;  3EYI A;  1KYW A;  3CQZ J;  3F22 A;  1RXQ A;  3CZ6 A;  1JXS A;  2LY9 A;  1UEL B;  2KIM A;  2M0M A;  2PEX A;  4JX6 A;  3LSG A;  5DS9 A;  2K85 A;  4I98 B;  1VQM I;  3TJ5 A;  2ISY A;  1S9H A;  2IRF G;  3S14 J;  2DLL A;  1HMO A;  2CNW A;  2BOL A;  3RW0 A;  2CGE A;  2VOP A;  1N77 A;  3ZMT A;  1GV5 A;  4HRI A;  2ZCW A;  5LLQ A;  5FLX K;  2OBP A;  3HPH A;  3I0T A;  4U0Y A;  2DA5 A;  1MJB A;  5FKL A;  2VE9 A;  5CVV A;  5L0H A;  3TW6 A;  1EH8 A;  3HBL A;  4U5F E;  2E1M C;  1MH4 A;  2GWR A;  4UVA A;  3GEI A;  2KHM A;  1EH6 A;  1OR3 A;  4P6I C;  3HHG A;  2DA7 A;  1ZG3 A;  2HQA A;  1ZGW A;  3NYM A;  3UMK A;  1F36 A;  1RIO H;  3U9M A;  2OUM A;  2EV0 A;  4D5F A;  4JKV A;  1MJA A;  2OU2 A;  3G1M A;  1LDK B;  4FT8 A;  4NC6 A;  3RDI A;  3I56 I;  1A5J A;  2ZXW C;  3OIQ A;  4XRF A;  3L2U A;  1TWH A;  4ULW A;  3N05 A;  5TIS C;  2JT1 A;  2L9J A;  3IQ5 A;  1U5T C;  1PYV A;  1T39 A;  1FOW A;  2V1X A;  1TC3 C;  5E79 C;  4ZTF A;  2E1N A;  3GOR A;  4F55 A;  2JRM A;  4IVN A;  2E36 A;  3I5Q A;  4CYC A;  3WGG A;  1J7K A;  4DQ2 A;  1OW6 A;  3OYL A;  4L6R A;  4HX4 A;  2QBY B;  2ZXP A;  1P4X A;  2XIG A;  2M87 A;  1SF8 A;  1WJC A;  3M1E A;  5HSW A;  2VJJ A;  3WTY C;  2ME0 A;  4QPQ A;  2X6W A;  1P4A A;  2LIG A;  4ZH4 F;  1Y6I A;  2F5C A;  2IAI A;  2ZME A;  1EA8 A;  2FFH A;  5DS6 A;  2D5V A;  1SVL A;  1ZHW A;  3VDX A;  4LGW A;  1YVI A;  1RI7 A;  1ZYR F;  3HHH A;  4ENJ A;  2XL6 A;  3WU2 C;  3SEQ A;  1Y4C A;  1AKH A;  2R7U A;  2CU7 A;  2K7L A;  3LSR A;  1TWA J;  1MZB A;  1LPE A;  2EPN A;  2W57 A;  1C03 A;  5M3M J;  3HC7 A;  3HUG B;  4GGG A;  4XN0 A;  4FQG A;  4A3G J;  3E5X A;  1T6U A;  1CGM E;  4HNT A;  2NUP B;  2YVK A;  1SD5 A;  2BE5 F;  2J5P A;  3RPQ A;  2EPO A;  3T6G B;  1H6G A;  3K4B A;  4MFE A;  2H1K A;  1ORS C;  3LLK A;  3Q0W A;  1G2H A;  1L3L A;  2ZJR F;  2HVR A;  2C04 A;  2E7X A;  3PO3 J;  2L81 A;  3LA3 A;  2LFF A;  4KIG A;  4E4H A;  3P9C A;  1QU3 A;  3QPL A;  1W0T A;  3T1B A;  1VQ6 I;  1ZEL A;  3H0G J;  2A1D D;  3CCJ I;  3JSZ A;  4MTE A;  1F5T A;  1FTZ A;  4YII A;  2GA2 A;  3UKG A;  1JT0 A;  2LBF B;  2GXA A;  1UHW A;  3DBR B;  2WV0 A;  1T8I A;  4ESF A;  4XN3 A;  4GYG A;  3HRU A;  4N6H A;  3T4R A;  2NVY J;  3QVY A;  4EJU A;  2DA1 A;  2QE9 A;  4I02 A;  4CS8 C;  1DOW A;  3T8R A;  5ILU A;  1FYL A;  1OXB A;  3H36 A;  4CXF A;  2CCY A;  4NBQ A;  4ZLC A;  4RLF A;  2VOD A;  3CJQ B;  2VT3 A;  5IY5 H;  3AG3 C;  3AG1 H;  4PJ0 C;  3V42 A;  3J80 Z;  3L1M A;  3JR9 A;  2UXX A;  1MBE A;  4AL0 A;  4Y52 J;  2DPU A;  2XLE A;  3K69 A;  1S72 I;  2CJJ A;  1J2X A;  1LEA A;  3AG3 H;  3CSK A;  4Z9J A;  3TOM A;  1E86 A;  2YUS A;  4XKW A;  1IJW C;  1YFH A;  2M7A A;  1R5G A;  5JHF A;  2Y39 A;  2M34 A;  4HA8 A;  2E2I J;  5EZG A;  256B A;  2AXT C;  4HX7 A;  1FOX A;  3TP3 A;  3NWT A;  4U5B E;  3U8P A;  4LIT A;  4DZJ A;  3DTE A;  3BG3 A;  2B0H A;  1I50 J;  1T33 A;  1VMA A;  3ZMZ A;  1NFO A;  5E2Q A;  1HLV A;  2XSJ C;  1N25 A;  4ENM A;  4WGZ A;  1E3P A;  3QWL A;  1DU6 A;  1ZHY A;  3JZ0 A;  1CPR A;  4WK8 F;  3FOP A;  3SXK A;  1IG7 A;  3J81 K;  2COB A;  1IF1 A;  4K0D A;  2PJP A;  2QM3 A;  1TWA A;  3ZMD A;  1U8B A;  2NS0 A;  3BC8 A;  1IN8 A;  3E6B A;  4NTF A;  1WAT A;  4W1U A;  4P96 A;  5ILS A;  3K7A J;  4EM1 A;  2K9M A;  2EPM X;  1Z6A A;  4KT5 C;  4I3M A;  4O7G A;  2E35 A;  3EGD B;  2XAS A;  3HKZ A;  3X1O A;  2QYO A;  3ECO A;  4IGG A;  4P9T A;  2IJL A;  1FP1 D;  1X3U A;  1YLF A;  2COM A;  2XXA A;  1WCM J;  1WGW A;  2J7P A;  1V3F A;  3L09 A;  1LQ1 A;  2FGY A;  2L9N A;  2VQL A;  4U87 A;  5F27 A;  1UG7 A;  1T0F C;  3BR0 A;  3OSG A;  2E1O A;  3FKJ A;  1MGT A;  2ESN A;  3DFG A;  3ONQ A;  2CG4 A;  4XWJ A;  2GQQ A;  3HOV J;  4PFP A;  3CDI A;  1E2X A;  2JRT A;  5TRD A;  4NHJ A;  3M07 A;  1K40 A;  1I3A A;  1MMG A;  5FKN A;  2XAQ A;  3BCA A;  1I6H J;  2KRH A;  3OR1 C;  1U0J A;  2HZD A;  3BPX A;  4ETS A;  5M5X J;  3EGX B;  1X1C A;  2Q1Z B;  3GTO J;  2LRE A;  1MNE A;  1WOL A;  4XPX A;  3H2V A;  2EIJ C;  1I6X A;  3F23 A;  4ZC3 A;  2Y69 H;  3KZZ A;  1S7Z A;  5DDG A;  1OPC A;  2ZXI A;  3QVZ A;  2EIJ H;  3OR2 C;  1KYZ A;  3HL2 A;  3BG6 A;  2IXS A;  2J9V A;  4XID A;  4HPQ A;  1VQN I;  3M1C B;  3ZR8 X;  2F4M B;  1RKE A;  2HOE A;  1KGS A;  1VK5 A;  4WXC A;  1TWF J;  2HS5 A;  2ZB9 A;  4PJL A;  2BZT A;  5F0C A;  2PF4 E;  2Q9C A;  3ASO C;  3CJT B;  1QQ3 A;  5A6B D;  5EJC A;  3C8G B;  2ZSH B;  2VUM J;  2L2O A;  2H94 A;  2JJ7 A;  3ASO H;  5DVW A;  4KDP A;  2NSF A;  4BGD A;  3C8Z A;  1ST6 A;  2CS3 A;  2KRF A;  4K2E A;  3SZP A;  5K1Y A;  1M56 C;  2NRA C;  2FD5 A;  3I4P A;  2WAF A;  1XD7 A;  2O8K A;  2K40 A;  4N9I A;  2ADU A;  4KT6 A;  2M2E A;  1ZHF A;  3ZQC A;  2KK1 A;  2WAD A;  5JHU A;  2QCO A;  4MQ9 F;  4A3B J;  3IKV A;  2Y30 A;  4EGY A;  2QSH X;  1SD6 A;  4OAZ A;  3WE2 A;  4IHS A;  1A7E A;  1K78 A;  3C3W A;  4XLA A;  3OS2 A;  2RD9 A;  3RYR A;  2VLA A;  1UMQ A;  4FWV A;  3I4U A;  2DK8 A;  1Y8Q B;  5DYM A;  2WV1 A;  3J7A O;  1XWJ A;  3MX3 A;  1VQ9 I;  2O9X A;  3OYM A;  4MVZ A;  1YDI A;  3A02 A;  3LL7 A;  2ZXJ A;  1MSF C;  3Q6M A;  3BR5 A;  1IRF A;  2HFH A;  2X9D A;  1V74 B;  3FOO A;  1XB4 A;  2HYF A;  3FWE A;  2FMY A;  3LMM A;  3B0U X;  1RKC A;  1S3J A;  2DXI A;  2A0B A;  4KA4 A;  2JPC A;  1IO2 A;  2DA6 A;  1G3T A;  3K6B A;  3CCQ I;  1WPK A;  4XR6 A;  2D5R B;  3TO7 A;  2X6X A;  2STW A;  4N4W A;  2W48 A;  5E18 F;  4CCN A;  2OCE A;  4A93 J;  4KJZ A;  2BW3 B;  5COM A;  1WQ2 A;  3WTS C;  4O79 A;  3QW1 A;  3FXJ A;  5LRS A;  2EFQ A;  2X6Y A;  2DYR C;  5L0D A;  2ZXH A;  1GUU A;  1SC7 A;  1MQV A;  3R7C A;  2CUF A;  3TDU C;  1VQL I;  2UXN A;  3VB2 A;  3K1H A;  2JA7 J;  2J0X A;  3WTT C;  1V5F A;  2DYR H;  4BJ6 A;  4O6Y A;  4PFO A;  2FOW A;  5LBQ A;  1HY5 A;  2DU9 A;  4M9S A;  1M6T A;  2A07 F;  3RYL A;  3S93 A;  4L9N A;  4ZYA A;  5FJ8 J;  2IA1 A;  3SXZ A;  3CUQ B;  2NSG A;  1ZRE A;  3JCU Q;  3CJN A;  5IP9 J;  2L0K A;  2OTL I;  4B6I A;  2DJI A;  2RVC A;  2RQQ A;  4YIF A;  3MZH A;  4YT4 A;  4G7H F;  3DMD A;  2CQK A;  2LTP A;  2P6S A;  3D5S C;  5B66 C;  5H20 A;  2F6C A;  3VFZ A;  4CCM A;  3OYF A;  1QKR A;  1P4W A;  2OZU A;  4PZJ A;  2ZXO A;  1XX5 A;  2X48 A;  1BL0 A;  2B0J A;  3UGP A;  4RDA A;  3DBH B;  4W8P A;  1Q0F A;  3IH3 A;  2LKP A;  3HGG A;  4Q4Z F;  2P4W A;  2V7F A;  2HGC A;  5F04 A;  3H9J A;  1EI7 A;  5E8G A;  1GM5 A;  3TOL A;  2PJR B;  2AO9 A;  1GS9 A;  5KYY A;  2MYS A;  1IV8 A;  1FOY A;  4I6Z A;  1HW1 A;  4C3I J;  2DGJ A;  1J0R A;  1Z63 A;  3EJN A;  5FFX A;  4U9E A;  4GDF A;  4R32 A;  1EA3 A;  2LY1 A;  1TP4 A;  3V8K A;  4KI2 A;  1QRY A;  2M4K A;  3GFL A;  3HRM A;  3J7Y J;  2LNB A;  3WG9 A;  2MWQ A;  1IN6 A;  1U6G A;  2HJM A;  3KE2 A;  3O10 A;  2EFP A;  1BC7 C;  2IPQ X;  4J19 A;  2YX4 A;  1MMD A;  2E1M B;  3S32 A;  5EG0 B;  2FSW A;  1VND A;  3Q3S A;  4JOM A;  4F52 A;  1W7P D;  4QDL A;  3CCU I;  4O3M A;  5KYU A;  4EBK A;  3NRV A;  3T6J A;  3QMK A;  2PBI A;  1JKQ C;  3LFU A;  4EJT A;  1ERD A;  4G6T B;  4A3I J;  3AJM A;  3B0V C;  1OW8 A;  3GEH A;  1Z3Y A;  3MKY B;  1MW7 A;  4ENK A;  5IT9 Z;  1QO0 D;  2EPF A;  1WN0 A;  2WY8 Q;  2KDO A;  1RJ9 A;  1Q0M A;  4UUS A;  1D1C A;  2XGC A;  3IPM O;  4ZYG A;  3QTH A;  2QVO A;  3BJ6 A;  2QSF X;  3JTH A;  2F5V A;  1OKR A;  4HDU A;  2K86 A;  4L18 B;  1OQC A;  2Y9Y A;  4XOP A;  2L6H A;  5J6X A;  2VON A;  2RAE A;  1U5T B;  4I0B A;  1FMW A;  1BJA A;  3VSL A;  4XLN F;  4ABZ A;  3OOU A;  1Y0N A;  3LQR A;  4XOT A;  1U3E M;  4XTK A;  3TJ6 A;  4HFK B;  2L7M P;  4BH9 A;  2J8W A;  4BAC A;  3LNM B;  3BDD A;  1XSX A;  1T56 A;  3MYI A;  4HQE A;  4P55 A;  1STZ A;  5EYR A;  4AX2 A;  4XRS G;  1LE4 A;  3HEF A;  5FRN A;  5C3E J;  1SYQ A;  2CW8 A;  3G50 A;  2XUB A;  4HE8 D;  2Q9A A;  4IHV A;  5J8F A;  1TBX A;  2DN0 A;  1LM3 B;  3O8H A;  2Y9Z A;  4HFF B;  1SAU A;  4C3E A;  5D6E A;  4YK5 A;  2XM0 A;  4C3H J;  3I5U A;  4HNV A;  5EF6 A;  2RC4 A;  3ZMV A;  1DU0 A;  4KNW A;  3HB9 A;  2XM4 A;  1WVR A;  3ZXS A;  2DOD A;  5F5H A;  3BY6 A;  1XZP A;  2LF8 A;  4KMU X;  4B3X A;  2VBW A;  1WAS A;  3ZWI A;  3RSN A;  5J1Y A;  2O3F A;  2Y31 A;  3ULQ B;  3W2V A;  1P7J A;  3LFK A;  4D7M A;  4IQ4 A;  4FX4 A;  3H0D A;  1XPX A;  2TRT A;  5IP7 J;  3J80 K;  2MH9 A;  1OQY A;  2DMP A;  2CFX A;  3GTP J;  1O87 A;  3OY9 A;  3PNV A;  3EPZ A;  2HDD A;  5FLM J;  3GF2 A;  2M8E A;  4G9Y A;  1YIJ I;  1BR1 A;  4FES A;  5L0G A;  3DZA A;  5DM7 F;  3AKZ A;  5A6B A;  3HDD A;  4IAO A;  2FAP B;  2MD5 A;  2V4J C;  4LLG F;  2KQ9 A;  3DKA A;  3EG9 A;  4FAP B;  3L1P A;  3FAP B;  1ON1 A;  1SVO A;  1IV6 A;  4Q5S F;  4XRM A;  1NU9 C;  3GCM A;  1Z1D A;  5CVU A;  3AQB A;  3I59 A;  4L5I A;  2WA0 A;  3BP8 A;  4YL1 A;  3F72 A;  2DO7 A;  3U2M A;  4DBR A;  1JHF A;  2IGM A;  2A6T A;  2M0C A;  3DE8 A;  2FXA A;  2XB5 A;  3CES A;  3SHF A;  1KU7 A;  3ZOB A;  5L3D A;  4ASN A;  3LA7 A;  4KIT B;  5M5Y J;  1PD0 A;  5EGO A;  3BPV A;  3POV A;  4JUR I;  2E5N A;  3GO5 A;  3DPU A;  3PL8 A;  5T3W A;  3IWZ A;  1NHA A;  4E17 A;  5GTH C;  2BC5 A;  4M71 A;  5TGT A;  2K27 A;  1IXR C;  3QU6 A;  3RVY A;  2IXP A;  3KP2 A;  2QQB A;  2KW3 C;  3I3L A;  3DEE A;  1UJ8 A;  5B1B C;  1Z21 A;  4KN7 X;  2HU9 A;  4U5C E;  5EK0 A;  2DYS C;  2HXI A;  2YL3 A;  3EH1 A;  1HQC A;  5B1B H;  3HOY J;  3ASN C;  5ICE A;  4DVZ A;  2XGE A;  2Q2E A;  3L7W A;  1DPR A;  3GXO A;  4AYB A;  5LHH A;  2JX0 A;  4JEA A;  5AGF A;  2DYS H;  1BW6 A;  2YWA A;  4A69 C;  3ASN H;  1MND A;  5CQG A;  4RB3 C;  4C30 A;  3X2Q C;  3GME A;  4JEB A;  4NC3 A;  1TQI A;  2M4E A;  2Y2Z A;  1CF7 A;  2K5C A;  2K9S A;  3X2Q H;  2IT0 A;  1I5Z A;  3SYT A;  2F48 A;  3PSI A;  3OA1 A;  3OMY A;  1VYI A;  2FBI A;  3L2R A;  5JLW A;  5IYD J;  1USS A;  1UG0 A;  3H5N A;  1V55 C;  1XCV A;  3O55 A;  4LB6 B;  3GM1 A;  3UMH A;  5K7F A;  2LKS A;  4EIY A;  4XLP F;  3L2V A;  1V55 H;  1VLT A;  4A5N A;  1PP8 F;  2DB4 A;  2A5W A;  1BOB A;  3TBI A;  3Q5F A;  1H0M A;  2N8G A;  5LFA A;  3KEQ A;  4J01 A;  3C2B A;  3DV8 A;  1X1D A;  5D4S A;  2L9S A;  2DPD A;  2J9W A;  3JYY A;  3GVA A;  1Z23 A;  3FXU A;  1BI2 A;  2DAO A;  1B68 A;  1M2V B;  5C44 J;  3CO6 C;  3N4M A;  2HPI A;  4CJG A;  2ZNY A;  4FAS D;  1BI1 A;  1BN5 A;  1S05 A;  1LE8 B;  4B47 A;  3V7O A;  2CW0 F;  1Z91 A;  4E18 A;  5FD6 A;  1LJ9 A;  3M3Y J;  5HNH A;  3PUF A;  5E3L A;  5EEA A;  4J00 A;  1JTY A;  3BQY A;  4HEA 2;  5J40 A;  5LHG A;  4NTB A;  2LMD A;  1YA9 A;  3T6B A;  2OZ6 A;  3A0B C;  2O5R A;  1F9N A;  2IGN A;  3R0A A;  3FXO A;  3L2W A;  1G4W R;  3FVY A;  3IQC A;  3KP7 A;  1PV3 A;  4G94 A;  1OKK A;  2J46 A;  3KCC A;  2ZNZ A;  4C9Y A;  2R5Z B;  2KIS A;  3WAQ A;  2DMT A;  4GRI A;  3F46 A;  2HXO A;  2GDC A;  5JUA A;  3J81 Z;  3OYN A;  1XN7 A;  4I1O B;  5FRO A;  2GXB A;  2PQ8 A;  5DUK A;  2QBY A;  3L8I A;  4KBL A;  3K4M A;  3F0C A;  4XIC A;  3IC7 A;  4XL9 A;  2OG2 A;  3KZI C;  4NC8 A;  1MH3 A;  4DIQ A;  4X0R A;  4BHC A;  2D1H A;  2HZ8 A;  3M4O J;  3TO6 A;  3RKX A;  1SEU A;  4N0B A;  4MTG A;  2MAB A;  3MMY B;  5COF A;  2VC0 A;  5KYW B;  5J1U A;  2OEX A;  5HDG A;  3SDG A;  3FHZ A;  4N4O B;  1S7A A;  5E17 F;  4CIP A;  3S1N J;  3V8J A;  4EM2 A;  1OR7 C;  2GM4 A;  1GGQ A;  3BR3 A;  1FIP A;  3HUG A;  3HOT A;  2DT5 A;  1K4S A;  1BZ4 A;  4YL0 A;  2F4O B;  4L5J A;  2VBX A;  2VKH A;  2DFE A;  1Z9C A;  5DLJ A;  2M45 A;  2NUP A;  4F92 B;  3OSF A;  1FY7 A;  3I9V 2;  5C4J J;  1FYK A;  3FM5 A;  5D5V B;  2YRF A;  2E60 A;  1BOA A;  1PD1 A;  1G8X A;  2DK5 A;  1BW5 A;  4V19 K;  1ETW A;  2QY9 A;  1ORK A;  5AIP A;  5FLV A;  3B6A A;  2W82 A;  2UUH A;  2Z15 A;  3CF5 F;  3QP6 A;  2O9L A;  4MTD A;  2F5D A;  2H1L A;  4RGR A;  3O6X A;  4D4N A;  3G2B A;  1Q1H A;  3ZC4 A;  1NK2 P;  4D1Q A;  3ABL C;  2W24 A;  3VPR A;  1JJ6 C;  1S8N A;  2DA2 A;  3SJM A;  1XS9 A;  4M3D A;  3ABL H;  2LBF A;  1R7J A;  4BJ5 A;  4GYI A;  5CYV A;  1AVO B;  4R1H A;  2O0Y A;  2XKP A;  4HZF A;  4JE9 A;  1I1S A;  3EHM A;  5L3F A;  3LS1 A;  2Q8K A;  3RQ4 A;  4IPA A;  2VCB A;  2OD5 A;  2HSB A;  3RF3 A;  1IN5 A;  1QPM A;  4XOR A;  3T8T A;  1B6A A;  1QZX A;  3H65 A;  3DEU A;  2K9Q A;  3MCZ A;  3ML6 A;  4LD5 A;  4O6J A;  1GQA A;  1D5Y A;  1Y8R B;  3OYG A;  1QLE C;  5BUO A;  1HF0 A;  3PDM P;  1HDP A;  2XAG A;  5J4Y A;  1TWG A;  3ZMU A;  1VOM A;  4DYQ A;  1A35 A;  4U5D E;  4A3L J;  3K4L A;  5H6R A;  4EAT A;  4G7Z F;  2HVS A;  4BXX J;  2ZME C;  2Z33 A;  1IDZ A;  2J9U A;  2YSR A;  3GM2 A;  4EHP A;  4BXF A;  3OYE A;  3E0J B;  1WWX A;  4FX0 A;  2Q3T A;  3IP4 B;  3RYP A;  4BG0 A;  1PUF B;  1TWH J;  5JI6 A;  3AL0 C;  3GM3 A;  2OJE D;  3F3X A;  3T0Y A;  3ZQI A;  4ZZL A;  4K7B A;  3A03 A;  4BPM A;  4D0P A;  3MBG A;  5K5O A;  1ENH A;  5HDK A;  1Z6T A;  1G3S A;  2F5F A;  2OPT A;  5A6J A;  3ZQG A;  3M79 A;  2VQC A;  4EGZ A;  1D8J A;  3QOP A;  3TUL A;  1G3Y A;  1I39 A;  2HZT A;  5IT9 K;  1P6R A;  2VCC A;  1QVU A;  1MKM A;  3FMS A;  3SP1 A;  2QTV A;  2J7P D;  1RPW A;  4HF1 A;  1BJZ A;  3K1I A;  2LY2 A;  3L9F A;  2MW8 A;  3WHB A;  2ZFU A;  2KMU A;  4I0A A;  4XKB A;  1NK3 P;  2NVT J;  3GTK J;  5GAG J;  4KIS A;  2WZL A;  5JSL A;  2EIN C;  2CSO A;  2Y75 A;  3EGD A;  2STT A;  3KYJ A;  3KFW X;  3TOA A;  4CX9 A;  3ZSU A;  1P9Q C;  3OYA A;  3SEO A;  4BEM J;  3DEW A;  2EIN H;  5F28 E;  4BQA A;  3E5Q A;  2W4M A;  1TFK B;  4IJJ A;  5DS4 A;  2MH2 A;  2CWE A;  3U3B A;  3UR3 C;  3F8B A;  4AM3 A;  3JRA A;  3FZV A;  3NMK A;  3JRT A;  4DXW A;  4CDG A;  1SZI A;  4KIB A;  3RIP A;  2HTS A;  1OCR C;  1E3O C;  4BQN A;  2AQE A;  1YQA A;  3BQZ A;  4M72 A;  2ZPA A;  1CGP A;  1XGO A;  4M3G A;  2XLM A;  1FBQ A;  2ZSI B;  1QQI A;  1K83 J;  2DOE A;  4O6M A;  2EZK A;  4YEJ A;  1X4P A;  3GFM A;  4BDY A;  2XGD A;  4U0W A;  4YEL A;  1G6N A;  2WB1 N;  4CCK A;  4A3F J;  1JKO C;  2FRH A;  2HMQ A;  4JRZ A;  5KVR A;  1ZK8 A;  4KUM A;  2G62 A;  2M3A A;  2H6B A;  1VQ7 I;  2EPK X;  1JTX A;  2XF5 A;  2YLG A;  2Y0M A;  2YS9 A;  4A0Y A;  4BY1 J;  4JC7 A;  3BG7 A;  3GEZ A;  2P5L C;  4KIF A;  4KC9 A;  2Y0S N;  3CF2 A;  3KP6 A;  4B3A A;  1J8M F;  4U88 A;  4UVC A;  3P7N A;  4MEY F;  4JIO A;  2WTE A;  4EM0 B;  4CJO A;  1JHH A;  3M1C A;  4CS9 A;  3LST A;  4ZDP A;  4AVZ A;  2FU4 A;  3ZP5 A;  1IGN A;  3EPV A;  1OYY A;  1H9G A;  1O3Q A;  2NOG A;  4Y15 A;  4YFX F;  3C8G A;  2O6G E;  4RAZ A;  2OKU A;  2DFI A;  4OMY A;  1YAU O;  1XGM A;  2LDU A;  4DJA A;  2L4A A;  2JQ7 A;  2YZS A;  4IWB A;  3Q0V A;  3PSF A;  2DCE A;  2IM8 A;  2Y3H A;  2Z99 A;  2ZXW H;  3K1M A;  4MW8 A;  1CGO A;  1D0X A;  3KIO A;  2R7Z J;  2BY3 A;  3ABU A;  3CAX A;  4GYT A;  2PMU A;  3BJA A;  4G78 A;  1TT5 B;  3VOD A;  1L7C A;  5E3C A;  5K5R A;  3LSK A;  3E1S A;  3EUH A;  1BDJ B;  2YPR A;  3H3V K;  1J09 A;  3E6D A;  3FDQ A;  2CQ7 A;  2XDV A;  4J32 B;  2VIX A;  2OJQ A;  3S29 A;  2MA3 A;  1G3W A;  2HI3 A;  4BJ1 A;  3ITF A;  3LNR A;  2O7O A;  2K4B A;  4ITV A;  4RAG A;  3C2H A;  3PUB A;  2ACJ A;  3MFK A;  3KEY A;  2LOO A;  3FXR A;  3W8H A;  4MVO A;  2EFW A;  2AHQ A;  4CIC A;  1LS4 A;  4KMF A;  5C4X J;  2PMH A;  3I54 A;  3RJP A;  1K79 A;  2QEN A;  3V8L A;  3S17 J;  5F08 A;  3CCS I;  4QSH A;  4G0H A;  3HNK A;  1NG1 A;  3CMM A;  1UFB A;  3HOW J;  2OQM A;  3DTI A;  3HPG A;  4GXO A;  2EA2 A;  4KN4 X;  4EV0 A;  4JJG A;  1G4D A;  3KYL A;  3L34 A;  2GXG A;  1I4Z A;  4Q48 A;  2BW3 A;  2LF7 A;  4L9V A;  1MSE C;  4UUV A;  4XKC A;  4LER A;  3LEV A;  1OCC C;  1UST A;  1YRN B;  3IKT A;  4LG3 A;  1QZY A;  5CLS A;  1OCC H;  3QPH A;  1W36 D;  2EFO A;  1V4A A;  1VQ5 I;  2YR2 A;  2CMP A;  2MLK A;  3DPT A;  1K6Y A;  2JK3 A;  4AVP A;  3CUQ A;  4U5G A;  1VI0 A;  4EQQ A;  4IOA F;  5E33 A;  1BA5 A;  1B4A A;  4ZDL A;  4F93 B;  1D0Z A;  3CD6 I;  2H7B A;  3TW7 A;  2HV7 A;  2NAZ A;  2NVU B;  1APL C;  1I27 A;  2VXD A;  4CUG A;  3K2Z A;  5E3O A;  4BEJ A;  3C1D A;  4CSW A;  4AL1 A;  2VPL A;  2R0Q C;  2ETS A;  2B0L A;  2LYC A;  3JAM Z;  2L6F A;  5E1X A;  2IA0 A;  1J8Y F;  3P9I A;  4UV8 A;  1ZW2 A;  1XCB A;  3HOX J;  4JK1 X;  4J30 B;  3FHN A;  3BEH A;  3M4B A;  1IC8 A;  1PP7 U;  2PJR A;  4M3F A;  2P5K A;  1LE2 A;  2XPW A;  1YHQ I;  2XLV A;  1WGX A;  1ETX A;  2P0W A;  3R6S A;  5LEK A;  1IRZ A;  5CIV A;  1EJ9 A;  3TOB A;  1BR2 A;  3FM3 A;  2HOS A;  3HKZ N;  4BS9 A;  4E7I A;  4OIO F;  2RGV A;  5TJ5 E;  5DCF A;  3OL3 A;  1Z77 A;  3WU1 B;  2DFF A;  4Y4R A;  3RIR A;  1VLS A;  2PFD A;  4BEH B;  4PSX A;  2XAH A;  1IW7 F;  2PX9 A;  2YU9 J;  1ETV A;  2L7K A;  2XSE A;  1JT6 A;  2QUF A;  1A6I A;  2CUE A;  5FKM A;  4AIH A;  4BJT A;  5EG0 A;  1FBU A;  2NNY A;  4E7K A;  2JA8 J;  2E7W A;  3BLY A;  4FET A;  1A7V A;  2V3C C;  2UZK A;  3R0J A;  3IV5 A;  1WJE A;  2BXZ A;  3HSR A;  3U21 A;  1IRX A;  5GAD J;  5J47 A;  1PDN C;  1W1W E;  4I44 A;  3N0T A;  3ZIB A;  1Y1W J;  5BMZ A;  4RB0 A;  2NG1 A;  3WHC A;  4XRS A;  3QOE A;  3GFI A;  3JSE O;  2ZD9 A;  4EBJ A;  3S1Q J;  1U5T A;  2VQH A;  5HOO A;  5A2Q Z;  1TR2 A;  3BJO A;  4IB4 A;  3GZ5 A;  4R8H A;  1TFO B;  1YOV B;  3OYK A;  2NUT B;  4DGW B;  3PIP F;  1KQ0 A;  1HXD A;  2KZG A;  3LQQ A;  4XQF A;  4UDV A;  4ZLD A;  2OCC C;  4JX4 A;  1FTT A;  4M6V A;  5KYN A;  5GPG B;  2CUJ A;  2M1B A;  3FXM A;  3BG9 A;  2KZV A;  5GP9 A;  5KAF C;  2O8X A;  3BRJ A;  2OCC H;  1A7D A;  4B44 A;  1F1M A;  1FNT c;  5CVR A;  5HVQ C;  3C62 A;  4IRH A;  2VCA A;  3BR6 A;  3A11 A;  1IXC A;  2LRD A;  2OQG A;  4C2M J;  1Q1V A;  2JD3 A;  2P1A A;  2F2E A;  2Q7R A;  1MMS A;  2BY0 A;  4DJ9 A;  2H09 A;  1SD4 A;  1YJ9 I;  4RD9 A;  4N4N B;  1HSJ A;  2TCT A;  4ZZD A;  5E3M A;  1SAX A;  2KYH A;  3S90 A;  1SFK A;  2VKE A;  1TW3 A;  4E6K G;  4A3K J;  1JUS A;  4CDA A;  4U7B A;  3F47 A;  3W8I A;  4HQM A;  2AWY A;  5CI8 A;  3U0C A;  2QZ8 A;  4MFD A;  4MQV A;  1HW5 A;  4YL3 A;  3PJR A;  3BT9 A;  5GAH J;  5FRM A;  4BAY A;  4Y33 A;  3SZG A;  2HOT A;  1ITY A;  3HTU A;  4CYD A;  3G4Z A;  2HUJ A;  4Q47 A;  2H7V C;  1XMX A;  5FGM A;  4E0H A;  2L6G A;  4ZYH A;  4ZTJ A;  3MKW B;  1OYI A;  2G7H A;  2QQA A;  4E7J A;  1BC8 C;  1QPI A;  4WAB A;  5T3T A;  3S2W A;  3EHN A;  4QIW N;  2Q9B A;  4JCZ A;  2EPL X;  4JZA A;  1B9N A;  3KLO A;  4P9F A;  1EH7 A;  2Y3G A;  1O57 A;  1IZ1 A;  3CC7 I;  4XLH A;  1EV7 A;  5JR3 A;  4CS8 A;  4YT8 A;  3JRH A;  4ON0 A;  1V54 C;  3AG2 C;  3RQF A;  1X1A A;  1T08 B;  3QAH A;  1GXP A;  4AU7 A;  2E34 A;  1R58 A;  4I76 A;  3HTS B;  2EBI A;  4HDV A;  1V5G A;  1V54 H;  3GAN A;  3AG2 H;  2ZJ2 A;  4WXD A;  4MW3 A;  2GIV A;  4ESJ A;  1UAA A;  4N6C A;  3OYI A;  1LKX A;  3GZ6 A;  2GFH A;  3ZQL A;  3QYE A;  2ZME B;  3E3V A;  2ZJQ F;  2K02 A;  4HV6 A;  3RZO J;  5LEJ A;  1Y1V J;  3K4C A;  4M9X A;  2LP0 A;  1YS6 A;  2H8A A;  4YT5 A;  2VC9 A;  2WVO A;  2FX0 A;  1AKH B;  2EA4 A;  3SXY A;  3V7C A;  4Y13 A;  1ZQ3 P;  5LRR A;  3AL0 B;  1VYK A;  1FT9 A;  2V26 A;  3ZCO A;  2DTR A;  3SQN A;  4Q7C A;  2M64 A;  4HAM A;  2JPB A;  2FF4 A;  3GFJ A;  3CLQ A;  3R60 A;  3IWF A;  1RRJ A;  2PNO A;  4CCL A;  2MG4 A;  3E70 C;  1O7L A;  1W0U A;  3IEE A;  4EUK B;  1IUF A;  3V7R A;  1HKS A;  1ZLJ A;  2M4G A;  2OF7 A;  3FXL A;  2B9S A;  1X3Z B;  3I5P A;  5KHD A;  4E7Z A;  4BYY A;  5BNG A;  1OCZ C;  2R7D A;  4PJN A;  5L0J A;  1WZ2 A;  2LCH A;  1D1B A;  1OCZ H;  2IVM A;  3DXJ F;  5FZT A;  1ETQ A;  1ZU4 A;  5CVJ A;  3K70 C;  4U5E E;  3GTQ J;  4J7T A;  1YJW I;  2Q0O A;  5JT4 A;  2FA5 A;  3G3Z A;  4XPY A;  3S3O A;  3Q6N A;  1Z3I X;  2WL8 A;  1T0F A;  3QRF F;  2JVG A;  4CHU A;  5J4V A;  3HSF A;  5HDN A;  2QEX I;  1YIO A;  1R1V A;  2K3F A;  3PO2 J;  1OMI A;  1M2V A;  2IBD A;  4IL6 C;  3GX4 X;  1R4N B;  1DP7 P;  3PNT A;  3LWF A;  1LE8 A;  3NYL A;  4FIS A;  3K7D A;  3KPH A;  2XF6 A;  1OKK D;  1TL8 A;  2YHS A;  3OS0 A;  3CCM I;  4IZZ A;  1YZC A;  4KFC A;  2IGK A;  4NNJ A;  3ROU A;  3DKY A;  3COA C;  3AQC A;  2BV6 A;  3PM1 A;  3E6M A;  3H35 A;  3NMJ A;  4CDV A;  2JTV A;  3DWL E;  1OLT A;  2Q4F A;  3W3C A;  1X3W B;  1MBF A;  3SNH A;  1J9I A;  1IAW A;  1C17 M;  1UFM A;  5FKK A;  3JTG A;  2R02 A;  4IAR A;  1B9M A;  2J45 A;  3DKW A;  1F43 A;  4BE0 A;  4OOI A;  4S05 A;  2GA0 A;  5JFR A;  5D92 A;  2VBY A;  2R5Z A;  1W4M A;  4O5V A;  2E1C A;  1R23 A;  2VT2 A;  2OOC A;  4DRI B;  2XLW A;  3ZN0 A;  1RUO A;  2MHR A;  3I55 I;  3CDH A;  1FEX A;  1B1B A;  3GZN B;  3VWB A;  3PNY A;  4I7H A;  4IOC F;  2CUZ A;  4M6Y A;  5D6F A;  3A9C A;  2CGP A;  4A6E A;  5M5W J;  5ICF A;  1NH3 A;  1RKT A;  3GTM J;  2R25 A;  1NBB A;  5KYW A;  5D5U B;  3S16 J;  3US6 A;  1ULY A;  3Q7L A;  2DMN A;  2XS1 A;  2VN2 A;  2RV8 A;  1ON2 A;  3KH2 A;  2C03 A;  2Z3Y A;  2BGC A;  3OYB A;  4EKW A;  4UUT A;  3JSP A;  2CFO A;  3CP2 A;  2XRO A;  4BBS J;  1RKW A;  3ZRG A;  3ZQF A;  4M63 A;  3LSI A;  3RQI A;  4A12 A;  2PX3 A;  4U7D A;  4HF0 A;  1NU7 D;  1WI9 A;  3BR1 A;  4G7O F;  1JI8 A;  4A4A A;  1U2W A;  3S28 A;  3QP5 A;  3CP8 A;  4RLQ A;  3H5R A;  3MN2 A;  1AEP A;  2PP4 A;  3ZMS A;  5DM6 F;  2NXN B;  1F4K A;  1NG6 A;  5EGY A;  1WH7 A;  2E71 A;  4XMY A;  3K1P A;  1Z05 A;  2KKO A;  4RMN A;  3VAY A;  2L7F P;  3RTR A;  1KZH A;  2VI6 A;  4E7H A;  1K7A A;  2AWC A;  4XLF A;  2KJC A;  2XF7 A;  4BHP A;  2XAF A;  6PAX A;  1WJB A;  2JSC A;  2QQ8 A;  1YTY A;  2DDA A;  5L0F A;  3R4K A;  3ERM A;  1OJL A;  3CC4 I;  4LK0 F;  2WBM A;  3P5J A;  1RC9 A;  2YKZ A;  2XRH A;  4JTD B;  3UMI A;  3JAM K;  1SMT A;  1CGN A;  1TQG A;  1TLH B;  1BIB A;  1O3T A;  4OIR F;  2JSP A;  3H3U A;  1A6Q A;  4AIJ A;  3ESW B;  4ZDO A;  3F9K A;  4XEF A;  5ILV A;  2KJG A;  3M9A A;  4AC0 A;  2A69 F;  5HNF A;  1YW7 A;  4XLE A;  3SDB A;  2ISZ A;  1ONV A;  1XTA A;  2YX7 A;  5KK1 A;  3LSP A;  3B73 A;  2QQ9 A;  3KZY A;  2WWY A;  2BY1 A;  4U9D A;  1LI7 A;  1TTY A;  2Z2S B;  1O3S A;  3SZR A;  2VQG A;  1FJL A;  5B3S C;  4OIP F;  1AA7 A;  1BI0 A;  3ELK A;  2MSY A;  3OEO A;  1FC3 A;  4IRG A;  4MHG A;  1YJG A;  5B3S H;  3EQL F;  3LA2 A;  1R22 A;  4CO8 A;  1PUF A;  1IZM A;  2Z1D A;  3IQT A;  2KIQ A;  4RGS A;  1TKN A;  4P9U A;  4LAC B;  2JWT A;  1DGW Y;  3OWT A;  4H4K C;  3ZQH A;  3KYI A;  2R7R A;  4ZJZ A;  4AYB N;  3KP5 A;  3GUD A;  2LSE A;  2KSF A;  3R2P A;  1XDS A;  2LC2 A;  2QKM B;  5EEG A;  4D5C A;  2XGX A;  2IS6 A;  4LFU A;  2M7B A;  4JJF A;  3CC2 I;  5IOZ A;  1T9K A;  3J06 A;  4M73 A;  5AIQ A;  3I71 A;  4XSZ F;  2KIU A;  3PFY A;  2J5O A;  4A6D A;  4JTC B;  2A6E F;  2HQR A;  3IAM 2;  3QPS A;  4FE7 A;  5A2Q K;  3NKE A;  3ZTZ A;  2HVQ A;  1E84 A;  5D91 A;  4MND A;  1JAF A;  4AE4 B;  5LHI A;  2HYJ A;  4UHT A;  3DQV C;  1U8R A;  4BNC A;  1E83 A;  1TQP A;  2DBB A;  1ZKG A;  1YS7 A;  5CQE A;  1VF9 A;  2V9V A;  3P9K A;  5GTI C;  3AFH A;  1X4O A;  1UG2 A;  4RM3 A;  3AAF A;  4H0E A;  1VQ4 I;  4LLC A;  3S3M A;  4PJJ A;  5ICG A;  3ZTM A;  1MJ9 A;  4M6X A;  4C3B A;  1LIH A;  4JYK A;  4CSA C;  1WH5 A;  2CYY A;  2UUZ A;  4CZC A;  1YG2 A;  4UNO A;  4LMY A;  5E8I A;  3ECS A;  1X1B A;  4A3M J;  3C8G D;  1VQK I;  1T5O A;  4MVM A;  2V6C A;  1XG1 A;  2R9R B;  5EHH A;  1FNN A;  2I8B A;  4GQH A;  4LK1 F;  1OYW A;  4E0I A;  4X0G A;  3M8J A;  1Z5Z A;  1SVM A;  1EKE A;  3NMI A;  2HR3 A;  3G71 I;  4LG0 B;  4KNV A;  3VOE A;  3B71 A;  2FUG 2;  4NTA A;  2A5Y B;  2GOX B;  2L4M A;  2QGU A;  4NC7 A;  1YX3 A;  2QLA A;  1QZE A;  1TWG J;  4R79 A;  1F1Z A;  3MD2 A;  3ZGK A;  1TZL A;  2EFN A;  2XVC A;  4GO1 A;  3ZQQ A;  4RB1 A;  1PJR A;  4DNC A;  1M2O A;  5KYY B;  5F64 A;  3EYY A;  2ZJP F;  4WXH A;  2OQR A;  4RS8 A;  2LKX A;  1TQM A;  4B48 A;  1DUX C;  1CQT A;  3ZDL A;  4OAY A;  3ZQ7 A;  2RQP A;  1ZU5 A;  2CH0 A;  2AQF A;  4NUB A;  3LJB A;  5L3G A;  1QSP A;  3LAY A;  3MKZ A;  4QI2 A;  3EUK L;  4EJO A;  3HXL A;  1JKR C;  2RRE A;  3F6O A;  1L3P A;  1OFC X;  2G3K A;  2H6C A;  5HS8 A;  3HTK C;  4EJW A;  1ETK A;  5M3F J;  4I09 A;  2Y3B A;  3W6J B;  1V4R A;  2A6H F;  2ZXR A;  2EJR A;  4LDR A;  4IRI A;  4FE4 A;  2E5Z A;  3A01 B;  2AU5 A;  1BI3 A;  3EUA A;  2LD6 A;  1SD7 A;  4CH7 A;  3DM5 A;  2D1V A;  2W84 A;  3ABT A;  4MEX F;  4Y7N J;  2XL8 A;  2HQN A;  4GFB A;  3KYC B;  1JPJ A;  3DAF A;  3E5U A;  3JRC A;  4XK4 A;  1ZTR A;  5H6Q A;  2DOF A;  2MC3 A;  3NAR A;  3DP7 A;  4RAF A;  1PVE A;  5BS6 A;  5FB2 A;  3DBL B;  1ZAR A;  4MVU A;  4LDK A;  3HNI A;  1J5Y A;  3Q0U A;  1W5S A;  2WAE A;  1P92 A;  1QVT A;  2XPV A;  2M5W A;  1YRN A;  3U9G A;  3DD7 A;  2KQR A;  4A2N B;  3M7G A;  2WAQ N;  3QW0 A;  2FE3 A;  2VOO A;  4BY7 J;  3L8J A;  4OD4 A;  1SAN A;  3WTU C;  3GTL J;  3DM9 B;  1I5N A;  4JX5 A;  3TMO A;  4V2F A;  1OW7 A;  2JMW A;  4A0Z A;  1ZN2 A;  3MKL A;  1JJ8 C;  5K0I A;  1JE8 A;  2L01 A;  1HCR A;  3VRC A;  4MLO A;  1NSG B;  4NB5 A;  5KAI C;  3JSO A;  1LEB A;  3CDL A;  1IRG A;  2HSQ A;  5CKT A;  3IH2 A;  2L54 A;  2G7U A;  5L3C A;  4U5H A;  4ONS A;  2VH3 A;  3RQG A;  5J1R A;  1OCO C;  2OA4 A;  3FK7 A;  3HSE A;  2CW7 A;  2V1D A;  4M3B A;  3I64 A;  3PQJ A;  4P5O A;  3IRR A;  1U0B B;  1FPQ A;  4BXU A;  1OCO H;  3OS1 A;  3VM6 A;  3S84 A;  4C2T A;  1FX7 A;  4AK9 A;  2XS8 A;  4BQQ A;  3DKX A;  3QQA A;  2I10 A;  4DRH B;  1R36 A;  1JUM A;  1QNT A;  1JMW A;  5K7Z A;  2QLZ A;  3CCR I;  1K61 A;  2P6T A;  2VC1 A;  3OIO A;  3BRO A;  2HNH A;  3OV8 A;  2R05 A;  5FCL A;  2W7N A;  3W2W A;  1B8I B;  3M15 A;  3GTG J;  2EIM C;  4ZYD A;  3O3K A;  5B1A C;  2L02 A;  4C3J J;  4BEH A;  4YWQ A;  2HKV A;  4BE2 A;  5IPA A;  3VF0 A;  3FXQ A;  2JPU A;  3TD7 A;  2PMZ A;  2EIM H;  3K2A A;  2R5Y B;  5B1A H;  1VTN C;  4QTR A;  2VB6 A;  5E1W A;  2PG4 A;  4UV9 A;  2DQL A;  4WF2 A;  2IXO A;  2O61 A;  2EV6 A;  1R49 A;  3LLI A;  3RKY A;  1Z67 A;  2HMZ A;  1A04 A;  1FAP B;  4DYR A;  2GLO A;  1MMN A;  1S7E A;  2ECB A;  4Z6Y A;  3FBN B;  3CMA I;  2LFD A;  5K5Q A;  5F0H A;  3HNJ A;  3RI4 A;  4XPW A;  2Z9O A;  4W8K A;  4ENN A;  2DJN A;  4RM2 A;  4ZYE A;  3KYD B;  1JUP A;  2JUC A;  4RB2 C;  1OCR H;  2NUT A;  3KMI A;  3RVZ A;  1AOY A;  3RFY A;  2FEZ A;  4X1E A;  3EGX A;  1D8K A;  3NWS A;  2GBY A;  3WTW C;  3A4C A;  2YL1 A;  3IUO A;  1G5Z A;  4MTF A;  3QZC A;  2V9K A;  3FMQ A;  1AHD P;  5IT3 A;  4ANJ A;  3QPT A;  2R03 A;  1HE9 A;  1N1C A;  3WTZ A;  2I15 A;  5BPD A;  1FFH A;  3NAU A;  4K1O A;  1ZG5 A;  2ETH A;  2GAQ A;  3W2A A;  2ECC A;  1ORY A;  4HEA J;  1NLX A;  1OR7 A;  3K0L A;  1JGG A;  1GV2 A;  2AXL A;  4KIC A;  2FML A;  4B09 A;  5HLG A;  1B72 B;  1VQ8 I;  2BL2 A;  3D0S A;  4MNU A;  2EB7 A;  1SFE A;  4CGZ A;  1XSV A;  4CIH A;  3GW2 A;  3KP4 A;  2MBF A;  2VKV A;  5DCM B;  3E7L A;  1XGN A;  2IS4 A;  3EZH A;  2I8D A;  1Z0X A;  3DI5 A;  1YA7 O;  4YIR X;  3ECH A;  1IN7 A;  3CMY A;  3LAP A;  2JN6 A;  5F5F A;  4C3D A;  2CQX A;  3GLL A;  3DJN B;  4HX8 A;  3L2C A;  3CO7 C;  4QI0 A;  1T2K A;  2FJ1 A;  3MQ0 A;  2QA4 I;  2WB1 A;  4RGX A;  1QVX A;  3JT1 A;  4S04 A;  4O6N A;  1SFU A;  2QF7 A;  5EDN A;  2E2H J;  1O3U A;  3DPL C;  2FBK A;  1GXQ A;  3HNL A;  4IKF A;  4A3D J;  1REP C;  1LFB A;  3G6E I;  2VJ4 A;  2L7A A;  3JRI A;  2M30 A;  2HDW A;  2Y0S A;  1WFX A;  1ZRD A;  2GIZ A;  4PGG A;  2LR8 A;  2ZFW A;  2QSG X;  3HYI A;  1LI5 A;  4WCG A;  2XC7 A;  1BBY A;  4LLL A;  2LSO A;  3VYR B;  2PLY A;  5HLH A;  3ATP A;  3A0H C;  1E17 A;  4AID A;  3OYD A;  4JVS A;  3IRQ A;  1VZ0 A;  1FR0 A;  5FD5 A;  4NQW B;  2OC6 A;  3V5Z A;  3WGI A;  2TDX A;  2X0L A;  1Z7Q c;  1TNS A;  4G8X A;  5JVE A;  1KU2 A;  1HW2 A;  1XC5 A;  1W7P B;  3E6C C;  4J7Y A;  2BHZ A;  4XLC A;  2VBZ A;  4L0Y B;  3CCL I;  1ZZP A;  3WOD F;  1MMA A;  1X19 A;  2P7V B;  5D8L B;  1KNY A;  5D5X B;  5A69 A;  2LFB A;  2MD0 A;  3FHD A;  2CO5 A;  4IXA A;  5CPR B;  2YLI A;  3U9J A;  1U78 A;  2EWN A; 
#chains in the Genus database with same CATH homology
 2OJE D;  1R5I D;  2ICW G;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...