2ICWG

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
MKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 80
structure length 213
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2icwG02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2icwG01
3KPHA 2ICWG 1R5ID 2OJED
chains in the Genus database with same CATH superfamily
1IJWC 2XAGA 2Y39A 1XD7A 2M9HA 1WJAA 1FTZA 3TW7A 2DB4A 1BOAA 3BG7A 3VM6A 2DA5A 4D5FA 1LM3B 2LY1A 1IV8A 4EEFG 2DODA 4IO9F 1G4DA 2CFXA 2VIXA 3RQFA 1VI0A 2TCTA 3K4CA 3JRAA 3L2QA 1YW9A 2GXAA 3HZJA 5LEKA 2LY9A 4LDQA 2JVHA 3EETA 4P9FA 3K1PA 3HTUA 4BH9A 3UGPA 1IUFA 3L09A 3NAUA 4QTRA 1OQCA 1R49A 2WVOA 3ZSUA 2PX0A 2JWTA 4MNDA 3KL4A 2EB7A 3H92A 4L5JA 1PDNC 2PNOA 1W4MA 4G9YA 2HJMA 1W5TA 1M6TA 1Z23A 4GO1A 2LBFA 5E8IA 3ABTA 4O79A 4ZDPA 1AU7A 1O5HA 3F8CA 1Y4CA 3H2UA 2HDWA 4IHVA 2HQRA 3GTKJ 5D5UB 1VQOI 2Y75A 4G8XA 2JD3A 4LMYA 1SMTA 4AIKA 3BC8A 3ZN0A 3GORA 5IOYA 3P9CA 2KGOA 2GIZA 1K4TA 3H0GJ 1QKRA 2M4EA 3H9JA 3ITFA 2IXNA 5FLVA 1AVOB 3WU2C 4G7HF 4M73A 1ZELA 2P0WA 1ZU5A 3RI4A 4RLQA 2GFHA 3CJTB 2R5ZA 3CP8A 5JR3A 5E1WA 4A6DA 4GFBA 4PCQA 3V7OA 2IOQA 2X1CA 2F4OB 2QA4I 3HDDA 1X1CA 1KYZA 2ME0A 4YFKF 1SFOJ 5JP7A 3ASNH 3HRTA 1KTMA 4YEJA 2E1MC 1I3QJ 5GAHJ 4MEXF 5KYYA 1J5YA 3L7WA 4BQNA 4JIOA 3CQZJ 2L9RA 3F8BA 3S1QJ 2XS1A 1E86A 1I6XA 2VKEA 2WZFA 3C63A 4XOTA 3HTKC 2KNHA 4GDFA 3S3MA 4B8XA 1A6IA 3N24A 2R0QC 3T1BA 3ZQGA 1BJAA 4YIRX 4I76A 5EGYA 4A3IJ 3QQAA 4IB4A 3DBRB 1WCMJ 2IA0A 1HY5A 3EHMA 2YRFA 3PO3J 1PP7U 4N06A 5IY5H 5DUKA 4O3MA 1EF4A 3L0IA 5CYVA 1REPC 1G5ZA 5K1YA 1OR3A 3T8TA 3LS1A 4JCZA 4Q4ZF 2Y9ZA 3F9KA 3T0YA 3SQNA 3FVYA 1M2OA 1Z3XA 2OQRA 2GDCA 3C3WA 3QP5A 4QPOA 5F0FA 2I5UA 2V26A 2BC5A 3A2KA 4OIPF 2DW4A 2KDZA 3KH2A 4MHGA 3PIOF 1QPUA 1E17A 3ESWB 3D1NI 3DM5A 4CS8C 3MBGA 3SDGA 2XAFA 4LLLA 2LY2A 1Y0NA 2VB6A 2DPUA 4CCOA 4HQMA 4XK4A 4E70A 3JRBA 4KNYA 5A6AA 2XROA 1J9IA 1Z91A 2VBXA 1R36A 1OR7A 3BOQA 2ZKZA 2O8XA 4C30A 4BEHB 4XLFA 4X0GA 1MDMB 3E1SA 2EPMX 1U6HA 4EWCA 1ORSC 4DBRA 4PFOA 1WASA 1BI3A 2V79A 3FX3A 4U5BE 4U5FE 1XGNA 3ECOA 2GLOA 3UMKA 1E83A 2ZXHA 1TQIA 5FD6A 1ZG3A 2M0MA 3G2BA 3TDUC 4A2UA 2R5ZB 2ETHA 3M1CB 2E1NA 4IF4A 3DJUB 2M4KA 2YU3A 2Q00A 1ZAOA 4G7ZF 3PNTA 3EGDB 1XGSA 1XS9A 2MD0A 1ZHWA 3IKVA 2H6CA 3KP6A 2Z5UA 2JA6J 1HF0A 2I15A 3JW4A 1YZAA 4I02A 3MFNA 3T6BA 2Q3TA 5E3LA 5DD8A 3AOUA 3V4GA 5IP9J 1PVEA 3IAS2 2CH0A 1JR8A 1VTMP 1VQKI 2O8KA 3EG9A 4J32B 2NUPA 3QW0A 3K4NA 1LFPA 4U0VA 2LNBA 1L7CA 4RM2A 5H20A 4LITA 2M8GX 4QWQA 3IRQA 3U3BA 1HLVA 2F4IA 3R6SA 3RFYA 1JT0A 1QQ3A 1O3QA 1GT0C 3H3UA 2K02A 2EPFA 3ZP5A 4IHYA 4RM3A 3Q9SA 1F43A 1P4WA 2L9SA 1GGQA 3TKYA 4U5HA 5K0IA 4KT5C 5KYWB 3V8JA 4CS7A 2KZVA 1JMWA 1V4AA 3HTSB 4BY1J 4O6NA 2J9BA 2YX4A 2DA1A 3NDBB 2FBIA 4M6YA 2J46A 2ADUA 4CX9A 2DA2A 2Q8KA 4MLOA 2IS6A 3I54A 2E2HJ 1Q0FA 5HS7A 4RGRA 4GYIA 2PEXA 3IC7A 4MVZA 1KU7A 3LUTB 1U9NA 2KIQA 5F28E 2H27A 4NQWA 3MKZA 1USTA 2L9NA 4JX4A 3RCOA 2P0NA 4R32A 4BJ5C 2DOAA 4M3EA 2LFFA 4KIGA 1JKOC 1ZG5A 3VSKA 1DU6A 3RIRA 3WHCA 4YT2A 3V7RA 1R4MB 1R22A 5KYXB 3GEHA 4XWJA 3DD7A 1MNMC 4MW3A 1TNTA 2WADA 3SYNA 4ZZDA 5ERIA 4UV8A 3AG1H 1YW7A 2HYJA 1G2HA 2AP3A 3DAGA 2ECBA 3WHBA 3TMOA 1R00A 2QTVA 3WTZA 1JTXA 4ETSA 3S3NA 4GCVA 4LIUA 4NTBA 5ED4A 3OYEA 2FQ3A 3DZAA 4A6EA 4JKVA 1TWCA 3W4YA 2W1OA 1Z9CA 4UVCA 2XAUA 4A69C 2E35A 3HOVJ 2H8AA 3FXJA 2HU9A 3US6A 4F3QA 1YRNB 4OOIA 3EH1A 5FCLA 4WX9A 5L3FA 1TWGA 1TWHA 3K33A 4FCYA 4QI0A 2EIJC 3TP0A 3L2VA 1DQUA 3CO7C 1NSGB 3RPUA 1Z05A 4YFXF 1VMAA 4A3FJ 2IXPA 2EA4A 4HV5A 4S0HB 3LEVA 2R92J 3VAYA 1ZG1A 1MBGA 3SYTA 4X0RA 3CJQB 4RLFA 2FQ4A 3DM9B 4NTFA 2M7AA 1U6GA 2HXIA 3O3KA 4C7OA 2Z99A 4LOCA 1M57C 1VLTA 5F0HA 5EGOB 1OCRC 5BQTA 4N0BA 4N4OB 2H1LA 3CUQB 1B4AA 1Z3YA 2EV6A 2K3PA 4Y4RA 4JW1A 4OMZA 2EIMC 3C7JA 2JJ7A 3H35A 1XB4A 1I27A 3DWLE 1JTYA 2DOFA 2W9YA 2LF8A 3LQQA 2EIKH 1MMSA 1DPUA 2RD9A 3EGXA 3V5ZA 1YS6A 4FETA 3M9AA 1P92A 2VBYA 4Y15A 3H1CA 2XGEA 1VK5A 1VQ4I 2G0EA 3FBIB 2XAJA 2PBEA 4J7YA 2XM0A 1G59A 2KKOA 2ZXWC 2EIKC 3RKYA 1LFUP 1SFXA 2Y0SA 2KT0A 3QMKA 3ABUA 3MKWB 2M2EA 2PN6A 1PJRA 1RNLA 2KZGA 2RVCA 2N8GA 3DP7A 3DPLC 4Y33A 2KRHA 2L7KA 3TBIA 3T6GB 3ML6A 5L3DA 4I09A 1MH3A 1NK3P 1FR0A 5TJJA 3ZQ7A 2CU7A 1EH7A 2ELJA 2M30A 5IYBJ 5E3OA 1T8IA 2HVQA 2M1BA 5IOZA 4IHTA 4V2GA 2NRAC 2WB1A 3RQ4A 2Q1ZB 2Z9OA 4XRSA 3V8KA 3J80K 2K5CA 1KNYA 1WHUA 3LSTA 3Q9VA 2GAQA 4IOCF 1WJEA 3NWSA 3FDYA 2L9VA 2XM4A 3QTHA 2RKHA 3HSRA 2ZNYA 1GV5A 3ELKA 4A3CJ 1QZEA 5EG0A 3AG3C 3RYLA 1JHFA 3X1OA 3JRGA 1GVDA 2A6HF 4Z9HA 5HSWA 3G71I 4RDUA 3QP6A 5ILSA 5HLHA 3S17J 5T1DB 3FMSA 4MVUA 3TQOA 5L0HA 5KVRA 2RREA 1A41A 3I55I 3CC7I 1FOXA 1PP8F 4XRSG 4BQOA 3HL2A 2PFBA 3CUQA 5DQTA 3VFZA 5HODA 4FESA 3T5XA 1IRFA 5FROA 3E7LA 2IS2A 5JLIA 2IGOA 2GWWA 3I4UA 3RDIA 1XC5A 3K4KA 3FXOA 2IEKA 1OCOH 3GVAA 3KP4A 4AIJA 2XAHA 2A61A 3ZQLA 1YI2I 3F8FA 2VBZA 1WTYA 3MYIA 3EPVA 2ZFWA 2VN2A 3NKEA 1I5ZA 2MW8A 3JSEO 5KCMA 3J7ZI 4N4NB 1AHDP 2G7HA 4PGGA 4XEFA 2A0UA 2CNWA 1W7PB 1TWGJ 1TWHJ 1FP2A 1IN7A 2EFNA 2HKOA 3ZQFA 4AIDA 1W5SA 2DO7A 2VKDA 4Y3OA 4FASD 2IXOA 3JRMO 4DIQA 2PFDA 2MWQA 4CHUA 1VQ5I 3K1HA 1TWAA 5E20A 5BQIA 3H9GA 3DLLF 4OU0A 2CV1A 4Y52J 1P4XA 1NU9C 3ZMSA 2IA2A 2DMNA 1OKRA 2BY1A 3R0JA 5DS9A 1G4US 2L6HA 4CCKA 2NG1A 3UR3C 3H5NA 1DOWA 4UDVA 2YL1A 3DTKA 4AD9A 3WTWC 4J7TA 4AE4A 3KCCA 1B68A 2FA5A 3C2BA 3U8PA 4XBFA 5DEQA 2XXAA 3GW2A 3LSMA 2Y30A 3VSLA 1RKTA 4C2MJ 3DKXA 5C3EJ 2F22A 1T95A 1TW2A 2NOJB 4EMSA 1ZREA 1NHAA 2P7VB 1A35A 2YPRA 4U0WA 3S3OA 1A7EA 2R25A 3FOOA 3ZQQA 2CW8A 3VYUB 4UV9A 1MW7A 5F08A 5KHDA 4HRIA 2B0JA 2OJQA 2L9JA 2ZPAA 4XPXA 1JKRC 3H5RA 5B3SC 2OTJI 1HSJA 2R7WA 4DXWA 5BUOA 3QYFA 4RD9A 1CF7A 5J1RA 3IH4A 2KLOA 2L02A 2E5NA 2LSEA 3JTGA 1UHWA 1R4TA 2L7ZA 2ETSA 4J30B 1HQCA 2KL4A 4LD5A 4LDKA 3TJ6A 4BPMA 5F27A 3LSGA 3M79A 4MQ9F 3CCMI 1ZVZA 2YEVA 1SAUA 4II3A 3A01A 5ICFA 5HDNA 3AG2C 3Q5FA 5AC4A 5HS8A 3ASOH 4L9JA 1OFCX 2P1AA 3CDHA 2CYDA 4ONSA 3HOUJ 2EFOA 2VQGA 3DEUA 5GTHC 4CUGA 4ZH4F 2FOKA 4EGYA 1OR2A 4EIYA 1D0YA 3MZYA 3MQ0A 3HHHA 4EGZA 3RKXA 5L3EA 4OD5A 5L0JA 4BQAA 4AYBA 3JSZA 1NG7A 3FK7A 1VQLI 3KYDB 1CGME 1DU0A 1HSTA 2DU9A 4YFNF 4P5OA 5L3QA 2OCCH 3ZQCA 2FU4A 1BOBA 2EFPA 3U1DA 1ETQA 2K3FA 5TISC 4HEA2 1POGA 4HPQA 2CGEA 4AX2A 4O6JA 3FXMA 1YRNA 1ETKA 3Q3SA 2IS1A 3NRHA 5FKKA 1YO5C 5E2QA 2DT5A 2VXDA 1SR2A 3HB9A 3EHNA 3WTTC 4BUPA 4YT4A 4MW8A 1YYVA 1KONA 1XDUA 2BEOA 3FXQA 1CGOA 1VYIA 3S90A 2IW5A 3BR3A 1J8MF 2G9WA 2LLKA 3K1MA 2QENA 2WAQA 4KA4A 3G50A 2XPVA 2BE5F 5FFZA 4D7NA 2OEVA 1UMQA 2FD5A 2DYRC 1W1WE 4B1RA 3M4OJ 3GODA 1FYLA 1QU3A 2OEXA 4XQ1A 1YDIA 1FBUA 5FLXZ 1STZA 3TOLA 2FMLA 5LLQA 2QE9A 2MH9A 1MZBA 3I59B 1T98A 3GZNB 1T39A 4Q48A 4EHPA 1JAFA 3UMHA 4J01A 5M5WJ 1E85A 1FEXA 3AQCA 3I53A 1SZIA 3DQVC 4BG0A 2XVCA 4CDYA 3E3VA 3COAC 2JT1A 3V5YA 5D8KB 2CFOA 5CVIA 2BBYA 3H0DA 4O7GA 3KEYA 1K79A 3NKDA 1XDSA 3TJ5A 1V54C 2H1KA 3H3ZA 2CNWD 2BYVE 1LEAA 3GTPJ 1ZGAA 5EF6A 4HSRA 3J7AY 1FTTA 4CJGA 1YHQI 3HKZN 3B73A 1K6YA 2DBBA 3A0BC 4E7LA 3GTLJ 3G4XA 1TNSA 2E34A 2V9VA 3B6CA 2L5QA 3SFZA 3IH3A 4BEMJ 3A0HC 2XSEA 1NZEA 4HX7A 1TQMA 1JUMA 1WJBA 5F64A 2AS5F 1J7KA 4I2OA 2XF6A 2QSFX 3K1IA 1OLTA 3TO6A 5JVTA 3BDDA 1I1SA 1BDJB 4I3MA 3BR1A 3IHUA 3N97A 3IWFA 1XZPA 1QPIA 4GYGA 1OW8A 2K9LA 3JRFA 2YKZA 4EKWA 1X2NA 2XLOA 3ECSA 2W00A 1I6HJ 3AL0C 1GQAA 1UB9A 2EINH 2KISA 1ON1A 3CCJI 2HVSA 1ZH5A 3BRJA 3K7DA 5F5FA 1QLEC 4RGXA 3I5UA 3G6EI 2XS8A 3NMKA 2MBFA 3QW1A 1WSUA 3BCAA 4G6DA 4ULWA 2L6GA 1FT9A 4LG0A 1FZPB 4HNUA 2ZXOA 2NVUB 2EFWA 2YWAA 1O7FA 3FZVA 2VJ5A 3Q7LA 3B02A 4L0ZB 4KNWA 1ONVA 2HOSA 1HA8A 1BL0A 4A3DJ 5F1JA 4YL3A 2VBWA 4OINF 2R7UA 3KKBA 4LIVA 4E17A 2V1DA 1RXQA 3SXYA 1T2KA 4AM3A 4OIQF 4CDGA 2D4UA 4GEHA 1ENHA 3FHNA 2RNGA 4LK1F 4UY8I 2Q2EB 3GO5A 1H0MA 3U2MA 3K4JA 1D5VA 3HXLA 2F48A 2ZNZA 2QLAA 2AU5A 3CCEI 4BJ6A 5L3VA 3BPXA 3QPSA 3SZTA 4DNCA 1X1PA 1V4RA 4I99C 4PR9A 3ZIBA 2DA3A 5GPCA 3U2RA 2QSHX 2EILC 5LRRA 1A6QA 3B0UX 4C3EA 1YX3A 3HKZA 2KP6A 5GTIC 3GZ5A 2YX7A 1U8RA 4JEAA 4KISA 4CYCA 2L81A 4A4AA 2QKLB 3K1IC 2YLDA 5E17F 1ZRFA 3FMQA 3NMJA 1UFMA 5GP9A 1Y0UA 1J59A 3HM5A 4FX0A 5GAEJ 2L6FA 1ETWA 2ID3A 1WI9A 3OSGA 1ETXA 3OL4A 3F46A 1RETA 5AGFA 1SANA 2QBYA 5J40A 1WH7A 3BR0A 2E36A 4M6XA 2MA3A 1PCXA 5JSLA 2WTEA 3FXHA 4NUBA 1V5FA 3QOPA 5B1BH 2FOWA 3KP5A 2FAPB 1LDKB 1UG7A 1NFOA 1Z6AA 2B0LA 2JX0A 2JA5J 1ZR2A 2X9DA 3BY6A 4I1MA 1OXKA 1H8AC 3F3XA 2DFFA 3I4NJ 1OYIA 1QZXA 1I4YA 5LEJA 2X51A 1CGNA 3RZDJ 3NQOA 1OCCH 2Y3DA 4YG2F 4UUSB 3BEHA 4HFKB 3GWNA 1T0FA 4I0BA 1HW5A 4CCNA 3PJRA 2XLWA 2OU2A 3S1MJ 2XKOA 2IGMA 3D5LA 3LSJA 1QVXA 4IRGA 1Q1HA 2CSOA 3V42A 2QQBA 3HGGA 1USSA 3E6CC 2BY0A 3KP3A 3D0SA 3HNLA 3BG3A 3LAPA 1K04A 1TBXA 2VC0A 2Y3HA 1SF8A 3WGIA 4U9DA 2FJ1A 3AG3H 3TP3A 3V7SA 4YRVA 4IQJA 2MSYA 4GGGA 3S15J 3VDXA 4IRIA 1U5TA 3MCZA 1WN0A 3LOCA 3VYWA 4MTEA 2E5ZA 1ZRDA 2ZD9A 2ID6A 1KGSA 3WODF 1DDNA 1LVKA 1ZHFA 2HGCA 2WY8Q 3U1KA 2EINC 3OR1C 4IL6C 1RESA 4EJOA 1S6LA 3TK0A 2JMWA 1QBJA 2BV6A 2UUZA 1H9GA 4FAPB 3F6VA 2P4WA 1IRXA 4C2TA 4CO8A 4ZLDA 2J45A 1A5JA 4PJMA 2XC7A 1C02A 2M4GA 4AC0A 1UHSA 2FBHA 4W8PA 1FMVA 3CCUI 2OZUA 2NSGA 2PMUA 3BR6A 1J8YF 5F5HA 4IJJA 3UNGC 2Z1DA 4M9XA 1XG1A 5F04A 4KI2A 3G4ZA 3FXUA 5IT9K 1EV7A 1MBEA 1VFCA 3CZ6A 3DTIA 1HW2A 1DP3A 1LQ1A 2E7WA 2OCEA 4E7HA 3M4BA 3VEPA 5DS5A 2KK1A 4ZDLA 2KHMA 3I5PA 2HTSA 2Q0OA 1E3OC 1HKSA 4CGZA 3B9QA 5JFRA 3P7NA 5FZTA 3HNKA 4M3DA 1OPCA 3PSFA 4L9NA 3QVZA 2EBIA 1OJLA 1Y6DA 1S9HA 2I8BA 2FNPA 2V7FA 1U78A 1MNDA 2MHRA 2X0CA 2GWRA 3DTEA 3PIPF 3J7AO 2VCBA 2MH2A 1VQNI 5KAIC 2R93J 4LGWA 1O57A 1IDYA 4U87A 3S14J 4LK0F 4JTCB 2VKHA 3N05A 2DA6A 4JYKA 4IHWA 4A0XA 4ANJA 2O03A 5D8LB 1TKNA 3LNRA 2NYXA 3AG4C 2EZIA 2W25A 1WKMA 2O3FA 2QGUA 3ONQA 1I1GA 1TW3A 1AUEA 4BHPA 2ACJA 2VUMJ 4HNTA 1YLFA 4WGYA 3M8JA 4JJGA 1X58A 2ME6A 4KC9A 5CI8A 1F9NA 1S7EA 3E5XA 3GLXA 1ORJA 3FF5A 2AHQA 2VLAA 1SFKA 1TT0A 1YTYA 2XF7A 3ZWIA 4M3BA 1F36A 3HRMA 4D5CA 2W45A 3NEUA 3DBHB 2OOCA 4YK5A 1T56A 4RB2C 1ZQ3P 2K9MA 5LBQA 2TRTA 2OQMA 1A04A 3TOMA 4MTFA 4E7JA 1BBHA 3IQ6A 5A6KA 4BE2A 4RDAA 5GPAA 4XLEA 3JR9A 2XRNA 2RDPA 3D5RC 3Q0VA 1IV6A 4XM3A 5EZHA 4F91B 2NUTB 2WZGA 4XTKA 3I0TA 4EQQA 3BJOA 5C44J 2UUIA 1JJ8C 2NNNA 2CW7A 1LE2A 2YZSA 1JJ6C 4DVZA 5F0CA 1XX5A 4G7OF 4BXXJ 2TMVP 1O3SA 1B72A 2L01A 2K27A 2QM3A 2JZYA 2LRDA 3I3LA 1MBKA 1YG2A 2DDAA 2P81A 4XLPF 1BC8C 2NVQJ 2V1UA 3ZG1A 2XLEA 2EK5A 1FLIA 4LLEA 3S29A 2RV8A 4QIWN 4ENNA 3W2WA 4E0IA 2FF4A 2JUCA 4IHSA 2A05A 1F1MA 3R61A 4BGDA 2FXAA 5HDGA 4CA0A 3HIFA 4B4CA 4EJWA 4XRMA 1JKQC 4HFFB 3LFUA 5DD4A 3JTHA 4OMYA 3PSIA 3CEXA 4M63A 5KYNA 5EGOA 4TV7A 2ZXPA 4RA2A 2I8DA 1SD7A 2A0BA 3GEEA 1BR2A 3FXRA 1MH4A 1LI5A 1LE8A 5ILUA 2BGCA 4MFEA 2Y31A 2K9QA 2BW3B 1B8IA 1ZLJA 5HV9A 3L2RA 2WV0A 2JVGA 3PHF2 2AQFA 1ORYA 4RBOA 4MVMA 3G1OA 2CO5A 3VB2A 2R7VA 1SYQA 2EPKX 2W57A 3CC4I 2PP4A 3JRDA 3HNIA 5HNHA 4EM1A 5FLXK 1O87A 1B6AA 4CZCA 2VT3A 4H0EA 1RJ9A 4XN0A 3CMMA 2LC2A 3EYYA 2OBPA 1OYWA 2NS7A 2X6WA 3K9TA 3MLGA 4IX7A 1LKXA 1PUFA 1A31A 1SEUA 3PUFA 3ZVRA 1QNTA 1GVJA 2L2OA 1QZZA 3CO6C 5JHUA 3CLQA 4IARA 1HKQA 1WJFA 4P6IC 2Y3BA 3R4KA 2FMYA 2X6YA 4ESBA 2CJJA 1VQPI 3K4BA 3WG9A 3GFJA 4KFCA 2MGQA 1BJZA 3LNQA 5FKOA 4EV0A 2ZXRA 4KBLA 2J9VA 3FAJA 2VJ4A 4DGWB 4U5DE 1YS7A 3S28A 4GXOA 2WVQA 3GBGA 2P6VA 3JYYA 2NUTA 2V3CC 3TOBA 1TFKB 1Y1VJ 1NG1A 1YAUO 3M4CA 2O9LA 2EPLX 4LJZF 5EK0A 1LUJB 2EZLA 2E87A 3HPGA 1MJAA 1RKWA 3OV8A 1LS4A 1T5OA 5TGTA 4YELA 3U0CA 4A0YA 2K7LA 1JUPA 2XLHA 3E5QA 1V74B 1FJLA 3L00A 1QSPA 4C3BA 3PFIA 2HYFA 2A68F 3SZGA 1JKPC 4HX8A 4XONA 5F6FA 2VODA 2JPUA 4I01A 4I44A 5J8CA 3HOTA 1G8XA 3MKLA 4G78A 2LK2A 3L34A 5IP6A 2OKUA 2BZTA 2DT6A 3QOEA 4ZYEA 4JZAA 5CLSA 1WJ5A 4ZLCA 2EV5A 2R02A 1Y8RB 1J0RA 1Z67A 5K5RA 4CS9A 5DYMA 4HQEA 3S1NJ 2IA1A 2KC3A 1S05A 3SDBA 4UVBA 3J81Z 2J7PA 1YJWI 3OL3A 4Z6YA 2VPRA 2KRCA 3S8PA 4II2A 1JXSA 3WU1B 4QI2A 2LBFB 1UG2A 4BJ5A 3ABMC 2EQRA 1WVRA 3DKAA 5HS9A 3ISPA 2F6CA 4BJ6C 1T38A 3KYIA 3KP2A 2COBA 1IN5A 1WPKA 1ZARA 1GM5A 1BI0A 5B1AH 1KU3A 3JAMK 4E6KG 1W36C 2KIFA 1VLSA 1YARO 5EEHA 1MMAA 4ZTJA 2IBDA 2VJIA 4L0YB 2B0HA 1PUFB 2IRFG 4W97A 2H94A 1AOYA 1HDPA 1S29A 4F93B 3G1LA 1W5CC 3ULQB 5JVGF 2ZJRF 1N78A 2QLZA 3CD6I 3QYBA 3KIOA 1FBQA 1D5YA 1G4WR 2O5RA 1ODDA 1UG0A 2HTJA 3OMYA 5DM7F 2JA8J 4XSXF 2HOTA 2DQLA 3FAPB 4N6CA 1Z0XA 3OYCA 3OOPA 3K6BA 3QPLA 2VCAA 2OQGA 3JRIA 4QDLA 2Y2ZA 2HS5A 4OD4A 1E3PA 4WCGA 3F23A 3VPRA 1TWCJ 2M45A 1MJBA 5FRMA 3IP4B 2DMUA 1Z7UA 3BLYA 2STWA 2F5DA 4ENMA 2MD5A 1T6QA 4IKFA 1FWZA 3EUAA 4Q5SF 4DW6A 2Q9BA 1KU2A 3CESA 5BS6A 2Y48A 4XNFA 1MMNA 2HFIA 1N25A 3LA3A 1WGWA 3O55A 5LFAA 4I6ZA 3OA1A 3CDIA 3R7CA 4BJ1A 4L5EA 256BA 4UHTA 2AXTC 3FDQA 3A02A 3PL8A 2QCOA 3E6DA 4XN3A 1MNEA 2FX0A 3BTCA 2CW0F 3ECHA 4HNVA 5M5XJ 4MTOA 1YJGA 1I3AA 5K7FA 1FOYA 2Y69H 4DYQA 2PJRA 2YSRA 1WJDA 3PNYA 4IQ4A 2V1XA 2G3KA 2FUG2 2HNHA 5JLXA 2HJ3A 2RN7A 2EPOA 2IBFA 1FC3A 4O6YA 2LFBA 3KYLA 2OPTA 1SMYF 2J0XA 2GBYA 4AK9A 4F4BA 3OS1A 3EGXB 3LNMB 2D1VA 4EJVA 2DMQA 4E7ZA 3B0VC 2XAQA 1E84A 1A7VA 3KMIA 1XCBA 5C4JJ 2ISZA 2LSOA 2P5VA 5LRSA 3KE2A 1NU7D 5DTDA 4D4XA 5COMA 1XTAA 2F5CA 3ZGKA 4BEHA 3ROUA 5J4VA 2LP4A 3AJMA 3EZIA 3MYFA 3J80Z 3GM1A 3CCSI 1MDMA 1P7IA 4NNJA 4A3EJ 1LI7A 4ZZLA 2JPBA 5IYCJ 4AYBN 2ICWG 2LREA 3J7YJ 2P7VA 3HRUA 3JT1A 2JSCA 3DXJF 1GS9A 4XIDA 4YL0A 2IAIA 3BR5A 3EGDA 4EATA 1OMIA 1YA7O 4DZJA 4U7BA 1D8KA 2G62A 4MNUA 1Z3IX 2KJGA 4BDYA 2DMPA 5J8FA 4IJAA 4CSAA 1V54H 1P6RA 2E2IJ 3P9KA 3CSKA 5FKNA 1TQGA 2EH3A 4ULVA 5TJ5E 4WK8F 1QA6A 4HA8A 5BOXA 2R05A 1R6RA 4JE9A 3HBLA 5LGNA 4MVSA 5D5VB 3EFOB 4U88A 3MD2A 3DPUA 3E97A 3L1PA 1HXDA 1JT6A 3FXLA 3DKWA 4BYYA 3FKJA 3RTRA 2GAUA 2RC4A 1BW6A 4P1WA 4EBJA 2DTZA 3K2AA 2X48A 1P2FA 2GA2A 5JLWA 1Q0DA 4PUSA 2LMDA 3U21A 4DZPA 2XSJC 3NRVA 2PF4E 5KK1A 4B48A 1VQ9I 2HSQA 3S0XA 5JI6A 3JRCA 3JSPA 2H8RA 4DOZA 5L0GA 4MGRA 4KMUX 1MMDA 4PZJA 4WXDA 3ERMA 1YYJA 1HC8A 2VKVA 4IHXA 4R1HA 2VC1A 5DCFA 1K7AA 2JN6A 1T6IA 3U9MA 2KYHA 3ZOBA 2VC9A 3I58A 1RI7A 2VASA 2LP0A 1OCTC 2CQQA 2GIVA 1BR4A 1LB2A 3CQZA 2DYSC 3JYHA 4Q7CA 3Q0UA 1C03A 3MN2A 2TDXA 3GYHX 1U8BA 1QVUA 1NTCA 4XKVA 4C9YA 4JTDB 2XXAB 3J81K 5DUIA 4I0AA 3N2ZB 5J1UA 3W6JB 2WL8A 3B29A 2HZDA 2FEZA 3CLOA 3C8GA 4GQHA 1QZYA 1WFXA 2ZCWA 4PSXA 4CZZA 2FGYA 4EJTA 2ZSHB 1ZGJA 5E79C 1K6OA 4OAYA 2E1MB 2OCCC 2JA2A 2XHKA 1OKKD 1IRZA 2R7TA 3FKIJ 2QYOA 1JPNA 1RKEB 1MSFC 3OYMA 4MQVA 3KLNA 3HYIA 5IY5C 4UUTA 2ZB9A 2UXNA 1LE4A 2R5YA 3DI5A 1ERDA 1YYXA 2D1HA 2P8TA 1OW6A 1IC8A 2MC4A 2QEXI 1RRJA 1ULYA 2K4JA 5CVJA 5BPDA 4N6HA 2OD5A 4AU7A 1QQIA 1GXPA 5JRAA 3L2WA 3KETA 3DJNB 4HV6A 1ITYA 4G12A 4Z9JA 2VE9A 2L4MA 3ZMVA 2H7BA 2XRLA 6PAXA 2BHYA 3WTYC 3AGTA 4IWBA 3W3CA 5FJ8J 1IO2A 1YLMA 4MEYF 1YZCA 3EUHC 1BZ4A 2XRHA 1NFNA 5B1BC 3JSOA 3AGUA 3HNJA 3S32A 2DQRA 1XCVA 4MTGA 4G6QA 3RQEA 4JEBA 2A5WA 3GWZA 2R7FA 5BNGA 4D9JA 2ZXJA 2ELHA 5JVEA 3GCMA 3HSFA 4HBLA 3SZPA 1SAXA 1I39A 1OCPA 5FGMA 3WTXC 2Q9AA 2F5VA 4CICA 9ANTA 3DE9A 1YIJI 2DDBA 1EH8A 4NHJA 5E3CA 1P7JA 2BXZA 2HFHA 2VOOA 2FFHA 3C2HA 4XICA 4A5MA 4S05A 4FQGA 2Y0SN 2VQLA 3U8VA 2EILH 2YL3A 1OCOC 1Z7LA 3QU6A 4LDRA 4LFUA 5T3WA 4FE7A 2KQRA 3ABMH 3MWMA 3BTIA 4FE4A 2WC2A 2QQAA 2QUFA 2L3DA 3K69A 1GLNA 3JCUC 3VODA 2NUPB 3JCUQ 1V55C 2QZ8A 3GFMA 5D92A 4RB3C 3ZN1A 4ZDOA 2COMA 3GZ6A 2NVXJ 1ZYRF 3TD7A 1ORKA 2H09A 4BHCA 3PDMP 1YOVB 4BY7J 3HUGB 1IN4A 4B47A 4CSWA 2B7EA 3IAM2 3AKZA 3IQCA 2UZKA 1NLXA 2OUMA 2W82A 4BE1A 1ZU4A 2WAFA 3BTLA 4A12A 4XKCA 1APCA 3RKOF 2LCHA 4IEJA 3C1DA 1B8IB 5L0IA 2XL4A 4UVAA 3EPZA 5JUAA 4BKXA 4S04A 3LA7A 2PX9A 2F5EA 3HHGA 1O7LA 4XMYA 3CF2A 4HZFA 3Q7GA 3CMAI 2HOAA 3M8EA 1BBYA 1BI2A 2IPQX 3KLOA 2EWNA 3TDZC 4BHBA 3CCRI 1RJ9B 5M3MJ 4FX5A 2KJCA 3GLLA 3KYCB 2LFDA 1E2XA 2ECCA 3PUBA 4PFPA 1HMDA 3S2HJ 1W7PD 1ETVA 2RSEB 2DA7A 5IT3A 2G3VA 3KZYA 1IXSB 2BVLA 2CMPA 4Z2YA 1BM9A 4UXNA 4DRHB 2R3SA 2CGPA 4P55A 4UUVA 4RGUA 4RS8A 1X3UA 2HXOA 4XPWA 1T6SA 3ZC4A 2O0YA 4XLNF 4X1EA 2ZSIB 1V55H 2M5WA 4HOBA 2E1OA 1UAAA 1Y8QB 4NB5A 3M3YJ 3T9OA 5EJCA 4A3BJ 2D45A 1RR8C 4L6RA 3SEOA 2ASRA 2Z3YA 1UJ8A 1ZW2A 4D1QA 5D5WB 1I50J 2JPCA 3HC7A 2OV7A 2STTA 4JVSA 3H2VA 2BVMA 2EA2A 3RYPA 3ABLC 1IDZA 1BIAA 4KN4X 3IH2A 1D1AA 4CCMA 1FIAA 4XKBA 2AVKA 1XN7A 2W4MA 1ZRCA 3C8ZA 4LG0B 2J0WA 3K4LA 1FFHA 3FBNB 4L18B 3QODA 1FOKA 2IM8A 3DPTA 4FHTA 5DV5A 2J5PA 1W0UA 3BZ6A 3F0CA 1WRJA 2CS3A 5HNFA 2ZXIA 1DP7P 2EZHA 2LKPA 1RIOH 3HKKA 5BQHA 3HLZA 2DYRH 3Q0WA 3C18A 3MAJA 2ZC2A 4HLYA 1GXQA 1MQVA 5B1AC 4ASNA 5LHHA 4KJZA 3M7GA 5D91A 2EIJH 3I71A 1MJ9A 3NWTA 4XEKA 3W2VA 3HOSA 2DXIA 4CBEA 5B3IA 3B71A 3FMRA 2KIUA 1TP4A 2DMTA 3RYRA 4F52A 1C0WA 1CGPA 4EJUA 1LS1A 2WAEA 1WZ2A 2QNLA 1GHCA 1HE1A 2R9RB 1W7PA 4ENKA 4A3MJ 2P6TA 3RSNA 2AWYA 3C62A 2IVMA 2FSWA 1I4ZA 3BQYA 2VQHA 1JOGA 3F72A 1YJ9I 1S7ZA 4XLAA 3TULA 2DN0A 4A3GJ 2X6XA 3O10A 2DK8A 2D2WA 2NAZA 3LFKA 2OZ6A 2ZFUA 1OW7A 4D0PA 5EEAA 4JOMA 3W6VA 3HPHA 2R7OA 4A3LJ 1ZHTA 3LAYA 3FISA 3A01B 1T9KA 3A4CA 1D1BA 1XGMA 5J47A 2B9SA 3D5SC 3IPMO 3UGOA 4ENJA 1R58A 1AA7A 1GUUA 5K5OA 1EA3A 4XL9A 1K05A 4HDVA 1G3SA 3S9OA 4I1OB 2LR8A 1OCZC 3GMEA 4BNCA 1IRGA 3E70C 4O6MA 1S3JA 1IXCA 3HOYJ 1YQAA 3DU6A 4E4HA 1K83J 3EZHA 1XSXA 3AQBA 4YWQA 1T6UA 4MS2A 3WU0A 4CYCB 2X1DA 3R60A 2R7ZJ 2DOEA 5E1XA 5HLGA 2DAOA 5HDKA 2CYYA 4B44A 3TEDA 3OYFA 5B66C 2R03A 3JTLO 1X1AA 1W2WA 1S7AA 2K4BA 1QGPA 3LL7A 4WXHA 2YHSA 1G6NA 1MBFA 2ZMEC 3VYTB 2ELKA 1FNTc 3MZ8A 5BPIA 3L2CA 3M1CA 3T8RA 4HW0A 4R79A 3S27A 3PNVA 3GF2A 4CCLA 4D4NA 1KU9A 1D0ZA 2MLGA 4YT8A 1XPXA 2HQNA 3TOAA 4BACA 3WGHA 1RUOA 2O6GE 1G3WA 3ZQHA 2VOPA 5A6BD 3B6AA 1TTYA 2E7XA 5E8GA 4ER9A 2DGJA 5LHGA 1L0OC 1FP1D 4LERA 2XDVA 2XASA 2VONA 2XLVA 2E71A 1B9NA 3HG9A 3W2AA 2J8WA 4KDPA 3KZZA 2IXSA 2NXNB 2OU6A 3LSRA 3HJEA 4C3JJ 2HMQA 4WABA 3KP7A 1TQPA 1K78A 3CC2I 1R5ID 2JA7J 2P6SA 4UB8C 3OYBA 3CCLI 1NBBA 3OR2C 2W84A 2HZTA 1MGTA 2YS9A 2J9UA 3WHNA 1JUSA 3BCBA 4R8HA 3POVA 1OCZH 4EUKB 3Q6MA 3REOA 1ZHYA 2HKXA 3WTVC 3SJMA 4P9UA 4OWRB 2V4JC 3ZMDA 5EDNA 5HLTA 1LPEA 1ZW3A 1RCPA 4AL1A 5JS5A 2YUSA 4HF1A 3GTGJ 4X6AJ 1Q1VA 4K0DA 4CDVA 3U3FA 3QPHA 4JK1X 3O8HA 4A3KJ 2MC3A 1EA8A 4L9VA 4AIHA 4HLXA 3RJPA 2Y69C 1HKTA 2LYCA 3EDPA 1ZZPA 4M71A 1LJ9A 1R5GA 3NYJA 3L2UA 1D1CA 3RIPA 4YIFA 2NOGA 3SEZA 1YW8A 4IVNA 2XIGA 1V3FA 5A6JA 4F55A 4BL0B 4DYRA 2BY2A 4IRHA 2Q2EA 1AKHB 3DAFA 2CUJA 3M15A 3SEQA 1TFOB 5DS6A 4ZJZA 1PD1A 3NYMA 2BHZA 3OYLA 2PI0A 3K66A 5FO5A 2C6YA 3WGGA 2G7UA 5AIQA 2CG4A 3WG7H 5ICEA 3AG2H 4KT6A 1QPMA 4RGSA 3OWTA 3AFHA 2JRMA 1XMAA 2PQ8A 4EVIA 1Z7Qc 1Y6IA 1FAPB 1BC7C 1Z63A 1YFHA 3RZOJ 2XLMA 2XL6A 1TZLA 3L8IA 3ZQVA 2WAQN 3DKYA 1CPRA 3C8GD 3CMEI 3JZ0A 2M34A 1FFTC 3DU5A 3BG9A 5B3SH 2JQ7A 1IUYA 4BJTA 1HW1A 1PV3A 2FRHA 2IS4A 5KYYB 4C7OB 1E3HA 4LLGF 2NPUA 3BJAA 1T0FC 3BJ6A 3CP2A 4FWVA 3H9QA 3ABKC 4MVRA 3A03A 3F22A 3I9V2 4RAZA 4OIRF 3ZXSA 3ZMZA 4E7KA 1H88C 2CV2A 1VB5A 5DCMA 2MG4A 1D8JA 1WWXA 3EQLF 4B3XA 1Q0KA 3FHDA 3ABLH 1ZN2A 2PMZA 3LLIA 2HV6A 5M5YJ 2DFEA 1Q0GA 1U0BB 5GAGJ 4Q47A 3TO7A 4CS8A 1NH3A 2BXYA 3BZCA 3V8LA 4JTAB 5CQEA 2L4AA 3T6JA 5A69A 4U5GA 4UUSA 4IRUA 2F4MB 1IW7F 4NDLA 4PJ0C 1R5HA 3LS0A 1OISA 1U5TC 1B1BA 2HQ5A 2EZKA 3VOEA 3S16J 4EM0B 1MBHA 2XGCA 2HDCA 3DWWA 5D5XB 3GEZA 2L54A 2WBMA 3DEEA 3KYJA 4AVZA 3WTUC 3A9CA 1Q0MA 1ON2A 2DFHA 3FM3A 3MEXA 3G4SI 1DUXC 1U2WA 2Z15A 3A11A 2DK5A 1IN6A 2O7OA 1X3ZB 4V2FA 3UMIA 2J7PD 3HRSA 4BXFA 1VNDA 3OIOA 2BOLA 2XSDC 1KZHA 1IG7A 4JCHA 2XF5A 5IP7J 4LB5A 3GX4X 1S7OA 4YN0B 4ZYAA 1U9OA 4A0ZA 3S1RJ 1ZTRA 4XRFA 1R23A 2CUEA 3CMYA 2VPLA 2Q4FA 4QLCU 1LFBA 2VXZA 2QQ8A 4CSAC 1DOVA 5E1ZB 5ICCA 3GUDA 3H36A 2EPNA 3ZCOA 1EI7A 4A2NB 5L0FA 2QKMB 2A69F 4KICA 5GPGB 2QVOA 1BN5A 3HOXJ 2K40A 3GM3A 2HR3A 1L3LA 4A5NA 4MVOA 3OIPA 2AWCA 4HX4A 4BDZA 4W1UA 2K86A 4PDKA 1V5GA 2XGXA 3RKWA 4CYDA 1R9TJ 1J75A 1UELB 4LG3A 5FB2A 3G73A 2WV1A 3ZR8X 3R2PA 2PJRB 4KIBA 5B5EC 4Z9IA 5KYWA 3I4PA 2X0LA 4N9IA 3FXKA 2WVNA 1ZGWA 2Y3GA 4N4WA 3Q6NA 4CIHA 1OCCC 1MD0A 4MTDA 2A5YB 4U5EE 3CCYA 4ESFA 3K70C 3QAHA 4FTHA 5EYRA 3RKQA 4Y17A 3BZKA 2JUGA 3F6OA 2LF7A 3S84A 2KJBA 2MLKA 3E5UA 1Z5ZA 1WGXA 2GQQA 3IRRA 2R4GA 2M8EA 1YVIA 1RC9A 1X4OA 2NS0A 1K40A 2HEOA 3DV8A 4RB0A 5EZGA 3RW0A 5IT9Z 4XR6A 4IZZA 5ICGA 1X1DA 1W0TA 3I59A 3GWLA 3FIWA 1UCRA 3LSKA 4WXCA 2QUPA 4PK4A 2CDQA 2NVYJ 4E0HA 4FT8A 1JGSA 3O6BB 1UHMA 3HEFA 5CKTA 3EJNA 3LLKA 4U7DA 1TT5B 3M1EA 4JQFA 1JHHA 4L9TA 5F1RA 2B63J 2A1DD 2YLGA 3CCQI 2LG4A 1OXBA 3O6XA 4EBKA 4BBRJ 3O39A 3U5SA 2HUJA 4ZYGA 4PJNA 2HOEA 1LVAA 3PCVA 4JC7A 2K9NA 2LD5A 1X3WB 4YT5A 3OOUA 3EH2A 5CVRA 1TR2A 3ABKH 3N0TA 5DDGA 5COGA 2EIMH 3VWBA 1SVLA 3G3ZA 3OSFA 1TC3C 4KMFA 5LGUA 3KEQA 1ST6A 3IEEA 2NVTJ 1FSEA 4I98B 4CH7A 2HPMA 3W6KB 1KQ0A 1SFUA 3BR2A 4E7IA 2R7QA 4K1OA 5CVVA 3IWZA 1R71A 1RMVA 1VQMI 2M0CA 5A2QK 3F47A 4QSHA 3OS2A 2XPWA 2FE3A 5D4SA 2HYGD 3HJCA 2R7XA 1UZCA 1D3YA 2DCEA 2W48A 4IPAA 1LEBA 3W8IA 2ESHA 2W7NA 3P9IA 3PO2J 3ASOC 2NNYA 3QZCA 3QWLA 3PM1A 1M1EB 1OYYA 2V9KA 3CTAA 2V6EA 2HSBA 1KA8A 2DI3A 3OYDA 2Q9CA 1QVTA 4BS9A 5EG0B 4ABZA 3RVYA 3J06A 2LQGA 2YU9J 1MBJA 1NG6A 3MX3A 1EH6A 2AXLA 2H7VC 2O9XA 1WOLA 5TRDA 2UV1A 1BIBA 2V1NA 3DLAA 1SD5A 4JJFA 4HAMA 4GRIA 4C2UA 3GTOJ 2A6TA 5J1YA 4WGZA 3SXMA 2KDOA 2HV7A 4Y7NJ 3I64A 4RMNA 2OAZA 3F8NA 2UUHA 2ZMEA 1AEPA 4MIMA 5D6FA 3IKTA 3G1MA 2PJPA 3L8JA 2GXBA 2VCCA 2RQQA 4NQFA 1ETYA 2VQCA 3H5AA 2KMUA 1B72B 4LACB 4IGGA 5HOOA 3K70D 1MSEC 3AAFA 2PG4A 1BI1A 2WY7Q 5H6RA 2DYSH 3OYHA 3MVPA 2XUBA 3GXOA 4BAYA 3OYIA 1VF9A 1FY7A 4P96A 3OEOA 2E60A 1MKMA 1MIJA 5JT4A 3A1YA 4G6TB 1IGNA 1NK2P 5H2FC 2RAEA 4XEVA 1EJ9A 3E6BA 5COFA 3SP1A 1XZQA 4O5VA 4L5IA 1F4KA 3BTJA 4PJLA 1BR1A 1G3YA 1KQ9A 2JK3A 4FISA 5E3MA 1JE8A 2DLLA 2P5KA 4JURI 2K9SA 1VOMA 1RPWA 3RH3A 3S93A 2AQEA 1APLC 2QSGX 1SVMA 1Y39A 2QQ9A 4YIIA 1O3RA 4BEJA 1U0JA 1LE8B 2EFQA 3JRHA 4A3JJ 4LB6B 3OY9A 3EUKL 3I56I 1SC7A 3B0PA 1ZR4A 2KW3C 5CJ9A 2R5YB 4DJAA 1X1BA 1M2VA 4JX5A 4CXFA 4LLNA 1OR7C 3HOZJ 1QRYA 4AE4B 2CV0A 3H3VK 3IQTA 1EKYA 4C3IJ 3ERED 5AC5A 2UWMA 3SHFA 3OIQA 2P61A 1FYMA 2DTRA 3CF5F 3PQJA 4HE8D 4E7SA 2E2JJ 1XMXA 1YITI 2ESNA 3BPVA 1YX5A 2OJED 2CWEA 3LWFA 2VT2A 3LSIA 2HQAA 1G3TA 5FKLA 4DYCA 3IV5A 1QHHD 4P9TA 3GEIA 3L9FA 3OS0A 3HGYA 3F21A 1T33A 4KIFA 2HVRA 3MFKA 2HMZA 3SZRA 2F5FA 5CVUA 1ZKGA 2KIMA 3CUOA 5KNLA 1VQ7I 2IXMA 2WZLA 4JRZA 3ZMTA 4H54A 3RQIA 2WB7A 2Y9YA 3KX2A 5KAFC 2IP2A 5C4XJ 1YA9A 1U5TB 2HI3A 3DE8A 3GM2A 4V19K 3L1MA 2LTPA 2NSFA 4C3DA 1E0EA 2D5RB 1YIOA 3TGNA 5T3TA 3ZRGA 5L0DA 4DRIB 1WQ2A 4RBNA 4AUXA 2FNAA 5LHIA 2RGVA 2ZJ2A 2A3SA 3QRFF 1K61A 3LAJA 1LPQA 3S2DJ 5CIVA 5HVQC 4BE0A 4XPYA 4Y13A 3O2PE 1RR7A 5K7ZA 1R1TA 3NG1A 4RB1A 4ZTFA 3E9VA 4HEAJ 3R0AA 1CQTA 2CUZA 3GTMJ 4QPQA 4UNOA 4ESJA 4CS9C 2OF7A 2BL2A 1XMKA 4NC8A 1DPRA 2FBKA 4M6VA 4DVYP 4MFDA 1S8NA 4HG2A 3FHZA 1U89A 2ZO4A 3JAMZ 1H89C 1PD0A 4XOPA 5D6EA 2L7AA 4HF0A 3FM5A 1RUNA 1VQ8I 1TWFJ 5M3FJ 2Q7RA 3SNHA 2ZXWH 3ZQYA 2GOXB 2W85A 4GYTA 3LQRA 2V6CA 1H6GA 3RQGA 1SFEA 3QU3A 4KNVA 2C03A 1Z6RA 2W4SA 2A6EF 1TLHB 2M87A 4A93J 1MMGA 2MYSA 4EM2A 1HOMA 2YL0A 2AO9A 4WWCA 3S2WA 4YJWA 2YVKA 4XKWA 4F92B 3ASNC 1VQ6I 3BG5A 4IOAF 4JP0A 5J4YA 3RVZA 4BQQA 1RZ4A 2CUFA 3LSHA 3ZTZA 1PUEE 5L0CA 3DF8A 5FKMA 4W8KA 1FOWA 1FPQA 2Z33A 2MABA 2QF7A 4LLCA 1SD6A 2CQNA 3KPHA 1WJCA 1K4SA 1FBSA 3TQNA 1V5EA 4DRJB 3MKYB 1HE9A 3ATPA 3X2QH 2R7SA 4OIOF 1RKCA 1W36D 2Y0MA 4PACA 1A0BA 3ZDLA 4JBAA 2M3AA 4KYWA 3BT9A 1GV2A 2MFZA 2X6OA 2F2EA 2L0KA 1FNNA 3MZHA 3FK6A 5DCMB 5E18F 3QVYA 5AONA 3WG7C 5IYDJ 3ZMUA 1DGRM 2XV4S 4KUMA 2M64A 1AWCA 1ZHXA 5KYUA 2IJLA 1I5NA 1ACIA 1X4PA 5FFXA 1ETOA 1VYKA 2P5LC 3TO9A 4M9ZA 3KZIC 1O4XA 3CAXA 3VRCA 4JX6A 1TL8A 2VJJA 4DBQA 2DT7B 2CCYA 1EQ1A 3IQ5A 1F5TA 3GFIA 1LDDA 1HCRA 3FOPA 3AG1C 4N9HA 1X19A 4HDUA 3GTJJ 3K0LA 2XB5A 3BQZA 2GA0A 2UXXA 1DGWY 2LKSA 1H9TA 3OYJA 3WE2A 5FD5A 4ON0A 1LIHA 2IGKA 2BY3A 1U3EM 1LNWA 4K7BA 5E3NA 1N1CA 2HKVA 3RF3A 1J2XA 1ZK8A 5BMZA 5FLMJ 5JHFA 4M3FA 2QY9A 1B59A 1T08B 2W24A 3AL0B 1A7DA 3CCVI 1FYKA 4BU2A 5D4RA 3ZPLA 4BXUA 2XL8A 2DJNA 4NBQA 2ZJPF 1WH5A 4M74A 3DBLB 4NC6A 3NARA 1FIPA 2P7CB 4G0HA 3I4MJ 2LIGA 4FX4A 4NCQA 1T01A 4AVPA 2ZMEB 2BW3A 2GZWA 4G94A 4H4KC 4CDAA 3HOWJ 4NY3A 3V7CA 2JTVA 2IT0A 4K2EA 4DJ9A 3CJRB 2PLYA 3O8GA 2XLDA 2XGDA 1CPQA 5KYUB 3H65A 3NMIA 2WB1N 3GTQJ 3SXKA 2EV0A 4C3HJ 3QPTA 2H6BA 4NQWB 1HDDC 4RAFA 5E33A 2DFIA 4CIPA 3WTSC 4WF2A 4XORA 2LDUA 3CJNA 2X85A 3CDLA 3M07A 4PSWA 3OYGA 3P5JA 2JRTA 4IAQA 3TL4X 1Z6TA 3U9JA 2VI6A 4YL1A 3IUOA 2O61A 1TWAJ 1VZ0A 2XPUA 2ZBKA 1YE9A 1F1ZA 5HLIA 2H8WA 2L7FP 3E6MA 3KFWX 3K1NA 3LMMA 2OG2A 2YL7A 3K6GA 3PMRA 1YJNI 2WA0A 3HUGA 1S72I 3SXZA 2OC6A 2GOMA 4J19A 1OCRH 1Z77A 4F7ZA 2DA4A 1ZLKA 2DPDA 5K7HA 1IZMA 1IF1A 4RAYA 2W4BA 3OYAA 4J00A 3CUQC 3EUHA 3QYEA 1M56C 4NC3A 1P4AA 3JREA 3K2ZA 3LESA 2PMHA 2LOOA 5E3AA 3DCFA 4IXAA 1PYVA 1OQYA 3NYLA 1IXRC 1CF7B 1IAWA 1SD4A 2CQXA 1M2VB 1L3PA 4ZYHA 5BQGA 2KPMA 4PGHA 4U0YA 4ZC3A 2ZJQF 3GANA 5L3GA 2C04A 2ISYA 4U9EA 2LVSA 4M9SA 4OAZA 2X4HA 4I7HA 4AWXB 3AG4H 2CQKA 3RPUD 3LEOA 4CCJA 3U2LA 5L3CA 3SFIA 3BROA 2EJRA 3C8GB 3ZTMA 4B6IA 4EBBA 5A2QZ 2L7MP 5LD2C 4M72A 4WJ0A 3JRTA 3HSEA 1R7JA 1P9QC 2IYLD 5DLJA 3K10A 1RKEA 4KN7X 5J3LA 1JRAA 4D7MA 2QBYB 3U9GA 3OYNA 1AKHA 2R7DA 4HSTA 3V5XA 1Z1DA 1B9MA 2J9WA 3DMDA 1O3TA 2PX3A 4UB6C 2LK4A 3IL2A 1XSVA 1GDTA 2A07F 1XWJA 1XGOA 2IGNA 2LH9A 2VH3A 1C17M 3DFGA 4XSZF 1J09A 5GADJ 1WI3A 5DM6F 2KSFA 3I5QA 4B09A 5CPRB 2HDDA 3LA2A 2KRFA 2D5VA 2R7RA 1Y1WJ 1ZHZA 1VTNC 2VE8A 1X2MA 2HPIA 5AIPA 3N4MA 1LDJA 1WWPA 2KFDA 1IZ1A 2CQ7A 2I10A 2J5OA 5J6XA 5LGTA 2KQ9A 1JPJA 5KYXA 2H7OA 2XKPA 2GA1A 2JSPA 4HYEA 1N77A 5DVWA 3F8MA 5FRNA 3EG9B 4NTAA 1FMWA 1HBXG 1WATA 3X2QC 2GM4A 3W8HA 3RPQA 2LKXA 2CRGA 3MMYB 4B3AA 1R4NB 2PBIA 4MO7A 4XQFA 1N75A 2E19A 2RNJA 4DQ2A 2V9PA 3PFYA 5DS4A 3BWGA 3BP8A 1O3UA 2OTLI 4NC7A 3OYKA 3K7AJ 3K4MA 4XLHA 3ZQIA 3VYRB 3TW6A 1Z21A 1QHGA 5DQZA 4PJJA 3T4RA 4HF2A 1BA5A 5H6QA 5CI9A 2YR2A 3WAQA 2YQYA 1KQ8A 1S5LC 5A6BA 4ZYDA 3LSPA 2LD6A 2E1CA 3UKGA 1FSHA 3PQKA 2K85A 3KEOA 1EKEA 4B43A 4AL0A 3LJBA 3E0JB 4BBSJ 3VF0A 2X1EA 3EYIA 3WE3A 1BW5A 4RAGA 2VL8A 1JGGA 2M7BA 2Z2SB 2YLIA 1R1VA 4E18A 2NS8A 2WWYA 1HMOA 3EFOA 4IAOA 2PMZN 2RQPA 5EHHA 3BG6A 2OA4A 5EEGA 5IPAA 4KITB 1Y56A 2DJIA 2QWWA 3DEWA 4M3GA 1SVOA 3VYSB 3GFLA 5L3BA 1IN8A 1FTSA 1H7IA 1D0XA 1OKKA 3M8FA 5ILVA 1UFBA 2GXGA 1XSDA 2XB0X 1K78B 5CQGA 4ITVA 2Z16A 1A36A 2HWVA 2HZ8A 1R1UA 4U5CE 4MVQA 1FX7A 4CJOA 3C2GA 3FWEA 5K5QA 1QO0D 1KYWA 1JI8A 4XLCA
chains in the Genus database with same CATH topology
3KPHA 2ICWG 1R5ID 2OJED
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPH A;  2ICW G;  1R5I D;  2OJE D; 
#chains in the Genus database with same CATH topology
 1IJW C;  2XAG A;  2Y39 A;  1XD7 A;  2M9H A;  1WJA A;  1FTZ A;  3TW7 A;  2DB4 A;  1BOA A;  3BG7 A;  3VM6 A;  2DA5 A;  4D5F A;  1LM3 B;  2LY1 A;  1IV8 A;  4EEF G;  2DOD A;  4IO9 F;  1G4D A;  2CFX A;  2VIX A;  3RQF A;  1VI0 A;  2TCT A;  3K4C A;  3JRA A;  3L2Q A;  1YW9 A;  2GXA A;  3HZJ A;  5LEK A;  2LY9 A;  4LDQ A;  2JVH A;  3EET A;  4P9F A;  3K1P A;  3HTU A;  4BH9 A;  3UGP A;  1IUF A;  3L09 A;  3NAU A;  4QTR A;  1OQC A;  1R49 A;  2WVO A;  3ZSU A;  2PX0 A;  2JWT A;  4MND A;  3KL4 A;  2EB7 A;  3H92 A;  4L5J A;  1PDN C;  2PNO A;  1W4M A;  4G9Y A;  2HJM A;  1W5T A;  1M6T A;  1Z23 A;  4GO1 A;  2LBF A;  5E8I A;  3ABT A;  4O79 A;  4ZDP A;  1AU7 A;  1O5H A;  3F8C A;  1Y4C A;  3H2U A;  2HDW A;  4IHV A;  2HQR A;  3GTK J;  5D5U B;  1VQO I;  2Y75 A;  4G8X A;  2JD3 A;  4LMY A;  1SMT A;  4AIK A;  3BC8 A;  3ZN0 A;  3GOR A;  5IOY A;  3P9C A;  2KGO A;  2GIZ A;  1K4T A;  3H0G J;  1QKR A;  2M4E A;  3H9J A;  3ITF A;  2IXN A;  5FLV A;  1AVO B;  3WU2 C;  4G7H F;  4M73 A;  1ZEL A;  2P0W A;  1ZU5 A;  3RI4 A;  4RLQ A;  2GFH A;  3CJT B;  2R5Z A;  3CP8 A;  5JR3 A;  5E1W A;  4A6D A;  4GFB A;  4PCQ A;  3V7O A;  2IOQ A;  2X1C A;  2F4O B;  2QA4 I;  3HDD A;  1X1C A;  1KYZ A;  2ME0 A;  4YFK F;  1SFO J;  5JP7 A;  3ASN H;  3HRT A;  1KTM A;  4YEJ A;  2E1M C;  1I3Q J;  5GAH J;  4MEX F;  5KYY A;  1J5Y A;  3L7W A;  4BQN A;  4JIO A;  3CQZ J;  2L9R A;  3F8B A;  3S1Q J;  2XS1 A;  1E86 A;  1I6X A;  2VKE A;  2WZF A;  3C63 A;  4XOT A;  3HTK C;  2KNH A;  4GDF A;  3S3M A;  4B8X A;  1A6I A;  3N24 A;  2R0Q C;  3T1B A;  3ZQG A;  1BJA A;  4YIR X;  4I76 A;  5EGY A;  4A3I J;  3QQA A;  4IB4 A;  3DBR B;  1WCM J;  2IA0 A;  1HY5 A;  3EHM A;  2YRF A;  3PO3 J;  1PP7 U;  4N06 A;  5IY5 H;  5DUK A;  4O3M A;  1EF4 A;  3L0I A;  5CYV A;  1REP C;  1G5Z A;  5K1Y A;  1OR3 A;  3T8T A;  3LS1 A;  4JCZ A;  4Q4Z F;  2Y9Z A;  3F9K A;  3T0Y A;  3SQN A;  3FVY A;  1M2O A;  1Z3X A;  2OQR A;  2GDC A;  3C3W A;  3QP5 A;  4QPO A;  5F0F A;  2I5U A;  2V26 A;  2BC5 A;  3A2K A;  4OIP F;  2DW4 A;  2KDZ A;  3KH2 A;  4MHG A;  3PIO F;  1QPU A;  1E17 A;  3ESW B;  3D1N I;  3DM5 A;  4CS8 C;  3MBG A;  3SDG A;  2XAF A;  4LLL A;  2LY2 A;  1Y0N A;  2VB6 A;  2DPU A;  4CCO A;  4HQM A;  4XK4 A;  4E70 A;  3JRB A;  4KNY A;  5A6A A;  2XRO A;  1J9I A;  1Z91 A;  2VBX A;  1R36 A;  1OR7 A;  3BOQ A;  2ZKZ A;  2O8X A;  4C30 A;  4BEH B;  4XLF A;  4X0G A;  1MDM B;  3E1S A;  2EPM X;  1U6H A;  4EWC A;  1ORS C;  4DBR A;  4PFO A;  1WAS A;  1BI3 A;  2V79 A;  3FX3 A;  4U5B E;  4U5F E;  1XGN A;  3ECO A;  2GLO A;  3UMK A;  1E83 A;  2ZXH A;  1TQI A;  5FD6 A;  1ZG3 A;  2M0M A;  3G2B A;  3TDU C;  4A2U A;  2R5Z B;  2ETH A;  3M1C B;  2E1N A;  4IF4 A;  3DJU B;  2M4K A;  2YU3 A;  2Q00 A;  1ZAO A;  4G7Z F;  3PNT A;  3EGD B;  1XGS A;  1XS9 A;  2MD0 A;  1ZHW A;  3IKV A;  2H6C A;  3KP6 A;  2Z5U A;  2JA6 J;  1HF0 A;  2I15 A;  3JW4 A;  1YZA A;  4I02 A;  3MFN A;  3T6B A;  2Q3T A;  5E3L A;  5DD8 A;  3AOU A;  3V4G A;  5IP9 J;  1PVE A;  3IAS 2;  2CH0 A;  1JR8 A;  1VTM P;  1VQK I;  2O8K A;  3EG9 A;  4J32 B;  2NUP A;  3QW0 A;  3K4N A;  1LFP A;  4U0V A;  2LNB A;  1L7C A;  4RM2 A;  5H20 A;  4LIT A;  2M8G X;  4QWQ A;  3IRQ A;  3U3B A;  1HLV A;  2F4I A;  3R6S A;  3RFY A;  1JT0 A;  1QQ3 A;  1O3Q A;  1GT0 C;  3H3U A;  2K02 A;  2EPF A;  3ZP5 A;  4IHY A;  4RM3 A;  3Q9S A;  1F43 A;  1P4W A;  2L9S A;  1GGQ A;  3TKY A;  4U5H A;  5K0I A;  4KT5 C;  5KYW B;  3V8J A;  4CS7 A;  2KZV A;  1JMW A;  1V4A A;  3HTS B;  4BY1 J;  4O6N A;  2J9B A;  2YX4 A;  2DA1 A;  3NDB B;  2FBI A;  4M6Y A;  2J46 A;  2ADU A;  4CX9 A;  2DA2 A;  2Q8K A;  4MLO A;  2IS6 A;  3I54 A;  2E2H J;  1Q0F A;  5HS7 A;  4RGR A;  4GYI A;  2PEX A;  3IC7 A;  4MVZ A;  1KU7 A;  3LUT B;  1U9N A;  2KIQ A;  5F28 E;  2H27 A;  4NQW A;  3MKZ A;  1UST A;  2L9N A;  4JX4 A;  3RCO A;  2P0N A;  4R32 A;  4BJ5 C;  2DOA A;  4M3E A;  2LFF A;  4KIG A;  1JKO C;  1ZG5 A;  3VSK A;  1DU6 A;  3RIR A;  3WHC A;  4YT2 A;  3V7R A;  1R4M B;  1R22 A;  5KYX B;  3GEH A;  4XWJ A;  3DD7 A;  1MNM C;  4MW3 A;  1TNT A;  2WAD A;  3SYN A;  4ZZD A;  5ERI A;  4UV8 A;  3AG1 H;  1YW7 A;  2HYJ A;  1G2H A;  2AP3 A;  3DAG A;  2ECB A;  3WHB A;  3TMO A;  1R00 A;  2QTV A;  3WTZ A;  1JTX A;  4ETS A;  3S3N A;  4GCV A;  4LIU A;  4NTB A;  5ED4 A;  3OYE A;  2FQ3 A;  3DZA A;  4A6E A;  4JKV A;  1TWC A;  3W4Y A;  2W1O A;  1Z9C A;  4UVC A;  2XAU A;  4A69 C;  2E35 A;  3HOV J;  2H8A A;  3FXJ A;  2HU9 A;  3US6 A;  4F3Q A;  1YRN B;  4OOI A;  3EH1 A;  5FCL A;  4WX9 A;  5L3F A;  1TWG A;  1TWH A;  3K33 A;  4FCY A;  4QI0 A;  2EIJ C;  3TP0 A;  3L2V A;  1DQU A;  3CO7 C;  1NSG B;  3RPU A;  1Z05 A;  4YFX F;  1VMA A;  4A3F J;  2IXP A;  2EA4 A;  4HV5 A;  4S0H B;  3LEV A;  2R92 J;  3VAY A;  1ZG1 A;  1MBG A;  3SYT A;  4X0R A;  3CJQ B;  4RLF A;  2FQ4 A;  3DM9 B;  4NTF A;  2M7A A;  1U6G A;  2HXI A;  3O3K A;  4C7O A;  2Z99 A;  4LOC A;  1M57 C;  1VLT A;  5F0H A;  5EGO B;  1OCR C;  5BQT A;  4N0B A;  4N4O B;  2H1L A;  3CUQ B;  1B4A A;  1Z3Y A;  2EV6 A;  2K3P A;  4Y4R A;  4JW1 A;  4OMZ A;  2EIM C;  3C7J A;  2JJ7 A;  3H35 A;  1XB4 A;  1I27 A;  3DWL E;  1JTY A;  2DOF A;  2W9Y A;  2LF8 A;  3LQQ A;  2EIK H;  1MMS A;  1DPU A;  2RD9 A;  3EGX A;  3V5Z A;  1YS6 A;  4FET A;  3M9A A;  1P92 A;  2VBY A;  4Y15 A;  3H1C A;  2XGE A;  1VK5 A;  1VQ4 I;  2G0E A;  3FBI B;  2XAJ A;  2PBE A;  4J7Y A;  2XM0 A;  1G59 A;  2KKO A;  2ZXW C;  2EIK C;  3RKY A;  1LFU P;  1SFX A;  2Y0S A;  2KT0 A;  3QMK A;  3ABU A;  3MKW B;  2M2E A;  2PN6 A;  1PJR A;  1RNL A;  2KZG A;  2RVC A;  2N8G A;  3DP7 A;  3DPL C;  4Y33 A;  2KRH A;  2L7K A;  3TBI A;  3T6G B;  3ML6 A;  5L3D A;  4I09 A;  1MH3 A;  1NK3 P;  1FR0 A;  5TJJ A;  3ZQ7 A;  2CU7 A;  1EH7 A;  2ELJ A;  2M30 A;  5IYB J;  5E3O A;  1T8I A;  2HVQ A;  2M1B A;  5IOZ A;  4IHT A;  4V2G A;  2NRA C;  2WB1 A;  3RQ4 A;  2Q1Z B;  2Z9O A;  4XRS A;  3V8K A;  3J80 K;  2K5C A;  1KNY A;  1WHU A;  3LST A;  3Q9V A;  2GAQ A;  4IOC F;  1WJE A;  3NWS A;  3FDY A;  2L9V A;  2XM4 A;  3QTH A;  2RKH A;  3HSR A;  2ZNY A;  1GV5 A;  3ELK A;  4A3C J;  1QZE A;  5EG0 A;  3AG3 C;  3RYL A;  1JHF A;  3X1O A;  3JRG A;  1GVD A;  2A6H F;  4Z9H A;  5HSW A;  3G71 I;  4RDU A;  3QP6 A;  5ILS A;  5HLH A;  3S17 J;  5T1D B;  3FMS A;  4MVU A;  3TQO A;  5L0H A;  5KVR A;  2RRE A;  1A41 A;  3I55 I;  3CC7 I;  1FOX A;  1PP8 F;  4XRS G;  4BQO A;  3HL2 A;  2PFB A;  3CUQ A;  5DQT A;  3VFZ A;  5HOD A;  4FES A;  3T5X A;  1IRF A;  5FRO A;  3E7L A;  2IS2 A;  5JLI A;  2IGO A;  2GWW A;  3I4U A;  3RDI A;  1XC5 A;  3K4K A;  3FXO A;  2IEK A;  1OCO H;  3GVA A;  3KP4 A;  4AIJ A;  2XAH A;  2A61 A;  3ZQL A;  1YI2 I;  3F8F A;  2VBZ A;  1WTY A;  3MYI A;  3EPV A;  2ZFW A;  2VN2 A;  3NKE A;  1I5Z A;  2MW8 A;  3JSE O;  5KCM A;  3J7Z I;  4N4N B;  1AHD P;  2G7H A;  4PGG A;  4XEF A;  2A0U A;  2CNW A;  1W7P B;  1TWG J;  1TWH J;  1FP2 A;  1IN7 A;  2EFN A;  2HKO A;  3ZQF A;  4AID A;  1W5S A;  2DO7 A;  2VKD A;  4Y3O A;  4FAS D;  2IXO A;  3JRM O;  4DIQ A;  2PFD A;  2MWQ A;  4CHU A;  1VQ5 I;  3K1H A;  1TWA A;  5E20 A;  5BQI A;  3H9G A;  3DLL F;  4OU0 A;  2CV1 A;  4Y52 J;  1P4X A;  1NU9 C;  3ZMS A;  2IA2 A;  2DMN A;  1OKR A;  2BY1 A;  3R0J A;  5DS9 A;  1G4U S;  2L6H A;  4CCK A;  2NG1 A;  3UR3 C;  3H5N A;  1DOW A;  4UDV A;  2YL1 A;  3DTK A;  4AD9 A;  3WTW C;  4J7T A;  4AE4 A;  3KCC A;  1B68 A;  2FA5 A;  3C2B A;  3U8P A;  4XBF A;  5DEQ A;  2XXA A;  3GW2 A;  3LSM A;  2Y30 A;  3VSL A;  1RKT A;  4C2M J;  3DKX A;  5C3E J;  2F22 A;  1T95 A;  1TW2 A;  2NOJ B;  4EMS A;  1ZRE A;  1NHA A;  2P7V B;  1A35 A;  2YPR A;  4U0W A;  3S3O A;  1A7E A;  2R25 A;  3FOO A;  3ZQQ A;  2CW8 A;  3VYU B;  4UV9 A;  1MW7 A;  5F08 A;  5KHD A;  4HRI A;  2B0J A;  2OJQ A;  2L9J A;  2ZPA A;  4XPX A;  1JKR C;  3H5R A;  5B3S C;  2OTJ I;  1HSJ A;  2R7W A;  4DXW A;  5BUO A;  3QYF A;  4RD9 A;  1CF7 A;  5J1R A;  3IH4 A;  2KLO A;  2L02 A;  2E5N A;  2LSE A;  3JTG A;  1UHW A;  1R4T A;  2L7Z A;  2ETS A;  4J30 B;  1HQC A;  2KL4 A;  4LD5 A;  4LDK A;  3TJ6 A;  4BPM A;  5F27 A;  3LSG A;  3M79 A;  4MQ9 F;  3CCM I;  1ZVZ A;  2YEV A;  1SAU A;  4II3 A;  3A01 A;  5ICF A;  5HDN A;  3AG2 C;  3Q5F A;  5AC4 A;  5HS8 A;  3ASO H;  4L9J A;  1OFC X;  2P1A A;  3CDH A;  2CYD A;  4ONS A;  3HOU J;  2EFO A;  2VQG A;  3DEU A;  5GTH C;  4CUG A;  4ZH4 F;  2FOK A;  4EGY A;  1OR2 A;  4EIY A;  1D0Y A;  3MZY A;  3MQ0 A;  3HHH A;  4EGZ A;  3RKX A;  5L3E A;  4OD5 A;  5L0J A;  4BQA A;  4AYB A;  3JSZ A;  1NG7 A;  3FK7 A;  1VQL I;  3KYD B;  1CGM E;  1DU0 A;  1HST A;  2DU9 A;  4YFN F;  4P5O A;  5L3Q A;  2OCC H;  3ZQC A;  2FU4 A;  1BOB A;  2EFP A;  3U1D A;  1ETQ A;  2K3F A;  5TIS C;  4HEA 2;  1POG A;  4HPQ A;  2CGE A;  4AX2 A;  4O6J A;  3FXM A;  1YRN A;  1ETK A;  3Q3S A;  2IS1 A;  3NRH A;  5FKK A;  1YO5 C;  5E2Q A;  2DT5 A;  2VXD A;  1SR2 A;  3HB9 A;  3EHN A;  3WTT C;  4BUP A;  4YT4 A;  4MW8 A;  1YYV A;  1KON A;  1XDU A;  2BEO A;  3FXQ A;  1CGO A;  1VYI A;  3S90 A;  2IW5 A;  3BR3 A;  1J8M F;  2G9W A;  2LLK A;  3K1M A;  2QEN A;  2WAQ A;  4KA4 A;  3G50 A;  2XPV A;  2BE5 F;  5FFZ A;  4D7N A;  2OEV A;  1UMQ A;  2FD5 A;  2DYR C;  1W1W E;  4B1R A;  3M4O J;  3GOD A;  1FYL A;  1QU3 A;  2OEX A;  4XQ1 A;  1YDI A;  1FBU A;  5FLX Z;  1STZ A;  3TOL A;  2FML A;  5LLQ A;  2QE9 A;  2MH9 A;  1MZB A;  3I59 B;  1T98 A;  3GZN B;  1T39 A;  4Q48 A;  4EHP A;  1JAF A;  3UMH A;  4J01 A;  5M5W J;  1E85 A;  1FEX A;  3AQC A;  3I53 A;  1SZI A;  3DQV C;  4BG0 A;  2XVC A;  4CDY A;  3E3V A;  3COA C;  2JT1 A;  3V5Y A;  5D8K B;  2CFO A;  5CVI A;  2BBY A;  3H0D A;  4O7G A;  3KEY A;  1K79 A;  3NKD A;  1XDS A;  3TJ5 A;  1V54 C;  2H1K A;  3H3Z A;  2CNW D;  2BYV E;  1LEA A;  3GTP J;  1ZGA A;  5EF6 A;  4HSR A;  3J7A Y;  1FTT A;  4CJG A;  1YHQ I;  3HKZ N;  3B73 A;  1K6Y A;  2DBB A;  3A0B C;  4E7L A;  3GTL J;  3G4X A;  1TNS A;  2E34 A;  2V9V A;  3B6C A;  2L5Q A;  3SFZ A;  3IH3 A;  4BEM J;  3A0H C;  2XSE A;  1NZE A;  4HX7 A;  1TQM A;  1JUM A;  1WJB A;  5F64 A;  2AS5 F;  1J7K A;  4I2O A;  2XF6 A;  2QSF X;  3K1I A;  1OLT A;  3TO6 A;  5JVT A;  3BDD A;  1I1S A;  1BDJ B;  4I3M A;  3BR1 A;  3IHU A;  3N97 A;  3IWF A;  1XZP A;  1QPI A;  4GYG A;  1OW8 A;  2K9L A;  3JRF A;  2YKZ A;  4EKW A;  1X2N A;  2XLO A;  3ECS A;  2W00 A;  1I6H J;  3AL0 C;  1GQA A;  1UB9 A;  2EIN H;  2KIS A;  1ON1 A;  3CCJ I;  2HVS A;  1ZH5 A;  3BRJ A;  3K7D A;  5F5F A;  1QLE C;  4RGX A;  3I5U A;  3G6E I;  2XS8 A;  3NMK A;  2MBF A;  3QW1 A;  1WSU A;  3BCA A;  4G6D A;  4ULW A;  2L6G A;  1FT9 A;  4LG0 A;  1FZP B;  4HNU A;  2ZXO A;  2NVU B;  2EFW A;  2YWA A;  1O7F A;  3FZV A;  2VJ5 A;  3Q7L A;  3B02 A;  4L0Z B;  4KNW A;  1ONV A;  2HOS A;  1HA8 A;  1BL0 A;  4A3D J;  5F1J A;  4YL3 A;  2VBW A;  4OIN F;  2R7U A;  3KKB A;  4LIV A;  4E17 A;  2V1D A;  1RXQ A;  3SXY A;  1T2K A;  4AM3 A;  4OIQ F;  4CDG A;  2D4U A;  4GEH A;  1ENH A;  3FHN A;  2RNG A;  4LK1 F;  4UY8 I;  2Q2E B;  3GO5 A;  1H0M A;  3U2M A;  3K4J A;  1D5V A;  3HXL A;  2F48 A;  2ZNZ A;  2QLA A;  2AU5 A;  3CCE I;  4BJ6 A;  5L3V A;  3BPX A;  3QPS A;  3SZT A;  4DNC A;  1X1P A;  1V4R A;  4I99 C;  4PR9 A;  3ZIB A;  2DA3 A;  5GPC A;  3U2R A;  2QSH X;  2EIL C;  5LRR A;  1A6Q A;  3B0U X;  4C3E A;  1YX3 A;  3HKZ A;  2KP6 A;  5GTI C;  3GZ5 A;  2YX7 A;  1U8R A;  4JEA A;  4KIS A;  4CYC A;  2L81 A;  4A4A A;  2QKL B;  3K1I C;  2YLD A;  5E17 F;  1ZRF A;  3FMQ A;  3NMJ A;  1UFM A;  5GP9 A;  1Y0U A;  1J59 A;  3HM5 A;  4FX0 A;  5GAE J;  2L6F A;  1ETW A;  2ID3 A;  1WI9 A;  3OSG A;  1ETX A;  3OL4 A;  3F46 A;  1RET A;  5AGF A;  1SAN A;  2QBY A;  5J40 A;  1WH7 A;  3BR0 A;  2E36 A;  4M6X A;  2MA3 A;  1PCX A;  5JSL A;  2WTE A;  3FXH A;  4NUB A;  1V5F A;  3QOP A;  5B1B H;  2FOW A;  3KP5 A;  2FAP B;  1LDK B;  1UG7 A;  1NFO A;  1Z6A A;  2B0L A;  2JX0 A;  2JA5 J;  1ZR2 A;  2X9D A;  3BY6 A;  4I1M A;  1OXK A;  1H8A C;  3F3X A;  2DFF A;  3I4N J;  1OYI A;  1QZX A;  1I4Y A;  5LEJ A;  2X51 A;  1CGN A;  3RZD J;  3NQO A;  1OCC H;  2Y3D A;  4YG2 F;  4UUS B;  3BEH A;  4HFK B;  3GWN A;  1T0F A;  4I0B A;  1HW5 A;  4CCN A;  3PJR A;  2XLW A;  2OU2 A;  3S1M J;  2XKO A;  2IGM A;  3D5L A;  3LSJ A;  1QVX A;  4IRG A;  1Q1H A;  2CSO A;  3V42 A;  2QQB A;  3HGG A;  1USS A;  3E6C C;  2BY0 A;  3KP3 A;  3D0S A;  3HNL A;  3BG3 A;  3LAP A;  1K04 A;  1TBX A;  2VC0 A;  2Y3H A;  1SF8 A;  3WGI A;  4U9D A;  2FJ1 A;  3AG3 H;  3TP3 A;  3V7S A;  4YRV A;  4IQJ A;  2MSY A;  4GGG A;  3S15 J;  3VDX A;  4IRI A;  1U5T A;  3MCZ A;  1WN0 A;  3LOC A;  3VYW A;  4MTE A;  2E5Z A;  1ZRD A;  2ZD9 A;  2ID6 A;  1KGS A;  3WOD F;  1DDN A;  1LVK A;  1ZHF A;  2HGC A;  2WY8 Q;  3U1K A;  2EIN C;  3OR1 C;  4IL6 C;  1RES A;  4EJO A;  1S6L A;  3TK0 A;  2JMW A;  1QBJ A;  2BV6 A;  2UUZ A;  1H9G A;  4FAP B;  3F6V A;  2P4W A;  1IRX A;  4C2T A;  4CO8 A;  4ZLD A;  2J45 A;  1A5J A;  4PJM A;  2XC7 A;  1C02 A;  2M4G A;  4AC0 A;  1UHS A;  2FBH A;  4W8P A;  1FMV A;  3CCU I;  2OZU A;  2NSG A;  2PMU A;  3BR6 A;  1J8Y F;  5F5H A;  4IJJ A;  3UNG C;  2Z1D A;  4M9X A;  1XG1 A;  5F04 A;  4KI2 A;  3G4Z A;  3FXU A;  5IT9 K;  1EV7 A;  1MBE A;  1VFC A;  3CZ6 A;  3DTI A;  1HW2 A;  1DP3 A;  1LQ1 A;  2E7W A;  2OCE A;  4E7H A;  3M4B A;  3VEP A;  5DS5 A;  2KK1 A;  4ZDL A;  2KHM A;  3I5P A;  2HTS A;  2Q0O A;  1E3O C;  1HKS A;  4CGZ A;  3B9Q A;  5JFR A;  3P7N A;  5FZT A;  3HNK A;  4M3D A;  1OPC A;  3PSF A;  4L9N A;  3QVZ A;  2EBI A;  1OJL A;  1Y6D A;  1S9H A;  2I8B A;  2FNP A;  2V7F A;  1U78 A;  1MND A;  2MHR A;  2X0C A;  2GWR A;  3DTE A;  3PIP F;  3J7A O;  2VCB A;  2MH2 A;  1VQN I;  5KAI C;  2R93 J;  4LGW A;  1O57 A;  1IDY A;  4U87 A;  3S14 J;  4LK0 F;  4JTC B;  2VKH A;  3N05 A;  2DA6 A;  4JYK A;  4IHW A;  4A0X A;  4ANJ A;  2O03 A;  5D8L B;  1TKN A;  3LNR A;  2NYX A;  3AG4 C;  2EZI A;  2W25 A;  1WKM A;  2O3F A;  2QGU A;  3ONQ A;  1I1G A;  1TW3 A;  1AUE A;  4BHP A;  2ACJ A;  2VUM J;  4HNT A;  1YLF A;  4WGY A;  3M8J A;  4JJG A;  1X58 A;  2ME6 A;  4KC9 A;  5CI8 A;  1F9N A;  1S7E A;  3E5X A;  3GLX A;  1ORJ A;  3FF5 A;  2AHQ A;  2VLA A;  1SFK A;  1TT0 A;  1YTY A;  2XF7 A;  3ZWI A;  4M3B A;  1F36 A;  3HRM A;  4D5C A;  2W45 A;  3NEU A;  3DBH B;  2OOC A;  4YK5 A;  1T56 A;  4RB2 C;  1ZQ3 P;  2K9M A;  5LBQ A;  2TRT A;  2OQM A;  1A04 A;  3TOM A;  4MTF A;  4E7J A;  1BBH A;  3IQ6 A;  5A6K A;  4BE2 A;  4RDA A;  5GPA A;  4XLE A;  3JR9 A;  2XRN A;  2RDP A;  3D5R C;  3Q0V A;  1IV6 A;  4XM3 A;  5EZH A;  4F91 B;  2NUT B;  2WZG A;  4XTK A;  3I0T A;  4EQQ A;  3BJO A;  5C44 J;  2UUI A;  1JJ8 C;  2NNN A;  2CW7 A;  1LE2 A;  2YZS A;  1JJ6 C;  4DVZ A;  5F0C A;  1XX5 A;  4G7O F;  4BXX J;  2TMV P;  1O3S A;  1B72 A;  2L01 A;  2K27 A;  2QM3 A;  2JZY A;  2LRD A;  3I3L A;  1MBK A;  1YG2 A;  2DDA A;  2P81 A;  4XLP F;  1BC8 C;  2NVQ J;  2V1U A;  3ZG1 A;  2XLE A;  2EK5 A;  1FLI A;  4LLE A;  3S29 A;  2RV8 A;  4QIW N;  4ENN A;  3W2W A;  4E0I A;  2FF4 A;  2JUC A;  4IHS A;  2A05 A;  1F1M A;  3R61 A;  4BGD A;  2FXA A;  5HDG A;  4CA0 A;  3HIF A;  4B4C A;  4EJW A;  4XRM A;  1JKQ C;  4HFF B;  3LFU A;  5DD4 A;  3JTH A;  4OMY A;  3PSI A;  3CEX A;  4M63 A;  5KYN A;  5EGO A;  4TV7 A;  2ZXP A;  4RA2 A;  2I8D A;  1SD7 A;  2A0B A;  3GEE A;  1BR2 A;  3FXR A;  1MH4 A;  1LI5 A;  1LE8 A;  5ILU A;  2BGC A;  4MFE A;  2Y31 A;  2K9Q A;  2BW3 B;  1B8I A;  1ZLJ A;  5HV9 A;  3L2R A;  2WV0 A;  2JVG A;  3PHF 2;  2AQF A;  1ORY A;  4RBO A;  4MVM A;  3G1O A;  2CO5 A;  3VB2 A;  2R7V A;  1SYQ A;  2EPK X;  2W57 A;  3CC4 I;  2PP4 A;  3JRD A;  3HNI A;  5HNH A;  4EM1 A;  5FLX K;  1O87 A;  1B6A A;  4CZC A;  2VT3 A;  4H0E A;  1RJ9 A;  4XN0 A;  3CMM A;  2LC2 A;  3EYY A;  2OBP A;  1OYW A;  2NS7 A;  2X6W A;  3K9T A;  3MLG A;  4IX7 A;  1LKX A;  1PUF A;  1A31 A;  1SEU A;  3PUF A;  3ZVR A;  1QNT A;  1GVJ A;  2L2O A;  1QZZ A;  3CO6 C;  5JHU A;  3CLQ A;  4IAR A;  1HKQ A;  1WJF A;  4P6I C;  2Y3B A;  3R4K A;  2FMY A;  2X6Y A;  4ESB A;  2CJJ A;  1VQP I;  3K4B A;  3WG9 A;  3GFJ A;  4KFC A;  2MGQ A;  1BJZ A;  3LNQ A;  5FKO A;  4EV0 A;  2ZXR A;  4KBL A;  2J9V A;  3FAJ A;  2VJ4 A;  4DGW B;  4U5D E;  1YS7 A;  3S28 A;  4GXO A;  2WVQ A;  3GBG A;  2P6V A;  3JYY A;  2NUT A;  2V3C C;  3TOB A;  1TFK B;  1Y1V J;  1NG1 A;  1YAU O;  3M4C A;  2O9L A;  2EPL X;  4LJZ F;  5EK0 A;  1LUJ B;  2EZL A;  2E87 A;  3HPG A;  1MJA A;  1RKW A;  3OV8 A;  1LS4 A;  1T5O A;  5TGT A;  4YEL A;  3U0C A;  4A0Y A;  2K7L A;  1JUP A;  2XLH A;  3E5Q A;  1V74 B;  1FJL A;  3L00 A;  1QSP A;  4C3B A;  3PFI A;  2HYF A;  2A68 F;  3SZG A;  1JKP C;  4HX8 A;  4XON A;  5F6F A;  2VOD A;  2JPU A;  4I01 A;  4I44 A;  5J8C A;  3HOT A;  1G8X A;  3MKL A;  4G78 A;  2LK2 A;  3L34 A;  5IP6 A;  2OKU A;  2BZT A;  2DT6 A;  3QOE A;  4ZYE A;  4JZA A;  5CLS A;  1WJ5 A;  4ZLC A;  2EV5 A;  2R02 A;  1Y8R B;  1J0R A;  1Z67 A;  5K5R A;  4CS9 A;  5DYM A;  4HQE A;  3S1N J;  2IA1 A;  2KC3 A;  1S05 A;  3SDB A;  4UVB A;  3J81 Z;  2J7P A;  1YJW I;  3OL3 A;  4Z6Y A;  2VPR A;  2KRC A;  3S8P A;  4II2 A;  1JXS A;  3WU1 B;  4QI2 A;  2LBF B;  1UG2 A;  4BJ5 A;  3ABM C;  2EQR A;  1WVR A;  3DKA A;  5HS9 A;  3ISP A;  2F6C A;  4BJ6 C;  1T38 A;  3KYI A;  3KP2 A;  2COB A;  1IN5 A;  1WPK A;  1ZAR A;  1GM5 A;  1BI0 A;  5B1A H;  1KU3 A;  3JAM K;  4E6K G;  1W36 C;  2KIF A;  1VLS A;  1YAR O;  5EEH A;  1MMA A;  4ZTJ A;  2IBD A;  2VJI A;  4L0Y B;  2B0H A;  1PUF B;  2IRF G;  4W97 A;  2H94 A;  1AOY A;  1HDP A;  1S29 A;  4F93 B;  3G1L A;  1W5C C;  3ULQ B;  5JVG F;  2ZJR F;  1N78 A;  2QLZ A;  3CD6 I;  3QYB A;  3KIO A;  1FBQ A;  1D5Y A;  1G4W R;  2O5R A;  1ODD A;  1UG0 A;  2HTJ A;  3OMY A;  5DM7 F;  2JA8 J;  4XSX F;  2HOT A;  2DQL A;  3FAP B;  4N6C A;  1Z0X A;  3OYC A;  3OOP A;  3K6B A;  3QPL A;  2VCA A;  2OQG A;  3JRI A;  4QDL A;  2Y2Z A;  2HS5 A;  4OD4 A;  1E3P A;  4WCG A;  3F23 A;  3VPR A;  1TWC J;  2M45 A;  1MJB A;  5FRM A;  3IP4 B;  2DMU A;  1Z7U A;  3BLY A;  2STW A;  2F5D A;  4ENM A;  2MD5 A;  1T6Q A;  4IKF A;  1FWZ A;  3EUA A;  4Q5S F;  4DW6 A;  2Q9B A;  1KU2 A;  3CES A;  5BS6 A;  2Y48 A;  4XNF A;  1MMN A;  2HFI A;  1N25 A;  3LA3 A;  1WGW A;  3O55 A;  5LFA A;  4I6Z A;  3OA1 A;  3CDI A;  3R7C A;  4BJ1 A;  4L5E A;  256B A;  4UHT A;  2AXT C;  3FDQ A;  3A02 A;  3PL8 A;  2QCO A;  3E6D A;  4XN3 A;  1MNE A;  2FX0 A;  3BTC A;  2CW0 F;  3ECH A;  4HNV A;  5M5X J;  4MTO A;  1YJG A;  1I3A A;  5K7F A;  1FOY A;  2Y69 H;  4DYQ A;  2PJR A;  2YSR A;  1WJD A;  3PNY A;  4IQ4 A;  2V1X A;  2G3K A;  2FUG 2;  2HNH A;  5JLX A;  2HJ3 A;  2RN7 A;  2EPO A;  2IBF A;  1FC3 A;  4O6Y A;  2LFB A;  3KYL A;  2OPT A;  1SMY F;  2J0X A;  2GBY A;  4AK9 A;  4F4B A;  3OS1 A;  3EGX B;  3LNM B;  2D1V A;  4EJV A;  2DMQ A;  4E7Z A;  3B0V C;  2XAQ A;  1E84 A;  1A7V A;  3KMI A;  1XCB A;  5C4J J;  2ISZ A;  2LSO A;  2P5V A;  5LRS A;  3KE2 A;  1NU7 D;  5DTD A;  4D4X A;  5COM A;  1XTA A;  2F5C A;  3ZGK A;  4BEH A;  3ROU A;  5J4V A;  2LP4 A;  3AJM A;  3EZI A;  3MYF A;  3J80 Z;  3GM1 A;  3CCS I;  1MDM A;  1P7I A;  4NNJ A;  4A3E J;  1LI7 A;  4ZZL A;  2JPB A;  5IYC J;  4AYB N;  2ICW G;  2LRE A;  3J7Y J;  2P7V A;  3HRU A;  3JT1 A;  2JSC A;  3DXJ F;  1GS9 A;  4XID A;  4YL0 A;  2IAI A;  3BR5 A;  3EGD A;  4EAT A;  1OMI A;  1YA7 O;  4DZJ A;  4U7B A;  1D8K A;  2G62 A;  4MNU A;  1Z3I X;  2KJG A;  4BDY A;  2DMP A;  5J8F A;  4IJA A;  4CSA A;  1V54 H;  1P6R A;  2E2I J;  3P9K A;  3CSK A;  5FKN A;  1TQG A;  2EH3 A;  4ULV A;  5TJ5 E;  4WK8 F;  1QA6 A;  4HA8 A;  5BOX A;  2R05 A;  1R6R A;  4JE9 A;  3HBL A;  5LGN A;  4MVS A;  5D5V B;  3EFO B;  4U88 A;  3MD2 A;  3DPU A;  3E97 A;  3L1P A;  1HXD A;  1JT6 A;  3FXL A;  3DKW A;  4BYY A;  3FKJ A;  3RTR A;  2GAU A;  2RC4 A;  1BW6 A;  4P1W A;  4EBJ A;  2DTZ A;  3K2A A;  2X48 A;  1P2F A;  2GA2 A;  5JLW A;  1Q0D A;  4PUS A;  2LMD A;  3U21 A;  4DZP A;  2XSJ C;  3NRV A;  2PF4 E;  5KK1 A;  4B48 A;  1VQ9 I;  2HSQ A;  3S0X A;  5JI6 A;  3JRC A;  3JSP A;  2H8R A;  4DOZ A;  5L0G A;  4MGR A;  4KMU X;  1MMD A;  4PZJ A;  4WXD A;  3ERM A;  1YYJ A;  1HC8 A;  2VKV A;  4IHX A;  4R1H A;  2VC1 A;  5DCF A;  1K7A A;  2JN6 A;  1T6I A;  3U9M A;  2KYH A;  3ZOB A;  2VC9 A;  3I58 A;  1RI7 A;  2VAS A;  2LP0 A;  1OCT C;  2CQQ A;  2GIV A;  1BR4 A;  1LB2 A;  3CQZ A;  2DYS C;  3JYH A;  4Q7C A;  3Q0U A;  1C03 A;  3MN2 A;  2TDX A;  3GYH X;  1U8B A;  1QVU A;  1NTC A;  4XKV A;  4C9Y A;  4JTD B;  2XXA B;  3J81 K;  5DUI A;  4I0A A;  3N2Z B;  5J1U A;  3W6J B;  2WL8 A;  3B29 A;  2HZD A;  2FEZ A;  3CLO A;  3C8G A;  4GQH A;  1QZY A;  1WFX A;  2ZCW A;  4PSX A;  4CZZ A;  2FGY A;  4EJT A;  2ZSH B;  1ZGJ A;  5E79 C;  1K6O A;  4OAY A;  2E1M B;  2OCC C;  2JA2 A;  2XHK A;  1OKK D;  1IRZ A;  2R7T A;  3FKI J;  2QYO A;  1JPN A;  1RKE B;  1MSF C;  3OYM A;  4MQV A;  3KLN A;  3HYI A;  5IY5 C;  4UUT A;  2ZB9 A;  2UXN A;  1LE4 A;  2R5Y A;  3DI5 A;  1ERD A;  1YYX A;  2D1H A;  2P8T A;  1OW6 A;  1IC8 A;  2MC4 A;  2QEX I;  1RRJ A;  1ULY A;  2K4J A;  5CVJ A;  5BPD A;  4N6H A;  2OD5 A;  4AU7 A;  1QQI A;  1GXP A;  5JRA A;  3L2W A;  3KET A;  3DJN B;  4HV6 A;  1ITY A;  4G12 A;  4Z9J A;  2VE9 A;  2L4M A;  3ZMV A;  2H7B A;  2XRL A;  6PAX A;  2BHY A;  3WTY C;  3AGT A;  4IWB A;  3W3C A;  5FJ8 J;  1IO2 A;  1YLM A;  4MEY F;  1YZC A;  3EUH C;  1BZ4 A;  2XRH A;  1NFN A;  5B1B C;  3JSO A;  3AGU A;  3HNJ A;  3S32 A;  2DQR A;  1XCV A;  4MTG A;  4G6Q A;  3RQE A;  4JEB A;  2A5W A;  3GWZ A;  2R7F A;  5BNG A;  4D9J A;  2ZXJ A;  2ELH A;  5JVE A;  3GCM A;  3HSF A;  4HBL A;  3SZP A;  1SAX A;  1I39 A;  1OCP A;  5FGM A;  3WTX C;  2Q9A A;  2F5V A;  4CIC A;  9ANT A;  3DE9 A;  1YIJ I;  2DDB A;  1EH8 A;  4NHJ A;  5E3C A;  1P7J A;  2BXZ A;  2HFH A;  2VOO A;  2FFH A;  3C2H A;  4XIC A;  4A5M A;  4S05 A;  4FQG A;  2Y0S N;  2VQL A;  3U8V A;  2EIL H;  2YL3 A;  1OCO C;  1Z7L A;  3QU6 A;  4LDR A;  4LFU A;  5T3W A;  4FE7 A;  2KQR A;  3ABM H;  3MWM A;  3BTI A;  4FE4 A;  2WC2 A;  2QQA A;  2QUF A;  2L3D A;  3K69 A;  1GLN A;  3JCU C;  3VOD A;  2NUP B;  3JCU Q;  1V55 C;  2QZ8 A;  3GFM A;  5D92 A;  4RB3 C;  3ZN1 A;  4ZDO A;  2COM A;  3GZ6 A;  2NVX J;  1ZYR F;  3TD7 A;  1ORK A;  2H09 A;  4BHC A;  3PDM P;  1YOV B;  4BY7 J;  3HUG B;  1IN4 A;  4B47 A;  4CSW A;  2B7E A;  3IAM 2;  3AKZ A;  3IQC A;  2UZK A;  1NLX A;  2OUM A;  2W82 A;  4BE1 A;  1ZU4 A;  2WAF A;  3BTL A;  4A12 A;  4XKC A;  1APC A;  3RKO F;  2LCH A;  4IEJ A;  3C1D A;  1B8I B;  5L0I A;  2XL4 A;  4UVA A;  3EPZ A;  5JUA A;  4BKX A;  4S04 A;  3LA7 A;  2PX9 A;  2F5E A;  3HHG A;  1O7L A;  4XMY A;  3CF2 A;  4HZF A;  3Q7G A;  3CMA I;  2HOA A;  3M8E A;  1BBY A;  1BI2 A;  2IPQ X;  3KLO A;  2EWN A;  3TDZ C;  4BHB A;  3CCR I;  1RJ9 B;  5M3M J;  4FX5 A;  2KJC A;  3GLL A;  3KYC B;  2LFD A;  1E2X A;  2ECC A;  3PUB A;  4PFP A;  1HMD A;  3S2H J;  1W7P D;  1ETV A;  2RSE B;  2DA7 A;  5IT3 A;  2G3V A;  3KZY A;  1IXS B;  2BVL A;  2CMP A;  4Z2Y A;  1BM9 A;  4UXN A;  4DRH B;  2R3S A;  2CGP A;  4P55 A;  4UUV A;  4RGU A;  4RS8 A;  1X3U A;  2HXO A;  4XPW A;  1T6S A;  3ZC4 A;  2O0Y A;  4XLN F;  4X1E A;  2ZSI B;  1V55 H;  2M5W A;  4HOB A;  2E1O A;  1UAA A;  1Y8Q B;  4NB5 A;  3M3Y J;  3T9O A;  5EJC A;  4A3B J;  2D45 A;  1RR8 C;  4L6R A;  3SEO A;  2ASR A;  2Z3Y A;  1UJ8 A;  1ZW2 A;  4D1Q A;  5D5W B;  1I50 J;  2JPC A;  3HC7 A;  2OV7 A;  2STT A;  4JVS A;  3H2V A;  2BVM A;  2EA2 A;  3RYP A;  3ABL C;  1IDZ A;  1BIA A;  4KN4 X;  3IH2 A;  1D1A A;  4CCM A;  1FIA A;  4XKB A;  2AVK A;  1XN7 A;  2W4M A;  1ZRC A;  3C8Z A;  4LG0 B;  2J0W A;  3K4L A;  1FFH A;  3FBN B;  4L18 B;  3QOD A;  1FOK A;  2IM8 A;  3DPT A;  4FHT A;  5DV5 A;  2J5P A;  1W0U A;  3BZ6 A;  3F0C A;  1WRJ A;  2CS3 A;  5HNF A;  2ZXI A;  1DP7 P;  2EZH A;  2LKP A;  1RIO H;  3HKK A;  5BQH A;  3HLZ A;  2DYR H;  3Q0W A;  3C18 A;  3MAJ A;  2ZC2 A;  4HLY A;  1GXQ A;  1MQV A;  5B1A C;  4ASN A;  5LHH A;  4KJZ A;  3M7G A;  5D91 A;  2EIJ H;  3I71 A;  1MJ9 A;  3NWT A;  4XEK A;  3W2V A;  3HOS A;  2DXI A;  4CBE A;  5B3I A;  3B71 A;  3FMR A;  2KIU A;  1TP4 A;  2DMT A;  3RYR A;  4F52 A;  1C0W A;  1CGP A;  4EJU A;  1LS1 A;  2WAE A;  1WZ2 A;  2QNL A;  1GHC A;  1HE1 A;  2R9R B;  1W7P A;  4ENK A;  4A3M J;  2P6T A;  3RSN A;  2AWY A;  3C62 A;  2IVM A;  2FSW A;  1I4Z A;  3BQY A;  2VQH A;  1JOG A;  3F72 A;  1YJ9 I;  1S7Z A;  4XLA A;  3TUL A;  2DN0 A;  4A3G J;  2X6X A;  3O10 A;  2DK8 A;  2D2W A;  2NAZ A;  3LFK A;  2OZ6 A;  2ZFU A;  1OW7 A;  4D0P A;  5EEA A;  4JOM A;  3W6V A;  3HPH A;  2R7O A;  4A3L J;  1ZHT A;  3LAY A;  3FIS A;  3A01 B;  1T9K A;  3A4C A;  1D1B A;  1XGM A;  5J47 A;  2B9S A;  3D5S C;  3IPM O;  3UGO A;  4ENJ A;  1R58 A;  1AA7 A;  1GUU A;  5K5O A;  1EA3 A;  4XL9 A;  1K05 A;  4HDV A;  1G3S A;  3S9O A;  4I1O B;  2LR8 A;  1OCZ C;  3GME A;  4BNC A;  1IRG A;  3E70 C;  4O6M A;  1S3J A;  1IXC A;  3HOY J;  1YQA A;  3DU6 A;  4E4H A;  1K83 J;  3EZH A;  1XSX A;  3AQB A;  4YWQ A;  1T6U A;  4MS2 A;  3WU0 A;  4CYC B;  2X1D A;  3R60 A;  2R7Z J;  2DOE A;  5E1X A;  5HLG A;  2DAO A;  5HDK A;  2CYY A;  4B44 A;  3TED A;  3OYF A;  5B66 C;  2R03 A;  3JTL O;  1X1A A;  1W2W A;  1S7A A;  2K4B A;  1QGP A;  3LL7 A;  4WXH A;  2YHS A;  1G6N A;  1MBF A;  2ZME C;  3VYT B;  2ELK A;  1FNT c;  3MZ8 A;  5BPI A;  3L2C A;  3M1C A;  3T8R A;  4HW0 A;  4R79 A;  3S27 A;  3PNV A;  3GF2 A;  4CCL A;  4D4N A;  1KU9 A;  1D0Z A;  2MLG A;  4YT8 A;  1XPX A;  2HQN A;  3TOA A;  4BAC A;  3WGH A;  1RUO A;  2O6G E;  1G3W A;  3ZQH A;  2VOP A;  5A6B D;  3B6A A;  1TTY A;  2E7X A;  5E8G A;  4ER9 A;  2DGJ A;  5LHG A;  1L0O C;  1FP1 D;  4LER A;  2XDV A;  2XAS A;  2VON A;  2XLV A;  2E71 A;  1B9N A;  3HG9 A;  3W2A A;  2J8W A;  4KDP A;  3KZZ A;  2IXS A;  2NXN B;  2OU6 A;  3LSR A;  3HJE A;  4C3J J;  2HMQ A;  4WAB A;  3KP7 A;  1TQP A;  1K78 A;  3CC2 I;  1R5I D;  2JA7 J;  2P6S A;  4UB8 C;  3OYB A;  3CCL I;  1NBB A;  3OR2 C;  2W84 A;  2HZT A;  1MGT A;  2YS9 A;  2J9U A;  3WHN A;  1JUS A;  3BCB A;  4R8H A;  3POV A;  1OCZ H;  4EUK B;  3Q6M A;  3REO A;  1ZHY A;  2HKX A;  3WTV C;  3SJM A;  4P9U A;  4OWR B;  2V4J C;  3ZMD A;  5EDN A;  5HLT A;  1LPE A;  1ZW3 A;  1RCP A;  4AL1 A;  5JS5 A;  2YUS A;  4HF1 A;  3GTG J;  4X6A J;  1Q1V A;  4K0D A;  4CDV A;  3U3F A;  3QPH A;  4JK1 X;  3O8H A;  4A3K J;  2MC3 A;  1EA8 A;  4L9V A;  4AIH A;  4HLX A;  3RJP A;  2Y69 C;  1HKT A;  2LYC A;  3EDP A;  1ZZP A;  4M71 A;  1LJ9 A;  1R5G A;  3NYJ A;  3L2U A;  1D1C A;  3RIP A;  4YIF A;  2NOG A;  3SEZ A;  1YW8 A;  4IVN A;  2XIG A;  1V3F A;  5A6J A;  4F55 A;  4BL0 B;  4DYR A;  2BY2 A;  4IRH A;  2Q2E A;  1AKH B;  3DAF A;  2CUJ A;  3M15 A;  3SEQ A;  1TFO B;  5DS6 A;  4ZJZ A;  1PD1 A;  3NYM A;  2BHZ A;  3OYL A;  2PI0 A;  3K66 A;  5FO5 A;  2C6Y A;  3WGG A;  2G7U A;  5AIQ A;  2CG4 A;  3WG7 H;  5ICE A;  3AG2 H;  4KT6 A;  1QPM A;  4RGS A;  3OWT A;  3AFH A;  2JRM A;  1XMA A;  2PQ8 A;  4EVI A;  1Z7Q c;  1Y6I A;  1FAP B;  1BC7 C;  1Z63 A;  1YFH A;  3RZO J;  2XLM A;  2XL6 A;  1TZL A;  3L8I A;  3ZQV A;  2WAQ N;  3DKY A;  1CPR A;  3C8G D;  3CME I;  3JZ0 A;  2M34 A;  1FFT C;  3DU5 A;  3BG9 A;  5B3S H;  2JQ7 A;  1IUY A;  4BJT A;  1HW1 A;  1PV3 A;  2FRH A;  2IS4 A;  5KYY B;  4C7O B;  1E3H A;  4LLG F;  2NPU A;  3BJA A;  1T0F C;  3BJ6 A;  3CP2 A;  4FWV A;  3H9Q A;  3ABK C;  4MVR A;  3A03 A;  3F22 A;  3I9V 2;  4RAZ A;  4OIR F;  3ZXS A;  3ZMZ A;  4E7K A;  1H88 C;  2CV2 A;  1VB5 A;  5DCM A;  2MG4 A;  1D8J A;  1WWX A;  3EQL F;  4B3X A;  1Q0K A;  3FHD A;  3ABL H;  1ZN2 A;  2PMZ A;  3LLI A;  2HV6 A;  5M5Y J;  2DFE A;  1Q0G A;  1U0B B;  5GAG J;  4Q47 A;  3TO7 A;  4CS8 A;  1NH3 A;  2BXY A;  3BZC A;  3V8L A;  4JTA B;  5CQE A;  2L4A A;  3T6J A;  5A69 A;  4U5G A;  4UUS A;  4IRU A;  2F4M B;  1IW7 F;  4NDL A;  4PJ0 C;  1R5H A;  3LS0 A;  1OIS A;  1U5T C;  1B1B A;  2HQ5 A;  2EZK A;  3VOE A;  3S16 J;  4EM0 B;  1MBH A;  2XGC A;  2HDC A;  3DWW A;  5D5X B;  3GEZ A;  2L54 A;  2WBM A;  3DEE A;  3KYJ A;  4AVZ A;  3WTU C;  3A9C A;  1Q0M A;  1ON2 A;  2DFH A;  3FM3 A;  3MEX A;  3G4S I;  1DUX C;  1U2W A;  2Z15 A;  3A11 A;  2DK5 A;  1IN6 A;  2O7O A;  1X3Z B;  4V2F A;  3UMI A;  2J7P D;  3HRS A;  4BXF A;  1VND A;  3OIO A;  2BOL A;  2XSD C;  1KZH A;  1IG7 A;  4JCH A;  2XF5 A;  5IP7 J;  4LB5 A;  3GX4 X;  1S7O A;  4YN0 B;  4ZYA A;  1U9O A;  4A0Z A;  3S1R J;  1ZTR A;  4XRF A;  1R23 A;  2CUE A;  3CMY A;  2VPL A;  2Q4F A;  4QLC U;  1LFB A;  2VXZ A;  2QQ8 A;  4CSA C;  1DOV A;  5E1Z B;  5ICC A;  3GUD A;  3H36 A;  2EPN A;  3ZCO A;  1EI7 A;  4A2N B;  5L0F A;  2QKM B;  2A69 F;  4KIC A;  5GPG B;  2QVO A;  1BN5 A;  3HOX J;  2K40 A;  3GM3 A;  2HR3 A;  1L3L A;  4A5N A;  4MVO A;  3OIP A;  2AWC A;  4HX4 A;  4BDZ A;  4W1U A;  2K86 A;  4PDK A;  1V5G A;  2XGX A;  3RKW A;  4CYD A;  1R9T J;  1J75 A;  1UEL B;  4LG3 A;  5FB2 A;  3G73 A;  2WV1 A;  3ZR8 X;  3R2P A;  2PJR B;  4KIB A;  5B5E C;  4Z9I A;  5KYW A;  3I4P A;  2X0L A;  4N9I A;  3FXK A;  2WVN A;  1ZGW A;  2Y3G A;  4N4W A;  3Q6N A;  4CIH A;  1OCC C;  1MD0 A;  4MTD A;  2A5Y B;  4U5E E;  3CCY A;  4ESF A;  3K70 C;  3QAH A;  4FTH A;  5EYR A;  3RKQ A;  4Y17 A;  3BZK A;  2JUG A;  3F6O A;  2LF7 A;  3S84 A;  2KJB A;  2MLK A;  3E5U A;  1Z5Z A;  1WGX A;  2GQQ A;  3IRR A;  2R4G A;  2M8E A;  1YVI A;  1RC9 A;  1X4O A;  2NS0 A;  1K40 A;  2HEO A;  3DV8 A;  4RB0 A;  5EZG A;  3RW0 A;  5IT9 Z;  4XR6 A;  4IZZ A;  5ICG A;  1X1D A;  1W0T A;  3I59 A;  3GWL A;  3FIW A;  1UCR A;  3LSK A;  4WXC A;  2QUP A;  4PK4 A;  2CDQ A;  2NVY J;  4E0H A;  4FT8 A;  1JGS A;  3O6B B;  1UHM A;  3HEF A;  5CKT A;  3EJN A;  3LLK A;  4U7D A;  1TT5 B;  3M1E A;  4JQF A;  1JHH A;  4L9T A;  5F1R A;  2B63 J;  2A1D D;  2YLG A;  3CCQ I;  2LG4 A;  1OXB A;  3O6X A;  4EBK A;  4BBR J;  3O39 A;  3U5S A;  2HUJ A;  4ZYG A;  4PJN A;  2HOE A;  1LVA A;  3PCV A;  4JC7 A;  2K9N A;  2LD5 A;  1X3W B;  4YT5 A;  3OOU A;  3EH2 A;  5CVR A;  1TR2 A;  3ABK H;  3N0T A;  5DDG A;  5COG A;  2EIM H;  3VWB A;  1SVL A;  3G3Z A;  3OSF A;  1TC3 C;  4KMF A;  5LGU A;  3KEQ A;  1ST6 A;  3IEE A;  2NVT J;  1FSE A;  4I98 B;  4CH7 A;  2HPM A;  3W6K B;  1KQ0 A;  1SFU A;  3BR2 A;  4E7I A;  2R7Q A;  4K1O A;  5CVV A;  3IWZ A;  1R71 A;  1RMV A;  1VQM I;  2M0C A;  5A2Q K;  3F47 A;  4QSH A;  3OS2 A;  2XPW A;  2FE3 A;  5D4S A;  2HYG D;  3HJC A;  2R7X A;  1UZC A;  1D3Y A;  2DCE A;  2W48 A;  4IPA A;  1LEB A;  3W8I A;  2ESH A;  2W7N A;  3P9I A;  3PO2 J;  3ASO C;  2NNY A;  3QZC A;  3QWL A;  3PM1 A;  1M1E B;  1OYY A;  2V9K A;  3CTA A;  2V6E A;  2HSB A;  1KA8 A;  2DI3 A;  3OYD A;  2Q9C A;  1QVT A;  4BS9 A;  5EG0 B;  4ABZ A;  3RVY A;  3J06 A;  2LQG A;  2YU9 J;  1MBJ A;  1NG6 A;  3MX3 A;  1EH6 A;  2AXL A;  2H7V C;  2O9X A;  1WOL A;  5TRD A;  2UV1 A;  1BIB A;  2V1N A;  3DLA A;  1SD5 A;  4JJF A;  4HAM A;  4GRI A;  4C2U A;  3GTO J;  2A6T A;  5J1Y A;  4WGZ A;  3SXM A;  2KDO A;  2HV7 A;  4Y7N J;  3I64 A;  4RMN A;  2OAZ A;  3F8N A;  2UUH A;  2ZME A;  1AEP A;  4MIM A;  5D6F A;  3IKT A;  3G1M A;  2PJP A;  3L8J A;  2GXB A;  2VCC A;  2RQQ A;  4NQF A;  1ETY A;  2VQC A;  3H5A A;  2KMU A;  1B72 B;  4LAC B;  4IGG A;  5HOO A;  3K70 D;  1MSE C;  3AAF A;  2PG4 A;  1BI1 A;  2WY7 Q;  5H6R A;  2DYS H;  3OYH A;  3MVP A;  2XUB A;  3GXO A;  4BAY A;  3OYI A;  1VF9 A;  1FY7 A;  4P96 A;  3OEO A;  2E60 A;  1MKM A;  1MIJ A;  5JT4 A;  3A1Y A;  4G6T B;  1IGN A;  1NK2 P;  5H2F C;  2RAE A;  4XEV A;  1EJ9 A;  3E6B A;  5COF A;  3SP1 A;  1XZQ A;  4O5V A;  4L5I A;  1F4K A;  3BTJ A;  4PJL A;  1BR1 A;  1G3Y A;  1KQ9 A;  2JK3 A;  4FIS A;  5E3M A;  1JE8 A;  2DLL A;  2P5K A;  4JUR I;  2K9S A;  1VOM A;  1RPW A;  3RH3 A;  3S93 A;  2AQE A;  1APL C;  2QSG X;  1SVM A;  1Y39 A;  2QQ9 A;  4YII A;  1O3R A;  4BEJ A;  1U0J A;  1LE8 B;  2EFQ A;  3JRH A;  4A3J J;  4LB6 B;  3OY9 A;  3EUK L;  3I56 I;  1SC7 A;  3B0P A;  1ZR4 A;  2KW3 C;  5CJ9 A;  2R5Y B;  4DJA A;  1X1B A;  1M2V A;  4JX5 A;  4CXF A;  4LLN A;  1OR7 C;  3HOZ J;  1QRY A;  4AE4 B;  2CV0 A;  3H3V K;  3IQT A;  1EKY A;  4C3I J;  3ERE D;  5AC5 A;  2UWM A;  3SHF A;  3OIQ A;  2P61 A;  1FYM A;  2DTR A;  3CF5 F;  3PQJ A;  4HE8 D;  4E7S A;  2E2J J;  1XMX A;  1YIT I;  2ESN A;  3BPV A;  1YX5 A;  2OJE D;  2CWE A;  3LWF A;  2VT2 A;  3LSI A;  2HQA A;  1G3T A;  5FKL A;  4DYC A;  3IV5 A;  1QHH D;  4P9T A;  3GEI A;  3L9F A;  3OS0 A;  3HGY A;  3F21 A;  1T33 A;  4KIF A;  2HVR A;  3MFK A;  2HMZ A;  3SZR A;  2F5F A;  5CVU A;  1ZKG A;  2KIM A;  3CUO A;  5KNL A;  1VQ7 I;  2IXM A;  2WZL A;  4JRZ A;  3ZMT A;  4H54 A;  3RQI A;  2WB7 A;  2Y9Y A;  3KX2 A;  5KAF C;  2IP2 A;  5C4X J;  1YA9 A;  1U5T B;  2HI3 A;  3DE8 A;  3GM2 A;  4V19 K;  3L1M A;  2LTP A;  2NSF A;  4C3D A;  1E0E A;  2D5R B;  1YIO A;  3TGN A;  5T3T A;  3ZRG A;  5L0D A;  4DRI B;  1WQ2 A;  4RBN A;  4AUX A;  2FNA A;  5LHI A;  2RGV A;  2ZJ2 A;  2A3S A;  3QRF F;  1K61 A;  3LAJ A;  1LPQ A;  3S2D J;  5CIV A;  5HVQ C;  4BE0 A;  4XPY A;  4Y13 A;  3O2P E;  1RR7 A;  5K7Z A;  1R1T A;  3NG1 A;  4RB1 A;  4ZTF A;  3E9V A;  4HEA J;  3R0A A;  1CQT A;  2CUZ A;  3GTM J;  4QPQ A;  4UNO A;  4ESJ A;  4CS9 C;  2OF7 A;  2BL2 A;  1XMK A;  4NC8 A;  1DPR A;  2FBK A;  4M6V A;  4DVY P;  4MFD A;  1S8N A;  4HG2 A;  3FHZ A;  1U89 A;  2ZO4 A;  3JAM Z;  1H89 C;  1PD0 A;  4XOP A;  5D6E A;  2L7A A;  4HF0 A;  3FM5 A;  1RUN A;  1VQ8 I;  1TWF J;  5M3F J;  2Q7R A;  3SNH A;  2ZXW H;  3ZQY A;  2GOX B;  2W85 A;  4GYT A;  3LQR A;  2V6C A;  1H6G A;  3RQG A;  1SFE A;  3QU3 A;  4KNV A;  2C03 A;  1Z6R A;  2W4S A;  2A6E F;  1TLH B;  2M87 A;  4A93 J;  1MMG A;  2MYS A;  4EM2 A;  1HOM A;  2YL0 A;  2AO9 A;  4WWC A;  3S2W A;  4YJW A;  2YVK A;  4XKW A;  4F92 B;  3ASN C;  1VQ6 I;  3BG5 A;  4IOA F;  4JP0 A;  5J4Y A;  3RVZ A;  4BQQ A;  1RZ4 A;  2CUF A;  3LSH A;  3ZTZ A;  1PUE E;  5L0C A;  3DF8 A;  5FKM A;  4W8K A;  1FOW A;  1FPQ A;  2Z33 A;  2MAB A;  2QF7 A;  4LLC A;  1SD6 A;  2CQN A;  3KPH A;  1WJC A;  1K4S A;  1FBS A;  3TQN A;  1V5E A;  4DRJ B;  3MKY B;  1HE9 A;  3ATP A;  3X2Q H;  2R7S A;  4OIO F;  1RKC A;  1W36 D;  2Y0M A;  4PAC A;  1A0B A;  3ZDL A;  4JBA A;  2M3A A;  4KYW A;  3BT9 A;  1GV2 A;  2MFZ A;  2X6O A;  2F2E A;  2L0K A;  1FNN A;  3MZH A;  3FK6 A;  5DCM B;  5E18 F;  3QVY A;  5AON A;  3WG7 C;  5IYD J;  3ZMU A;  1DGR M;  2XV4 S;  4KUM A;  2M64 A;  1AWC A;  1ZHX A;  5KYU A;  2IJL A;  1I5N A;  1ACI A;  1X4P A;  5FFX A;  1ETO A;  1VYK A;  2P5L C;  3TO9 A;  4M9Z A;  3KZI C;  1O4X A;  3CAX A;  3VRC A;  4JX6 A;  1TL8 A;  2VJJ A;  4DBQ A;  2DT7 B;  2CCY A;  1EQ1 A;  3IQ5 A;  1F5T A;  3GFI A;  1LDD A;  1HCR A;  3FOP A;  3AG1 C;  4N9H A;  1X19 A;  4HDU A;  3GTJ J;  3K0L A;  2XB5 A;  3BQZ A;  2GA0 A;  2UXX A;  1DGW Y;  2LKS A;  1H9T A;  3OYJ A;  3WE2 A;  5FD5 A;  4ON0 A;  1LIH A;  2IGK A;  2BY3 A;  1U3E M;  1LNW A;  4K7B A;  5E3N A;  1N1C A;  2HKV A;  3RF3 A;  1J2X A;  1ZK8 A;  5BMZ A;  5FLM J;  5JHF A;  4M3F A;  2QY9 A;  1B59 A;  1T08 B;  2W24 A;  3AL0 B;  1A7D A;  3CCV I;  1FYK A;  4BU2 A;  5D4R A;  3ZPL A;  4BXU A;  2XL8 A;  2DJN A;  4NBQ A;  2ZJP F;  1WH5 A;  4M74 A;  3DBL B;  4NC6 A;  3NAR A;  1FIP A;  2P7C B;  4G0H A;  3I4M J;  2LIG A;  4FX4 A;  4NCQ A;  1T01 A;  4AVP A;  2ZME B;  2BW3 A;  2GZW A;  4G94 A;  4H4K C;  4CDA A;  3HOW J;  4NY3 A;  3V7C A;  2JTV A;  2IT0 A;  4K2E A;  4DJ9 A;  3CJR B;  2PLY A;  3O8G A;  2XLD A;  2XGD A;  1CPQ A;  5KYU B;  3H65 A;  3NMI A;  2WB1 N;  3GTQ J;  3SXK A;  2EV0 A;  4C3H J;  3QPT A;  2H6B A;  4NQW B;  1HDD C;  4RAF A;  5E33 A;  2DFI A;  4CIP A;  3WTS C;  4WF2 A;  4XOR A;  2LDU A;  3CJN A;  2X85 A;  3CDL A;  3M07 A;  4PSW A;  3OYG A;  3P5J A;  2JRT A;  4IAQ A;  3TL4 X;  1Z6T A;  3U9J A;  2VI6 A;  4YL1 A;  3IUO A;  2O61 A;  1TWA J;  1VZ0 A;  2XPU A;  2ZBK A;  1YE9 A;  1F1Z A;  5HLI A;  2H8W A;  2L7F P;  3E6M A;  3KFW X;  3K1N A;  3LMM A;  2OG2 A;  2YL7 A;  3K6G A;  3PMR A;  1YJN I;  2WA0 A;  3HUG A;  1S72 I;  3SXZ A;  2OC6 A;  2GOM A;  4J19 A;  1OCR H;  1Z77 A;  4F7Z A;  2DA4 A;  1ZLK A;  2DPD A;  5K7H A;  1IZM A;  1IF1 A;  4RAY A;  2W4B A;  3OYA A;  4J00 A;  3CUQ C;  3EUH A;  3QYE A;  1M56 C;  4NC3 A;  1P4A A;  3JRE A;  3K2Z A;  3LES A;  2PMH A;  2LOO A;  5E3A A;  3DCF A;  4IXA A;  1PYV A;  1OQY A;  3NYL A;  1IXR C;  1CF7 B;  1IAW A;  1SD4 A;  2CQX A;  1M2V B;  1L3P A;  4ZYH A;  5BQG A;  2KPM A;  4PGH A;  4U0Y A;  4ZC3 A;  2ZJQ F;  3GAN A;  5L3G A;  2C04 A;  2ISY A;  4U9E A;  2LVS A;  4M9S A;  4OAZ A;  2X4H A;  4I7H A;  4AWX B;  3AG4 H;  2CQK A;  3RPU D;  3LEO A;  4CCJ A;  3U2L A;  5L3C A;  3SFI A;  3BRO A;  2EJR A;  3C8G B;  3ZTM A;  4B6I A;  4EBB A;  5A2Q Z;  2L7M P;  5LD2 C;  4M72 A;  4WJ0 A;  3JRT A;  3HSE A;  1R7J A;  1P9Q C;  2IYL D;  5DLJ A;  3K10 A;  1RKE A;  4KN7 X;  5J3L A;  1JRA A;  4D7M A;  2QBY B;  3U9G A;  3OYN A;  1AKH A;  2R7D A;  4HST A;  3V5X A;  1Z1D A;  1B9M A;  2J9W A;  3DMD A;  1O3T A;  2PX3 A;  4UB6 C;  2LK4 A;  3IL2 A;  1XSV A;  1GDT A;  2A07 F;  1XWJ A;  1XGO A;  2IGN A;  2LH9 A;  2VH3 A;  1C17 M;  3DFG A;  4XSZ F;  1J09 A;  5GAD J;  1WI3 A;  5DM6 F;  2KSF A;  3I5Q A;  4B09 A;  5CPR B;  2HDD A;  3LA2 A;  2KRF A;  2D5V A;  2R7R A;  1Y1W J;  1ZHZ A;  1VTN C;  2VE8 A;  1X2M A;  2HPI A;  5AIP A;  3N4M A;  1LDJ A;  1WWP A;  2KFD A;  1IZ1 A;  2CQ7 A;  2I10 A;  2J5O A;  5J6X A;  5LGT A;  2KQ9 A;  1JPJ A;  5KYX A;  2H7O A;  2XKP A;  2GA1 A;  2JSP A;  4HYE A;  1N77 A;  5DVW A;  3F8M A;  5FRN A;  3EG9 B;  4NTA A;  1FMW A;  1HBX G;  1WAT A;  3X2Q C;  2GM4 A;  3W8H A;  3RPQ A;  2LKX A;  2CRG A;  3MMY B;  4B3A A;  1R4N B;  2PBI A;  4MO7 A;  4XQF A;  1N75 A;  2E19 A;  2RNJ A;  4DQ2 A;  2V9P A;  3PFY A;  5DS4 A;  3BWG A;  3BP8 A;  1O3U A;  2OTL I;  4NC7 A;  3OYK A;  3K7A J;  3K4M A;  4XLH A;  3ZQI A;  3VYR B;  3TW6 A;  1Z21 A;  1QHG A;  5DQZ A;  4PJJ A;  3T4R A;  4HF2 A;  1BA5 A;  5H6Q A;  5CI9 A;  2YR2 A;  3WAQ A;  2YQY A;  1KQ8 A;  1S5L C;  5A6B A;  4ZYD A;  3LSP A;  2LD6 A;  2E1C A;  3UKG A;  1FSH A;  3PQK A;  2K85 A;  3KEO A;  1EKE A;  4B43 A;  4AL0 A;  3LJB A;  3E0J B;  4BBS J;  3VF0 A;  2X1E A;  3EYI A;  3WE3 A;  1BW5 A;  4RAG A;  2VL8 A;  1JGG A;  2M7B A;  2Z2S B;  2YLI A;  1R1V A;  4E18 A;  2NS8 A;  2WWY A;  1HMO A;  3EFO A;  4IAO A;  2PMZ N;  2RQP A;  5EHH A;  3BG6 A;  2OA4 A;  5EEG A;  5IPA A;  4KIT B;  1Y56 A;  2DJI A;  2QWW A;  3DEW A;  4M3G A;  1SVO A;  3VYS B;  3GFL A;  5L3B A;  1IN8 A;  1FTS A;  1H7I A;  1D0X A;  1OKK A;  3M8F A;  5ILV A;  1UFB A;  2GXG A;  1XSD A;  2XB0 X;  1K78 B;  5CQG A;  4ITV A;  2Z16 A;  1A36 A;  2HWV A;  2HZ8 A;  1R1U A;  4U5C E;  4MVQ A;  1FX7 A;  4CJO A;  3C2G A;  3FWE A;  5K5Q A;  1QO0 D;  1KYW A;  1JI8 A;  4XLC A; 
#chains in the Genus database with same CATH homology
 3KPH A;  2ICW G;  1R5I D;  2OJE D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...