2ICWG

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
MKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 80
structure length 213
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2icwG02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2icwG01
2OJED 1R5ID 2ICWG 3KPHA
chains in the Genus database with same CATH superfamily
4O6JA 3ABKC 1B59A 2XGCA 2IA0A 3POVA 2PMZN 3OR1C 2NS0A 2W24A 1QQIA 4BXUA 4AIJA 4NTFA 3MYIA 3LOCA 4ZDLA 1OQCA 3DQVC 1YIJI 1FFTC 1WJCA 5J40A 3F72A 1FLIA 2HTSA 2LH9A 3OYGA 3QPSA 2MFZA 4R32A 1YHQI 2R7XA 3V5ZA 4CJGA 4YN0B 2VBWA 3I71A 3QQAA 4E7HA 2LDUA 3ISPA 3HLZA 4FX0A 3KMIA 2E7WA 2NAZA 2VQLA 3AG1H 3E6BA 1K7AA 3FISA 2DOAA 4OAZA 1OCCC 4ZYHA 3C8ZA 3ZMVA 3RI4A 2ZMEC 2F4OB 3O6BB 2DA5A 3SDBA 4UVAA 4BQAA 3L2QA 2F5DA 2QGUA 1W0UA 3PMRA 1G3WA 2V6EA 5E1XA 2ZPAA 3Q0VA 2FAPB 3S3NA 4QWQA 1OCTC 3Q7GA 4BQQA 2BBYA 4G6DA 4I6ZA 3IQ5A 1KGSA 2IM8A 2OCEA 1ZAOA 4ULVA 4D4NA 2ZMEB 5FROA 2BL2A 4J00A 3IQTA 4M9SA 3BOQA 3KP5A 2MLKA 2OJED 3WTWC 3M8EA 5IP6A 2V3CC 1J8MF 3ZWIA 2QTVA 5FB2A 3QW0A 2FOWA 4XRMA 2HOTA 4Q47A 5J4YA 5E3CA 3KEQA 1JRAA 2IPQX 3SQNA 2XGEA 2P6SA 4AUXA 4RB2C 2EQRA 3PM1A 2WVQA 3HM5A 2O61A 3FMQA 3WTSC 1P2FA 4QSHA 3S1NJ 3QAHA 1JI8A 1T6QA 3H65A 4GQHA 4IXAA 1GQAA 1RC9A 1M2VA 1VF9A 2RVCA 4L5EA 1V74B 3S1QJ 2PQ8A 1R5HA 4I7HA 1KTMA 2R5ZB 1USSA 1CPQA 1OCOC 2XLMA 5LEJA 1G5ZA 2NPUA 3PQJA 2C04A 2K9NA 2L7MP 2D1HA 2VKVA 2YUSA 1D0XA 2P1AA 1A6IA 2DYSH 3M8FA 4ITVA 2EV5A 3CCEI 4PACA 3EDPA 2QQ9A 2JA5J 3KZYA 4ZZLA 1WI9A 4F92B 3WTXC 3CCVI 5KYWB 3JAMZ 2F5VA 2DTZA 1K78B 2CQNA 4A3MJ 2UXXA 2CWEA 3RZOJ 4AIHA 2DMUA 1LFUP 3FIWA 4AYBA 3JCUQ 4WXCA 1VQ6I 5HSWA 3RYLA 3B0UX 2M0CA 5BNGA 2W00A 1R5GA 3HGYA 3K6GA 3VYWA 2XGDA 1RMVA 1ORJA 3S32A 4XTKA 4IRGA 3RKYA 5HODA 5J8CA 1I3QJ 4CCLA 4CCNA 3IPMO 4YIRX 3GF2A 3HOWJ 4XWJA 4RBOA 2R25A 3W4YA 2M0MA 1WJ5A 4DJAA 2YZSA 3D5SC 4XKVA 4ZLCA 1RZ4A 2FU4A 2CFOA 3VWBA 1MJAA 3IH3A 1ZHZA 2CS3A 4II2A 1LE8B 3M79A 5EZGA 2ZCWA 2V6CA 1FOYA 1Q1HA 2W85A 2YLIA 4XOTA 1GVJA 1FT9A 2VQHA 1RR8C 6PAXA 4MFEA 4RDUA 3Q5FA 3E5XA 1C0WA 1MSFC 4PJ0C 2R7TA 3ECSA 3SEOA 3C2GA 2XM4A 4YT4A 3QOEA 1VQPI 1U78A 5HLTA 1K40A 3U8PA 1A35A 1FYLA 2PP4A 3OMYA 5EK0A 2RGVA 1HQCA 3CSKA 2O0YA 1IW7F 1CGME 3DTIA 3VPRA 2MG4A 4QPOA 4II3A 4CGZA 4G7OF 3K69A 2CH0A 3L7WA 2OZ6A 4I0BA 1KZHA 2BC5A 5A6AA 4BGDA 3OYMA 3HDDA 4BY7J 2FFHA 3CC7I 3C8GD 2V1DA 1R00A 4NCQA 4WK8F 4YL3A 2X0CA 3SXKA 3PSFA 3K4LA 4OOIA 5FKLA 3AKZA 3DWWA 1F4KA 5IT9Z 3HNJA 2NOJB 5E3LA 3ABKH 2XM0A 3BTJA 2LKXA 5L3EA 4BBRJ 3H5RA 4CS8C 3QYEA 2R92J 3U9MA 1GXQA 1BBHA 4N9IA 2QA4I 1G59A 1AWCA 3GYHX 1HKTA 4FHTA 2W4MA 3L2RA 5D8LB 3N2ZB 1XTAA 4KIFA 4LG0A 2Z15A 2A5WA 1E3HA 2UUIA 1R9TJ 3QPLA 5CVVA 1HE1A 2OQRA 4B48A 3O8HA 2QM3A 4EVIA 3QRFF 1B9MA 5L3DA 3E5UA 5L3FA 2L6HA 4O79A 1O7FA 2XAHA 3SEQA 2JT1A 3FXOA 4UHTA 1ZELA 4G9YA 4CDGA 2HNHA 3L09A 2J5OA 2RKHA 4KNYA 4AL0A 4Z9JA 4AVZA 2KQ9A 1BR2A 4RA2A 4IARA 4WXHA 1AKHA 2J46A 4FT8A 4N0BA 3PIPF 1Z7UA 2DDBA 3IWZA 4WWCA 4BNCA 3R61A 4BHCA 4RAZA 2QVOA 2BHYA 2JA6J 1W5CC 2IXMA 3M07A 1GGQA 4QTRA 3S29A 4KICA 3DBHB 3WTYC 3H5AA 5GPAA 2ME0A 1IZMA 2KMUA 1AHDP 1TWAA 3SYTA 3BJAA 2LK4A 4CA0A 1VQ5I 5KYYB 1IC8A 2PMHA 3ABLH 2I5UA 2VQCA 1LJ9A 2GWRA 4V19K 2Q7RA 3VM6A 2Y30A 4DIQA 1Q0MA 1ACIA 1YA9A 2F5FA 1QZXA 3FBNB 4XEKA 1TW2A 2V9PA 3GM3A 1D5YA 3J7AY 4XICA 3I4NJ 4I1OB 4Y52J 5B5EC 1ZG5A 2EB7A 2KIQA 3Q9SA 2ZO4A 1A31A 4IF4A 5HOOA 1Q0GA 2YEVA 2EFOA 1ENHA 3GO5A 3U5SA 1U0BB 2XXAA 3PNVA 5FD6A 3ZQCA 1SEUA 2BEOA 3L8JA 3SJMA 4NY3A 4EUKB 2LTPA 4A5MA 3FXUA 3UNGC 1XMKA 4IOCF 4X6AJ 2L9NA 4NQWA 1JT6A 3HOUJ 3B71A 3G4SI 4OIRF 3FK7A 5J6XA 4BPMA 2E5NA 3KEYA 1QSPA 3VB2A 1BM9A 1IV8A 4M71A 2BW3A 3GLXA 5HS9A 2YWAA 1X2MA 1A7EA 3K1MA 2IGMA 3BZCA 1CPRA 2LLKA 1Y4CA 2CNWA 4P9UA 4U9DA 1RKEB 2OC6A 1JKPC 3GUDA 3CUQA 3CO6C 3JZ0A 1WWPA 4HFKB 2X6YA 3SXMA 3MKZA 2VLAA 1QHGA 1HC8A 3CMEI 3MKWB 1DPRA 5IP9J 4BG0A 4I99C 4FETA 1MJ9A 1G6NA 1XG1A 3DF8A 2ZSHB 4G6QA 1EQ1A 4MVOA 4M6VA 1QQ3A 2R7WA 4C7OA 2BY1A 3C2BA 1K4TA 4M6XA 1SC7A 1E83A 4B44A 3U2RA 1PJRA 2R7VA 2QZ8A 3TJ5A 3C63A 1X58A 4N4WA 3M7GA 3PNYA 3T5XA 3IRRA 1QVXA 2LR8A 1TR2A 4I76A 3RYPA 3Q6NA 1X4OA 2HDDA 2N8GA 2IT0A 3LSTA 4IPAA 1MW7A 3E70C 2FJ1A 2L4MA 2OEXA 1V4AA 3T8TA 3IP4B 4CDYA 1LEAA 4FX4A 1BL0A 5JS5A 2JJ7A 1ZLKA 2MA3A 4RGRA 3CAXA 1FOWA 3OL4A 3PNTA 4O5VA 4HPQA 2OBPA 3MKYB 3BG6A 2L6FA 2XL8A 4NC3A 3WTVC 2XC7A 4RDAA 3ECOA 1DDNA 4KT6A 4A3IJ 2HUJA 3BR0A 2EV6A 3ZQHA 2V79A 4M73A 2FBHA 1IJWC 3Q9VA 2VUMJ 4DYCA 2DO7A 2NNYA 4IQJA 2HMZA 3QW1A 2L6GA 2EINC 3CDIA 4KMUX 3E1SA 3I4PA 4JCHA 3E6MA 3MBGA 1JUPA 2JRMA 3Q6MA 1HKQA 1SMTA 3GTLJ 2IXNA 3PO3J 4JYKA 2P7VB 4KYWA 4O6NA 2HMQA 4A2NB 1D8KA 3ZSUA 2OAZA 2GXGA 2KW3C 3CF5F 5L0FA 4O6YA 1JOGA 3K33A 2E1MC 5E3OA 5LRRA 5E3AA 3O8GA 4XORA 2BY3A 3CP8A 1MNDA 2Y2ZA 1MMSA 4JKVA 1NG6A 3M8JA 1ZARA 2O7OA 3JW4A 4OAYA 1J9IA 3KZIC 4XMYA 5DVWA 3O2PE 3Q3SA 2DA2A 1MNMC 1N25A 1FAPB 2Y69C 4Y17A 1VQMI 2XVCA 5JLWA 3VOEA 1LQ1A 3M15A 2KKOA 1Z63A 2FD5A 3U21A 3GTQJ 2A0BA 3OOPA 1H8AC 2G62A 2COMA 5CVJA 3J7AO 4HV5A 1CGNA 1YS6A 1ZQ3P 1QPMA 3LA2A 4KITB 5E3MA 3FDYA 1IRGA 3OWTA 3JCUC 3DU5A 3S0XA 2AQFA 5K7ZA 3DBRB 2HOAA 3CUQC 4YJWA 4M9XA 5EGOA 3BWGA 4XEVA 2FUG2 1HW1A 2RQQA 3TQOA 2Z2SB 4LJZF 3NQOA 4XPWA 2CQQA 1O3TA 3KYDB 5GAGJ 5LRSA 2DBBA 5M5YJ 1IN7A 2OA4A 1JTYA 2X1DA 5K1YA 2QSFX 5CQEA 3TULA 1O5HA 1I6XA 2L7KA 3SP1A 4K7BA 3G4XA 2CYDA 3CCUI 5T1DB 2OJQA 4MO7A 2QQ8A 3G50A 2AXLA 3BP8A 3JRIA 3JRDA 1BI2A 1P4AA 4RM3A 4KJZA 3IAS2 2JTVA 4GGGA 5GPGB 3AFHA 4ESBA 1MQVA 3JSEO 3A01A 3HRTA 2PN6A 1W36C 2CRGA 4CDVA 2ZXPA 2HYGD 4QLCU 1T9KA 3WTZA 4M63A 2Q2EA 4U5DE 1A0BA 3JYHA 3KH2A 1RNLA 4DOZA 1VQ4I 4AE4A 2O8XA 5DS9A 1RKEA 5JHUA 3RYRA 3EUHA 3HSRA 4YIFA 4B4CA 3MD2A 1AUEA 2J9BA 4MEYF 2HZDA 2EINH 1Z23A 2PX0A 2KDZA 3HL2A 4ASNA 3HB9A 2GIZA 3RW0A 3CJTB 2FEZA 5DCMB 3S28A 4A3BJ 4PUSA 3OYJA 4F52A 3LWFA 4E70A 4ETSA 5HS7A 3B6AA 1O4XA 2GAUA 2ACJA 3EPZA 5HLIA 4U7DA 1X3WB 3S15J 3P9IA 2M1BA 1MBHA 4C3EA 4CJOA 2LOOA 1GUUA 2E5ZA 2JA2A 5D6FA 3D1NI 3LSPA 4CX9A 1YIOA 1BJZA 1BIAA 1VK5A 2DK8A 3DPTA 2XL6A 5E33A 5E1ZB 3G6EI 4AE4B 4EIYA 1HF0A 4RAGA 3U3FA 3JSZA 4LLLA 3DLLF 3V7SA 2XGXA 3OYBA 2Z16A 5FLVA 1R49A 2IBFA 2L7FP 3I4MJ 3RSNA 4IX7A 1FX7A 2F4MB 3NDBB 4DVYP 3ZMUA 4HDVA 1U9OA 3IQCA 4KNWA 1O57A 1M2VB 1N1CA 2GA1A 1ERDA 2M30A 3TQNA 3CO7C 3HRSA 1VQNI 1LS1A 3MX3A 1V5FA 3FXRA 3W2VA 3HOTA 5L0CA 4RB1A 5C44J 2TMVP 1NK2P 2LNBA 4M3GA 1I5ZA 1U6HA 2JK3A 5KK1A 3RIRA 5BS6A 4UV8A 3IAM2 3RCOA 3CJRB 4PSWA 4UV9A 5L0JA 1G3SA 3P9CA 4DW6A 1BIBA 2WAQA 5C3EJ 3J80K 4G7ZF 1JGSA 2JN6A 2K27A 1O3UA 1Z6TA 3SFIA 2HFHA 3FHZA 2X6OA 2NG1A 2EIKC 4H54A 1JR8A 1VQLI 5B3IA 4HNVA 3QU6A 3OYNA 4YWQA 2EIMH 2OU2A 3OIPA 1FP2A 2AO9A 2BE5F 1RJ9B 5LLQA 4RS8A 3MAJA 1XD7A 2IS1A 2KJGA 4O3MA 4U9EA 2K5CA 4B3AA 2X1EA 2IGOA 2WVNA 2GM4A 3RQIA 1UG0A 1UAAA 4A12A 3F6OA 1R1TA 1XCBA 3K66A 1GLNA 4RMNA 1B6AA 4HLXA 4MQVA 3LNQA 1YITI 3LAPA 1T0FA 3EH2A 1B72B 1J75A 5CIVA 4M9ZA 4XRFA 1QLEC 1RKTA 3VDXA 1VLSA 1VQ9I 5JRAA 3HEFA 2M64A 5IPAA 2B9SA 1AVOB 3GORA 3K1NA 4J7TA 5ILUA 1BBYA 5K5RA 5BPIA 4S05A 3S16J 3ABMC 3I5QA 1USTA 4A3LJ 1U8BA 5L0HA 1DP3A 4FTHA 3AL0B 3HZJA 1FTSA 4Q7CA 2WVOA 2V1NA 3DJUB 1S7EA 4XKCA 3CF2A 3RKWA 5IT3A 1YZCA 1MBJA 4NC8A 2XAFA 4JQFA 2Q4FA 5GTIC 1Z3YA 2YX7A 2M3AA 1YW7A 2HDCA 3FKIJ 5LHHA 1KYZA 2HKOA 5KYUB 4ZLDA 5CI8A 1XMXA 3H2UA 3LSHA 1NBBA 3BT9A 1ZZPA 2CUJA 1RIOH 1L7CA 2EPMX 3C62A 3F21A 2F2EA 1PDNC 3UGOA 2OV7A 2W1OA 3F9KA 4RGUA 1YJNI 2VJ4A 3PDMP 5LGTA 3HNKA 2Y0MA 1LE8A 4EBJA 4QPQA 2ISYA 2R9RB 4JTCB 5IYDJ 3HNLA 4I2OA 2P4WA 3B73A 4B1RA 2NSGA 2KP6A 2VQGA 4EMSA 1VQOI 1TWHJ 5HV9A 2FNAA 2DFEA 2BZTA 3GEHA 1DUXC 2ZFUA 2LSEA 4JX6A 1UELB 3RFYA 5AIQA 3H35A 3E9VA 2I8BA 2L0KA 4NDLA 4CS7A 3K4KA 3A02A 4BEHB 1MKMA 4A69C 3SZGA 4EJWA 5LHIA 1TFKB 3TOMA 1W5SA 3J81Z 2DXIA 2I10A 3GMEA 4HQMA 4NQWB 4LMYA 3H2VA 4NB5A 3FX3A 4U5CE 4XSXF 5FJ8J 2LP0A 2R4GA 4YT5A 3RH3A 3R0JA 1P4WA 3IH4A 3E5QA 2HS5A 1JTXA 3OYHA 5L3BA 1Z1DA 1W7PD 1REPC 5DS6A 1UHWA 3LMMA 2E34A 1U9NA 3DM5A 3QTHA 3OYAA 1PVEA 1Z67A 3KLOA 4LB6B 2AP3A 5A6JA 1YX3A 3IWFA 5CYVA 5LGUA 1KQ9A 2COBA 3VEPA 3KPHA 2JPCA 3BQYA 2M8GX 3E0JB 2Q9CA 3K2AA 3WODF 5T3WA 1QO0D 2X48A 5AONA 1OMIA 3BZKA 3TMOA 2G7HA 2XXAB 3WHCA 4A0XA 2VIXA 3HOYJ 5EGOB 2O9LA 2CQKA 1MMDA 4M3FA 3IUOA 4S0HB 1X3ZB 3ZPLA 3L9FA 4RAFA 2DA6A 3H3ZA 2ZXWC 3RQGA 1SAUA 4UB6C 3CCRI 3GZ6A 4HFFB 4UNOA 4G8XA 2Q00A 2K9SA 3BLYA 3ZQVA 3CUOA 2CW7A 1ORKA 4F7ZA 2O8KA 4F3QA 3GCMA 2R7QA 3MQ0A 5COFA 1K83J 2KISA 4CZCA 2R5YA 5BMZA 1IG7A 2BVLA 4IEJA 3V7RA 2JQ7A 2HSBA 5DS4A 5EJCA 4BY1J 3DMDA 2H27A 4YL1A 4ENNA 3EHMA 2IVMA 2IGKA 3CTAA 2E60A 1PUEE 2NRAC 4HEA2 2DGJA 5ILSA 2HPMA 2B7EA 2FRHA 3TBIA 2X9DA 3A4CA 1NG1A 1YZAA 1AU7A 3BRJA 1ZTRA 3HYIA 1B72A 2CV2A 2CGEA 2WAQN 1KNYA 4Y15A 2KSFA 2P7VA 4E7JA 2XRLA 3LSKA 1M57C 3K1IA 1ULYA 1YI2I 4FISA 2IA2A 3QZCA 4XEFA 2NYXA 1Q0KA 5E18F 4LDQA 3RPQA 2GDCA 1YDIA 4MIMA 2R02A 3EHNA 1XN7A 4JBAA 1IXCA 2QEXI 3T0YA 4N6CA 1QA6A 2LD5A 3CC4I 4CCMA 2IOQA 3DPUA 4RM2A 2BVMA 2H94A 1FR0A 4NTBA 5COMA 2H8AA 4Z9HA 3LNRA 3ZTZA 4GDFA 4V2GA 1YTYA 1OXKA 2CYYA 4GYIA 5E8IA 3ONQA 5ICEA 4ZYAA 4F91B 2LF8A 1ZLJA 5FO5A 2QF7A 4JCZA 2HTJA 1I5NA 3X2QC 2IXSA 4DRJB 4RGSA 2R7SA 4CO8A 5DD4A 3GM1A 4HF0A 3U3BA 4HA8A 1V55C 1YYJA 3GWZA 1WN0A 2EK5A 2JUGA 1RKCA 2K9LA 5A2QK 5T3TA 2CSOA 4EM0B 2OOCA 3U1KA 1X1CA 4CYDA 2VE9A 1NZEA 1U0JA 2OG2A 1BA5A 3TJ6A 2A6EF 3MLGA 2AS5F 3W2AA 3ZQFA 1NFNA 2CJJA 1KQ8A 5L0GA 2R93J 4HNTA 1VZ0A 2DODA 3W3CA 5ICCA 1FOXA 2XPWA 1YW8A 2YLGA 1YLMA 1BR4A 256BA 4ESJA 1EH8A 3KX2A 2RAEA 3O55A 1YYXA 2XB0X 2QUFA 2IXOA 3EJNA 3B29A 1TWFJ 2STWA 3CUQB 3UMHA 2Z1DA 3CJNA 4CHUA 3BR5A 2JA7J 4I1MA 2Z9OA 2R05A 3OY9A 5JSLA 3L00A 1F5TA 3DZAA 1TQMA 2QQBA 3QP5A 4P9TA 3ZVRA 1HW5A 1FBSA 2BW3B 4EGYA 4DJ9A 1TZLA 2AHQA 2AVKA 2H1LA 3L2UA 2KGOA 4LK1F 3O3KA 3HXLA 2VJ5A 4C9YA 4MS2A 3RIPA 3JYYA 3W6KB 1HMOA 3RQFA 3GEEA 1AA7A 1SD4A 2P0NA 1EH7A 2WWYA 2EZHA 2QBYB 1RI7A 2DN0A 4LLGF 2E87A 1DGRM 3A1YA 2A05A 2KJCA 4BE2A 3OYCA 2WV1A 1U8RA 3O10A 1RESA 2NS7A 4XL9A 2MYSA 4KBLA 3BTCA 1MDMA 3QPHA 2L4AA 4CH7A 5BQTA 2PBIA 3O39A 1BI0A 1FTTA 2PI0A 5E2QA 4NBQA 4A3KJ 2I15A 2ID3A 2V9KA 5KYXA 3JRMO 4GCVA 4I44A 2QSHX 3B6CA 1YVIA 2DOFA 3CCSI 3TO6A 2X6XA 4CS9A 1HXDA 3BTLA 1SR2A 4KT5C 1YW9A 4PSXA 1QBJA 2QNLA 4IHYA 4JTDB 2KC3A 2M2EA 1QZYA 1W5TA 1POGA 3MN2A 5K0IA 3S3MA 5J4VA 4ULWA 1NU7D 5ED4A 4H0EA 2D45A 1FBUA 3L1MA 4BJTA 5BUOA 4DZJA 2ICWG 1E3OC 2HXIA 5KVRA 2JUCA 1DPUA 1TT0A 3H5NA 3WHBA 3WGIA 1J8YF 5F0CA 4W1UA 2XF7A 5BOXA 1FOKA 5IP7J 2JD3A 1ODDA 3BZ6A 2H7VC 3V5YA 1JJ8C 1AKHB 5F28E 5K7HA 1G3YA 2NVXJ 1T6UA 1T56A 3AQBA 4A5NA 3PUBA 4ZYEA 2Q9AA 4C3HJ 3F46A 4FWVA 3LEOA 1PUFB 3NMKA 5F6FA 1X19A 4BXXJ 1FFHA 1S7OA 1BR1A 2FE3A 1K04A 4XLCA 5GTHC 4KIGA 1H6GA 3H3VK 4XN0A 4NC7A 3ITFA 3REOA 2K3FA 4PDKA 5DM6F 3LLIA 2ELHA 1VYKA 1TWGA 2XAUA 4D7MA 1ETXA 2DPDA 2OEVA 3U9JA 2VASA 3DP7A 4C2TA 3K1PA 3RF3A 1BOAA 3N97A 1FYKA 3F47A 4E6KG 2LF7A 4XSZF 4E7KA 3RZDJ 2DJNA 2YL1A 2Y3HA 4LDRA 4UB8C 4DZPA 4FASD 4KA4A 2Z5UA 3NG1A 3NRVA 4LGWA 1IUFA 2XAQA 4MTDA 3LNMB 1Q1VA 4BYYA 3CQZA 5AGFA 4F93B 5JUAA 1YE9A 5IY5C 2VPRA 1Z3XA 5EG0A 2VC0A 5FD5A 1ZN2A 1MDMB 2VJJA 1QZZA 2JX0A 1VTMP 2LKPA 3S9OA 1Y8RB 1T8IA 1SD7A 3GXOA 3TO9A 1D8JA 4AYBN 2GZWA 1R5ID 2LREA 3GANA 2OKUA 2Q3TA 5EGYA 3S84A 3FXJA 3TGNA 3OIQA 2DMPA 3S93A 3HOZJ 3LQQA 3FM5A 3WE3A 2YQYA 4L5JA 1D1CA 2EIMC 4EM2A 1TC3C 5IT9K 1FY7A 4MTFA 2JWTA 4L0YB 1FMWA 5GP9A 3C8GA 5CJ9A 1M56C 2K02A 3K4NA 2NOGA 3CCLI 3H3UA 2R7ZJ 3CCQI 2L7ZA 2PEXA 2KNHA 3HUGA 4E7ZA 2R7DA 3BY6A 4LDKA 4ENKA 1IN5A 3JAMK 5LGNA 4MTOA 3I4UA 2EPLX 3ULQB 1YARO 2EV0A 3EGXA 5JLIA 1MJBA 3CCJI 4YG2F 3OYDA 3HTKC 2R7OA 1OKRA 3ZQYA 4HDUA 3F8CA 4HF1A 4NUBA 2KZVA 1VQKI 1WJBA 2W45A 2GWWA 1TTYA 3NRHA 4NQFA 1FNNA 5BQGA 1ONVA 1ON2A 3B02A 3SZPA 2DMQA 3K70C 5IYBJ 3HPHA 4Z9IA 2W7NA 1JKOC 1NHAA 2DTRA 2HDWA 4JIOA 4X0RA 4U5FE 1LDJA 2H6CA 2LKSA 2XIGA 3SDGA 3PCVA 2G3VA 4WGZA 1KU7A 4DRHB 2DFHA 1EF4A 4RLQA 2LBFB 2L02A 4ABZA 3BPVA 4CYCA 2H1KA 3FOPA 1V3FA 2QKMB 1IF1A 1E17A 1OCRH 1W7PB 4DGWB 1FP1D 1OR7C 1JPNA 2IS6A 2DCEA 3AG2H 3AG4C 1OYIA 3MZHA 3HGGA 1J5YA 2FOKA 1JHHA 2GQQA 3V8KA 1P7JA 1JAFA 3HRMA 5FKOA 3OA1A 3AOUA 3ZQ7A 3LSRA 2I8DA 4FESA 3FOOA 4YELA 1OR2A 2MABA 4C3DA 1E84A 1WATA 1L3LA 1ORYA 1X1PA 3TW7A 2XLEA 3OL3A 3HHHA 4W8KA 4BQOA 2ADUA 2M34A 2LG4A 2P8TA 4PCQA 4BXFA 3EUAA 4AWXB 1YOVB 2YX4A 3OSGA 2L54A 2J9UA 3EGDA 3IHUA 2E36A 3VF0A 1RKWA 4BDYA 2DU9A 4XN3A 3P7NA 1MGTA 1NLXA 5JLXA 3ZP5A 3GTKJ 1XZPA 2IXPA 1FC3A 3NYLA 2E1NA 5J1UA 2LC2A 3ZDLA 3B0PA 3JTLO 4IHTA 2AWCA 3I3LA 1LIHA 2CUFA 3J81K 2PMZA 4WCGA 2A69F 3MEXA 2LY1A 3W6VA 4ZDPA 3LA7A 3OIOA 4UUVA 2V7FA 1BW6A 3KKBA 2VN2A 1JHFA 2KZGA 2DYRH 4Y3OA 1LFPA 5D91A 3FKJA 5BQIA 3FDQA 4BJ5C 3OYIA 1J2XA 3MWMA 2KFDA 4MGRA 3S2WA 3GFLA 3SXYA 1K6OA 1RUOA 2R5YB 4MVRA 4S04A 3GZ5A 3U0CA 1D0ZA 2MH9A 3PL8A 2KIUA 4ZZDA 1WJDA 2Q9BA 3TOAA 2HPIA 5B1BH 3HSEA 3EYIA 2F6CA 2P5KA 2EFQA 2L9RA 3WTTC 3WG7C 3N24A 2J0XA 1V54H 4HYEA 2DT7B 1OR3A 3CLQA 2L7AA 4OU0A 1TLHB 2AXTC 3SXZA 3GFMA 3M9AA 3LLKA 1I1GA 3F8BA 1WTYA 4I01A 4NHJA 5HS8A 4BACA 1IO2A 2J7PD 2JPUA 3JT1A 3OS2A 3NWSA 2HQRA 1WOLA 3M4CA 2FBIA 1UG2A 2EILH 2PF4E 3BPXA 5J3LA 3FMSA 5TGTA 2ZNYA 3X1OA 1HSJA 1FBQA 2IEKA 5DDGA 5DUIA 1UHMA 2A3SA 3CMYA 3EGDB 3KL4A 4AK9A 2PG4A 4KISA 2GXAA 3RPUD 2YU9J 2L01A 2YL7A 4JZAA 3TK0A 1Y0UA 2HQAA 4A3FJ 3A0HC 3BR6A 2HSQA 1GDTA 2X51A 4U0VA 3TEDA 3MYFA 4BKXA 3AG3H 3DE9A 3FXHA 2M87A 2RNJA 3NARA 2V1UA 5FLXZ 1XWJA 2ASRA 3EG9B 2YL0A 1IZ1A 2CG4A 2STTA 3CD6I 4PR9A 2A68F 2PX9A 2DT5A 3BCBA 4NC6A 1TBXA 4HLYA 2QSGX 3D0SA 3EFOB 2OTJI 2NS8A 4K0DA 1RPWA 4HX7A 1MH4A 3TDUC 4UUSA 3V7CA 3UR3C 2MHRA 2CW0F 4KFCA 4IWBA 4DQ2A 2LSOA 5EZHA 2LBFA 4CDAA 3BG5A 2WY7Q 1CGPA 1VNDA 2QCOA 3KETA 4CSWA 3AJMA 4G6TB 3BCAA 4CZZA 2PNOA 3KP3A 2P61A 3GFIA 4D5CA 5FKKA 3OSFA 3L0IA 4L9TA 4OMZA 5E3NA 3HTSB 1C03A 2ESNA 3US6A 4EJOA 3DTKA 5J1RA 1EH6A 3CCMI 1W36D 1ZU4A 2ZXWH 4LITA 4Y13A 1YRNA 1B68A 1LNWA 1R22A 2VB6A 4A0YA 4GYTA 3LA3A 1Z77A 2DMTA 5CVRA 3R6SA 4OIQF 3AGUA 5L0DA 1FNTc 1SVOA 1T6IA 3S27A 1UFBA 2VE8A 1XC5A 3PO2J 2VXDA 1R58A 5HLGA 2AU5A 1XGOA 3DEUA 3VSKA 3AGTA 4Y7NJ 2KDOA 2UZKA 2NVUB 2J45A 1C02A 1BZ4A 2W9YA 1MH3A 5FFXA 3V5XA 4UUSB 2R03A 2RQPA 4XNFA 4MEXF 2DFIA 1TQIA 2E35A 3TO7A 3VYTB 1BDJB 1UB9A 4XPXA 2DQLA 1A7VA 1B1BA 3PFIA 4XPYA 1VLTA 4N4OB 1O87A 3T6JA 2XPVA 3HOXJ 2CV1A 4CSAA 2X0LA 1WGXA 2ZB9A 2WZFA 4BJ1A 2ID6A 3DBLB 3D5RC 1TQPA 4XLNF 2XSJC 3VYRB 2XSDC 2BY2A 2VT3A 2LFDA 4OWRB 4DBQA 4E18A 2W48A 4ZDOA 4L6RA 2DJIA 2A5YB 1VQ8I 2VKHA 3CEXA 1TNSA 4FCYA 2IP2A 4N4NB 2VBXA 3OYFA 3NKDA 4PJLA 5ICGA 2J8WA 3FF5A 5BPDA 2VC1A 3R7CA 2B0JA 3HPGA 1ZRFA 3OYLA 3FHDA 4XONA 3IQ6A 1P92A 4CXFA 5ERIA 2Z33A 3M4BA 1HE9A 1I6HJ 3JSPA 1ETKA 1SD5A 4NNJA 2ELKA 2KHMA 1YQAA 3HOSA 2XF5A 4AU7A 2W4BA 2R7UA 3E97A 2VBZA 1TKNA 2XS1A 1ZK8A 4RBNA 3QVZA 3AAFA 5IYCJ 1M2OA 4IHXA 3NEUA 3GTOJ 2OTLI 3BJOA 1RJ9A 2ZXOA 4N06A 2HQNA 4ZTFA 2KIFA 3DAFA 2Y3GA 3DFGA 2ZD9A 3G4ZA 1FWZA 3I5PA 1OJLA 1WHUA 2CMPA 2P7CB 4QDLA 3K2ZA 2O9XA 3UMIA 2ZXIA 5L3CA 1MBGA 1VQ7I 1Y1WJ 1TQGA 2F22A 3LFUA 1PP8F 5FCLA 2OCCH 4YFNF 2ME6A 4D1QA 1R7JA 1BOBA 1VFCA 3RKQA 5FKNA 1QGPA 3WAQA 2H8WA 3IKTA 3I56I 4M3BA 2EILC 3T4RA 3LESA 3U2LA 5CVIA 4IHWA 1S7ZA 1LEBA 3G3ZA 1VYIA 3LEVA 4OIOF 3FXQA 2QY9A 4XR6A 1SFOJ 2MH2A 3KLNA 4C7OB 2EPFA 3LAJA 3HHGA 4XQFA 1J59A 1RUNA 3L2CA 1CGOA 4A2UA 1APCA 4A93J 4MVMA 1SVMA 3E7LA 4A6EA 2QLZA 1ZG1A 1F1ZA 2UXNA 4JP0A 5A6KA 1SYQA 1R71A 4HBLA 2JSCA 3ZGKA 2E71A 3KZZA 1Z0XA 2FSWA 2HFIA 1SVLA 2ZJRF 4MW8A 2GA0A 3L2VA 2RSEB 2EPKX 4G12A 3X2QH 2L9SA 2M4GA 2VOPA 3WTUC 2RV8A 2WC2A 3K10A 2V26A 5A6BA 2IBDA 1PD0A 4MNUA 2ZKZA 2QBYA 3WU0A 4E7SA 1W7PA 4G94A 2XROA 3QMKA 2PFBA 2W57A 1ZYRF 2B0LA 1OCOH 4GRIA 3GX4X 4MVZA 5KYXB 4EWCA 3MFNA 2VT2A 3LS0A 1EJ9A 5A69A 4G0HA 5E17F 3OYEA 3DI5A 5L3GA 3LSMA 5GAEJ 1EV7A 1BC7C 1MMNA 1J09A 2MBFA 4A3GJ 4N6HA 4DYQA 1STZA 1U2WA 1XSXA 2GBYA 3ASOH 3DKXA 1FMVA 2AQEA 2YS9A 2BV6A 3GTMJ 1WJEA 2K4JA 1OXBA 2BYVE 2KRFA 3EQLF 1FIAA 2WADA 3FVYA 4EBBA 3ZMDA 4ANJA 2K3PA 1XSVA 3MZ8A 3OV8A 1OYWA 1WCMJ 1SANA 2DLLA 5K7FA 1TWGJ 2ECBA 3EETA 4QIWN 5HNHA 1LS4A 1Q0DA 3F0CA 2BOLA 2HVRA 5F08A 2FBKA 1MMGA 1V54C 2M7BA 3KCCA 4YEJA 5D4RA 1T0FC 3NMJA 3WGGA 5K5OA 2H7OA 2CDQA 3SYNA 4B3XA 1LM3B 1ETVA 3LSJA 1WWXA 5LHGA 3L34A 4XRSG 3MMYB 4PFOA 2O6GE 4B43A 3PJRA 3G1MA 2FF4A 5CVUA 2A6TA 3DCFA 4MTEA 1YO5C 4WJ0A 2X1CA 4HZFA 1A6QA 1TWCA 3ZR8X 5HLHA 3CDHA 2Y3BA 1LE4A 5E20A 3FXLA 2H6BA 2E1CA 3DKYA 4KIBA 1SAXA 1P7IA 4CICA 1WZ2A 1M1EB 1EI7A 3R2PA 3CCYA 1WSUA 1S6LA 4JRZA 2KK1A 2XASA 2CU7A 1G8XA 3OOUA 3W2WA 3GWNA 4XLPF 2MC4A 4K2EA 4U87A 5GADJ 1S8NA 2D4UA 2A61A 5CPRB 5E8GA 4BQNA 4WABA 1NH3A 2MD5A 1P6RA 2EFPA 4L9NA 4ESFA 4IRUA 2KLOA 1RXQA 1E2XA 4PGGA 5F64A 4AM3A 1N78A 4HX8A 1YA7O 1WPKA 3K70D 3HIFA 2NNNA 3OS1A 2EH3A 2E2IJ 5AC4A 5D5WB 4XLHA 1SFXA 3FWEA 3ABMH 4D0PA 1I4YA 1OFCX 3HJEA 3S14J 4LIUA 3I9V2 2WTEA 1UJ8A 3AQCA 2RREA 2R0QC 3V7OA 1WKMA 5HDGA 4DNCA 5JR3A 4UDVA 2K7LA 3ZQIA 2LY2A 2Y9YA 4HV6A 5H2FC 1GVDA 1QPIA 3K7AJ 4IGGA 4LB5A 4XIDA 2ETSA 4EHPA 1CF7B 4IAOA 3COAC 3G1OA 3CQZJ 5KCMA 2LCHA 1J7KA 3KP7A 1G3TA 4HQEA 4Z6YA 1SFUA 1PUFA 3WHNA 1FSEA 4CCJA 5FKMA 1Z05A 2P5VA 2E19A 5DM7F 3M4OJ 4ZC3A 4PJJA 2Q0OA 2XLOA 3C7JA 2EJRA 2GIVA 3EPVA 3FAJA 1MD0A 2WAFA 1S3JA 1H7IA 4D5FA 3QODA 1H9TA 1QNTA 2FNPA 1U89A 3FM3A 1MSEC 4N9HA 1VOMA 3Q0WA 2Q8KA 2QKLB 4LG3A 3PUFA 3R0AA 1U6GA 2G0EA 1XSDA 3JRAA 4ON0A 2DOEA 4XM3A 3ZG1A 1B4AA 2J5PA 4YT8A 3ZN1A 2BXYA 4O6MA 2YLDA 3MCZA 4CBEA 4Q4ZF 5JVTA 1MIJA 5EEHA 3JREA 1PP7U 4B09A 5TRDA 2V9VA 1XS9A 4BEMJ 5ICFA 1SMYF 3DXJF 2A0UA 1OCRC 1TWAJ 2YKZA 4J30B 3FXMA 5COGA 1DGWY 3BTIA 1F43A 1IXRC 1S9HA 2EWNA 5D6EA 5JFRA 5B66C 1WASA 3V4GA 2P81A 3S2DJ 2R3SA 2V4JC 1PV3A 3TW6A 3LJBA 2XAJA 3I54A 3NYJA 3VRCA 1W4MA 1Z3IX 2Q2EB 2CNWD 3GW2A 5D5VB 1HKSA 1WH5A 1NU9C 5J47A 3R60A 3OYKA 3TP0A 2D5VA 1JT0A 3V8JA 1Y56A 3BROA 2UWMA 4HG2A 5FFZA 3NWTA 1ETWA 4EM1A 4J01A 1K78A 1LFBA 1S7AA 1KU2A 1IDYA 1V55H 1WH7A 2KRCA 2G3KA 2LD6A 1M6TA 1XGMA 4R1HA 4LERA 2DQRA 1LDDA 1ZRCA 3RJPA 1W0TA 1OKKA 3BR1A 1T39A 4G78A 4EGZA 5JHFA 1NSGB 1DP7P 1MMAA 3AL0C 2CO5A 1YAUO 3HBLA 1R36A 4B8XA 2VPLA 4JURI 1UHSA 4BJ6A 2CW8A 1BN5A 4G7HF 3VSLA 1ZHFA 3TP3A 4IQ4A 3FAPB 1X4PA 4CCKA 5HDKA 2ZXRA 2OCCC 1DQUA 2W82A 2XLWA 2RNGA 3JRTA 3JR9A 2LP4A 1UG7A 1GM5A 3VODA 2P0WA 4CIPA 1ZHXA 1BI1A 1OISA 4I02A 2Y75A 3WG9A 2HV7A 1GV5A 2DYSC 3M1CA 3WG7H 1YFHA 1OPCA 5GAHJ 2WZGA 2HKXA 3Q0UA 4X1EA 1T01A 3GODA 3UMKA 4XLAA 4RAYA 1UCRA 3LUTB 3KYJA 5DCFA 2QENA 1B8IB 2J9WA 1LB2A 1S05A 4FAPB 2L3DA 2XUBA 5J1YA 2Y0SN 2K9MA 5CLSA 2AWYA 1U5TA 1W1WE 4LFUA 3C1DA 1SD6A 3RTRA 3EZIA 2TRTA 1ZH5A 3PHF2 2J0WA 2VH3A 2W4SA 3S17J 1JPJA 5HDNA 3TDZC 2W25A 4LIVA 1O3SA 2OPTA 3FMRA 2EZKA 1B9NA 2J7PA 4E0HA 4GO1A 5DS5A 1V5GA 2VODA 2HJ3A 3TOLA 2IRFG 2PLYA 3K4CA 3KYCB 4D4XA 5J8FA 1O3QA 4CUGA 2CGPA 2WA0A 4U88A 3ZIBA 2L9JA 3BR3A 4XOPA 5KAIC 4XLFA 3IV5A 4IJJA 2E1MB 3G2BA 2HEOA 2W84A 3ROUA 4HSRA 2VCCA 1IRFA 1CF7A 1W2WA 3C3WA 3BG3A 1IRZA 3ERED 2H8RA 1GXPA 2Y69H 3BG7A 2O3FA 3DEEA 2KT0A 1NFOA 2E2HJ 3ZMZA 3A03A 3F8NA 4XKBA 4JOMA 4IB4A 5JI6A 2VI6A 4V2FA 4YIIA 1ZREA 5FLXK 4P55A 1XGSA 3J06A 2XB5A 1WJFA 3PSIA 2BY0A 3DLAA 3IL2A 3QYBA 1AOYA 3AG3C 5FLMJ 2LMDA 2HOSA 2PJPA 1HA8A 2R7FA 2IS4A 1A04A 4B47A 4HRIA 1BJAA 1K79A 3SNHA 1X1AA 1X2NA 4AL1A 4BH9A 2LFFA 3JRCA 2V1XA 4YFKF 3S1RJ 1A5JA 1A41A 3O6XA 2DA7A 5AC5A 5F5HA 1UZCA 1LPEA 4R79A 4ZYGA 2RD9A 4E7IA 2LYCA 5CQGA 2PX3A 3HKZN 3LSGA 4CS9C 3QPTA 4HSTA 1OCPA 1U5TC 4IZZA 1ZVZA 4U0YA 4P5OA 1TWHA 4X0GA 2HZ8A 4F4BA 2IGNA 1Y0NA 1I1SA 2OQGA 3E6CC 2GAQA 1LE2A 3NYMA 2GLOA 2L81A 3OEOA 3FBIB 2X85A 2DA3A 1YRNB 2XSEA 5F5FA 3ZQGA 1D3YA 1JGGA 1ZW3A 1ZG3A 1H0MA 4YT2A 3M1CB 1ZHYA 4L0ZB 2A6HF 3HKKA 2M45A 1JKQC 4OMYA 2KPMA 3RKOF 4DVZA 4BUPA 3HRUA 1K6YA 2QUPA 2DPUA 3H0GJ 5FRMA 1NG7A 1L3PA 4M74A 2K86A 3P5JA 5JT4A 5L3VA 1T33A 2PJRA 3QVYA 1ZKGA 3TOBA 2DA1A 3LAYA 3VFZA 2XKPA 2ZJ2A 3GVAA 5FRNA 3W8IA 4C3BA 4BE0A 4IRIA 3Q7LA 4EQQA 3C18A 3ZRGA 2DYRC 3H9JA 3SFZA 1I50J 2PJRB 2VONA 3B0VC 3EG9A 4A3CJ 2LRDA 5DCMA 2NVYJ 1LI7A 1CQTA 4BEHA 4R8HA 4K1OA 2CUZA 2D1VA 3S1MJ 1KYWA 3FXKA 3HOVJ 2KIMA 3MZYA 3CESA 3RDIA 4ZH4F 5D4SA 1XCVA 2EFWA 5TJ5E 3LSIA 5CI9A 4E17A 2MLGA 2E7XA 2RDPA 3G1LA 3KFWX 3SHFA 4AVPA 3ML6A 4MVSA 3E3VA 3EUHC 2LVSA 1JXSA 2FXAA 2RC4A 4YL0A 1T08B 2F5CA 5DYMA 5A2QZ 3VAYA 5F0FA 2VJIA 2MGQA 3A01B 3A0BC 3HG9A 4AIKA 1FZPB 1EA3A 2G9WA 9ANTA 5KYWA 4RB0A 1ZGAA 2YL3A 4KNVA 3BQZA 4OIPF 1IN6A 2HVSA 1JUMA 1OCZH 4H4KC 1R1UA 5KYUA 4OD4A 4LLNA 3ELKA 1O7LA 4P1WA 2DB4A 4U0WA 3K7DA 2PMUA 3RPUA 1ST6A 2R5ZA 1OLTA 1GS9A 4EJUA 4JX4A 3CP2A 1K61A 1WVRA 1SF8A 1LUJB 4IAQA 4C2MJ 2H09A 3T8RA 4BE1A 4XKWA 3F8FA 3B9QA 3HC7A 1JUSA 2NVTJ 3ZTMA 5DEQA 3ZQQA 2VXZA 1F9NA 1N77A 2ESHA 3S3OA 4DBRA 2H7BA 3NAUA 2JSPA 1WI3A 3OR2C 4O7GA 2WB1A 4Q48A 4E4HA 1PYVA 3I64A 1A7DA 5H6RA 2XV4S 2WB1N 4OINF 1IXSB 4L9VA 1S72I 3WU1B 1IUYA 1V4RA 2ELJA 1JJ6C 3CC2I 4LG0B 3W6JB 1WFXA 1Q0FA 2PFDA 2ETHA 4HNUA 1TL8A 1R4MB 2F48A 4UVBA 1QRYA 1T2KA 3KYLA 4D9JA 2CQ7A 1WQ2A 2YRFA 4JC7A 1AEPA 2GOXB 3U8VA 3FZVA 4MVUA 2YU3A 1R23A 4BHPA 3GTGJ 2ZC2A 2Y31A 3H92A 4PGHA 1VB5A 1ETOA 4HEAJ 1F36A 3MKLA 4MNDA 3LFKA 1XPXA 1B8IA 3WGHA 4LACB 1Z9CA 2NVQJ 4JTAB 1ZW2A 2VBYA 1Y1VJ 5GPCA 1XX5A 3S2HJ 3WU2C 2EZIA 4F55A 2VL8A 1LDKB 1ZGJA 3ECHA 3F23A 2M8EA 4ZTJA 1EKYA 1OCZC 2C6YA 2OUMA 2KRHA 2XLHA 3K4MA 4QI2A 4IHSA 2MD0A 4IJAA 2OU6A 1IN4A 1LKXA 4AC0A 1UMQA 4KMFA 5DV5A 1DOWA 2MWQA 4MW3A 1GT0C 4JW1A 5LBQA 2DFFA 5HVQC 2VOOA 1ZHWA 1MBFA 2O03A 3I55I 3OS0A 4BL0B 4HAMA 2BHZA 3BEHA 2CQXA 1IN8A 2D2WA 4BAYA 5TJJA 4KDPA 4XQ1A 1Z5ZA 3DPLC 5HNFA 2UUZA 4DXWA 2R7RA 4BJ5A 2WY8Q 5FZTA 1E3PA 1RR7A 1ZR2A 1BW5A 5AIPA 2XL4A 1E86A 1G2HA 4GXOA 2HI3A 5C4XJ 1Z91A 1TW3A 1HBXG 4HOBA 3QWLA 2M4KA 3SZRA 2IJLA 2YVKA 4IKFA 2OD5A 3BC8A 3KP6A 2NSFA 3ESWB 1P9QC 4IL6C 2CV0A 4OD5A 3NMIA 3BJ6A 1RETA 4DYRA 1QVUA 1OW7A 5B1AH 1OKKD 1YS7A 5KHDA 4A3JJ 2HR3A 2IW5A 3IKVA 1BC8C 2QLAA 3TL4X 4JVSA 3GZNB 1OW6A 4MFDA 5D8KB 2Y48A 2IAIA 4BJ6C 1ZR4A 2BXZA 4I3MA 3ZQLA 2K40A 4W8PA 3EYYA 2CFXA 1NK3P 3H36A 1EA8A 5DLJA 2L9VA 2LFBA 1Z6RA 2ZNZA 4ZYDA 2Y0SA 3CMMA 3KEOA 1S5LC 2HZTA 2GXBA 1OCCH 4J7YA 5B1BC 2ZSIB 4L5IA 4ZJZA 2EIJH 4LLEA 3ASNH 5M5XJ 3LL7A 3E6DA 1IGNA 4RD9A 3I58A 3ZCOA 4M3DA 2JMWA 5F04A 2ZXHA 3TD7A 5JVGF 3JTGA 3J80Z 2UUHA 4BU2A 5KYYA 4L18B 1K05A 2D5RB 1YJGA 1XDUA 5FGMA 3JRBA 4YK5A 3A2KA 1FPQA 1XZQA 2X4HA 4C2UA 2DW4A 1MNEA 1JMWA 3W8HA 3GTPJ 3F22A 3H9GA 4EEFG 5F1JA 3GLLA 4XK4A 4A3DJ 1KU3A 1OW8A 1BI3A 5KYNA 4TV7A 3TKYA 1IAWA 1R4TA 5EDNA 3CDLA 2QYOA 5DUKA 1D1BA 2XKOA 3ABLC 4PZJA 2VCBA 1T38A 4GYGA 3GFJA 1L0OC 1C17M 4LK0F 1FJLA 5LEKA 3GWLA 4EATA 4FE4A 1YJ9I 3RVYA 1NTCA 2K9QA 1FEXA 3HTUA 4EJVA 1ORSC 5H20A 4P96A 3RKXA 5DTDA 5LD2C 1YLFA 4GFBA 1E0EA 3SEZA 2FGYA 2E1OA 3FHNA 5EYRA 2WBMA 5L3QA 3KP2A 5KAFC 1A36A 3PQKA 2O5RA 2VCAA 3UGPA 2XHKA 1WJAA 2JRTA 5CKTA 5ILVA 1J0RA 4MHGA 4RB3C 4GEHA 4UXNA 2HYFA 2RN7A 3U1DA 1Y6DA 1I27A 2MSYA 3ASNC 4J32B 1MBKA 4I98B 2CUEA 4PFPA 4CYCB 4KN4X 4BBSJ 4PK4A 4B6IA 1OQYA 1ON1A 3C2HA 2ISZA 4UY8I 2Z99A 3CLOA 3F3XA 4E7LA 3VYUB 2ZJQF 5D5XB 3F8MA 5IOYA 4E0IA 1HLVA 1YG2A 2G7UA 2TDXA 4LD5A 3ZN0A 4M3EA 2WB7A 4MVQA 2X6WA 3G73A 1OYYA 3EUKL 3WE2A 3ATPA 4C3IJ 2E2JJ 1DU6A 1R4NB 3RQ4A 1HSTA 3QOPA 4MQ9F 4A0ZA 2ZBKA 1Y39A 3V8LA 3DAGA 3U2MA 3S8PA 4P9FA 4WXDA 2HJMA 2HV6A 3ERMA 2YHSA 4U5GA 2YR2A 3HKZA 2FQ3A 2FQ4A 2DA4A 2WV0A 2VKEA 2MC3A 4XRSA 3T6BA 3T6GB 1ZGWA 2XS8A 1U5TB 4HF2A 3KIOA 4WX9A 3ZC4A 4QI0A 1R6RA 2EIJC 5A6BD 3ABTA 3LS1A 1KA8A 1G4DA 2M7AA 2GOMA 1VI0A 2DI3A 3IH2A 1E85A 3BG9A 4JEBA 3HNIA 3GBGA 4I09A 4IOAF 2EPOA 2HKVA 3KE2A 3J7YJ 1VTNC 3P9KA 2HOEA 3BR2A 2OF7A 2B63J 2NUTB 1Z21A 1R1VA 2K4BA 2XF6A 1JKRC 3T9OA 4RGXA 1N75A 3N05A 4YRVA 2GA2A 2ZXJA 4KC9A 4BDZA 3PFYA 4IRHA 2Y39A 1D1AA 4CCOA 2P6VA 3DTEA 2VKDA 5EG0B 2HVQA 1ETYA 1RRJA 4KN7X 5JVEA 1SZIA 4BEJA 1XB4A 1SFEA 3DWLE 4C30A 4C3JJ 2GFHA 1GV2A 4ENJA 1KQ0A 5C4JJ 3PIOF 4EKWA 3ZOBA 2EA4A 4JJGA 3DKAA 2KYHA 1KU9A 3I5UA 1XMAA 5F1RA 3JSOA 1TNTA 2XLDA 5M3FJ 2NUPB 2EFNA 2LK2A 5H6QA 1ITYA 2IYLD 4CS8A 2ZFWA 1LPQA 3AG2C 3LQRA 4DRIB 2JA8J 1IV6A 2XAGA 4AX2A 5EEGA 1HCRA 1ZRDA 3HSFA 1G4WR 2M4EA 3H9QA 3DJNB 1QU3A 4ONSA 4Y4RA 3KYIA 5B3SC 3C8GB 2TCTA 4EJTA 1HW2A 3JTHA 3QU3A 1APLC 4A4AA 3EH1A 4JK1X 3EFOA 1WRJA 3VYSB 2EPNA 2QQAA 1TWCJ 1X1BA 3J7ZI 4ER9A 3D5LA 2FMLA 3BDDA 5E79C 1WGWA 4MLOA 2J9VA 3GTJJ 1H88C 1H89C 3ZMSA 3MFKA 1VMAA 4W97A 1XGNA 1Z7LA 1Z7Qc 4I0AA 4NTAA 3ABUA 4RLFA 3L8IA 1Y8QB 2XPUA 5LFAA 1UFMA 2YPRA 5E1WA 5D5UB 5B1AC 2DMNA 1X1DA 4ENMA 2K85A 1IDZA 2FX0A 3DV8A 1HY5A 2QE9A 4M72A 4U5HA 2DT6A 2L2OA 4D7NA 2Z3YA 4UUTA 3AG1C 5B3SH 2HWVA 1H9GA 2ZJPF 1MZBA 5EF6A 3IRQA 2C03A 1HDDC 5D92A 5BQHA 2EA2A 1HDPA 2HYJA 1TT5B 4JEAA 2DDAA 1HMDA 2FA5A 3QP6A 1FYMA 1PCXA 1I39A 3DM9B 1X3UA 3IEEA 4CIHA 4FE7A 1DU0A 1LI5A 3DEWA 4WF2A 2F4IA 3L1PA 4XBFA 3DD7A 3GEIA 3ZXSA 2F5EA 2EIKH 5TISC 1I4ZA 2MW8A 2KL4A 5K5QA 1EKEA 1ZHTA 3K4BA 5IY5H 2NXNB 5L0IA 1QVTA 4EBKA 4J19A 4YFXF 2DK5A 1V5EA 2XRNA 4EV0A 2IA1A 3MVPA 3N4MA 1GHCA 5IOZA 3N0TA 4HX4A 1T98A 2L5QA 3ASOC 1F1MA 5JP7A 3M1EA 1I3AA 4PJMA 1FIPA 2B0HA 1P4XA 3AG4H 4MTGA 4P6IC 2ECCA 4JX5A 4LOCA 4PJNA 3R4KA 2ZMEA 2KJBA 2UV1A 3S90A 1YJWI 1LVKA 3K1HA 4BHBA 4L9JA 1U3EM 3KP4A 4HE8D 3I53A 2XDVA 1SFKA 4M6YA 1QPUA 4Z2YA 1D0YA 1TP4A 5F0HA 1TFOB 3DE8A 4AD9A 4JE9A 2QWWA 3U9GA 2HGCA 4FX5A 1LVAA 4A3EJ 1DOVA 2WZLA 4U5EE 4A6DA 3JRGA 3RQEA 2HXOA 4IO9F 4WGYA 2LQGA 2DAOA 2NUPA 2HU9A 5EEAA 1S29A 3M3YJ 2XRHA 5DD8A 2Q1ZB 3QYFA 3CZ6A 1IRXA 3I0TA 3I59A 2P5LC 2JVGA 3JRHA 1Y6IA 1XDSA 4U7BA 2XLVA 2A1DD 4XLEA 4Y33A 1Z6AA 3K6BA 3CMAI 4AIDA 3SZTA 2JZYA 2EZLA 1QKRA 2CCYA 3GM2A 2BGCA 2EBIA 3JRFA 2LIGA 3DKWA 3IC7A 1ZU5A 5EHHA 4LLCA 3EZHA 3H0DA 5KNLA 2WAEA 2Y3DA 3HJCA 1MBEA 3CJQB 3ZMTA 1PD1A 4UVCA 4KUMA 3T1BA 3FK6A 1ETQA 1D5VA 4U5BE 1O3RA 2IS2A 2LY9A 3K1IC 5DQZA 1QZEA 4HW0A 4IHVA 3EGXB 1YX5A 1QHHD 1T95A 2FMYA 3F6VA 4FQGA 2PBEA 2YSRA 3HUGB 2A07F 2P6TA 3DU6A 2HQ5A 1OR7A 2Y9ZA 1G4US 5DQTA 4BS9A 4CSAC 3UKGA 3A11A 3I59B 1YYVA 4IVNA 3K4JA 3NKEA 1T5OA 3GEZA 3K0LA 1T6SA 3K9TA 5M5WJ 1HOMA 4KI2A 1FTZA 5F27A 3V42A 2JPBA 3L2WA 3H1CA 2NUTA 2OQMA 1JE8A 1FSHA 2WL8A 3A9CA 2KQRA 2M9HA 1RCPA 1KONA 2OZUA 2JVHA 1K4SA 4Q5SF 2VC9A 4JJFA 3G71I 3RVZA 5M3MJ 2M5WA
chains in the Genus database with same CATH topology
2OJED 1R5ID 2ICWG 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OJE D;  1R5I D;  2ICW G;  3KPH A; 
#chains in the Genus database with same CATH topology
 4O6J A;  3ABK C;  1B59 A;  2XGC A;  2IA0 A;  3POV A;  2PMZ N;  3OR1 C;  2NS0 A;  2W24 A;  1QQI A;  4BXU A;  4AIJ A;  4NTF A;  3MYI A;  3LOC A;  4ZDL A;  1OQC A;  3DQV C;  1YIJ I;  1FFT C;  1WJC A;  5J40 A;  3F72 A;  1FLI A;  2HTS A;  2LH9 A;  3OYG A;  3QPS A;  2MFZ A;  4R32 A;  1YHQ I;  2R7X A;  3V5Z A;  4CJG A;  4YN0 B;  2VBW A;  3I71 A;  3QQA A;  4E7H A;  2LDU A;  3ISP A;  3HLZ A;  4FX0 A;  3KMI A;  2E7W A;  2NAZ A;  2VQL A;  3AG1 H;  3E6B A;  1K7A A;  3FIS A;  2DOA A;  4OAZ A;  1OCC C;  4ZYH A;  3C8Z A;  3ZMV A;  3RI4 A;  2ZME C;  2F4O B;  3O6B B;  2DA5 A;  3SDB A;  4UVA A;  4BQA A;  3L2Q A;  2F5D A;  2QGU A;  1W0U A;  3PMR A;  1G3W A;  2V6E A;  5E1X A;  2ZPA A;  3Q0V A;  2FAP B;  3S3N A;  4QWQ A;  1OCT C;  3Q7G A;  4BQQ A;  2BBY A;  4G6D A;  4I6Z A;  3IQ5 A;  1KGS A;  2IM8 A;  2OCE A;  1ZAO A;  4ULV A;  4D4N A;  2ZME B;  5FRO A;  2BL2 A;  4J00 A;  3IQT A;  4M9S A;  3BOQ A;  3KP5 A;  2MLK A;  2OJE D;  3WTW C;  3M8E A;  5IP6 A;  2V3C C;  1J8M F;  3ZWI A;  2QTV A;  5FB2 A;  3QW0 A;  2FOW A;  4XRM A;  2HOT A;  4Q47 A;  5J4Y A;  5E3C A;  3KEQ A;  1JRA A;  2IPQ X;  3SQN A;  2XGE A;  2P6S A;  4AUX A;  4RB2 C;  2EQR A;  3PM1 A;  2WVQ A;  3HM5 A;  2O61 A;  3FMQ A;  3WTS C;  1P2F A;  4QSH A;  3S1N J;  3QAH A;  1JI8 A;  1T6Q A;  3H65 A;  4GQH A;  4IXA A;  1GQA A;  1RC9 A;  1M2V A;  1VF9 A;  2RVC A;  4L5E A;  1V74 B;  3S1Q J;  2PQ8 A;  1R5H A;  4I7H A;  1KTM A;  2R5Z B;  1USS A;  1CPQ A;  1OCO C;  2XLM A;  5LEJ A;  1G5Z A;  2NPU A;  3PQJ A;  2C04 A;  2K9N A;  2L7M P;  2D1H A;  2VKV A;  2YUS A;  1D0X A;  2P1A A;  1A6I A;  2DYS H;  3M8F A;  4ITV A;  2EV5 A;  3CCE I;  4PAC A;  3EDP A;  2QQ9 A;  2JA5 J;  3KZY A;  4ZZL A;  1WI9 A;  4F92 B;  3WTX C;  3CCV I;  5KYW B;  3JAM Z;  2F5V A;  2DTZ A;  1K78 B;  2CQN A;  4A3M J;  2UXX A;  2CWE A;  3RZO J;  4AIH A;  2DMU A;  1LFU P;  3FIW A;  4AYB A;  3JCU Q;  4WXC A;  1VQ6 I;  5HSW A;  3RYL A;  3B0U X;  2M0C A;  5BNG A;  2W00 A;  1R5G A;  3HGY A;  3K6G A;  3VYW A;  2XGD A;  1RMV A;  1ORJ A;  3S32 A;  4XTK A;  4IRG A;  3RKY A;  5HOD A;  5J8C A;  1I3Q J;  4CCL A;  4CCN A;  3IPM O;  4YIR X;  3GF2 A;  3HOW J;  4XWJ A;  4RBO A;  2R25 A;  3W4Y A;  2M0M A;  1WJ5 A;  4DJA A;  2YZS A;  3D5S C;  4XKV A;  4ZLC A;  1RZ4 A;  2FU4 A;  2CFO A;  3VWB A;  1MJA A;  3IH3 A;  1ZHZ A;  2CS3 A;  4II2 A;  1LE8 B;  3M79 A;  5EZG A;  2ZCW A;  2V6C A;  1FOY A;  1Q1H A;  2W85 A;  2YLI A;  4XOT A;  1GVJ A;  1FT9 A;  2VQH A;  1RR8 C;  6PAX A;  4MFE A;  4RDU A;  3Q5F A;  3E5X A;  1C0W A;  1MSF C;  4PJ0 C;  2R7T A;  3ECS A;  3SEO A;  3C2G A;  2XM4 A;  4YT4 A;  3QOE A;  1VQP I;  1U78 A;  5HLT A;  1K40 A;  3U8P A;  1A35 A;  1FYL A;  2PP4 A;  3OMY A;  5EK0 A;  2RGV A;  1HQC A;  3CSK A;  2O0Y A;  1IW7 F;  1CGM E;  3DTI A;  3VPR A;  2MG4 A;  4QPO A;  4II3 A;  4CGZ A;  4G7O F;  3K69 A;  2CH0 A;  3L7W A;  2OZ6 A;  4I0B A;  1KZH A;  2BC5 A;  5A6A A;  4BGD A;  3OYM A;  3HDD A;  4BY7 J;  2FFH A;  3CC7 I;  3C8G D;  2V1D A;  1R00 A;  4NCQ A;  4WK8 F;  4YL3 A;  2X0C A;  3SXK A;  3PSF A;  3K4L A;  4OOI A;  5FKL A;  3AKZ A;  3DWW A;  1F4K A;  5IT9 Z;  3HNJ A;  2NOJ B;  5E3L A;  3ABK H;  2XM0 A;  3BTJ A;  2LKX A;  5L3E A;  4BBR J;  3H5R A;  4CS8 C;  3QYE A;  2R92 J;  3U9M A;  1GXQ A;  1BBH A;  4N9I A;  2QA4 I;  1G59 A;  1AWC A;  3GYH X;  1HKT A;  4FHT A;  2W4M A;  3L2R A;  5D8L B;  3N2Z B;  1XTA A;  4KIF A;  4LG0 A;  2Z15 A;  2A5W A;  1E3H A;  2UUI A;  1R9T J;  3QPL A;  5CVV A;  1HE1 A;  2OQR A;  4B48 A;  3O8H A;  2QM3 A;  4EVI A;  3QRF F;  1B9M A;  5L3D A;  3E5U A;  5L3F A;  2L6H A;  4O79 A;  1O7F A;  2XAH A;  3SEQ A;  2JT1 A;  3FXO A;  4UHT A;  1ZEL A;  4G9Y A;  4CDG A;  2HNH A;  3L09 A;  2J5O A;  2RKH A;  4KNY A;  4AL0 A;  4Z9J A;  4AVZ A;  2KQ9 A;  1BR2 A;  4RA2 A;  4IAR A;  4WXH A;  1AKH A;  2J46 A;  4FT8 A;  4N0B A;  3PIP F;  1Z7U A;  2DDB A;  3IWZ A;  4WWC A;  4BNC A;  3R61 A;  4BHC A;  4RAZ A;  2QVO A;  2BHY A;  2JA6 J;  1W5C C;  2IXM A;  3M07 A;  1GGQ A;  4QTR A;  3S29 A;  4KIC A;  3DBH B;  3WTY C;  3H5A A;  5GPA A;  2ME0 A;  1IZM A;  2KMU A;  1AHD P;  1TWA A;  3SYT A;  3BJA A;  2LK4 A;  4CA0 A;  1VQ5 I;  5KYY B;  1IC8 A;  2PMH A;  3ABL H;  2I5U A;  2VQC A;  1LJ9 A;  2GWR A;  4V19 K;  2Q7R A;  3VM6 A;  2Y30 A;  4DIQ A;  1Q0M A;  1ACI A;  1YA9 A;  2F5F A;  1QZX A;  3FBN B;  4XEK A;  1TW2 A;  2V9P A;  3GM3 A;  1D5Y A;  3J7A Y;  4XIC A;  3I4N J;  4I1O B;  4Y52 J;  5B5E C;  1ZG5 A;  2EB7 A;  2KIQ A;  3Q9S A;  2ZO4 A;  1A31 A;  4IF4 A;  5HOO A;  1Q0G A;  2YEV A;  2EFO A;  1ENH A;  3GO5 A;  3U5S A;  1U0B B;  2XXA A;  3PNV A;  5FD6 A;  3ZQC A;  1SEU A;  2BEO A;  3L8J A;  3SJM A;  4NY3 A;  4EUK B;  2LTP A;  4A5M A;  3FXU A;  3UNG C;  1XMK A;  4IOC F;  4X6A J;  2L9N A;  4NQW A;  1JT6 A;  3HOU J;  3B71 A;  3G4S I;  4OIR F;  3FK7 A;  5J6X A;  4BPM A;  2E5N A;  3KEY A;  1QSP A;  3VB2 A;  1BM9 A;  1IV8 A;  4M71 A;  2BW3 A;  3GLX A;  5HS9 A;  2YWA A;  1X2M A;  1A7E A;  3K1M A;  2IGM A;  3BZC A;  1CPR A;  2LLK A;  1Y4C A;  2CNW A;  4P9U A;  4U9D A;  1RKE B;  2OC6 A;  1JKP C;  3GUD A;  3CUQ A;  3CO6 C;  3JZ0 A;  1WWP A;  4HFK B;  2X6Y A;  3SXM A;  3MKZ A;  2VLA A;  1QHG A;  1HC8 A;  3CME I;  3MKW B;  1DPR A;  5IP9 J;  4BG0 A;  4I99 C;  4FET A;  1MJ9 A;  1G6N A;  1XG1 A;  3DF8 A;  2ZSH B;  4G6Q A;  1EQ1 A;  4MVO A;  4M6V A;  1QQ3 A;  2R7W A;  4C7O A;  2BY1 A;  3C2B A;  1K4T A;  4M6X A;  1SC7 A;  1E83 A;  4B44 A;  3U2R A;  1PJR A;  2R7V A;  2QZ8 A;  3TJ5 A;  3C63 A;  1X58 A;  4N4W A;  3M7G A;  3PNY A;  3T5X A;  3IRR A;  1QVX A;  2LR8 A;  1TR2 A;  4I76 A;  3RYP A;  3Q6N A;  1X4O A;  2HDD A;  2N8G A;  2IT0 A;  3LST A;  4IPA A;  1MW7 A;  3E70 C;  2FJ1 A;  2L4M A;  2OEX A;  1V4A A;  3T8T A;  3IP4 B;  4CDY A;  1LEA A;  4FX4 A;  1BL0 A;  5JS5 A;  2JJ7 A;  1ZLK A;  2MA3 A;  4RGR A;  3CAX A;  1FOW A;  3OL4 A;  3PNT A;  4O5V A;  4HPQ A;  2OBP A;  3MKY B;  3BG6 A;  2L6F A;  2XL8 A;  4NC3 A;  3WTV C;  2XC7 A;  4RDA A;  3ECO A;  1DDN A;  4KT6 A;  4A3I J;  2HUJ A;  3BR0 A;  2EV6 A;  3ZQH A;  2V79 A;  4M73 A;  2FBH A;  1IJW C;  3Q9V A;  2VUM J;  4DYC A;  2DO7 A;  2NNY A;  4IQJ A;  2HMZ A;  3QW1 A;  2L6G A;  2EIN C;  3CDI A;  4KMU X;  3E1S A;  3I4P A;  4JCH A;  3E6M A;  3MBG A;  1JUP A;  2JRM A;  3Q6M A;  1HKQ A;  1SMT A;  3GTL J;  2IXN A;  3PO3 J;  4JYK A;  2P7V B;  4KYW A;  4O6N A;  2HMQ A;  4A2N B;  1D8K A;  3ZSU A;  2OAZ A;  2GXG A;  2KW3 C;  3CF5 F;  5L0F A;  4O6Y A;  1JOG A;  3K33 A;  2E1M C;  5E3O A;  5LRR A;  5E3A A;  3O8G A;  4XOR A;  2BY3 A;  3CP8 A;  1MND A;  2Y2Z A;  1MMS A;  4JKV A;  1NG6 A;  3M8J A;  1ZAR A;  2O7O A;  3JW4 A;  4OAY A;  1J9I A;  3KZI C;  4XMY A;  5DVW A;  3O2P E;  3Q3S A;  2DA2 A;  1MNM C;  1N25 A;  1FAP B;  2Y69 C;  4Y17 A;  1VQM I;  2XVC A;  5JLW A;  3VOE A;  1LQ1 A;  3M15 A;  2KKO A;  1Z63 A;  2FD5 A;  3U21 A;  3GTQ J;  2A0B A;  3OOP A;  1H8A C;  2G62 A;  2COM A;  5CVJ A;  3J7A O;  4HV5 A;  1CGN A;  1YS6 A;  1ZQ3 P;  1QPM A;  3LA2 A;  4KIT B;  5E3M A;  3FDY A;  1IRG A;  3OWT A;  3JCU C;  3DU5 A;  3S0X A;  2AQF A;  5K7Z A;  3DBR B;  2HOA A;  3CUQ C;  4YJW A;  4M9X A;  5EGO A;  3BWG A;  4XEV A;  2FUG 2;  1HW1 A;  2RQQ A;  3TQO A;  2Z2S B;  4LJZ F;  3NQO A;  4XPW A;  2CQQ A;  1O3T A;  3KYD B;  5GAG J;  5LRS A;  2DBB A;  5M5Y J;  1IN7 A;  2OA4 A;  1JTY A;  2X1D A;  5K1Y A;  2QSF X;  5CQE A;  3TUL A;  1O5H A;  1I6X A;  2L7K A;  3SP1 A;  4K7B A;  3G4X A;  2CYD A;  3CCU I;  5T1D B;  2OJQ A;  4MO7 A;  2QQ8 A;  3G50 A;  2AXL A;  3BP8 A;  3JRI A;  3JRD A;  1BI2 A;  1P4A A;  4RM3 A;  4KJZ A;  3IAS 2;  2JTV A;  4GGG A;  5GPG B;  3AFH A;  4ESB A;  1MQV A;  3JSE O;  3A01 A;  3HRT A;  2PN6 A;  1W36 C;  2CRG A;  4CDV A;  2ZXP A;  2HYG D;  4QLC U;  1T9K A;  3WTZ A;  4M63 A;  2Q2E A;  4U5D E;  1A0B A;  3JYH A;  3KH2 A;  1RNL A;  4DOZ A;  1VQ4 I;  4AE4 A;  2O8X A;  5DS9 A;  1RKE A;  5JHU A;  3RYR A;  3EUH A;  3HSR A;  4YIF A;  4B4C A;  3MD2 A;  1AUE A;  2J9B A;  4MEY F;  2HZD A;  2EIN H;  1Z23 A;  2PX0 A;  2KDZ A;  3HL2 A;  4ASN A;  3HB9 A;  2GIZ A;  3RW0 A;  3CJT B;  2FEZ A;  5DCM B;  3S28 A;  4A3B J;  4PUS A;  3OYJ A;  4F52 A;  3LWF A;  4E70 A;  4ETS A;  5HS7 A;  3B6A A;  1O4X A;  2GAU A;  2ACJ A;  3EPZ A;  5HLI A;  4U7D A;  1X3W B;  3S15 J;  3P9I A;  2M1B A;  1MBH A;  4C3E A;  4CJO A;  2LOO A;  1GUU A;  2E5Z A;  2JA2 A;  5D6F A;  3D1N I;  3LSP A;  4CX9 A;  1YIO A;  1BJZ A;  1BIA A;  1VK5 A;  2DK8 A;  3DPT A;  2XL6 A;  5E33 A;  5E1Z B;  3G6E I;  4AE4 B;  4EIY A;  1HF0 A;  4RAG A;  3U3F A;  3JSZ A;  4LLL A;  3DLL F;  3V7S A;  2XGX A;  3OYB A;  2Z16 A;  5FLV A;  1R49 A;  2IBF A;  2L7F P;  3I4M J;  3RSN A;  4IX7 A;  1FX7 A;  2F4M B;  3NDB B;  4DVY P;  3ZMU A;  4HDV A;  1U9O A;  3IQC A;  4KNW A;  1O57 A;  1M2V B;  1N1C A;  2GA1 A;  1ERD A;  2M30 A;  3TQN A;  3CO7 C;  3HRS A;  1VQN I;  1LS1 A;  3MX3 A;  1V5F A;  3FXR A;  3W2V A;  3HOT A;  5L0C A;  4RB1 A;  5C44 J;  2TMV P;  1NK2 P;  2LNB A;  4M3G A;  1I5Z A;  1U6H A;  2JK3 A;  5KK1 A;  3RIR A;  5BS6 A;  4UV8 A;  3IAM 2;  3RCO A;  3CJR B;  4PSW A;  4UV9 A;  5L0J A;  1G3S A;  3P9C A;  4DW6 A;  1BIB A;  2WAQ A;  5C3E J;  3J80 K;  4G7Z F;  1JGS A;  2JN6 A;  2K27 A;  1O3U A;  1Z6T A;  3SFI A;  2HFH A;  3FHZ A;  2X6O A;  2NG1 A;  2EIK C;  4H54 A;  1JR8 A;  1VQL I;  5B3I A;  4HNV A;  3QU6 A;  3OYN A;  4YWQ A;  2EIM H;  2OU2 A;  3OIP A;  1FP2 A;  2AO9 A;  2BE5 F;  1RJ9 B;  5LLQ A;  4RS8 A;  3MAJ A;  1XD7 A;  2IS1 A;  2KJG A;  4O3M A;  4U9E A;  2K5C A;  4B3A A;  2X1E A;  2IGO A;  2WVN A;  2GM4 A;  3RQI A;  1UG0 A;  1UAA A;  4A12 A;  3F6O A;  1R1T A;  1XCB A;  3K66 A;  1GLN A;  4RMN A;  1B6A A;  4HLX A;  4MQV A;  3LNQ A;  1YIT I;  3LAP A;  1T0F A;  3EH2 A;  1B72 B;  1J75 A;  5CIV A;  4M9Z A;  4XRF A;  1QLE C;  1RKT A;  3VDX A;  1VLS A;  1VQ9 I;  5JRA A;  3HEF A;  2M64 A;  5IPA A;  2B9S A;  1AVO B;  3GOR A;  3K1N A;  4J7T A;  5ILU A;  1BBY A;  5K5R A;  5BPI A;  4S05 A;  3S16 J;  3ABM C;  3I5Q A;  1UST A;  4A3L J;  1U8B A;  5L0H A;  1DP3 A;  4FTH A;  3AL0 B;  3HZJ A;  1FTS A;  4Q7C A;  2WVO A;  2V1N A;  3DJU B;  1S7E A;  4XKC A;  3CF2 A;  3RKW A;  5IT3 A;  1YZC A;  1MBJ A;  4NC8 A;  2XAF A;  4JQF A;  2Q4F A;  5GTI C;  1Z3Y A;  2YX7 A;  2M3A A;  1YW7 A;  2HDC A;  3FKI J;  5LHH A;  1KYZ A;  2HKO A;  5KYU B;  4ZLD A;  5CI8 A;  1XMX A;  3H2U A;  3LSH A;  1NBB A;  3BT9 A;  1ZZP A;  2CUJ A;  1RIO H;  1L7C A;  2EPM X;  3C62 A;  3F21 A;  2F2E A;  1PDN C;  3UGO A;  2OV7 A;  2W1O A;  3F9K A;  4RGU A;  1YJN I;  2VJ4 A;  3PDM P;  5LGT A;  3HNK A;  2Y0M A;  1LE8 A;  4EBJ A;  4QPQ A;  2ISY A;  2R9R B;  4JTC B;  5IYD J;  3HNL A;  4I2O A;  2P4W A;  3B73 A;  4B1R A;  2NSG A;  2KP6 A;  2VQG A;  4EMS A;  1VQO I;  1TWH J;  5HV9 A;  2FNA A;  2DFE A;  2BZT A;  3GEH A;  1DUX C;  2ZFU A;  2LSE A;  4JX6 A;  1UEL B;  3RFY A;  5AIQ A;  3H35 A;  3E9V A;  2I8B A;  2L0K A;  4NDL A;  4CS7 A;  3K4K A;  3A02 A;  4BEH B;  1MKM A;  4A69 C;  3SZG A;  4EJW A;  5LHI A;  1TFK B;  3TOM A;  1W5S A;  3J81 Z;  2DXI A;  2I10 A;  3GME A;  4HQM A;  4NQW B;  4LMY A;  3H2V A;  4NB5 A;  3FX3 A;  4U5C E;  4XSX F;  5FJ8 J;  2LP0 A;  2R4G A;  4YT5 A;  3RH3 A;  3R0J A;  1P4W A;  3IH4 A;  3E5Q A;  2HS5 A;  1JTX A;  3OYH A;  5L3B A;  1Z1D A;  1W7P D;  1REP C;  5DS6 A;  1UHW A;  3LMM A;  2E34 A;  1U9N A;  3DM5 A;  3QTH A;  3OYA A;  1PVE A;  1Z67 A;  3KLO A;  4LB6 B;  2AP3 A;  5A6J A;  1YX3 A;  3IWF A;  5CYV A;  5LGU A;  1KQ9 A;  2COB A;  3VEP A;  3KPH A;  2JPC A;  3BQY A;  2M8G X;  3E0J B;  2Q9C A;  3K2A A;  3WOD F;  5T3W A;  1QO0 D;  2X48 A;  5AON A;  1OMI A;  3BZK A;  3TMO A;  2G7H A;  2XXA B;  3WHC A;  4A0X A;  2VIX A;  3HOY J;  5EGO B;  2O9L A;  2CQK A;  1MMD A;  4M3F A;  3IUO A;  4S0H B;  1X3Z B;  3ZPL A;  3L9F A;  4RAF A;  2DA6 A;  3H3Z A;  2ZXW C;  3RQG A;  1SAU A;  4UB6 C;  3CCR I;  3GZ6 A;  4HFF B;  4UNO A;  4G8X A;  2Q00 A;  2K9S A;  3BLY A;  3ZQV A;  3CUO A;  2CW7 A;  1ORK A;  4F7Z A;  2O8K A;  4F3Q A;  3GCM A;  2R7Q A;  3MQ0 A;  5COF A;  1K83 J;  2KIS A;  4CZC A;  2R5Y A;  5BMZ A;  1IG7 A;  2BVL A;  4IEJ A;  3V7R A;  2JQ7 A;  2HSB A;  5DS4 A;  5EJC A;  4BY1 J;  3DMD A;  2H27 A;  4YL1 A;  4ENN A;  3EHM A;  2IVM A;  2IGK A;  3CTA A;  2E60 A;  1PUE E;  2NRA C;  4HEA 2;  2DGJ A;  5ILS A;  2HPM A;  2B7E A;  2FRH A;  3TBI A;  2X9D A;  3A4C A;  1NG1 A;  1YZA A;  1AU7 A;  3BRJ A;  1ZTR A;  3HYI A;  1B72 A;  2CV2 A;  2CGE A;  2WAQ N;  1KNY A;  4Y15 A;  2KSF A;  2P7V A;  4E7J A;  2XRL A;  3LSK A;  1M57 C;  3K1I A;  1ULY A;  1YI2 I;  4FIS A;  2IA2 A;  3QZC A;  4XEF A;  2NYX A;  1Q0K A;  5E18 F;  4LDQ A;  3RPQ A;  2GDC A;  1YDI A;  4MIM A;  2R02 A;  3EHN A;  1XN7 A;  4JBA A;  1IXC A;  2QEX I;  3T0Y A;  4N6C A;  1QA6 A;  2LD5 A;  3CC4 I;  4CCM A;  2IOQ A;  3DPU A;  4RM2 A;  2BVM A;  2H94 A;  1FR0 A;  4NTB A;  5COM A;  2H8A A;  4Z9H A;  3LNR A;  3ZTZ A;  4GDF A;  4V2G A;  1YTY A;  1OXK A;  2CYY A;  4GYI A;  5E8I A;  3ONQ A;  5ICE A;  4ZYA A;  4F91 B;  2LF8 A;  1ZLJ A;  5FO5 A;  2QF7 A;  4JCZ A;  2HTJ A;  1I5N A;  3X2Q C;  2IXS A;  4DRJ B;  4RGS A;  2R7S A;  4CO8 A;  5DD4 A;  3GM1 A;  4HF0 A;  3U3B A;  4HA8 A;  1V55 C;  1YYJ A;  3GWZ A;  1WN0 A;  2EK5 A;  2JUG A;  1RKC A;  2K9L A;  5A2Q K;  5T3T A;  2CSO A;  4EM0 B;  2OOC A;  3U1K A;  1X1C A;  4CYD A;  2VE9 A;  1NZE A;  1U0J A;  2OG2 A;  1BA5 A;  3TJ6 A;  2A6E F;  3MLG A;  2AS5 F;  3W2A A;  3ZQF A;  1NFN A;  2CJJ A;  1KQ8 A;  5L0G A;  2R93 J;  4HNT A;  1VZ0 A;  2DOD A;  3W3C A;  5ICC A;  1FOX A;  2XPW A;  1YW8 A;  2YLG A;  1YLM A;  1BR4 A;  256B A;  4ESJ A;  1EH8 A;  3KX2 A;  2RAE A;  3O55 A;  1YYX A;  2XB0 X;  2QUF A;  2IXO A;  3EJN A;  3B29 A;  1TWF J;  2STW A;  3CUQ B;  3UMH A;  2Z1D A;  3CJN A;  4CHU A;  3BR5 A;  2JA7 J;  4I1M A;  2Z9O A;  2R05 A;  3OY9 A;  5JSL A;  3L00 A;  1F5T A;  3DZA A;  1TQM A;  2QQB A;  3QP5 A;  4P9T A;  3ZVR A;  1HW5 A;  1FBS A;  2BW3 B;  4EGY A;  4DJ9 A;  1TZL A;  2AHQ A;  2AVK A;  2H1L A;  3L2U A;  2KGO A;  4LK1 F;  3O3K A;  3HXL A;  2VJ5 A;  4C9Y A;  4MS2 A;  3RIP A;  3JYY A;  3W6K B;  1HMO A;  3RQF A;  3GEE A;  1AA7 A;  1SD4 A;  2P0N A;  1EH7 A;  2WWY A;  2EZH A;  2QBY B;  1RI7 A;  2DN0 A;  4LLG F;  2E87 A;  1DGR M;  3A1Y A;  2A05 A;  2KJC A;  4BE2 A;  3OYC A;  2WV1 A;  1U8R A;  3O10 A;  1RES A;  2NS7 A;  4XL9 A;  2MYS A;  4KBL A;  3BTC A;  1MDM A;  3QPH A;  2L4A A;  4CH7 A;  5BQT A;  2PBI A;  3O39 A;  1BI0 A;  1FTT A;  2PI0 A;  5E2Q A;  4NBQ A;  4A3K J;  2I15 A;  2ID3 A;  2V9K A;  5KYX A;  3JRM O;  4GCV A;  4I44 A;  2QSH X;  3B6C A;  1YVI A;  2DOF A;  3CCS I;  3TO6 A;  2X6X A;  4CS9 A;  1HXD A;  3BTL A;  1SR2 A;  4KT5 C;  1YW9 A;  4PSX A;  1QBJ A;  2QNL A;  4IHY A;  4JTD B;  2KC3 A;  2M2E A;  1QZY A;  1W5T A;  1POG A;  3MN2 A;  5K0I A;  3S3M A;  5J4V A;  4ULW A;  1NU7 D;  5ED4 A;  4H0E A;  2D45 A;  1FBU A;  3L1M A;  4BJT A;  5BUO A;  4DZJ A;  2ICW G;  1E3O C;  2HXI A;  5KVR A;  2JUC A;  1DPU A;  1TT0 A;  3H5N A;  3WHB A;  3WGI A;  1J8Y F;  5F0C A;  4W1U A;  2XF7 A;  5BOX A;  1FOK A;  5IP7 J;  2JD3 A;  1ODD A;  3BZ6 A;  2H7V C;  3V5Y A;  1JJ8 C;  1AKH B;  5F28 E;  5K7H A;  1G3Y A;  2NVX J;  1T6U A;  1T56 A;  3AQB A;  4A5N A;  3PUB A;  4ZYE A;  2Q9A A;  4C3H J;  3F46 A;  4FWV A;  3LEO A;  1PUF B;  3NMK A;  5F6F A;  1X19 A;  4BXX J;  1FFH A;  1S7O A;  1BR1 A;  2FE3 A;  1K04 A;  4XLC A;  5GTH C;  4KIG A;  1H6G A;  3H3V K;  4XN0 A;  4NC7 A;  3ITF A;  3REO A;  2K3F A;  4PDK A;  5DM6 F;  3LLI A;  2ELH A;  1VYK A;  1TWG A;  2XAU A;  4D7M A;  1ETX A;  2DPD A;  2OEV A;  3U9J A;  2VAS A;  3DP7 A;  4C2T A;  3K1P A;  3RF3 A;  1BOA A;  3N97 A;  1FYK A;  3F47 A;  4E6K G;  2LF7 A;  4XSZ F;  4E7K A;  3RZD J;  2DJN A;  2YL1 A;  2Y3H A;  4LDR A;  4UB8 C;  4DZP A;  4FAS D;  4KA4 A;  2Z5U A;  3NG1 A;  3NRV A;  4LGW A;  1IUF A;  2XAQ A;  4MTD A;  3LNM B;  1Q1V A;  4BYY A;  3CQZ A;  5AGF A;  4F93 B;  5JUA A;  1YE9 A;  5IY5 C;  2VPR A;  1Z3X A;  5EG0 A;  2VC0 A;  5FD5 A;  1ZN2 A;  1MDM B;  2VJJ A;  1QZZ A;  2JX0 A;  1VTM P;  2LKP A;  3S9O A;  1Y8R B;  1T8I A;  1SD7 A;  3GXO A;  3TO9 A;  1D8J A;  4AYB N;  2GZW A;  1R5I D;  2LRE A;  3GAN A;  2OKU A;  2Q3T A;  5EGY A;  3S84 A;  3FXJ A;  3TGN A;  3OIQ A;  2DMP A;  3S93 A;  3HOZ J;  3LQQ A;  3FM5 A;  3WE3 A;  2YQY A;  4L5J A;  1D1C A;  2EIM C;  4EM2 A;  1TC3 C;  5IT9 K;  1FY7 A;  4MTF A;  2JWT A;  4L0Y B;  1FMW A;  5GP9 A;  3C8G A;  5CJ9 A;  1M56 C;  2K02 A;  3K4N A;  2NOG A;  3CCL I;  3H3U A;  2R7Z J;  3CCQ I;  2L7Z A;  2PEX A;  2KNH A;  3HUG A;  4E7Z A;  2R7D A;  3BY6 A;  4LDK A;  4ENK A;  1IN5 A;  3JAM K;  5LGN A;  4MTO A;  3I4U A;  2EPL X;  3ULQ B;  1YAR O;  2EV0 A;  3EGX A;  5JLI A;  1MJB A;  3CCJ I;  4YG2 F;  3OYD A;  3HTK C;  2R7O A;  1OKR A;  3ZQY A;  4HDU A;  3F8C A;  4HF1 A;  4NUB A;  2KZV A;  1VQK I;  1WJB A;  2W45 A;  2GWW A;  1TTY A;  3NRH A;  4NQF A;  1FNN A;  5BQG A;  1ONV A;  1ON2 A;  3B02 A;  3SZP A;  2DMQ A;  3K70 C;  5IYB J;  3HPH A;  4Z9I A;  2W7N A;  1JKO C;  1NHA A;  2DTR A;  2HDW A;  4JIO A;  4X0R A;  4U5F E;  1LDJ A;  2H6C A;  2LKS A;  2XIG A;  3SDG A;  3PCV A;  2G3V A;  4WGZ A;  1KU7 A;  4DRH B;  2DFH A;  1EF4 A;  4RLQ A;  2LBF B;  2L02 A;  4ABZ A;  3BPV A;  4CYC A;  2H1K A;  3FOP A;  1V3F A;  2QKM B;  1IF1 A;  1E17 A;  1OCR H;  1W7P B;  4DGW B;  1FP1 D;  1OR7 C;  1JPN A;  2IS6 A;  2DCE A;  3AG2 H;  3AG4 C;  1OYI A;  3MZH A;  3HGG A;  1J5Y A;  2FOK A;  1JHH A;  2GQQ A;  3V8K A;  1P7J A;  1JAF A;  3HRM A;  5FKO A;  3OA1 A;  3AOU A;  3ZQ7 A;  3LSR A;  2I8D A;  4FES A;  3FOO A;  4YEL A;  1OR2 A;  2MAB A;  4C3D A;  1E84 A;  1WAT A;  1L3L A;  1ORY A;  1X1P A;  3TW7 A;  2XLE A;  3OL3 A;  3HHH A;  4W8K A;  4BQO A;  2ADU A;  2M34 A;  2LG4 A;  2P8T A;  4PCQ A;  4BXF A;  3EUA A;  4AWX B;  1YOV B;  2YX4 A;  3OSG A;  2L54 A;  2J9U A;  3EGD A;  3IHU A;  2E36 A;  3VF0 A;  1RKW A;  4BDY A;  2DU9 A;  4XN3 A;  3P7N A;  1MGT A;  1NLX A;  5JLX A;  3ZP5 A;  3GTK J;  1XZP A;  2IXP A;  1FC3 A;  3NYL A;  2E1N A;  5J1U A;  2LC2 A;  3ZDL A;  3B0P A;  3JTL O;  4IHT A;  2AWC A;  3I3L A;  1LIH A;  2CUF A;  3J81 K;  2PMZ A;  4WCG A;  2A69 F;  3MEX A;  2LY1 A;  3W6V A;  4ZDP A;  3LA7 A;  3OIO A;  4UUV A;  2V7F A;  1BW6 A;  3KKB A;  2VN2 A;  1JHF A;  2KZG A;  2DYR H;  4Y3O A;  1LFP A;  5D91 A;  3FKJ A;  5BQI A;  3FDQ A;  4BJ5 C;  3OYI A;  1J2X A;  3MWM A;  2KFD A;  4MGR A;  3S2W A;  3GFL A;  3SXY A;  1K6O A;  1RUO A;  2R5Y B;  4MVR A;  4S04 A;  3GZ5 A;  3U0C A;  1D0Z A;  2MH9 A;  3PL8 A;  2KIU A;  4ZZD A;  1WJD A;  2Q9B A;  3TOA A;  2HPI A;  5B1B H;  3HSE A;  3EYI A;  2F6C A;  2P5K A;  2EFQ A;  2L9R A;  3WTT C;  3WG7 C;  3N24 A;  2J0X A;  1V54 H;  4HYE A;  2DT7 B;  1OR3 A;  3CLQ A;  2L7A A;  4OU0 A;  1TLH B;  2AXT C;  3SXZ A;  3GFM A;  3M9A A;  3LLK A;  1I1G A;  3F8B A;  1WTY A;  4I01 A;  4NHJ A;  5HS8 A;  4BAC A;  1IO2 A;  2J7P D;  2JPU A;  3JT1 A;  3OS2 A;  3NWS A;  2HQR A;  1WOL A;  3M4C A;  2FBI A;  1UG2 A;  2EIL H;  2PF4 E;  3BPX A;  5J3L A;  3FMS A;  5TGT A;  2ZNY A;  3X1O A;  1HSJ A;  1FBQ A;  2IEK A;  5DDG A;  5DUI A;  1UHM A;  2A3S A;  3CMY A;  3EGD B;  3KL4 A;  4AK9 A;  2PG4 A;  4KIS A;  2GXA A;  3RPU D;  2YU9 J;  2L01 A;  2YL7 A;  4JZA A;  3TK0 A;  1Y0U A;  2HQA A;  4A3F J;  3A0H C;  3BR6 A;  2HSQ A;  1GDT A;  2X51 A;  4U0V A;  3TED A;  3MYF A;  4BKX A;  3AG3 H;  3DE9 A;  3FXH A;  2M87 A;  2RNJ A;  3NAR A;  2V1U A;  5FLX Z;  1XWJ A;  2ASR A;  3EG9 B;  2YL0 A;  1IZ1 A;  2CG4 A;  2STT A;  3CD6 I;  4PR9 A;  2A68 F;  2PX9 A;  2DT5 A;  3BCB A;  4NC6 A;  1TBX A;  4HLY A;  2QSG X;  3D0S A;  3EFO B;  2OTJ I;  2NS8 A;  4K0D A;  1RPW A;  4HX7 A;  1MH4 A;  3TDU C;  4UUS A;  3V7C A;  3UR3 C;  2MHR A;  2CW0 F;  4KFC A;  4IWB A;  4DQ2 A;  2LSO A;  5EZH A;  2LBF A;  4CDA A;  3BG5 A;  2WY7 Q;  1CGP A;  1VND A;  2QCO A;  3KET A;  4CSW A;  3AJM A;  4G6T B;  3BCA A;  4CZZ A;  2PNO A;  3KP3 A;  2P61 A;  3GFI A;  4D5C A;  5FKK A;  3OSF A;  3L0I A;  4L9T A;  4OMZ A;  5E3N A;  3HTS B;  1C03 A;  2ESN A;  3US6 A;  4EJO A;  3DTK A;  5J1R A;  1EH6 A;  3CCM I;  1W36 D;  1ZU4 A;  2ZXW H;  4LIT A;  4Y13 A;  1YRN A;  1B68 A;  1LNW A;  1R22 A;  2VB6 A;  4A0Y A;  4GYT A;  3LA3 A;  1Z77 A;  2DMT A;  5CVR A;  3R6S A;  4OIQ F;  3AGU A;  5L0D A;  1FNT c;  1SVO A;  1T6I A;  3S27 A;  1UFB A;  2VE8 A;  1XC5 A;  3PO2 J;  2VXD A;  1R58 A;  5HLG A;  2AU5 A;  1XGO A;  3DEU A;  3VSK A;  3AGT A;  4Y7N J;  2KDO A;  2UZK A;  2NVU B;  2J45 A;  1C02 A;  1BZ4 A;  2W9Y A;  1MH3 A;  5FFX A;  3V5X A;  4UUS B;  2R03 A;  2RQP A;  4XNF A;  4MEX F;  2DFI A;  1TQI A;  2E35 A;  3TO7 A;  3VYT B;  1BDJ B;  1UB9 A;  4XPX A;  2DQL A;  1A7V A;  1B1B A;  3PFI A;  4XPY A;  1VLT A;  4N4O B;  1O87 A;  3T6J A;  2XPV A;  3HOX J;  2CV1 A;  4CSA A;  2X0L A;  1WGX A;  2ZB9 A;  2WZF A;  4BJ1 A;  2ID6 A;  3DBL B;  3D5R C;  1TQP A;  4XLN F;  2XSJ C;  3VYR B;  2XSD C;  2BY2 A;  2VT3 A;  2LFD A;  4OWR B;  4DBQ A;  4E18 A;  2W48 A;  4ZDO A;  4L6R A;  2DJI A;  2A5Y B;  1VQ8 I;  2VKH A;  3CEX A;  1TNS A;  4FCY A;  2IP2 A;  4N4N B;  2VBX A;  3OYF A;  3NKD A;  4PJL A;  5ICG A;  2J8W A;  3FF5 A;  5BPD A;  2VC1 A;  3R7C A;  2B0J A;  3HPG A;  1ZRF A;  3OYL A;  3FHD A;  4XON A;  3IQ6 A;  1P92 A;  4CXF A;  5ERI A;  2Z33 A;  3M4B A;  1HE9 A;  1I6H J;  3JSP A;  1ETK A;  1SD5 A;  4NNJ A;  2ELK A;  2KHM A;  1YQA A;  3HOS A;  2XF5 A;  4AU7 A;  2W4B A;  2R7U A;  3E97 A;  2VBZ A;  1TKN A;  2XS1 A;  1ZK8 A;  4RBN A;  3QVZ A;  3AAF A;  5IYC J;  1M2O A;  4IHX A;  3NEU A;  3GTO J;  2OTL I;  3BJO A;  1RJ9 A;  2ZXO A;  4N06 A;  2HQN A;  4ZTF A;  2KIF A;  3DAF A;  2Y3G A;  3DFG A;  2ZD9 A;  3G4Z A;  1FWZ A;  3I5P A;  1OJL A;  1WHU A;  2CMP A;  2P7C B;  4QDL A;  3K2Z A;  2O9X A;  3UMI A;  2ZXI A;  5L3C A;  1MBG A;  1VQ7 I;  1Y1W J;  1TQG A;  2F22 A;  3LFU A;  1PP8 F;  5FCL A;  2OCC H;  4YFN F;  2ME6 A;  4D1Q A;  1R7J A;  1BOB A;  1VFC A;  3RKQ A;  5FKN A;  1QGP A;  3WAQ A;  2H8W A;  3IKT A;  3I56 I;  4M3B A;  2EIL C;  3T4R A;  3LES A;  3U2L A;  5CVI A;  4IHW A;  1S7Z A;  1LEB A;  3G3Z A;  1VYI A;  3LEV A;  4OIO F;  3FXQ A;  2QY9 A;  4XR6 A;  1SFO J;  2MH2 A;  3KLN A;  4C7O B;  2EPF A;  3LAJ A;  3HHG A;  4XQF A;  1J59 A;  1RUN A;  3L2C A;  1CGO A;  4A2U A;  1APC A;  4A93 J;  4MVM A;  1SVM A;  3E7L A;  4A6E A;  2QLZ A;  1ZG1 A;  1F1Z A;  2UXN A;  4JP0 A;  5A6K A;  1SYQ A;  1R71 A;  4HBL A;  2JSC A;  3ZGK A;  2E71 A;  3KZZ A;  1Z0X A;  2FSW A;  2HFI A;  1SVL A;  2ZJR F;  4MW8 A;  2GA0 A;  3L2V A;  2RSE B;  2EPK X;  4G12 A;  3X2Q H;  2L9S A;  2M4G A;  2VOP A;  3WTU C;  2RV8 A;  2WC2 A;  3K10 A;  2V26 A;  5A6B A;  2IBD A;  1PD0 A;  4MNU A;  2ZKZ A;  2QBY A;  3WU0 A;  4E7S A;  1W7P A;  4G94 A;  2XRO A;  3QMK A;  2PFB A;  2W57 A;  1ZYR F;  2B0L A;  1OCO H;  4GRI A;  3GX4 X;  4MVZ A;  5KYX B;  4EWC A;  3MFN A;  2VT2 A;  3LS0 A;  1EJ9 A;  5A69 A;  4G0H A;  5E17 F;  3OYE A;  3DI5 A;  5L3G A;  3LSM A;  5GAE J;  1EV7 A;  1BC7 C;  1MMN A;  1J09 A;  2MBF A;  4A3G J;  4N6H A;  4DYQ A;  1STZ A;  1U2W A;  1XSX A;  2GBY A;  3ASO H;  3DKX A;  1FMV A;  2AQE A;  2YS9 A;  2BV6 A;  3GTM J;  1WJE A;  2K4J A;  1OXB A;  2BYV E;  2KRF A;  3EQL F;  1FIA A;  2WAD A;  3FVY A;  4EBB A;  3ZMD A;  4ANJ A;  2K3P A;  1XSV A;  3MZ8 A;  3OV8 A;  1OYW A;  1WCM J;  1SAN A;  2DLL A;  5K7F A;  1TWG J;  2ECB A;  3EET A;  4QIW N;  5HNH A;  1LS4 A;  1Q0D A;  3F0C A;  2BOL A;  2HVR A;  5F08 A;  2FBK A;  1MMG A;  1V54 C;  2M7B A;  3KCC A;  4YEJ A;  5D4R A;  1T0F C;  3NMJ A;  3WGG A;  5K5O A;  2H7O A;  2CDQ A;  3SYN A;  4B3X A;  1LM3 B;  1ETV A;  3LSJ A;  1WWX A;  5LHG A;  3L34 A;  4XRS G;  3MMY B;  4PFO A;  2O6G E;  4B43 A;  3PJR A;  3G1M A;  2FF4 A;  5CVU A;  2A6T A;  3DCF A;  4MTE A;  1YO5 C;  4WJ0 A;  2X1C A;  4HZF A;  1A6Q A;  1TWC A;  3ZR8 X;  5HLH A;  3CDH A;  2Y3B A;  1LE4 A;  5E20 A;  3FXL A;  2H6B A;  2E1C A;  3DKY A;  4KIB A;  1SAX A;  1P7I A;  4CIC A;  1WZ2 A;  1M1E B;  1EI7 A;  3R2P A;  3CCY A;  1WSU A;  1S6L A;  4JRZ A;  2KK1 A;  2XAS A;  2CU7 A;  1G8X A;  3OOU A;  3W2W A;  3GWN A;  4XLP F;  2MC4 A;  4K2E A;  4U87 A;  5GAD J;  1S8N A;  2D4U A;  2A61 A;  5CPR B;  5E8G A;  4BQN A;  4WAB A;  1NH3 A;  2MD5 A;  1P6R A;  2EFP A;  4L9N A;  4ESF A;  4IRU A;  2KLO A;  1RXQ A;  1E2X A;  4PGG A;  5F64 A;  4AM3 A;  1N78 A;  4HX8 A;  1YA7 O;  1WPK A;  3K70 D;  3HIF A;  2NNN A;  3OS1 A;  2EH3 A;  2E2I J;  5AC4 A;  5D5W B;  4XLH A;  1SFX A;  3FWE A;  3ABM H;  4D0P A;  1I4Y A;  1OFC X;  3HJE A;  3S14 J;  4LIU A;  3I9V 2;  2WTE A;  1UJ8 A;  3AQC A;  2RRE A;  2R0Q C;  3V7O A;  1WKM A;  5HDG A;  4DNC A;  5JR3 A;  4UDV A;  2K7L A;  3ZQI A;  2LY2 A;  2Y9Y A;  4HV6 A;  5H2F C;  1GVD A;  1QPI A;  3K7A J;  4IGG A;  4LB5 A;  4XID A;  2ETS A;  4EHP A;  1CF7 B;  4IAO A;  3COA C;  3G1O A;  3CQZ J;  5KCM A;  2LCH A;  1J7K A;  3KP7 A;  1G3T A;  4HQE A;  4Z6Y A;  1SFU A;  1PUF A;  3WHN A;  1FSE A;  4CCJ A;  5FKM A;  1Z05 A;  2P5V A;  2E19 A;  5DM7 F;  3M4O J;  4ZC3 A;  4PJJ A;  2Q0O A;  2XLO A;  3C7J A;  2EJR A;  2GIV A;  3EPV A;  3FAJ A;  1MD0 A;  2WAF A;  1S3J A;  1H7I A;  4D5F A;  3QOD A;  1H9T A;  1QNT A;  2FNP A;  1U89 A;  3FM3 A;  1MSE C;  4N9H A;  1VOM A;  3Q0W A;  2Q8K A;  2QKL B;  4LG3 A;  3PUF A;  3R0A A;  1U6G A;  2G0E A;  1XSD A;  3JRA A;  4ON0 A;  2DOE A;  4XM3 A;  3ZG1 A;  1B4A A;  2J5P A;  4YT8 A;  3ZN1 A;  2BXY A;  4O6M A;  2YLD A;  3MCZ A;  4CBE A;  4Q4Z F;  5JVT A;  1MIJ A;  5EEH A;  3JRE A;  1PP7 U;  4B09 A;  5TRD A;  2V9V A;  1XS9 A;  4BEM J;  5ICF A;  1SMY F;  3DXJ F;  2A0U A;  1OCR C;  1TWA J;  2YKZ A;  4J30 B;  3FXM A;  5COG A;  1DGW Y;  3BTI A;  1F43 A;  1IXR C;  1S9H A;  2EWN A;  5D6E A;  5JFR A;  5B66 C;  1WAS A;  3V4G A;  2P81 A;  3S2D J;  2R3S A;  2V4J C;  1PV3 A;  3TW6 A;  3LJB A;  2XAJ A;  3I54 A;  3NYJ A;  3VRC A;  1W4M A;  1Z3I X;  2Q2E B;  2CNW D;  3GW2 A;  5D5V B;  1HKS A;  1WH5 A;  1NU9 C;  5J47 A;  3R60 A;  3OYK A;  3TP0 A;  2D5V A;  1JT0 A;  3V8J A;  1Y56 A;  3BRO A;  2UWM A;  4HG2 A;  5FFZ A;  3NWT A;  1ETW A;  4EM1 A;  4J01 A;  1K78 A;  1LFB A;  1S7A A;  1KU2 A;  1IDY A;  1V55 H;  1WH7 A;  2KRC A;  2G3K A;  2LD6 A;  1M6T A;  1XGM A;  4R1H A;  4LER A;  2DQR A;  1LDD A;  1ZRC A;  3RJP A;  1W0T A;  1OKK A;  3BR1 A;  1T39 A;  4G78 A;  4EGZ A;  5JHF A;  1NSG B;  1DP7 P;  1MMA A;  3AL0 C;  2CO5 A;  1YAU O;  3HBL A;  1R36 A;  4B8X A;  2VPL A;  4JUR I;  1UHS A;  4BJ6 A;  2CW8 A;  1BN5 A;  4G7H F;  3VSL A;  1ZHF A;  3TP3 A;  4IQ4 A;  3FAP B;  1X4P A;  4CCK A;  5HDK A;  2ZXR A;  2OCC C;  1DQU A;  2W82 A;  2XLW A;  2RNG A;  3JRT A;  3JR9 A;  2LP4 A;  1UG7 A;  1GM5 A;  3VOD A;  2P0W A;  4CIP A;  1ZHX A;  1BI1 A;  1OIS A;  4I02 A;  2Y75 A;  3WG9 A;  2HV7 A;  1GV5 A;  2DYS C;  3M1C A;  3WG7 H;  1YFH A;  1OPC A;  5GAH J;  2WZG A;  2HKX A;  3Q0U A;  4X1E A;  1T01 A;  3GOD A;  3UMK A;  4XLA A;  4RAY A;  1UCR A;  3LUT B;  3KYJ A;  5DCF A;  2QEN A;  1B8I B;  2J9W A;  1LB2 A;  1S05 A;  4FAP B;  2L3D A;  2XUB A;  5J1Y A;  2Y0S N;  2K9M A;  5CLS A;  2AWY A;  1U5T A;  1W1W E;  4LFU A;  3C1D A;  1SD6 A;  3RTR A;  3EZI A;  2TRT A;  1ZH5 A;  3PHF 2;  2J0W A;  2VH3 A;  2W4S A;  3S17 J;  1JPJ A;  5HDN A;  3TDZ C;  2W25 A;  4LIV A;  1O3S A;  2OPT A;  3FMR A;  2EZK A;  1B9N A;  2J7P A;  4E0H A;  4GO1 A;  5DS5 A;  1V5G A;  2VOD A;  2HJ3 A;  3TOL A;  2IRF G;  2PLY A;  3K4C A;  3KYC B;  4D4X A;  5J8F A;  1O3Q A;  4CUG A;  2CGP A;  2WA0 A;  4U88 A;  3ZIB A;  2L9J A;  3BR3 A;  4XOP A;  5KAI C;  4XLF A;  3IV5 A;  4IJJ A;  2E1M B;  3G2B A;  2HEO A;  2W84 A;  3ROU A;  4HSR A;  2VCC A;  1IRF A;  1CF7 A;  1W2W A;  3C3W A;  3BG3 A;  1IRZ A;  3ERE D;  2H8R A;  1GXP A;  2Y69 H;  3BG7 A;  2O3F A;  3DEE A;  2KT0 A;  1NFO A;  2E2H J;  3ZMZ A;  3A03 A;  3F8N A;  4XKB A;  4JOM A;  4IB4 A;  5JI6 A;  2VI6 A;  4V2F A;  4YII A;  1ZRE A;  5FLX K;  4P55 A;  1XGS A;  3J06 A;  2XB5 A;  1WJF A;  3PSI A;  2BY0 A;  3DLA A;  3IL2 A;  3QYB A;  1AOY A;  3AG3 C;  5FLM J;  2LMD A;  2HOS A;  2PJP A;  1HA8 A;  2R7F A;  2IS4 A;  1A04 A;  4B47 A;  4HRI A;  1BJA A;  1K79 A;  3SNH A;  1X1A A;  1X2N A;  4AL1 A;  4BH9 A;  2LFF A;  3JRC A;  2V1X A;  4YFK F;  3S1R J;  1A5J A;  1A41 A;  3O6X A;  2DA7 A;  5AC5 A;  5F5H A;  1UZC A;  1LPE A;  4R79 A;  4ZYG A;  2RD9 A;  4E7I A;  2LYC A;  5CQG A;  2PX3 A;  3HKZ N;  3LSG A;  4CS9 C;  3QPT A;  4HST A;  1OCP A;  1U5T C;  4IZZ A;  1ZVZ A;  4U0Y A;  4P5O A;  1TWH A;  4X0G A;  2HZ8 A;  4F4B A;  2IGN A;  1Y0N A;  1I1S A;  2OQG A;  3E6C C;  2GAQ A;  1LE2 A;  3NYM A;  2GLO A;  2L81 A;  3OEO A;  3FBI B;  2X85 A;  2DA3 A;  1YRN B;  2XSE A;  5F5F A;  3ZQG A;  1D3Y A;  1JGG A;  1ZW3 A;  1ZG3 A;  1H0M A;  4YT2 A;  3M1C B;  1ZHY A;  4L0Z B;  2A6H F;  3HKK A;  2M45 A;  1JKQ C;  4OMY A;  2KPM A;  3RKO F;  4DVZ A;  4BUP A;  3HRU A;  1K6Y A;  2QUP A;  2DPU A;  3H0G J;  5FRM A;  1NG7 A;  1L3P A;  4M74 A;  2K86 A;  3P5J A;  5JT4 A;  5L3V A;  1T33 A;  2PJR A;  3QVY A;  1ZKG A;  3TOB A;  2DA1 A;  3LAY A;  3VFZ A;  2XKP A;  2ZJ2 A;  3GVA A;  5FRN A;  3W8I A;  4C3B A;  4BE0 A;  4IRI A;  3Q7L A;  4EQQ A;  3C18 A;  3ZRG A;  2DYR C;  3H9J A;  3SFZ A;  1I50 J;  2PJR B;  2VON A;  3B0V C;  3EG9 A;  4A3C J;  2LRD A;  5DCM A;  2NVY J;  1LI7 A;  1CQT A;  4BEH A;  4R8H A;  4K1O A;  2CUZ A;  2D1V A;  3S1M J;  1KYW A;  3FXK A;  3HOV J;  2KIM A;  3MZY A;  3CES A;  3RDI A;  4ZH4 F;  5D4S A;  1XCV A;  2EFW A;  5TJ5 E;  3LSI A;  5CI9 A;  4E17 A;  2MLG A;  2E7X A;  2RDP A;  3G1L A;  3KFW X;  3SHF A;  4AVP A;  3ML6 A;  4MVS A;  3E3V A;  3EUH C;  2LVS A;  1JXS A;  2FXA A;  2RC4 A;  4YL0 A;  1T08 B;  2F5C A;  5DYM A;  5A2Q Z;  3VAY A;  5F0F A;  2VJI A;  2MGQ A;  3A01 B;  3A0B C;  3HG9 A;  4AIK A;  1FZP B;  1EA3 A;  2G9W A;  9ANT A;  5KYW A;  4RB0 A;  1ZGA A;  2YL3 A;  4KNV A;  3BQZ A;  4OIP F;  1IN6 A;  2HVS A;  1JUM A;  1OCZ H;  4H4K C;  1R1U A;  5KYU A;  4OD4 A;  4LLN A;  3ELK A;  1O7L A;  4P1W A;  2DB4 A;  4U0W A;  3K7D A;  2PMU A;  3RPU A;  1ST6 A;  2R5Z A;  1OLT A;  1GS9 A;  4EJU A;  4JX4 A;  3CP2 A;  1K61 A;  1WVR A;  1SF8 A;  1LUJ B;  4IAQ A;  4C2M J;  2H09 A;  3T8R A;  4BE1 A;  4XKW A;  3F8F A;  3B9Q A;  3HC7 A;  1JUS A;  2NVT J;  3ZTM A;  5DEQ A;  3ZQQ A;  2VXZ A;  1F9N A;  1N77 A;  2ESH A;  3S3O A;  4DBR A;  2H7B A;  3NAU A;  2JSP A;  1WI3 A;  3OR2 C;  4O7G A;  2WB1 A;  4Q48 A;  4E4H A;  1PYV A;  3I64 A;  1A7D A;  5H6R A;  2XV4 S;  2WB1 N;  4OIN F;  1IXS B;  4L9V A;  1S72 I;  3WU1 B;  1IUY A;  1V4R A;  2ELJ A;  1JJ6 C;  3CC2 I;  4LG0 B;  3W6J B;  1WFX A;  1Q0F A;  2PFD A;  2ETH A;  4HNU A;  1TL8 A;  1R4M B;  2F48 A;  4UVB A;  1QRY A;  1T2K A;  3KYL A;  4D9J A;  2CQ7 A;  1WQ2 A;  2YRF A;  4JC7 A;  1AEP A;  2GOX B;  3U8V A;  3FZV A;  4MVU A;  2YU3 A;  1R23 A;  4BHP A;  3GTG J;  2ZC2 A;  2Y31 A;  3H92 A;  4PGH A;  1VB5 A;  1ETO A;  4HEA J;  1F36 A;  3MKL A;  4MND A;  3LFK A;  1XPX A;  1B8I A;  3WGH A;  4LAC B;  1Z9C A;  2NVQ J;  4JTA B;  1ZW2 A;  2VBY A;  1Y1V J;  5GPC A;  1XX5 A;  3S2H J;  3WU2 C;  2EZI A;  4F55 A;  2VL8 A;  1LDK B;  1ZGJ A;  3ECH A;  3F23 A;  2M8E A;  4ZTJ A;  1EKY A;  1OCZ C;  2C6Y A;  2OUM A;  2KRH A;  2XLH A;  3K4M A;  4QI2 A;  4IHS A;  2MD0 A;  4IJA A;  2OU6 A;  1IN4 A;  1LKX A;  4AC0 A;  1UMQ A;  4KMF A;  5DV5 A;  1DOW A;  2MWQ A;  4MW3 A;  1GT0 C;  4JW1 A;  5LBQ A;  2DFF A;  5HVQ C;  2VOO A;  1ZHW A;  1MBF A;  2O03 A;  3I55 I;  3OS0 A;  4BL0 B;  4HAM A;  2BHZ A;  3BEH A;  2CQX A;  1IN8 A;  2D2W A;  4BAY A;  5TJJ A;  4KDP A;  4XQ1 A;  1Z5Z A;  3DPL C;  5HNF A;  2UUZ A;  4DXW A;  2R7R A;  4BJ5 A;  2WY8 Q;  5FZT A;  1E3P A;  1RR7 A;  1ZR2 A;  1BW5 A;  5AIP A;  2XL4 A;  1E86 A;  1G2H A;  4GXO A;  2HI3 A;  5C4X J;  1Z91 A;  1TW3 A;  1HBX G;  4HOB A;  3QWL A;  2M4K A;  3SZR A;  2IJL A;  2YVK A;  4IKF A;  2OD5 A;  3BC8 A;  3KP6 A;  2NSF A;  3ESW B;  1P9Q C;  4IL6 C;  2CV0 A;  4OD5 A;  3NMI A;  3BJ6 A;  1RET A;  4DYR A;  1QVU A;  1OW7 A;  5B1A H;  1OKK D;  1YS7 A;  5KHD A;  4A3J J;  2HR3 A;  2IW5 A;  3IKV A;  1BC8 C;  2QLA A;  3TL4 X;  4JVS A;  3GZN B;  1OW6 A;  4MFD A;  5D8K B;  2Y48 A;  2IAI A;  4BJ6 C;  1ZR4 A;  2BXZ A;  4I3M A;  3ZQL A;  2K40 A;  4W8P A;  3EYY A;  2CFX A;  1NK3 P;  3H36 A;  1EA8 A;  5DLJ A;  2L9V A;  2LFB A;  1Z6R A;  2ZNZ A;  4ZYD A;  2Y0S A;  3CMM A;  3KEO A;  1S5L C;  2HZT A;  2GXB A;  1OCC H;  4J7Y A;  5B1B C;  2ZSI B;  4L5I A;  4ZJZ A;  2EIJ H;  4LLE A;  3ASN H;  5M5X J;  3LL7 A;  3E6D A;  1IGN A;  4RD9 A;  3I58 A;  3ZCO A;  4M3D A;  2JMW A;  5F04 A;  2ZXH A;  3TD7 A;  5JVG F;  3JTG A;  3J80 Z;  2UUH A;  4BU2 A;  5KYY A;  4L18 B;  1K05 A;  2D5R B;  1YJG A;  1XDU A;  5FGM A;  3JRB A;  4YK5 A;  3A2K A;  1FPQ A;  1XZQ A;  2X4H A;  4C2U A;  2DW4 A;  1MNE A;  1JMW A;  3W8H A;  3GTP J;  3F22 A;  3H9G A;  4EEF G;  5F1J A;  3GLL A;  4XK4 A;  4A3D J;  1KU3 A;  1OW8 A;  1BI3 A;  5KYN A;  4TV7 A;  3TKY A;  1IAW A;  1R4T A;  5EDN A;  3CDL A;  2QYO A;  5DUK A;  1D1B A;  2XKO A;  3ABL C;  4PZJ A;  2VCB A;  1T38 A;  4GYG A;  3GFJ A;  1L0O C;  1C17 M;  4LK0 F;  1FJL A;  5LEK A;  3GWL A;  4EAT A;  4FE4 A;  1YJ9 I;  3RVY A;  1NTC A;  2K9Q A;  1FEX A;  3HTU A;  4EJV A;  1ORS C;  5H20 A;  4P96 A;  3RKX A;  5DTD A;  5LD2 C;  1YLF A;  4GFB A;  1E0E A;  3SEZ A;  2FGY A;  2E1O A;  3FHN A;  5EYR A;  2WBM A;  5L3Q A;  3KP2 A;  5KAF C;  1A36 A;  3PQK A;  2O5R A;  2VCA A;  3UGP A;  2XHK A;  1WJA A;  2JRT A;  5CKT A;  5ILV A;  1J0R A;  4MHG A;  4RB3 C;  4GEH A;  4UXN A;  2HYF A;  2RN7 A;  3U1D A;  1Y6D A;  1I27 A;  2MSY A;  3ASN C;  4J32 B;  1MBK A;  4I98 B;  2CUE A;  4PFP A;  4CYC B;  4KN4 X;  4BBS J;  4PK4 A;  4B6I A;  1OQY A;  1ON1 A;  3C2H A;  2ISZ A;  4UY8 I;  2Z99 A;  3CLO A;  3F3X A;  4E7L A;  3VYU B;  2ZJQ F;  5D5X B;  3F8M A;  5IOY A;  4E0I A;  1HLV A;  1YG2 A;  2G7U A;  2TDX A;  4LD5 A;  3ZN0 A;  4M3E A;  2WB7 A;  4MVQ A;  2X6W A;  3G73 A;  1OYY A;  3EUK L;  3WE2 A;  3ATP A;  4C3I J;  2E2J J;  1DU6 A;  1R4N B;  3RQ4 A;  1HST A;  3QOP A;  4MQ9 F;  4A0Z A;  2ZBK A;  1Y39 A;  3V8L A;  3DAG A;  3U2M A;  3S8P A;  4P9F A;  4WXD A;  2HJM A;  2HV6 A;  3ERM A;  2YHS A;  4U5G A;  2YR2 A;  3HKZ A;  2FQ3 A;  2FQ4 A;  2DA4 A;  2WV0 A;  2VKE A;  2MC3 A;  4XRS A;  3T6B A;  3T6G B;  1ZGW A;  2XS8 A;  1U5T B;  4HF2 A;  3KIO A;  4WX9 A;  3ZC4 A;  4QI0 A;  1R6R A;  2EIJ C;  5A6B D;  3ABT A;  3LS1 A;  1KA8 A;  1G4D A;  2M7A A;  2GOM A;  1VI0 A;  2DI3 A;  3IH2 A;  1E85 A;  3BG9 A;  4JEB A;  3HNI A;  3GBG A;  4I09 A;  4IOA F;  2EPO A;  2HKV A;  3KE2 A;  3J7Y J;  1VTN C;  3P9K A;  2HOE A;  3BR2 A;  2OF7 A;  2B63 J;  2NUT B;  1Z21 A;  1R1V A;  2K4B A;  2XF6 A;  1JKR C;  3T9O A;  4RGX A;  1N75 A;  3N05 A;  4YRV A;  2GA2 A;  2ZXJ A;  4KC9 A;  4BDZ A;  3PFY A;  4IRH A;  2Y39 A;  1D1A A;  4CCO A;  2P6V A;  3DTE A;  2VKD A;  5EG0 B;  2HVQ A;  1ETY A;  1RRJ A;  4KN7 X;  5JVE A;  1SZI A;  4BEJ A;  1XB4 A;  1SFE A;  3DWL E;  4C30 A;  4C3J J;  2GFH A;  1GV2 A;  4ENJ A;  1KQ0 A;  5C4J J;  3PIO F;  4EKW A;  3ZOB A;  2EA4 A;  4JJG A;  3DKA A;  2KYH A;  1KU9 A;  3I5U A;  1XMA A;  5F1R A;  3JSO A;  1TNT A;  2XLD A;  5M3F J;  2NUP B;  2EFN A;  2LK2 A;  5H6Q A;  1ITY A;  2IYL D;  4CS8 A;  2ZFW A;  1LPQ A;  3AG2 C;  3LQR A;  4DRI B;  2JA8 J;  1IV6 A;  2XAG A;  4AX2 A;  5EEG A;  1HCR A;  1ZRD A;  3HSF A;  1G4W R;  2M4E A;  3H9Q A;  3DJN B;  1QU3 A;  4ONS A;  4Y4R A;  3KYI A;  5B3S C;  3C8G B;  2TCT A;  4EJT A;  1HW2 A;  3JTH A;  3QU3 A;  1APL C;  4A4A A;  3EH1 A;  4JK1 X;  3EFO A;  1WRJ A;  3VYS B;  2EPN A;  2QQA A;  1TWC J;  1X1B A;  3J7Z I;  4ER9 A;  3D5L A;  2FML A;  3BDD A;  5E79 C;  1WGW A;  4MLO A;  2J9V A;  3GTJ J;  1H88 C;  1H89 C;  3ZMS A;  3MFK A;  1VMA A;  4W97 A;  1XGN A;  1Z7L A;  1Z7Q c;  4I0A A;  4NTA A;  3ABU A;  4RLF A;  3L8I A;  1Y8Q B;  2XPU A;  5LFA A;  1UFM A;  2YPR A;  5E1W A;  5D5U B;  5B1A C;  2DMN A;  1X1D A;  4ENM A;  2K85 A;  1IDZ A;  2FX0 A;  3DV8 A;  1HY5 A;  2QE9 A;  4M72 A;  4U5H A;  2DT6 A;  2L2O A;  4D7N A;  2Z3Y A;  4UUT A;  3AG1 C;  5B3S H;  2HWV A;  1H9G A;  2ZJP F;  1MZB A;  5EF6 A;  3IRQ A;  2C03 A;  1HDD C;  5D92 A;  5BQH A;  2EA2 A;  1HDP A;  2HYJ A;  1TT5 B;  4JEA A;  2DDA A;  1HMD A;  2FA5 A;  3QP6 A;  1FYM A;  1PCX A;  1I39 A;  3DM9 B;  1X3U A;  3IEE A;  4CIH A;  4FE7 A;  1DU0 A;  1LI5 A;  3DEW A;  4WF2 A;  2F4I A;  3L1P A;  4XBF A;  3DD7 A;  3GEI A;  3ZXS A;  2F5E A;  2EIK H;  5TIS C;  1I4Z A;  2MW8 A;  2KL4 A;  5K5Q A;  1EKE A;  1ZHT A;  3K4B A;  5IY5 H;  2NXN B;  5L0I A;  1QVT A;  4EBK A;  4J19 A;  4YFX F;  2DK5 A;  1V5E A;  2XRN A;  4EV0 A;  2IA1 A;  3MVP A;  3N4M A;  1GHC A;  5IOZ A;  3N0T A;  4HX4 A;  1T98 A;  2L5Q A;  3ASO C;  1F1M A;  5JP7 A;  3M1E A;  1I3A A;  4PJM A;  1FIP A;  2B0H A;  1P4X A;  3AG4 H;  4MTG A;  4P6I C;  2ECC A;  4JX5 A;  4LOC A;  4PJN A;  3R4K A;  2ZME A;  2KJB A;  2UV1 A;  3S90 A;  1YJW I;  1LVK A;  3K1H A;  4BHB A;  4L9J A;  1U3E M;  3KP4 A;  4HE8 D;  3I53 A;  2XDV A;  1SFK A;  4M6Y A;  1QPU A;  4Z2Y A;  1D0Y A;  1TP4 A;  5F0H A;  1TFO B;  3DE8 A;  4AD9 A;  4JE9 A;  2QWW A;  3U9G A;  2HGC A;  4FX5 A;  1LVA A;  4A3E J;  1DOV A;  2WZL A;  4U5E E;  4A6D A;  3JRG A;  3RQE A;  2HXO A;  4IO9 F;  4WGY A;  2LQG A;  2DAO A;  2NUP A;  2HU9 A;  5EEA A;  1S29 A;  3M3Y J;  2XRH A;  5DD8 A;  2Q1Z B;  3QYF A;  3CZ6 A;  1IRX A;  3I0T A;  3I59 A;  2P5L C;  2JVG A;  3JRH A;  1Y6I A;  1XDS A;  4U7B A;  2XLV A;  2A1D D;  4XLE A;  4Y33 A;  1Z6A A;  3K6B A;  3CMA I;  4AID A;  3SZT A;  2JZY A;  2EZL A;  1QKR A;  2CCY A;  3GM2 A;  2BGC A;  2EBI A;  3JRF A;  2LIG A;  3DKW A;  3IC7 A;  1ZU5 A;  5EHH A;  4LLC A;  3EZH A;  3H0D A;  5KNL A;  2WAE A;  2Y3D A;  3HJC A;  1MBE A;  3CJQ B;  3ZMT A;  1PD1 A;  4UVC A;  4KUM A;  3T1B A;  3FK6 A;  1ETQ A;  1D5V A;  4U5B E;  1O3R A;  2IS2 A;  2LY9 A;  3K1I C;  5DQZ A;  1QZE A;  4HW0 A;  4IHV A;  3EGX B;  1YX5 A;  1QHH D;  1T95 A;  2FMY A;  3F6V A;  4FQG A;  2PBE A;  2YSR A;  3HUG B;  2A07 F;  2P6T A;  3DU6 A;  2HQ5 A;  1OR7 A;  2Y9Z A;  1G4U S;  5DQT A;  4BS9 A;  4CSA C;  3UKG A;  3A11 A;  3I59 B;  1YYV A;  4IVN A;  3K4J A;  3NKE A;  1T5O A;  3GEZ A;  3K0L A;  1T6S A;  3K9T A;  5M5W J;  1HOM A;  4KI2 A;  1FTZ A;  5F27 A;  3V42 A;  2JPB A;  3L2W A;  3H1C A;  2NUT A;  2OQM A;  1JE8 A;  1FSH A;  2WL8 A;  3A9C A;  2KQR A;  2M9H A;  1RCP A;  1KON A;  2OZU A;  2JVH A;  1K4S A;  4Q5S F;  2VC9 A;  4JJF A;  3G71 I;  3RVZ A;  5M3M J;  2M5W A; 
#chains in the Genus database with same CATH homology
 2OJE D;  1R5I D;  2ICW G;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...