2ICWG

Crystal structure of a complete ternary complex between tcr, superantigen, and peptide-mhc class ii molecule
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
213
structure length
213
Chain Sequence
MKLRVENPKKAQKHFVQNLNNVVFTNKELEDIYNLSNKEETKEVLKLFKLKVNQFYRHAFGIVNDYNGLLEYKEIFNMMFLKLSVVFDTQRKEANNVEQIKRNIAILDEIMAKADNDLSYFISQNKNFQELWDKAVKLTKEMKIKLKGQKLDLRDGEVAINKVRELFGSDKNVKELWWFRSLLVKGVYLIKRYYEGDIELKTTSDFAKAVFED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complete ternary complex of TCR, superantigen and peptide-MHC.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
total genus 80
structure length 213
sequence length 213
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-09-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.530 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A mam-mhc complex, Chain D, Domain 2 2icwG02
1.20.120.390 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Hla class ii histocompatibility antigen, dr alpha chain. Chain D, domain 1 2icwG01
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH superfamily
1PCXA 3F8BA 1HOMA 3HOZJ 2LH9A 2QE9A 2CV0A 4CS8C 5LRRA 4CXFA 2XROA 2XL4A 2A3SA 5D4SA 4UVBA 5K7FA 4EJUA 4EM1A 1SD5A 3EETA 2YU3A 3JCUC 3BPXA 4FQGA 2QYOA 1MBKA 1IXCA 4PGHA 2HDDA 2WVQA 4XMYA 4KC9A 2PJPA 3CD6I 3F8NA 2WL8A 2EILC 4WJ0A 3GM3A 3DU5A 2WVNA 2CGEA 1SVLA 1TFKB 5KYXB 5DQTA 1TW2A 2VBZA 1FAPB 1XCBA 3K4MA 3QPSA 4W8KA 2IA1A 4R8HA 5IYDJ 2WB7A 4B6IA 2CWEA 1SFOJ 1IG7A 2VT2A 2KQ9A 1SFXA 1QHGA 1WCMJ 3DM9B 4FESA 5CVJA 1LS4A 1OCCH 3GLXA 3BQZA 3SZPA 4BPMA 1X3WB 1K78B 3FXRA 4G6TB 1ETWA 2NUPB 1JRAA 3VYSB 1JKRC 2JPBA 1ETXA 3HUGB 3IHUA 3LJBA 2L7ZA 3DBRB 4NUBA 1RKCA 2KIMA 3GO5A 5E1WA 3MX3A 4BJ6A 1ZHYA 1YX3A 4O6JA 1QBJA 1HE9A 3PCVA 2VKDA 3ERED 4JIOA 2CU7A 4M6VA 2X6YA 1VFCA 4HZFA 2B0HA 1AOYA 2DMTA 3MYIA 1FIAA 1VF9A 1VQPI 2NVTJ 2JRMA 2OU2A 3DTIA 3HOUJ 1CF7B 1UELB 3I5PA 3US6A 3F21A 3ZN0A 1RUNA 2K27A 1KYWA 2QUFA 2KLOA 2R7DA 4PFOA 4G7OF 4LJZF 2GXBA 2Q2EA 3CCYA 3W3CA 4P9FA 5F08A 4L5EA 2YS9A 3LL7A 4J01A 2HVSA 4HYEA 4HLYA 3JAMK 2HKVA 3PSFA 3KYDB 4L6RA 1ZREA 3O39A 3ASOH 4II3A 2DFIA 3ISPA 4DJ9A 2HYJA 2DPUA 4ULVA 3MFKA 2GWWA 1S05A 4C3EA 2QQ9A 3ZMSA 3OS0A 4GXOA 2Y3BA 2HYFA 1TR2A 5E17F 1LQ1A 1C17M 4Y33A 2O6GE 2JVHA 2DCEA 1V74B 1IJWC 1IRFA 3V8LA 3S1RJ 2CNWD 3I5UA 5IY5H 5L0JA 5M3FJ 2QQ8A 3HGGA 4UXNA 4XTKA 5FKKA 2VXDA 4NQFA 4FAPB 4H4KC 1YOVB 3C8GD 3H65A 4BBSJ 1WQ2A 2HS5A 3BCAA 5JLWA 3EG9B 2MYSA 2HDCA 2RSEB 4JTDB 4WABA 2O61A 1G8XA 2ZCWA 3H3VK 1XN7A 1KQ0A 3ZMTA 4YN0B 4XRSA 4IHVA 3U5SA 3LLKA 3BLYA 3ZN1A 2A5WA 3KKBA 1U3EM 3ABKH 3CCQI 4WXDA 4YIFA 4IQJA 2DT6A 4A3BJ 3DF8A 1LI5A 4UHTA 3FKJA 1E3PA 3L2QA 3AG4C 4A3JJ 2K9SA 4Y3OA 3RKWA 1AKHA 3PL8A 4DZPA 3OYFA 2I15A 5LHGA 1LS1A 2G3KA 2MBFA 2R25A 1QZYA 3K7AJ 2KJGA 2FOKA 1LPQA 2EIJH 2LKPA 2RREA 4G6DA 5CVVA 2CQKA 3M9AA 4KA4A 3OOUA 3FVYA 3JRMO 2K4JA 4AVPA 2KDZA 1HDDC 2DQLA 1TQIA 2EFPA 3JRFA 1IDYA 2MLGA 3EHMA 3U2LA 2EFOA 3SQNA 4CSWA 3IQCA 5DYMA 4QTRA 4OD5A 2HKXA 3HNIA 3OYDA 2L81A 3PO2J 1FR0A 5IT3A 2BY1A 2WAFA 1VMAA 4IHWA 1H88C 2X0CA 2ECCA 1NH3A 5E8GA 2FMLA 4CS7A 3ASNH 4RLQA 2CGPA 3H9JA 5CI9A 2L54A 2VQLA 2KSFA 2YVKA 4MNUA 3K1MA 1FPQA 5M5XJ 1J2XA 1D1AA 5H6RA 4G94A 4AIKA 1ERDA 3SYNA 1ENHA 2H94A 3HTUA 2F22A 2N8GA 3U3FA 1Y0UA 3JCUQ 1FBUA 4LLGF 3F6VA 3DKXA 4BEJA 1I1SA 2EV0A 3OS1A 2UUZA 5DUIA 3ZIBA 3ZRGA 3OYKA 4XKBA 3FWEA 3C7JA 5E3LA 5BQTA 1LE8A 5CVIA 3O6XA 4BG0A 2XIGA 3DPLC 5FZTA 2O5RA 4RB0A 4OWRB 2MGQA 2DA4A 2XGDA 3H3ZA 2J0WA 3QW0A 1S7ZA 1H9GA 2XGCA 2H6BA 3HRMA 3C8GA 3KYIA 3W2WA 2DYRC 1XGOA 3N2ZB 4UUTA 4BE0A 1T8IA 2CFOA 3QU3A 5J1YA 4ZYHA 2OQMA 4E0HA 1R7JA 2AXLA 3MN2A 3CO6C 5KK1A 1O7LA 3DTKA 4HV6A 1O7FA 3K66A 1V54H 5B3SH 1STZA 5J3LA 5C4XJ 3JTLO 3JREA 4ESJA 1MJBA 3C63A 4MVOA 2VL8A 3V8JA 5M5WJ 1Y8QB 3H92A 3F8MA 3IV5A 2M4KA 3S3OA 2MH9A 4A3GJ 4Z2YA 1DOWA 2ZPAA 5HSWA 5BQIA 2WADA 1QU3A 5LBQA 3K9TA 2H8AA 4C2MJ 3R61A 2O7OA 5ICCA 1HW1A 2DODA 3I4MJ 3QOPA 2E5ZA 1NFOA 5LLQA 2YPRA 3LSGA 1UJ8A 5TJ5E 2X9DA 3L8JA 2LY9A 1KU7A 3CC4I 2Z99A 2HJ3A 3HKZN 2L4AA 2W7NA 4WX9A 1IUFA 3OYBA 4F3QA 4NC7A 5DVWA 5F6FA 4KT6A 5L0FA 1GT0C 4XBFA 5KNLA 2RQPA 2LK4A 2OZ6A 4IF4A 1WATA 3GW2A 4I2OA 4QI0A 1AVOB 4BAYA 1RETA 3U8VA 2AVKA 1S7AA 3D0SA 3TO6A 1HLVA 1MGTA 3LSIA 1IW7F 5HDNA 4K0DA 2R7SA 1BN5A 1Z3XA 4MHGA 4CS8A 1XSVA 1OJLA 5ICFA 2Y0SA 2L3DA 4XEVA 3FHZA 1PUFB 4O79A 5DTDA 3A4CA 3BR5A 1W36C 3DV8A 1DGWY 4J32B 3RDIA 4EVIA 5D92A 2VJIA 2IXMA 1TT0A 3M4OJ 2VC1A 4YK5A 4E7LA 1J9IA 2O8KA 3CMYA 1KNYA 2KHMA 2D1HA 4UUSA 3J7AO 4RD9A 3M8FA 1CGOA 2IVMA 3CCVI 4YL3A 1D5YA 4WWCA 1JTYA 3S93A 4XLPF 2OPTA 1L7CA 4HNUA 5JLXA 1C0WA 4ULWA 1QKRA 3QYFA 3E6DA 3S15J 1V4RA 3HSFA 2XPWA 1YAUO 1YVIA 1O57A 4XL9A 2V1DA 3M1EA 2E5NA 4BJTA 2E1OA 1ZRCA 2VT3A 4K1OA 5HS9A 1B8IA 2VONA 2XLEA 4XPXA 3W8HA 3ZMZA 3E7LA 4O6MA 3ABKC 1ZKGA 3TBIA 3EGDB 2LR8A 1Y0NA 4HLXA 4JX6A 4L9VA 1RCPA 1TWCJ 1JHFA 2PMZA 4IARA 1GVDA 5E3AA 2OG2A 1BIBA 2AQEA 1W2WA 1QHHD 3WGHA 4KDPA 1XZPA 4E70A 3U9JA 4YT8A 1A04A 4FISA 1ZK8A 5JP7A 3D1NI 3KYJA 3CCMI 4N6CA 1TWHJ 2M4EA 3E3VA 1D8JA 5GAEJ 2WC2A 2VOPA 5D8KB 3GCMA 4HOBA 5KHDA 3GEIA 5HLIA 3I4PA 5HDKA 4D7MA 4Z9IA 2DDBA 4ENNA 4KBLA 3T4RA 1OKKA 4B43A 1RKEA 1V55H 4D9JA 4S05A 3BROA 1MBHA 3W6VA 2ZB9A 5DM6F 2PMUA 3EUHC 2H8RA 1HMOA 3AG1C 3TMOA 1ZRDA 3FK6A 1FTTA 1ORJA 2ME0A 4IAQA 2HVQA 1NU9C 2WWYA 2I8BA 3CMAI 3AG3C 2LP0A 1QZZA 3K0LA 5C3EJ 3MFNA 3FMSA 3BWGA 3BJ6A 3CUQC 1NHAA 3SHFA 2K5CA 1WSUA 2XLVA 3AQBA 4KT5C 4IRUA 2CO5A 4ZLCA 4I6ZA 1YS6A 9ANTA 5FCLA 3S2DJ 4XRFA 1Q0GA 1QZEA 4DRIB 2Q3TA 2HV7A 2Q1ZB 2STTA 4K2EA 5BUOA 2XS8A 1MSEC 1J59A 3PNTA 2ESHA 3OYMA 3QAHA 2BZTA 3K6GA 3GORA 4CSAA 4JX4A 1QGPA 4NB5A 3ZGKA 4ZLDA 5FRNA 3CP8A 4HEA2 3C2BA 3QVYA 5LFAA 3DAGA 1TWAJ 5E79C 2BYVE 4EBJA 5L3GA 2HJMA 4NCQA 2M0CA 3PFIA 5BPIA 3RI4A 3PNVA 2EZLA 3FXOA 4OIRF 1IGNA 4UY8I 3LS0A 3LUTB 3TQOA 1JOGA 3EZIA 3OSFA 1MD0A 2ZXJA 4FX5A 5M5YJ 1I6HJ 3ABLH 4XLEA 1OR7A 3HC7A 1U6GA 1WHUA 1U9OA 5JUAA 1FT9A 2MG4A 1UHWA 4LK1F 4P1WA 3JTGA 1QPIA 1L0OC 1P9QC 2R7XA 4NC8A 4D4XA 1HKQA 1M1EB 4CICA 2W82A 2ID3A 1I5NA 3KL4A 4YELA 2L9RA 2DA7A 3QRFF 1ZQ3P 2Y48A 4AK9A 3GFLA 1W0TA 4ZH4F 4KFCA 4ASNA 5ILVA 2AXTC 2YHSA 2JT1A 1GQAA 2OBPA 3MZ8A 3PSIA 4FHTA 5EG0B 1AEPA 1G4WR 1Y4CA 4N4OB 2EIKC 3FAPB 4AIHA 4AL0A 1JAFA 2RGVA 2XLDA 3JSEO 2B7EA 2DFFA 2PN6A 3H3UA 4UB6C 1RR8C 1LE4A 2X1CA 3K4JA 2YL1A 4ZDPA 3PJRA 2IPQX 2KC3A 2E36A 1T0FC 4NNJA 1QQ3A 4MFDA 3LQQA 3DMDA 4II2A 1LDKB 3TP3A 5FKMA 3KEYA 2MABA 2RC4A 4YIIA 2KNHA 1R5HA 5AIPA 3AOUA 1VQ6I 2IGKA 4MFEA 4A0ZA 1FZPB 5E33A 3D5LA 4OAYA 1HKSA 2J9VA 3S84A 4XEKA 3AKZA 3S2HJ 5EHHA 3LA7A 3ZMVA 2AO9A 1OKKD 5E3NA 1JKPC 4F4BA 3N05A 3ECHA 2VC9A 2HZDA 4HQMA 3GTQJ 3TOLA 3B9QA 4BQQA 1G5ZA 2ZXWC 1WJEA 3HPGA 3GTJJ 2AQFA 4O7GA 4A6DA 3BG5A 3U1DA 3TK0A 1CGPA 4IPAA 2VIXA 3EG9A 3CQZJ 2PX3A 2JX0A 2F4MB 3FZVA 4EKWA 5A6AA 4ESBA 4J00A 3BG9A 4RDUA 4M6YA 4E7ZA 5GAGJ 1ZHWA 2BOLA 1YQAA 2KIFA 4RB2C 4WXHA 1M6TA 2HEOA 4IWBA 3HPHA 3AJMA 2CRGA 1WH5A 3CJNA 3BQYA 4C3HJ 3LFUA 1BC7C 1WN0A 4HFFB 3Q3SA 4ABZA 2CUJA 2EIKH 3WTUC 5IP9J 1X1PA 1R22A 3G2BA 3GEZA 3KP6A 5B66C 4D1QA 2B63J 2QWWA 3Q6MA 4MTOA 4PFPA 4JTCB 5A6BD 2RNJA 2FJ1A 2RV8A 3CCUI 3G4ZA 4HQEA 3HOVJ 1PDNC 3CLOA 1E84A 2XAQA 2LF8A 2ME6A 2FX0A 3C18A 4MNDA 3OA1A 3EFOA 2DLLA 2CDQA 2NXNB 2XF7A 2ZJ2A 4XQFA 4NTAA 1EKEA 4F92B 1MMAA 1A7EA 3W8IA 3HJCA 1HQCA 1UHSA 2LDUA 5DM7F 3J80Z 5K5OA 3SJMA 4C3BA 1R00A 3KLNA 4XRSG 2VE9A 4QWQA 2D5RB 4DVYP 2XF5A 1B8IB 5J1UA 3MMYB 1S72I 2FXAA 2HOTA 4U5BE 3X2QH 4LLEA 4HRIA 5JRAA 2P61A 3F0CA 3WG9A 3GTLJ 2G0EA 2X6XA 3BOQA 2CV1A 1EKYA 2Y39A 2L9NA 5IP7J 4GEHA 2H7VC 5L3QA 1X58A 2HPIA 5L0GA 3L2CA 1VOMA 2DA3A 3I9V2 1TW3A 3H5RA 2EFQA 2DDAA 3GODA 2GZWA 2WZFA 3V5ZA 3W2AA 2JZYA 2EIMC 2KL4A 2R7OA 3NRHA 1A35A 5DS4A 1DU6A 5K0IA 4CDAA 2IT0A 1ETQA 4IX7A 2EZIA 3O8GA 1PUFA 2DOAA 4BEHB 3MWMA 5FGMA 2EBIA 2YUSA 3J06A 2ZBKA 2ZSIB 3FM5A 1S7OA 4I0BA 3L2WA 1K4SA 3O3KA 1GXQA 5COGA 2NS0A 3BJOA 2KYHA 5D4RA 3HLZA 1RKWA 4PJMA 1YJWI 1NFNA 2IGMA 2JPUA 2W00A 1R4MB 2O0YA 5E3CA 5IY5C 5E18F 1ZHTA 5L3DA 3BDDA 2NRAC 2L4MA 1HXDA 3EPVA 3S9OA 2JA2A 4M3EA 2JUCA 3RYRA 4M3FA 2L2OA 3EH1A 1Z63A 1T56A 4E7HA 5A6JA 1VTNC 4M74A 4A93J 3V42A 2VLAA 2CG4A 4Y52J 1P4XA 2ZMEC 4JBAA 4MVUA 5BQGA 3CC2I 2CFXA 5KAFC 4AE4A 4BEHA 1EF4A 2J9UA 1P7IA 3ASOC 2H7BA 2X6OA 3EUAA 2F5FA 2HNHA 1P4WA 3DBLB 2JSPA 2L0KA 4BXXJ 1T6IA 3G4XA 4H54A 5COFA 2LD5A 4CBEA 3FK7A 5F27A 3K4LA 2DA6A 2QNLA 4DGWB 3A0BC 1R6RA 4XKWA 4D7NA 1KZHA 3HKZA 5HVQC 3L0IA 3HJEA 2VPLA 2BHYA 5B1BH 1BBHA 4B1RA 3A0HC 4ZC3A 2BEOA 1XPXA 2O3FA 3GZNB 1A31A 1Q0FA 3MKYB 3WU1B 1VQ4I 2ZFWA 1CPRA 2P7VB 3PQKA 1QVXA 1DPUA 3OOPA 4KI2A 3A01B 2BW3B 2KDOA 3NYMA 2ZXWH 4I99C 2ASRA 4JEBA 1N1CA 1LDDA 4CS9C 3KH2A 2EZHA 2IAIA 5KYUB 2BGCA 1XS9A 2JA7J 5CVUA 3J7ZI 2QENA 1TKNA 2ZXPA 2B0LA 4CSAC 2R7WA 1V5GA 3T6BA 2TRTA 3X2QC 2D5VA 2R03A 5DS9A 3WTZA 5GTIC 1X19A 3A2KA 3PO3J 3DE9A 3K4KA 2L9SA 3ONQA 3ZXSA 2XL6A 1LKXA 2QLZA 1XX5A 2XRLA 3DLAA 1JJ6C 3W6KB 4O3MA 2Z15A 3VOEA 1HE1A 3DKAA 4M63A 2EINC 4L9NA 4M71A 5GPCA 3MKZA 1GV5A 3IAM2 2L6FA 1QA6A 3IUOA 2F5DA 2OU6A 1YJ9I 4C7OA 1U9NA 4IOAF 1REPC 3ZQHA 1HF0A 2COMA 4LITA 1V4AA 1XB4A 4YT2A 3Q7LA 1MJAA 4RB3C 3SZTA 1IN5A 1W4MA 1IN4A 3KZYA 2E1NA 2JN6A 3G1OA 2IS2A 2ICWG 1LPEA 1BL0A 3OYHA 2HTJA 1KU3A 2VC0A 1ZR2A 4XLFA 4BHCA 2JA8J 2M3AA 3OIQA 1OXBA 3IP4B 3NKEA 1SF8A 5DCFA 3KEQA 4W97A 2L7KA 2KP6A 5AC4A 3QWLA 4ENKA 2DPDA 4JC7A 1ZELA 2UZKA 1QRYA 3HKKA 3V5XA 1PUEE 4HX7A 4IJJA 4U9EA 1T0FA 5JVTA 3F9KA 1OCRC 4Y4RA 1WJ5A 1K79A 3IEEA 1H7IA 5EGYA 2IW5A 3GTKJ 4U5HA 3UMIA 2FNAA 4XOPA 5L3VA 3Q9VA 5D5UB 3HNKA 2YZSA 2NUTA 2QVOA 1FFHA 2NPUA 3OYCA 3QYEA 3CUOA 4B47A 2DTRA 3DCFA 1HW5A 2DXIA 1V54C 3T0YA 1YRNB 3PFYA 1ZGJA 3HXLA 3GWZA 3KP4A 1ON2A 1FC3A 4XSZF 1IRZA 3WU2C 4XR6A 1OCOH 3G1MA 6PAXA 1VQNI 3C8ZA 5IOZA 2F5EA 1HSTA 4MEYF 1EA3A 1TC3C 1Z77A 2XKPA 2DA5A 2EWNA 4JOMA 2P5KA 4Y17A 1X2NA 2VJJA 1SR2A 3V7SA 2EK5A 2OKUA 1FOWA 4MW3A 2CJJA 4CCMA 2I10A 1UG2A 3DU6A 2CYDA 2RD9A 2DB4A 4WGZA 3KE2A 2D1VA 3CCSI 4U7BA 2F5VA 3KZIC 3AG1H 4IVNA 1EH6A 3TW7A 2DFHA 1UCRA 2R7TA 1V55C 3S27A 4B44A 1RNLA 5F0HA 3FM3A 2MWQA 3S0XA 3UMKA 3OV8A 5K7ZA 1Y6DA 3BP8A 3WTWC 2WZGA 2ETSA 1XWJA 2QGUA 1YS7A 5F5FA 2L6GA 3U9MA 2LFDA 2HQ5A 4OINF 2JQ7A 3RJPA 3HOWJ 2PF4E 3UMHA 2F4OB 1R36A 4XICA 1B72A 2P0NA 2MW8A 1LB2A 1CF7A 3EDPA 1RXQA 4WXCA 2PMZN 3RTRA 3LAYA 2CMPA 1A6QA 2V79A 4AVZA 2VN2A 2EIJC 3V7CA 2XPVA 3TP0A 2X48A 1WZ2A 2TCTA 3VM6A 2K3FA 1I39A 1Y56A 2HOEA 2P6TA 1IN7A 2XLWA 2GOXB 4OIQF 1W7PB 1KQ9A 1JT6A 5J6XA 4FWVA 5E1XA 1FP2A 5DCMB 1YYJA 2DMQA 3DZAA 3S90A 1IV8A 2K9MA 2LKSA 4K7BA 5L0DA 4CYCA 1Z7Qc 5CQGA 4AC0A 4YFXF 3HSEA 1O3SA 4UV9A 3IQTA 4Z9HA 1MNEA 4UVCA 2E35A 1DP7P 4EBKA 3AGUA 1N78A 3MVPA 3ABMH 3BG6A 1LFUP 4F91B 3KYLA 1WPKA 3ML6A 2FBKA 1GM5A 2O9XA 3SXKA 4B4CA 1O4XA 5C44J 2UUIA 2A0BA 4EWCA 2XRNA 2H8WA 5GP9A 2NG1A 1Z67A 3LQRA 2M34A 4I02A 1SFUA 3RF3A 1N25A 2VKEA 4E7KA 4BHPA 2V1NA 2Z33A 3AQCA 1RUOA 1RRJA 2GQQA 1OCCC 2DI3A 3FHDA 3LS1A 1MSFC 4JCZA 4IXAA 2W4BA 5EK0A 1W5CC 3H9GA 2W24A 2R7FA 1ZHFA 2DK8A 3OL3A 1V3FA 2L7MP 2V1UA 2VB6A 3Q0VA 2KZVA 4NC6A 2Y9ZA 1POGA 1R58A 2YL3A 1OCZH 2XGXA 3R6SA 3CO7C 1F5TA 4L18B 4X0RA 3OYGA 1W5SA 2DGJA 4EATA 4FTHA 1PP8F 2Y3DA 5EEAA 4V19K 3M3YJ 4O5VA 2GXAA 4P96A 2BXYA 3P7NA 2GIVA 3F22A 2DOEA 3QQAA 2VOOA 2KPMA 1FOXA 1FFTC 3LAJA 3R7CA 2WAQA 3WHCA 2FBIA 1BI0A 3R60A 4XLAA 5EF6A 2FGYA 3NEUA 3PQJA 2G9WA 4NHJA 4AYBA 3RFYA 2NVXJ 3L2VA 3GANA 5JHFA 3DJNB 2ZMEA 4PJLA 3OYIA 5D5WB 4G78A 3HOSA 3ROUA 2PMHA 5C4JJ 4V2FA 1VI0A 5EZGA 3R0AA 4BS9A 2BC5A 1MMGA 2V9PA 3CJQB 3PNYA 5LGNA 1TWCA 1TFOB 2LYCA 2QZ8A 1VQKI 1G4DA 3F46A 1T08B 5TGTA 5LHHA 3CQZA 1A6IA 5H2FC 4X6AJ 1BDJB 2FD5A 2W4SA 3GBGA 3LEVA 3H5NA 2P1AA 4Q7CA 4ZYAA 4CIPA 1C02A 1NTCA 1SMYF 1FIPA 3S3NA 2EQRA 1XSDA 2IP2A 2WZLA 3MBGA 2FNPA 4XQ1A 1NK3P 1ZLKA 5D8LB 1J7KA 2QQBA 4XK4A 5FD5A 3LNQA 4B48A 2OJED 1TLHB 1TP4A 2JVGA 3BG3A 1BOAA 4G12A 2EPKX 1XGNA 1VQMI 3HIFA 3X1OA 4EHPA 4NY3A 3DBHB 3E9VA 4MTGA 2FBHA 2Y69C 2XRHA 5JHUA 2DA1A 2A07F 3COAC 3PHF2 1WJBA 5FFXA 2A6TA 4A3KJ 1L3LA 1IDZA 4PACA 1O3UA 2MH2A 4XKCA 4JW1A 1XCVA 3KPHA 2CQNA 1WTYA 3GZ5A 5FB2A 1DOVA 5GTHC 4FX4A 5JVEA 3CLQA 1R5GA 2JPCA 3Q0UA 3ZQQA 2BY3A 4AU7A 3EJNA 3IH2A 3P9IA 4KN4X 1KQ8A 4XNFA 2P5VA 3FXJA 5LD2C 5D91A 2M8EA 2H7OA 3LSHA 1OCOC 3M79A 4AWXB 2PLYA 3OSGA 1WI9A 1XDSA 2PG4A 3F6OA 4MVZA 1USSA 1BM9A 4D5FA 1SYQA 2PJRB 3V7RA 2FAPB 4DYRA 2E34A 2Z2SB 3L7WA 5DD8A 2Q8KA 3CDIA 2VCCA 2ADUA 1ODDA 4G0HA 2EA4A 2G62A 2DJNA 2LVSA 4PUSA 4XOTA 2ZKZA 1GXPA 2BHZA 3JRAA 3S28A 2JJ7A 2FMYA 4BNCA 2FRHA 2JUGA 2X6WA 4ZYDA 4ZTJA 5FO5A 1QZXA 1RZ4A 1RI7A 1PV3A 2JD3A 2VJ5A 3BCBA 2JA5J 1YA7O 4M6XA 2IS4A 3S16J 2NUTB 1JT0A 3K2AA 3WODF 2HV6A 3I58A 3S1NJ 1XMAA 2P7CB 3FXKA 3Q6NA 1ORKA 3IQ6A 4YT5A 4IRIA 3NYLA 2YLIA 3GTMJ 1UHMA 1GUUA 1V5FA 1SD6A 5FLMJ 1XDUA 3UNGC 1R71A 1X3UA 3VFZA 5JSLA 1IXRC 1Q1VA 2P81A 3TEDA 2FQ3A 2M7AA 2M87A 1YJNI 1MBGA 1Z5ZA 3FOPA 3SDBA 3R0JA 4HSRA 5CYVA 2XF6A 2V7FA 4EJTA 1ORYA 3DEWA 2E1MB 5J8CA 1VQLI 2COBA 3AL0C 5IOYA 3FAJA 3GTPJ 3K33A 3M1CB 2Z1DA 5CKTA 4A6EA 3IAS2 4HX8A 1IZ1A 5HLHA 3HM5A 5GADJ 3OYNA 2UWMA 1J8YF 2CCYA 1BR4A 1WOLA 3L00A 2Q9BA 3ZDLA 4XLNF 3MD2A 2OCCC 2QUPA 3VYTB 2VH3A 5M3MJ 5J4VA 1GS9A 2XS1A 1J09A 3L1PA 4U9DA 3JTHA 2ESNA 2WBMA 2C6YA 1S29A 1G4US 5A6KA 2P4WA 2HQRA 2ISYA 3HHHA 2QEXI 3GEHA 2QSGX 2IBDA 5CLSA 3W2VA 3EGXA 2WB1N 5JLIA 4BL0B 2QQAA 4P9TA 2OOCA 3BTLA 2AS5F 4CDVA 1EA8A 2HXOA 1BI1A 1WJCA 1Z7UA 2OC6A 4A12A 4BY7J 1VQOI 5T3WA 2MC4A 2X85A 4IHSA 4IQ4A 2XLOA 4LIUA 2XVCA 2DW4A 2VBWA 3RKXA 3CF5F 2WY7Q 3LSKA 4A3EJ 2VQGA 4OIPF 5FRMA 1IRXA 1E2XA 3DKWA 1ZHZA 3RW0A 4YEJA 2F4IA 1YE9A 3A11A 1CGNA 1MQVA 3ZTZA 2ELHA 4M9ZA 4LACB 1B59A 2MSYA 3VYRB 1HDPA 3B71A 3KP3A 2NUPA 1R49A 2K9QA 4M73A 1OCZC 3JR9A 3U8PA 1OCRH 3MYFA 1JXSA 3LSJA 2XAFA 1T9KA 3HGYA 4HDUA 4LLLA 2C04A 2V9KA 5K1YA 4BQNA 3SEQA 4N6HA 4KYWA 2B0JA 4MQ9F 4CA0A 4L9TA 3JRGA 3S29A 2CUZA 3KFWX 3B29A 4ESFA 3RKQA 3K1IC 4E0IA 3OR1C 3L2RA 4ZDOA 4G7ZF 3T8RA 2DT7B 3MZHA 3ZWIA 2Q9AA 4RB1A 1HKTA 5KYWA 3GYHX 1XTAA 2A61A 1CPQA 2J46A 4QLCU 4N0BA 2EJRA 2R0QC 2YKZA 2QLAA 2HFHA 3BPVA 1TNTA 3REOA 4Y13A 3JRBA 4B09A 2XHKA 1YTYA 1HY5A 3CP2A 1NG7A 3DEUA 1NLXA 2NVYJ 4RGXA 5CQEA 1J75A 3EUKL 3QPHA 1XD7A 3CCEI 2L5QA 2DK5A 4MGRA 4JURI 4LDRA 4N4WA 2ZC2A 3WHNA 2Q9CA 5L3CA 2VE8A 5B3SC 4U7DA 2J45A 3BC8A 5H20A 3RQFA 3M1CA 3J81K 3T9OA 3EPZA 4MVQA 4A2UA 1AWCA 2YX4A 1CGME 4P55A 4ZTFA 4RA2A 5FJ8J 4Q5SF 3TDUC 1BZ4A 1Q0DA 2BW3A 1P92A 2X0LA 4ZDLA 2JWTA 4WGYA 5IT9K 5JT4A 5E1ZB 4CCNA 3H36A 5DD4A 1BR1A 1FWZA 4PGGA 2R05A 1B9NA 1BA5A 1M2VB 3RSNA 1SC7A 3GF2A 1A5JA 3M07A 1NZEA 2XDVA 4DYCA 3D5RC 3OYJA 4AX2A 2BV6A 2ZXHA 5ICEA 1VQ9I 1E86A 1PD1A 1K78A 1W36D 1SAXA 1T95A 1YW8A 2NS7A 1W7PD 1F4KA 2KQRA 4MEXF 3JRTA 3TO9A 5B1AH 2ZD9A 4IB4A 4HF0A 1QVUA 3OIOA 4C7OB 3HL2A 1GV2A 3FXQA 3FBIB 4C3DA 2VCAA 2ZFUA 1EJ9A 4A5MA 3ZMUA 3CESA 2DYRH 4L5JA 2YR2A 4NTBA 4GYTA 1ZGAA 2DOFA 4A0YA 2OEXA 3QZCA 3RIPA 4MTDA 1YARO 2R93J 2DO7A 5A6BA 3A03A 2M0MA 2X1DA 3I59B 3MEXA 2AWYA 2PBIA 2YSRA 4HPQA 2NSFA 2RN7A 3OL4A 4LDQA 3E5UA 1M56C 2KJCA 2PX0A 2NVQJ 2DQRA 3MQ0A 1ZU5A 3TKYA 4BJ5A 3NWSA 2LNBA 2D4UA 5LGTA 1FOYA 3M8EA 1HCRA 3CCLI 4I98B 4ENJA 4ONSA 4BDYA 2KMUA 2Q2EB 5HOOA 4LB6B 2IRFG 2GIZA 1RC9A 1OKRA 1ITYA 1HW2A 4C2TA 1ZW3A 3OYEA 4CX9A 3L1MA 3FBNB 4RM3A 4I0AA 4WCGA 4IHYA 3RVYA 4KIGA 3P5JA 3E1SA 1MNDA 1S7EA 4E4HA 2QBYB 3DP7A 1TWGA 3VAYA 4EJOA 5FKLA 1WWXA 5HS7A 2V3CC 3E6BA 1OYIA 2ELJA 4KIBA 1U89A 4I09A 3TULA 2PFBA 2OZUA 3K1PA 4QI2A 3S1MJ 1S9HA 2OF7A 3NMJA 2KRFA 4JQFA 3IPMO 1B4AA 3VF0A 3AG2H 4BEMJ 4W1UA 3C2HA 4GQHA 3FMQA 2ZJPF 3I5QA 2DYSC 2ECBA 2LKXA 1R23A 3WAQA 4IEJA 4Q4ZF 4CUGA 1HA8A 5E20A 3E6CC 1APLC 3SEOA 1UMQA 4PR9A 1SVMA 5HLTA 1OR7C 2YL0A 3CTAA 3U2RA 4E17A 1IO2A 1N75A 3RQ4A 5GPGB 2FOWA 2ID6A 2NYXA 1T6QA 4GYIA 1USTA 1OCTC 1OR3A 2P7VA 2E71A 2VKVA 2ZJQF 4RGRA 1MMDA 4ER9A 3WU0A 1ZTRA 3G6EI 1D0XA 2CW8A 3DAFA 4HEAJ 4X1EA 1OCPA 1YG2A 1B6AA 4F55A 3RQEA 2R5YB 1S3JA 1TWGJ 3WTYC 3HB9A 5IPAA 2HQAA 2M9HA 2R9RB 2K3PA 2XAHA 2QKMB 1YFHA 1FP1D 2P0WA 1LIHA 4XEFA 2R5ZA 3POVA 1JJ8C 4G8XA 4PJNA 2IJLA 5L0IA 2MFZA 3J80K 1KGSA 1IAWA 1Z3IX 2XLMA 3JYYA 1DU0A 3K7DA 2ISZA 2WAEA 1G3YA 1J8MF 2YL7A 4HFKB 3F8FA 1ZYRF 2CYYA 5LGUA 2PNOA 1X1AA 2FUG2 4ZYGA 4C2UA 3I55I 2W25A 3PIOF 3BR1A 5IT9Z 3WHBA 1FMVA 3H9QA 5DEQA 3DLLF 1GHCA 4A3DJ 3RKYA 5JI6A 4BY1J 2PFDA 1Y8RB 4YT4A 1PYVA 3U9GA 1D1CA 1YZAA 4RBNA 2G7HA 5ILSA 3M7GA 3TO7A 3ZR8X 4HBLA 4HF1A 1E85A 5GAHJ 3I71A 4H0EA 4EQQA 4YFKF 3BR0A 3C3WA 1C03A 1X1CA 2LQGA 3LWFA 4JE9A 4HDVA 1LE2A 3FISA 1E0EA 3RZOJ 4GO1A 3F3XA 3BTJA 3EFOB 2UV1A 4FE4A 4IL6C 3FDQA 3LESA 2AHQA 1B68A 4I76A 3OR2C 2I8DA 2D45A 3F8CA 3ULQB 3OIPA 3OWTA 2L9JA 1JGGA 2DN0A 5LEJA 5HNHA 3LNMB 3BZ6A 5CI8A 5FLXK 2MA3A 2HGCA 4AM3A 1DUXC 2DMPA 1R5ID 2IGNA 3VODA 1A36A 3BTCA 4JP0A 1BR2A 5DUKA 1YIJI 4EUKB 3GM1A 4I1OB 4ITVA 2KJBA 4DNCA 2EB7A 5E3MA 3W4YA 2Y30A 3N97A 5CPRB 2AU5A 4U88A 4A4AA 4CZZA 2K9LA 2HSQA 3JRIA 5KVRA 4QPQA 4BBRJ 1IF1A 4LGWA 1H8AC 1OXKA 3GFMA 3O2PE 3BTIA 1QPUA 5GPAA 1GDTA 4AYBN 4KITB 1EQ1A 3V8KA 1I27A 2F48A 2V6CA 3JRCA 3TOMA 1VQ8I 2ZNYA 4XWJA 1YYVA 3DTEA 3WGIA 2EV5A 4YRVA 1ZN2A 1ZZPA 3M15A 1XMXA 4U87A 1OYWA 3HTSB 4NDLA 4RAFA 2Y3HA 4IRGA 1YI2I 1UB9A 4DRJB 2H1LA 1U0BB 5KAIC 4UUSB 2QTVA 4TV7A 4UB8C 3KZZA 3ABMC 3KP2A 4FASD 2WV1A 5HODA 2GXGA 4E7IA 1F43A 1RJ9B 4L0YB 3IQ5A 4DIQA 3DPUA 1X4OA 3HTKC 3E97A 3K1IA 2DAOA 3NAUA 2MD5A 5IYCJ 4F52A 3R4KA 4O6NA 3TGNA 1LVAA 3KX2A 2BVLA 1FY7A 1JTXA 4QDLA 1FNNA 3IL2A 3EZHA 2XSJC 1ZLJA 1FTZA 3GTOJ 2OQRA 4IHTA 3ZCOA 3NARA 5F1RA 3OYAA 1KTMA 3S3MA 2E87A 4RLFA 4LG0A 5ED4A 5KYUA 4GYGA 2XASA 4DQ2A 3M4CA 2VPRA 2EPFA 2JMWA 3CJTB 3SNHA 1SEUA 1WVRA 4DOZA 3ELKA 2NNNA 3I53A 4HNVA 3DI5A 4E7SA 2C03A 3AAFA 5LHIA 3UR3C 2H1KA 1MMSA 4P5OA 5J40A 5HV9A 3CUQB 1ZG1A 1T6UA 4JCHA 2QSFX 2RAEA 3K4CA 2VBXA 3QP6A 3ZOBA 2X51A 3FXHA 5K5RA 2E2HJ 2J7PD 1U8BA 3TJ5A 5A69A 2CQQA 2VXZA 2Y75A 4BHBA 3FDYA 3J81Z 1ZGWA 3UGOA 1MBEA 2KW3C 2OEVA 1PJRA 5FLVA 1LI7A 5L0CA 1EV7A 4NTFA 3CAXA 1G2HA 1JPJA 3WTTC 4D0PA 1Z3YA 3B6AA 4MTEA 4I44A 4XM3A 2W45A 1HC8A 4DXWA 3IC7A 3RQIA 1V5EA 1B72B 3LA2A 5FFZA 1MBJA 4YJWA 2ZXRA 3WTXC 4MW8A 2CW0F 2Y9YA 4BQAA 4HAMA 3A9CA 1JPNA 4Z9JA 1DP3A 1VYIA 2LY2A 4MVMA 3PM1A 1PP7U 1O5HA 2M64A 1LJ9A 4Y7NJ 4JJFA 2FE3A 1E3HA 1Y1WJ 1TWHA 1ETYA 4KMFA 2EPLX 2KRCA 2Q0OA 2DBBA 1A0BA 3HNLA 3NMKA 2VJ4A 1O3QA 1AUEA 2P6SA 2F5CA 4OD4A 5KYNA 3K1NA 1OW8A 3GUDA 3SEZA 1SD4A 1WKMA 1R1VA 3LEOA 4O6YA 5EEGA 3OMYA 2R7RA 1JMWA 4BJ5C 3TD7A 2CUFA 4WF2A 5EEHA 2CW7A 1MMNA 3GTGJ 4JEAA 3T6GB 3GWLA 4XIDA 4EV0A 3GX4X 4PK4A 1G59A 3QP5A 4HV5A 5EZHA 1Z23A 2OCEA 3IH4A 4MO7A 2E7XA 1R9TJ 1MZBA 1QO0D 3KEOA 3EHNA 1YZCA 4NQWB 1O3RA 1FX7A 2XXAB 2CUEA 2R7VA 4U0WA 1TQGA 4CS9A 3ABUA 2QKLB 3DFGA 4LFUA 4E6KG 2M2EA 3BR2A 1K6OA 1YW9A 2Z9OA 2LF7A 3S1QJ 3GFIA 1LE8B 4E7JA 4CHUA 4BU2A 2VI6A 1WJDA 2OD5A 1G6NA 2HYGD 2UXNA 3D5SC 4EM2A 4QIWN 5L3BA 2LFBA 3F23A 1SD7A 1UAAA 2XAJA 4DW6A 2IGOA 4Y15A 1JUMA 1HBXG 2YRFA 4I1MA 2DU9A 4YIRX 2EFNA 2RKHA 4HA8A 4DYQA 1E17A 2P5LC 3IWZA 4OMZA 1SVOA 1ZVZA 1SFKA 3ZP5A 1TT5B 1UZCA 4KNWA 2M1BA 3E0JB 3QPTA 3C8GB 3PUFA 1I6XA 5FKOA 2J9BA 2KKOA 4I01A 3ECOA 1K61A 3H5AA 4BH9A 3HRSA 3VYUB 4R79A 2L6HA 5AGFA 1BI3A 3HOYJ 2RNGA 5J4YA 2G7UA 1K04A 2UUHA 3FIWA 1XSXA 1K40A 3IKTA 2LY1A 3IH3A 4AIDA 2OTLI 2K40A 2QA4I 2R7QA 1FEXA 3DM5A 4RM2A 5IP6A 4U5DE 4HW0A 4PCQA 1WH7A 1XGSA 4M72A 2PP4A 5KYYA 1Z1DA 4A3LJ 5BPDA 1JKOC 3HHGA 3Q0WA 4JTAB 3HOXJ 4MQVA 4DJAA 1UG0A 1BIAA 2JRTA 1TTYA 2IXNA 3U3BA 5KYWB 1WJFA 1QPMA 4A3MJ 1T01A 2HI3A 4XLHA 2LP4A 3DD7A 3G1LA 3B02A 2ELKA 4IO9F 3WTVC 1VQ7I 3VSKA 5J8FA 1RPWA 2XM0A 1KYZA 2P8TA 3FKIJ 3I54A 3EYYA 3NMIA 4PDKA 3OS2A 2L02A 1K7AA 2Y2ZA 5HNFA 3QOEA 2YQYA 4N9IA 2YWAA 3JT1A 4AL1A 2OJQA 2LREA 3AG4H 3SZGA 4CCOA 1LVKA 1TWAA 2XSEA 5T1DB 2ZNZA 4NQWA 1QLEC 3SZRA 3BY6A 2IXOA 2ZJRF 3CDHA 2XXAA 1FOKA 2Q7RA 4HX4A 1EH8A 4LLCA 3T8TA 1VLTA 4GCVA 4IZZA 1NU7D 2Z16A 2EPNA 5D5XB 2GA0A 2Q4FA 3ZC4A 5JS5A 2ZXIA 4AD9A 4RGSA 3SP1A 3CJRB 3RQGA 3VEPA 1AKHB 1OW7A 3CF2A 1FMWA 2LRDA 5J47A 4F7ZA 3ZQVA 4RBOA 1QSPA 4BJ1A 2H6CA 2L7FP 2NS8A 5LRSA 5AC5A 1ZRFA 2XM4A 3QMKA 2ZO4A 1H0MA 1IRGA 2WA0A 1YIOA 4IJAA 4RMNA 4F93B 1P7JA 2NOGA 4IRHA 2M4GA 5L3FA 1JUPA 1ZG5A 4C9YA 4EBBA 5CVRA 2VQHA 2R7ZJ 1F9NA 1EH7A 1XC5A 1IV6A 3V5YA 2HXIA 2OCCH 3L09A 3VYWA 1JKQC 3ZQLA 1ZW2A 2BXZA 1B9MA 1LNWA 4RAGA 2QM3A 1DQUA 1K6YA 2EIMH 3IRRA 2BY2A 5BOXA 5CIVA 1K83J 2LFFA 1BW5A 1WGXA 4ZJZA 1U5TB 2WTEA 3DKYA 4GDFA 3ZQGA 3FXUA 2EH3A 3DWLE 1OMIA 1JGSA 3VPRA 1X1BA 1P6RA 1OISA 2XB0X 3WE2A 3ZQCA 3SYTA 3I59A 1YHQI 2J8WA 3Q7GA 4NC3A 1ZH5A 3G4SI 4W8PA 1Z05A 4JX5A 3SXYA 3J7AY 3QTHA 3FOOA 3T1BA 4MVSA 4LD5A 5IYBJ 2ETHA 4M9XA 2CQ7A 3P9KA 2OAZA 1MH4A 1SAUA 1B1BA 1Y1VJ 2W57A 2B9SA 5BNGA 3BZCA 3O10A 4LERA 1MKMA 3LSMA 1X2MA 2NSGA 2M8GX 3CMMA 2H27A 3DEEA 3TDZC 2DJIA 3N0TA 3UGPA 1IN6A 1KU2A 1S8NA 3FXMA 5HDGA 3RZDJ 1W0UA 5E2QA 1WFXA 4D5CA 1U2WA 4OMYA 3PMRA 4B8XA 1A7VA 1ON1A 4ZZDA 2XLHA 4LOCA 4BXFA 5TRDA 5B5EC 5D5VB 2M30A 4CDGA 1Z6AA 3DQVC 1NK2P 1G3TA 3G73A 4P9UA 1SANA 2XAUA 4EIYA 1QNTA 4L9JA 3M4BA 3W6JB 2CH0A 4JK1X 4X0GA 3GMEA 4CCJA 4BACA 2KIQA 3O55A 4UDVA 3MKWB 3P9CA 4QPOA 2LCHA 2E19A 3MLGA 4RDAA 5EGOB 5K5QA 3AG3H 2ZXOA 3CCJI 1R4NB 4JKVA 5EJCA 4ETSA 5TJJA 4P6IC 3G3ZA 1O87A 1Q0KA 5JFRA 2VODA 4EJVA 3RPUA 2LTPA 3BR3A 1W5TA 2EPOA 4ZZLA 2CSOA 4OU0A 3FF5A 1JI8A 3CDLA 2Y31A 4J30B 2FF4A 2OUMA 5F04A 3G71I 2R02A 2W48A 2NAZA 4EM0B 4XRMA 1TQPA 1Q1HA 3JAMZ 5JVGF 1ZAOA 1YLMA 3MAJA 4J7YA 3HDDA 5FKNA 1BC8C 2IBFA 2KFDA 3T5XA 3KP7A 4YFNF 4ZYEA 5EG0A 3EGDA 3EUHA 3IRQA 2VKHA 3ZQ7A 3SXMA 3H2VA 1RKTA 1TQMA 1EI7A 4BXUA 3BZKA 1PD0A 1X4PA 1Y6IA 3CCRI 5DCMA 4S04A 5F28E 1U0JA 1FYLA 2WVOA 4IAOA 2HSBA 5FROA 1U5TC 1M2VA 3U21A 3CUQA 1D8KA 2E1MC 1XG1A 2MLKA 4XONA 4A3IJ 3KIOA 1J0RA 3FMRA 4BUPA 1E83A 2LC2A 5A2QZ 2FU4A 3DXJF 4PSXA 3MCZA 4DVZA 2O9LA 1YYXA 3EQLF 1NSGB 1JHHA 5EGOA 4IGGA 1D5VA 3LSTA 4G6QA 3JSOA 2STWA 1Z9CA 2KZGA 2IOQA 4D4NA 3HZJA 1MBFA 2EV6A 1RKEB 3VSLA 4G9YA 1T39A 4B3AA 3EGXB 1OW6A 2VBYA 2Y0MA 2EINH 1LEBA 3GEEA 3QPLA 4PZJA 2ZSHB 4JJGA 3ERMA 1NG1A 1BJZA 4UV8A 3U2MA 3QODA 2YLDA 4LMYA 2NOJB 5EDNA 3NYJA 2CNWA 3JYHA 2HQNA 3H0DA 3CZ6A 3RIRA 2RVCA 1FYMA 3I64A 4V2GA 3CMEI 5EYRA 1PVEA 3GZ6A 2Z3YA 3KYCB 1YO5C 3ABLC 3GLLA 2I5UA 2QSHX 1GVJA 4DBQA 3WTSC 2HDWA 3ZVRA 5DS5A 3WG7C 4IKFA 1ZHXA 4KIFA 2IXSA 2MD0A 2HPMA 3A01A 3B6CA 2XKOA 5DS6A 3H2UA 2A0UA 3NQOA 3MZYA 3LSPA 4FCYA 3DWWA 3QW1A 2X4HA 2K85A 3GWNA 5D6FA 5F0CA 3RCOA 1M2OA 3T6JA 1Q0MA 3V7OA 2YU9J 4LDKA 2EZKA 3HEFA 2A1DD 4LB5A 2J7PA 4QSHA 3WE3A 3DE8A 1FSHA 2L01A 4XORA 2OV7A 5COMA 2Z5UA 4LK0F 1NG6A 2LOOA 2NNYA 5T3TA 5TISC 2PQ8A 1F36A 3EH2A 2FFHA 4U5EE 3CC7I 5FD6A 4C3IJ 2PX9A 1T6SA 4GRIA 4KUMA 2HMQA 2IYLD 1XZQA 1K05A 3ECSA 2A05A 3AG2C 1APCA 2FEZA 4MIMA 3HNJA 3S8PA 2A5YB 4I3MA 2KISA 4U5CE 1VB5A 4RAYA 1T5OA 2BVMA 4UUVA 1LFBA 1RMVA 5B3IA 3UKGA 3IWFA 3E5XA 5ILUA 5JR3A 3M8JA 3R2PA 1J5YA 1P2FA 2K02A 2IA0A 1ZR4A 2O03A 1FSEA 2LBFA 3PUBA 3OY9A 1RJ9A 4A3CJ 2NVUB 1L3PA 4EEFG 2KT0A 4IHXA 2DYSH 1OQCA 1YA9A 3O6BB 2V9VA 2ACJA 3K2ZA 4JVSA 1LFPA 2IEKA 4XN0A 2L9VA 2M5WA 4CJGA 2V26A 2HWVA 1Z0XA 2R5YA 1BW6A 1GGQA 3N24A 3K4BA 1ETKA 3K70C 3K69A 1A41A 1YJGA 3I56I 3ZG1A 5FLXZ 2M45A 4OAZA 3LMMA 4CCLA 2WAQN 3LSRA 1WGWA 2HU9A 1NBBA 1X3ZB 1E3OC 1MNMC 2HVRA 5F64A 1VLSA 3JW4A 2LLKA 5KYXA 3DPTA 2M7BA 1JE8A 4HSTA 5KYYB 3ZPLA 2W85A 4L0ZB 3AGTA 3S17J 1SFEA 2W1OA 1VNDA 4Z6YA 2OTJI 3IKVA 1YITI 1ULYA 3ZQYA 3BT9A 3LAPA 1D3YA 1OYYA 1ETVA 1TL8A 3A1YA 4M3GA 1FYKA 4XLCA 2DT5A 4UVAA 4B3XA 4N4NB 4UNOA 2V6EA 2Y3GA 1YX5A 3NG1A 1DGRM 3VWBA 4HG2A 3SDGA 1K4TA 4KMUX 3TOAA 1WASA 1N77A 1VK5A 1OR2A 2IM8A 3G50A 5DLJA 1MJ9A 2KGOA 3QVZA 5DV5A 2QBYA 4N06A 4U5GA 4J19A 1YDIA 1QVTA 4BE1A 1A7DA 1MW7A 1DDNA 5L3EA 4FE7A 3V4GA 3E6MA 4E18A 4Q47A 1BOBA 1G3WA 2IS1A 3ZMDA 2DA2A 4Q48A 2LMDA 4LG3A 4CDYA 3ZSUA 3ZQIA 1Z6TA 2HKOA 3HG9A 1AA7A 4KISA 2FSWA 1OPCA 1ZARA 2GAQA 1WJAA 5E3OA 5KCMA 3FX3A 1I1GA 3BG7A 2F2EA 1UFMA 4RS8A 4CJOA 4M3DA 3GM2A 2EILH 1W1WE 2GOMA 2HTSA 2XV4S 4ANJA 3RKOF 3VRCA 3Q5FA 1OFCX 1I50J 2XC7A 4CYDA 3TW6A 3AFHA 4EGZA 4L5IA 4J7TA 3HYIA 2P6VA 3NDBB 3SXZA 3H1CA 4AE4B 3HSRA 1OQYA 1U78A 2E2IJ 1VTMP 2CQXA 1FBQA 4FT8A 2K86A 2XUBA 4M9SA 4YG2F 1H6GA 4A5NA 1VQ5I 3GXOA 2VASA 1I4YA 1KA8A 2XGEA 2A69F 2HFIA 2H09A 4A69C 1I5ZA 3LLIA 3GVAA 1T2KA 1H89C 4BJ6C 3ABTA 3JRHA 2RQQA 4CH7A 4KNYA 4RAZA 3CSKA 3JSPA 1TBXA 4PJJA 4PJ0C 3ZQFA 4BKXA 4BGDA 3ITFA 3FHNA 1TWFJ 1TNSA 3Q9SA 4I7HA 2VUMJ 4EMSA 1D0ZA 1KU9A 1O3TA 1FTSA 1FBSA 5B1AC 2JK3A 3SFZA 5E8IA 2L7AA 2GFHA 2R7UA 1RESA 2HOAA 3TJ6A 2GLOA 4C3JJ 1LM3B 1T38A 2XB5A 5K7HA 4HNTA 5HS8A 2Y69H 3KMIA 1MH3A 2VQCA 3L9FA 2PBEA 1HSJA 3KETA 256BA 2OA4A 1CQTA 5F1JA 3SFIA 2W4MA 2D2WA 3ESWB 4C30A 1U6HA 5B1BC 3MKLA 1QQIA 1F1MA 5LEKA 2LSEA 1IN8A 3TQNA 1WRJA 2EPMX 3KCCA 3K6BA 3NRVA 1BBYA 4JYKA 1ETOA 4CYCB 2GM4A 4YL1A 5DQZA 3LOCA 3TL4X 1UFBA 1AHDP 4RGUA 2KIUA 2Y0SN 2W9YA 3CEXA 5CJ9A 1H9TA 3B0VC 5F0FA 5BMZA 2GDCA 3BEHA 2LG4A 2R5ZB 1U5TA 3H35A 4FX0A 1SMTA 4DZJA 1D1BA 1RR7A 4OIOF 4U0VA 2GWRA 3BJAA 3RYLA 3C62A 5J1RA 4IOCF 1I3QJ 1WI3A 2V1XA 5AONA 1Z6RA 2DFEA 4CZCA 5HLGA 4DRHB 2UXXA 4MS2A 5BQHA 2MC3A 1WWPA 2KK1A 1YLFA 2OQGA 1IXSB 1OLTA 1XGMA 2A6HF 2JA6J 2LIGA 2PEXA 3B0PA 5BS6A 3PDMP 2XAGA 1S5LC 2E7WA 2K4BA 3ZTMA 3K10A 4AIJA 3L8IA 1T33A 1I3AA 4XKVA 4R1HA 2EA2A 3RPQA 2VCBA 2HZTA 2X1EA 1Z21A 2O8XA 3I3LA 3BR6A 1U8RA 3ASNC 3E70C 4LG0B 3L34A 2BBYA 3S14J 2A68F 3GFJA 4HF2A 4YL0A 3H0GJ 4BQOA 4OOIA 3QYBA 2XSDC 4CGZA 4XN3A 2E1CA 2TMVP 1VYKA 2GA1A 3RVZA 2ZMEB 1MIJA 4PSWA 4KNVA 1KONA 3RH3A 2K7LA 1FLIA 5H6QA 2FA5A 4KICA 2PI0A 3NKDA 3LNRA 1BJAA 3NWTA 2YX7A 4A3FJ 4WK8F 1RIOH 1MDMA 3EYIA 3HBLA 1VZ0A 2A6EF 2BL2A 1BI2A 1W7PA 1YRNA 1FNTc 3E5QA 3C1DA 1JR8A 1ST6A 2YLGA 4KN7X 1XMKA 3JRDA 1LDJA 2GBYA 2K9NA 2J9WA 4BYYA 1TZLA 3N4MA 2R92J 2IA2A 2KRHA 2G3VA 2WY8Q 4LIVA 3A02A 1R1UA 1ZG3A 3TOBA 5AIQA 3K1HA 4MLOA 3C2GA 1JUSA 4U0YA 1Z7LA 2QF7A 3LA3A 1G3SA 2GA2A 3WG7H 2XL8A 4ON0A 2XPUA 4DBRA 3RYPA 4M3BA 3I4NJ 2CS3A 2TDXA 4KJZA 1M57C 2E60A 2WB1A 3B0UX 4XPYA 4N9HA 3I0TA 2AP3A 5L0HA 5D6EA 4GGGA 1T98A 4MVRA 5A2QK 1Y39A 3F47A 1P4AA 3KP5A 3O8HA 4FETA 4JRZA 4G7HF 3HUGA 3U1KA 5DDGA 2WV0A 3S2WA 3HRUA 4JZAA 2BE5F 3F72A 2RDPA 1R1TA 2AWCA 1Z91A 1AU7A 2DMUA 3OYLA 2QY9A 3PIPF 3L2UA 3OEOA 4EJWA 2LK2A 1LEAA 3BRJA 3KLOA 2LSOA 1D0YA 3S32A 3VDXA 1SZIA 1MDMB 2BY0A 3J7YJ 2IS6A 2V4JC 2DTZA 3HRTA 1I4ZA 1IUYA 3K70D 5ERIA 2Q00A 2YEVA 1ONVA 3U0CA 1HMDA 1ZU4A 1YW7A 3RPUD 1UG7A 4XSXF 2GAUA 2PJRA 4LLNA 2E2JJ 1S6LA 2W84A 4BDZA 3I4UA 2JSCA 3FXLA 2MHRA 4A2NB 4MTFA 4R32A 3LFKA 4CCKA 3HOTA 2R3SA 2QCOA 2CV2A 4GFBA 4ENMA 3B73A 4AUXA 2HUJA 2EFWA 2JTVA 3QU6A 3WGGA 3ATPA 2J5PA 2J5OA 1R4TA 3JSZA 3DJUB 2HR3A 2J0XA 3AL0B 1X1DA 4NBQA 4XPWA 1DPRA 4HE8D 3VB2A 1GLNA 2R4GA 1IC8A 4CO8A 4YWQA 2LBFB 1ACIA 4EGYA 5ICGA 3K4NA 2HMZA 2DMNA 1F1ZA 2F6CA 2IXPA 1ORSC 4S0HB 4A0XA 2HZ8A 2LD6A 4U5FE 3JZ0A 1IZMA 1LUJB 2HOSA 4BE2A 4CIHA 1FJLA 5F5HA 2FQ4A
chains in the Genus database with same CATH topology
2ICWG 1R5ID 2OJED 3KPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
#chains in the Genus database with same CATH topology
 1PCX A;  3F8B A;  1HOM A;  3HOZ J;  2LH9 A;  2QE9 A;  2CV0 A;  4CS8 C;  5LRR A;  4CXF A;  2XRO A;  2XL4 A;  2A3S A;  5D4S A;  4UVB A;  5K7F A;  4EJU A;  4EM1 A;  1SD5 A;  3EET A;  2YU3 A;  3JCU C;  3BPX A;  4FQG A;  2QYO A;  1MBK A;  1IXC A;  4PGH A;  2HDD A;  2WVQ A;  4XMY A;  4KC9 A;  2PJP A;  3CD6 I;  3F8N A;  2WL8 A;  2EIL C;  4WJ0 A;  3GM3 A;  3DU5 A;  2WVN A;  2CGE A;  1SVL A;  1TFK B;  5KYX B;  5DQT A;  1TW2 A;  2VBZ A;  1FAP B;  1XCB A;  3K4M A;  3QPS A;  4W8K A;  2IA1 A;  4R8H A;  5IYD J;  2WB7 A;  4B6I A;  2CWE A;  1SFO J;  1IG7 A;  2VT2 A;  2KQ9 A;  1SFX A;  1QHG A;  1WCM J;  3DM9 B;  4FES A;  5CVJ A;  1LS4 A;  1OCC H;  3GLX A;  3BQZ A;  3SZP A;  4BPM A;  1X3W B;  1K78 B;  3FXR A;  4G6T B;  1ETW A;  2NUP B;  1JRA A;  3VYS B;  1JKR C;  2JPB A;  1ETX A;  3HUG B;  3IHU A;  3LJB A;  2L7Z A;  3DBR B;  4NUB A;  1RKC A;  2KIM A;  3GO5 A;  5E1W A;  3MX3 A;  4BJ6 A;  1ZHY A;  1YX3 A;  4O6J A;  1QBJ A;  1HE9 A;  3PCV A;  2VKD A;  3ERE D;  4JIO A;  2CU7 A;  4M6V A;  2X6Y A;  1VFC A;  4HZF A;  2B0H A;  1AOY A;  2DMT A;  3MYI A;  1FIA A;  1VF9 A;  1VQP I;  2NVT J;  2JRM A;  2OU2 A;  3DTI A;  3HOU J;  1CF7 B;  1UEL B;  3I5P A;  3US6 A;  3F21 A;  3ZN0 A;  1RUN A;  2K27 A;  1KYW A;  2QUF A;  2KLO A;  2R7D A;  4PFO A;  4G7O F;  4LJZ F;  2GXB A;  2Q2E A;  3CCY A;  3W3C A;  4P9F A;  5F08 A;  4L5E A;  2YS9 A;  3LL7 A;  4J01 A;  2HVS A;  4HYE A;  4HLY A;  3JAM K;  2HKV A;  3PSF A;  3KYD B;  4L6R A;  1ZRE A;  3O39 A;  3ASO H;  4II3 A;  2DFI A;  3ISP A;  4DJ9 A;  2HYJ A;  2DPU A;  4ULV A;  3MFK A;  2GWW A;  1S05 A;  4C3E A;  2QQ9 A;  3ZMS A;  3OS0 A;  4GXO A;  2Y3B A;  2HYF A;  1TR2 A;  5E17 F;  1LQ1 A;  1C17 M;  4Y33 A;  2O6G E;  2JVH A;  2DCE A;  1V74 B;  1IJW C;  1IRF A;  3V8L A;  3S1R J;  2CNW D;  3I5U A;  5IY5 H;  5L0J A;  5M3F J;  2QQ8 A;  3HGG A;  4UXN A;  4XTK A;  5FKK A;  2VXD A;  4NQF A;  4FAP B;  4H4K C;  1YOV B;  3C8G D;  3H65 A;  4BBS J;  1WQ2 A;  2HS5 A;  3BCA A;  5JLW A;  3EG9 B;  2MYS A;  2HDC A;  2RSE B;  4JTD B;  4WAB A;  2O61 A;  1G8X A;  2ZCW A;  3H3V K;  1XN7 A;  1KQ0 A;  3ZMT A;  4YN0 B;  4XRS A;  4IHV A;  3U5S A;  3LLK A;  3BLY A;  3ZN1 A;  2A5W A;  3KKB A;  1U3E M;  3ABK H;  3CCQ I;  4WXD A;  4YIF A;  4IQJ A;  2DT6 A;  4A3B J;  3DF8 A;  1LI5 A;  4UHT A;  3FKJ A;  1E3P A;  3L2Q A;  3AG4 C;  4A3J J;  2K9S A;  4Y3O A;  3RKW A;  1AKH A;  3PL8 A;  4DZP A;  3OYF A;  2I15 A;  5LHG A;  1LS1 A;  2G3K A;  2MBF A;  2R25 A;  1QZY A;  3K7A J;  2KJG A;  2FOK A;  1LPQ A;  2EIJ H;  2LKP A;  2RRE A;  4G6D A;  5CVV A;  2CQK A;  3M9A A;  4KA4 A;  3OOU A;  3FVY A;  3JRM O;  2K4J A;  4AVP A;  2KDZ A;  1HDD C;  2DQL A;  1TQI A;  2EFP A;  3JRF A;  1IDY A;  2MLG A;  3EHM A;  3U2L A;  2EFO A;  3SQN A;  4CSW A;  3IQC A;  5DYM A;  4QTR A;  4OD5 A;  2HKX A;  3HNI A;  3OYD A;  2L81 A;  3PO2 J;  1FR0 A;  5IT3 A;  2BY1 A;  2WAF A;  1VMA A;  4IHW A;  1H88 C;  2X0C A;  2ECC A;  1NH3 A;  5E8G A;  2FML A;  4CS7 A;  3ASN H;  4RLQ A;  2CGP A;  3H9J A;  5CI9 A;  2L54 A;  2VQL A;  2KSF A;  2YVK A;  4MNU A;  3K1M A;  1FPQ A;  5M5X J;  1J2X A;  1D1A A;  5H6R A;  4G94 A;  4AIK A;  1ERD A;  3SYN A;  1ENH A;  2H94 A;  3HTU A;  2F22 A;  2N8G A;  3U3F A;  1Y0U A;  3JCU Q;  1FBU A;  4LLG F;  3F6V A;  3DKX A;  4BEJ A;  1I1S A;  2EV0 A;  3OS1 A;  2UUZ A;  5DUI A;  3ZIB A;  3ZRG A;  3OYK A;  4XKB A;  3FWE A;  3C7J A;  5E3L A;  5BQT A;  1LE8 A;  5CVI A;  3O6X A;  4BG0 A;  2XIG A;  3DPL C;  5FZT A;  2O5R A;  4RB0 A;  4OWR B;  2MGQ A;  2DA4 A;  2XGD A;  3H3Z A;  2J0W A;  3QW0 A;  1S7Z A;  1H9G A;  2XGC A;  2H6B A;  3HRM A;  3C8G A;  3KYI A;  3W2W A;  2DYR C;  1XGO A;  3N2Z B;  4UUT A;  4BE0 A;  1T8I A;  2CFO A;  3QU3 A;  5J1Y A;  4ZYH A;  2OQM A;  4E0H A;  1R7J A;  2AXL A;  3MN2 A;  3CO6 C;  5KK1 A;  1O7L A;  3DTK A;  4HV6 A;  1O7F A;  3K66 A;  1V54 H;  5B3S H;  1STZ A;  5J3L A;  5C4X J;  3JTL O;  3JRE A;  4ESJ A;  1MJB A;  3C63 A;  4MVO A;  2VL8 A;  3V8J A;  5M5W J;  1Y8Q B;  3H92 A;  3F8M A;  3IV5 A;  2M4K A;  3S3O A;  2MH9 A;  4A3G J;  4Z2Y A;  1DOW A;  2ZPA A;  5HSW A;  5BQI A;  2WAD A;  1QU3 A;  5LBQ A;  3K9T A;  2H8A A;  4C2M J;  3R61 A;  2O7O A;  5ICC A;  1HW1 A;  2DOD A;  3I4M J;  3QOP A;  2E5Z A;  1NFO A;  5LLQ A;  2YPR A;  3LSG A;  1UJ8 A;  5TJ5 E;  2X9D A;  3L8J A;  2LY9 A;  1KU7 A;  3CC4 I;  2Z99 A;  2HJ3 A;  3HKZ N;  2L4A A;  2W7N A;  4WX9 A;  1IUF A;  3OYB A;  4F3Q A;  4NC7 A;  5DVW A;  5F6F A;  4KT6 A;  5L0F A;  1GT0 C;  4XBF A;  5KNL A;  2RQP A;  2LK4 A;  2OZ6 A;  4IF4 A;  1WAT A;  3GW2 A;  4I2O A;  4QI0 A;  1AVO B;  4BAY A;  1RET A;  3U8V A;  2AVK A;  1S7A A;  3D0S A;  3TO6 A;  1HLV A;  1MGT A;  3LSI A;  1IW7 F;  5HDN A;  4K0D A;  2R7S A;  1BN5 A;  1Z3X A;  4MHG A;  4CS8 A;  1XSV A;  1OJL A;  5ICF A;  2Y0S A;  2L3D A;  4XEV A;  3FHZ A;  1PUF B;  4O79 A;  5DTD A;  3A4C A;  3BR5 A;  1W36 C;  3DV8 A;  1DGW Y;  4J32 B;  3RDI A;  4EVI A;  5D92 A;  2VJI A;  2IXM A;  1TT0 A;  3M4O J;  2VC1 A;  4YK5 A;  4E7L A;  1J9I A;  2O8K A;  3CMY A;  1KNY A;  2KHM A;  2D1H A;  4UUS A;  3J7A O;  4RD9 A;  3M8F A;  1CGO A;  2IVM A;  3CCV I;  4YL3 A;  1D5Y A;  4WWC A;  1JTY A;  3S93 A;  4XLP F;  2OPT A;  1L7C A;  4HNU A;  5JLX A;  1C0W A;  4ULW A;  1QKR A;  3QYF A;  3E6D A;  3S15 J;  1V4R A;  3HSF A;  2XPW A;  1YAU O;  1YVI A;  1O57 A;  4XL9 A;  2V1D A;  3M1E A;  2E5N A;  4BJT A;  2E1O A;  1ZRC A;  2VT3 A;  4K1O A;  5HS9 A;  1B8I A;  2VON A;  2XLE A;  4XPX A;  3W8H A;  3ZMZ A;  3E7L A;  4O6M A;  3ABK C;  1ZKG A;  3TBI A;  3EGD B;  2LR8 A;  1Y0N A;  4HLX A;  4JX6 A;  4L9V A;  1RCP A;  1TWC J;  1JHF A;  2PMZ A;  4IAR A;  1GVD A;  5E3A A;  2OG2 A;  1BIB A;  2AQE A;  1W2W A;  1QHH D;  3WGH A;  4KDP A;  1XZP A;  4E70 A;  3U9J A;  4YT8 A;  1A04 A;  4FIS A;  1ZK8 A;  5JP7 A;  3D1N I;  3KYJ A;  3CCM I;  4N6C A;  1TWH J;  2M4E A;  3E3V A;  1D8J A;  5GAE J;  2WC2 A;  2VOP A;  5D8K B;  3GCM A;  4HOB A;  5KHD A;  3GEI A;  5HLI A;  3I4P A;  5HDK A;  4D7M A;  4Z9I A;  2DDB A;  4ENN A;  4KBL A;  3T4R A;  1OKK A;  4B43 A;  1RKE A;  1V55 H;  4D9J A;  4S05 A;  3BRO A;  1MBH A;  3W6V A;  2ZB9 A;  5DM6 F;  2PMU A;  3EUH C;  2H8R A;  1HMO A;  3AG1 C;  3TMO A;  1ZRD A;  3FK6 A;  1FTT A;  1ORJ A;  2ME0 A;  4IAQ A;  2HVQ A;  1NU9 C;  2WWY A;  2I8B A;  3CMA I;  3AG3 C;  2LP0 A;  1QZZ A;  3K0L A;  5C3E J;  3MFN A;  3FMS A;  3BWG A;  3BJ6 A;  3CUQ C;  1NHA A;  3SHF A;  2K5C A;  1WSU A;  2XLV A;  3AQB A;  4KT5 C;  4IRU A;  2CO5 A;  4ZLC A;  4I6Z A;  1YS6 A;  9ANT A;  5FCL A;  3S2D J;  4XRF A;  1Q0G A;  1QZE A;  4DRI B;  2Q3T A;  2HV7 A;  2Q1Z B;  2STT A;  4K2E A;  5BUO A;  2XS8 A;  1MSE C;  1J59 A;  3PNT A;  2ESH A;  3OYM A;  3QAH A;  2BZT A;  3K6G A;  3GOR A;  4CSA A;  4JX4 A;  1QGP A;  4NB5 A;  3ZGK A;  4ZLD A;  5FRN A;  3CP8 A;  4HEA 2;  3C2B A;  3QVY A;  5LFA A;  3DAG A;  1TWA J;  5E79 C;  2BYV E;  4EBJ A;  5L3G A;  2HJM A;  4NCQ A;  2M0C A;  3PFI A;  5BPI A;  3RI4 A;  3PNV A;  2EZL A;  3FXO A;  4OIR F;  1IGN A;  4UY8 I;  3LS0 A;  3LUT B;  3TQO A;  1JOG A;  3EZI A;  3OSF A;  1MD0 A;  2ZXJ A;  4FX5 A;  5M5Y J;  1I6H J;  3ABL H;  4XLE A;  1OR7 A;  3HC7 A;  1U6G A;  1WHU A;  1U9O A;  5JUA A;  1FT9 A;  2MG4 A;  1UHW A;  4LK1 F;  4P1W A;  3JTG A;  1QPI A;  1L0O C;  1P9Q C;  2R7X A;  4NC8 A;  4D4X A;  1HKQ A;  1M1E B;  4CIC A;  2W82 A;  2ID3 A;  1I5N A;  3KL4 A;  4YEL A;  2L9R A;  2DA7 A;  3QRF F;  1ZQ3 P;  2Y48 A;  4AK9 A;  3GFL A;  1W0T A;  4ZH4 F;  4KFC A;  4ASN A;  5ILV A;  2AXT C;  2YHS A;  2JT1 A;  1GQA A;  2OBP A;  3MZ8 A;  3PSI A;  4FHT A;  5EG0 B;  1AEP A;  1G4W R;  1Y4C A;  4N4O B;  2EIK C;  3FAP B;  4AIH A;  4AL0 A;  1JAF A;  2RGV A;  2XLD A;  3JSE O;  2B7E A;  2DFF A;  2PN6 A;  3H3U A;  4UB6 C;  1RR8 C;  1LE4 A;  2X1C A;  3K4J A;  2YL1 A;  4ZDP A;  3PJR A;  2IPQ X;  2KC3 A;  2E36 A;  1T0F C;  4NNJ A;  1QQ3 A;  4MFD A;  3LQQ A;  3DMD A;  4II2 A;  1LDK B;  3TP3 A;  5FKM A;  3KEY A;  2MAB A;  2RC4 A;  4YII A;  2KNH A;  1R5H A;  5AIP A;  3AOU A;  1VQ6 I;  2IGK A;  4MFE A;  4A0Z A;  1FZP B;  5E33 A;  3D5L A;  4OAY A;  1HKS A;  2J9V A;  3S84 A;  4XEK A;  3AKZ A;  3S2H J;  5EHH A;  3LA7 A;  3ZMV A;  2AO9 A;  1OKK D;  5E3N A;  1JKP C;  4F4B A;  3N05 A;  3ECH A;  2VC9 A;  2HZD A;  4HQM A;  3GTQ J;  3TOL A;  3B9Q A;  4BQQ A;  1G5Z A;  2ZXW C;  1WJE A;  3HPG A;  3GTJ J;  2AQF A;  4O7G A;  4A6D A;  3BG5 A;  3U1D A;  3TK0 A;  1CGP A;  4IPA A;  2VIX A;  3EG9 A;  3CQZ J;  2PX3 A;  2JX0 A;  2F4M B;  3FZV A;  4EKW A;  5A6A A;  4ESB A;  4J00 A;  3BG9 A;  4RDU A;  4M6Y A;  4E7Z A;  5GAG J;  1ZHW A;  2BOL A;  1YQA A;  2KIF A;  4RB2 C;  4WXH A;  1M6T A;  2HEO A;  4IWB A;  3HPH A;  3AJM A;  2CRG A;  1WH5 A;  3CJN A;  3BQY A;  4C3H J;  3LFU A;  1BC7 C;  1WN0 A;  4HFF B;  3Q3S A;  4ABZ A;  2CUJ A;  2EIK H;  3WTU C;  5IP9 J;  1X1P A;  1R22 A;  3G2B A;  3GEZ A;  3KP6 A;  5B66 C;  4D1Q A;  2B63 J;  2QWW A;  3Q6M A;  4MTO A;  4PFP A;  4JTC B;  5A6B D;  2RNJ A;  2FJ1 A;  2RV8 A;  3CCU I;  3G4Z A;  4HQE A;  3HOV J;  1PDN C;  3CLO A;  1E84 A;  2XAQ A;  2LF8 A;  2ME6 A;  2FX0 A;  3C18 A;  4MND A;  3OA1 A;  3EFO A;  2DLL A;  2CDQ A;  2NXN B;  2XF7 A;  2ZJ2 A;  4XQF A;  4NTA A;  1EKE A;  4F92 B;  1MMA A;  1A7E A;  3W8I A;  3HJC A;  1HQC A;  1UHS A;  2LDU A;  5DM7 F;  3J80 Z;  5K5O A;  3SJM A;  4C3B A;  1R00 A;  3KLN A;  4XRS G;  2VE9 A;  4QWQ A;  2D5R B;  4DVY P;  2XF5 A;  1B8I B;  5J1U A;  3MMY B;  1S72 I;  2FXA A;  2HOT A;  4U5B E;  3X2Q H;  4LLE A;  4HRI A;  5JRA A;  2P61 A;  3F0C A;  3WG9 A;  3GTL J;  2G0E A;  2X6X A;  3BOQ A;  2CV1 A;  1EKY A;  2Y39 A;  2L9N A;  5IP7 J;  4GEH A;  2H7V C;  5L3Q A;  1X58 A;  2HPI A;  5L0G A;  3L2C A;  1VOM A;  2DA3 A;  3I9V 2;  1TW3 A;  3H5R A;  2EFQ A;  2DDA A;  3GOD A;  2GZW A;  2WZF A;  3V5Z A;  3W2A A;  2JZY A;  2EIM C;  2KL4 A;  2R7O A;  3NRH A;  1A35 A;  5DS4 A;  1DU6 A;  5K0I A;  4CDA A;  2IT0 A;  1ETQ A;  4IX7 A;  2EZI A;  3O8G A;  1PUF A;  2DOA A;  4BEH B;  3MWM A;  5FGM A;  2EBI A;  2YUS A;  3J06 A;  2ZBK A;  2ZSI B;  3FM5 A;  1S7O A;  4I0B A;  3L2W A;  1K4S A;  3O3K A;  1GXQ A;  5COG A;  2NS0 A;  3BJO A;  2KYH A;  5D4R A;  3HLZ A;  1RKW A;  4PJM A;  1YJW I;  1NFN A;  2IGM A;  2JPU A;  2W00 A;  1R4M B;  2O0Y A;  5E3C A;  5IY5 C;  5E18 F;  1ZHT A;  5L3D A;  3BDD A;  2NRA C;  2L4M A;  1HXD A;  3EPV A;  3S9O A;  2JA2 A;  4M3E A;  2JUC A;  3RYR A;  4M3F A;  2L2O A;  3EH1 A;  1Z63 A;  1T56 A;  4E7H A;  5A6J A;  1VTN C;  4M74 A;  4A93 J;  3V42 A;  2VLA A;  2CG4 A;  4Y52 J;  1P4X A;  2ZME C;  4JBA A;  4MVU A;  5BQG A;  3CC2 I;  2CFX A;  5KAF C;  4AE4 A;  4BEH A;  1EF4 A;  2J9U A;  1P7I A;  3ASO C;  2H7B A;  2X6O A;  3EUA A;  2F5F A;  2HNH A;  1P4W A;  3DBL B;  2JSP A;  2L0K A;  4BXX J;  1T6I A;  3G4X A;  4H54 A;  5COF A;  2LD5 A;  4CBE A;  3FK7 A;  5F27 A;  3K4L A;  2DA6 A;  2QNL A;  4DGW B;  3A0B C;  1R6R A;  4XKW A;  4D7N A;  1KZH A;  3HKZ A;  5HVQ C;  3L0I A;  3HJE A;  2VPL A;  2BHY A;  5B1B H;  1BBH A;  4B1R A;  3A0H C;  4ZC3 A;  2BEO A;  1XPX A;  2O3F A;  3GZN B;  1A31 A;  1Q0F A;  3MKY B;  3WU1 B;  1VQ4 I;  2ZFW A;  1CPR A;  2P7V B;  3PQK A;  1QVX A;  1DPU A;  3OOP A;  4KI2 A;  3A01 B;  2BW3 B;  2KDO A;  3NYM A;  2ZXW H;  4I99 C;  2ASR A;  4JEB A;  1N1C A;  1LDD A;  4CS9 C;  3KH2 A;  2EZH A;  2IAI A;  5KYU B;  2BGC A;  1XS9 A;  2JA7 J;  5CVU A;  3J7Z I;  2QEN A;  1TKN A;  2ZXP A;  2B0L A;  4CSA C;  2R7W A;  1V5G A;  3T6B A;  2TRT A;  3X2Q C;  2D5V A;  2R03 A;  5DS9 A;  3WTZ A;  5GTI C;  1X19 A;  3A2K A;  3PO3 J;  3DE9 A;  3K4K A;  2L9S A;  3ONQ A;  3ZXS A;  2XL6 A;  1LKX A;  2QLZ A;  1XX5 A;  2XRL A;  3DLA A;  1JJ6 C;  3W6K B;  4O3M A;  2Z15 A;  3VOE A;  1HE1 A;  3DKA A;  4M63 A;  2EIN C;  4L9N A;  4M71 A;  5GPC A;  3MKZ A;  1GV5 A;  3IAM 2;  2L6F A;  1QA6 A;  3IUO A;  2F5D A;  2OU6 A;  1YJ9 I;  4C7O A;  1U9N A;  4IOA F;  1REP C;  3ZQH A;  1HF0 A;  2COM A;  4LIT A;  1V4A A;  1XB4 A;  4YT2 A;  3Q7L A;  1MJA A;  4RB3 C;  3SZT A;  1IN5 A;  1W4M A;  1IN4 A;  3KZY A;  2E1N A;  2JN6 A;  3G1O A;  2IS2 A;  2ICW G;  1LPE A;  1BL0 A;  3OYH A;  2HTJ A;  1KU3 A;  2VC0 A;  1ZR2 A;  4XLF A;  4BHC A;  2JA8 J;  2M3A A;  3OIQ A;  1OXB A;  3IP4 B;  3NKE A;  1SF8 A;  5DCF A;  3KEQ A;  4W97 A;  2L7K A;  2KP6 A;  5AC4 A;  3QWL A;  4ENK A;  2DPD A;  4JC7 A;  1ZEL A;  2UZK A;  1QRY A;  3HKK A;  3V5X A;  1PUE E;  4HX7 A;  4IJJ A;  4U9E A;  1T0F A;  5JVT A;  3F9K A;  1OCR C;  4Y4R A;  1WJ5 A;  1K79 A;  3IEE A;  1H7I A;  5EGY A;  2IW5 A;  3GTK J;  4U5H A;  3UMI A;  2FNA A;  4XOP A;  5L3V A;  3Q9V A;  5D5U B;  3HNK A;  2YZS A;  2NUT A;  2QVO A;  1FFH A;  2NPU A;  3OYC A;  3QYE A;  3CUO A;  4B47 A;  2DTR A;  3DCF A;  1HW5 A;  2DXI A;  1V54 C;  3T0Y A;  1YRN B;  3PFY A;  1ZGJ A;  3HXL A;  3GWZ A;  3KP4 A;  1ON2 A;  1FC3 A;  4XSZ F;  1IRZ A;  3WU2 C;  4XR6 A;  1OCO H;  3G1M A;  6PAX A;  1VQN I;  3C8Z A;  5IOZ A;  2F5E A;  1HST A;  4MEY F;  1EA3 A;  1TC3 C;  1Z77 A;  2XKP A;  2DA5 A;  2EWN A;  4JOM A;  2P5K A;  4Y17 A;  1X2N A;  2VJJ A;  1SR2 A;  3V7S A;  2EK5 A;  2OKU A;  1FOW A;  4MW3 A;  2CJJ A;  4CCM A;  2I10 A;  1UG2 A;  3DU6 A;  2CYD A;  2RD9 A;  2DB4 A;  4WGZ A;  3KE2 A;  2D1V A;  3CCS I;  4U7B A;  2F5V A;  3KZI C;  3AG1 H;  4IVN A;  1EH6 A;  3TW7 A;  2DFH A;  1UCR A;  2R7T A;  1V55 C;  3S27 A;  4B44 A;  1RNL A;  5F0H A;  3FM3 A;  2MWQ A;  3S0X A;  3UMK A;  3OV8 A;  5K7Z A;  1Y6D A;  3BP8 A;  3WTW C;  2WZG A;  2ETS A;  1XWJ A;  2QGU A;  1YS7 A;  5F5F A;  2L6G A;  3U9M A;  2LFD A;  2HQ5 A;  4OIN F;  2JQ7 A;  3RJP A;  3HOW J;  2PF4 E;  3UMH A;  2F4O B;  1R36 A;  4XIC A;  1B72 A;  2P0N A;  2MW8 A;  1LB2 A;  1CF7 A;  3EDP A;  1RXQ A;  4WXC A;  2PMZ N;  3RTR A;  3LAY A;  2CMP A;  1A6Q A;  2V79 A;  4AVZ A;  2VN2 A;  2EIJ C;  3V7C A;  2XPV A;  3TP0 A;  2X48 A;  1WZ2 A;  2TCT A;  3VM6 A;  2K3F A;  1I39 A;  1Y56 A;  2HOE A;  2P6T A;  1IN7 A;  2XLW A;  2GOX B;  4OIQ F;  1W7P B;  1KQ9 A;  1JT6 A;  5J6X A;  4FWV A;  5E1X A;  1FP2 A;  5DCM B;  1YYJ A;  2DMQ A;  3DZA A;  3S90 A;  1IV8 A;  2K9M A;  2LKS A;  4K7B A;  5L0D A;  4CYC A;  1Z7Q c;  5CQG A;  4AC0 A;  4YFX F;  3HSE A;  1O3S A;  4UV9 A;  3IQT A;  4Z9H A;  1MNE A;  4UVC A;  2E35 A;  1DP7 P;  4EBK A;  3AGU A;  1N78 A;  3MVP A;  3ABM H;  3BG6 A;  1LFU P;  4F91 B;  3KYL A;  1WPK A;  3ML6 A;  2FBK A;  1GM5 A;  2O9X A;  3SXK A;  4B4C A;  1O4X A;  5C44 J;  2UUI A;  2A0B A;  4EWC A;  2XRN A;  2H8W A;  5GP9 A;  2NG1 A;  1Z67 A;  3LQR A;  2M34 A;  4I02 A;  1SFU A;  3RF3 A;  1N25 A;  2VKE A;  4E7K A;  4BHP A;  2V1N A;  2Z33 A;  3AQC A;  1RUO A;  1RRJ A;  2GQQ A;  1OCC C;  2DI3 A;  3FHD A;  3LS1 A;  1MSF C;  4JCZ A;  4IXA A;  2W4B A;  5EK0 A;  1W5C C;  3H9G A;  2W24 A;  2R7F A;  1ZHF A;  2DK8 A;  3OL3 A;  1V3F A;  2L7M P;  2V1U A;  2VB6 A;  3Q0V A;  2KZV A;  4NC6 A;  2Y9Z A;  1POG A;  1R58 A;  2YL3 A;  1OCZ H;  2XGX A;  3R6S A;  3CO7 C;  1F5T A;  4L18 B;  4X0R A;  3OYG A;  1W5S A;  2DGJ A;  4EAT A;  4FTH A;  1PP8 F;  2Y3D A;  5EEA A;  4V19 K;  3M3Y J;  4O5V A;  2GXA A;  4P96 A;  2BXY A;  3P7N A;  2GIV A;  3F22 A;  2DOE A;  3QQA A;  2VOO A;  2KPM A;  1FOX A;  1FFT C;  3LAJ A;  3R7C A;  2WAQ A;  3WHC A;  2FBI A;  1BI0 A;  3R60 A;  4XLA A;  5EF6 A;  2FGY A;  3NEU A;  3PQJ A;  2G9W A;  4NHJ A;  4AYB A;  3RFY A;  2NVX J;  3L2V A;  3GAN A;  5JHF A;  3DJN B;  2ZME A;  4PJL A;  3OYI A;  5D5W B;  4G78 A;  3HOS A;  3ROU A;  2PMH A;  5C4J J;  4V2F A;  1VI0 A;  5EZG A;  3R0A A;  4BS9 A;  2BC5 A;  1MMG A;  2V9P A;  3CJQ B;  3PNY A;  5LGN A;  1TWC A;  1TFO B;  2LYC A;  2QZ8 A;  1VQK I;  1G4D A;  3F46 A;  1T08 B;  5TGT A;  5LHH A;  3CQZ A;  1A6I A;  5H2F C;  4X6A J;  1BDJ B;  2FD5 A;  2W4S A;  3GBG A;  3LEV A;  3H5N A;  2P1A A;  4Q7C A;  4ZYA A;  4CIP A;  1C02 A;  1NTC A;  1SMY F;  1FIP A;  3S3N A;  2EQR A;  1XSD A;  2IP2 A;  2WZL A;  3MBG A;  2FNP A;  4XQ1 A;  1NK3 P;  1ZLK A;  5D8L B;  1J7K A;  2QQB A;  4XK4 A;  5FD5 A;  3LNQ A;  4B48 A;  2OJE D;  1TLH B;  1TP4 A;  2JVG A;  3BG3 A;  1BOA A;  4G12 A;  2EPK X;  1XGN A;  1VQM I;  3HIF A;  3X1O A;  4EHP A;  4NY3 A;  3DBH B;  3E9V A;  4MTG A;  2FBH A;  2Y69 C;  2XRH A;  5JHU A;  2DA1 A;  2A07 F;  3COA C;  3PHF 2;  1WJB A;  5FFX A;  2A6T A;  4A3K J;  1L3L A;  1IDZ A;  4PAC A;  1O3U A;  2MH2 A;  4XKC A;  4JW1 A;  1XCV A;  3KPH A;  2CQN A;  1WTY A;  3GZ5 A;  5FB2 A;  1DOV A;  5GTH C;  4FX4 A;  5JVE A;  3CLQ A;  1R5G A;  2JPC A;  3Q0U A;  3ZQQ A;  2BY3 A;  4AU7 A;  3EJN A;  3IH2 A;  3P9I A;  4KN4 X;  1KQ8 A;  4XNF A;  2P5V A;  3FXJ A;  5LD2 C;  5D91 A;  2M8E A;  2H7O A;  3LSH A;  1OCO C;  3M79 A;  4AWX B;  2PLY A;  3OSG A;  1WI9 A;  1XDS A;  2PG4 A;  3F6O A;  4MVZ A;  1USS A;  1BM9 A;  4D5F A;  1SYQ A;  2PJR B;  3V7R A;  2FAP B;  4DYR A;  2E34 A;  2Z2S B;  3L7W A;  5DD8 A;  2Q8K A;  3CDI A;  2VCC A;  2ADU A;  1ODD A;  4G0H A;  2EA4 A;  2G62 A;  2DJN A;  2LVS A;  4PUS A;  4XOT A;  2ZKZ A;  1GXP A;  2BHZ A;  3JRA A;  3S28 A;  2JJ7 A;  2FMY A;  4BNC A;  2FRH A;  2JUG A;  2X6W A;  4ZYD A;  4ZTJ A;  5FO5 A;  1QZX A;  1RZ4 A;  1RI7 A;  1PV3 A;  2JD3 A;  2VJ5 A;  3BCB A;  2JA5 J;  1YA7 O;  4M6X A;  2IS4 A;  3S16 J;  2NUT B;  1JT0 A;  3K2A A;  3WOD F;  2HV6 A;  3I58 A;  3S1N J;  1XMA A;  2P7C B;  3FXK A;  3Q6N A;  1ORK A;  3IQ6 A;  4YT5 A;  4IRI A;  3NYL A;  2YLI A;  3GTM J;  1UHM A;  1GUU A;  1V5F A;  1SD6 A;  5FLM J;  1XDU A;  3UNG C;  1R71 A;  1X3U A;  3VFZ A;  5JSL A;  1IXR C;  1Q1V A;  2P81 A;  3TED A;  2FQ3 A;  2M7A A;  2M87 A;  1YJN I;  1MBG A;  1Z5Z A;  3FOP A;  3SDB A;  3R0J A;  4HSR A;  5CYV A;  2XF6 A;  2V7F A;  4EJT A;  1ORY A;  3DEW A;  2E1M B;  5J8C A;  1VQL I;  2COB A;  3AL0 C;  5IOY A;  3FAJ A;  3GTP J;  3K33 A;  3M1C B;  2Z1D A;  5CKT A;  4A6E A;  3IAS 2;  4HX8 A;  1IZ1 A;  5HLH A;  3HM5 A;  5GAD J;  3OYN A;  2UWM A;  1J8Y F;  2CCY A;  1BR4 A;  1WOL A;  3L00 A;  2Q9B A;  3ZDL A;  4XLN F;  3MD2 A;  2OCC C;  2QUP A;  3VYT B;  2VH3 A;  5M3M J;  5J4V A;  1GS9 A;  2XS1 A;  1J09 A;  3L1P A;  4U9D A;  3JTH A;  2ESN A;  2WBM A;  2C6Y A;  1S29 A;  1G4U S;  5A6K A;  2P4W A;  2HQR A;  2ISY A;  3HHH A;  2QEX I;  3GEH A;  2QSG X;  2IBD A;  5CLS A;  3W2V A;  3EGX A;  2WB1 N;  5JLI A;  4BL0 B;  2QQA A;  4P9T A;  2OOC A;  3BTL A;  2AS5 F;  4CDV A;  1EA8 A;  2HXO A;  1BI1 A;  1WJC A;  1Z7U A;  2OC6 A;  4A12 A;  4BY7 J;  1VQO I;  5T3W A;  2MC4 A;  2X85 A;  4IHS A;  4IQ4 A;  2XLO A;  4LIU A;  2XVC A;  2DW4 A;  2VBW A;  3RKX A;  3CF5 F;  2WY7 Q;  3LSK A;  4A3E J;  2VQG A;  4OIP F;  5FRM A;  1IRX A;  1E2X A;  3DKW A;  1ZHZ A;  3RW0 A;  4YEJ A;  2F4I A;  1YE9 A;  3A11 A;  1CGN A;  1MQV A;  3ZTZ A;  2ELH A;  4M9Z A;  4LAC B;  1B59 A;  2MSY A;  3VYR B;  1HDP A;  3B71 A;  3KP3 A;  2NUP A;  1R49 A;  2K9Q A;  4M73 A;  1OCZ C;  3JR9 A;  3U8P A;  1OCR H;  3MYF A;  1JXS A;  3LSJ A;  2XAF A;  1T9K A;  3HGY A;  4HDU A;  4LLL A;  2C04 A;  2V9K A;  5K1Y A;  4BQN A;  3SEQ A;  4N6H A;  4KYW A;  2B0J A;  4MQ9 F;  4CA0 A;  4L9T A;  3JRG A;  3S29 A;  2CUZ A;  3KFW X;  3B29 A;  4ESF A;  3RKQ A;  3K1I C;  4E0I A;  3OR1 C;  3L2R A;  4ZDO A;  4G7Z F;  3T8R A;  2DT7 B;  3MZH A;  3ZWI A;  2Q9A A;  4RB1 A;  1HKT A;  5KYW A;  3GYH X;  1XTA A;  2A61 A;  1CPQ A;  2J46 A;  4QLC U;  4N0B A;  2EJR A;  2R0Q C;  2YKZ A;  2QLA A;  2HFH A;  3BPV A;  1TNT A;  3REO A;  4Y13 A;  3JRB A;  4B09 A;  2XHK A;  1YTY A;  1HY5 A;  3CP2 A;  1NG7 A;  3DEU A;  1NLX A;  2NVY J;  4RGX A;  5CQE A;  1J75 A;  3EUK L;  3QPH A;  1XD7 A;  3CCE I;  2L5Q A;  2DK5 A;  4MGR A;  4JUR I;  4LDR A;  4N4W A;  2ZC2 A;  3WHN A;  2Q9C A;  5L3C A;  2VE8 A;  5B3S C;  4U7D A;  2J45 A;  3BC8 A;  5H20 A;  3RQF A;  3M1C A;  3J81 K;  3T9O A;  3EPZ A;  4MVQ A;  4A2U A;  1AWC A;  2YX4 A;  1CGM E;  4P55 A;  4ZTF A;  4RA2 A;  5FJ8 J;  4Q5S F;  3TDU C;  1BZ4 A;  1Q0D A;  2BW3 A;  1P92 A;  2X0L A;  4ZDL A;  2JWT A;  4WGY A;  5IT9 K;  5JT4 A;  5E1Z B;  4CCN A;  3H36 A;  5DD4 A;  1BR1 A;  1FWZ A;  4PGG A;  2R05 A;  1B9N A;  1BA5 A;  1M2V B;  3RSN A;  1SC7 A;  3GF2 A;  1A5J A;  3M07 A;  1NZE A;  2XDV A;  4DYC A;  3D5R C;  3OYJ A;  4AX2 A;  2BV6 A;  2ZXH A;  5ICE A;  1VQ9 I;  1E86 A;  1PD1 A;  1K78 A;  1W36 D;  1SAX A;  1T95 A;  1YW8 A;  2NS7 A;  1W7P D;  1F4K A;  2KQR A;  4MEX F;  3JRT A;  3TO9 A;  5B1A H;  2ZD9 A;  4IB4 A;  4HF0 A;  1QVU A;  3OIO A;  4C7O B;  3HL2 A;  1GV2 A;  3FXQ A;  3FBI B;  4C3D A;  2VCA A;  2ZFU A;  1EJ9 A;  4A5M A;  3ZMU A;  3CES A;  2DYR H;  4L5J A;  2YR2 A;  4NTB A;  4GYT A;  1ZGA A;  2DOF A;  4A0Y A;  2OEX A;  3QZC A;  3RIP A;  4MTD A;  1YAR O;  2R93 J;  2DO7 A;  5A6B A;  3A03 A;  2M0M A;  2X1D A;  3I59 B;  3MEX A;  2AWY A;  2PBI A;  2YSR A;  4HPQ A;  2NSF A;  2RN7 A;  3OL4 A;  4LDQ A;  3E5U A;  1M56 C;  2KJC A;  2PX0 A;  2NVQ J;  2DQR A;  3MQ0 A;  1ZU5 A;  3TKY A;  4BJ5 A;  3NWS A;  2LNB A;  2D4U A;  5LGT A;  1FOY A;  3M8E A;  1HCR A;  3CCL I;  4I98 B;  4ENJ A;  4ONS A;  4BDY A;  2KMU A;  2Q2E B;  5HOO A;  4LB6 B;  2IRF G;  2GIZ A;  1RC9 A;  1OKR A;  1ITY A;  1HW2 A;  4C2T A;  1ZW3 A;  3OYE A;  4CX9 A;  3L1M A;  3FBN B;  4RM3 A;  4I0A A;  4WCG A;  4IHY A;  3RVY A;  4KIG A;  3P5J A;  3E1S A;  1MND A;  1S7E A;  4E4H A;  2QBY B;  3DP7 A;  1TWG A;  3VAY A;  4EJO A;  5FKL A;  1WWX A;  5HS7 A;  2V3C C;  3E6B A;  1OYI A;  2ELJ A;  4KIB A;  1U89 A;  4I09 A;  3TUL A;  2PFB A;  2OZU A;  3K1P A;  4QI2 A;  3S1M J;  1S9H A;  2OF7 A;  3NMJ A;  2KRF A;  4JQF A;  3IPM O;  1B4A A;  3VF0 A;  3AG2 H;  4BEM J;  4W1U A;  3C2H A;  4GQH A;  3FMQ A;  2ZJP F;  3I5Q A;  2DYS C;  2ECB A;  2LKX A;  1R23 A;  3WAQ A;  4IEJ A;  4Q4Z F;  4CUG A;  1HA8 A;  5E20 A;  3E6C C;  1APL C;  3SEO A;  1UMQ A;  4PR9 A;  1SVM A;  5HLT A;  1OR7 C;  2YL0 A;  3CTA A;  3U2R A;  4E17 A;  1IO2 A;  1N75 A;  3RQ4 A;  5GPG B;  2FOW A;  2ID6 A;  2NYX A;  1T6Q A;  4GYI A;  1UST A;  1OCT C;  1OR3 A;  2P7V A;  2E71 A;  2VKV A;  2ZJQ F;  4RGR A;  1MMD A;  4ER9 A;  3WU0 A;  1ZTR A;  3G6E I;  1D0X A;  2CW8 A;  3DAF A;  4HEA J;  4X1E A;  1OCP A;  1YG2 A;  1B6A A;  4F55 A;  3RQE A;  2R5Y B;  1S3J A;  1TWG J;  3WTY C;  3HB9 A;  5IPA A;  2HQA A;  2M9H A;  2R9R B;  2K3P A;  2XAH A;  2QKM B;  1YFH A;  1FP1 D;  2P0W A;  1LIH A;  4XEF A;  2R5Z A;  3POV A;  1JJ8 C;  4G8X A;  4PJN A;  2IJL A;  5L0I A;  2MFZ A;  3J80 K;  1KGS A;  1IAW A;  1Z3I X;  2XLM A;  3JYY A;  1DU0 A;  3K7D A;  2ISZ A;  2WAE A;  1G3Y A;  1J8M F;  2YL7 A;  4HFK B;  3F8F A;  1ZYR F;  2CYY A;  5LGU A;  2PNO A;  1X1A A;  2FUG 2;  4ZYG A;  4C2U A;  3I55 I;  2W25 A;  3PIO F;  3BR1 A;  5IT9 Z;  3WHB A;  1FMV A;  3H9Q A;  5DEQ A;  3DLL F;  1GHC A;  4A3D J;  3RKY A;  5JI6 A;  4BY1 J;  2PFD A;  1Y8R B;  4YT4 A;  1PYV A;  3U9G A;  1D1C A;  1YZA A;  4RBN A;  2G7H A;  5ILS A;  3M7G A;  3TO7 A;  3ZR8 X;  4HBL A;  4HF1 A;  1E85 A;  5GAH J;  3I71 A;  4H0E A;  4EQQ A;  4YFK F;  3BR0 A;  3C3W A;  1C03 A;  1X1C A;  2LQG A;  3LWF A;  4JE9 A;  4HDV A;  1LE2 A;  3FIS A;  1E0E A;  3RZO J;  4GO1 A;  3F3X A;  3BTJ A;  3EFO B;  2UV1 A;  4FE4 A;  4IL6 C;  3FDQ A;  3LES A;  2AHQ A;  1B68 A;  4I76 A;  3OR2 C;  2I8D A;  2D45 A;  3F8C A;  3ULQ B;  3OIP A;  3OWT A;  2L9J A;  1JGG A;  2DN0 A;  5LEJ A;  5HNH A;  3LNM B;  3BZ6 A;  5CI8 A;  5FLX K;  2MA3 A;  2HGC A;  4AM3 A;  1DUX C;  2DMP A;  1R5I D;  2IGN A;  3VOD A;  1A36 A;  3BTC A;  4JP0 A;  1BR2 A;  5DUK A;  1YIJ I;  4EUK B;  3GM1 A;  4I1O B;  4ITV A;  2KJB A;  4DNC A;  2EB7 A;  5E3M A;  3W4Y A;  2Y30 A;  3N97 A;  5CPR B;  2AU5 A;  4U88 A;  4A4A A;  4CZZ A;  2K9L A;  2HSQ A;  3JRI A;  5KVR A;  4QPQ A;  4BBR J;  1IF1 A;  4LGW A;  1H8A C;  1OXK A;  3GFM A;  3O2P E;  3BTI A;  1QPU A;  5GPA A;  1GDT A;  4AYB N;  4KIT B;  1EQ1 A;  3V8K A;  1I27 A;  2F48 A;  2V6C A;  3JRC A;  3TOM A;  1VQ8 I;  2ZNY A;  4XWJ A;  1YYV A;  3DTE A;  3WGI A;  2EV5 A;  4YRV A;  1ZN2 A;  1ZZP A;  3M15 A;  1XMX A;  4U87 A;  1OYW A;  3HTS B;  4NDL A;  4RAF A;  2Y3H A;  4IRG A;  1YI2 I;  1UB9 A;  4DRJ B;  2H1L A;  1U0B B;  5KAI C;  4UUS B;  2QTV A;  4TV7 A;  4UB8 C;  3KZZ A;  3ABM C;  3KP2 A;  4FAS D;  2WV1 A;  5HOD A;  2GXG A;  4E7I A;  1F43 A;  1RJ9 B;  4L0Y B;  3IQ5 A;  4DIQ A;  3DPU A;  1X4O A;  3HTK C;  3E97 A;  3K1I A;  2DAO A;  3NAU A;  2MD5 A;  5IYC J;  4F52 A;  3R4K A;  4O6N A;  3TGN A;  1LVA A;  3KX2 A;  2BVL A;  1FY7 A;  1JTX A;  4QDL A;  1FNN A;  3IL2 A;  3EZH A;  2XSJ C;  1ZLJ A;  1FTZ A;  3GTO J;  2OQR A;  4IHT A;  3ZCO A;  3NAR A;  5F1R A;  3OYA A;  1KTM A;  3S3M A;  2E87 A;  4RLF A;  4LG0 A;  5ED4 A;  5KYU A;  4GYG A;  2XAS A;  4DQ2 A;  3M4C A;  2VPR A;  2EPF A;  2JMW A;  3CJT B;  3SNH A;  1SEU A;  1WVR A;  4DOZ A;  3ELK A;  2NNN A;  3I53 A;  4HNV A;  3DI5 A;  4E7S A;  2C03 A;  3AAF A;  5LHI A;  3UR3 C;  2H1K A;  1MMS A;  4P5O A;  5J40 A;  5HV9 A;  3CUQ B;  1ZG1 A;  1T6U A;  4JCH A;  2QSF X;  2RAE A;  3K4C A;  2VBX A;  3QP6 A;  3ZOB A;  2X51 A;  3FXH A;  5K5R A;  2E2H J;  2J7P D;  1U8B A;  3TJ5 A;  5A69 A;  2CQQ A;  2VXZ A;  2Y75 A;  4BHB A;  3FDY A;  3J81 Z;  1ZGW A;  3UGO A;  1MBE A;  2KW3 C;  2OEV A;  1PJR A;  5FLV A;  1LI7 A;  5L0C A;  1EV7 A;  4NTF A;  3CAX A;  1G2H A;  1JPJ A;  3WTT C;  4D0P A;  1Z3Y A;  3B6A A;  4MTE A;  4I44 A;  4XM3 A;  2W45 A;  1HC8 A;  4DXW A;  3IC7 A;  3RQI A;  1V5E A;  1B72 B;  3LA2 A;  5FFZ A;  1MBJ A;  4YJW A;  2ZXR A;  3WTX C;  4MW8 A;  2CW0 F;  2Y9Y A;  4BQA A;  4HAM A;  3A9C A;  1JPN A;  4Z9J A;  1DP3 A;  1VYI A;  2LY2 A;  4MVM A;  3PM1 A;  1PP7 U;  1O5H A;  2M64 A;  1LJ9 A;  4Y7N J;  4JJF A;  2FE3 A;  1E3H A;  1Y1W J;  1TWH A;  1ETY A;  4KMF A;  2EPL X;  2KRC A;  2Q0O A;  2DBB A;  1A0B A;  3HNL A;  3NMK A;  2VJ4 A;  1O3Q A;  1AUE A;  2P6S A;  2F5C A;  4OD4 A;  5KYN A;  3K1N A;  1OW8 A;  3GUD A;  3SEZ A;  1SD4 A;  1WKM A;  1R1V A;  3LEO A;  4O6Y A;  5EEG A;  3OMY A;  2R7R A;  1JMW A;  4BJ5 C;  3TD7 A;  2CUF A;  4WF2 A;  5EEH A;  2CW7 A;  1MMN A;  3GTG J;  4JEA A;  3T6G B;  3GWL A;  4XID A;  4EV0 A;  3GX4 X;  4PK4 A;  1G59 A;  3QP5 A;  4HV5 A;  5EZH A;  1Z23 A;  2OCE A;  3IH4 A;  4MO7 A;  2E7X A;  1R9T J;  1MZB A;  1QO0 D;  3KEO A;  3EHN A;  1YZC A;  4NQW B;  1O3R A;  1FX7 A;  2XXA B;  2CUE A;  2R7V A;  4U0W A;  1TQG A;  4CS9 A;  3ABU A;  2QKL B;  3DFG A;  4LFU A;  4E6K G;  2M2E A;  3BR2 A;  1K6O A;  1YW9 A;  2Z9O A;  2LF7 A;  3S1Q J;  3GFI A;  1LE8 B;  4E7J A;  4CHU A;  4BU2 A;  2VI6 A;  1WJD A;  2OD5 A;  1G6N A;  2HYG D;  2UXN A;  3D5S C;  4EM2 A;  4QIW N;  5L3B A;  2LFB A;  3F23 A;  1SD7 A;  1UAA A;  2XAJ A;  4DW6 A;  2IGO A;  4Y15 A;  1JUM A;  1HBX G;  2YRF A;  4I1M A;  2DU9 A;  4YIR X;  2EFN A;  2RKH A;  4HA8 A;  4DYQ A;  1E17 A;  2P5L C;  3IWZ A;  4OMZ A;  1SVO A;  1ZVZ A;  1SFK A;  3ZP5 A;  1TT5 B;  1UZC A;  4KNW A;  2M1B A;  3E0J B;  3QPT A;  3C8G B;  3PUF A;  1I6X A;  5FKO A;  2J9B A;  2KKO A;  4I01 A;  3ECO A;  1K61 A;  3H5A A;  4BH9 A;  3HRS A;  3VYU B;  4R79 A;  2L6H A;  5AGF A;  1BI3 A;  3HOY J;  2RNG A;  5J4Y A;  2G7U A;  1K04 A;  2UUH A;  3FIW A;  1XSX A;  1K40 A;  3IKT A;  2LY1 A;  3IH3 A;  4AID A;  2OTL I;  2K40 A;  2QA4 I;  2R7Q A;  1FEX A;  3DM5 A;  4RM2 A;  5IP6 A;  4U5D E;  4HW0 A;  4PCQ A;  1WH7 A;  1XGS A;  4M72 A;  2PP4 A;  5KYY A;  1Z1D A;  4A3L J;  5BPD A;  1JKO C;  3HHG A;  3Q0W A;  4JTA B;  3HOX J;  4MQV A;  4DJA A;  1UG0 A;  1BIA A;  2JRT A;  1TTY A;  2IXN A;  3U3B A;  5KYW B;  1WJF A;  1QPM A;  4A3M J;  1T01 A;  2HI3 A;  4XLH A;  2LP4 A;  3DD7 A;  3G1L A;  3B02 A;  2ELK A;  4IO9 F;  3WTV C;  1VQ7 I;  3VSK A;  5J8F A;  1RPW A;  2XM0 A;  1KYZ A;  2P8T A;  3FKI J;  3I54 A;  3EYY A;  3NMI A;  4PDK A;  3OS2 A;  2L02 A;  1K7A A;  2Y2Z A;  5HNF A;  3QOE A;  2YQY A;  4N9I A;  2YWA A;  3JT1 A;  4AL1 A;  2OJQ A;  2LRE A;  3AG4 H;  3SZG A;  4CCO A;  1LVK A;  1TWA A;  2XSE A;  5T1D B;  2ZNZ A;  4NQW A;  1QLE C;  3SZR A;  3BY6 A;  2IXO A;  2ZJR F;  3CDH A;  2XXA A;  1FOK A;  2Q7R A;  4HX4 A;  1EH8 A;  4LLC A;  3T8T A;  1VLT A;  4GCV A;  4IZZ A;  1NU7 D;  2Z16 A;  2EPN A;  5D5X B;  2GA0 A;  2Q4F A;  3ZC4 A;  5JS5 A;  2ZXI A;  4AD9 A;  4RGS A;  3SP1 A;  3CJR B;  3RQG A;  3VEP A;  1AKH B;  1OW7 A;  3CF2 A;  1FMW A;  2LRD A;  5J47 A;  4F7Z A;  3ZQV A;  4RBO A;  1QSP A;  4BJ1 A;  2H6C A;  2L7F P;  2NS8 A;  5LRS A;  5AC5 A;  1ZRF A;  2XM4 A;  3QMK A;  2ZO4 A;  1H0M A;  1IRG A;  2WA0 A;  1YIO A;  4IJA A;  4RMN A;  4F93 B;  1P7J A;  2NOG A;  4IRH A;  2M4G A;  5L3F A;  1JUP A;  1ZG5 A;  4C9Y A;  4EBB A;  5CVR A;  2VQH A;  2R7Z J;  1F9N A;  1EH7 A;  1XC5 A;  1IV6 A;  3V5Y A;  2HXI A;  2OCC H;  3L09 A;  3VYW A;  1JKQ C;  3ZQL A;  1ZW2 A;  2BXZ A;  1B9M A;  1LNW A;  4RAG A;  2QM3 A;  1DQU A;  1K6Y A;  2EIM H;  3IRR A;  2BY2 A;  5BOX A;  5CIV A;  1K83 J;  2LFF A;  1BW5 A;  1WGX A;  4ZJZ A;  1U5T B;  2WTE A;  3DKY A;  4GDF A;  3ZQG A;  3FXU A;  2EH3 A;  3DWL E;  1OMI A;  1JGS A;  3VPR A;  1X1B A;  1P6R A;  1OIS A;  2XB0 X;  3WE2 A;  3ZQC A;  3SYT A;  3I59 A;  1YHQ I;  2J8W A;  3Q7G A;  4NC3 A;  1ZH5 A;  3G4S I;  4W8P A;  1Z05 A;  4JX5 A;  3SXY A;  3J7A Y;  3QTH A;  3FOO A;  3T1B A;  4MVS A;  4LD5 A;  5IYB J;  2ETH A;  4M9X A;  2CQ7 A;  3P9K A;  2OAZ A;  1MH4 A;  1SAU A;  1B1B A;  1Y1V J;  2W57 A;  2B9S A;  5BNG A;  3BZC A;  3O10 A;  4LER A;  1MKM A;  3LSM A;  1X2M A;  2NSG A;  2M8G X;  3CMM A;  2H27 A;  3DEE A;  3TDZ C;  2DJI A;  3N0T A;  3UGP A;  1IN6 A;  1KU2 A;  1S8N A;  3FXM A;  5HDG A;  3RZD J;  1W0U A;  5E2Q A;  1WFX A;  4D5C A;  1U2W A;  4OMY A;  3PMR A;  4B8X A;  1A7V A;  1ON1 A;  4ZZD A;  2XLH A;  4LOC A;  4BXF A;  5TRD A;  5B5E C;  5D5V B;  2M30 A;  4CDG A;  1Z6A A;  3DQV C;  1NK2 P;  1G3T A;  3G73 A;  4P9U A;  1SAN A;  2XAU A;  4EIY A;  1QNT A;  4L9J A;  3M4B A;  3W6J B;  2CH0 A;  4JK1 X;  4X0G A;  3GME A;  4CCJ A;  4BAC A;  2KIQ A;  3O55 A;  4UDV A;  3MKW B;  3P9C A;  4QPO A;  2LCH A;  2E19 A;  3MLG A;  4RDA A;  5EGO B;  5K5Q A;  3AG3 H;  2ZXO A;  3CCJ I;  1R4N B;  4JKV A;  5EJC A;  4ETS A;  5TJJ A;  4P6I C;  3G3Z A;  1O87 A;  1Q0K A;  5JFR A;  2VOD A;  4EJV A;  3RPU A;  2LTP A;  3BR3 A;  1W5T A;  2EPO A;  4ZZL A;  2CSO A;  4OU0 A;  3FF5 A;  1JI8 A;  3CDL A;  2Y31 A;  4J30 B;  2FF4 A;  2OUM A;  5F04 A;  3G71 I;  2R02 A;  2W48 A;  2NAZ A;  4EM0 B;  4XRM A;  1TQP A;  1Q1H A;  3JAM Z;  5JVG F;  1ZAO A;  1YLM A;  3MAJ A;  4J7Y A;  3HDD A;  5FKN A;  1BC8 C;  2IBF A;  2KFD A;  3T5X A;  3KP7 A;  4YFN F;  4ZYE A;  5EG0 A;  3EGD A;  3EUH A;  3IRQ A;  2VKH A;  3ZQ7 A;  3SXM A;  3H2V A;  1RKT A;  1TQM A;  1EI7 A;  4BXU A;  3BZK A;  1PD0 A;  1X4P A;  1Y6I A;  3CCR I;  5DCM A;  4S04 A;  5F28 E;  1U0J A;  1FYL A;  2WVO A;  4IAO A;  2HSB A;  5FRO A;  1U5T C;  1M2V A;  3U21 A;  3CUQ A;  1D8K A;  2E1M C;  1XG1 A;  2MLK A;  4XON A;  4A3I J;  3KIO A;  1J0R A;  3FMR A;  4BUP A;  1E83 A;  2LC2 A;  5A2Q Z;  2FU4 A;  3DXJ F;  4PSX A;  3MCZ A;  4DVZ A;  2O9L A;  1YYX A;  3EQL F;  1NSG B;  1JHH A;  5EGO A;  4IGG A;  1D5V A;  3LST A;  4G6Q A;  3JSO A;  2STW A;  1Z9C A;  2KZG A;  2IOQ A;  4D4N A;  3HZJ A;  1MBF A;  2EV6 A;  1RKE B;  3VSL A;  4G9Y A;  1T39 A;  4B3A A;  3EGX B;  1OW6 A;  2VBY A;  2Y0M A;  2EIN H;  1LEB A;  3GEE A;  3QPL A;  4PZJ A;  2ZSH B;  4JJG A;  3ERM A;  1NG1 A;  1BJZ A;  4UV8 A;  3U2M A;  3QOD A;  2YLD A;  4LMY A;  2NOJ B;  5EDN A;  3NYJ A;  2CNW A;  3JYH A;  2HQN A;  3H0D A;  3CZ6 A;  3RIR A;  2RVC A;  1FYM A;  3I64 A;  4V2G A;  3CME I;  5EYR A;  1PVE A;  3GZ6 A;  2Z3Y A;  3KYC B;  1YO5 C;  3ABL C;  3GLL A;  2I5U A;  2QSH X;  1GVJ A;  4DBQ A;  3WTS C;  2HDW A;  3ZVR A;  5DS5 A;  3WG7 C;  4IKF A;  1ZHX A;  4KIF A;  2IXS A;  2MD0 A;  2HPM A;  3A01 A;  3B6C A;  2XKO A;  5DS6 A;  3H2U A;  2A0U A;  3NQO A;  3MZY A;  3LSP A;  4FCY A;  3DWW A;  3QW1 A;  2X4H A;  2K85 A;  3GWN A;  5D6F A;  5F0C A;  3RCO A;  1M2O A;  3T6J A;  1Q0M A;  3V7O A;  2YU9 J;  4LDK A;  2EZK A;  3HEF A;  2A1D D;  4LB5 A;  2J7P A;  4QSH A;  3WE3 A;  3DE8 A;  1FSH A;  2L01 A;  4XOR A;  2OV7 A;  5COM A;  2Z5U A;  4LK0 F;  1NG6 A;  2LOO A;  2NNY A;  5T3T A;  5TIS C;  2PQ8 A;  1F36 A;  3EH2 A;  2FFH A;  4U5E E;  3CC7 I;  5FD6 A;  4C3I J;  2PX9 A;  1T6S A;  4GRI A;  4KUM A;  2HMQ A;  2IYL D;  1XZQ A;  1K05 A;  3ECS A;  2A05 A;  3AG2 C;  1APC A;  2FEZ A;  4MIM A;  3HNJ A;  3S8P A;  2A5Y B;  4I3M A;  2KIS A;  4U5C E;  1VB5 A;  4RAY A;  1T5O A;  2BVM A;  4UUV A;  1LFB A;  1RMV A;  5B3I A;  3UKG A;  3IWF A;  3E5X A;  5ILU A;  5JR3 A;  3M8J A;  3R2P A;  1J5Y A;  1P2F A;  2K02 A;  2IA0 A;  1ZR4 A;  2O03 A;  1FSE A;  2LBF A;  3PUB A;  3OY9 A;  1RJ9 A;  4A3C J;  2NVU B;  1L3P A;  4EEF G;  2KT0 A;  4IHX A;  2DYS H;  1OQC A;  1YA9 A;  3O6B B;  2V9V A;  2ACJ A;  3K2Z A;  4JVS A;  1LFP A;  2IEK A;  4XN0 A;  2L9V A;  2M5W A;  4CJG A;  2V26 A;  2HWV A;  1Z0X A;  2R5Y A;  1BW6 A;  1GGQ A;  3N24 A;  3K4B A;  1ETK A;  3K70 C;  3K69 A;  1A41 A;  1YJG A;  3I56 I;  3ZG1 A;  5FLX Z;  2M45 A;  4OAZ A;  3LMM A;  4CCL A;  2WAQ N;  3LSR A;  1WGW A;  2HU9 A;  1NBB A;  1X3Z B;  1E3O C;  1MNM C;  2HVR A;  5F64 A;  1VLS A;  3JW4 A;  2LLK A;  5KYX A;  3DPT A;  2M7B A;  1JE8 A;  4HST A;  5KYY B;  3ZPL A;  2W85 A;  4L0Z B;  3AGT A;  3S17 J;  1SFE A;  2W1O A;  1VND A;  4Z6Y A;  2OTJ I;  3IKV A;  1YIT I;  1ULY A;  3ZQY A;  3BT9 A;  3LAP A;  1D3Y A;  1OYY A;  1ETV A;  1TL8 A;  3A1Y A;  4M3G A;  1FYK A;  4XLC A;  2DT5 A;  4UVA A;  4B3X A;  4N4N B;  4UNO A;  2V6E A;  2Y3G A;  1YX5 A;  3NG1 A;  1DGR M;  3VWB A;  4HG2 A;  3SDG A;  1K4T A;  4KMU X;  3TOA A;  1WAS A;  1N77 A;  1VK5 A;  1OR2 A;  2IM8 A;  3G50 A;  5DLJ A;  1MJ9 A;  2KGO A;  3QVZ A;  5DV5 A;  2QBY A;  4N06 A;  4U5G A;  4J19 A;  1YDI A;  1QVT A;  4BE1 A;  1A7D A;  1MW7 A;  1DDN A;  5L3E A;  4FE7 A;  3V4G A;  3E6M A;  4E18 A;  4Q47 A;  1BOB A;  1G3W A;  2IS1 A;  3ZMD A;  2DA2 A;  4Q48 A;  2LMD A;  4LG3 A;  4CDY A;  3ZSU A;  3ZQI A;  1Z6T A;  2HKO A;  3HG9 A;  1AA7 A;  4KIS A;  2FSW A;  1OPC A;  1ZAR A;  2GAQ A;  1WJA A;  5E3O A;  5KCM A;  3FX3 A;  1I1G A;  3BG7 A;  2F2E A;  1UFM A;  4RS8 A;  4CJO A;  4M3D A;  3GM2 A;  2EIL H;  1W1W E;  2GOM A;  2HTS A;  2XV4 S;  4ANJ A;  3RKO F;  3VRC A;  3Q5F A;  1OFC X;  1I50 J;  2XC7 A;  4CYD A;  3TW6 A;  3AFH A;  4EGZ A;  4L5I A;  4J7T A;  3HYI A;  2P6V A;  3NDB B;  3SXZ A;  3H1C A;  4AE4 B;  3HSR A;  1OQY A;  1U78 A;  2E2I J;  1VTM P;  2CQX A;  1FBQ A;  4FT8 A;  2K86 A;  2XUB A;  4M9S A;  4YG2 F;  1H6G A;  4A5N A;  1VQ5 I;  3GXO A;  2VAS A;  1I4Y A;  1KA8 A;  2XGE A;  2A69 F;  2HFI A;  2H09 A;  4A69 C;  1I5Z A;  3LLI A;  3GVA A;  1T2K A;  1H89 C;  4BJ6 C;  3ABT A;  3JRH A;  2RQQ A;  4CH7 A;  4KNY A;  4RAZ A;  3CSK A;  3JSP A;  1TBX A;  4PJJ A;  4PJ0 C;  3ZQF A;  4BKX A;  4BGD A;  3ITF A;  3FHN A;  1TWF J;  1TNS A;  3Q9S A;  4I7H A;  2VUM J;  4EMS A;  1D0Z A;  1KU9 A;  1O3T A;  1FTS A;  1FBS A;  5B1A C;  2JK3 A;  3SFZ A;  5E8I A;  2L7A A;  2GFH A;  2R7U A;  1RES A;  2HOA A;  3TJ6 A;  2GLO A;  4C3J J;  1LM3 B;  1T38 A;  2XB5 A;  5K7H A;  4HNT A;  5HS8 A;  2Y69 H;  3KMI A;  1MH3 A;  2VQC A;  3L9F A;  2PBE A;  1HSJ A;  3KET A;  256B A;  2OA4 A;  1CQT A;  5F1J A;  3SFI A;  2W4M A;  2D2W A;  3ESW B;  4C30 A;  1U6H A;  5B1B C;  3MKL A;  1QQI A;  1F1M A;  5LEK A;  2LSE A;  1IN8 A;  3TQN A;  1WRJ A;  2EPM X;  3KCC A;  3K6B A;  3NRV A;  1BBY A;  4JYK A;  1ETO A;  4CYC B;  2GM4 A;  4YL1 A;  5DQZ A;  3LOC A;  3TL4 X;  1UFB A;  1AHD P;  4RGU A;  2KIU A;  2Y0S N;  2W9Y A;  3CEX A;  5CJ9 A;  1H9T A;  3B0V C;  5F0F A;  5BMZ A;  2GDC A;  3BEH A;  2LG4 A;  2R5Z B;  1U5T A;  3H35 A;  4FX0 A;  1SMT A;  4DZJ A;  1D1B A;  1RR7 A;  4OIO F;  4U0V A;  2GWR A;  3BJA A;  3RYL A;  3C62 A;  5J1R A;  4IOC F;  1I3Q J;  1WI3 A;  2V1X A;  5AON A;  1Z6R A;  2DFE A;  4CZC A;  5HLG A;  4DRH B;  2UXX A;  4MS2 A;  5BQH A;  2MC3 A;  1WWP A;  2KK1 A;  1YLF A;  2OQG A;  1IXS B;  1OLT A;  1XGM A;  2A6H F;  2JA6 J;  2LIG A;  2PEX A;  3B0P A;  5BS6 A;  3PDM P;  2XAG A;  1S5L C;  2E7W A;  2K4B A;  3ZTM A;  3K10 A;  4AIJ A;  3L8I A;  1T33 A;  1I3A A;  4XKV A;  4R1H A;  2EA2 A;  3RPQ A;  2VCB A;  2HZT A;  2X1E A;  1Z21 A;  2O8X A;  3I3L A;  3BR6 A;  1U8R A;  3ASN C;  3E70 C;  4LG0 B;  3L34 A;  2BBY A;  3S14 J;  2A68 F;  3GFJ A;  4HF2 A;  4YL0 A;  3H0G J;  4BQO A;  4OOI A;  3QYB A;  2XSD C;  4CGZ A;  4XN3 A;  2E1C A;  2TMV P;  1VYK A;  2GA1 A;  3RVZ A;  2ZME B;  1MIJ A;  4PSW A;  4KNV A;  1KON A;  3RH3 A;  2K7L A;  1FLI A;  5H6Q A;  2FA5 A;  4KIC A;  2PI0 A;  3NKD A;  3LNR A;  1BJA A;  3NWT A;  2YX7 A;  4A3F J;  4WK8 F;  1RIO H;  1MDM A;  3EYI A;  3HBL A;  1VZ0 A;  2A6E F;  2BL2 A;  1BI2 A;  1W7P A;  1YRN A;  1FNT c;  3E5Q A;  3C1D A;  1JR8 A;  1ST6 A;  2YLG A;  4KN7 X;  1XMK A;  3JRD A;  1LDJ A;  2GBY A;  2K9N A;  2J9W A;  4BYY A;  1TZL A;  3N4M A;  2R92 J;  2IA2 A;  2KRH A;  2G3V A;  2WY8 Q;  4LIV A;  3A02 A;  1R1U A;  1ZG3 A;  3TOB A;  5AIQ A;  3K1H A;  4MLO A;  3C2G A;  1JUS A;  4U0Y A;  1Z7L A;  2QF7 A;  3LA3 A;  1G3S A;  2GA2 A;  3WG7 H;  2XL8 A;  4ON0 A;  2XPU A;  4DBR A;  3RYP A;  4M3B A;  3I4N J;  2CS3 A;  2TDX A;  4KJZ A;  1M57 C;  2E60 A;  2WB1 A;  3B0U X;  4XPY A;  4N9H A;  3I0T A;  2AP3 A;  5L0H A;  5D6E A;  4GGG A;  1T98 A;  4MVR A;  5A2Q K;  1Y39 A;  3F47 A;  1P4A A;  3KP5 A;  3O8H A;  4FET A;  4JRZ A;  4G7H F;  3HUG A;  3U1K A;  5DDG A;  2WV0 A;  3S2W A;  3HRU A;  4JZA A;  2BE5 F;  3F72 A;  2RDP A;  1R1T A;  2AWC A;  1Z91 A;  1AU7 A;  2DMU A;  3OYL A;  2QY9 A;  3PIP F;  3L2U A;  3OEO A;  4EJW A;  2LK2 A;  1LEA A;  3BRJ A;  3KLO A;  2LSO A;  1D0Y A;  3S32 A;  3VDX A;  1SZI A;  1MDM B;  2BY0 A;  3J7Y J;  2IS6 A;  2V4J C;  2DTZ A;  3HRT A;  1I4Z A;  1IUY A;  3K70 D;  5ERI A;  2Q00 A;  2YEV A;  1ONV A;  3U0C A;  1HMD A;  1ZU4 A;  1YW7 A;  3RPU D;  1UG7 A;  4XSX F;  2GAU A;  2PJR A;  4LLN A;  2E2J J;  1S6L A;  2W84 A;  4BDZ A;  3I4U A;  2JSC A;  3FXL A;  2MHR A;  4A2N B;  4MTF A;  4R32 A;  3LFK A;  4CCK A;  3HOT A;  2R3S A;  2QCO A;  2CV2 A;  4GFB A;  4ENM A;  3B73 A;  4AUX A;  2HUJ A;  2EFW A;  2JTV A;  3QU6 A;  3WGG A;  3ATP A;  2J5P A;  2J5O A;  1R4T A;  3JSZ A;  3DJU B;  2HR3 A;  2J0X A;  3AL0 B;  1X1D A;  4NBQ A;  4XPW A;  1DPR A;  4HE8 D;  3VB2 A;  1GLN A;  2R4G A;  1IC8 A;  4CO8 A;  4YWQ A;  2LBF B;  1ACI A;  4EGY A;  5ICG A;  3K4N A;  2HMZ A;  2DMN A;  1F1Z A;  2F6C A;  2IXP A;  1ORS C;  4S0H B;  4A0X A;  2HZ8 A;  2LD6 A;  4U5F E;  3JZ0 A;  1IZM A;  1LUJ B;  2HOS A;  4BE2 A;  4CIH A;  1FJL A;  5F5H A;  2FQ4 A; 
#chains in the Genus database with same CATH homology
 2ICW G;  1R5I D;  2OJE D;  3KPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...